data_5W4A
# 
_entry.id   5W4A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5W4A         
WWPDB D_1000226296 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        'Entry contains methionine mutations; selenomethionine sample used for SAD phasing' 
_pdbx_database_related.db_id          5W4D 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5W4A 
_pdbx_database_status.recvd_initial_deposition_date   2017-06-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Aoki, S.T.'    1 ? 
'Bingman, C.A.' 2 ? 
'Kimble, J.'    3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Structure of the C. japonica P-granule scaffold protein N-domain' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Aoki, S.T.'    1 ? 
primary 'Bingman, C.A.' 2 ? 
primary 'Kimble, J.'    3 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.76 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5W4A 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     132.770 
_cell.length_a_esd                 ? 
_cell.length_b                     94.670 
_cell.length_b_esd                 ? 
_cell.length_c                     72.950 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5W4A 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'P-granule scaffold'    24372.131 4   ? ? 'N-domain (UNP residues 1-216)' ? 
2 non-polymer syn 1,2-ETHANEDIOL          62.068    11  ? ? ?                               ? 
3 non-polymer syn 'TRIETHYLENE GLYCOL'    150.173   4   ? ? ?                               ? 
4 non-polymer syn IMIDAZOLE               69.085    5   ? ? ?                               ? 
5 non-polymer syn 'TETRAETHYLENE GLYCOL'  194.226   1   ? ? ?                               ? 
6 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120   2   ? ? ?                               ? 
7 water       nat water                   18.015    836 ? ? ?                               ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)DTNKREIVEFLGIRTYFFPNLALYAVNNDELLVSDPNKANSFAAYVFGASDKKPSVDDIVQILFPSGSDSGTILT
S(MSE)DTLLALGPDFLTEFKKRNQDLARFNLTHDLSILAQGDEDAAKKKLNL(MSE)GRKAKLQKTEAAKILAILIKTI
NSEENYEKFTELSELCGLDLDFDAYVFTKILGLEDEDTADEVEVIRDNFLNRLDQTKPKLADIIRNGP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDTNKREIVEFLGIRTYFFPNLALYAVNNDELLVSDPNKANSFAAYVFGASDKKPSVDDIVQILFPSGSDSGTILTSMDT
LLALGPDFLTEFKKRNQDLARFNLTHDLSILAQGDEDAAKKKLNLMGRKAKLQKTEAAKILAILIKTINSEENYEKFTEL
SELCGLDLDFDAYVFTKILGLEDEDTADEVEVIRDNFLNRLDQTKPKLADIIRNGP
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   ASP n 
1 3   THR n 
1 4   ASN n 
1 5   LYS n 
1 6   ARG n 
1 7   GLU n 
1 8   ILE n 
1 9   VAL n 
1 10  GLU n 
1 11  PHE n 
1 12  LEU n 
1 13  GLY n 
1 14  ILE n 
1 15  ARG n 
1 16  THR n 
1 17  TYR n 
1 18  PHE n 
1 19  PHE n 
1 20  PRO n 
1 21  ASN n 
1 22  LEU n 
1 23  ALA n 
1 24  LEU n 
1 25  TYR n 
1 26  ALA n 
1 27  VAL n 
1 28  ASN n 
1 29  ASN n 
1 30  ASP n 
1 31  GLU n 
1 32  LEU n 
1 33  LEU n 
1 34  VAL n 
1 35  SER n 
1 36  ASP n 
1 37  PRO n 
1 38  ASN n 
1 39  LYS n 
1 40  ALA n 
1 41  ASN n 
1 42  SER n 
1 43  PHE n 
1 44  ALA n 
1 45  ALA n 
1 46  TYR n 
1 47  VAL n 
1 48  PHE n 
1 49  GLY n 
1 50  ALA n 
1 51  SER n 
1 52  ASP n 
1 53  LYS n 
1 54  LYS n 
1 55  PRO n 
1 56  SER n 
1 57  VAL n 
1 58  ASP n 
1 59  ASP n 
1 60  ILE n 
1 61  VAL n 
1 62  GLN n 
1 63  ILE n 
1 64  LEU n 
1 65  PHE n 
1 66  PRO n 
1 67  SER n 
1 68  GLY n 
1 69  SER n 
1 70  ASP n 
1 71  SER n 
1 72  GLY n 
1 73  THR n 
1 74  ILE n 
1 75  LEU n 
1 76  THR n 
1 77  SER n 
1 78  MSE n 
1 79  ASP n 
1 80  THR n 
1 81  LEU n 
1 82  LEU n 
1 83  ALA n 
1 84  LEU n 
1 85  GLY n 
1 86  PRO n 
1 87  ASP n 
1 88  PHE n 
1 89  LEU n 
1 90  THR n 
1 91  GLU n 
1 92  PHE n 
1 93  LYS n 
1 94  LYS n 
1 95  ARG n 
1 96  ASN n 
1 97  GLN n 
1 98  ASP n 
1 99  LEU n 
1 100 ALA n 
1 101 ARG n 
1 102 PHE n 
1 103 ASN n 
1 104 LEU n 
1 105 THR n 
1 106 HIS n 
1 107 ASP n 
1 108 LEU n 
1 109 SER n 
1 110 ILE n 
1 111 LEU n 
1 112 ALA n 
1 113 GLN n 
1 114 GLY n 
1 115 ASP n 
1 116 GLU n 
1 117 ASP n 
1 118 ALA n 
1 119 ALA n 
1 120 LYS n 
1 121 LYS n 
1 122 LYS n 
1 123 LEU n 
1 124 ASN n 
1 125 LEU n 
1 126 MSE n 
1 127 GLY n 
1 128 ARG n 
1 129 LYS n 
1 130 ALA n 
1 131 LYS n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 THR n 
1 136 GLU n 
1 137 ALA n 
1 138 ALA n 
1 139 LYS n 
1 140 ILE n 
1 141 LEU n 
1 142 ALA n 
1 143 ILE n 
1 144 LEU n 
1 145 ILE n 
1 146 LYS n 
1 147 THR n 
1 148 ILE n 
1 149 ASN n 
1 150 SER n 
1 151 GLU n 
1 152 GLU n 
1 153 ASN n 
1 154 TYR n 
1 155 GLU n 
1 156 LYS n 
1 157 PHE n 
1 158 THR n 
1 159 GLU n 
1 160 LEU n 
1 161 SER n 
1 162 GLU n 
1 163 LEU n 
1 164 CYS n 
1 165 GLY n 
1 166 LEU n 
1 167 ASP n 
1 168 LEU n 
1 169 ASP n 
1 170 PHE n 
1 171 ASP n 
1 172 ALA n 
1 173 TYR n 
1 174 VAL n 
1 175 PHE n 
1 176 THR n 
1 177 LYS n 
1 178 ILE n 
1 179 LEU n 
1 180 GLY n 
1 181 LEU n 
1 182 GLU n 
1 183 ASP n 
1 184 GLU n 
1 185 ASP n 
1 186 THR n 
1 187 ALA n 
1 188 ASP n 
1 189 GLU n 
1 190 VAL n 
1 191 GLU n 
1 192 VAL n 
1 193 ILE n 
1 194 ARG n 
1 195 ASP n 
1 196 ASN n 
1 197 PHE n 
1 198 LEU n 
1 199 ASN n 
1 200 ARG n 
1 201 LEU n 
1 202 ASP n 
1 203 GLN n 
1 204 THR n 
1 205 LYS n 
1 206 PRO n 
1 207 LYS n 
1 208 LEU n 
1 209 ALA n 
1 210 ASP n 
1 211 ILE n 
1 212 ILE n 
1 213 ARG n 
1 214 ASN n 
1 215 GLY n 
1 216 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   216 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   'codon optimized version synthesized for bacterial expression' 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Caenorhabditis japonica' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     281687 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              Rosetta2 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   'IPTG inducible' 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET21a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    H2W791_CAEJA 
_struct_ref.pdbx_db_accession          H2W791 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDTNKREIVEFLGIRTYFFPNLALYAVNNDELLVSDPNKANSFAAYVFGASDKKPSVDDIVQILFPSGSDSGTILTSMDT
LLALGPDFLTEFKKRNQDLARFNLTHDLSILAQGDEDAAKKKLNLMGRKAKLQKTEAAKILAILIKTINSEENYEKFTEL
SELCGLDLDFDAYVFTKILGLEDEDTADEVEVIRDNFLNRLDQTKPKLADIIRNGP
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5W4A A 1 ? 216 ? H2W791 1 ? 216 ? 1 216 
2 1 5W4A B 1 ? 216 ? H2W791 1 ? 216 ? 1 216 
3 1 5W4A C 1 ? 216 ? H2W791 1 ? 216 ? 1 216 
4 1 5W4A D 1 ? 216 ? H2W791 1 ? 216 ? 1 216 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                 ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL          'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE               ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE               ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ?                 'C6 H13 N O2'    131.173 
IMD non-polymer         . IMIDAZOLE               ?                 'C3 H5 N2 1'     69.085  
LEU 'L-peptide linking' y LEUCINE                 ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ?                 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE        ?                 'C5 H11 N O2 Se' 196.106 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER' ?                 'C4 H10 O3'      106.120 
PG4 non-polymer         . 'TETRAETHYLENE GLYCOL'  ?                 'C8 H18 O5'      194.226 
PGE non-polymer         . 'TRIETHYLENE GLYCOL'    ?                 'C6 H14 O4'      150.173 
PHE 'L-peptide linking' y PHENYLALANINE           ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                 ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ?                 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ?                 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5W4A 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.35 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         47.69 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM Imidazole pH 7.5, 40-45% PEG 400, 1 mM TCEP pH 7.4' 
_exptl_crystal_grow.pdbx_pH_range   7.5-8.0 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      'MD2 Micro Diffractometer' 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 9M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-11-10 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.984 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-D' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.984 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-D 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5W4A 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.5 
_reflns.d_resolution_low                 30.361 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       283749 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.77 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  15.1 
_reflns.pdbx_Rmerge_I_obs                0.08108 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            16.91 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.01984 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.997 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.5 
_reflns_shell.d_res_low                   1.554 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.85 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           14301 
_reflns_shell.percent_possible_all        99.33 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.282 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             13.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.357 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.662 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5W4A 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.500 
_refine.ls_d_res_low                             30.361 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     283749 
_refine.ls_number_reflns_R_free                  2915 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.72 
_refine.ls_percent_reflns_R_free                 1.03 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1622 
_refine.ls_R_factor_R_free                       0.1970 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1618 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5W4D 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            1468 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.16 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.20 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6738 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         136 
_refine_hist.number_atoms_solvent             836 
_refine_hist.number_atoms_total               7710 
_refine_hist.d_res_high                       1.500 
_refine_hist.d_res_low                        30.361 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  ? 7040 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.989  ? 9463 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 10.323 ? 4336 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.050  ? 1088 ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 1229 ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.5000 1.5246  . . 152 13172 98.00  . . . 0.3724 . 0.3209 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5246 1.5509  . . 136 13463 100.00 . . . 0.2886 . 0.2874 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5509 1.5791  . . 135 13337 100.00 . . . 0.2896 . 0.2718 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5791 1.6095  . . 129 13299 100.00 . . . 0.2707 . 0.2523 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6095 1.6423  . . 142 13467 100.00 . . . 0.2990 . 0.2330 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6423 1.6780  . . 130 13469 100.00 . . . 0.2044 . 0.2238 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6780 1.7171  . . 150 13321 100.00 . . . 0.2750 . 0.2076 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7171 1.7600  . . 140 13432 100.00 . . . 0.2236 . 0.1998 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7600 1.8076  . . 144 13423 100.00 . . . 0.2461 . 0.1908 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8076 1.8608  . . 132 13247 99.00  . . . 0.2253 . 0.1704 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8608 1.9208  . . 139 13237 99.00  . . . 0.2046 . 0.1652 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9208 1.9894  . . 139 13452 100.00 . . . 0.1846 . 0.1572 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9894 2.0691  . . 143 13349 100.00 . . . 0.1586 . 0.1526 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0691 2.1632  . . 138 13403 100.00 . . . 0.2037 . 0.1437 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1632 2.2772  . . 136 13460 100.00 . . . 0.1638 . 0.1338 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2772 2.4199  . . 146 13356 100.00 . . . 0.1666 . 0.1371 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4199 2.6066  . . 142 13451 100.00 . . . 0.1942 . 0.1412 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6066 2.8687  . . 126 13363 100.00 . . . 0.2595 . 0.1521 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8687 3.2834  . . 136 13436 100.00 . . . 0.1953 . 0.1568 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2834 4.1351  . . 142 13399 100.00 . . . 0.1891 . 0.1467 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1351 30.3671 . . 138 13298 99.00  . . . 0.1586 . 0.1624 . . . . . . . . . . 
# 
_struct.entry_id                     5W4A 
_struct.title                        'C. japonica N-domain' 
_struct.pdbx_descriptor              'P-granule scaffold' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5W4A 
_struct_keywords.text            'P-granule scaffold protein, RNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 2 ? 
L  N N 4 ? 
M  N N 4 ? 
N  N N 4 ? 
O  N N 5 ? 
P  N N 3 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 2 ? 
U  N N 4 ? 
V  N N 3 ? 
W  N N 6 ? 
X  N N 2 ? 
Y  N N 2 ? 
Z  N N 4 ? 
AA N N 6 ? 
BA N N 7 ? 
CA N N 7 ? 
DA N N 7 ? 
EA N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PHE A 19  ? ASN A 29  ? PHE A 19  ASN A 29  1 ? 11 
HELX_P HELX_P2  AA2 ASN A 29  ? ASP A 36  ? ASN A 29  ASP A 36  1 ? 8  
HELX_P HELX_P3  AA3 PRO A 37  ? ALA A 40  ? PRO A 37  ALA A 40  5 ? 4  
HELX_P HELX_P4  AA4 ASN A 41  ? PHE A 48  ? ASN A 41  PHE A 48  1 ? 8  
HELX_P HELX_P5  AA5 SER A 56  ? PHE A 65  ? SER A 56  PHE A 65  1 ? 10 
HELX_P HELX_P6  AA6 ASP A 70  ? GLY A 85  ? ASP A 70  GLY A 85  1 ? 16 
HELX_P HELX_P7  AA7 PHE A 88  ? ARG A 101 ? PHE A 88  ARG A 101 1 ? 14 
HELX_P HELX_P8  AA8 LEU A 108 ? GLN A 113 ? LEU A 108 GLN A 113 5 ? 6  
HELX_P HELX_P9  AA9 ASP A 115 ? LEU A 132 ? ASP A 115 LEU A 132 1 ? 18 
HELX_P HELX_P10 AB1 THR A 135 ? ASN A 149 ? THR A 135 ASN A 149 1 ? 15 
HELX_P HELX_P11 AB2 GLU A 152 ? GLU A 162 ? GLU A 152 GLU A 162 1 ? 11 
HELX_P HELX_P12 AB3 LEU A 163 ? ASP A 167 ? LEU A 163 ASP A 167 5 ? 5  
HELX_P HELX_P13 AB4 LEU A 168 ? GLY A 180 ? LEU A 168 GLY A 180 1 ? 13 
HELX_P HELX_P14 AB5 THR A 186 ? ASP A 202 ? THR A 186 ASP A 202 1 ? 17 
HELX_P HELX_P15 AB6 LYS A 205 ? GLY A 215 ? LYS A 205 GLY A 215 1 ? 11 
HELX_P HELX_P16 AB7 PHE B 19  ? ASN B 29  ? PHE B 19  ASN B 29  1 ? 11 
HELX_P HELX_P17 AB8 ASN B 29  ? ASP B 36  ? ASN B 29  ASP B 36  1 ? 8  
HELX_P HELX_P18 AB9 PRO B 37  ? ALA B 40  ? PRO B 37  ALA B 40  5 ? 4  
HELX_P HELX_P19 AC1 ASN B 41  ? PHE B 48  ? ASN B 41  PHE B 48  1 ? 8  
HELX_P HELX_P20 AC2 SER B 56  ? PHE B 65  ? SER B 56  PHE B 65  1 ? 10 
HELX_P HELX_P21 AC3 ASP B 70  ? GLY B 85  ? ASP B 70  GLY B 85  1 ? 16 
HELX_P HELX_P22 AC4 PHE B 88  ? ARG B 101 ? PHE B 88  ARG B 101 1 ? 14 
HELX_P HELX_P23 AC5 SER B 109 ? GLY B 114 ? SER B 109 GLY B 114 1 ? 6  
HELX_P HELX_P24 AC6 ASP B 115 ? LEU B 132 ? ASP B 115 LEU B 132 1 ? 18 
HELX_P HELX_P25 AC7 THR B 135 ? ASN B 149 ? THR B 135 ASN B 149 1 ? 15 
HELX_P HELX_P26 AC8 GLU B 152 ? SER B 161 ? GLU B 152 SER B 161 1 ? 10 
HELX_P HELX_P27 AC9 GLU B 162 ? ASP B 167 ? GLU B 162 ASP B 167 5 ? 6  
HELX_P HELX_P28 AD1 LEU B 168 ? GLY B 180 ? LEU B 168 GLY B 180 1 ? 13 
HELX_P HELX_P29 AD2 THR B 186 ? ASP B 202 ? THR B 186 ASP B 202 1 ? 17 
HELX_P HELX_P30 AD3 LYS B 205 ? ASN B 214 ? LYS B 205 ASN B 214 1 ? 10 
HELX_P HELX_P31 AD4 PHE C 19  ? ASN C 29  ? PHE C 19  ASN C 29  1 ? 11 
HELX_P HELX_P32 AD5 ASN C 29  ? ASP C 36  ? ASN C 29  ASP C 36  1 ? 8  
HELX_P HELX_P33 AD6 PRO C 37  ? ALA C 40  ? PRO C 37  ALA C 40  5 ? 4  
HELX_P HELX_P34 AD7 ASN C 41  ? PHE C 48  ? ASN C 41  PHE C 48  1 ? 8  
HELX_P HELX_P35 AD8 SER C 56  ? PHE C 65  ? SER C 56  PHE C 65  1 ? 10 
HELX_P HELX_P36 AD9 ASP C 70  ? GLY C 85  ? ASP C 70  GLY C 85  1 ? 16 
HELX_P HELX_P37 AE1 PHE C 88  ? ARG C 101 ? PHE C 88  ARG C 101 1 ? 14 
HELX_P HELX_P38 AE2 GLU C 116 ? LEU C 132 ? GLU C 116 LEU C 132 1 ? 17 
HELX_P HELX_P39 AE3 THR C 135 ? ASN C 149 ? THR C 135 ASN C 149 1 ? 15 
HELX_P HELX_P40 AE4 GLU C 152 ? SER C 161 ? GLU C 152 SER C 161 1 ? 10 
HELX_P HELX_P41 AE5 GLU C 162 ? ASP C 167 ? GLU C 162 ASP C 167 5 ? 6  
HELX_P HELX_P42 AE6 LEU C 168 ? GLY C 180 ? LEU C 168 GLY C 180 1 ? 13 
HELX_P HELX_P43 AE7 THR C 186 ? ASP C 202 ? THR C 186 ASP C 202 1 ? 17 
HELX_P HELX_P44 AE8 LYS C 205 ? ASN C 214 ? LYS C 205 ASN C 214 1 ? 10 
HELX_P HELX_P45 AE9 PHE D 19  ? ASN D 29  ? PHE D 19  ASN D 29  1 ? 11 
HELX_P HELX_P46 AF1 ASN D 29  ? ASP D 36  ? ASN D 29  ASP D 36  1 ? 8  
HELX_P HELX_P47 AF2 PRO D 37  ? ALA D 40  ? PRO D 37  ALA D 40  5 ? 4  
HELX_P HELX_P48 AF3 ASN D 41  ? PHE D 48  ? ASN D 41  PHE D 48  1 ? 8  
HELX_P HELX_P49 AF4 SER D 56  ? PHE D 65  ? SER D 56  PHE D 65  1 ? 10 
HELX_P HELX_P50 AF5 ASP D 70  ? GLY D 85  ? ASP D 70  GLY D 85  1 ? 16 
HELX_P HELX_P51 AF6 PHE D 88  ? ARG D 101 ? PHE D 88  ARG D 101 1 ? 14 
HELX_P HELX_P52 AF7 LEU D 108 ? GLN D 113 ? LEU D 108 GLN D 113 5 ? 6  
HELX_P HELX_P53 AF8 ASP D 115 ? LEU D 132 ? ASP D 115 LEU D 132 1 ? 18 
HELX_P HELX_P54 AF9 THR D 135 ? ASN D 149 ? THR D 135 ASN D 149 1 ? 15 
HELX_P HELX_P55 AG1 GLU D 152 ? GLU D 162 ? GLU D 152 GLU D 162 1 ? 11 
HELX_P HELX_P56 AG2 LEU D 163 ? ASP D 167 ? LEU D 163 ASP D 167 5 ? 5  
HELX_P HELX_P57 AG3 LEU D 168 ? GLY D 180 ? LEU D 168 GLY D 180 1 ? 13 
HELX_P HELX_P58 AG4 THR D 186 ? ASP D 202 ? THR D 186 ASP D 202 1 ? 17 
HELX_P HELX_P59 AG5 LYS D 205 ? GLY D 215 ? LYS D 205 GLY D 215 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? A SER 77  C ? ? ? 1_555 A MSE 78  N ? ? A SER 77  A MSE 78  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2  covale both ? A MSE 78  C ? ? ? 1_555 A ASP 79  N ? ? A MSE 78  A ASP 79  1_555 ? ? ? ? ? ? ? 1.340 ? 
covale3  covale both ? A LEU 125 C ? ? ? 1_555 A MSE 126 N ? ? A LEU 125 A MSE 126 1_555 ? ? ? ? ? ? ? 1.341 ? 
covale4  covale both ? A MSE 126 C ? ? ? 1_555 A GLY 127 N ? ? A MSE 126 A GLY 127 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale5  covale both ? B MSE 1   C ? ? ? 1_555 B ASP 2   N ? ? B MSE 1   B ASP 2   1_555 ? ? ? ? ? ? ? 1.334 ? 
covale6  covale both ? B SER 77  C ? ? ? 1_555 B MSE 78  N ? ? B SER 77  B MSE 78  1_555 ? ? ? ? ? ? ? 1.338 ? 
covale7  covale both ? B MSE 78  C ? ? ? 1_555 B ASP 79  N ? ? B MSE 78  B ASP 79  1_555 ? ? ? ? ? ? ? 1.344 ? 
covale8  covale both ? B LEU 125 C ? ? ? 1_555 B MSE 126 N ? ? B LEU 125 B MSE 126 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale9  covale both ? B MSE 126 C ? ? ? 1_555 B GLY 127 N ? ? B MSE 126 B GLY 127 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale10 covale both ? C MSE 1   C ? ? ? 1_555 C ASP 2   N ? ? C MSE 1   C ASP 2   1_555 ? ? ? ? ? ? ? 1.334 ? 
covale11 covale both ? C SER 77  C ? ? ? 1_555 C MSE 78  N ? ? C SER 77  C MSE 78  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale12 covale both ? C MSE 78  C ? ? ? 1_555 C ASP 79  N ? ? C MSE 78  C ASP 79  1_555 ? ? ? ? ? ? ? 1.341 ? 
covale13 covale both ? C LEU 125 C ? ? ? 1_555 C MSE 126 N ? ? C LEU 125 C MSE 126 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale14 covale both ? C MSE 126 C ? ? ? 1_555 C GLY 127 N ? ? C MSE 126 C GLY 127 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale15 covale both ? D SER 77  C ? ? ? 1_555 D MSE 78  N ? ? D SER 77  D MSE 78  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale16 covale both ? D MSE 78  C ? ? ? 1_555 D ASP 79  N ? ? D MSE 78  D ASP 79  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale17 covale both ? D LEU 125 C ? ? ? 1_555 D MSE 126 N ? ? D LEU 125 D MSE 126 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale18 covale both ? D MSE 126 C ? ? ? 1_555 D GLY 127 N ? ? D MSE 126 D GLY 127 1_555 ? ? ? ? ? ? ? 1.332 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 9  ? PHE A 11 ? VAL A 9  PHE A 11 
AA1 2 ILE A 14 ? THR A 16 ? ILE A 14 THR A 16 
AA2 1 VAL B 9  ? PHE B 11 ? VAL B 9  PHE B 11 
AA2 2 ILE B 14 ? THR B 16 ? ILE B 14 THR B 16 
AA3 1 VAL C 9  ? PHE C 11 ? VAL C 9  PHE C 11 
AA3 2 ILE C 14 ? THR C 16 ? ILE C 14 THR C 16 
AA4 1 VAL D 9  ? PHE D 11 ? VAL D 9  PHE D 11 
AA4 2 ILE D 14 ? THR D 16 ? ILE D 14 THR D 16 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 9 ? N VAL A 9 O THR A 16 ? O THR A 16 
AA2 1 2 N VAL B 9 ? N VAL B 9 O THR B 16 ? O THR B 16 
AA3 1 2 N VAL C 9 ? N VAL C 9 O THR C 16 ? O THR C 16 
AA4 1 2 N VAL D 9 ? N VAL D 9 O THR D 16 ? O THR D 16 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A EDO 301 ? 2 'binding site for residue EDO A 301' 
AC2 Software A EDO 302 ? 3 'binding site for residue EDO A 302' 
AC3 Software A EDO 303 ? 1 'binding site for residue EDO A 303' 
AC4 Software A EDO 304 ? 7 'binding site for residue EDO A 304' 
AC5 Software A PGE 305 ? 5 'binding site for residue PGE A 305' 
AC6 Software A PGE 306 ? 3 'binding site for residue PGE A 306' 
AC7 Software B EDO 301 ? 2 'binding site for residue EDO B 301' 
AC8 Software B IMD 302 ? 8 'binding site for residue IMD B 302' 
AC9 Software B IMD 303 ? 2 'binding site for residue IMD B 303' 
AD1 Software B IMD 304 ? 4 'binding site for residue IMD B 304' 
AD2 Software B PG4 305 ? 7 'binding site for residue PG4 B 305' 
AD3 Software B PGE 306 ? 4 'binding site for residue PGE B 306' 
AD4 Software C EDO 301 ? 1 'binding site for residue EDO C 301' 
AD5 Software C EDO 302 ? 1 'binding site for residue EDO C 302' 
AD6 Software C EDO 303 ? 1 'binding site for residue EDO C 303' 
AD7 Software C EDO 304 ? 4 'binding site for residue EDO C 304' 
AD8 Software C IMD 305 ? 9 'binding site for residue IMD C 305' 
AD9 Software C PGE 306 ? 8 'binding site for residue PGE C 306' 
AE1 Software C PEG 307 ? 2 'binding site for residue PEG C 307' 
AE2 Software D EDO 301 ? 2 'binding site for residue EDO D 301' 
AE3 Software D IMD 303 ? 7 'binding site for residue IMD D 303' 
AE4 Software D PEG 304 ? 4 'binding site for residue PEG D 304' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 GLU A  136 ? GLU A 136 . ? 1_555 ? 
2  AC1 2 HOH BA .   ? HOH A 547 . ? 1_555 ? 
3  AC2 3 ASP A  107 ? ASP A 107 . ? 1_555 ? 
4  AC2 3 MSE A  126 ? MSE A 126 . ? 1_555 ? 
5  AC2 3 ARG B  101 ? ARG B 101 . ? 4_445 ? 
6  AC3 1 LYS A  134 ? LYS A 134 . ? 1_555 ? 
7  AC4 7 ASN A  4   ? ASN A 4   . ? 1_555 ? 
8  AC4 7 ARG A  6   ? ARG A 6   . ? 1_555 ? 
9  AC4 7 TYR A  17  ? TYR A 17  . ? 1_555 ? 
10 AC4 7 LEU A  75  ? LEU A 75  . ? 1_555 ? 
11 AC4 7 THR A  76  ? THR A 76  . ? 1_555 ? 
12 AC4 7 ASP A  79  ? ASP A 79  . ? 1_555 ? 
13 AC4 7 HOH CA .   ? HOH B 497 . ? 4_445 ? 
14 AC5 5 SER A  69  ? SER A 69  . ? 1_555 ? 
15 AC5 5 SER A  71  ? SER A 71  . ? 1_555 ? 
16 AC5 5 PHE A  102 ? PHE A 102 . ? 1_555 ? 
17 AC5 5 HOH BA .   ? HOH A 417 . ? 1_555 ? 
18 AC5 5 HOH BA .   ? HOH A 539 . ? 1_555 ? 
19 AC6 3 ASP A  117 ? ASP A 117 . ? 1_555 ? 
20 AC6 3 LYS A  121 ? LYS A 121 . ? 1_555 ? 
21 AC6 3 ASN A  124 ? ASN A 124 . ? 1_555 ? 
22 AC7 2 ILE B  74  ? ILE B 74  . ? 1_555 ? 
23 AC7 2 HOH CA .   ? HOH B 555 . ? 1_555 ? 
24 AC8 8 ASN A  103 ? ASN A 103 . ? 4_455 ? 
25 AC8 8 ASN B  4   ? ASN B 4   . ? 1_555 ? 
26 AC8 8 ARG B  6   ? ARG B 6   . ? 1_555 ? 
27 AC8 8 TYR B  17  ? TYR B 17  . ? 1_555 ? 
28 AC8 8 LEU B  75  ? LEU B 75  . ? 1_555 ? 
29 AC8 8 THR B  76  ? THR B 76  . ? 1_555 ? 
30 AC8 8 ASP B  79  ? ASP B 79  . ? 1_555 ? 
31 AC8 8 ASP B  107 ? ASP B 107 . ? 1_555 ? 
32 AC9 2 TYR B  154 ? TYR B 154 . ? 1_555 ? 
33 AC9 2 ASP B  185 ? ASP B 185 . ? 1_555 ? 
34 AD1 4 GLU B  151 ? GLU B 151 . ? 1_555 ? 
35 AD1 4 GLU B  152 ? GLU B 152 . ? 2_555 ? 
36 AD1 4 GLU B  152 ? GLU B 152 . ? 1_555 ? 
37 AD1 4 HOH CA .   ? HOH B 545 . ? 1_555 ? 
38 AD2 7 MSE B  1   ? MSE B 1   . ? 1_555 ? 
39 AD2 7 PRO B  66  ? PRO B 66  . ? 1_555 ? 
40 AD2 7 SER B  67  ? SER B 67  . ? 1_555 ? 
41 AD2 7 GLY B  72  ? GLY B 72  . ? 1_555 ? 
42 AD2 7 THR B  73  ? THR B 73  . ? 1_555 ? 
43 AD2 7 THR B  76  ? THR B 76  . ? 1_555 ? 
44 AD2 7 HOH CA .   ? HOH B 510 . ? 1_555 ? 
45 AD3 4 LYS B  54  ? LYS B 54  . ? 1_555 ? 
46 AD3 4 PRO B  55  ? PRO B 55  . ? 1_555 ? 
47 AD3 4 LYS B  177 ? LYS B 177 . ? 1_555 ? 
48 AD3 4 ILE B  178 ? ILE B 178 . ? 1_555 ? 
49 AD4 1 ILE C  178 ? ILE C 178 . ? 1_555 ? 
50 AD5 1 ASP C  185 ? ASP C 185 . ? 1_555 ? 
51 AD6 1 HOH DA .   ? HOH C 556 . ? 1_555 ? 
52 AD7 4 TYR C  46  ? TYR C 46  . ? 1_555 ? 
53 AD7 4 LYS C  54  ? LYS C 54  . ? 1_555 ? 
54 AD7 4 LYS C  177 ? LYS C 177 . ? 1_555 ? 
55 AD7 4 ILE C  178 ? ILE C 178 . ? 1_555 ? 
56 AD8 9 ASN C  4   ? ASN C 4   . ? 1_555 ? 
57 AD8 9 ARG C  6   ? ARG C 6   . ? 1_555 ? 
58 AD8 9 TYR C  17  ? TYR C 17  . ? 1_555 ? 
59 AD8 9 LEU C  75  ? LEU C 75  . ? 1_555 ? 
60 AD8 9 THR C  76  ? THR C 76  . ? 1_555 ? 
61 AD8 9 ASP C  79  ? ASP C 79  . ? 1_555 ? 
62 AD8 9 ASP C  107 ? ASP C 107 . ? 1_555 ? 
63 AD8 9 HOH DA .   ? HOH C 549 . ? 1_555 ? 
64 AD8 9 ASN D  103 ? ASN D 103 . ? 4_456 ? 
65 AD9 8 LYS C  134 ? LYS C 134 . ? 1_555 ? 
66 AD9 8 GLU C  136 ? GLU C 136 . ? 1_555 ? 
67 AD9 8 LYS C  139 ? LYS C 139 . ? 1_555 ? 
68 AD9 8 HOH DA .   ? HOH C 420 . ? 1_555 ? 
69 AD9 8 HOH DA .   ? HOH C 422 . ? 1_555 ? 
70 AD9 8 HOH DA .   ? HOH C 428 . ? 1_555 ? 
71 AD9 8 HOH DA .   ? HOH C 458 . ? 1_555 ? 
72 AD9 8 HOH DA .   ? HOH C 548 . ? 1_555 ? 
73 AE1 2 PRO C  66  ? PRO C 66  . ? 1_555 ? 
74 AE1 2 HOH DA .   ? HOH C 511 . ? 1_555 ? 
75 AE2 2 PHE C  102 ? PHE C 102 . ? 4_446 ? 
76 AE2 2 ASN D  4   ? ASN D 4   . ? 1_555 ? 
77 AE3 7 ASN C  103 ? ASN C 103 . ? 4_446 ? 
78 AE3 7 ASN D  4   ? ASN D 4   . ? 1_555 ? 
79 AE3 7 ARG D  6   ? ARG D 6   . ? 1_555 ? 
80 AE3 7 TYR D  17  ? TYR D 17  . ? 1_555 ? 
81 AE3 7 LEU D  75  ? LEU D 75  . ? 1_555 ? 
82 AE3 7 THR D  76  ? THR D 76  . ? 1_555 ? 
83 AE3 7 ASP D  79  ? ASP D 79  . ? 1_555 ? 
84 AE4 4 LYS D  120 ? LYS D 120 . ? 1_555 ? 
85 AE4 4 LYS D  121 ? LYS D 121 . ? 1_555 ? 
86 AE4 4 ASN D  124 ? ASN D 124 . ? 1_555 ? 
87 AE4 4 ASN D  149 ? ASN D 149 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5W4A 
_atom_sites.fract_transf_matrix[1][1]   0.007532 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000099 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010563 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013709 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . ASN A  1 4   ? -40.397 -28.648 3.374   1.00 73.86  ?  4   ASN A N    1 
ATOM   2     C  CA   . ASN A  1 4   ? -41.842 -28.516 3.526   1.00 65.12  ?  4   ASN A CA   1 
ATOM   3     C  C    . ASN A  1 4   ? -42.207 -27.757 4.805   1.00 67.54  ?  4   ASN A C    1 
ATOM   4     O  O    . ASN A  1 4   ? -43.391 -27.550 5.089   1.00 72.35  ?  4   ASN A O    1 
ATOM   5     C  CB   . ASN A  1 4   ? -42.506 -29.894 3.533   1.00 73.54  ?  4   ASN A CB   1 
ATOM   6     C  CG   . ASN A  1 4   ? -42.074 -30.745 4.718   1.00 70.01  ?  4   ASN A CG   1 
ATOM   7     O  OD1  . ASN A  1 4   ? -42.859 -30.997 5.642   1.00 64.13  ?  4   ASN A OD1  1 
ATOM   8     N  ND2  . ASN A  1 4   ? -40.823 -31.197 4.696   1.00 77.39  ?  4   ASN A ND2  1 
ATOM   9     H  HA   . ASN A  1 4   ? -42.194 -28.018 2.771   1.00 78.15  ?  4   ASN A HA   1 
ATOM   10    H  HB2  . ASN A  1 4   ? -43.468 -29.781 3.579   1.00 88.25  ?  4   ASN A HB2  1 
ATOM   11    H  HB3  . ASN A  1 4   ? -42.265 -30.366 2.721   1.00 88.25  ?  4   ASN A HB3  1 
ATOM   12    H  HD21 . ASN A  1 4   ? -40.530 -31.683 5.342   1.00 92.87  ?  4   ASN A HD21 1 
ATOM   13    H  HD22 . ASN A  1 4   ? -40.308 -31.003 4.035   1.00 92.87  ?  4   ASN A HD22 1 
ATOM   14    N  N    . LYS A  1 5   ? -41.191 -27.355 5.572   1.00 36.99  ?  5   LYS A N    1 
ATOM   15    C  CA   . LYS A  1 5   ? -41.411 -26.518 6.754   1.00 38.14  ?  5   LYS A CA   1 
ATOM   16    C  C    . LYS A  1 5   ? -41.964 -25.150 6.360   1.00 33.48  ?  5   LYS A C    1 
ATOM   17    O  O    . LYS A  1 5   ? -41.616 -24.606 5.312   1.00 32.44  ?  5   LYS A O    1 
ATOM   18    C  CB   . LYS A  1 5   ? -40.093 -26.323 7.508   1.00 44.96  ?  5   LYS A CB   1 
ATOM   19    C  CG   . LYS A  1 5   ? -40.172 -25.320 8.643   1.00 48.91  ?  5   LYS A CG   1 
ATOM   20    C  CD   . LYS A  1 5   ? -38.875 -25.218 9.411   1.00 52.55  ?  5   LYS A CD   1 
ATOM   21    C  CE   . LYS A  1 5   ? -38.677 -26.423 10.323  1.00 64.66  ?  5   LYS A CE   1 
ATOM   22    N  NZ   . LYS A  1 5   ? -37.530 -26.228 11.265  1.00 70.91  1  5   LYS A NZ   1 
ATOM   23    H  H    . LYS A  1 5   ? -40.366 -27.553 5.429   1.00 44.38  ?  5   LYS A H    1 
ATOM   24    H  HA   . LYS A  1 5   ? -42.045 -26.951 7.346   1.00 45.77  ?  5   LYS A HA   1 
ATOM   25    H  HB2  . LYS A  1 5   ? -39.820 -27.174 7.884   1.00 53.95  ?  5   LYS A HB2  1 
ATOM   26    H  HB3  . LYS A  1 5   ? -39.420 -26.010 6.883   1.00 53.95  ?  5   LYS A HB3  1 
ATOM   27    H  HG2  . LYS A  1 5   ? -40.377 -24.444 8.280   1.00 58.69  ?  5   LYS A HG2  1 
ATOM   28    H  HG3  . LYS A  1 5   ? -40.867 -25.595 9.262   1.00 58.69  ?  5   LYS A HG3  1 
ATOM   29    H  HD2  . LYS A  1 5   ? -38.134 -25.184 8.786   1.00 63.06  ?  5   LYS A HD2  1 
ATOM   30    H  HD3  . LYS A  1 5   ? -38.889 -24.419 9.960   1.00 63.06  ?  5   LYS A HD3  1 
ATOM   31    H  HE2  . LYS A  1 5   ? -39.480 -26.560 10.848  1.00 77.59  ?  5   LYS A HE2  1 
ATOM   32    H  HE3  . LYS A  1 5   ? -38.493 -27.206 9.781   1.00 77.59  ?  5   LYS A HE3  1 
ATOM   33    H  HZ1  . LYS A  1 5   ? -37.438 -26.945 11.784  1.00 85.09  ?  5   LYS A HZ1  1 
ATOM   34    H  HZ2  . LYS A  1 5   ? -36.778 -26.104 10.807  1.00 85.09  ?  5   LYS A HZ2  1 
ATOM   35    H  HZ3  . LYS A  1 5   ? -37.677 -25.516 11.779  1.00 85.09  ?  5   LYS A HZ3  1 
ATOM   36    N  N    . ARG A  1 6   ? -42.786 -24.562 7.242   1.00 22.00  ?  6   ARG A N    1 
ATOM   37    C  CA   . ARG A  1 6   ? -43.281 -23.198 7.041   1.00 19.09  ?  6   ARG A CA   1 
ATOM   38    C  C    . ARG A  1 6   ? -42.141 -22.267 7.401   1.00 21.71  ?  6   ARG A C    1 
ATOM   39    O  O    . ARG A  1 6   ? -41.727 -22.217 8.565   1.00 27.62  ?  6   ARG A O    1 
ATOM   40    C  CB   . ARG A  1 6   ? -44.494 -22.890 7.910   1.00 20.83  ?  6   ARG A CB   1 
ATOM   41    C  CG   . ARG A  1 6   ? -45.738 -23.703 7.528   1.00 18.46  ?  6   ARG A CG   1 
ATOM   42    C  CD   . ARG A  1 6   ? -46.984 -23.246 8.286   1.00 17.76  ?  6   ARG A CD   1 
ATOM   43    N  NE   . ARG A  1 6   ? -48.189 -23.776 7.650   1.00 16.77  ?  6   ARG A NE   1 
ATOM   44    C  CZ   . ARG A  1 6   ? -48.683 -25.004 7.852   1.00 15.95  ?  6   ARG A CZ   1 
ATOM   45    N  NH1  . ARG A  1 6   ? -48.135 -25.817 8.733   1.00 17.57  1  6   ARG A NH1  1 
ATOM   46    N  NH2  . ARG A  1 6   ? -49.745 -25.414 7.160   1.00 17.69  ?  6   ARG A NH2  1 
ATOM   47    H  H    . ARG A  1 6   ? -43.069 -24.934 7.964   1.00 26.40  ?  6   ARG A H    1 
ATOM   48    H  HA   . ARG A  1 6   ? -43.517 -23.064 6.110   1.00 22.91  ?  6   ARG A HA   1 
ATOM   49    H  HB2  . ARG A  1 6   ? -44.278 -23.092 8.834   1.00 24.99  ?  6   ARG A HB2  1 
ATOM   50    H  HB3  . ARG A  1 6   ? -44.714 -21.949 7.820   1.00 24.99  ?  6   ARG A HB3  1 
ATOM   51    H  HG2  . ARG A  1 6   ? -45.906 -23.598 6.579   1.00 22.15  ?  6   ARG A HG2  1 
ATOM   52    H  HG3  . ARG A  1 6   ? -45.583 -24.637 7.738   1.00 22.15  ?  6   ARG A HG3  1 
ATOM   53    H  HD2  . ARG A  1 6   ? -46.948 -23.575 9.198   1.00 21.31  ?  6   ARG A HD2  1 
ATOM   54    H  HD3  . ARG A  1 6   ? -47.032 -22.277 8.276   1.00 21.31  ?  6   ARG A HD3  1 
ATOM   55    H  HE   . ARG A  1 6   ? -48.612 -23.261 7.106   1.00 20.12  ?  6   ARG A HE   1 
ATOM   56    H  HH11 . ARG A  1 6   ? -47.437 -25.570 9.170   1.00 21.09  ?  6   ARG A HH11 1 
ATOM   57    H  HH12 . ARG A  1 6   ? -48.469 -26.599 8.862   1.00 21.09  ?  6   ARG A HH12 1 
ATOM   58    H  HH21 . ARG A  1 6   ? -50.122 -24.884 6.597   1.00 21.22  ?  6   ARG A HH21 1 
ATOM   59    H  HH22 . ARG A  1 6   ? -50.085 -26.189 7.314   1.00 21.22  ?  6   ARG A HH22 1 
ATOM   60    N  N    . GLU A  1 7   ? -41.633 -21.548 6.406   1.00 18.08  ?  7   GLU A N    1 
ATOM   61    C  CA   A GLU A  1 7   ? -40.465 -20.702 6.580   0.38 18.37  ?  7   GLU A CA   1 
ATOM   62    C  CA   B GLU A  1 7   ? -40.454 -20.712 6.563   0.62 18.57  ?  7   GLU A CA   1 
ATOM   63    C  C    . GLU A  1 7   ? -40.750 -19.307 6.045   1.00 16.21  ?  7   GLU A C    1 
ATOM   64    O  O    . GLU A  1 7   ? -41.166 -19.145 4.888   1.00 18.60  ?  7   GLU A O    1 
ATOM   65    C  CB   A GLU A  1 7   ? -39.242 -21.316 5.889   0.38 23.35  ?  7   GLU A CB   1 
ATOM   66    C  CB   B GLU A  1 7   ? -39.273 -21.357 5.809   0.62 23.77  ?  7   GLU A CB   1 
ATOM   67    C  CG   A GLU A  1 7   ? -38.657 -22.492 6.663   0.38 23.50  ?  7   GLU A CG   1 
ATOM   68    C  CG   B GLU A  1 7   ? -37.928 -20.634 5.903   0.62 21.98  ?  7   GLU A CG   1 
ATOM   69    C  CD   A GLU A  1 7   ? -37.599 -22.086 7.667   0.38 16.56  ?  7   GLU A CD   1 
ATOM   70    C  CD   B GLU A  1 7   ? -36.799 -21.491 6.482   0.62 24.77  ?  7   GLU A CD   1 
ATOM   71    O  OE1  A GLU A  1 7   ? -36.996 -21.010 7.494   0.38 33.25  ?  7   GLU A OE1  1 
ATOM   72    O  OE1  B GLU A  1 7   ? -36.997 -22.686 6.789   0.62 38.00  ?  7   GLU A OE1  1 
ATOM   73    O  OE2  A GLU A  1 7   ? -37.343 -22.859 8.620   0.38 31.02  -1 7   GLU A OE2  1 
ATOM   74    O  OE2  B GLU A  1 7   ? -35.694 -20.965 6.644   0.62 26.74  -1 7   GLU A OE2  1 
ATOM   75    H  H    A GLU A  1 7   ? -41.954 -21.535 5.609   0.38 21.70  ?  7   GLU A H    1 
ATOM   76    H  H    B GLU A  1 7   ? -41.963 -21.530 5.612   0.62 21.70  ?  7   GLU A H    1 
ATOM   77    H  HA   . GLU A  1 7   ? -40.245 -20.639 7.516   1.00 22.29  ?  7   GLU A HA   1 
ATOM   78    H  HB2  A GLU A  1 7   ? -39.503 -21.634 5.011   0.38 28.03  ?  7   GLU A HB2  1 
ATOM   79    H  HB2  B GLU A  1 7   ? -39.144 -22.253 6.158   0.62 28.53  ?  7   GLU A HB2  1 
ATOM   80    H  HB3  A GLU A  1 7   ? -38.553 -20.638 5.806   0.38 28.03  ?  7   GLU A HB3  1 
ATOM   81    H  HB3  B GLU A  1 7   ? -39.506 -21.409 4.869   0.62 28.53  ?  7   GLU A HB3  1 
ATOM   82    H  HG2  A GLU A  1 7   ? -39.371 -22.936 7.147   0.38 28.21  ?  7   GLU A HG2  1 
ATOM   83    H  HG2  B GLU A  1 7   ? -37.661 -20.355 5.014   0.62 26.38  ?  7   GLU A HG2  1 
ATOM   84    H  HG3  A GLU A  1 7   ? -38.250 -23.110 6.036   0.38 28.21  ?  7   GLU A HG3  1 
ATOM   85    H  HG3  B GLU A  1 7   ? -38.031 -19.856 6.474   0.62 26.38  ?  7   GLU A HG3  1 
ATOM   86    N  N    . ILE A  1 8   ? -40.549 -18.309 6.901   1.00 16.05  ?  8   ILE A N    1 
ATOM   87    C  CA   . ILE A  1 8   ? -40.611 -16.915 6.490   1.00 16.87  ?  8   ILE A CA   1 
ATOM   88    C  C    . ILE A  1 8   ? -39.435 -16.625 5.567   1.00 18.84  ?  8   ILE A C    1 
ATOM   89    O  O    . ILE A  1 8   ? -38.294 -17.078 5.810   1.00 20.00  ?  8   ILE A O    1 
ATOM   90    C  CB   . ILE A  1 8   ? -40.604 -16.006 7.729   1.00 15.83  ?  8   ILE A CB   1 
ATOM   91    C  CG1  . ILE A  1 8   ? -41.896 -16.246 8.528   1.00 17.32  ?  8   ILE A CG1  1 
ATOM   92    C  CG2  . ILE A  1 8   ? -40.409 -14.523 7.382   1.00 17.07  ?  8   ILE A CG2  1 
ATOM   93    C  CD1  . ILE A  1 8   ? -41.931 -15.607 9.897   1.00 18.95  ?  8   ILE A CD1  1 
ATOM   94    H  H    . ILE A  1 8   ? -40.372 -18.417 7.735   1.00 19.26  ?  8   ILE A H    1 
ATOM   95    H  HA   . ILE A  1 8   ? -41.433 -16.759 5.998   1.00 20.25  ?  8   ILE A HA   1 
ATOM   96    H  HB   . ILE A  1 8   ? -39.859 -16.277 8.288   1.00 18.99  ?  8   ILE A HB   1 
ATOM   97    H  HG12 . ILE A  1 8   ? -42.643 -15.890 8.020   1.00 20.79  ?  8   ILE A HG12 1 
ATOM   98    H  HG13 . ILE A  1 8   ? -42.012 -17.201 8.648   1.00 20.79  ?  8   ILE A HG13 1 
ATOM   99    H  HG21 . ILE A  1 8   ? -40.414 -14.004 8.201   1.00 20.48  ?  8   ILE A HG21 1 
ATOM   100   H  HG22 . ILE A  1 8   ? -39.560 -14.415 6.926   1.00 20.48  ?  8   ILE A HG22 1 
ATOM   101   H  HG23 . ILE A  1 8   ? -41.134 -14.236 6.804   1.00 20.48  ?  8   ILE A HG23 1 
ATOM   102   H  HD11 . ILE A  1 8   ? -42.780 -15.813 10.319  1.00 22.74  ?  8   ILE A HD11 1 
ATOM   103   H  HD12 . ILE A  1 8   ? -41.202 -15.962 10.428  1.00 22.74  ?  8   ILE A HD12 1 
ATOM   104   H  HD13 . ILE A  1 8   ? -41.834 -14.647 9.799   1.00 22.74  ?  8   ILE A HD13 1 
ATOM   105   N  N    . VAL A  1 9   ? -39.686 -15.818 4.542   1.00 17.60  ?  9   VAL A N    1 
ATOM   106   C  CA   . VAL A  1 9   ? -38.645 -15.377 3.619   1.00 17.20  ?  9   VAL A CA   1 
ATOM   107   C  C    . VAL A  1 9   ? -38.668 -13.858 3.524   1.00 17.39  ?  9   VAL A C    1 
ATOM   108   O  O    . VAL A  1 9   ? -39.534 -13.177 4.085   1.00 16.92  ?  9   VAL A O    1 
ATOM   109   C  CB   . VAL A  1 9   ? -38.808 -16.014 2.225   1.00 17.15  ?  9   VAL A CB   1 
ATOM   110   C  CG1  . VAL A  1 9   ? -38.701 -17.538 2.327   1.00 20.49  ?  9   VAL A CG1  1 
ATOM   111   C  CG2  . VAL A  1 9   ? -40.141 -15.621 1.591   1.00 19.88  ?  9   VAL A CG2  1 
ATOM   112   H  H    . VAL A  1 9   ? -40.466 -15.506 4.356   1.00 21.11  ?  9   VAL A H    1 
ATOM   113   H  HA   . VAL A  1 9   ? -37.780 -15.643 3.969   1.00 20.64  ?  9   VAL A HA   1 
ATOM   114   H  HB   . VAL A  1 9   ? -38.095 -15.700 1.648   1.00 20.59  ?  9   VAL A HB   1 
ATOM   115   H  HG11 . VAL A  1 9   ? -38.805 -17.921 1.441   1.00 24.58  ?  9   VAL A HG11 1 
ATOM   116   H  HG12 . VAL A  1 9   ? -37.830 -17.770 2.687   1.00 24.58  ?  9   VAL A HG12 1 
ATOM   117   H  HG13 . VAL A  1 9   ? -39.400 -17.865 2.914   1.00 24.58  ?  9   VAL A HG13 1 
ATOM   118   H  HG21 . VAL A  1 9   ? -40.210 -16.038 0.718   1.00 23.86  ?  9   VAL A HG21 1 
ATOM   119   H  HG22 . VAL A  1 9   ? -40.864 -15.926 2.162   1.00 23.86  ?  9   VAL A HG22 1 
ATOM   120   H  HG23 . VAL A  1 9   ? -40.175 -14.656 1.501   1.00 23.86  ?  9   VAL A HG23 1 
ATOM   121   N  N    . GLU A  1 10  ? -37.674 -13.311 2.829   1.00 17.21  ?  10  GLU A N    1 
ATOM   122   C  CA   . GLU A  1 10  ? -37.593 -11.864 2.681   1.00 14.53  ?  10  GLU A CA   1 
ATOM   123   C  C    . GLU A  1 10  ? -37.017 -11.563 1.306   1.00 15.37  ?  10  GLU A C    1 
ATOM   124   O  O    . GLU A  1 10  ? -36.162 -12.306 0.809   1.00 16.95  ?  10  GLU A O    1 
ATOM   125   C  CB   . GLU A  1 10  ? -36.739 -11.243 3.793   1.00 15.76  ?  10  GLU A CB   1 
ATOM   126   C  CG   . GLU A  1 10  ? -36.553 -9.750  3.677   1.00 16.61  ?  10  GLU A CG   1 
ATOM   127   C  CD   . GLU A  1 10  ? -36.013 -9.136  4.953   1.00 27.10  ?  10  GLU A CD   1 
ATOM   128   O  OE1  . GLU A  1 10  ? -36.533 -9.426  6.052   1.00 23.68  ?  10  GLU A OE1  1 
ATOM   129   O  OE2  . GLU A  1 10  ? -35.061 -8.334  4.857   1.00 30.51  -1 10  GLU A OE2  1 
ATOM   130   H  H    . GLU A  1 10  ? -37.045 -13.749 2.439   1.00 20.65  ?  10  GLU A H    1 
ATOM   131   H  HA   . GLU A  1 10  ? -38.484 -11.484 2.730   1.00 17.44  ?  10  GLU A HA   1 
ATOM   132   H  HB2  . GLU A  1 10  ? -37.165 -11.421 4.646   1.00 18.91  ?  10  GLU A HB2  1 
ATOM   133   H  HB3  . GLU A  1 10  ? -35.860 -11.652 3.774   1.00 18.91  ?  10  GLU A HB3  1 
ATOM   134   H  HG2  . GLU A  1 10  ? -35.923 -9.564  2.963   1.00 19.93  ?  10  GLU A HG2  1 
ATOM   135   H  HG3  . GLU A  1 10  ? -37.409 -9.338  3.483   1.00 19.93  ?  10  GLU A HG3  1 
ATOM   136   N  N    . PHE A  1 11  ? -37.524 -10.498 0.700   1.00 15.44  ?  11  PHE A N    1 
ATOM   137   C  CA   . PHE A  1 11  ? -37.025 -9.961  -0.561  1.00 17.18  ?  11  PHE A CA   1 
ATOM   138   C  C    . PHE A  1 11  ? -36.790 -8.474  -0.389  1.00 20.83  ?  11  PHE A C    1 
ATOM   139   O  O    . PHE A  1 11  ? -37.741 -7.693  -0.367  1.00 18.43  ?  11  PHE A O    1 
ATOM   140   C  CB   . PHE A  1 11  ? -38.021 -10.172 -1.683  1.00 18.77  ?  11  PHE A CB   1 
ATOM   141   C  CG   . PHE A  1 11  ? -38.335 -11.568 -1.960  1.00 21.32  ?  11  PHE A CG   1 
ATOM   142   C  CD1  . PHE A  1 11  ? -39.240 -12.278 -1.160  1.00 23.51  ?  11  PHE A CD1  1 
ATOM   143   C  CD2  . PHE A  1 11  ? -37.769 -12.184 -3.065  1.00 26.98  ?  11  PHE A CD2  1 
ATOM   144   C  CE1  . PHE A  1 11  ? -39.557 -13.601 -1.459  1.00 26.13  ?  11  PHE A CE1  1 
ATOM   145   C  CE2  . PHE A  1 11  ? -38.077 -13.505 -3.368  1.00 26.93  ?  11  PHE A CE2  1 
ATOM   146   C  CZ   . PHE A  1 11  ? -38.977 -14.215 -2.559  1.00 26.08  ?  11  PHE A CZ   1 
ATOM   147   H  H    . PHE A  1 11  ? -38.187 -10.050 1.014   1.00 18.53  ?  11  PHE A H    1 
ATOM   148   H  HA   . PHE A  1 11  ? -36.187 -10.389 -0.797  1.00 20.62  ?  11  PHE A HA   1 
ATOM   149   H  HB2  . PHE A  1 11  ? -38.850 -9.725  -1.450  1.00 22.52  ?  11  PHE A HB2  1 
ATOM   150   H  HB3  . PHE A  1 11  ? -37.659 -9.785  -2.495  1.00 22.52  ?  11  PHE A HB3  1 
ATOM   151   H  HD1  . PHE A  1 11  ? -39.631 -11.863 -0.425  1.00 28.21  ?  11  PHE A HD1  1 
ATOM   152   H  HD2  . PHE A  1 11  ? -37.175 -11.712 -3.603  1.00 32.37  ?  11  PHE A HD2  1 
ATOM   153   H  HE1  . PHE A  1 11  ? -40.151 -14.072 -0.920  1.00 31.36  ?  11  PHE A HE1  1 
ATOM   154   H  HE2  . PHE A  1 11  ? -37.688 -13.918 -4.106  1.00 32.31  ?  11  PHE A HE2  1 
ATOM   155   H  HZ   . PHE A  1 11  ? -39.181 -15.101 -2.757  1.00 31.30  ?  11  PHE A HZ   1 
ATOM   156   N  N    . LEU A  1 12  ? -35.540 -8.077  -0.232  1.00 18.40  ?  12  LEU A N    1 
ATOM   157   C  CA   . LEU A  1 12  ? -35.131 -6.653  -0.217  1.00 17.23  ?  12  LEU A CA   1 
ATOM   158   C  C    . LEU A  1 12  ? -36.106 -5.772  0.578   1.00 18.56  ?  12  LEU A C    1 
ATOM   159   O  O    . LEU A  1 12  ? -36.709 -4.830  0.064   1.00 20.13  ?  12  LEU A O    1 
ATOM   160   C  CB   . LEU A  1 12  ? -34.952 -6.137  -1.644  1.00 19.04  ?  12  LEU A CB   1 
ATOM   161   C  CG   . LEU A  1 12  ? -34.180 -4.843  -1.907  1.00 23.91  ?  12  LEU A CG   1 
ATOM   162   C  CD1  . LEU A  1 12  ? -32.874 -4.854  -1.163  1.00 23.04  ?  12  LEU A CD1  1 
ATOM   163   C  CD2  . LEU A  1 12  ? -33.939 -4.700  -3.408  1.00 26.82  ?  12  LEU A CD2  1 
ATOM   164   H  H    . LEU A  1 12  ? -34.880 -8.618  -0.128  1.00 22.08  ?  12  LEU A H    1 
ATOM   165   H  HA   . LEU A  1 12  ? -34.268 -6.591  0.221   1.00 20.67  ?  12  LEU A HA   1 
ATOM   166   H  HB2  . LEU A  1 12  ? -34.501 -6.832  -2.148  1.00 22.85  ?  12  LEU A HB2  1 
ATOM   167   H  HB3  . LEU A  1 12  ? -35.838 -6.008  -2.018  1.00 22.85  ?  12  LEU A HB3  1 
ATOM   168   H  HG   . LEU A  1 12  ? -34.703 -4.084  -1.604  1.00 28.69  ?  12  LEU A HG   1 
ATOM   169   H  HD11 . LEU A  1 12  ? -32.401 -4.027  -1.343  1.00 27.64  ?  12  LEU A HD11 1 
ATOM   170   H  HD12 . LEU A  1 12  ? -33.053 -4.933  -0.213  1.00 27.64  ?  12  LEU A HD12 1 
ATOM   171   H  HD13 . LEU A  1 12  ? -32.345 -5.610  -1.464  1.00 27.64  ?  12  LEU A HD13 1 
ATOM   172   H  HD21 . LEU A  1 12  ? -33.450 -3.878  -3.572  1.00 32.19  ?  12  LEU A HD21 1 
ATOM   173   H  HD22 . LEU A  1 12  ? -33.423 -5.460  -3.719  1.00 32.19  ?  12  LEU A HD22 1 
ATOM   174   H  HD23 . LEU A  1 12  ? -34.795 -4.672  -3.864  1.00 32.19  ?  12  LEU A HD23 1 
ATOM   175   N  N    . GLY A  1 13  ? -36.245 -6.099  1.867   1.00 18.04  ?  13  GLY A N    1 
ATOM   176   C  CA   . GLY A  1 13  ? -37.030 -5.313  2.777   1.00 19.97  ?  13  GLY A CA   1 
ATOM   177   C  C    . GLY A  1 13  ? -38.468 -5.765  2.940   1.00 20.60  ?  13  GLY A C    1 
ATOM   178   O  O    . GLY A  1 13  ? -39.158 -5.237  3.809   1.00 23.08  ?  13  GLY A O    1 
ATOM   179   H  H    . GLY A  1 13  ? -35.880 -6.788  2.230   1.00 21.65  ?  13  GLY A H    1 
ATOM   180   H  HA2  . GLY A  1 13  ? -36.611 -5.332  3.651   1.00 23.96  ?  13  GLY A HA2  1 
ATOM   181   H  HA3  . GLY A  1 13  ? -37.040 -4.393  2.469   1.00 23.96  ?  13  GLY A HA3  1 
ATOM   182   N  N    . ILE A  1 14  ? -38.925 -6.742  2.169   1.00 16.35  ?  14  ILE A N    1 
ATOM   183   C  CA   . ILE A  1 14  ? -40.304 -7.237  2.262   1.00 15.15  ?  14  ILE A CA   1 
ATOM   184   C  C    . ILE A  1 14  ? -40.238 -8.640  2.868   1.00 15.07  ?  14  ILE A C    1 
ATOM   185   O  O    . ILE A  1 14  ? -39.861 -9.610  2.189   1.00 15.69  ?  14  ILE A O    1 
ATOM   186   C  CB   . ILE A  1 14  ? -41.027 -7.254  0.907   1.00 16.30  ?  14  ILE A CB   1 
ATOM   187   C  CG1  . ILE A  1 14  ? -40.983 -5.866  0.259   1.00 19.55  ?  14  ILE A CG1  1 
ATOM   188   C  CG2  . ILE A  1 14  ? -42.485 -7.714  1.115   1.00 16.01  ?  14  ILE A CG2  1 
ATOM   189   C  CD1  . ILE A  1 14  ? -41.621 -5.805  -1.125  1.00 22.79  ?  14  ILE A CD1  1 
ATOM   190   H  H    . ILE A  1 14  ? -38.453 -7.145  1.573   1.00 19.61  ?  14  ILE A H    1 
ATOM   191   H  HA   . ILE A  1 14  ? -40.807 -6.668  2.866   1.00 18.18  ?  14  ILE A HA   1 
ATOM   192   H  HB   . ILE A  1 14  ? -40.580 -7.886  0.322   1.00 19.56  ?  14  ILE A HB   1 
ATOM   193   H  HG12 . ILE A  1 14  ? -41.455 -5.241  0.830   1.00 23.46  ?  14  ILE A HG12 1 
ATOM   194   H  HG13 . ILE A  1 14  ? -40.056 -5.593  0.169   1.00 23.46  ?  14  ILE A HG13 1 
ATOM   195   H  HG21 . ILE A  1 14  ? -42.938 -7.724  0.258   1.00 19.22  ?  14  ILE A HG21 1 
ATOM   196   H  HG22 . ILE A  1 14  ? -42.483 -8.605  1.499   1.00 19.22  ?  14  ILE A HG22 1 
ATOM   197   H  HG23 . ILE A  1 14  ? -42.928 -7.095  1.717   1.00 19.22  ?  14  ILE A HG23 1 
ATOM   198   H  HD11 . ILE A  1 14  ? -41.552 -4.898  -1.463  1.00 27.35  ?  14  ILE A HD11 1 
ATOM   199   H  HD12 . ILE A  1 14  ? -41.153 -6.415  -1.715  1.00 27.35  ?  14  ILE A HD12 1 
ATOM   200   H  HD13 . ILE A  1 14  ? -42.553 -6.062  -1.053  1.00 27.35  ?  14  ILE A HD13 1 
ATOM   201   N  N    . ARG A  1 15  ? -40.614 -8.737  4.146   1.00 15.79  ?  15  ARG A N    1 
ATOM   202   C  CA   . ARG A  1 15  ? -40.610 -9.981  4.909   1.00 13.91  ?  15  ARG A CA   1 
ATOM   203   C  C    . ARG A  1 15  ? -42.001 -10.595 4.805   1.00 14.27  ?  15  ARG A C    1 
ATOM   204   O  O    . ARG A  1 15  ? -42.999 -9.929  5.096   1.00 16.16  ?  15  ARG A O    1 
ATOM   205   C  CB   . ARG A  1 15  ? -40.223 -9.709  6.369   1.00 14.70  ?  15  ARG A CB   1 
ATOM   206   C  CG   . ARG A  1 15  ? -40.302 -10.900 7.287   1.00 14.55  ?  15  ARG A CG   1 
ATOM   207   C  CD   . ARG A  1 15  ? -39.837 -10.457 8.699   1.00 15.50  ?  15  ARG A CD   1 
ATOM   208   N  NE   . ARG A  1 15  ? -40.223 -11.362 9.773   1.00 16.82  ?  15  ARG A NE   1 
ATOM   209   C  CZ   . ARG A  1 15  ? -39.517 -12.400 10.193  1.00 17.10  ?  15  ARG A CZ   1 
ATOM   210   N  NH1  . ARG A  1 15  ? -38.370 -12.730 9.619   1.00 17.99  1  15  ARG A NH1  1 
ATOM   211   N  NH2  . ARG A  1 15  ? -39.962 -13.124 11.200  1.00 17.13  ?  15  ARG A NH2  1 
ATOM   212   H  H    . ARG A  1 15  ? -40.885 -8.064  4.608   1.00 18.95  ?  15  ARG A H    1 
ATOM   213   H  HA   . ARG A  1 15  ? -39.967 -10.598 4.526   1.00 16.69  ?  15  ARG A HA   1 
ATOM   214   H  HB2  . ARG A  1 15  ? -39.309 -9.385  6.390   1.00 17.64  ?  15  ARG A HB2  1 
ATOM   215   H  HB3  . ARG A  1 15  ? -40.817 -9.028  6.723   1.00 17.64  ?  15  ARG A HB3  1 
ATOM   216   H  HG2  . ARG A  1 15  ? -41.219 -11.214 7.342   1.00 17.45  ?  15  ARG A HG2  1 
ATOM   217   H  HG3  . ARG A  1 15  ? -39.714 -11.602 6.968   1.00 17.45  ?  15  ARG A HG3  1 
ATOM   218   H  HD2  . ARG A  1 15  ? -38.869 -10.394 8.701   1.00 18.60  ?  15  ARG A HD2  1 
ATOM   219   H  HD3  . ARG A  1 15  ? -40.221 -9.588  8.894   1.00 18.60  ?  15  ARG A HD3  1 
ATOM   220   H  HE   . ARG A  1 15  ? -40.972 -11.209 10.167  1.00 20.19  ?  15  ARG A HE   1 
ATOM   221   H  HH11 . ARG A  1 15  ? -38.065 -12.260 8.966   1.00 21.59  ?  15  ARG A HH11 1 
ATOM   222   H  HH12 . ARG A  1 15  ? -37.928 -13.411 9.902   1.00 21.59  ?  15  ARG A HH12 1 
ATOM   223   H  HH21 . ARG A  1 15  ? -40.709 -12.925 11.576  1.00 20.56  ?  15  ARG A HH21 1 
ATOM   224   H  HH22 . ARG A  1 15  ? -39.515 -13.809 11.467  1.00 20.56  ?  15  ARG A HH22 1 
ATOM   225   N  N    . THR A  1 16  ? -42.063 -11.847 4.356   1.00 14.64  ?  16  THR A N    1 
ATOM   226   C  CA   . THR A  1 16  ? -43.350 -12.454 4.033   1.00 14.95  ?  16  THR A CA   1 
ATOM   227   C  C    . THR A  1 16  ? -43.287 -13.954 4.259   1.00 14.63  ?  16  THR A C    1 
ATOM   228   O  O    . THR A  1 16  ? -42.262 -14.601 4.011   1.00 16.10  ?  16  THR A O    1 
ATOM   229   C  CB   . THR A  1 16  ? -43.763 -12.139 2.577   1.00 16.10  ?  16  THR A CB   1 
ATOM   230   O  OG1  . THR A  1 16  ? -45.038 -12.705 2.274   1.00 15.86  ?  16  THR A OG1  1 
ATOM   231   C  CG2  . THR A  1 16  ? -42.755 -12.675 1.554   1.00 16.76  ?  16  THR A CG2  1 
ATOM   232   H  H    . THR A  1 16  ? -41.384 -12.359 4.231   1.00 17.57  ?  16  THR A H    1 
ATOM   233   H  HA   . THR A  1 16  ? -44.028 -12.090 4.622   1.00 17.94  ?  16  THR A HA   1 
ATOM   234   H  HB   . THR A  1 16  ? -43.813 -11.176 2.468   1.00 19.32  ?  16  THR A HB   1 
ATOM   235   H  HG1  . THR A  1 16  ? -45.622 -12.392 2.791   1.00 19.03  ?  16  THR A HG1  1 
ATOM   236   H  HG21 . THR A  1 16  ? -43.048 -12.458 0.655   1.00 20.11  ?  16  THR A HG21 1 
ATOM   237   H  HG22 . THR A  1 16  ? -41.884 -12.277 1.707   1.00 20.11  ?  16  THR A HG22 1 
ATOM   238   H  HG23 . THR A  1 16  ? -42.680 -13.639 1.637   1.00 20.11  ?  16  THR A HG23 1 
ATOM   239   N  N    . TYR A  1 17  ? -44.427 -14.524 4.655   1.00 15.32  ?  17  TYR A N    1 
ATOM   240   C  CA   . TYR A  1 17  ? -44.661 -15.954 4.576   1.00 14.42  ?  17  TYR A CA   1 
ATOM   241   C  C    . TYR A  1 17  ? -45.621 -16.292 3.445   1.00 14.10  ?  17  TYR A C    1 
ATOM   242   O  O    . TYR A  1 17  ? -45.329 -17.154 2.611   1.00 16.50  ?  17  TYR A O    1 
ATOM   243   C  CB   . TYR A  1 17  ? -45.209 -16.536 5.902   1.00 14.50  ?  17  TYR A CB   1 
ATOM   244   C  CG   . TYR A  1 17  ? -45.578 -17.994 5.679   1.00 14.05  ?  17  TYR A CG   1 
ATOM   245   C  CD1  . TYR A  1 17  ? -44.565 -18.945 5.448   1.00 15.95  ?  17  TYR A CD1  1 
ATOM   246   C  CD2  . TYR A  1 17  ? -46.924 -18.409 5.556   1.00 15.22  ?  17  TYR A CD2  1 
ATOM   247   C  CE1  . TYR A  1 17  ? -44.860 -20.235 5.117   1.00 18.69  ?  17  TYR A CE1  1 
ATOM   248   C  CE2  . TYR A  1 17  ? -47.228 -19.728 5.221   1.00 16.39  ?  17  TYR A CE2  1 
ATOM   249   C  CZ   . TYR A  1 17  ? -46.193 -20.632 5.000   1.00 16.80  ?  17  TYR A CZ   1 
ATOM   250   O  OH   . TYR A  1 17  ? -46.482 -21.932 4.656   1.00 19.53  ?  17  TYR A OH   1 
ATOM   251   H  H    . TYR A  1 17  ? -45.092 -14.086 4.981   1.00 18.39  ?  17  TYR A H    1 
ATOM   252   H  HA   . TYR A  1 17  ? -43.818 -16.395 4.388   1.00 17.31  ?  17  TYR A HA   1 
ATOM   253   H  HB2  . TYR A  1 17  ? -44.526 -16.488 6.590   1.00 17.39  ?  17  TYR A HB2  1 
ATOM   254   H  HB3  . TYR A  1 17  ? -46.004 -16.050 6.171   1.00 17.39  ?  17  TYR A HB3  1 
ATOM   255   H  HD1  . TYR A  1 17  ? -43.675 -18.678 5.488   1.00 19.13  ?  17  TYR A HD1  1 
ATOM   256   H  HD2  . TYR A  1 17  ? -47.610 -17.792 5.670   1.00 18.26  ?  17  TYR A HD2  1 
ATOM   257   H  HE1  . TYR A  1 17  ? -44.176 -20.847 4.970   1.00 22.42  ?  17  TYR A HE1  1 
ATOM   258   H  HE2  . TYR A  1 17  ? -48.114 -20.000 5.143   1.00 19.67  ?  17  TYR A HE2  1 
ATOM   259   H  HH   . TYR A  1 17  ? -47.314 -22.041 4.619   1.00 23.44  ?  17  TYR A HH   1 
ATOM   260   N  N    . PHE A  1 18  ? -46.749 -15.592 3.396   1.00 13.49  ?  18  PHE A N    1 
ATOM   261   C  CA   . PHE A  1 18  ? -47.850 -15.966 2.520   1.00 15.25  ?  18  PHE A CA   1 
ATOM   262   C  C    . PHE A  1 18  ? -47.703 -15.475 1.084   1.00 15.06  ?  18  PHE A C    1 
ATOM   263   O  O    . PHE A  1 18  ? -48.395 -15.996 0.192   1.00 15.79  ?  18  PHE A O    1 
ATOM   264   C  CB   . PHE A  1 18  ? -49.160 -15.437 3.121   1.00 14.44  ?  18  PHE A CB   1 
ATOM   265   C  CG   . PHE A  1 18  ? -49.611 -16.163 4.350   1.00 16.74  ?  18  PHE A CG   1 
ATOM   266   C  CD1  . PHE A  1 18  ? -49.352 -15.633 5.613   1.00 14.52  ?  18  PHE A CD1  1 
ATOM   267   C  CD2  . PHE A  1 18  ? -50.309 -17.356 4.262   1.00 16.40  ?  18  PHE A CD2  1 
ATOM   268   C  CE1  . PHE A  1 18  ? -49.780 -16.298 6.756   1.00 16.55  ?  18  PHE A CE1  1 
ATOM   269   C  CE2  . PHE A  1 18  ? -50.736 -18.022 5.417   1.00 16.29  ?  18  PHE A CE2  1 
ATOM   270   C  CZ   . PHE A  1 18  ? -50.453 -17.489 6.659   1.00 16.01  ?  18  PHE A CZ   1 
ATOM   271   H  H    . PHE A  1 18  ? -46.901 -14.888 3.866   1.00 16.19  ?  18  PHE A H    1 
ATOM   272   H  HA   . PHE A  1 18  ? -47.909 -16.934 2.493   1.00 18.30  ?  18  PHE A HA   1 
ATOM   273   H  HB2  . PHE A  1 18  ? -49.039 -14.504 3.358   1.00 17.32  ?  18  PHE A HB2  1 
ATOM   274   H  HB3  . PHE A  1 18  ? -49.862 -15.517 2.457   1.00 17.32  ?  18  PHE A HB3  1 
ATOM   275   H  HD1  . PHE A  1 18  ? -48.888 -14.831 5.692   1.00 17.43  ?  18  PHE A HD1  1 
ATOM   276   H  HD2  . PHE A  1 18  ? -50.493 -17.721 3.427   1.00 19.68  ?  18  PHE A HD2  1 
ATOM   277   H  HE1  . PHE A  1 18  ? -49.594 -15.940 7.594   1.00 19.86  ?  18  PHE A HE1  1 
ATOM   278   H  HE2  . PHE A  1 18  ? -51.197 -18.827 5.349   1.00 19.55  ?  18  PHE A HE2  1 
ATOM   279   H  HZ   . PHE A  1 18  ? -50.740 -17.926 7.428   1.00 19.22  ?  18  PHE A HZ   1 
ATOM   280   N  N    . PHE A  1 19  ? -46.884 -14.436 0.821   1.00 15.29  ?  19  PHE A N    1 
ATOM   281   C  CA   . PHE A  1 19  ? -46.875 -13.766 -0.485  1.00 16.87  ?  19  PHE A CA   1 
ATOM   282   C  C    . PHE A  1 19  ? -45.471 -13.593 -1.076  1.00 15.58  ?  19  PHE A C    1 
ATOM   283   O  O    . PHE A  1 19  ? -45.128 -12.523 -1.575  1.00 16.24  ?  19  PHE A O    1 
ATOM   284   C  CB   . PHE A  1 19  ? -47.555 -12.415 -0.356  1.00 15.78  ?  19  PHE A CB   1 
ATOM   285   C  CG   . PHE A  1 19  ? -48.991 -12.521 0.042   1.00 17.51  ?  19  PHE A CG   1 
ATOM   286   C  CD1  . PHE A  1 19  ? -49.944 -12.935 -0.868  1.00 17.89  ?  19  PHE A CD1  1 
ATOM   287   C  CD2  . PHE A  1 19  ? -49.381 -12.224 1.340   1.00 19.41  ?  19  PHE A CD2  1 
ATOM   288   C  CE1  . PHE A  1 19  ? -51.273 -13.041 -0.506  1.00 18.15  ?  19  PHE A CE1  1 
ATOM   289   C  CE2  . PHE A  1 19  ? -50.723 -12.317 1.701   1.00 16.98  ?  19  PHE A CE2  1 
ATOM   290   C  CZ   . PHE A  1 19  ? -51.651 -12.745 0.795   1.00 18.03  ?  19  PHE A CZ   1 
ATOM   291   H  H    . PHE A  1 19  ? -46.328 -14.105 1.387   1.00 18.35  ?  19  PHE A H    1 
ATOM   292   H  HA   . PHE A  1 19  ? -47.392 -14.298 -1.110  1.00 20.25  ?  19  PHE A HA   1 
ATOM   293   H  HB2  . PHE A  1 19  ? -47.094 -11.894 0.321   1.00 18.93  ?  19  PHE A HB2  1 
ATOM   294   H  HB3  . PHE A  1 19  ? -47.514 -11.958 -1.210  1.00 18.93  ?  19  PHE A HB3  1 
ATOM   295   H  HD1  . PHE A  1 19  ? -49.688 -13.143 -1.738  1.00 21.47  ?  19  PHE A HD1  1 
ATOM   296   H  HD2  . PHE A  1 19  ? -48.750 -11.941 1.962   1.00 23.29  ?  19  PHE A HD2  1 
ATOM   297   H  HE1  . PHE A  1 19  ? -51.907 -13.321 -1.126  1.00 21.78  ?  19  PHE A HE1  1 
ATOM   298   H  HE2  . PHE A  1 19  ? -50.983 -12.121 2.572   1.00 20.37  ?  19  PHE A HE2  1 
ATOM   299   H  HZ   . PHE A  1 19  ? -52.546 -12.806 1.042   1.00 21.64  ?  19  PHE A HZ   1 
ATOM   300   N  N    . PRO A  1 20  ? -44.646 -14.645 -1.087  1.00 16.12  ?  20  PRO A N    1 
ATOM   301   C  CA   . PRO A  1 20  ? -43.277 -14.462 -1.615  1.00 15.82  ?  20  PRO A CA   1 
ATOM   302   C  C    . PRO A  1 20  ? -43.227 -14.017 -3.071  1.00 15.91  ?  20  PRO A C    1 
ATOM   303   O  O    . PRO A  1 20  ? -42.349 -13.197 -3.408  1.00 17.60  ?  20  PRO A O    1 
ATOM   304   C  CB   . PRO A  1 20  ? -42.640 -15.841 -1.428  1.00 19.07  ?  20  PRO A CB   1 
ATOM   305   C  CG   . PRO A  1 20  ? -43.774 -16.768 -1.340  1.00 19.30  ?  20  PRO A CG   1 
ATOM   306   C  CD   . PRO A  1 20  ? -44.829 -16.012 -0.576  1.00 17.17  ?  20  PRO A CD   1 
ATOM   307   H  HA   . PRO A  1 20  ? -42.797 -13.817 -1.072  1.00 18.99  ?  20  PRO A HA   1 
ATOM   308   H  HB2  . PRO A  1 20  ? -42.082 -16.051 -2.193  1.00 22.89  ?  20  PRO A HB2  1 
ATOM   309   H  HB3  . PRO A  1 20  ? -42.120 -15.853 -0.608  1.00 22.89  ?  20  PRO A HB3  1 
ATOM   310   H  HG2  . PRO A  1 20  ? -44.086 -16.989 -2.231  1.00 23.16  ?  20  PRO A HG2  1 
ATOM   311   H  HG3  . PRO A  1 20  ? -43.508 -17.567 -0.859  1.00 23.16  ?  20  PRO A HG3  1 
ATOM   312   H  HD2  . PRO A  1 20  ? -45.714 -16.344 -0.794  1.00 20.61  ?  20  PRO A HD2  1 
ATOM   313   H  HD3  . PRO A  1 20  ? -44.654 -16.047 0.377   1.00 20.61  ?  20  PRO A HD3  1 
ATOM   314   N  N    . ASN A  1 21  ? -44.098 -14.544 -3.959  1.00 18.29  ?  21  ASN A N    1 
ATOM   315   C  CA   . ASN A  1 21  ? -43.988 -14.142 -5.365  1.00 17.86  ?  21  ASN A CA   1 
ATOM   316   C  C    . ASN A  1 21  ? -44.492 -12.727 -5.579  1.00 16.47  ?  21  ASN A C    1 
ATOM   317   O  O    . ASN A  1 21  ? -44.045 -12.059 -6.515  1.00 18.92  ?  21  ASN A O    1 
ATOM   318   C  CB   . ASN A  1 21  ? -44.715 -15.125 -6.292  1.00 18.78  ?  21  ASN A CB   1 
ATOM   319   C  CG   . ASN A  1 21  ? -44.339 -14.927 -7.772  1.00 22.28  ?  21  ASN A CG   1 
ATOM   320   O  OD1  . ASN A  1 21  ? -43.170 -14.692 -8.096  1.00 25.42  ?  21  ASN A OD1  1 
ATOM   321   N  ND2  . ASN A  1 21  ? -45.327 -15.035 -8.672  1.00 24.28  ?  21  ASN A ND2  1 
ATOM   322   H  H    . ASN A  1 21  ? -44.724 -15.105 -3.780  1.00 21.95  ?  21  ASN A H    1 
ATOM   323   H  HA   . ASN A  1 21  ? -43.050 -14.154 -5.612  1.00 21.43  ?  21  ASN A HA   1 
ATOM   324   H  HB2  . ASN A  1 21  ? -44.480 -16.032 -6.040  1.00 22.54  ?  21  ASN A HB2  1 
ATOM   325   H  HB3  . ASN A  1 21  ? -45.672 -14.993 -6.205  1.00 22.54  ?  21  ASN A HB3  1 
ATOM   326   H  HD21 . ASN A  1 21  ? -45.159 -14.931 -9.509  1.00 29.14  ?  21  ASN A HD21 1 
ATOM   327   H  HD22 . ASN A  1 21  ? -46.128 -15.208 -8.412  1.00 29.14  ?  21  ASN A HD22 1 
ATOM   328   N  N    . LEU A  1 22  ? -45.403 -12.249 -4.724  1.00 16.65  ?  22  LEU A N    1 
ATOM   329   C  CA   . LEU A  1 22  ? -45.813 -10.854 -4.769  1.00 17.93  ?  22  LEU A CA   1 
ATOM   330   C  C    . LEU A  1 22  ? -44.656 -9.938  -4.368  1.00 16.66  ?  22  LEU A C    1 
ATOM   331   O  O    . LEU A  1 22  ? -44.416 -8.898  -5.007  1.00 18.64  ?  22  LEU A O    1 
ATOM   332   C  CB   . LEU A  1 22  ? -47.025 -10.661 -3.858  1.00 20.19  ?  22  LEU A CB   1 
ATOM   333   C  CG   . LEU A  1 22  ? -47.638 -9.277  -3.797  1.00 23.38  ?  22  LEU A CG   1 
ATOM   334   C  CD1  . LEU A  1 22  ? -48.200 -8.868  -5.156  1.00 25.82  ?  22  LEU A CD1  1 
ATOM   335   C  CD2  . LEU A  1 22  ? -48.711 -9.224  -2.717  1.00 21.50  ?  22  LEU A CD2  1 
ATOM   336   H  H    . LEU A  1 22  ? -45.793 -12.714 -4.115  1.00 19.98  ?  22  LEU A H    1 
ATOM   337   H  HA   . LEU A  1 22  ? -46.077 -10.628 -5.675  1.00 21.51  ?  22  LEU A HA   1 
ATOM   338   H  HB2  . LEU A  1 22  ? -47.721 -11.267 -4.153  1.00 24.23  ?  22  LEU A HB2  1 
ATOM   339   H  HB3  . LEU A  1 22  ? -46.761 -10.895 -2.954  1.00 24.23  ?  22  LEU A HB3  1 
ATOM   340   H  HG   . LEU A  1 22  ? -46.947 -8.640  -3.558  1.00 28.06  ?  22  LEU A HG   1 
ATOM   341   H  HD11 . LEU A  1 22  ? -48.584 -7.981  -5.084  1.00 30.98  ?  22  LEU A HD11 1 
ATOM   342   H  HD12 . LEU A  1 22  ? -47.481 -8.866  -5.806  1.00 30.98  ?  22  LEU A HD12 1 
ATOM   343   H  HD13 . LEU A  1 22  ? -48.883 -9.505  -5.419  1.00 30.98  ?  22  LEU A HD13 1 
ATOM   344   H  HD21 . LEU A  1 22  ? -49.091 -8.332  -2.693  1.00 25.80  ?  22  LEU A HD21 1 
ATOM   345   H  HD22 . LEU A  1 22  ? -49.402 -9.873  -2.926  1.00 25.80  ?  22  LEU A HD22 1 
ATOM   346   H  HD23 . LEU A  1 22  ? -48.308 -9.435  -1.860  1.00 25.80  ?  22  LEU A HD23 1 
ATOM   347   N  N    . ALA A  1 23  ? -43.891 -10.332 -3.349  1.00 17.09  ?  23  ALA A N    1 
ATOM   348   C  CA   . ALA A  1 23  ? -42.714 -9.570  -2.947  1.00 17.14  ?  23  ALA A CA   1 
ATOM   349   C  C    . ALA A  1 23  ? -41.659 -9.567  -4.049  1.00 19.69  ?  23  ALA A C    1 
ATOM   350   O  O    . ALA A  1 23  ? -41.065 -8.526  -4.345  1.00 20.99  ?  23  ALA A O    1 
ATOM   351   C  CB   . ALA A  1 23  ? -42.140 -10.142 -1.657  1.00 17.44  ?  23  ALA A CB   1 
ATOM   352   H  H    . ALA A  1 23  ? -44.033 -11.036 -2.877  1.00 20.51  ?  23  ALA A H    1 
ATOM   353   H  HA   . ALA A  1 23  ? -42.974 -8.651  -2.778  1.00 20.57  ?  23  ALA A HA   1 
ATOM   354   H  HB1  . ALA A  1 23  ? -41.359 -9.625  -1.403  1.00 20.93  ?  23  ALA A HB1  1 
ATOM   355   H  HB2  . ALA A  1 23  ? -42.814 -10.088 -0.961  1.00 20.93  ?  23  ALA A HB2  1 
ATOM   356   H  HB3  . ALA A  1 23  ? -41.891 -11.067 -1.806  1.00 20.93  ?  23  ALA A HB3  1 
ATOM   357   N  N    . LEU A  1 24  ? -41.414 -10.719 -4.664  1.00 16.81  ?  24  LEU A N    1 
ATOM   358   C  CA   . LEU A  1 24  ? -40.466 -10.764 -5.762  1.00 18.45  ?  24  LEU A CA   1 
ATOM   359   C  C    . LEU A  1 24  ? -40.916 -9.851  -6.896  1.00 20.36  ?  24  LEU A C    1 
ATOM   360   O  O    . LEU A  1 24  ? -40.080 -9.181  -7.524  1.00 20.08  ?  24  LEU A O    1 
ATOM   361   C  CB   . LEU A  1 24  ? -40.287 -12.201 -6.254  1.00 17.43  ?  24  LEU A CB   1 
ATOM   362   C  CG   . LEU A  1 24  ? -39.249 -12.394 -7.369  1.00 22.58  ?  24  LEU A CG   1 
ATOM   363   C  CD1  . LEU A  1 24  ? -37.850 -11.882 -6.976  1.00 24.17  ?  24  LEU A CD1  1 
ATOM   364   C  CD2  . LEU A  1 24  ? -39.156 -13.874 -7.723  1.00 27.57  ?  24  LEU A CD2  1 
ATOM   365   H  H    . LEU A  1 24  ? -41.778 -11.473 -4.468  1.00 20.18  ?  24  LEU A H    1 
ATOM   366   H  HA   . LEU A  1 24  ? -39.605 -10.448 -5.447  1.00 22.14  ?  24  LEU A HA   1 
ATOM   367   H  HB2  . LEU A  1 24  ? -40.013 -12.751 -5.504  1.00 20.92  ?  24  LEU A HB2  1 
ATOM   368   H  HB3  . LEU A  1 24  ? -41.139 -12.517 -6.593  1.00 20.92  ?  24  LEU A HB3  1 
ATOM   369   H  HG   . LEU A  1 24  ? -39.537 -11.912 -8.160  1.00 27.09  ?  24  LEU A HG   1 
ATOM   370   H  HD11 . LEU A  1 24  ? -37.241 -12.030 -7.716  1.00 29.00  ?  24  LEU A HD11 1 
ATOM   371   H  HD12 . LEU A  1 24  ? -37.906 -10.934 -6.778  1.00 29.00  ?  24  LEU A HD12 1 
ATOM   372   H  HD13 . LEU A  1 24  ? -37.545 -12.367 -6.194  1.00 29.00  ?  24  LEU A HD13 1 
ATOM   373   H  HD21 . LEU A  1 24  ? -38.499 -13.989 -8.427  1.00 33.09  ?  24  LEU A HD21 1 
ATOM   374   H  HD22 . LEU A  1 24  ? -38.887 -14.370 -6.934  1.00 33.09  ?  24  LEU A HD22 1 
ATOM   375   H  HD23 . LEU A  1 24  ? -40.025 -14.180 -8.027  1.00 33.09  ?  24  LEU A HD23 1 
ATOM   376   N  N    . TYR A  1 25  ? -42.209 -9.873  -7.226  1.00 17.40  ?  25  TYR A N    1 
ATOM   377   C  CA   . TYR A  1 25  ? -42.723 -9.033  -8.309  1.00 19.65  ?  25  TYR A CA   1 
ATOM   378   C  C    . TYR A  1 25  ? -42.412 -7.562  -8.045  1.00 21.32  ?  25  TYR A C    1 
ATOM   379   O  O    . TYR A  1 25  ? -41.944 -6.837  -8.936  1.00 20.93  ?  25  TYR A O    1 
ATOM   380   C  CB   . TYR A  1 25  ? -44.239 -9.247  -8.493  1.00 21.57  ?  25  TYR A CB   1 
ATOM   381   C  CG   . TYR A  1 25  ? -44.781 -8.454  -9.674  1.00 20.07  ?  25  TYR A CG   1 
ATOM   382   C  CD1  . TYR A  1 25  ? -44.863 -9.016  -10.931 1.00 23.86  ?  25  TYR A CD1  1 
ATOM   383   C  CD2  . TYR A  1 25  ? -45.092 -7.100  -9.533  1.00 22.28  ?  25  TYR A CD2  1 
ATOM   384   C  CE1  . TYR A  1 25  ? -45.282 -8.262  -12.024 1.00 23.79  ?  25  TYR A CE1  1 
ATOM   385   C  CE2  . TYR A  1 25  ? -45.498 -6.343  -10.618 1.00 23.19  ?  25  TYR A CE2  1 
ATOM   386   C  CZ   . TYR A  1 25  ? -45.593 -6.923  -11.853 1.00 26.43  ?  25  TYR A CZ   1 
ATOM   387   O  OH   . TYR A  1 25  ? -46.013 -6.150  -12.931 1.00 27.52  ?  25  TYR A OH   1 
ATOM   388   H  H    . TYR A  1 25  ? -42.804 -10.361 -6.842  1.00 20.88  ?  25  TYR A H    1 
ATOM   389   H  HA   . TYR A  1 25  ? -42.284 -9.286  -9.136  1.00 23.58  ?  25  TYR A HA   1 
ATOM   390   H  HB2  . TYR A  1 25  ? -44.411 -10.188 -8.655  1.00 25.88  ?  25  TYR A HB2  1 
ATOM   391   H  HB3  . TYR A  1 25  ? -44.702 -8.955  -7.693  1.00 25.88  ?  25  TYR A HB3  1 
ATOM   392   H  HD1  . TYR A  1 25  ? -44.639 -9.911  -11.050 1.00 28.63  ?  25  TYR A HD1  1 
ATOM   393   H  HD2  . TYR A  1 25  ? -45.012 -6.698  -8.699  1.00 26.74  ?  25  TYR A HD2  1 
ATOM   394   H  HE1  . TYR A  1 25  ? -45.347 -8.654  -12.865 1.00 28.55  ?  25  TYR A HE1  1 
ATOM   395   H  HE2  . TYR A  1 25  ? -45.716 -5.446  -10.505 1.00 27.82  ?  25  TYR A HE2  1 
ATOM   396   H  HH   . TYR A  1 25  ? -46.036 -6.618  -13.628 1.00 33.02  ?  25  TYR A HH   1 
ATOM   397   N  N    . ALA A  1 26  ? -42.625 -7.111  -6.809  1.00 23.59  ?  26  ALA A N    1 
ATOM   398   C  CA   . ALA A  1 26  ? -42.279 -5.734  -6.420  1.00 27.74  ?  26  ALA A CA   1 
ATOM   399   C  C    . ALA A  1 26  ? -40.786 -5.428  -6.547  1.00 29.88  ?  26  ALA A C    1 
ATOM   400   O  O    . ALA A  1 26  ? -40.414 -4.332  -6.993  1.00 35.61  ?  26  ALA A O    1 
ATOM   401   C  CB   . ALA A  1 26  ? -42.734 -5.469  -4.976  1.00 29.99  ?  26  ALA A CB   1 
ATOM   402   H  H    . ALA A  1 26  ? -42.969 -7.579  -6.174  1.00 28.30  ?  26  ALA A H    1 
ATOM   403   H  HA   . ALA A  1 26  ? -42.756 -5.119  -6.998  1.00 33.29  ?  26  ALA A HA   1 
ATOM   404   H  HB1  . ALA A  1 26  ? -42.499 -4.559  -4.734  1.00 35.98  ?  26  ALA A HB1  1 
ATOM   405   H  HB2  . ALA A  1 26  ? -43.695 -5.589  -4.921  1.00 35.98  ?  26  ALA A HB2  1 
ATOM   406   H  HB3  . ALA A  1 26  ? -42.287 -6.095  -4.385  1.00 35.98  ?  26  ALA A HB3  1 
ATOM   407   N  N    . VAL A  1 27  ? -39.910 -6.337  -6.103  1.00 31.11  ?  27  VAL A N    1 
ATOM   408   C  CA   . VAL A  1 27  ? -38.471 -6.164  -6.324  1.00 32.15  ?  27  VAL A CA   1 
ATOM   409   C  C    . VAL A  1 27  ? -38.171 -6.013  -7.812  1.00 38.88  ?  27  VAL A C    1 
ATOM   410   O  O    . VAL A  1 27  ? -37.365 -5.168  -8.232  1.00 35.25  ?  27  VAL A O    1 
ATOM   411   C  CB   . VAL A  1 27  ? -37.682 -7.356  -5.732  1.00 41.39  ?  27  VAL A CB   1 
ATOM   412   C  CG1  . VAL A  1 27  ? -36.237 -7.449  -6.321  1.00 36.17  ?  27  VAL A CG1  1 
ATOM   413   C  CG2  . VAL A  1 27  ? -37.647 -7.284  -4.213  1.00 41.48  ?  27  VAL A CG2  1 
ATOM   414   H  H    . VAL A  1 27  ? -40.121 -7.053  -5.676  1.00 37.34  ?  27  VAL A H    1 
ATOM   415   H  HA   . VAL A  1 27  ? -38.177 -5.356  -5.875  1.00 38.58  ?  27  VAL A HA   1 
ATOM   416   H  HB   . VAL A  1 27  ? -38.143 -8.174  -5.971  1.00 49.67  ?  27  VAL A HB   1 
ATOM   417   H  HG11 . VAL A  1 27  ? -35.782 -8.208  -5.923  1.00 43.40  ?  27  VAL A HG11 1 
ATOM   418   H  HG12 . VAL A  1 27  ? -36.295 -7.566  -7.283  1.00 43.40  ?  27  VAL A HG12 1 
ATOM   419   H  HG13 . VAL A  1 27  ? -35.759 -6.631  -6.116  1.00 43.40  ?  27  VAL A HG13 1 
ATOM   420   H  HG21 . VAL A  1 27  ? -37.146 -8.043  -3.873  1.00 49.78  ?  27  VAL A HG21 1 
ATOM   421   H  HG22 . VAL A  1 27  ? -37.216 -6.457  -3.946  1.00 49.78  ?  27  VAL A HG22 1 
ATOM   422   H  HG23 . VAL A  1 27  ? -38.556 -7.309  -3.875  1.00 49.78  ?  27  VAL A HG23 1 
ATOM   423   N  N    . ASN A  1 28  ? -38.776 -6.854  -8.631  1.00 23.18  ?  28  ASN A N    1 
ATOM   424   C  CA   . ASN A  1 28  ? -38.366 -6.908  -10.015 1.00 24.35  ?  28  ASN A CA   1 
ATOM   425   C  C    . ASN A  1 28  ? -39.029 -5.830  -10.860 1.00 25.28  ?  28  ASN A C    1 
ATOM   426   O  O    . ASN A  1 28  ? -38.541 -5.538  -11.960 1.00 28.22  ?  28  ASN A O    1 
ATOM   427   C  CB   . ASN A  1 28  ? -38.663 -8.286  -10.589 1.00 23.55  ?  28  ASN A CB   1 
ATOM   428   C  CG   . ASN A  1 28  ? -37.660 -9.319  -10.135 1.00 29.95  ?  28  ASN A CG   1 
ATOM   429   O  OD1  . ASN A  1 28  ? -36.492 -9.001  -9.870  1.00 30.71  ?  28  ASN A OD1  1 
ATOM   430   N  ND2  . ASN A  1 28  ? -38.099 -10.561 -10.057 1.00 26.84  ?  28  ASN A ND2  1 
ATOM   431   H  H    . ASN A  1 28  ? -39.412 -7.391  -8.416  1.00 27.81  ?  28  ASN A H    1 
ATOM   432   H  HA   . ASN A  1 28  ? -37.407 -6.770  -10.060 1.00 29.22  ?  28  ASN A HA   1 
ATOM   433   H  HB2  . ASN A  1 28  ? -39.543 -8.570  -10.295 1.00 28.26  ?  28  ASN A HB2  1 
ATOM   434   H  HB3  . ASN A  1 28  ? -38.632 -8.240  -11.557 1.00 28.26  ?  28  ASN A HB3  1 
ATOM   435   H  HD21 . ASN A  1 28  ? -37.569 -11.189 -9.804  1.00 32.21  ?  28  ASN A HD21 1 
ATOM   436   H  HD22 . ASN A  1 28  ? -38.915 -10.742 -10.259 1.00 32.21  ?  28  ASN A HD22 1 
ATOM   437   N  N    . ASN A  1 29  ? -40.121 -5.248  -10.387 1.00 23.45  ?  29  ASN A N    1 
ATOM   438   C  CA   . ASN A  1 29  ? -40.911 -4.317  -11.195 1.00 24.66  ?  29  ASN A CA   1 
ATOM   439   C  C    . ASN A  1 29  ? -41.123 -2.992  -10.457 1.00 21.03  ?  29  ASN A C    1 
ATOM   440   O  O    . ASN A  1 29  ? -42.118 -2.297  -10.680 1.00 24.37  ?  29  ASN A O    1 
ATOM   441   C  CB   . ASN A  1 29  ? -42.244 -4.953  -11.577 1.00 22.72  ?  29  ASN A CB   1 
ATOM   442   C  CG   . ASN A  1 29  ? -42.077 -6.167  -12.478 1.00 27.78  ?  29  ASN A CG   1 
ATOM   443   O  OD1  . ASN A  1 29  ? -41.914 -6.033  -13.696 1.00 28.85  ?  29  ASN A OD1  1 
ATOM   444   N  ND2  . ASN A  1 29  ? -42.108 -7.358  -11.887 1.00 22.65  ?  29  ASN A ND2  1 
ATOM   445   H  H    . ASN A  1 29  ? -40.432 -5.374  -9.595  1.00 28.14  ?  29  ASN A H    1 
ATOM   446   H  HA   . ASN A  1 29  ? -40.428 -4.127  -12.015 1.00 29.59  ?  29  ASN A HA   1 
ATOM   447   H  HB2  . ASN A  1 29  ? -42.700 -5.238  -10.770 1.00 27.26  ?  29  ASN A HB2  1 
ATOM   448   H  HB3  . ASN A  1 29  ? -42.782 -4.299  -12.050 1.00 27.26  ?  29  ASN A HB3  1 
ATOM   449   H  HD21 . ASN A  1 29  ? -42.018 -8.074  -12.356 1.00 27.18  ?  29  ASN A HD21 1 
ATOM   450   H  HD22 . ASN A  1 29  ? -42.218 -7.414  -11.036 1.00 27.18  ?  29  ASN A HD22 1 
ATOM   451   N  N    . ASP A  1 30  ? -40.187 -2.671  -9.563  1.00 25.96  ?  30  ASP A N    1 
ATOM   452   C  CA   . ASP A  1 30  ? -40.127 -1.419  -8.812  1.00 32.77  ?  30  ASP A CA   1 
ATOM   453   C  C    . ASP A  1 30  ? -40.470 -0.200  -9.678  1.00 32.91  ?  30  ASP A C    1 
ATOM   454   O  O    . ASP A  1 30  ? -41.467 0.503   -9.451  1.00 27.48  ?  30  ASP A O    1 
ATOM   455   C  CB   . ASP A  1 30  ? -38.692 -1.328  -8.247  1.00 32.60  ?  30  ASP A CB   1 
ATOM   456   C  CG   . ASP A  1 30  ? -38.516 -0.272  -7.199  1.00 41.35  ?  30  ASP A CG   1 
ATOM   457   O  OD1  . ASP A  1 30  ? -39.496 0.360   -6.769  1.00 40.63  ?  30  ASP A OD1  1 
ATOM   458   O  OD2  . ASP A  1 30  ? -37.356 -0.090  -6.780  1.00 41.93  -1 30  ASP A OD2  1 
ATOM   459   H  H    . ASP A  1 30  ? -39.537 -3.199  -9.366  1.00 31.15  ?  30  ASP A H    1 
ATOM   460   H  HA   . ASP A  1 30  ? -40.751 -1.455  -8.069  1.00 39.32  ?  30  ASP A HA   1 
ATOM   461   H  HB2  . ASP A  1 30  ? -38.459 -2.181  -7.850  1.00 39.12  ?  30  ASP A HB2  1 
ATOM   462   H  HB3  . ASP A  1 30  ? -38.083 -1.127  -8.975  1.00 39.12  ?  30  ASP A HB3  1 
ATOM   463   N  N    . GLU A  1 31  ? -39.651 0.031   -10.704 1.00 31.50  ?  31  GLU A N    1 
ATOM   464   C  CA   . GLU A  1 31  ? -39.811 1.218   -11.552 1.00 33.16  ?  31  GLU A CA   1 
ATOM   465   C  C    . GLU A  1 31  ? -41.163 1.225   -12.241 1.00 33.13  ?  31  GLU A C    1 
ATOM   466   O  O    . GLU A  1 31  ? -41.815 2.275   -12.372 1.00 31.59  ?  31  GLU A O    1 
ATOM   467   C  CB   . GLU A  1 31  ? -38.698 1.262   -12.602 1.00 39.13  ?  31  GLU A CB   1 
ATOM   468   C  CG   . GLU A  1 31  ? -37.288 1.129   -12.047 1.00 58.66  ?  31  GLU A CG   1 
ATOM   469   C  CD   . GLU A  1 31  ? -36.312 0.587   -13.078 1.00 72.79  ?  31  GLU A CD   1 
ATOM   470   O  OE1  . GLU A  1 31  ? -36.626 0.656   -14.289 1.00 76.77  ?  31  GLU A OE1  1 
ATOM   471   O  OE2  . GLU A  1 31  ? -35.238 0.090   -12.676 1.00 65.22  -1 31  GLU A OE2  1 
ATOM   472   H  H    . GLU A  1 31  ? -38.998 -0.480  -10.931 1.00 37.80  ?  31  GLU A H    1 
ATOM   473   H  HA   . GLU A  1 31  ? -39.745 2.015   -11.003 1.00 39.79  ?  31  GLU A HA   1 
ATOM   474   H  HB2  . GLU A  1 31  ? -38.836 0.534   -13.229 1.00 46.96  ?  31  GLU A HB2  1 
ATOM   475   H  HB3  . GLU A  1 31  ? -38.750 2.109   -13.071 1.00 46.96  ?  31  GLU A HB3  1 
ATOM   476   H  HG2  . GLU A  1 31  ? -36.974 2.003   -11.765 1.00 70.40  ?  31  GLU A HG2  1 
ATOM   477   H  HG3  . GLU A  1 31  ? -37.299 0.520   -11.293 1.00 70.40  ?  31  GLU A HG3  1 
ATOM   478   N  N    . LEU A  1 32  ? -41.588 0.064   -12.727 1.00 29.39  ?  32  LEU A N    1 
ATOM   479   C  CA   . LEU A  1 32  ? -42.863 -0.036  -13.411 1.00 27.52  ?  32  LEU A CA   1 
ATOM   480   C  C    . LEU A  1 32  ? -44.016 0.395   -12.506 1.00 31.62  ?  32  LEU A C    1 
ATOM   481   O  O    . LEU A  1 32  ? -44.901 1.153   -12.917 1.00 29.28  ?  32  LEU A O    1 
ATOM   482   C  CB   . LEU A  1 32  ? -43.053 -1.466  -13.886 1.00 27.96  ?  32  LEU A CB   1 
ATOM   483   C  CG   . LEU A  1 32  ? -44.247 -1.710  -14.791 1.00 31.79  ?  32  LEU A CG   1 
ATOM   484   C  CD1  . LEU A  1 32  ? -44.034 -0.968  -16.112 1.00 38.77  ?  32  LEU A CD1  1 
ATOM   485   C  CD2  . LEU A  1 32  ? -44.450 -3.191  -15.038 1.00 33.24  ?  32  LEU A CD2  1 
ATOM   486   H  H    . LEU A  1 32  ? -41.155 -0.677  -12.673 1.00 35.26  ?  32  LEU A H    1 
ATOM   487   H  HA   . LEU A  1 32  ? -42.855 0.544   -14.188 1.00 33.02  ?  32  LEU A HA   1 
ATOM   488   H  HB2  . LEU A  1 32  ? -42.260 -1.734  -14.375 1.00 33.56  ?  32  LEU A HB2  1 
ATOM   489   H  HB3  . LEU A  1 32  ? -43.159 -2.035  -13.107 1.00 33.56  ?  32  LEU A HB3  1 
ATOM   490   H  HG   . LEU A  1 32  ? -45.046 -1.358  -14.369 1.00 38.14  ?  32  LEU A HG   1 
ATOM   491   H  HD11 . LEU A  1 32  ? -44.798 -1.125  -16.688 1.00 46.52  ?  32  LEU A HD11 1 
ATOM   492   H  HD12 . LEU A  1 32  ? -43.946 -0.019  -15.930 1.00 46.52  ?  32  LEU A HD12 1 
ATOM   493   H  HD13 . LEU A  1 32  ? -43.226 -1.300  -16.534 1.00 46.52  ?  32  LEU A HD13 1 
ATOM   494   H  HD21 . LEU A  1 32  ? -45.218 -3.312  -15.618 1.00 39.89  ?  32  LEU A HD21 1 
ATOM   495   H  HD22 . LEU A  1 32  ? -43.656 -3.553  -15.461 1.00 39.89  ?  32  LEU A HD22 1 
ATOM   496   H  HD23 . LEU A  1 32  ? -44.604 -3.634  -14.189 1.00 39.89  ?  32  LEU A HD23 1 
ATOM   497   N  N    . LEU A  1 33  ? -44.032 -0.108  -11.272 1.00 28.84  ?  33  LEU A N    1 
ATOM   498   C  CA   . LEU A  1 33  ? -45.100 0.227   -10.342 1.00 26.32  ?  33  LEU A CA   1 
ATOM   499   C  C    . LEU A  1 33  ? -45.099 1.710   -10.003 1.00 31.15  ?  33  LEU A C    1 
ATOM   500   O  O    . LEU A  1 33  ? -46.163 2.313   -9.829  1.00 30.25  ?  33  LEU A O    1 
ATOM   501   C  CB   . LEU A  1 33  ? -44.950 -0.597  -9.063  1.00 27.26  ?  33  LEU A CB   1 
ATOM   502   C  CG   . LEU A  1 33  ? -45.374 -2.061  -9.152  1.00 23.14  ?  33  LEU A CG   1 
ATOM   503   C  CD1  . LEU A  1 33  ? -44.748 -2.877  -7.989  1.00 21.43  ?  33  LEU A CD1  1 
ATOM   504   C  CD2  . LEU A  1 33  ? -46.880 -2.155  -9.184  1.00 25.45  ?  33  LEU A CD2  1 
ATOM   505   H  H    . LEU A  1 33  ? -43.438 -0.642  -10.953 1.00 34.61  ?  33  LEU A H    1 
ATOM   506   H  HA   . LEU A  1 33  ? -45.954 0.008   -10.746 1.00 31.58  ?  33  LEU A HA   1 
ATOM   507   H  HB2  . LEU A  1 33  ? -44.017 -0.582  -8.798  1.00 32.71  ?  33  LEU A HB2  1 
ATOM   508   H  HB3  . LEU A  1 33  ? -45.488 -0.183  -8.369  1.00 32.71  ?  33  LEU A HB3  1 
ATOM   509   H  HG   . LEU A  1 33  ? -45.039 -2.430  -9.984  1.00 27.77  ?  33  LEU A HG   1 
ATOM   510   H  HD11 . LEU A  1 33  ? -45.030 -3.802  -8.065  1.00 25.71  ?  33  LEU A HD11 1 
ATOM   511   H  HD12 . LEU A  1 33  ? -43.782 -2.820  -8.048  1.00 25.71  ?  33  LEU A HD12 1 
ATOM   512   H  HD13 . LEU A  1 33  ? -45.051 -2.508  -7.145  1.00 25.71  ?  33  LEU A HD13 1 
ATOM   513   H  HD21 . LEU A  1 33  ? -47.136 -3.089  -9.241  1.00 30.54  ?  33  LEU A HD21 1 
ATOM   514   H  HD22 . LEU A  1 33  ? -47.238 -1.762  -8.372  1.00 30.54  ?  33  LEU A HD22 1 
ATOM   515   H  HD23 . LEU A  1 33  ? -47.210 -1.673  -9.958  1.00 30.54  ?  33  LEU A HD23 1 
ATOM   516   N  N    . VAL A  1 34  ? -43.914 2.298   -9.875  1.00 30.44  ?  34  VAL A N    1 
ATOM   517   C  CA   . VAL A  1 34  ? -43.800 3.710   -9.530  1.00 32.74  ?  34  VAL A CA   1 
ATOM   518   C  C    . VAL A  1 34  ? -44.103 4.587   -10.738 1.00 36.46  ?  34  VAL A C    1 
ATOM   519   O  O    . VAL A  1 34  ? -44.784 5.610   -10.612 1.00 35.07  ?  34  VAL A O    1 
ATOM   520   C  CB   . VAL A  1 34  ? -42.400 3.996   -8.958  1.00 38.25  ?  34  VAL A CB   1 
ATOM   521   C  CG1  . VAL A  1 34  ? -42.159 5.505   -8.826  1.00 40.38  ?  34  VAL A CG1  1 
ATOM   522   C  CG2  . VAL A  1 34  ? -42.201 3.278   -7.589  1.00 38.05  ?  34  VAL A CG2  1 
ATOM   523   H  H    . VAL A  1 34  ? -43.159 1.900   -9.983  1.00 36.53  ?  34  VAL A H    1 
ATOM   524   H  HA   . VAL A  1 34  ? -44.451 3.918   -8.841  1.00 39.28  ?  34  VAL A HA   1 
ATOM   525   H  HB   . VAL A  1 34  ? -41.737 3.645   -9.573  1.00 45.91  ?  34  VAL A HB   1 
ATOM   526   H  HG11 . VAL A  1 34  ? -41.271 5.652   -8.464  1.00 48.46  ?  34  VAL A HG11 1 
ATOM   527   H  HG12 . VAL A  1 34  ? -42.232 5.913   -9.703  1.00 48.46  ?  34  VAL A HG12 1 
ATOM   528   H  HG13 . VAL A  1 34  ? -42.826 5.879   -8.230  1.00 48.46  ?  34  VAL A HG13 1 
ATOM   529   H  HG21 . VAL A  1 34  ? -41.313 3.476   -7.255  1.00 45.66  ?  34  VAL A HG21 1 
ATOM   530   H  HG22 . VAL A  1 34  ? -42.870 3.600   -6.964  1.00 45.66  ?  34  VAL A HG22 1 
ATOM   531   H  HG23 . VAL A  1 34  ? -42.302 2.322   -7.717  1.00 45.66  ?  34  VAL A HG23 1 
ATOM   532   N  N    . SER A  1 35  ? -43.645 4.187   -11.928 1.00 37.85  ?  35  SER A N    1 
ATOM   533   C  CA   . SER A  1 35  ? -43.646 5.072   -13.098 1.00 38.73  ?  35  SER A CA   1 
ATOM   534   C  C    . SER A  1 35  ? -44.733 4.771   -14.114 1.00 42.37  ?  35  SER A C    1 
ATOM   535   O  O    . SER A  1 35  ? -45.159 5.690   -14.825 1.00 48.69  ?  35  SER A O    1 
ATOM   536   C  CB   . SER A  1 35  ? -42.297 5.009   -13.820 1.00 41.87  ?  35  SER A CB   1 
ATOM   537   O  OG   . SER A  1 35  ? -41.260 5.501   -12.992 1.00 50.10  ?  35  SER A OG   1 
ATOM   538   H  H    . SER A  1 35  ? -43.326 3.404   -12.084 1.00 45.42  ?  35  SER A H    1 
ATOM   539   H  HA   . SER A  1 35  ? -43.775 5.984   -12.794 1.00 46.48  ?  35  SER A HA   1 
ATOM   540   H  HB2  . SER A  1 35  ? -42.105 4.087   -14.051 1.00 50.24  ?  35  SER A HB2  1 
ATOM   541   H  HB3  . SER A  1 35  ? -42.343 5.550   -14.624 1.00 50.24  ?  35  SER A HB3  1 
ATOM   542   H  HG   . SER A  1 35  ? -40.526 5.462   -13.398 1.00 60.12  ?  35  SER A HG   1 
ATOM   543   N  N    . ASP A  1 36  ? -45.177 3.521   -14.242 1.00 30.90  ?  36  ASP A N    1 
ATOM   544   C  CA   . ASP A  1 36  ? -46.202 3.201   -15.231 1.00 31.32  ?  36  ASP A CA   1 
ATOM   545   C  C    . ASP A  1 36  ? -47.122 2.090   -14.726 1.00 35.06  ?  36  ASP A C    1 
ATOM   546   O  O    . ASP A  1 36  ? -47.240 1.026   -15.353 1.00 30.08  ?  36  ASP A O    1 
ATOM   547   C  CB   . ASP A  1 36  ? -45.550 2.801   -16.559 1.00 39.47  ?  36  ASP A CB   1 
ATOM   548   C  CG   . ASP A  1 36  ? -46.483 2.976   -17.761 1.00 49.37  ?  36  ASP A CG   1 
ATOM   549   O  OD1  . ASP A  1 36  ? -47.587 3.549   -17.614 1.00 45.53  ?  36  ASP A OD1  1 
ATOM   550   O  OD2  . ASP A  1 36  ? -46.104 2.526   -18.867 1.00 48.50  -1 36  ASP A OD2  1 
ATOM   551   H  H    . ASP A  1 36  ? -44.905 2.852   -13.776 1.00 37.08  ?  36  ASP A H    1 
ATOM   552   H  HA   . ASP A  1 36  ? -46.745 3.989   -15.389 1.00 37.58  ?  36  ASP A HA   1 
ATOM   553   H  HB2  . ASP A  1 36  ? -44.767 3.355   -16.705 1.00 47.37  ?  36  ASP A HB2  1 
ATOM   554   H  HB3  . ASP A  1 36  ? -45.291 1.867   -16.515 1.00 47.37  ?  36  ASP A HB3  1 
ATOM   555   N  N    . PRO A  1 37  ? -47.841 2.316   -13.626 1.00 34.39  ?  37  PRO A N    1 
ATOM   556   C  CA   . PRO A  1 37  ? -48.551 1.196   -12.982 1.00 34.21  ?  37  PRO A CA   1 
ATOM   557   C  C    . PRO A  1 37  ? -49.676 0.612   -13.805 1.00 35.67  ?  37  PRO A C    1 
ATOM   558   O  O    . PRO A  1 37  ? -50.115 -0.507  -13.517 1.00 29.96  ?  37  PRO A O    1 
ATOM   559   C  CB   . PRO A  1 37  ? -49.101 1.805   -11.691 1.00 38.18  ?  37  PRO A CB   1 
ATOM   560   C  CG   . PRO A  1 37  ? -48.674 3.212   -11.660 1.00 43.31  ?  37  PRO A CG   1 
ATOM   561   C  CD   . PRO A  1 37  ? -48.069 3.600   -12.952 1.00 36.84  ?  37  PRO A CD   1 
ATOM   562   H  HA   . PRO A  1 37  ? -47.924 0.490   -12.757 1.00 41.05  ?  37  PRO A HA   1 
ATOM   563   H  HB2  . PRO A  1 37  ? -50.070 1.747   -11.695 1.00 45.82  ?  37  PRO A HB2  1 
ATOM   564   H  HB3  . PRO A  1 37  ? -48.738 1.326   -10.929 1.00 45.82  ?  37  PRO A HB3  1 
ATOM   565   H  HG2  . PRO A  1 37  ? -49.449 3.768   -11.483 1.00 51.98  ?  37  PRO A HG2  1 
ATOM   566   H  HG3  . PRO A  1 37  ? -48.024 3.323   -10.949 1.00 51.98  ?  37  PRO A HG3  1 
ATOM   567   H  HD2  . PRO A  1 37  ? -48.687 4.145   -13.464 1.00 44.21  ?  37  PRO A HD2  1 
ATOM   568   H  HD3  . PRO A  1 37  ? -47.227 4.059   -12.806 1.00 44.21  ?  37  PRO A HD3  1 
ATOM   569   N  N    . ASN A  1 38  ? -50.183 1.319   -14.812 1.00 37.10  ?  38  ASN A N    1 
ATOM   570   C  CA   . ASN A  1 38  ? -51.243 0.722   -15.610 1.00 43.18  ?  38  ASN A CA   1 
ATOM   571   C  C    . ASN A  1 38  ? -50.757 -0.482  -16.403 1.00 36.84  ?  38  ASN A C    1 
ATOM   572   O  O    . ASN A  1 38  ? -51.584 -1.260  -16.889 1.00 40.73  ?  38  ASN A O    1 
ATOM   573   C  CB   . ASN A  1 38  ? -51.847 1.771   -16.553 1.00 51.41  ?  38  ASN A CB   1 
ATOM   574   C  CG   . ASN A  1 38  ? -52.863 2.665   -15.855 1.00 67.18  ?  38  ASN A CG   1 
ATOM   575   O  OD1  . ASN A  1 38  ? -53.724 2.180   -15.115 1.00 74.56  ?  38  ASN A OD1  1 
ATOM   576   N  ND2  . ASN A  1 38  ? -52.764 3.975   -16.081 1.00 72.29  ?  38  ASN A ND2  1 
ATOM   577   H  H    . ASN A  1 38  ? -49.943 2.111   -15.045 1.00 44.53  ?  38  ASN A H    1 
ATOM   578   H  HA   . ASN A  1 38  ? -51.947 0.419   -15.015 1.00 51.82  ?  38  ASN A HA   1 
ATOM   579   H  HB2  . ASN A  1 38  ? -51.137 2.335   -16.896 1.00 61.70  ?  38  ASN A HB2  1 
ATOM   580   H  HB3  . ASN A  1 38  ? -52.296 1.319   -17.284 1.00 61.70  ?  38  ASN A HB3  1 
ATOM   581   H  HD21 . ASN A  1 38  ? -52.148 4.277   -16.600 1.00 86.74  ?  38  ASN A HD21 1 
ATOM   582   H  HD22 . ASN A  1 38  ? -53.316 4.519   -15.708 1.00 86.74  ?  38  ASN A HD22 1 
ATOM   583   N  N    . LYS A  1 39  ? -49.442 -0.660  -16.517 1.00 35.16  ?  39  LYS A N    1 
ATOM   584   C  CA   . LYS A  1 39  ? -48.847 -1.812  -17.177 1.00 40.65  ?  39  LYS A CA   1 
ATOM   585   C  C    . LYS A  1 39  ? -48.469 -2.921  -16.209 1.00 38.54  ?  39  LYS A C    1 
ATOM   586   O  O    . LYS A  1 39  ? -48.024 -3.987  -16.651 1.00 34.94  ?  39  LYS A O    1 
ATOM   587   C  CB   . LYS A  1 39  ? -47.583 -1.395  -17.932 1.00 35.96  ?  39  LYS A CB   1 
ATOM   588   C  CG   . LYS A  1 39  ? -47.727 -0.166  -18.819 1.00 52.36  ?  39  LYS A CG   1 
ATOM   589   C  CD   . LYS A  1 39  ? -48.842 -0.318  -19.831 1.00 51.97  ?  39  LYS A CD   1 
ATOM   590   C  CE   . LYS A  1 39  ? -48.609 0.586   -21.039 1.00 55.27  ?  39  LYS A CE   1 
ATOM   591   N  NZ   . LYS A  1 39  ? -47.952 1.872   -20.662 1.00 57.34  1  39  LYS A NZ   1 
ATOM   592   H  H    . LYS A  1 39  ? -48.859 -0.107  -16.210 1.00 42.19  ?  39  LYS A H    1 
ATOM   593   H  HA   . LYS A  1 39  ? -49.478 -2.173  -17.820 1.00 48.77  ?  39  LYS A HA   1 
ATOM   594   H  HB2  . LYS A  1 39  ? -46.887 -1.205  -17.283 1.00 43.15  ?  39  LYS A HB2  1 
ATOM   595   H  HB3  . LYS A  1 39  ? -47.306 -2.132  -18.498 1.00 43.15  ?  39  LYS A HB3  1 
ATOM   596   H  HG2  . LYS A  1 39  ? -47.926 0.604   -18.265 1.00 62.83  ?  39  LYS A HG2  1 
ATOM   597   H  HG3  . LYS A  1 39  ? -46.898 -0.025  -19.303 1.00 62.83  ?  39  LYS A HG3  1 
ATOM   598   H  HD2  . LYS A  1 39  ? -48.875 -1.237  -20.139 1.00 62.36  ?  39  LYS A HD2  1 
ATOM   599   H  HD3  . LYS A  1 39  ? -49.685 -0.068  -19.421 1.00 62.36  ?  39  LYS A HD3  1 
ATOM   600   H  HE2  . LYS A  1 39  ? -48.035 0.128   -21.673 1.00 66.33  ?  39  LYS A HE2  1 
ATOM   601   H  HE3  . LYS A  1 39  ? -49.463 0.793   -21.451 1.00 66.33  ?  39  LYS A HE3  1 
ATOM   602   H  HZ1  . LYS A  1 39  ? -47.162 1.710   -20.285 1.00 68.81  ?  39  LYS A HZ1  1 
ATOM   603   H  HZ2  . LYS A  1 39  ? -47.830 2.375   -21.386 1.00 68.81  ?  39  LYS A HZ2  1 
ATOM   604   H  HZ3  . LYS A  1 39  ? -48.463 2.316   -20.083 1.00 68.81  ?  39  LYS A HZ3  1 
ATOM   605   N  N    . ALA A  1 40  ? -48.596 -2.689  -14.911 1.00 30.17  ?  40  ALA A N    1 
ATOM   606   C  CA   . ALA A  1 40  ? -48.165 -3.666  -13.929 1.00 29.79  ?  40  ALA A CA   1 
ATOM   607   C  C    . ALA A  1 40  ? -49.250 -4.693  -13.647 1.00 28.32  ?  40  ALA A C    1 
ATOM   608   O  O    . ALA A  1 40  ? -50.435 -4.483  -13.891 1.00 27.52  ?  40  ALA A O    1 
ATOM   609   C  CB   . ALA A  1 40  ? -47.775 -2.966  -12.635 1.00 33.59  ?  40  ALA A CB   1 
ATOM   610   H  H    . ALA A  1 40  ? -48.928 -1.971  -14.573 1.00 36.20  ?  40  ALA A H    1 
ATOM   611   H  HA   . ALA A  1 40  ? -47.385 -4.134  -14.267 1.00 35.75  ?  40  ALA A HA   1 
ATOM   612   H  HB1  . ALA A  1 40  ? -47.490 -3.632  -11.990 1.00 40.31  ?  40  ALA A HB1  1 
ATOM   613   H  HB2  . ALA A  1 40  ? -47.049 -2.348  -12.816 1.00 40.31  ?  40  ALA A HB2  1 
ATOM   614   H  HB3  . ALA A  1 40  ? -48.544 -2.483  -12.294 1.00 40.31  ?  40  ALA A HB3  1 
ATOM   615   N  N    . ASN A  1 41  ? -48.819 -5.815  -13.082 1.00 26.04  ?  41  ASN A N    1 
ATOM   616   C  CA   . ASN A  1 41  ? -49.736 -6.843  -12.610 1.00 22.81  ?  41  ASN A CA   1 
ATOM   617   C  C    . ASN A  1 41  ? -50.799 -6.251  -11.673 1.00 27.42  ?  41  ASN A C    1 
ATOM   618   O  O    . ASN A  1 41  ? -50.484 -5.455  -10.783 1.00 23.47  ?  41  ASN A O    1 
ATOM   619   C  CB   . ASN A  1 41  ? -48.904 -7.899  -11.893 1.00 26.09  ?  41  ASN A CB   1 
ATOM   620   C  CG   . ASN A  1 41  ? -49.748 -8.956  -11.292 1.00 26.83  ?  41  ASN A CG   1 
ATOM   621   O  OD1  . ASN A  1 41  ? -50.274 -8.780  -10.195 1.00 26.48  ?  41  ASN A OD1  1 
ATOM   622   N  ND2  . ASN A  1 41  ? -49.928 -10.051 -12.010 1.00 29.05  ?  41  ASN A ND2  1 
ATOM   623   H  H    . ASN A  1 41  ? -47.990 -6.005  -12.958 1.00 31.25  ?  41  ASN A H    1 
ATOM   624   H  HA   . ASN A  1 41  ? -50.181 -7.257  -13.366 1.00 27.37  ?  41  ASN A HA   1 
ATOM   625   H  HB2  . ASN A  1 41  ? -48.304 -8.318  -12.529 1.00 31.31  ?  41  ASN A HB2  1 
ATOM   626   H  HB3  . ASN A  1 41  ? -48.397 -7.477  -11.182 1.00 31.31  ?  41  ASN A HB3  1 
ATOM   627   H  HD21 . ASN A  1 41  ? -50.411 -10.692 -11.702 1.00 34.86  ?  41  ASN A HD21 1 
ATOM   628   H  HD22 . ASN A  1 41  ? -49.562 -10.122 -12.785 1.00 34.86  ?  41  ASN A HD22 1 
ATOM   629   N  N    . SER A  1 42  ? -52.065 -6.656  -11.865 1.00 27.67  ?  42  SER A N    1 
ATOM   630   C  CA   A SER A  1 42  ? -53.168 -5.979  -11.180 0.54 24.45  ?  42  SER A CA   1 
ATOM   631   C  CA   B SER A  1 42  ? -53.185 -5.998  -11.186 0.46 24.74  ?  42  SER A CA   1 
ATOM   632   C  C    . SER A  1 42  ? -53.166 -6.231  -9.675  1.00 25.21  ?  42  SER A C    1 
ATOM   633   O  O    . SER A  1 42  ? -53.537 -5.338  -8.900  1.00 25.29  ?  42  SER A O    1 
ATOM   634   C  CB   A SER A  1 42  ? -54.508 -6.406  -11.785 0.54 29.53  ?  42  SER A CB   1 
ATOM   635   C  CB   B SER A  1 42  ? -54.514 -6.482  -11.775 0.46 29.50  ?  42  SER A CB   1 
ATOM   636   O  OG   A SER A  1 42  ? -54.723 -5.742  -13.017 0.54 35.28  ?  42  SER A OG   1 
ATOM   637   O  OG   B SER A  1 42  ? -54.759 -7.842  -11.451 0.46 30.47  ?  42  SER A OG   1 
ATOM   638   H  H    A SER A  1 42  ? -52.304 -7.306  -12.376 0.54 33.20  ?  42  SER A H    1 
ATOM   639   H  H    B SER A  1 42  ? -52.297 -7.305  -12.380 0.46 33.20  ?  42  SER A H    1 
ATOM   640   H  HA   A SER A  1 42  ? -53.075 -5.024  -11.317 0.54 29.34  ?  42  SER A HA   1 
ATOM   641   H  HA   B SER A  1 42  ? -53.124 -5.042  -11.338 0.46 29.69  ?  42  SER A HA   1 
ATOM   642   H  HB2  A SER A  1 42  ? -54.496 -7.364  -11.938 0.54 35.44  ?  42  SER A HB2  1 
ATOM   643   H  HB2  B SER A  1 42  ? -55.233 -5.939  -11.416 0.46 35.40  ?  42  SER A HB2  1 
ATOM   644   H  HB3  A SER A  1 42  ? -55.221 -6.174  -11.171 0.54 35.44  ?  42  SER A HB3  1 
ATOM   645   H  HB3  B SER A  1 42  ? -54.482 -6.391  -12.740 0.46 35.40  ?  42  SER A HB3  1 
ATOM   646   H  HG   A SER A  1 42  ? -54.109 -5.933  -13.558 0.54 42.34  ?  42  SER A HG   1 
ATOM   647   H  HG   B SER A  1 42  ? -55.491 -8.089  -11.782 0.46 36.56  ?  42  SER A HG   1 
ATOM   648   N  N    . PHE A  1 43  ? -52.762 -7.426  -9.240  1.00 23.93  ?  43  PHE A N    1 
ATOM   649   C  CA   . PHE A  1 43  ? -52.691 -7.745  -7.815  1.00 24.05  ?  43  PHE A CA   1 
ATOM   650   C  C    . PHE A  1 43  ? -51.616 -6.892  -7.161  1.00 21.91  ?  43  PHE A C    1 
ATOM   651   O  O    . PHE A  1 43  ? -51.864 -6.202  -6.163  1.00 21.26  ?  43  PHE A O    1 
ATOM   652   C  CB   . PHE A  1 43  ? -52.425 -9.261  -7.693  1.00 21.48  ?  43  PHE A CB   1 
ATOM   653   C  CG   . PHE A  1 43  ? -52.314 -9.823  -6.295  1.00 22.65  ?  43  PHE A CG   1 
ATOM   654   C  CD1  . PHE A  1 43  ? -52.710 -9.140  -5.137  1.00 25.11  ?  43  PHE A CD1  1 
ATOM   655   C  CD2  . PHE A  1 43  ? -51.809 -11.098 -6.149  1.00 21.77  ?  43  PHE A CD2  1 
ATOM   656   C  CE1  . PHE A  1 43  ? -52.584 -9.751  -3.877  1.00 23.64  ?  43  PHE A CE1  1 
ATOM   657   C  CE2  . PHE A  1 43  ? -51.690 -11.707 -4.894  1.00 23.54  ?  43  PHE A CE2  1 
ATOM   658   C  CZ   . PHE A  1 43  ? -52.060 -11.028 -3.762  1.00 21.59  ?  43  PHE A CZ   1 
ATOM   659   H  H    . PHE A  1 43  ? -52.523 -8.073  -9.754  1.00 28.72  ?  43  PHE A H    1 
ATOM   660   H  HA   . PHE A  1 43  ? -53.542 -7.545  -7.394  1.00 28.86  ?  43  PHE A HA   1 
ATOM   661   H  HB2  . PHE A  1 43  ? -53.150 -9.731  -8.134  1.00 25.78  ?  43  PHE A HB2  1 
ATOM   662   H  HB3  . PHE A  1 43  ? -51.592 -9.459  -8.149  1.00 25.78  ?  43  PHE A HB3  1 
ATOM   663   H  HD1  . PHE A  1 43  ? -53.057 -8.280  -5.203  1.00 30.13  ?  43  PHE A HD1  1 
ATOM   664   H  HD2  . PHE A  1 43  ? -51.547 -11.570 -6.907  1.00 26.12  ?  43  PHE A HD2  1 
ATOM   665   H  HE1  . PHE A  1 43  ? -52.842 -9.288  -3.112  1.00 28.37  ?  43  PHE A HE1  1 
ATOM   666   H  HE2  . PHE A  1 43  ? -51.337 -12.565 -4.826  1.00 28.25  ?  43  PHE A HE2  1 
ATOM   667   H  HZ   . PHE A  1 43  ? -51.981 -11.429 -2.927  1.00 25.90  ?  43  PHE A HZ   1 
ATOM   668   N  N    . ALA A  1 44  ? -50.449 -6.825  -7.791  1.00 21.10  ?  44  ALA A N    1 
ATOM   669   C  CA   . ALA A  1 44  ? -49.382 -5.986  -7.256  1.00 20.94  ?  44  ALA A CA   1 
ATOM   670   C  C    . ALA A  1 44  ? -49.772 -4.517  -7.256  1.00 21.63  ?  44  ALA A C    1 
ATOM   671   O  O    . ALA A  1 44  ? -49.524 -3.808  -6.281  1.00 20.39  ?  44  ALA A O    1 
ATOM   672   C  CB   . ALA A  1 44  ? -48.095 -6.196  -8.051  1.00 23.43  ?  44  ALA A CB   1 
ATOM   673   H  H    . ALA A  1 44  ? -50.251 -7.246  -8.515  1.00 25.32  ?  44  ALA A H    1 
ATOM   674   H  HA   . ALA A  1 44  ? -49.210 -6.247  -6.338  1.00 25.12  ?  44  ALA A HA   1 
ATOM   675   H  HB1  . ALA A  1 44  ? -47.399 -5.631  -7.680  1.00 28.11  ?  44  ALA A HB1  1 
ATOM   676   H  HB2  . ALA A  1 44  ? -47.833 -7.128  -7.987  1.00 28.11  ?  44  ALA A HB2  1 
ATOM   677   H  HB3  . ALA A  1 44  ? -48.254 -5.960  -8.978  1.00 28.11  ?  44  ALA A HB3  1 
ATOM   678   N  N    . ALA A  1 45  ? -50.380 -4.030  -8.347  1.00 21.84  ?  45  ALA A N    1 
ATOM   679   C  CA   . ALA A  1 45  ? -50.716 -2.611  -8.426  1.00 25.39  ?  45  ALA A CA   1 
ATOM   680   C  C    . ALA A  1 45  ? -51.712 -2.221  -7.352  1.00 22.48  ?  45  ALA A C    1 
ATOM   681   O  O    . ALA A  1 45  ? -51.606 -1.140  -6.763  1.00 22.64  ?  45  ALA A O    1 
ATOM   682   C  CB   . ALA A  1 45  ? -51.276 -2.284  -9.803  1.00 22.51  ?  45  ALA A CB   1 
ATOM   683   H  H    . ALA A  1 45  ? -50.602 -4.492  -9.037  1.00 26.21  ?  45  ALA A H    1 
ATOM   684   H  HA   . ALA A  1 45  ? -49.911 -2.087  -8.295  1.00 30.47  ?  45  ALA A HA   1 
ATOM   685   H  HB1  . ALA A  1 45  ? -51.494 -1.340  -9.838  1.00 27.01  ?  45  ALA A HB1  1 
ATOM   686   H  HB2  . ALA A  1 45  ? -50.607 -2.495  -10.473 1.00 27.01  ?  45  ALA A HB2  1 
ATOM   687   H  HB3  . ALA A  1 45  ? -52.074 -2.815  -9.953  1.00 27.01  ?  45  ALA A HB3  1 
ATOM   688   N  N    . TYR A  1 46  ? -52.663 -3.101  -7.064  1.00 21.31  ?  46  TYR A N    1 
ATOM   689   C  CA   . TYR A  1 46  ? -53.649 -2.817  -6.030  1.00 21.50  ?  46  TYR A CA   1 
ATOM   690   C  C    . TYR A  1 46  ? -53.010 -2.781  -4.647  1.00 24.75  ?  46  TYR A C    1 
ATOM   691   O  O    . TYR A  1 46  ? -53.241 -1.849  -3.859  1.00 22.24  ?  46  TYR A O    1 
ATOM   692   C  CB   . TYR A  1 46  ? -54.743 -3.878  -6.075  1.00 21.80  ?  46  TYR A CB   1 
ATOM   693   C  CG   . TYR A  1 46  ? -55.896 -3.628  -5.151  1.00 26.12  ?  46  TYR A CG   1 
ATOM   694   C  CD1  . TYR A  1 46  ? -56.740 -2.557  -5.373  1.00 32.13  ?  46  TYR A CD1  1 
ATOM   695   C  CD2  . TYR A  1 46  ? -56.167 -4.478  -4.075  1.00 24.95  ?  46  TYR A CD2  1 
ATOM   696   C  CE1  . TYR A  1 46  ? -57.815 -2.307  -4.552  1.00 36.07  ?  46  TYR A CE1  1 
ATOM   697   C  CE2  . TYR A  1 46  ? -57.253 -4.229  -3.245  1.00 30.12  ?  46  TYR A CE2  1 
ATOM   698   C  CZ   . TYR A  1 46  ? -58.068 -3.141  -3.498  1.00 39.23  ?  46  TYR A CZ   1 
ATOM   699   O  OH   . TYR A  1 46  ? -59.171 -2.873  -2.714  1.00 45.28  ?  46  TYR A OH   1 
ATOM   700   H  H    . TYR A  1 46  ? -52.759 -3.865  -7.448  1.00 25.58  ?  46  TYR A H    1 
ATOM   701   H  HA   . TYR A  1 46  ? -54.054 -1.952  -6.202  1.00 25.80  ?  46  TYR A HA   1 
ATOM   702   H  HB2  . TYR A  1 46  ? -55.095 -3.921  -6.978  1.00 26.16  ?  46  TYR A HB2  1 
ATOM   703   H  HB3  . TYR A  1 46  ? -54.355 -4.733  -5.836  1.00 26.16  ?  46  TYR A HB3  1 
ATOM   704   H  HD1  . TYR A  1 46  ? -56.573 -1.987  -6.089  1.00 38.56  ?  46  TYR A HD1  1 
ATOM   705   H  HD2  . TYR A  1 46  ? -55.615 -5.208  -3.910  1.00 29.94  ?  46  TYR A HD2  1 
ATOM   706   H  HE1  . TYR A  1 46  ? -58.373 -1.582  -4.719  1.00 43.29  ?  46  TYR A HE1  1 
ATOM   707   H  HE2  . TYR A  1 46  ? -57.435 -4.794  -2.529  1.00 36.15  ?  46  TYR A HE2  1 
ATOM   708   H  HH   . TYR A  1 46  ? -59.232 -3.443  -2.100  1.00 54.34  ?  46  TYR A HH   1 
ATOM   709   N  N    . VAL A  1 47  ? -52.230 -3.810  -4.320  1.00 23.55  ?  47  VAL A N    1 
ATOM   710   C  CA   . VAL A  1 47  ? -51.617 -3.898  -2.993  1.00 23.01  ?  47  VAL A CA   1 
ATOM   711   C  C    . VAL A  1 47  ? -50.735 -2.695  -2.727  1.00 24.86  ?  47  VAL A C    1 
ATOM   712   O  O    . VAL A  1 47  ? -50.731 -2.159  -1.611  1.00 23.53  ?  47  VAL A O    1 
ATOM   713   C  CB   . VAL A  1 47  ? -50.818 -5.205  -2.854  1.00 22.77  ?  47  VAL A CB   1 
ATOM   714   C  CG1  . VAL A  1 47  ? -49.864 -5.165  -1.626  1.00 27.12  ?  47  VAL A CG1  1 
ATOM   715   C  CG2  . VAL A  1 47  ? -51.780 -6.359  -2.752  1.00 23.20  ?  47  VAL A CG2  1 
ATOM   716   H  H    . VAL A  1 47  ? -52.040 -4.466  -4.842  1.00 28.26  ?  47  VAL A H    1 
ATOM   717   H  HA   . VAL A  1 47  ? -52.319 -3.905  -2.324  1.00 27.61  ?  47  VAL A HA   1 
ATOM   718   H  HB   . VAL A  1 47  ? -50.279 -5.333  -3.650  1.00 27.32  ?  47  VAL A HB   1 
ATOM   719   H  HG11 . VAL A  1 47  ? -49.381 -6.004  -1.574  1.00 32.55  ?  47  VAL A HG11 1 
ATOM   720   H  HG12 . VAL A  1 47  ? -49.240 -4.430  -1.736  1.00 32.55  ?  47  VAL A HG12 1 
ATOM   721   H  HG13 . VAL A  1 47  ? -50.390 -5.035  -0.822  1.00 32.55  ?  47  VAL A HG13 1 
ATOM   722   H  HG21 . VAL A  1 47  ? -51.275 -7.183  -2.664  1.00 27.84  ?  47  VAL A HG21 1 
ATOM   723   H  HG22 . VAL A  1 47  ? -52.344 -6.232  -1.973  1.00 27.84  ?  47  VAL A HG22 1 
ATOM   724   H  HG23 . VAL A  1 47  ? -52.324 -6.388  -3.554  1.00 27.84  ?  47  VAL A HG23 1 
ATOM   725   N  N    . PHE A  1 48  ? -49.951 -2.263  -3.726  1.00 21.78  ?  48  PHE A N    1 
ATOM   726   C  CA   . PHE A  1 48  ? -49.004 -1.181  -3.529  1.00 21.69  ?  48  PHE A CA   1 
ATOM   727   C  C    . PHE A  1 48  ? -49.602 0.199   -3.769  1.00 22.05  ?  48  PHE A C    1 
ATOM   728   O  O    . PHE A  1 48  ? -48.855 1.187   -3.757  1.00 26.59  ?  48  PHE A O    1 
ATOM   729   C  CB   . PHE A  1 48  ? -47.756 -1.433  -4.370  1.00 21.34  ?  48  PHE A CB   1 
ATOM   730   C  CG   . PHE A  1 48  ? -46.874 -2.491  -3.766  1.00 22.79  ?  48  PHE A CG   1 
ATOM   731   C  CD1  . PHE A  1 48  ? -45.907 -2.152  -2.818  1.00 23.07  ?  48  PHE A CD1  1 
ATOM   732   C  CD2  . PHE A  1 48  ? -47.052 -3.834  -4.075  1.00 24.77  ?  48  PHE A CD2  1 
ATOM   733   C  CE1  . PHE A  1 48  ? -45.136 -3.127  -2.233  1.00 21.78  ?  48  PHE A CE1  1 
ATOM   734   C  CE2  . PHE A  1 48  ? -46.275 -4.802  -3.502  1.00 25.45  ?  48  PHE A CE2  1 
ATOM   735   C  CZ   . PHE A  1 48  ? -45.316 -4.457  -2.579  1.00 23.42  ?  48  PHE A CZ   1 
ATOM   736   H  H    . PHE A  1 48  ? -49.957 -2.586  -4.523  1.00 26.14  ?  48  PHE A H    1 
ATOM   737   H  HA   . PHE A  1 48  ? -48.723 -1.203  -2.601  1.00 26.03  ?  48  PHE A HA   1 
ATOM   738   H  HB2  . PHE A  1 48  ? -48.023 -1.730  -5.255  1.00 25.61  ?  48  PHE A HB2  1 
ATOM   739   H  HB3  . PHE A  1 48  ? -47.244 -0.612  -4.434  1.00 25.61  ?  48  PHE A HB3  1 
ATOM   740   H  HD1  . PHE A  1 48  ? -45.784 -1.261  -2.582  1.00 27.69  ?  48  PHE A HD1  1 
ATOM   741   H  HD2  . PHE A  1 48  ? -47.699 -4.078  -4.697  1.00 29.72  ?  48  PHE A HD2  1 
ATOM   742   H  HE1  . PHE A  1 48  ? -44.482 -2.893  -1.614  1.00 26.13  ?  48  PHE A HE1  1 
ATOM   743   H  HE2  . PHE A  1 48  ? -46.399 -5.694  -3.731  1.00 30.54  ?  48  PHE A HE2  1 
ATOM   744   H  HZ   . PHE A  1 48  ? -44.787 -5.115  -2.190  1.00 28.11  ?  48  PHE A HZ   1 
ATOM   745   N  N    . GLY A  1 49  ? -50.921 0.288   -3.903  1.00 21.96  ?  49  GLY A N    1 
ATOM   746   C  CA   . GLY A  1 49  ? -51.601 1.566   -3.939  1.00 27.37  ?  49  GLY A CA   1 
ATOM   747   C  C    . GLY A  1 49  ? -51.530 2.289   -5.258  1.00 32.49  ?  49  GLY A C    1 
ATOM   748   O  O    . GLY A  1 49  ? -51.924 3.464   -5.330  1.00 30.98  ?  49  GLY A O    1 
ATOM   749   H  H    . GLY A  1 49  ? -51.447 -0.389  -3.975  1.00 26.35  ?  49  GLY A H    1 
ATOM   750   H  HA2  . GLY A  1 49  ? -52.537 1.431   -3.723  1.00 32.84  ?  49  GLY A HA2  1 
ATOM   751   H  HA3  . GLY A  1 49  ? -51.218 2.145   -3.261  1.00 32.84  ?  49  GLY A HA3  1 
ATOM   752   N  N    . ALA A  1 50  ? -51.047 1.627   -6.301  1.00 26.15  ?  50  ALA A N    1 
ATOM   753   C  CA   . ALA A  1 50  ? -50.895 2.285   -7.593  1.00 29.22  ?  50  ALA A CA   1 
ATOM   754   C  C    . ALA A  1 50  ? -52.177 2.270   -8.396  1.00 35.02  ?  50  ALA A C    1 
ATOM   755   O  O    . ALA A  1 50  ? -52.326 3.068   -9.331  1.00 38.52  ?  50  ALA A O    1 
ATOM   756   C  CB   . ALA A  1 50  ? -49.791 1.615   -8.400  1.00 35.18  ?  50  ALA A CB   1 
ATOM   757   H  H    . ALA A  1 50  ? -50.801 0.802   -6.290  1.00 31.38  ?  50  ALA A H    1 
ATOM   758   H  HA   . ALA A  1 50  ? -50.642 3.211   -7.448  1.00 35.07  ?  50  ALA A HA   1 
ATOM   759   H  HB1  . ALA A  1 50  ? -49.706 2.067   -9.254  1.00 42.22  ?  50  ALA A HB1  1 
ATOM   760   H  HB2  . ALA A  1 50  ? -48.958 1.678   -7.907  1.00 42.22  ?  50  ALA A HB2  1 
ATOM   761   H  HB3  . ALA A  1 50  ? -50.024 0.684   -8.539  1.00 42.22  ?  50  ALA A HB3  1 
ATOM   762   N  N    . SER A  1 51  ? -53.103 1.387   -8.052  1.00 25.52  ?  51  SER A N    1 
ATOM   763   C  CA   . SER A  1 51  ? -54.391 1.317   -8.709  1.00 27.11  ?  51  SER A CA   1 
ATOM   764   C  C    . SER A  1 51  ? -55.469 0.984   -7.691  1.00 37.01  ?  51  SER A C    1 
ATOM   765   O  O    . SER A  1 51  ? -55.215 0.318   -6.686  1.00 32.47  ?  51  SER A O    1 
ATOM   766   C  CB   . SER A  1 51  ? -54.403 0.263   -9.806  1.00 32.29  ?  51  SER A CB   1 
ATOM   767   O  OG   . SER A  1 51  ? -55.688 0.229   -10.405 1.00 37.58  ?  51  SER A OG   1 
ATOM   768   H  H    . SER A  1 51  ? -53.003 0.806   -7.426  1.00 30.62  ?  51  SER A H    1 
ATOM   769   H  HA   . SER A  1 51  ? -54.599 2.177   -9.106  1.00 32.53  ?  51  SER A HA   1 
ATOM   770   H  HB2  . SER A  1 51  ? -53.741 0.491   -10.478 1.00 38.75  ?  51  SER A HB2  1 
ATOM   771   H  HB3  . SER A  1 51  ? -54.206 -0.605  -9.420  1.00 38.75  ?  51  SER A HB3  1 
ATOM   772   H  HG   . SER A  1 51  ? -55.707 -0.350  -11.013 1.00 45.10  ?  51  SER A HG   1 
ATOM   773   N  N    . ASP A  1 52  ? -56.676 1.463   -7.966  1.00 38.87  ?  52  ASP A N    1 
ATOM   774   C  CA   . ASP A  1 52  ? -57.842 1.140   -7.162  1.00 41.42  ?  52  ASP A CA   1 
ATOM   775   C  C    . ASP A  1 52  ? -58.615 -0.045  -7.722  1.00 38.14  ?  52  ASP A C    1 
ATOM   776   O  O    . ASP A  1 52  ? -59.589 -0.482  -7.100  1.00 40.88  ?  52  ASP A O    1 
ATOM   777   C  CB   . ASP A  1 52  ? -58.762 2.370   -7.060  1.00 56.14  ?  52  ASP A CB   1 
ATOM   778   C  CG   . ASP A  1 52  ? -59.176 2.911   -8.424  1.00 68.89  ?  52  ASP A CG   1 
ATOM   779   O  OD1  . ASP A  1 52  ? -58.444 2.669   -9.411  1.00 63.94  ?  52  ASP A OD1  1 
ATOM   780   O  OD2  . ASP A  1 52  ? -60.230 3.587   -8.507  1.00 78.45  -1 52  ASP A OD2  1 
ATOM   781   H  H    . ASP A  1 52  ? -56.846 1.986   -8.626  1.00 46.64  ?  52  ASP A H    1 
ATOM   782   H  HA   . ASP A  1 52  ? -57.551 0.909   -6.266  1.00 49.71  ?  52  ASP A HA   1 
ATOM   783   H  HB2  . ASP A  1 52  ? -59.566 2.123   -6.578  1.00 67.37  ?  52  ASP A HB2  1 
ATOM   784   H  HB3  . ASP A  1 52  ? -58.294 3.075   -6.586  1.00 67.37  ?  52  ASP A HB3  1 
ATOM   785   N  N    . LYS A  1 53  ? -58.202 -0.572  -8.873  1.00 39.95  ?  53  LYS A N    1 
ATOM   786   C  CA   . LYS A  1 53  ? -58.873 -1.725  -9.461  1.00 41.44  ?  53  LYS A CA   1 
ATOM   787   C  C    . LYS A  1 53  ? -58.510 -2.994  -8.694  1.00 42.86  ?  53  LYS A C    1 
ATOM   788   O  O    . LYS A  1 53  ? -57.329 -3.332  -8.546  1.00 31.48  ?  53  LYS A O    1 
ATOM   789   C  CB   . LYS A  1 53  ? -58.493 -1.857  -10.930 1.00 38.17  ?  53  LYS A CB   1 
ATOM   790   C  CG   . LYS A  1 53  ? -59.337 -2.887  -11.661 1.00 57.84  ?  53  LYS A CG   1 
ATOM   791   C  CD   . LYS A  1 53  ? -59.276 -2.701  -13.172 1.00 75.81  ?  53  LYS A CD   1 
ATOM   792   C  CE   . LYS A  1 53  ? -58.938 -4.008  -13.891 1.00 82.23  ?  53  LYS A CE   1 
ATOM   793   N  NZ   . LYS A  1 53  ? -57.509 -4.426  -13.705 1.00 67.31  1  53  LYS A NZ   1 
ATOM   794   H  H    . LYS A  1 53  ? -57.537 -0.279  -9.333  1.00 47.94  ?  53  LYS A H    1 
ATOM   795   H  HA   . LYS A  1 53  ? -59.833 -1.600  -9.405  1.00 49.73  ?  53  LYS A HA   1 
ATOM   796   H  HB2  . LYS A  1 53  ? -58.618 -1.000  -11.368 1.00 45.80  ?  53  LYS A HB2  1 
ATOM   797   H  HB3  . LYS A  1 53  ? -57.564 -2.130  -10.994 1.00 45.80  ?  53  LYS A HB3  1 
ATOM   798   H  HG2  . LYS A  1 53  ? -59.009 -3.775  -11.451 1.00 69.41  ?  53  LYS A HG2  1 
ATOM   799   H  HG3  . LYS A  1 53  ? -60.262 -2.797  -11.381 1.00 69.41  ?  53  LYS A HG3  1 
ATOM   800   H  HD2  . LYS A  1 53  ? -60.139 -2.394  -13.491 1.00 90.97  ?  53  LYS A HD2  1 
ATOM   801   H  HD3  . LYS A  1 53  ? -58.589 -2.050  -13.386 1.00 90.97  ?  53  LYS A HD3  1 
ATOM   802   H  HE2  . LYS A  1 53  ? -59.503 -4.715  -13.542 1.00 98.68  ?  53  LYS A HE2  1 
ATOM   803   H  HE3  . LYS A  1 53  ? -59.095 -3.895  -14.841 1.00 98.68  ?  53  LYS A HE3  1 
ATOM   804   H  HZ1  . LYS A  1 53  ? -57.357 -5.188  -14.139 1.00 80.78  ?  53  LYS A HZ1  1 
ATOM   805   H  HZ2  . LYS A  1 53  ? -56.965 -3.798  -14.025 1.00 80.78  ?  53  LYS A HZ2  1 
ATOM   806   H  HZ3  . LYS A  1 53  ? -57.337 -4.545  -12.840 1.00 80.78  ?  53  LYS A HZ3  1 
ATOM   807   N  N    . LYS A  1 54  ? -59.527 -3.701  -8.223  1.00 47.45  ?  54  LYS A N    1 
ATOM   808   C  CA   . LYS A  1 54  ? -59.333 -4.913  -7.441  1.00 45.99  ?  54  LYS A CA   1 
ATOM   809   C  C    . LYS A  1 54  ? -58.900 -6.062  -8.355  1.00 33.99  ?  54  LYS A C    1 
ATOM   810   O  O    . LYS A  1 54  ? -59.412 -6.190  -9.469  1.00 36.65  ?  54  LYS A O    1 
ATOM   811   C  CB   . LYS A  1 54  ? -60.625 -5.299  -6.716  1.00 52.00  ?  54  LYS A CB   1 
ATOM   812   C  CG   . LYS A  1 54  ? -61.340 -4.155  -5.975  1.00 60.01  ?  54  LYS A CG   1 
ATOM   813   C  CD   . LYS A  1 54  ? -62.187 -3.293  -6.916  1.00 67.64  ?  54  LYS A CD   1 
ATOM   814   C  CE   . LYS A  1 54  ? -63.524 -2.910  -6.289  1.00 80.42  ?  54  LYS A CE   1 
ATOM   815   N  NZ   . LYS A  1 54  ? -64.400 -2.204  -7.269  1.00 78.20  1  54  LYS A NZ   1 
ATOM   816   H  H    . LYS A  1 54  ? -60.354 -3.496  -8.345  1.00 56.93  ?  54  LYS A H    1 
ATOM   817   H  HA   . LYS A  1 54  ? -58.640 -4.765  -6.779  1.00 55.19  ?  54  LYS A HA   1 
ATOM   818   H  HB2  . LYS A  1 54  ? -61.247 -5.656  -7.369  1.00 62.40  ?  54  LYS A HB2  1 
ATOM   819   H  HB3  . LYS A  1 54  ? -60.415 -5.983  -6.061  1.00 62.40  ?  54  LYS A HB3  1 
ATOM   820   H  HG2  . LYS A  1 54  ? -61.926 -4.531  -5.300  1.00 72.01  ?  54  LYS A HG2  1 
ATOM   821   H  HG3  . LYS A  1 54  ? -60.676 -3.583  -5.558  1.00 72.01  ?  54  LYS A HG3  1 
ATOM   822   H  HD2  . LYS A  1 54  ? -61.705 -2.477  -7.122  1.00 81.17  ?  54  LYS A HD2  1 
ATOM   823   H  HD3  . LYS A  1 54  ? -62.366 -3.791  -7.729  1.00 81.17  ?  54  LYS A HD3  1 
ATOM   824   H  HE2  . LYS A  1 54  ? -63.982 -3.713  -5.995  1.00 96.50  ?  54  LYS A HE2  1 
ATOM   825   H  HE3  . LYS A  1 54  ? -63.367 -2.317  -5.538  1.00 96.50  ?  54  LYS A HE3  1 
ATOM   826   H  HZ1  . LYS A  1 54  ? -65.174 -1.989  -6.884  1.00 93.84  ?  54  LYS A HZ1  1 
ATOM   827   H  HZ2  . LYS A  1 54  ? -64.001 -1.460  -7.552  1.00 93.84  ?  54  LYS A HZ2  1 
ATOM   828   H  HZ3  . LYS A  1 54  ? -64.560 -2.730  -7.968  1.00 93.84  ?  54  LYS A HZ3  1 
ATOM   829   N  N    . PRO A  1 55  ? -57.965 -6.909  -7.923  1.00 34.45  ?  55  PRO A N    1 
ATOM   830   C  CA   . PRO A  1 55  ? -57.571 -8.040  -8.774  1.00 30.44  ?  55  PRO A CA   1 
ATOM   831   C  C    . PRO A  1 55  ? -58.640 -9.120  -8.824  1.00 28.10  ?  55  PRO A C    1 
ATOM   832   O  O    . PRO A  1 55  ? -59.431 -9.318  -7.892  1.00 30.00  ?  55  PRO A O    1 
ATOM   833   C  CB   . PRO A  1 55  ? -56.290 -8.567  -8.117  1.00 35.16  ?  55  PRO A CB   1 
ATOM   834   C  CG   . PRO A  1 55  ? -56.378 -8.106  -6.677  1.00 33.48  ?  55  PRO A CG   1 
ATOM   835   C  CD   . PRO A  1 55  ? -57.131 -6.812  -6.702  1.00 35.25  ?  55  PRO A CD   1 
ATOM   836   H  HA   . PRO A  1 55  ? -57.373 -7.737  -9.673  1.00 36.53  ?  55  PRO A HA   1 
ATOM   837   H  HB2  . PRO A  1 55  ? -56.270 -9.536  -8.167  1.00 42.19  ?  55  PRO A HB2  1 
ATOM   838   H  HB3  . PRO A  1 55  ? -55.514 -8.183  -8.555  1.00 42.19  ?  55  PRO A HB3  1 
ATOM   839   H  HG2  . PRO A  1 55  ? -56.855 -8.768  -6.153  1.00 40.18  ?  55  PRO A HG2  1 
ATOM   840   H  HG3  . PRO A  1 55  ? -55.484 -7.973  -6.325  1.00 40.18  ?  55  PRO A HG3  1 
ATOM   841   H  HD2  . PRO A  1 55  ? -57.693 -6.735  -5.916  1.00 42.30  ?  55  PRO A HD2  1 
ATOM   842   H  HD3  . PRO A  1 55  ? -56.516 -6.065  -6.773  1.00 42.30  ?  55  PRO A HD3  1 
ATOM   843   N  N    . SER A  1 56  ? -58.623 -9.864  -9.919  1.00 28.51  ?  56  SER A N    1 
ATOM   844   C  CA   . SER A  1 56  ? -59.500 -11.013 -10.019 1.00 29.29  ?  56  SER A CA   1 
ATOM   845   C  C    . SER A  1 56  ? -58.951 -12.201 -9.238  1.00 28.67  ?  56  SER A C    1 
ATOM   846   O  O    . SER A  1 56  ? -57.790 -12.232 -8.807  1.00 26.14  ?  56  SER A O    1 
ATOM   847   C  CB   . SER A  1 56  ? -59.683 -11.409 -11.476 1.00 33.18  ?  56  SER A CB   1 
ATOM   848   O  OG   . SER A  1 56  ? -58.458 -11.873 -12.008 1.00 27.55  ?  56  SER A OG   1 
ATOM   849   H  H    . SER A  1 56  ? -58.122 -9.729  -10.605 1.00 34.21  ?  56  SER A H    1 
ATOM   850   H  HA   . SER A  1 56  ? -60.370 -10.784 -9.654  1.00 35.15  ?  56  SER A HA   1 
ATOM   851   H  HB2  . SER A  1 56  ? -60.343 -12.116 -11.533 1.00 39.81  ?  56  SER A HB2  1 
ATOM   852   H  HB3  . SER A  1 56  ? -59.977 -10.635 -11.981 1.00 39.81  ?  56  SER A HB3  1 
ATOM   853   H  HG   . SER A  1 56  ? -58.559 -12.091 -12.813 1.00 33.06  ?  56  SER A HG   1 
ATOM   854   N  N    . VAL A  1 57  ? -59.806 -13.203 -9.061  1.00 26.64  ?  57  VAL A N    1 
ATOM   855   C  CA   . VAL A  1 57  ? -59.372 -14.465 -8.476  1.00 28.08  ?  57  VAL A CA   1 
ATOM   856   C  C    . VAL A  1 57  ? -58.230 -15.043 -9.291  1.00 29.03  ?  57  VAL A C    1 
ATOM   857   O  O    . VAL A  1 57  ? -57.197 -15.464 -8.752  1.00 24.44  ?  57  VAL A O    1 
ATOM   858   C  CB   . VAL A  1 57  ? -60.551 -15.455 -8.388  1.00 36.24  ?  57  VAL A CB   1 
ATOM   859   C  CG1  . VAL A  1 57  ? -60.058 -16.862 -8.010  1.00 37.48  ?  57  VAL A CG1  1 
ATOM   860   C  CG2  . VAL A  1 57  ? -61.572 -14.965 -7.374  1.00 37.24  ?  57  VAL A CG2  1 
ATOM   861   H  H    . VAL A  1 57  ? -60.640 -13.178 -9.270  1.00 31.96  ?  57  VAL A H    1 
ATOM   862   H  HA   . VAL A  1 57  ? -59.048 -14.302 -7.576  1.00 33.70  ?  57  VAL A HA   1 
ATOM   863   H  HB   . VAL A  1 57  ? -60.986 -15.510 -9.253  1.00 43.49  ?  57  VAL A HB   1 
ATOM   864   H  HG11 . VAL A  1 57  ? -60.819 -17.461 -7.963  1.00 44.98  ?  57  VAL A HG11 1 
ATOM   865   H  HG12 . VAL A  1 57  ? -59.435 -17.170 -8.687  1.00 44.98  ?  57  VAL A HG12 1 
ATOM   866   H  HG13 . VAL A  1 57  ? -59.615 -16.820 -7.148  1.00 44.98  ?  57  VAL A HG13 1 
ATOM   867   H  HG21 . VAL A  1 57  ? -62.305 -15.599 -7.333  1.00 44.68  ?  57  VAL A HG21 1 
ATOM   868   H  HG22 . VAL A  1 57  ? -61.146 -14.894 -6.506  1.00 44.68  ?  57  VAL A HG22 1 
ATOM   869   H  HG23 . VAL A  1 57  ? -61.902 -14.096 -7.653  1.00 44.68  ?  57  VAL A HG23 1 
ATOM   870   N  N    . ASP A  1 58  ? -58.393 -15.069 -10.609 1.00 28.72  ?  58  ASP A N    1 
ATOM   871   C  CA   . ASP A  1 58  ? -57.344 -15.624 -11.445 1.00 32.51  ?  58  ASP A CA   1 
ATOM   872   C  C    . ASP A  1 58  ? -56.042 -14.843 -11.296 1.00 26.49  ?  58  ASP A C    1 
ATOM   873   O  O    . ASP A  1 58  ? -54.972 -15.451 -11.208 1.00 26.91  ?  58  ASP A O    1 
ATOM   874   C  CB   . ASP A  1 58  ? -57.785 -15.666 -12.906 1.00 34.43  ?  58  ASP A CB   1 
ATOM   875   C  CG   . ASP A  1 58  ? -56.786 -16.410 -13.768 1.00 34.66  ?  58  ASP A CG   1 
ATOM   876   O  OD1  . ASP A  1 58  ? -56.624 -17.633 -13.540 1.00 35.65  ?  58  ASP A OD1  1 
ATOM   877   O  OD2  . ASP A  1 58  ? -56.137 -15.766 -14.613 1.00 38.26  -1 58  ASP A OD2  1 
ATOM   878   H  H    . ASP A  1 58  ? -59.083 -14.778 -11.032 1.00 34.47  ?  58  ASP A H    1 
ATOM   879   H  HA   . ASP A  1 58  ? -57.173 -16.536 -11.163 1.00 39.01  ?  58  ASP A HA   1 
ATOM   880   H  HB2  . ASP A  1 58  ? -58.639 -16.122 -12.969 1.00 41.31  ?  58  ASP A HB2  1 
ATOM   881   H  HB3  . ASP A  1 58  ? -57.862 -14.760 -13.243 1.00 41.31  ?  58  ASP A HB3  1 
ATOM   882   N  N    . ASP A  1 59  ? -56.106 -13.500 -11.259 1.00 22.10  ?  59  ASP A N    1 
ATOM   883   C  CA   . ASP A  1 59  ? -54.907 -12.684 -11.057 1.00 22.61  ?  59  ASP A CA   1 
ATOM   884   C  C    . ASP A  1 59  ? -54.172 -13.122 -9.797  1.00 23.11  ?  59  ASP A C    1 
ATOM   885   O  O    . ASP A  1 59  ? -52.938 -13.221 -9.775  1.00 23.93  ?  59  ASP A O    1 
ATOM   886   C  CB   . ASP A  1 59  ? -55.252 -11.193 -10.902 1.00 24.19  ?  59  ASP A CB   1 
ATOM   887   C  CG   . ASP A  1 59  ? -55.788 -10.543 -12.163 1.00 37.41  ?  59  ASP A CG   1 
ATOM   888   O  OD1  . ASP A  1 59  ? -55.400 -10.938 -13.285 1.00 33.11  ?  59  ASP A OD1  1 
ATOM   889   O  OD2  . ASP A  1 59  ? -56.583 -9.595  -11.992 1.00 34.78  -1 59  ASP A OD2  1 
ATOM   890   H  H    . ASP A  1 59  ? -56.830 -13.045 -11.350 1.00 26.52  ?  59  ASP A H    1 
ATOM   891   H  HA   . ASP A  1 59  ? -54.311 -12.787 -11.815 1.00 27.13  ?  59  ASP A HA   1 
ATOM   892   H  HB2  . ASP A  1 59  ? -55.928 -11.100 -10.212 1.00 29.03  ?  59  ASP A HB2  1 
ATOM   893   H  HB3  . ASP A  1 59  ? -54.450 -10.713 -10.641 1.00 29.03  ?  59  ASP A HB3  1 
ATOM   894   N  N    . ILE A  1 60  ? -54.925 -13.341 -8.717  1.00 23.17  ?  60  ILE A N    1 
ATOM   895   C  CA   . ILE A  1 60  ? -54.319 -13.750 -7.449  1.00 20.37  ?  60  ILE A CA   1 
ATOM   896   C  C    . ILE A  1 60  ? -53.718 -15.145 -7.570  1.00 19.11  ?  60  ILE A C    1 
ATOM   897   O  O    . ILE A  1 60  ? -52.578 -15.379 -7.166  1.00 18.91  ?  60  ILE A O    1 
ATOM   898   C  CB   . ILE A  1 60  ? -55.368 -13.685 -6.324  1.00 20.78  ?  60  ILE A CB   1 
ATOM   899   C  CG1  . ILE A  1 60  ? -55.740 -12.233 -6.029  1.00 23.13  ?  60  ILE A CG1  1 
ATOM   900   C  CG2  . ILE A  1 60  ? -54.843 -14.365 -5.059  1.00 25.08  ?  60  ILE A CG2  1 
ATOM   901   C  CD1  . ILE A  1 60  ? -57.067 -12.094 -5.298  1.00 27.19  ?  60  ILE A CD1  1 
ATOM   902   H  H    . ILE A  1 60  ? -55.781 -13.261 -8.691  1.00 27.81  ?  60  ILE A H    1 
ATOM   903   H  HA   . ILE A  1 60  ? -53.603 -13.134 -7.227  1.00 24.45  ?  60  ILE A HA   1 
ATOM   904   H  HB   . ILE A  1 60  ? -56.165 -14.154 -6.618  1.00 24.93  ?  60  ILE A HB   1 
ATOM   905   H  HG12 . ILE A  1 60  ? -55.050 -11.838 -5.473  1.00 27.75  ?  60  ILE A HG12 1 
ATOM   906   H  HG13 . ILE A  1 60  ? -55.808 -11.749 -6.867  1.00 27.75  ?  60  ILE A HG13 1 
ATOM   907   H  HG21 . ILE A  1 60  ? -55.521 -14.311 -4.368  1.00 30.09  ?  60  ILE A HG21 1 
ATOM   908   H  HG22 . ILE A  1 60  ? -54.647 -15.294 -5.259  1.00 30.09  ?  60  ILE A HG22 1 
ATOM   909   H  HG23 . ILE A  1 60  ? -54.037 -13.911 -4.769  1.00 30.09  ?  60  ILE A HG23 1 
ATOM   910   H  HD11 . ILE A  1 60  ? -57.244 -11.153 -5.142  1.00 32.63  ?  60  ILE A HD11 1 
ATOM   911   H  HD12 . ILE A  1 60  ? -57.771 -12.477 -5.846  1.00 32.63  ?  60  ILE A HD12 1 
ATOM   912   H  HD13 . ILE A  1 60  ? -57.013 -12.566 -4.452  1.00 32.63  ?  60  ILE A HD13 1 
ATOM   913   N  N    . VAL A  1 61  ? -54.472 -16.086 -8.147  1.00 22.24  ?  61  VAL A N    1 
ATOM   914   C  CA   . VAL A  1 61  ? -54.004 -17.468 -8.272  1.00 19.95  ?  61  VAL A CA   1 
ATOM   915   C  C    . VAL A  1 61  ? -52.741 -17.532 -9.115  1.00 22.46  ?  61  VAL A C    1 
ATOM   916   O  O    . VAL A  1 61  ? -51.817 -18.285 -8.795  1.00 23.98  ?  61  VAL A O    1 
ATOM   917   C  CB   . VAL A  1 61  ? -55.124 -18.355 -8.840  1.00 26.97  ?  61  VAL A CB   1 
ATOM   918   C  CG1  . VAL A  1 61  ? -54.610 -19.743 -9.267  1.00 25.92  ?  61  VAL A CG1  1 
ATOM   919   C  CG2  . VAL A  1 61  ? -56.230 -18.528 -7.800  1.00 28.21  ?  61  VAL A CG2  1 
ATOM   920   H  H    . VAL A  1 61  ? -55.256 -15.949 -8.473  1.00 26.69  ?  61  VAL A H    1 
ATOM   921   H  HA   . VAL A  1 61  ? -53.784 -17.802 -7.388  1.00 23.94  ?  61  VAL A HA   1 
ATOM   922   H  HB   . VAL A  1 61  ? -55.507 -17.923 -9.619  1.00 32.37  ?  61  VAL A HB   1 
ATOM   923   H  HG11 . VAL A  1 61  ? -55.352 -20.261 -9.616  1.00 31.10  ?  61  VAL A HG11 1 
ATOM   924   H  HG12 . VAL A  1 61  ? -53.932 -19.632 -9.951  1.00 31.10  ?  61  VAL A HG12 1 
ATOM   925   H  HG13 . VAL A  1 61  ? -54.230 -20.190 -8.494  1.00 31.10  ?  61  VAL A HG13 1 
ATOM   926   H  HG21 . VAL A  1 61  ? -56.928 -19.089 -8.173  1.00 33.85  ?  61  VAL A HG21 1 
ATOM   927   H  HG22 . VAL A  1 61  ? -55.856 -18.945 -7.009  1.00 33.85  ?  61  VAL A HG22 1 
ATOM   928   H  HG23 . VAL A  1 61  ? -56.591 -17.655 -7.576  1.00 33.85  ?  61  VAL A HG23 1 
ATOM   929   N  N    . GLN A  1 62  ? -52.662 -16.737 -10.190 1.00 23.15  ?  62  GLN A N    1 
ATOM   930   C  CA   . GLN A  1 62  ? -51.469 -16.807 -11.045 1.00 27.69  ?  62  GLN A CA   1 
ATOM   931   C  C    . GLN A  1 62  ? -50.217 -16.283 -10.340 1.00 22.98  ?  62  GLN A C    1 
ATOM   932   O  O    . GLN A  1 62  ? -49.122 -16.807 -10.569 1.00 24.59  ?  62  GLN A O    1 
ATOM   933   C  CB   . GLN A  1 62  ? -51.679 -16.040 -12.349 1.00 28.60  ?  62  GLN A CB   1 
ATOM   934   C  CG   . GLN A  1 62  ? -52.845 -16.542 -13.233 1.00 30.70  ?  62  GLN A CG   1 
ATOM   935   C  CD   . GLN A  1 62  ? -52.853 -18.042 -13.404 1.00 46.63  ?  62  GLN A CD   1 
ATOM   936   O  OE1  . GLN A  1 62  ? -51.808 -18.649 -13.641 1.00 43.95  ?  62  GLN A OE1  1 
ATOM   937   N  NE2  . GLN A  1 62  ? -54.037 -18.658 -13.258 1.00 46.68  ?  62  GLN A NE2  1 
ATOM   938   H  H    . GLN A  1 62  ? -53.259 -16.170 -10.438 1.00 27.78  ?  62  GLN A H    1 
ATOM   939   H  HA   . GLN A  1 62  ? -51.309 -17.736 -11.274 1.00 33.23  ?  62  GLN A HA   1 
ATOM   940   H  HB2  . GLN A  1 62  ? -51.856 -15.111 -12.134 1.00 34.32  ?  62  GLN A HB2  1 
ATOM   941   H  HB3  . GLN A  1 62  ? -50.867 -16.102 -12.876 1.00 34.32  ?  62  GLN A HB3  1 
ATOM   942   H  HG2  . GLN A  1 62  ? -53.685 -16.283 -12.823 1.00 36.84  ?  62  GLN A HG2  1 
ATOM   943   H  HG3  . GLN A  1 62  ? -52.768 -16.141 -14.113 1.00 36.84  ?  62  GLN A HG3  1 
ATOM   944   H  HE21 . GLN A  1 62  ? -54.741 -18.199 -13.077 1.00 56.02  ?  62  GLN A HE21 1 
ATOM   945   H  HE22 . GLN A  1 62  ? -54.091 -19.512 -13.347 1.00 56.02  ?  62  GLN A HE22 1 
ATOM   946   N  N    . ILE A  1 63  ? -50.341 -15.265 -9.482  1.00 18.66  ?  63  ILE A N    1 
ATOM   947   C  CA   . ILE A  1 63  ? -49.204 -14.818 -8.681  1.00 20.26  ?  63  ILE A CA   1 
ATOM   948   C  C    . ILE A  1 63  ? -48.842 -15.863 -7.629  1.00 19.64  ?  63  ILE A C    1 
ATOM   949   O  O    . ILE A  1 63  ? -47.654 -16.124 -7.374  1.00 20.07  ?  63  ILE A O    1 
ATOM   950   C  CB   . ILE A  1 63  ? -49.488 -13.454 -8.028  1.00 21.73  ?  63  ILE A CB   1 
ATOM   951   C  CG1  . ILE A  1 63  ? -49.430 -12.342 -9.089  1.00 24.29  ?  63  ILE A CG1  1 
ATOM   952   C  CG2  . ILE A  1 63  ? -48.531 -13.163 -6.875  1.00 26.18  ?  63  ILE A CG2  1 
ATOM   953   C  CD1  . ILE A  1 63  ? -48.033 -12.062 -9.677  1.00 28.25  ?  63  ILE A CD1  1 
ATOM   954   H  H    . ILE A  1 63  ? -51.066 -14.822 -9.348  1.00 22.39  ?  63  ILE A H    1 
ATOM   955   H  HA   . ILE A  1 63  ? -48.437 -14.711 -9.265  1.00 24.31  ?  63  ILE A HA   1 
ATOM   956   H  HB   . ILE A  1 63  ? -50.389 -13.478 -7.669  1.00 26.07  ?  63  ILE A HB   1 
ATOM   957   H  HG12 . ILE A  1 63  ? -50.012 -12.588 -9.825  1.00 29.15  ?  63  ILE A HG12 1 
ATOM   958   H  HG13 . ILE A  1 63  ? -49.747 -11.518 -8.687  1.00 29.15  ?  63  ILE A HG13 1 
ATOM   959   H  HG21 . ILE A  1 63  ? -48.748 -12.297 -6.496  1.00 31.41  ?  63  ILE A HG21 1 
ATOM   960   H  HG22 . ILE A  1 63  ? -48.630 -13.854 -6.201  1.00 31.41  ?  63  ILE A HG22 1 
ATOM   961   H  HG23 . ILE A  1 63  ? -47.622 -13.159 -7.214  1.00 31.41  ?  63  ILE A HG23 1 
ATOM   962   H  HD11 . ILE A  1 63  ? -48.103 -11.349 -10.331 1.00 33.90  ?  63  ILE A HD11 1 
ATOM   963   H  HD12 . ILE A  1 63  ? -47.436 -11.795 -8.960  1.00 33.90  ?  63  ILE A HD12 1 
ATOM   964   H  HD13 . ILE A  1 63  ? -47.702 -12.869 -10.101 1.00 33.90  ?  63  ILE A HD13 1 
ATOM   965   N  N    . LEU A  1 64  ? -49.854 -16.503 -7.017  1.00 18.72  ?  64  LEU A N    1 
ATOM   966   C  CA   . LEU A  1 64  ? -49.561 -17.501 -5.991  1.00 16.43  ?  64  LEU A CA   1 
ATOM   967   C  C    . LEU A  1 64  ? -48.979 -18.791 -6.579  1.00 18.09  ?  64  LEU A C    1 
ATOM   968   O  O    . LEU A  1 64  ? -48.119 -19.414 -5.940  1.00 19.56  ?  64  LEU A O    1 
ATOM   969   C  CB   . LEU A  1 64  ? -50.822 -17.832 -5.187  1.00 18.96  ?  64  LEU A CB   1 
ATOM   970   C  CG   . LEU A  1 64  ? -51.385 -16.697 -4.319  1.00 20.57  ?  64  LEU A CG   1 
ATOM   971   C  CD1  . LEU A  1 64  ? -52.637 -17.260 -3.624  1.00 20.09  ?  64  LEU A CD1  1 
ATOM   972   C  CD2  . LEU A  1 64  ? -50.378 -16.179 -3.346  1.00 24.77  ?  64  LEU A CD2  1 
ATOM   973   H  H    . LEU A  1 64  ? -50.690 -16.378 -7.176  1.00 22.46  ?  64  LEU A H    1 
ATOM   974   H  HA   . LEU A  1 64  ? -48.906 -17.134 -5.377  1.00 19.71  ?  64  LEU A HA   1 
ATOM   975   H  HB2  . LEU A  1 64  ? -51.520 -18.094 -5.808  1.00 22.75  ?  64  LEU A HB2  1 
ATOM   976   H  HB3  . LEU A  1 64  ? -50.621 -18.575 -4.596  1.00 22.75  ?  64  LEU A HB3  1 
ATOM   977   H  HG   . LEU A  1 64  ? -51.659 -15.963 -4.891  1.00 24.68  ?  64  LEU A HG   1 
ATOM   978   H  HD11 . LEU A  1 64  ? -53.023 -16.569 -3.063  1.00 24.11  ?  64  LEU A HD11 1 
ATOM   979   H  HD12 . LEU A  1 64  ? -53.276 -17.534 -4.300  1.00 24.11  ?  64  LEU A HD12 1 
ATOM   980   H  HD13 . LEU A  1 64  ? -52.380 -18.022 -3.081  1.00 24.11  ?  64  LEU A HD13 1 
ATOM   981   H  HD21 . LEU A  1 64  ? -50.781 -15.467 -2.824  1.00 29.72  ?  64  LEU A HD21 1 
ATOM   982   H  HD22 . LEU A  1 64  ? -50.103 -16.903 -2.761  1.00 29.72  ?  64  LEU A HD22 1 
ATOM   983   H  HD23 . LEU A  1 64  ? -49.613 -15.839 -3.835  1.00 29.72  ?  64  LEU A HD23 1 
ATOM   984   N  N    . PHE A  1 65  ? -49.341 -19.147 -7.806  1.00 17.69  ?  65  PHE A N    1 
ATOM   985   C  CA   . PHE A  1 65  ? -48.932 -20.415 -8.432  1.00 17.92  ?  65  PHE A CA   1 
ATOM   986   C  C    . PHE A  1 65  ? -48.381 -20.166 -9.840  1.00 19.19  ?  65  PHE A C    1 
ATOM   987   O  O    . PHE A  1 65  ? -49.002 -20.551 -10.845 1.00 22.86  ?  65  PHE A O    1 
ATOM   988   C  CB   . PHE A  1 65  ? -50.108 -21.390 -8.499  1.00 20.64  ?  65  PHE A CB   1 
ATOM   989   C  CG   . PHE A  1 65  ? -50.688 -21.759 -7.163  1.00 21.20  ?  65  PHE A CG   1 
ATOM   990   C  CD1  . PHE A  1 65  ? -50.209 -22.844 -6.447  1.00 21.15  ?  65  PHE A CD1  1 
ATOM   991   C  CD2  . PHE A  1 65  ? -51.754 -21.036 -6.646  1.00 19.93  ?  65  PHE A CD2  1 
ATOM   992   C  CE1  . PHE A  1 65  ? -50.745 -23.181 -5.219  1.00 20.49  ?  65  PHE A CE1  1 
ATOM   993   C  CE2  . PHE A  1 65  ? -52.309 -21.369 -5.410  1.00 20.91  ?  65  PHE A CE2  1 
ATOM   994   C  CZ   . PHE A  1 65  ? -51.811 -22.455 -4.702  1.00 19.61  ?  65  PHE A CZ   1 
ATOM   995   H  H    . PHE A  1 65  ? -49.837 -18.662 -8.315  1.00 21.23  ?  65  PHE A H    1 
ATOM   996   H  HA   . PHE A  1 65  ? -48.231 -20.822 -7.899  1.00 21.51  ?  65  PHE A HA   1 
ATOM   997   H  HB2  . PHE A  1 65  ? -50.815 -20.986 -9.026  1.00 24.77  ?  65  PHE A HB2  1 
ATOM   998   H  HB3  . PHE A  1 65  ? -49.809 -22.208 -8.926  1.00 24.77  ?  65  PHE A HB3  1 
ATOM   999   H  HD1  . PHE A  1 65  ? -49.497 -23.337 -6.786  1.00 25.38  ?  65  PHE A HD1  1 
ATOM   1000  H  HD2  . PHE A  1 65  ? -52.090 -20.310 -7.120  1.00 23.92  ?  65  PHE A HD2  1 
ATOM   1001  H  HE1  . PHE A  1 65  ? -50.408 -23.910 -4.749  1.00 24.59  ?  65  PHE A HE1  1 
ATOM   1002  H  HE2  . PHE A  1 65  ? -53.019 -20.875 -5.069  1.00 25.09  ?  65  PHE A HE2  1 
ATOM   1003  H  HZ   . PHE A  1 65  ? -52.175 -22.682 -3.877  1.00 23.53  ?  65  PHE A HZ   1 
ATOM   1004  N  N    . PRO A  1 66  ? -47.218 -19.523 -9.944  1.00 22.12  ?  66  PRO A N    1 
ATOM   1005  C  CA   . PRO A  1 66  ? -46.622 -19.322 -11.274 1.00 25.54  ?  66  PRO A CA   1 
ATOM   1006  C  C    . PRO A  1 66  ? -46.309 -20.661 -11.926 1.00 25.97  ?  66  PRO A C    1 
ATOM   1007  O  O    . PRO A  1 66  ? -46.153 -21.689 -11.263 1.00 25.36  ?  66  PRO A O    1 
ATOM   1008  C  CB   . PRO A  1 66  ? -45.351 -18.513 -10.983 1.00 30.10  ?  66  PRO A CB   1 
ATOM   1009  C  CG   . PRO A  1 66  ? -45.075 -18.683 -9.558  1.00 27.16  ?  66  PRO A CG   1 
ATOM   1010  C  CD   . PRO A  1 66  ? -46.394 -18.951 -8.879  1.00 22.01  ?  66  PRO A CD   1 
ATOM   1011  H  HA   . PRO A  1 66  ? -47.216 -18.808 -11.844 1.00 30.65  ?  66  PRO A HA   1 
ATOM   1012  H  HB2  . PRO A  1 66  ? -44.617 -18.859 -11.514 1.00 36.13  ?  66  PRO A HB2  1 
ATOM   1013  H  HB3  . PRO A  1 66  ? -45.508 -17.578 -11.189 1.00 36.13  ?  66  PRO A HB3  1 
ATOM   1014  H  HG2  . PRO A  1 66  ? -44.474 -19.435 -9.435  1.00 32.60  ?  66  PRO A HG2  1 
ATOM   1015  H  HG3  . PRO A  1 66  ? -44.676 -17.871 -9.209  1.00 32.60  ?  66  PRO A HG3  1 
ATOM   1016  H  HD2  . PRO A  1 66  ? -46.280 -19.592 -8.160  1.00 26.41  ?  66  PRO A HD2  1 
ATOM   1017  H  HD3  . PRO A  1 66  ? -46.784 -18.123 -8.558  1.00 26.41  ?  66  PRO A HD3  1 
ATOM   1018  N  N    . SER A  1 67  ? -46.281 -20.651 -13.259 1.00 27.41  ?  67  SER A N    1 
ATOM   1019  C  CA   . SER A  1 67  ? -45.888 -21.841 -13.994 1.00 31.15  ?  67  SER A CA   1 
ATOM   1020  C  C    . SER A  1 67  ? -44.547 -22.352 -13.477 1.00 25.53  ?  67  SER A C    1 
ATOM   1021  O  O    . SER A  1 67  ? -43.623 -21.568 -13.241 1.00 27.20  ?  67  SER A O    1 
ATOM   1022  C  CB   . SER A  1 67  ? -45.813 -21.518 -15.490 1.00 35.71  ?  67  SER A CB   1 
ATOM   1023  O  OG   . SER A  1 67  ? -45.619 -22.704 -16.222 1.00 35.07  ?  67  SER A OG   1 
ATOM   1024  H  H    . SER A  1 67  ? -46.483 -19.976 -13.752 1.00 32.89  ?  67  SER A H    1 
ATOM   1025  H  HA   . SER A  1 67  ? -46.553 -22.535 -13.862 1.00 37.38  ?  67  SER A HA   1 
ATOM   1026  H  HB2  . SER A  1 67  ? -46.643 -21.102 -15.769 1.00 42.85  ?  67  SER A HB2  1 
ATOM   1027  H  HB3  . SER A  1 67  ? -45.067 -20.919 -15.650 1.00 42.85  ?  67  SER A HB3  1 
ATOM   1028  H  HG   . SER A  1 67  ? -45.577 -22.531 -17.043 1.00 42.09  ?  67  SER A HG   1 
ATOM   1029  N  N    . GLY A  1 68  ? -44.460 -23.663 -13.268 1.00 26.62  ?  68  GLY A N    1 
ATOM   1030  C  CA   . GLY A  1 68  ? -43.226 -24.269 -12.822 1.00 32.08  ?  68  GLY A CA   1 
ATOM   1031  C  C    . GLY A  1 68  ? -43.032 -24.260 -11.331 1.00 31.25  ?  68  GLY A C    1 
ATOM   1032  O  O    . GLY A  1 68  ? -41.948 -24.633 -10.856 1.00 27.84  ?  68  GLY A O    1 
ATOM   1033  H  H    . GLY A  1 68  ? -45.106 -24.219 -13.380 1.00 31.94  ?  68  GLY A H    1 
ATOM   1034  H  HA2  . GLY A  1 68  ? -43.200 -25.191 -13.122 1.00 38.50  ?  68  GLY A HA2  1 
ATOM   1035  H  HA3  . GLY A  1 68  ? -42.479 -23.800 -13.225 1.00 38.50  ?  68  GLY A HA3  1 
ATOM   1036  N  N    . SER A  1 69  ? -44.034 -23.825 -10.571 1.00 26.84  ?  69  SER A N    1 
ATOM   1037  C  CA   . SER A  1 69  ? -43.908 -23.834 -9.119  1.00 26.63  ?  69  SER A CA   1 
ATOM   1038  C  C    . SER A  1 69  ? -43.576 -25.231 -8.609  1.00 24.77  ?  69  SER A C    1 
ATOM   1039  O  O    . SER A  1 69  ? -44.166 -26.234 -9.034  1.00 26.05  ?  69  SER A O    1 
ATOM   1040  C  CB   . SER A  1 69  ? -45.207 -23.362 -8.454  1.00 24.79  ?  69  SER A CB   1 
ATOM   1041  O  OG   . SER A  1 69  ? -45.478 -21.990 -8.679  1.00 28.08  ?  69  SER A OG   1 
ATOM   1042  H  H    . SER A  1 69  ? -44.784 -23.525 -10.866 1.00 32.21  ?  69  SER A H    1 
ATOM   1043  H  HA   . SER A  1 69  ? -43.194 -23.233 -8.854  1.00 31.96  ?  69  SER A HA   1 
ATOM   1044  H  HB2  . SER A  1 69  ? -45.943 -23.884 -8.810  1.00 29.75  ?  69  SER A HB2  1 
ATOM   1045  H  HB3  . SER A  1 69  ? -45.136 -23.510 -7.498  1.00 29.75  ?  69  SER A HB3  1 
ATOM   1046  H  HG   . SER A  1 69  ? -45.550 -21.842 -9.502  1.00 33.70  ?  69  SER A HG   1 
ATOM   1047  N  N    . ASP A  1 70  ? -42.677 -25.286 -7.636  1.00 22.82  ?  70  ASP A N    1 
ATOM   1048  C  CA   . ASP A  1 70  ? -42.322 -26.557 -7.035  1.00 23.91  ?  70  ASP A CA   1 
ATOM   1049  C  C    . ASP A  1 70  ? -43.221 -26.843 -5.837  1.00 25.37  ?  70  ASP A C    1 
ATOM   1050  O  O    . ASP A  1 70  ? -44.103 -26.058 -5.490  1.00 22.72  ?  70  ASP A O    1 
ATOM   1051  C  CB   . ASP A  1 70  ? -40.830 -26.586 -6.675  1.00 29.75  ?  70  ASP A CB   1 
ATOM   1052  C  CG   . ASP A  1 70  ? -40.439 -25.643 -5.527  1.00 34.08  ?  70  ASP A CG   1 
ATOM   1053  O  OD1  . ASP A  1 70  ? -41.289 -25.052 -4.821  1.00 27.15  ?  70  ASP A OD1  1 
ATOM   1054  O  OD2  . ASP A  1 70  ? -39.212 -25.506 -5.309  1.00 35.57  -1 70  ASP A OD2  1 
ATOM   1055  H  H    . ASP A  1 70  ? -42.264 -24.607 -7.308  1.00 27.38  ?  70  ASP A H    1 
ATOM   1056  H  HA   . ASP A  1 70  ? -42.476 -27.258 -7.688  1.00 28.69  ?  70  ASP A HA   1 
ATOM   1057  H  HB2  . ASP A  1 70  ? -40.592 -27.488 -6.409  1.00 35.70  ?  70  ASP A HB2  1 
ATOM   1058  H  HB3  . ASP A  1 70  ? -40.316 -26.328 -7.456  1.00 35.70  ?  70  ASP A HB3  1 
ATOM   1059  N  N    . SER A  1 71  ? -43.017 -28.006 -5.214  1.00 25.18  ?  71  SER A N    1 
ATOM   1060  C  CA   . SER A  1 71  ? -43.946 -28.468 -4.193  1.00 27.86  ?  71  SER A CA   1 
ATOM   1061  C  C    . SER A  1 71  ? -43.954 -27.553 -2.969  1.00 26.00  ?  71  SER A C    1 
ATOM   1062  O  O    . SER A  1 71  ? -45.019 -27.292 -2.396  1.00 21.49  ?  71  SER A O    1 
ATOM   1063  C  CB   . SER A  1 71  ? -43.614 -29.914 -3.805  1.00 28.76  ?  71  SER A CB   1 
ATOM   1064  O  OG   . SER A  1 71  ? -42.364 -30.000 -3.167  1.00 31.25  ?  71  SER A OG   1 
ATOM   1065  H  H    . SER A  1 71  ? -42.357 -28.536 -5.365  1.00 30.21  ?  71  SER A H    1 
ATOM   1066  H  HA   . SER A  1 71  ? -44.842 -28.464 -4.567  1.00 33.43  ?  71  SER A HA   1 
ATOM   1067  H  HB2  . SER A  1 71  ? -44.299 -30.241 -3.201  1.00 34.51  ?  71  SER A HB2  1 
ATOM   1068  H  HB3  . SER A  1 71  ? -43.595 -30.458 -4.608  1.00 34.51  ?  71  SER A HB3  1 
ATOM   1069  H  HG   . SER A  1 71  ? -41.760 -29.721 -3.680  1.00 37.50  ?  71  SER A HG   1 
ATOM   1070  N  N    . GLY A  1 72  ? -42.789 -27.040 -2.551  1.00 22.05  ?  72  GLY A N    1 
ATOM   1071  C  CA   . GLY A  1 72  ? -42.775 -26.084 -1.453  1.00 24.63  ?  72  GLY A CA   1 
ATOM   1072  C  C    . GLY A  1 72  ? -43.559 -24.819 -1.754  1.00 20.06  ?  72  GLY A C    1 
ATOM   1073  O  O    . GLY A  1 72  ? -44.248 -24.282 -0.874  1.00 21.49  ?  72  GLY A O    1 
ATOM   1074  H  H    . GLY A  1 72  ? -42.017 -27.227 -2.881  1.00 26.47  ?  72  GLY A H    1 
ATOM   1075  H  HA2  . GLY A  1 72  ? -43.155 -26.498 -0.663  1.00 29.55  ?  72  GLY A HA2  1 
ATOM   1076  H  HA3  . GLY A  1 72  ? -41.858 -25.835 -1.256  1.00 29.55  ?  72  GLY A HA3  1 
ATOM   1077  N  N    . THR A  1 73  ? -43.427 -24.297 -2.980  1.00 20.90  ?  73  THR A N    1 
ATOM   1078  C  CA   . THR A  1 73  ? -44.166 -23.102 -3.385  1.00 18.77  ?  73  THR A CA   1 
ATOM   1079  C  C    . THR A  1 73  ? -45.653 -23.379 -3.370  1.00 19.16  ?  73  THR A C    1 
ATOM   1080  O  O    . THR A  1 73  ? -46.453 -22.553 -2.897  1.00 19.11  ?  73  THR A O    1 
ATOM   1081  C  CB   . THR A  1 73  ? -43.720 -22.665 -4.783  1.00 21.83  ?  73  THR A CB   1 
ATOM   1082  O  OG1  . THR A  1 73  ? -42.343 -22.259 -4.703  1.00 25.73  ?  73  THR A OG1  1 
ATOM   1083  C  CG2  . THR A  1 73  ? -44.547 -21.529 -5.345  1.00 25.34  ?  73  THR A CG2  1 
ATOM   1084  H  H    . THR A  1 73  ? -42.915 -24.617 -3.592  1.00 25.08  ?  73  THR A H    1 
ATOM   1085  H  HA   . THR A  1 73  ? -43.982 -22.381 -2.764  1.00 22.53  ?  73  THR A HA   1 
ATOM   1086  H  HB   . THR A  1 73  ? -43.793 -23.418 -5.389  1.00 26.19  ?  73  THR A HB   1 
ATOM   1087  H  HG1  . THR A  1 73  ? -41.869 -22.901 -4.439  1.00 30.88  ?  73  THR A HG1  1 
ATOM   1088  H  HG21 . THR A  1 73  ? -44.225 -21.290 -6.228  1.00 30.41  ?  73  THR A HG21 1 
ATOM   1089  H  HG22 . THR A  1 73  ? -45.477 -21.797 -5.410  1.00 30.41  ?  73  THR A HG22 1 
ATOM   1090  H  HG23 . THR A  1 73  ? -44.482 -20.754 -4.765  1.00 30.41  ?  73  THR A HG23 1 
ATOM   1091  N  N    . ILE A  1 74  ? -46.037 -24.543 -3.891  1.00 18.31  ?  74  ILE A N    1 
ATOM   1092  C  CA   . ILE A  1 74  ? -47.435 -24.923 -3.942  1.00 16.85  ?  74  ILE A CA   1 
ATOM   1093  C  C    . ILE A  1 74  ? -48.007 -25.020 -2.536  1.00 17.85  ?  74  ILE A C    1 
ATOM   1094  O  O    . ILE A  1 74  ? -49.060 -24.441 -2.242  1.00 17.75  ?  74  ILE A O    1 
ATOM   1095  C  CB   . ILE A  1 74  ? -47.589 -26.243 -4.715  1.00 16.62  ?  74  ILE A CB   1 
ATOM   1096  C  CG1  . ILE A  1 74  ? -47.295 -25.997 -6.203  1.00 19.89  ?  74  ILE A CG1  1 
ATOM   1097  C  CG2  . ILE A  1 74  ? -49.000 -26.812 -4.530  1.00 18.60  ?  74  ILE A CG2  1 
ATOM   1098  C  CD1  . ILE A  1 74  ? -47.053 -27.241 -7.014  1.00 22.02  ?  74  ILE A CD1  1 
ATOM   1099  H  H    . ILE A  1 74  ? -45.501 -25.129 -4.221  1.00 21.97  ?  74  ILE A H    1 
ATOM   1100  H  HA   . ILE A  1 74  ? -47.930 -24.239 -4.419  1.00 20.22  ?  74  ILE A HA   1 
ATOM   1101  H  HB   . ILE A  1 74  ? -46.946 -26.884 -4.371  1.00 19.94  ?  74  ILE A HB   1 
ATOM   1102  H  HG12 . ILE A  1 74  ? -48.052 -25.534 -6.595  1.00 23.87  ?  74  ILE A HG12 1 
ATOM   1103  H  HG13 . ILE A  1 74  ? -46.502 -25.442 -6.274  1.00 23.87  ?  74  ILE A HG13 1 
ATOM   1104  H  HG21 . ILE A  1 74  ? -49.073 -27.643 -5.025  1.00 22.32  ?  74  ILE A HG21 1 
ATOM   1105  H  HG22 . ILE A  1 74  ? -49.153 -26.975 -3.586  1.00 22.32  ?  74  ILE A HG22 1 
ATOM   1106  H  HG23 . ILE A  1 74  ? -49.645 -26.169 -4.864  1.00 22.32  ?  74  ILE A HG23 1 
ATOM   1107  H  HD11 . ILE A  1 74  ? -46.878 -26.989 -7.934  1.00 26.42  ?  74  ILE A HD11 1 
ATOM   1108  H  HD12 . ILE A  1 74  ? -46.289 -27.712 -6.647  1.00 26.42  ?  74  ILE A HD12 1 
ATOM   1109  H  HD13 . ILE A  1 74  ? -47.842 -27.804 -6.969  1.00 26.42  ?  74  ILE A HD13 1 
ATOM   1110  N  N    . LEU A  1 75  ? -47.296 -25.710 -1.630  1.00 20.26  ?  75  LEU A N    1 
ATOM   1111  C  CA   . LEU A  1 75  ? -47.799 -25.867 -0.264  1.00 20.36  ?  75  LEU A CA   1 
ATOM   1112  C  C    . LEU A  1 75  ? -47.926 -24.529 0.459   1.00 19.23  ?  75  LEU A C    1 
ATOM   1113  O  O    . LEU A  1 75  ? -48.916 -24.302 1.166   1.00 18.44  ?  75  LEU A O    1 
ATOM   1114  C  CB   . LEU A  1 75  ? -46.916 -26.828 0.529   1.00 21.51  ?  75  LEU A CB   1 
ATOM   1115  C  CG   . LEU A  1 75  ? -47.153 -28.286 0.133   1.00 20.90  ?  75  LEU A CG   1 
ATOM   1116  C  CD1  . LEU A  1 75  ? -45.997 -29.129 0.634   1.00 22.50  ?  75  LEU A CD1  1 
ATOM   1117  C  CD2  . LEU A  1 75  ? -48.467 -28.811 0.703   1.00 21.58  ?  75  LEU A CD2  1 
ATOM   1118  H  H    . LEU A  1 75  ? -46.537 -26.087 -1.780  1.00 24.32  ?  75  LEU A H    1 
ATOM   1119  H  HA   . LEU A  1 75  ? -48.686 -26.258 -0.307  1.00 24.43  ?  75  LEU A HA   1 
ATOM   1120  H  HB2  . LEU A  1 75  ? -45.984 -26.616 0.361   1.00 25.81  ?  75  LEU A HB2  1 
ATOM   1121  H  HB3  . LEU A  1 75  ? -47.114 -26.735 1.475   1.00 25.81  ?  75  LEU A HB3  1 
ATOM   1122  H  HG   . LEU A  1 75  ? -47.188 -28.356 -0.834  1.00 25.07  ?  75  LEU A HG   1 
ATOM   1123  H  HD11 . LEU A  1 75  ? -46.149 -30.054 0.382   1.00 27.00  ?  75  LEU A HD11 1 
ATOM   1124  H  HD12 . LEU A  1 75  ? -45.175 -28.807 0.233   1.00 27.00  ?  75  LEU A HD12 1 
ATOM   1125  H  HD13 . LEU A  1 75  ? -45.947 -29.053 1.600   1.00 27.00  ?  75  LEU A HD13 1 
ATOM   1126  H  HD21 . LEU A  1 75  ? -48.581 -29.735 0.431   1.00 25.89  ?  75  LEU A HD21 1 
ATOM   1127  H  HD22 . LEU A  1 75  ? -48.437 -28.752 1.671   1.00 25.89  ?  75  LEU A HD22 1 
ATOM   1128  H  HD23 . LEU A  1 75  ? -49.197 -28.272 0.361   1.00 25.89  ?  75  LEU A HD23 1 
ATOM   1129  N  N    . THR A  1 76  ? -46.934 -23.635 0.306   1.00 17.21  ?  76  THR A N    1 
ATOM   1130  C  CA   . THR A  1 76  ? -47.027 -22.312 0.912   1.00 16.10  ?  76  THR A CA   1 
ATOM   1131  C  C    . THR A  1 76  ? -48.224 -21.554 0.380   1.00 15.70  ?  76  THR A C    1 
ATOM   1132  O  O    . THR A  1 76  ? -48.992 -20.964 1.151   1.00 17.40  ?  76  THR A O    1 
ATOM   1133  C  CB   . THR A  1 76  ? -45.752 -21.538 0.643   1.00 16.81  ?  76  THR A CB   1 
ATOM   1134  O  OG1  . THR A  1 76  ? -44.688 -22.196 1.334   1.00 21.87  ?  76  THR A OG1  1 
ATOM   1135  C  CG2  . THR A  1 76  ? -45.849 -20.139 1.190   1.00 17.17  ?  76  THR A CG2  1 
ATOM   1136  H  H    . THR A  1 76  ? -46.211 -23.774 -0.138  1.00 20.65  ?  76  THR A H    1 
ATOM   1137  H  HA   . THR A  1 76  ? -47.130 -22.406 1.872   1.00 19.32  ?  76  THR A HA   1 
ATOM   1138  H  HB   . THR A  1 76  ? -45.569 -21.503 -0.309  1.00 20.18  ?  76  THR A HB   1 
ATOM   1139  H  HG1  . THR A  1 76  ? -44.610 -22.985 1.057   1.00 26.24  ?  76  THR A HG1  1 
ATOM   1140  H  HG21 . THR A  1 76  ? -45.027 -19.656 1.011   1.00 20.60  ?  76  THR A HG21 1 
ATOM   1141  H  HG22 . THR A  1 76  ? -46.588 -19.670 0.771   1.00 20.60  ?  76  THR A HG22 1 
ATOM   1142  H  HG23 . THR A  1 76  ? -45.996 -20.167 2.148   1.00 20.60  ?  76  THR A HG23 1 
ATOM   1143  N  N    . SER A  1 77  ? -48.414 -21.568 -0.937  1.00 16.98  ?  77  SER A N    1 
ATOM   1144  C  CA   . SER A  1 77  ? -49.532 -20.840 -1.512  1.00 15.87  ?  77  SER A CA   1 
ATOM   1145  C  C    . SER A  1 77  ? -50.870 -21.474 -1.175  1.00 16.81  ?  77  SER A C    1 
ATOM   1146  O  O    . SER A  1 77  ? -51.887 -20.769 -1.170  1.00 17.80  ?  77  SER A O    1 
ATOM   1147  C  CB   . SER A  1 77  ? -49.345 -20.734 -3.027  1.00 18.69  ?  77  SER A CB   1 
ATOM   1148  O  OG   . SER A  1 77  ? -48.309 -19.764 -3.280  1.00 17.43  ?  77  SER A OG   1 
ATOM   1149  H  H    . SER A  1 77  ? -47.920 -21.983 -1.506  1.00 20.38  ?  77  SER A H    1 
ATOM   1150  H  HA   . SER A  1 77  ? -49.535 -19.940 -1.152  1.00 19.04  ?  77  SER A HA   1 
ATOM   1151  H  HB2  . SER A  1 77  ? -49.077 -21.596 -3.382  1.00 22.42  ?  77  SER A HB2  1 
ATOM   1152  H  HB3  . SER A  1 77  ? -50.173 -20.439 -3.437  1.00 22.42  ?  77  SER A HB3  1 
ATOM   1153  H  HG   . SER A  1 77  ? -48.185 -19.685 -4.107  1.00 20.91  ?  77  SER A HG   1 
HETATM 1154  N  N    . MSE A  1 78  ? -50.897 -22.767 -0.870  1.00 16.63  ?  78  MSE A N    1 
HETATM 1155  C  CA   . MSE A  1 78  ? -52.148 -23.372 -0.417  1.00 16.53  ?  78  MSE A CA   1 
HETATM 1156  C  C    . MSE A  1 78  ? -52.527 -22.860 0.996   1.00 14.45  ?  78  MSE A C    1 
HETATM 1157  O  O    . MSE A  1 78  ? -53.726 -22.710 1.267   1.00 16.52  ?  78  MSE A O    1 
HETATM 1158  C  CB   . MSE A  1 78  ? -52.055 -24.883 -0.467  1.00 17.10  ?  78  MSE A CB   1 
HETATM 1159  C  CG   . MSE A  1 78  ? -52.087 -25.416 -1.879  1.00 17.06  ?  78  MSE A CG   1 
HETATM 1160  SE SE   . MSE A  1 78  ? -51.633 -27.300 -1.936  1.00 19.24  ?  78  MSE A SE   1 
HETATM 1161  C  CE   . MSE A  1 78  ? -53.265 -27.965 -1.157  1.00 17.36  ?  78  MSE A CE   1 
HETATM 1162  H  H    . MSE A  1 78  ? -50.227 -23.304 -0.916  1.00 19.95  ?  78  MSE A H    1 
HETATM 1163  H  HA   . MSE A  1 78  ? -52.851 -23.109 -1.031  1.00 19.84  ?  78  MSE A HA   1 
HETATM 1164  H  HB2  . MSE A  1 78  ? -51.221 -25.163 -0.058  1.00 20.52  ?  78  MSE A HB2  1 
HETATM 1165  H  HB3  . MSE A  1 78  ? -52.806 -25.263 0.015   1.00 20.52  ?  78  MSE A HB3  1 
HETATM 1166  H  HG2  . MSE A  1 78  ? -52.979 -25.307 -2.242  1.00 20.47  ?  78  MSE A HG2  1 
HETATM 1167  H  HG3  . MSE A  1 78  ? -51.443 -24.932 -2.419  1.00 20.47  ?  78  MSE A HG3  1 
HETATM 1168  H  HE1  . MSE A  1 78  ? -53.217 -28.932 -1.104  1.00 20.83  ?  78  MSE A HE1  1 
HETATM 1169  H  HE2  . MSE A  1 78  ? -53.367 -27.589 -0.269  1.00 20.83  ?  78  MSE A HE2  1 
HETATM 1170  H  HE3  . MSE A  1 78  ? -54.012 -27.701 -1.717  1.00 20.83  ?  78  MSE A HE3  1 
ATOM   1171  N  N    . ASP A  1 79  ? -51.528 -22.606 1.852   1.00 16.55  ?  79  ASP A N    1 
ATOM   1172  C  CA   . ASP A  1 79  ? -51.785 -21.867 3.090   1.00 16.30  ?  79  ASP A CA   1 
ATOM   1173  C  C    . ASP A  1 79  ? -52.462 -20.542 2.787   1.00 16.48  ?  79  ASP A C    1 
ATOM   1174  O  O    . ASP A  1 79  ? -53.452 -20.169 3.435   1.00 16.59  ?  79  ASP A O    1 
ATOM   1175  C  CB   . ASP A  1 79  ? -50.486 -21.629 3.868   1.00 16.27  ?  79  ASP A CB   1 
ATOM   1176  C  CG   . ASP A  1 79  ? -50.015 -22.822 4.666   1.00 16.67  ?  79  ASP A CG   1 
ATOM   1177  O  OD1  . ASP A  1 79  ? -50.769 -23.791 4.855   1.00 16.31  ?  79  ASP A OD1  1 
ATOM   1178  O  OD2  . ASP A  1 79  ? -48.885 -22.728 5.199   1.00 21.04  -1 79  ASP A OD2  1 
ATOM   1179  H  H    . ASP A  1 79  ? -50.710 -22.846 1.740   1.00 19.86  ?  79  ASP A H    1 
ATOM   1180  H  HA   . ASP A  1 79  ? -52.381 -22.387 3.651   1.00 19.56  ?  79  ASP A HA   1 
ATOM   1181  H  HB2  . ASP A  1 79  ? -49.784 -21.400 3.239   1.00 19.53  ?  79  ASP A HB2  1 
ATOM   1182  H  HB3  . ASP A  1 79  ? -50.624 -20.896 4.487   1.00 19.53  ?  79  ASP A HB3  1 
ATOM   1183  N  N    . THR A  1 80  ? -51.951 -19.804 1.793   1.00 15.67  ?  80  THR A N    1 
ATOM   1184  C  CA   . THR A  1 80  ? -52.550 -18.525 1.445   1.00 14.60  ?  80  THR A CA   1 
ATOM   1185  C  C    . THR A  1 80  ? -53.987 -18.692 0.980   1.00 16.39  ?  80  THR A C    1 
ATOM   1186  O  O    . THR A  1 80  ? -54.866 -17.913 1.368   1.00 17.33  ?  80  THR A O    1 
ATOM   1187  C  CB   . THR A  1 80  ? -51.713 -17.840 0.380   1.00 15.71  ?  80  THR A CB   1 
ATOM   1188  O  OG1  . THR A  1 80  ? -50.367 -17.864 0.856   1.00 17.55  ?  80  THR A OG1  1 
ATOM   1189  C  CG2  . THR A  1 80  ? -52.177 -16.367 0.187   1.00 17.98  ?  80  THR A CG2  1 
ATOM   1190  H  H    . THR A  1 80  ? -51.269 -20.023 1.316   1.00 18.80  ?  80  THR A H    1 
ATOM   1191  H  HA   . THR A  1 80  ? -52.556 -17.956 2.231   1.00 17.52  ?  80  THR A HA   1 
ATOM   1192  H  HB   . THR A  1 80  ? -51.783 -18.315 -0.463  1.00 18.85  ?  80  THR A HB   1 
ATOM   1193  H  HG1  . THR A  1 80  ? -49.859 -17.495 0.299   1.00 21.06  ?  80  THR A HG1  1 
ATOM   1194  H  HG21 . THR A  1 80  ? -51.638 -15.936 -0.495  1.00 21.57  ?  80  THR A HG21 1 
ATOM   1195  H  HG22 . THR A  1 80  ? -53.108 -16.346 -0.087  1.00 21.57  ?  80  THR A HG22 1 
ATOM   1196  H  HG23 . THR A  1 80  ? -52.083 -15.878 1.019   1.00 21.57  ?  80  THR A HG23 1 
ATOM   1197  N  N    . LEU A  1 81  ? -54.250 -19.708 0.154   1.00 16.61  ?  81  LEU A N    1 
ATOM   1198  C  CA   . LEU A  1 81  ? -55.628 -19.975 -0.254  1.00 17.45  ?  81  LEU A CA   1 
ATOM   1199  C  C    . LEU A  1 81  ? -56.552 -20.192 0.942   1.00 16.27  ?  81  LEU A C    1 
ATOM   1200  O  O    . LEU A  1 81  ? -57.675 -19.686 0.947   1.00 17.56  ?  81  LEU A O    1 
ATOM   1201  C  CB   . LEU A  1 81  ? -55.709 -21.197 -1.177  1.00 18.55  ?  81  LEU A CB   1 
ATOM   1202  C  CG   . LEU A  1 81  ? -55.000 -21.096 -2.524  1.00 17.16  ?  81  LEU A CG   1 
ATOM   1203  C  CD1  . LEU A  1 81  ? -55.178 -22.420 -3.248  1.00 19.34  ?  81  LEU A CD1  1 
ATOM   1204  C  CD2  . LEU A  1 81  ? -55.539 -19.955 -3.345  1.00 19.38  ?  81  LEU A CD2  1 
ATOM   1205  H  H    . LEU A  1 81  ? -53.663 -20.243 -0.177  1.00 19.94  ?  81  LEU A H    1 
ATOM   1206  H  HA   . LEU A  1 81  ? -55.960 -19.209 -0.748  1.00 20.94  ?  81  LEU A HA   1 
ATOM   1207  H  HB2  . LEU A  1 81  ? -55.325 -21.954 -0.709  1.00 22.26  ?  81  LEU A HB2  1 
ATOM   1208  H  HB3  . LEU A  1 81  ? -56.645 -21.375 -1.360  1.00 22.26  ?  81  LEU A HB3  1 
ATOM   1209  H  HG   . LEU A  1 81  ? -54.052 -20.950 -2.380  1.00 20.60  ?  81  LEU A HG   1 
ATOM   1210  H  HD11 . LEU A  1 81  ? -54.732 -22.372 -4.108  1.00 23.20  ?  81  LEU A HD11 1 
ATOM   1211  H  HD12 . LEU A  1 81  ? -54.788 -23.128 -2.711  1.00 23.20  ?  81  LEU A HD12 1 
ATOM   1212  H  HD13 . LEU A  1 81  ? -56.126 -22.585 -3.375  1.00 23.20  ?  81  LEU A HD13 1 
ATOM   1213  H  HD21 . LEU A  1 81  ? -55.065 -19.924 -4.191  1.00 23.25  ?  81  LEU A HD21 1 
ATOM   1214  H  HD22 . LEU A  1 81  ? -56.486 -20.098 -3.501  1.00 23.25  ?  81  LEU A HD22 1 
ATOM   1215  H  HD23 . LEU A  1 81  ? -55.405 -19.126 -2.860  1.00 23.25  ?  81  LEU A HD23 1 
ATOM   1216  N  N    . LEU A  1 82  ? -56.116 -20.965 1.942   1.00 16.74  ?  82  LEU A N    1 
ATOM   1217  C  CA   . LEU A  1 82  ? -56.977 -21.207 3.095   1.00 18.21  ?  82  LEU A CA   1 
ATOM   1218  C  C    . LEU A  1 82  ? -57.233 -19.923 3.863   1.00 18.49  ?  82  LEU A C    1 
ATOM   1219  O  O    . LEU A  1 82  ? -58.373 -19.665 4.294   1.00 18.18  ?  82  LEU A O    1 
ATOM   1220  C  CB   . LEU A  1 82  ? -56.377 -22.274 4.017   1.00 19.97  ?  82  LEU A CB   1 
ATOM   1221  C  CG   . LEU A  1 82  ? -56.342 -23.725 3.469   1.00 17.56  ?  82  LEU A CG   1 
ATOM   1222  C  CD1  . LEU A  1 82  ? -55.681 -24.656 4.504   1.00 19.60  ?  82  LEU A CD1  1 
ATOM   1223  C  CD2  . LEU A  1 82  ? -57.680 -24.255 3.151   1.00 18.48  ?  82  LEU A CD2  1 
ATOM   1224  H  H    . LEU A  1 82  ? -55.348 -21.349 1.975   1.00 20.09  ?  82  LEU A H    1 
ATOM   1225  H  HA   . LEU A  1 82  ? -57.833 -21.538 2.780   1.00 21.85  ?  82  LEU A HA   1 
ATOM   1226  H  HB2  . LEU A  1 82  ? -55.462 -22.021 4.218   1.00 23.97  ?  82  LEU A HB2  1 
ATOM   1227  H  HB3  . LEU A  1 82  ? -56.893 -22.290 4.839   1.00 23.97  ?  82  LEU A HB3  1 
ATOM   1228  H  HG   . LEU A  1 82  ? -55.808 -23.746 2.659   1.00 21.07  ?  82  LEU A HG   1 
ATOM   1229  H  HD11 . LEU A  1 82  ? -55.665 -25.559 4.150   1.00 23.52  ?  82  LEU A HD11 1 
ATOM   1230  H  HD12 . LEU A  1 82  ? -54.777 -24.349 4.671   1.00 23.52  ?  82  LEU A HD12 1 
ATOM   1231  H  HD13 . LEU A  1 82  ? -56.197 -24.630 5.325   1.00 23.52  ?  82  LEU A HD13 1 
ATOM   1232  H  HD21 . LEU A  1 82  ? -57.589 -25.160 2.815   1.00 22.18  ?  82  LEU A HD21 1 
ATOM   1233  H  HD22 . LEU A  1 82  ? -58.219 -24.254 3.957   1.00 22.18  ?  82  LEU A HD22 1 
ATOM   1234  H  HD23 . LEU A  1 82  ? -58.091 -23.691 2.477   1.00 22.18  ?  82  LEU A HD23 1 
ATOM   1235  N  N    . ALA A  1 83  ? -56.193 -19.108 4.053   1.00 17.42  ?  83  ALA A N    1 
ATOM   1236  C  CA   . ALA A  1 83  ? -56.367 -17.824 4.724   1.00 17.58  ?  83  ALA A CA   1 
ATOM   1237  C  C    . ALA A  1 83  ? -57.283 -16.883 3.948   1.00 17.66  ?  83  ALA A C    1 
ATOM   1238  O  O    . ALA A  1 83  ? -58.018 -16.102 4.564   1.00 20.84  ?  83  ALA A O    1 
ATOM   1239  C  CB   . ALA A  1 83  ? -55.013 -17.162 4.957   1.00 16.80  ?  83  ALA A CB   1 
ATOM   1240  H  H    . ALA A  1 83  ? -55.387 -19.274 3.804   1.00 20.90  ?  83  ALA A H    1 
ATOM   1241  H  HA   . ALA A  1 83  ? -56.773 -17.980 5.591   1.00 21.09  ?  83  ALA A HA   1 
ATOM   1242  H  HB1  . ALA A  1 83  ? -55.150 -16.312 5.403   1.00 20.16  ?  83  ALA A HB1  1 
ATOM   1243  H  HB2  . ALA A  1 83  ? -54.469 -17.743 5.512   1.00 20.16  ?  83  ALA A HB2  1 
ATOM   1244  H  HB3  . ALA A  1 83  ? -54.579 -17.021 4.101   1.00 20.16  ?  83  ALA A HB3  1 
ATOM   1245  N  N    . LEU A  1 84  ? -57.269 -16.935 2.599   1.00 18.40  ?  84  LEU A N    1 
ATOM   1246  C  CA   . LEU A  1 84  ? -58.170 -16.107 1.809   1.00 19.30  ?  84  LEU A CA   1 
ATOM   1247  C  C    . LEU A  1 84  ? -59.622 -16.539 1.914   1.00 22.96  ?  84  LEU A C    1 
ATOM   1248  O  O    . LEU A  1 84  ? -60.518 -15.736 1.612   1.00 24.80  ?  84  LEU A O    1 
ATOM   1249  C  CB   . LEU A  1 84  ? -57.743 -16.100 0.336   1.00 21.12  ?  84  LEU A CB   1 
ATOM   1250  C  CG   . LEU A  1 84  ? -56.425 -15.353 0.139   1.00 18.81  ?  84  LEU A CG   1 
ATOM   1251  C  CD1  . LEU A  1 84  ? -55.896 -15.642 -1.257  1.00 19.59  ?  84  LEU A CD1  1 
ATOM   1252  C  CD2  . LEU A  1 84  ? -56.532 -13.879 0.371   1.00 20.67  ?  84  LEU A CD2  1 
ATOM   1253  H  H    . LEU A  1 84  ? -56.749 -17.439 2.134   1.00 22.08  ?  84  LEU A H    1 
ATOM   1254  H  HA   . LEU A  1 84  ? -58.113 -15.195 2.134   1.00 23.15  ?  84  LEU A HA   1 
ATOM   1255  H  HB2  . LEU A  1 84  ? -57.624 -17.013 0.033   1.00 25.35  ?  84  LEU A HB2  1 
ATOM   1256  H  HB3  . LEU A  1 84  ? -58.426 -15.657 -0.192  1.00 25.35  ?  84  LEU A HB3  1 
ATOM   1257  H  HG   . LEU A  1 84  ? -55.778 -15.700 0.773   1.00 22.57  ?  84  LEU A HG   1 
ATOM   1258  H  HD11 . LEU A  1 84  ? -55.060 -15.168 -1.382  1.00 23.51  ?  84  LEU A HD11 1 
ATOM   1259  H  HD12 . LEU A  1 84  ? -55.753 -16.597 -1.348  1.00 23.51  ?  84  LEU A HD12 1 
ATOM   1260  H  HD13 . LEU A  1 84  ? -56.548 -15.342 -1.910  1.00 23.51  ?  84  LEU A HD13 1 
ATOM   1261  H  HD21 . LEU A  1 84  ? -55.662 -13.474 0.228   1.00 24.80  ?  84  LEU A HD21 1 
ATOM   1262  H  HD22 . LEU A  1 84  ? -57.176 -13.508 -0.252  1.00 24.80  ?  84  LEU A HD22 1 
ATOM   1263  H  HD23 . LEU A  1 84  ? -56.824 -13.724 1.283   1.00 24.80  ?  84  LEU A HD23 1 
ATOM   1264  N  N    . GLY A  1 85  ? -59.894 -17.781 2.312   1.00 18.46  ?  85  GLY A N    1 
ATOM   1265  C  CA   . GLY A  1 85  ? -61.244 -18.182 2.638   1.00 22.79  ?  85  GLY A CA   1 
ATOM   1266  C  C    . GLY A  1 85  ? -61.948 -19.050 1.614   1.00 20.63  ?  85  GLY A C    1 
ATOM   1267  O  O    . GLY A  1 85  ? -61.379 -19.496 0.611   1.00 20.67  ?  85  GLY A O    1 
ATOM   1268  H  H    . GLY A  1 85  ? -59.309 -18.405 2.399   1.00 22.15  ?  85  GLY A H    1 
ATOM   1269  H  HA2  . GLY A  1 85  ? -61.229 -18.670 3.476   1.00 27.34  ?  85  GLY A HA2  1 
ATOM   1270  H  HA3  . GLY A  1 85  ? -61.782 -17.385 2.768   1.00 27.34  ?  85  GLY A HA3  1 
ATOM   1271  N  N    . PRO A  1 86  ? -63.238 -19.312 1.876   1.00 21.82  ?  86  PRO A N    1 
ATOM   1272  C  CA   . PRO A  1 86  ? -63.982 -20.276 1.061   1.00 24.65  ?  86  PRO A CA   1 
ATOM   1273  C  C    . PRO A  1 86  ? -63.989 -19.995 -0.436  1.00 20.89  ?  86  PRO A C    1 
ATOM   1274  O  O    . PRO A  1 86  ? -64.120 -20.943 -1.213  1.00 22.17  ?  86  PRO A O    1 
ATOM   1275  C  CB   . PRO A  1 86  ? -65.397 -20.189 1.658   1.00 27.05  ?  86  PRO A CB   1 
ATOM   1276  C  CG   . PRO A  1 86  ? -65.154 -19.865 3.121   1.00 24.53  ?  86  PRO A CG   1 
ATOM   1277  C  CD   . PRO A  1 86  ? -63.937 -18.963 3.123   1.00 24.58  ?  86  PRO A CD   1 
ATOM   1278  H  HA   . PRO A  1 86  ? -63.634 -21.169 1.210   1.00 29.57  ?  86  PRO A HA   1 
ATOM   1279  H  HB2  . PRO A  1 86  ? -65.896 -19.479 1.223   1.00 32.46  ?  86  PRO A HB2  1 
ATOM   1280  H  HB3  . PRO A  1 86  ? -65.849 -21.042 1.562   1.00 32.46  ?  86  PRO A HB3  1 
ATOM   1281  H  HG2  . PRO A  1 86  ? -65.925 -19.403 3.487   1.00 29.44  ?  86  PRO A HG2  1 
ATOM   1282  H  HG3  . PRO A  1 86  ? -64.977 -20.682 3.613   1.00 29.44  ?  86  PRO A HG3  1 
ATOM   1283  H  HD2  . PRO A  1 86  ? -64.208 -18.032 3.109   1.00 29.50  ?  86  PRO A HD2  1 
ATOM   1284  H  HD3  . PRO A  1 86  ? -63.375 -19.157 3.890   1.00 29.50  ?  86  PRO A HD3  1 
ATOM   1285  N  N    . ASP A  1 87  ? -63.856 -18.737 -0.872  1.00 22.33  ?  87  ASP A N    1 
ATOM   1286  C  CA   . ASP A  1 87  ? -63.809 -18.467 -2.299  1.00 22.44  ?  87  ASP A CA   1 
ATOM   1287  C  C    . ASP A  1 87  ? -62.663 -19.187 -2.998  1.00 25.67  ?  87  ASP A C    1 
ATOM   1288  O  O    . ASP A  1 87  ? -62.712 -19.387 -4.215  1.00 26.18  ?  87  ASP A O    1 
ATOM   1289  C  CB   . ASP A  1 87  ? -63.669 -16.971 -2.578  1.00 23.04  ?  87  ASP A CB   1 
ATOM   1290  C  CG   . ASP A  1 87  ? -64.968 -16.204 -2.361  1.00 29.36  ?  87  ASP A CG   1 
ATOM   1291  O  OD1  . ASP A  1 87  ? -66.039 -16.821 -2.359  1.00 32.02  ?  87  ASP A OD1  1 
ATOM   1292  O  OD2  . ASP A  1 87  ? -64.897 -14.961 -2.232  1.00 35.17  -1 87  ASP A OD2  1 
ATOM   1293  H  H    . ASP A  1 87  ? -63.793 -18.042 -0.369  1.00 26.79  ?  87  ASP A H    1 
ATOM   1294  H  HA   . ASP A  1 87  ? -64.638 -18.768 -2.702  1.00 26.93  ?  87  ASP A HA   1 
ATOM   1295  H  HB2  . ASP A  1 87  ? -62.999 -16.600 -1.982  1.00 27.65  ?  87  ASP A HB2  1 
ATOM   1296  H  HB3  . ASP A  1 87  ? -63.397 -16.846 -3.500  1.00 27.65  ?  87  ASP A HB3  1 
ATOM   1297  N  N    . PHE A  1 88  ? -61.616 -19.543 -2.257  1.00 20.54  ?  88  PHE A N    1 
ATOM   1298  C  CA   . PHE A  1 88  ? -60.437 -20.194 -2.816  1.00 22.32  ?  88  PHE A CA   1 
ATOM   1299  C  C    . PHE A  1 88  ? -60.336 -21.683 -2.481  1.00 26.59  ?  88  PHE A C    1 
ATOM   1300  O  O    . PHE A  1 88  ? -59.330 -22.324 -2.825  1.00 23.21  ?  88  PHE A O    1 
ATOM   1301  C  CB   . PHE A  1 88  ? -59.199 -19.437 -2.348  1.00 18.43  ?  88  PHE A CB   1 
ATOM   1302  C  CG   . PHE A  1 88  ? -59.149 -18.024 -2.866  1.00 20.14  ?  88  PHE A CG   1 
ATOM   1303  C  CD1  . PHE A  1 88  ? -59.787 -16.999 -2.202  1.00 20.41  ?  88  PHE A CD1  1 
ATOM   1304  C  CD2  . PHE A  1 88  ? -58.500 -17.744 -4.052  1.00 23.56  ?  88  PHE A CD2  1 
ATOM   1305  C  CE1  . PHE A  1 88  ? -59.777 -15.701 -2.703  1.00 23.31  ?  88  PHE A CE1  1 
ATOM   1306  C  CE2  . PHE A  1 88  ? -58.474 -16.464 -4.558  1.00 26.01  ?  88  PHE A CE2  1 
ATOM   1307  C  CZ   . PHE A  1 88  ? -59.104 -15.432 -3.875  1.00 28.47  ?  88  PHE A CZ   1 
ATOM   1308  H  H    . PHE A  1 88  ? -61.565 -19.414 -1.408  1.00 24.65  ?  88  PHE A H    1 
ATOM   1309  H  HA   . PHE A  1 88  ? -60.475 -20.118 -3.783  1.00 26.78  ?  88  PHE A HA   1 
ATOM   1310  H  HB2  . PHE A  1 88  ? -59.198 -19.401 -1.379  1.00 22.12  ?  88  PHE A HB2  1 
ATOM   1311  H  HB3  . PHE A  1 88  ? -58.407 -19.900 -2.664  1.00 22.12  ?  88  PHE A HB3  1 
ATOM   1312  H  HD1  . PHE A  1 88  ? -60.239 -17.180 -1.410  1.00 24.50  ?  88  PHE A HD1  1 
ATOM   1313  H  HD2  . PHE A  1 88  ? -58.073 -18.429 -4.514  1.00 28.27  ?  88  PHE A HD2  1 
ATOM   1314  H  HE1  . PHE A  1 88  ? -60.199 -15.016 -2.238  1.00 27.97  ?  88  PHE A HE1  1 
ATOM   1315  H  HE2  . PHE A  1 88  ? -58.022 -16.287 -5.351  1.00 31.21  ?  88  PHE A HE2  1 
ATOM   1316  H  HZ   . PHE A  1 88  ? -59.085 -14.567 -4.215  1.00 34.16  ?  88  PHE A HZ   1 
ATOM   1317  N  N    . LEU A  1 89  ? -61.374 -22.264 -1.875  1.00 24.14  ?  89  LEU A N    1 
ATOM   1318  C  CA   . LEU A  1 89  ? -61.311 -23.662 -1.465  1.00 22.57  ?  89  LEU A CA   1 
ATOM   1319  C  C    . LEU A  1 89  ? -61.305 -24.620 -2.659  1.00 22.51  ?  89  LEU A C    1 
ATOM   1320  O  O    . LEU A  1 89  ? -60.610 -25.639 -2.631  1.00 24.12  ?  89  LEU A O    1 
ATOM   1321  C  CB   . LEU A  1 89  ? -62.478 -23.983 -0.545  1.00 28.41  ?  89  LEU A CB   1 
ATOM   1322  C  CG   . LEU A  1 89  ? -62.483 -25.401 0.042   1.00 28.96  ?  89  LEU A CG   1 
ATOM   1323  C  CD1  . LEU A  1 89  ? -61.244 -25.651 0.879   1.00 32.23  ?  89  LEU A CD1  1 
ATOM   1324  C  CD2  . LEU A  1 89  ? -63.741 -25.577 0.892   1.00 33.52  ?  89  LEU A CD2  1 
ATOM   1325  H  H    . LEU A  1 89  ? -62.118 -21.872 -1.693  1.00 28.96  ?  89  LEU A H    1 
ATOM   1326  H  HA   . LEU A  1 89  ? -60.492 -23.805 -0.966  1.00 27.08  ?  89  LEU A HA   1 
ATOM   1327  H  HB2  . LEU A  1 89  ? -62.463 -23.360 0.198   1.00 34.09  ?  89  LEU A HB2  1 
ATOM   1328  H  HB3  . LEU A  1 89  ? -63.302 -23.872 -1.045  1.00 34.09  ?  89  LEU A HB3  1 
ATOM   1329  H  HG   . LEU A  1 89  ? -62.505 -26.051 -0.678  1.00 34.75  ?  89  LEU A HG   1 
ATOM   1330  H  HD11 . LEU A  1 89  ? -61.280 -26.553 1.234   1.00 38.68  ?  89  LEU A HD11 1 
ATOM   1331  H  HD12 . LEU A  1 89  ? -60.459 -25.546 0.319   1.00 38.68  ?  89  LEU A HD12 1 
ATOM   1332  H  HD13 . LEU A  1 89  ? -61.221 -25.010 1.607   1.00 38.68  ?  89  LEU A HD13 1 
ATOM   1333  H  HD21 . LEU A  1 89  ? -63.748 -26.472 1.265   1.00 40.22  ?  89  LEU A HD21 1 
ATOM   1334  H  HD22 . LEU A  1 89  ? -63.733 -24.920 1.607   1.00 40.22  ?  89  LEU A HD22 1 
ATOM   1335  H  HD23 . LEU A  1 89  ? -64.522 -25.446 0.331   1.00 40.22  ?  89  LEU A HD23 1 
ATOM   1336  N  N    . THR A  1 90  ? -62.084 -24.355 -3.714  1.00 22.89  ?  90  THR A N    1 
ATOM   1337  C  CA   . THR A  1 90  ? -62.029 -25.253 -4.858  1.00 21.80  ?  90  THR A CA   1 
ATOM   1338  C  C    . THR A  1 90  ? -60.635 -25.292 -5.468  1.00 25.82  ?  90  THR A C    1 
ATOM   1339  O  O    . THR A  1 90  ? -60.159 -26.360 -5.865  1.00 26.18  ?  90  THR A O    1 
ATOM   1340  C  CB   . THR A  1 90  ? -63.074 -24.858 -5.898  1.00 31.05  ?  90  THR A CB   1 
ATOM   1341  O  OG1  . THR A  1 90  ? -64.362 -25.194 -5.372  1.00 34.20  ?  90  THR A OG1  1 
ATOM   1342  C  CG2  . THR A  1 90  ? -62.866 -25.613 -7.201  1.00 38.64  ?  90  THR A CG2  1 
ATOM   1343  H  H    . THR A  1 90  ? -62.626 -23.691 -3.786  1.00 27.47  ?  90  THR A H    1 
ATOM   1344  H  HA   . THR A  1 90  ? -62.241 -26.151 -4.557  1.00 26.16  ?  90  THR A HA   1 
ATOM   1345  H  HB   . THR A  1 90  ? -63.025 -23.905 -6.073  1.00 37.26  ?  90  THR A HB   1 
ATOM   1346  H  HG1  . THR A  1 90  ? -64.497 -24.778 -4.655  1.00 41.04  ?  90  THR A HG1  1 
ATOM   1347  H  HG21 . THR A  1 90  ? -63.539 -25.349 -7.848  1.00 46.36  ?  90  THR A HG21 1 
ATOM   1348  H  HG22 . THR A  1 90  ? -61.988 -25.416 -7.561  1.00 46.36  ?  90  THR A HG22 1 
ATOM   1349  H  HG23 . THR A  1 90  ? -62.937 -26.568 -7.045  1.00 46.36  ?  90  THR A HG23 1 
ATOM   1350  N  N    . GLU A  1 91  ? -59.964 -24.141 -5.550  1.00 23.49  ?  91  GLU A N    1 
ATOM   1351  C  CA   . GLU A  1 91  ? -58.582 -24.125 -6.022  1.00 21.23  ?  91  GLU A CA   1 
ATOM   1352  C  C    . GLU A  1 91  ? -57.681 -24.945 -5.099  1.00 22.40  ?  91  GLU A C    1 
ATOM   1353  O  O    . GLU A  1 91  ? -56.828 -25.719 -5.571  1.00 20.94  ?  91  GLU A O    1 
ATOM   1354  C  CB   . GLU A  1 91  ? -58.082 -22.670 -6.133  1.00 21.86  ?  91  GLU A CB   1 
ATOM   1355  C  CG   . GLU A  1 91  ? -56.699 -22.524 -6.735  1.00 22.49  ?  91  GLU A CG   1 
ATOM   1356  C  CD   . GLU A  1 91  ? -56.649 -22.835 -8.216  1.00 28.04  ?  91  GLU A CD   1 
ATOM   1357  O  OE1  . GLU A  1 91  ? -57.664 -22.636 -8.931  1.00 27.27  ?  91  GLU A OE1  1 
ATOM   1358  O  OE2  . GLU A  1 91  ? -55.591 -23.291 -8.672  1.00 25.02  -1 91  GLU A OE2  1 
ATOM   1359  H  H    . GLU A  1 91  ? -60.281 -23.370 -5.341  1.00 28.19  ?  91  GLU A H    1 
ATOM   1360  H  HA   . GLU A  1 91  ? -58.546 -24.522 -6.906  1.00 25.48  ?  91  GLU A HA   1 
ATOM   1361  H  HB2  . GLU A  1 91  ? -58.700 -22.172 -6.690  1.00 26.23  ?  91  GLU A HB2  1 
ATOM   1362  H  HB3  . GLU A  1 91  ? -58.058 -22.282 -5.244  1.00 26.23  ?  91  GLU A HB3  1 
ATOM   1363  H  HG2  . GLU A  1 91  ? -56.399 -21.609 -6.613  1.00 26.99  ?  91  GLU A HG2  1 
ATOM   1364  H  HG3  . GLU A  1 91  ? -56.094 -23.132 -6.282  1.00 26.99  ?  91  GLU A HG3  1 
ATOM   1365  N  N    . PHE A  1 92  ? -57.844 -24.774 -3.780  1.00 19.08  ?  92  PHE A N    1 
ATOM   1366  C  CA   . PHE A  1 92  ? -57.074 -25.540 -2.816  1.00 18.23  ?  92  PHE A CA   1 
ATOM   1367  C  C    . PHE A  1 92  ? -57.260 -27.041 -3.040  1.00 20.33  ?  92  PHE A C    1 
ATOM   1368  O  O    . PHE A  1 92  ? -56.296 -27.809 -3.043  1.00 19.40  ?  92  PHE A O    1 
ATOM   1369  C  CB   . PHE A  1 92  ? -57.480 -25.123 -1.396  1.00 18.49  ?  92  PHE A CB   1 
ATOM   1370  C  CG   . PHE A  1 92  ? -56.866 -25.952 -0.303  1.00 18.06  ?  92  PHE A CG   1 
ATOM   1371  C  CD1  . PHE A  1 92  ? -57.441 -27.178 0.050   1.00 21.72  ?  92  PHE A CD1  1 
ATOM   1372  C  CD2  . PHE A  1 92  ? -55.731 -25.531 0.375   1.00 18.74  ?  92  PHE A CD2  1 
ATOM   1373  C  CE1  . PHE A  1 92  ? -56.906 -27.937 1.059   1.00 21.06  ?  92  PHE A CE1  1 
ATOM   1374  C  CE2  . PHE A  1 92  ? -55.182 -26.308 1.403   1.00 17.29  ?  92  PHE A CE2  1 
ATOM   1375  C  CZ   . PHE A  1 92  ? -55.753 -27.493 1.750   1.00 16.63  ?  92  PHE A CZ   1 
ATOM   1376  H  H    . PHE A  1 92  ? -58.397 -24.219 -3.426  1.00 22.89  ?  92  PHE A H    1 
ATOM   1377  H  HA   . PHE A  1 92  ? -56.132 -25.336 -2.930  1.00 21.87  ?  92  PHE A HA   1 
ATOM   1378  H  HB2  . PHE A  1 92  ? -57.209 -24.202 -1.255  1.00 22.19  ?  92  PHE A HB2  1 
ATOM   1379  H  HB3  . PHE A  1 92  ? -58.444 -25.196 -1.315  1.00 22.19  ?  92  PHE A HB3  1 
ATOM   1380  H  HD1  . PHE A  1 92  ? -58.205 -27.472 -0.392  1.00 26.07  ?  92  PHE A HD1  1 
ATOM   1381  H  HD2  . PHE A  1 92  ? -55.339 -24.718 0.154   1.00 22.49  ?  92  PHE A HD2  1 
ATOM   1382  H  HE1  . PHE A  1 92  ? -57.299 -28.749 1.286   1.00 25.27  ?  92  PHE A HE1  1 
ATOM   1383  H  HE2  . PHE A  1 92  ? -54.423 -26.011 1.850   1.00 20.75  ?  92  PHE A HE2  1 
ATOM   1384  H  HZ   . PHE A  1 92  ? -55.381 -28.013 2.426   1.00 19.96  ?  92  PHE A HZ   1 
ATOM   1385  N  N    . LYS A  1 93  ? -58.500 -27.487 -3.203  1.00 21.10  ?  93  LYS A N    1 
ATOM   1386  C  CA   . LYS A  1 93  ? -58.731 -28.920 -3.413  1.00 20.85  ?  93  LYS A CA   1 
ATOM   1387  C  C    . LYS A  1 93  ? -58.081 -29.418 -4.688  1.00 22.50  ?  93  LYS A C    1 
ATOM   1388  O  O    . LYS A  1 93  ? -57.541 -30.531 -4.721  1.00 23.50  ?  93  LYS A O    1 
ATOM   1389  C  CB   . LYS A  1 93  ? -60.229 -29.197 -3.448  1.00 21.97  ?  93  LYS A CB   1 
ATOM   1390  C  CG   . LYS A  1 93  ? -60.873 -28.975 -2.126  1.00 24.29  ?  93  LYS A CG   1 
ATOM   1391  C  CD   . LYS A  1 93  ? -62.373 -29.251 -2.234  1.00 34.46  ?  93  LYS A CD   1 
ATOM   1392  C  CE   . LYS A  1 93  ? -63.074 -29.168 -0.902  1.00 42.78  ?  93  LYS A CE   1 
ATOM   1393  N  NZ   . LYS A  1 93  ? -64.534 -29.483 -1.075  1.00 56.78  1  93  LYS A NZ   1 
ATOM   1394  H  H    . LYS A  1 93  ? -59.209 -27.000 -3.199  1.00 25.32  ?  93  LYS A H    1 
ATOM   1395  H  HA   . LYS A  1 93  ? -58.352 -29.414 -2.669  1.00 25.02  ?  93  LYS A HA   1 
ATOM   1396  H  HB2  . LYS A  1 93  ? -60.647 -28.603 -4.091  1.00 26.37  ?  93  LYS A HB2  1 
ATOM   1397  H  HB3  . LYS A  1 93  ? -60.375 -30.121 -3.704  1.00 26.37  ?  93  LYS A HB3  1 
ATOM   1398  H  HG2  . LYS A  1 93  ? -60.492 -29.582 -1.472  1.00 29.15  ?  93  LYS A HG2  1 
ATOM   1399  H  HG3  . LYS A  1 93  ? -60.746 -28.054 -1.852  1.00 29.15  ?  93  LYS A HG3  1 
ATOM   1400  H  HD2  . LYS A  1 93  ? -62.774 -28.596 -2.827  1.00 41.35  ?  93  LYS A HD2  1 
ATOM   1401  H  HD3  . LYS A  1 93  ? -62.506 -30.145 -2.588  1.00 41.35  ?  93  LYS A HD3  1 
ATOM   1402  H  HE2  . LYS A  1 93  ? -62.688 -29.814 -0.290  1.00 51.33  ?  93  LYS A HE2  1 
ATOM   1403  H  HE3  . LYS A  1 93  ? -62.992 -28.269 -0.547  1.00 51.33  ?  93  LYS A HE3  1 
ATOM   1404  H  HZ1  . LYS A  1 93  ? -64.951 -29.435 -0.290  1.00 68.14  ?  93  LYS A HZ1  1 
ATOM   1405  H  HZ2  . LYS A  1 93  ? -64.906 -28.902 -1.637  1.00 68.14  ?  93  LYS A HZ2  1 
ATOM   1406  H  HZ3  . LYS A  1 93  ? -64.631 -30.305 -1.404  1.00 68.14  ?  93  LYS A HZ3  1 
ATOM   1407  N  N    . LYS A  1 94  ? -58.134 -28.623 -5.761  1.00 23.15  ?  94  LYS A N    1 
ATOM   1408  C  CA   . LYS A  1 94  ? -57.493 -29.036 -7.005  1.00 22.74  ?  94  LYS A CA   1 
ATOM   1409  C  C    . LYS A  1 94  ? -55.993 -29.198 -6.819  1.00 24.95  ?  94  LYS A C    1 
ATOM   1410  O  O    . LYS A  1 94  ? -55.399 -30.175 -7.300  1.00 24.19  ?  94  LYS A O    1 
ATOM   1411  C  CB   . LYS A  1 94  ? -57.776 -28.024 -8.124  1.00 31.13  ?  94  LYS A CB   1 
ATOM   1412  C  CG   . LYS A  1 94  ? -59.170 -28.103 -8.698  1.00 42.27  ?  94  LYS A CG   1 
ATOM   1413  C  CD   . LYS A  1 94  ? -59.307 -27.129 -9.876  1.00 47.65  ?  94  LYS A CD   1 
ATOM   1414  C  CE   . LYS A  1 94  ? -60.321 -26.036 -9.603  1.00 61.72  ?  94  LYS A CE   1 
ATOM   1415  N  NZ   . LYS A  1 94  ? -60.193 -24.922 -10.589 1.00 66.96  1  94  LYS A NZ   1 
ATOM   1416  H  H    . LYS A  1 94  ? -58.525 -27.858 -5.793  1.00 27.77  ?  94  LYS A H    1 
ATOM   1417  H  HA   . LYS A  1 94  ? -57.856 -29.893 -7.277  1.00 27.28  ?  94  LYS A HA   1 
ATOM   1418  H  HB2  . LYS A  1 94  ? -57.653 -27.129 -7.772  1.00 37.36  ?  94  LYS A HB2  1 
ATOM   1419  H  HB3  . LYS A  1 94  ? -57.150 -28.179 -8.848  1.00 37.36  ?  94  LYS A HB3  1 
ATOM   1420  H  HG2  . LYS A  1 94  ? -59.339 -29.002 -9.019  1.00 50.72  ?  94  LYS A HG2  1 
ATOM   1421  H  HG3  . LYS A  1 94  ? -59.816 -27.857 -8.017  1.00 50.72  ?  94  LYS A HG3  1 
ATOM   1422  H  HD2  . LYS A  1 94  ? -58.448 -26.710 -10.043 1.00 57.17  ?  94  LYS A HD2  1 
ATOM   1423  H  HD3  . LYS A  1 94  ? -59.597 -27.620 -10.661 1.00 57.17  ?  94  LYS A HD3  1 
ATOM   1424  H  HE2  . LYS A  1 94  ? -61.216 -26.403 -9.672  1.00 74.06  ?  94  LYS A HE2  1 
ATOM   1425  H  HE3  . LYS A  1 94  ? -60.172 -25.675 -8.715  1.00 74.06  ?  94  LYS A HE3  1 
ATOM   1426  H  HZ1  . LYS A  1 94  ? -60.795 -24.290 -10.413 1.00 80.35  ?  94  LYS A HZ1  1 
ATOM   1427  H  HZ2  . LYS A  1 94  ? -59.379 -24.567 -10.542 1.00 80.35  ?  94  LYS A HZ2  1 
ATOM   1428  H  HZ3  . LYS A  1 94  ? -60.328 -25.229 -11.413 1.00 80.35  ?  94  LYS A HZ3  1 
ATOM   1429  N  N    . ARG A  1 95  ? -55.352 -28.218 -6.161  1.00 21.80  ?  95  ARG A N    1 
ATOM   1430  C  CA   . ARG A  1 95  ? -53.915 -28.294 -5.932  1.00 20.20  ?  95  ARG A CA   1 
ATOM   1431  C  C    . ARG A  1 95  ? -53.564 -29.499 -5.064  1.00 21.47  ?  95  ARG A C    1 
ATOM   1432  O  O    . ARG A  1 95  ? -52.572 -30.185 -5.327  1.00 21.41  ?  95  ARG A O    1 
ATOM   1433  C  CB   . ARG A  1 95  ? -53.408 -27.006 -5.276  1.00 19.22  ?  95  ARG A CB   1 
ATOM   1434  C  CG   . ARG A  1 95  ? -53.622 -25.728 -6.096  1.00 21.87  ?  95  ARG A CG   1 
ATOM   1435  C  CD   . ARG A  1 95  ? -52.733 -25.681 -7.340  1.00 23.85  ?  95  ARG A CD   1 
ATOM   1436  N  NE   . ARG A  1 95  ? -53.131 -24.546 -8.182  1.00 23.81  ?  95  ARG A NE   1 
ATOM   1437  C  CZ   . ARG A  1 95  ? -52.432 -24.088 -9.220  1.00 22.87  ?  95  ARG A CZ   1 
ATOM   1438  N  NH1  . ARG A  1 95  ? -51.273 -24.629 -9.541  1.00 28.00  1  95  ARG A NH1  1 
ATOM   1439  N  NH2  . ARG A  1 95  ? -52.895 -23.049 -9.904  1.00 24.69  ?  95  ARG A NH2  1 
ATOM   1440  H  H    . ARG A  1 95  ? -55.727 -27.512 -5.845  1.00 26.16  ?  95  ARG A H    1 
ATOM   1441  H  HA   . ARG A  1 95  ? -53.463 -28.395 -6.784  1.00 24.24  ?  95  ARG A HA   1 
ATOM   1442  H  HB2  . ARG A  1 95  ? -53.868 -26.890 -4.430  1.00 23.07  ?  95  ARG A HB2  1 
ATOM   1443  H  HB3  . ARG A  1 95  ? -52.456 -27.096 -5.117  1.00 23.07  ?  95  ARG A HB3  1 
ATOM   1444  H  HG2  . ARG A  1 95  ? -54.547 -25.687 -6.385  1.00 26.24  ?  95  ARG A HG2  1 
ATOM   1445  H  HG3  . ARG A  1 95  ? -53.410 -24.959 -5.545  1.00 26.24  ?  95  ARG A HG3  1 
ATOM   1446  H  HD2  . ARG A  1 95  ? -51.807 -25.562 -7.075  1.00 28.62  ?  95  ARG A HD2  1 
ATOM   1447  H  HD3  . ARG A  1 95  ? -52.841 -26.499 -7.850  1.00 28.62  ?  95  ARG A HD3  1 
ATOM   1448  H  HE   . ARG A  1 95  ? -53.869 -24.148 -7.992  1.00 28.57  ?  95  ARG A HE   1 
ATOM   1449  H  HH11 . ARG A  1 95  ? -50.972 -25.300 -9.094  1.00 33.60  ?  95  ARG A HH11 1 
ATOM   1450  H  HH12 . ARG A  1 95  ? -50.826 -24.323 -10.209 1.00 33.60  ?  95  ARG A HH12 1 
ATOM   1451  H  HH21 . ARG A  1 95  ? -53.648 -22.693 -9.689  1.00 29.63  ?  95  ARG A HH21 1 
ATOM   1452  H  HH22 . ARG A  1 95  ? -52.449 -22.740 -10.571 1.00 29.63  ?  95  ARG A HH22 1 
ATOM   1453  N  N    . ASN A  1 96  ? -54.381 -29.776 -4.037  1.00 20.66  ?  96  ASN A N    1 
ATOM   1454  C  CA   . ASN A  1 96  ? -54.130 -30.911 -3.154  1.00 18.55  ?  96  ASN A CA   1 
ATOM   1455  C  C    . ASN A  1 96  ? -54.276 -32.224 -3.891  1.00 20.94  ?  96  ASN A C    1 
ATOM   1456  O  O    . ASN A  1 96  ? -53.485 -33.150 -3.668  1.00 22.40  ?  96  ASN A O    1 
ATOM   1457  C  CB   . ASN A  1 96  ? -55.076 -30.872 -1.953  1.00 18.82  ?  96  ASN A CB   1 
ATOM   1458  C  CG   . ASN A  1 96  ? -54.459 -31.461 -0.701  1.00 20.07  ?  96  ASN A CG   1 
ATOM   1459  O  OD1  . ASN A  1 96  ? -53.250 -31.327 -0.451  1.00 20.02  ?  96  ASN A OD1  1 
ATOM   1460  N  ND2  . ASN A  1 96  ? -55.290 -32.114 0.106   1.00 26.60  ?  96  ASN A ND2  1 
ATOM   1461  H  H    . ASN A  1 96  ? -55.082 -29.321 -3.836  1.00 24.80  ?  96  ASN A H    1 
ATOM   1462  H  HA   . ASN A  1 96  ? -53.221 -30.855 -2.820  1.00 22.26  ?  96  ASN A HA   1 
ATOM   1463  H  HB2  . ASN A  1 96  ? -55.311 -29.949 -1.766  1.00 22.58  ?  96  ASN A HB2  1 
ATOM   1464  H  HB3  . ASN A  1 96  ? -55.874 -31.381 -2.163  1.00 22.58  ?  96  ASN A HB3  1 
ATOM   1465  H  HD21 . ASN A  1 96  ? -54.994 -32.469 0.831   1.00 31.91  ?  96  ASN A HD21 1 
ATOM   1466  H  HD22 . ASN A  1 96  ? -56.122 -32.180 -0.097  1.00 31.91  ?  96  ASN A HD22 1 
ATOM   1467  N  N    . GLN A  1 97  ? -55.286 -32.327 -4.767  1.00 20.12  ?  97  GLN A N    1 
ATOM   1468  C  CA   . GLN A  1 97  ? -55.490 -33.566 -5.517  1.00 22.85  ?  97  GLN A CA   1 
ATOM   1469  C  C    . GLN A  1 97  ? -54.282 -33.844 -6.393  1.00 24.14  ?  97  GLN A C    1 
ATOM   1470  O  O    . GLN A  1 97  ? -53.807 -34.985 -6.476  1.00 24.70  ?  97  GLN A O    1 
ATOM   1471  C  CB   . GLN A  1 97  ? -56.768 -33.479 -6.362  1.00 27.91  ?  97  GLN A CB   1 
ATOM   1472  C  CG   . GLN A  1 97  ? -57.012 -34.714 -7.223  1.00 42.06  ?  97  GLN A CG   1 
ATOM   1473  C  CD   . GLN A  1 97  ? -57.779 -34.401 -8.503  1.00 71.51  ?  97  GLN A CD   1 
ATOM   1474  O  OE1  . GLN A  1 97  ? -58.381 -33.331 -8.645  1.00 74.14  ?  97  GLN A OE1  1 
ATOM   1475  N  NE2  . GLN A  1 97  ? -57.751 -35.339 -9.446  1.00 76.59  ?  97  GLN A NE2  1 
ATOM   1476  H  H    . GLN A  1 97  ? -55.854 -31.705 -4.941  1.00 24.14  ?  97  GLN A H    1 
ATOM   1477  H  HA   . GLN A  1 97  ? -55.589 -34.303 -4.894  1.00 27.42  ?  97  GLN A HA   1 
ATOM   1478  H  HB2  . GLN A  1 97  ? -57.529 -33.374 -5.771  1.00 33.49  ?  97  GLN A HB2  1 
ATOM   1479  H  HB3  . GLN A  1 97  ? -56.701 -32.713 -6.953  1.00 33.49  ?  97  GLN A HB3  1 
ATOM   1480  H  HG2  . GLN A  1 97  ? -56.158 -35.099 -7.473  1.00 50.47  ?  97  GLN A HG2  1 
ATOM   1481  H  HG3  . GLN A  1 97  ? -57.530 -35.357 -6.714  1.00 50.47  ?  97  GLN A HG3  1 
ATOM   1482  H  HE21 . GLN A  1 97  ? -57.317 -36.069 -9.314  1.00 91.90  ?  97  GLN A HE21 1 
ATOM   1483  H  HE22 . GLN A  1 97  ? -58.166 -35.214 -10.189 1.00 91.90  ?  97  GLN A HE22 1 
ATOM   1484  N  N    . ASP A  1 98  ? -53.736 -32.796 -7.016  1.00 25.05  ?  98  ASP A N    1 
ATOM   1485  C  CA   . ASP A  1 98  ? -52.577 -32.978 -7.876  1.00 28.56  ?  98  ASP A CA   1 
ATOM   1486  C  C    . ASP A  1 98  ? -51.350 -33.423 -7.093  1.00 29.67  ?  98  ASP A C    1 
ATOM   1487  O  O    . ASP A  1 98  ? -50.515 -34.155 -7.633  1.00 31.66  ?  98  ASP A O    1 
ATOM   1488  C  CB   . ASP A  1 98  ? -52.249 -31.692 -8.645  1.00 30.16  ?  98  ASP A CB   1 
ATOM   1489  C  CG   . ASP A  1 98  ? -50.885 -31.764 -9.323  1.00 45.38  ?  98  ASP A CG   1 
ATOM   1490  O  OD1  . ASP A  1 98  ? -50.824 -32.354 -10.427 1.00 46.26  ?  98  ASP A OD1  1 
ATOM   1491  O  OD2  . ASP A  1 98  ? -49.878 -31.284 -8.736  1.00 48.63  -1 98  ASP A OD2  1 
ATOM   1492  H  H    . ASP A  1 98  ? -54.016 -31.985 -6.957  1.00 30.07  ?  98  ASP A H    1 
ATOM   1493  H  HA   . ASP A  1 98  ? -52.779 -33.668 -8.527  1.00 34.27  ?  98  ASP A HA   1 
ATOM   1494  H  HB2  . ASP A  1 98  ? -52.920 -31.551 -9.331  1.00 36.19  ?  98  ASP A HB2  1 
ATOM   1495  H  HB3  . ASP A  1 98  ? -52.240 -30.945 -8.027  1.00 36.19  ?  98  ASP A HB3  1 
ATOM   1496  N  N    . LEU A  1 99  ? -51.206 -32.980 -5.839  1.00 22.82  ?  99  LEU A N    1 
ATOM   1497  C  CA   . LEU A  1 99  ? -50.045 -33.360 -5.041  1.00 22.42  ?  99  LEU A CA   1 
ATOM   1498  C  C    . LEU A  1 99  ? -50.063 -34.845 -4.684  1.00 23.30  ?  99  LEU A C    1 
ATOM   1499  O  O    . LEU A  1 99  ? -48.993 -35.431 -4.472  1.00 21.30  ?  99  LEU A O    1 
ATOM   1500  C  CB   . LEU A  1 99  ? -49.977 -32.542 -3.763  1.00 21.86  ?  99  LEU A CB   1 
ATOM   1501  C  CG   . LEU A  1 99  ? -49.542 -31.076 -3.914  1.00 24.46  ?  99  LEU A CG   1 
ATOM   1502  C  CD1  . LEU A  1 99  ? -49.552 -30.470 -2.515  1.00 26.69  ?  99  LEU A CD1  1 
ATOM   1503  C  CD2  . LEU A  1 99  ? -48.169 -30.916 -4.524  1.00 25.78  ?  99  LEU A CD2  1 
ATOM   1504  H  H    . LEU A  1 99  ? -51.763 -32.465 -5.434  1.00 27.38  ?  99  LEU A H    1 
ATOM   1505  H  HA   . LEU A  1 99  ? -49.239 -33.185 -5.553  1.00 26.90  ?  99  LEU A HA   1 
ATOM   1506  H  HB2  . LEU A  1 99  ? -50.857 -32.541 -3.356  1.00 26.23  ?  99  LEU A HB2  1 
ATOM   1507  H  HB3  . LEU A  1 99  ? -49.346 -32.970 -3.163  1.00 26.23  ?  99  LEU A HB3  1 
ATOM   1508  H  HG   . LEU A  1 99  ? -50.184 -30.599 -4.463  1.00 29.36  ?  99  LEU A HG   1 
ATOM   1509  H  HD11 . LEU A  1 99  ? -49.281 -29.540 -2.572  1.00 32.02  ?  99  LEU A HD11 1 
ATOM   1510  H  HD12 . LEU A  1 99  ? -50.449 -30.532 -2.151  1.00 32.02  ?  99  LEU A HD12 1 
ATOM   1511  H  HD13 . LEU A  1 99  ? -48.932 -30.961 -1.954  1.00 32.02  ?  99  LEU A HD13 1 
ATOM   1512  H  HD21 . LEU A  1 99  ? -47.960 -29.970 -4.588  1.00 30.94  ?  99  LEU A HD21 1 
ATOM   1513  H  HD22 . LEU A  1 99  ? -47.518 -31.360 -3.958  1.00 30.94  ?  99  LEU A HD22 1 
ATOM   1514  H  HD23 . LEU A  1 99  ? -48.168 -31.316 -5.407  1.00 30.94  ?  99  LEU A HD23 1 
ATOM   1515  N  N    . ALA A  1 100 ? -51.246 -35.457 -4.606  1.00 25.16  ?  100 ALA A N    1 
ATOM   1516  C  CA   . ALA A  1 100 ? -51.358 -36.835 -4.099  1.00 21.52  ?  100 ALA A CA   1 
ATOM   1517  C  C    . ALA A  1 100 ? -50.563 -37.812 -4.948  1.00 23.20  ?  100 ALA A C    1 
ATOM   1518  O  O    . ALA A  1 100 ? -50.012 -38.788 -4.425  1.00 22.31  ?  100 ALA A O    1 
ATOM   1519  C  CB   . ALA A  1 100 ? -52.820 -37.260 -4.051  1.00 29.65  ?  100 ALA A CB   1 
ATOM   1520  H  H    . ALA A  1 100 ? -51.995 -35.103 -4.837  1.00 30.19  ?  100 ALA A H    1 
ATOM   1521  H  HA   . ALA A  1 100 ? -51.006 -36.868 -3.195  1.00 25.82  ?  100 ALA A HA   1 
ATOM   1522  H  HB1  . ALA A  1 100 ? -52.873 -38.168 -3.715  1.00 35.57  ?  100 ALA A HB1  1 
ATOM   1523  H  HB2  . ALA A  1 100 ? -53.303 -36.660 -3.462  1.00 35.57  ?  100 ALA A HB2  1 
ATOM   1524  H  HB3  . ALA A  1 100 ? -53.191 -37.215 -4.946  1.00 35.57  ?  100 ALA A HB3  1 
ATOM   1525  N  N    . ARG A  1 101 ? -50.455 -37.548 -6.245  1.00 24.43  ?  101 ARG A N    1 
ATOM   1526  C  CA   . ARG A  1 101 ? -49.734 -38.472 -7.113  1.00 27.32  ?  101 ARG A CA   1 
ATOM   1527  C  C    . ARG A  1 101 ? -48.265 -38.555 -6.729  1.00 25.42  ?  101 ARG A C    1 
ATOM   1528  O  O    . ARG A  1 101 ? -47.605 -39.557 -7.039  1.00 27.70  ?  101 ARG A O    1 
ATOM   1529  C  CB   . ARG A  1 101 ? -49.855 -38.018 -8.575  1.00 36.44  ?  101 ARG A CB   1 
ATOM   1530  C  CG   . ARG A  1 101 ? -51.280 -37.690 -9.030  1.00 52.66  ?  101 ARG A CG   1 
ATOM   1531  C  CD   . ARG A  1 101 ? -51.261 -36.531 -9.998  1.00 53.53  ?  101 ARG A CD   1 
ATOM   1532  N  NE   . ARG A  1 101 ? -50.183 -36.681 -10.969 1.00 56.94  ?  101 ARG A NE   1 
ATOM   1533  C  CZ   . ARG A  1 101 ? -49.525 -35.669 -11.525 1.00 56.92  ?  101 ARG A CZ   1 
ATOM   1534  N  NH1  . ARG A  1 101 ? -49.821 -34.418 -11.205 1.00 55.01  1  101 ARG A NH1  1 
ATOM   1535  N  NH2  . ARG A  1 101 ? -48.556 -35.912 -12.398 1.00 65.13  ?  101 ARG A NH2  1 
ATOM   1536  H  H    . ARG A  1 101 ? -50.782 -36.858 -6.640  1.00 29.32  ?  101 ARG A H    1 
ATOM   1537  H  HA   . ARG A  1 101 ? -50.122 -39.358 -7.035  1.00 32.78  ?  101 ARG A HA   1 
ATOM   1538  H  HB2  . ARG A  1 101 ? -49.317 -37.219 -8.696  1.00 43.73  ?  101 ARG A HB2  1 
ATOM   1539  H  HB3  . ARG A  1 101 ? -49.520 -38.726 -9.148  1.00 43.73  ?  101 ARG A HB3  1 
ATOM   1540  H  HG2  . ARG A  1 101 ? -51.663 -38.460 -9.478  1.00 63.19  ?  101 ARG A HG2  1 
ATOM   1541  H  HG3  . ARG A  1 101 ? -51.817 -37.441 -8.261  1.00 63.19  ?  101 ARG A HG3  1 
ATOM   1542  H  HD2  . ARG A  1 101 ? -52.103 -36.498 -10.478 1.00 64.23  ?  101 ARG A HD2  1 
ATOM   1543  H  HD3  . ARG A  1 101 ? -51.119 -35.705 -9.509  1.00 64.23  ?  101 ARG A HD3  1 
ATOM   1544  H  HE   . ARG A  1 101 ? -49.958 -37.479 -11.198 1.00 68.33  ?  101 ARG A HE   1 
ATOM   1545  H  HH11 . ARG A  1 101 ? -50.447 -34.255 -10.638 1.00 66.01  ?  101 ARG A HH11 1 
ATOM   1546  H  HH12 . ARG A  1 101 ? -49.390 -33.768 -11.567 1.00 66.01  ?  101 ARG A HH12 1 
ATOM   1547  H  HH21 . ARG A  1 101 ? -48.359 -36.723 -12.607 1.00 78.16  ?  101 ARG A HH21 1 
ATOM   1548  H  HH22 . ARG A  1 101 ? -48.127 -35.259 -12.758 1.00 78.16  ?  101 ARG A HH22 1 
ATOM   1549  N  N    . PHE A  1 102 ? -47.740 -37.518 -6.090  1.00 22.29  ?  102 PHE A N    1 
ATOM   1550  C  CA   . PHE A  1 102 ? -46.357 -37.438 -5.651  1.00 21.05  ?  102 PHE A CA   1 
ATOM   1551  C  C    . PHE A  1 102 ? -46.208 -37.805 -4.188  1.00 21.60  ?  102 PHE A C    1 
ATOM   1552  O  O    . PHE A  1 102 ? -45.139 -37.606 -3.612  1.00 23.64  ?  102 PHE A O    1 
ATOM   1553  C  CB   . PHE A  1 102 ? -45.818 -36.028 -5.884  1.00 25.89  ?  102 PHE A CB   1 
ATOM   1554  C  CG   . PHE A  1 102 ? -45.951 -35.569 -7.305  1.00 32.60  ?  102 PHE A CG   1 
ATOM   1555  C  CD1  . PHE A  1 102 ? -45.051 -35.996 -8.265  1.00 33.52  ?  102 PHE A CD1  1 
ATOM   1556  C  CD2  . PHE A  1 102 ? -46.982 -34.725 -7.682  1.00 31.57  ?  102 PHE A CD2  1 
ATOM   1557  C  CE1  . PHE A  1 102 ? -45.177 -35.585 -9.574  1.00 36.82  ?  102 PHE A CE1  1 
ATOM   1558  C  CE2  . PHE A  1 102 ? -47.114 -34.312 -8.986  1.00 39.16  ?  102 PHE A CE2  1 
ATOM   1559  C  CZ   . PHE A  1 102 ? -46.211 -34.745 -9.935  1.00 34.39  ?  102 PHE A CZ   1 
ATOM   1560  H  H    . PHE A  1 102 ? -48.192 -36.813 -5.890  1.00 26.74  ?  102 PHE A H    1 
ATOM   1561  H  HA   . PHE A  1 102 ? -45.822 -38.057 -6.173  1.00 25.26  ?  102 PHE A HA   1 
ATOM   1562  H  HB2  . PHE A  1 102 ? -46.309 -35.407 -5.324  1.00 31.07  ?  102 PHE A HB2  1 
ATOM   1563  H  HB3  . PHE A  1 102 ? -44.877 -36.009 -5.652  1.00 31.07  ?  102 PHE A HB3  1 
ATOM   1564  H  HD1  . PHE A  1 102 ? -44.356 -36.566 -8.025  1.00 40.22  ?  102 PHE A HD1  1 
ATOM   1565  H  HD2  . PHE A  1 102 ? -47.594 -34.435 -7.044  1.00 37.88  ?  102 PHE A HD2  1 
ATOM   1566  H  HE1  . PHE A  1 102 ? -44.567 -35.875 -10.214 1.00 44.18  ?  102 PHE A HE1  1 
ATOM   1567  H  HE2  . PHE A  1 102 ? -47.809 -33.744 -9.227  1.00 46.99  ?  102 PHE A HE2  1 
ATOM   1568  H  HZ   . PHE A  1 102 ? -46.294 -34.463 -10.818 1.00 41.27  ?  102 PHE A HZ   1 
ATOM   1569  N  N    . ASN A  1 103 ? -47.260 -38.373 -3.595  1.00 20.78  ?  103 ASN A N    1 
ATOM   1570  C  CA   . ASN A  1 103 ? -47.309 -38.713 -2.164  1.00 19.26  ?  103 ASN A CA   1 
ATOM   1571  C  C    . ASN A  1 103 ? -47.182 -37.491 -1.261  1.00 21.69  ?  103 ASN A C    1 
ATOM   1572  O  O    . ASN A  1 103 ? -46.735 -37.582 -0.111  1.00 20.87  ?  103 ASN A O    1 
ATOM   1573  C  CB   . ASN A  1 103 ? -46.266 -39.784 -1.814  1.00 22.52  ?  103 ASN A CB   1 
ATOM   1574  C  CG   . ASN A  1 103 ? -46.555 -41.101 -2.473  1.00 23.51  ?  103 ASN A CG   1 
ATOM   1575  O  OD1  . ASN A  1 103 ? -45.844 -41.534 -3.395  1.00 25.26  ?  103 ASN A OD1  1 
ATOM   1576  N  ND2  . ASN A  1 103 ? -47.637 -41.736 -2.068  1.00 22.40  ?  103 ASN A ND2  1 
ATOM   1577  H  H    . ASN A  1 103 ? -47.983 -38.578 -4.013  1.00 24.94  ?  103 ASN A H    1 
ATOM   1578  H  HA   . ASN A  1 103 ? -48.180 -39.102 -1.983  1.00 23.11  ?  103 ASN A HA   1 
ATOM   1579  H  HB2  . ASN A  1 103 ? -45.392 -39.485 -2.110  1.00 27.02  ?  103 ASN A HB2  1 
ATOM   1580  H  HB3  . ASN A  1 103 ? -46.263 -39.923 -0.854  1.00 27.02  ?  103 ASN A HB3  1 
ATOM   1581  H  HD21 . ASN A  1 103 ? -47.846 -42.494 -2.415  1.00 26.88  ?  103 ASN A HD21 1 
ATOM   1582  H  HD22 . ASN A  1 103 ? -48.134 -41.391 -1.457  1.00 26.88  ?  103 ASN A HD22 1 
ATOM   1583  N  N    . LEU A  1 104 ? -47.594 -36.314 -1.747  1.00 20.10  ?  104 LEU A N    1 
ATOM   1584  C  CA   . LEU A  1 104 ? -47.594 -35.096 -0.960  1.00 19.87  ?  104 LEU A CA   1 
ATOM   1585  C  C    . LEU A  1 104 ? -49.024 -34.658 -0.675  1.00 17.56  ?  104 LEU A C    1 
ATOM   1586  O  O    . LEU A  1 104 ? -49.953 -34.939 -1.445  1.00 19.07  ?  104 LEU A O    1 
ATOM   1587  C  CB   . LEU A  1 104 ? -46.854 -33.979 -1.694  1.00 21.26  ?  104 LEU A CB   1 
ATOM   1588  C  CG   . LEU A  1 104 ? -45.390 -34.272 -2.006  1.00 23.76  ?  104 LEU A CG   1 
ATOM   1589  C  CD1  . LEU A  1 104 ? -44.790 -33.126 -2.821  1.00 29.69  ?  104 LEU A CD1  1 
ATOM   1590  C  CD2  . LEU A  1 104 ? -44.643 -34.486 -0.728  1.00 29.54  ?  104 LEU A CD2  1 
ATOM   1591  H  H    . LEU A  1 104 ? -47.882 -36.203 -2.550  1.00 24.12  ?  104 LEU A H    1 
ATOM   1592  H  HA   . LEU A  1 104 ? -47.148 -35.257 -0.114  1.00 23.85  ?  104 LEU A HA   1 
ATOM   1593  H  HB2  . LEU A  1 104 ? -47.304 -33.812 -2.536  1.00 25.51  ?  104 LEU A HB2  1 
ATOM   1594  H  HB3  . LEU A  1 104 ? -46.881 -33.179 -1.146  1.00 25.51  ?  104 LEU A HB3  1 
ATOM   1595  H  HG   . LEU A  1 104 ? -45.331 -35.084 -2.533  1.00 28.51  ?  104 LEU A HG   1 
ATOM   1596  H  HD11 . LEU A  1 104 ? -43.860 -33.327 -3.011  1.00 35.63  ?  104 LEU A HD11 1 
ATOM   1597  H  HD12 . LEU A  1 104 ? -45.286 -33.036 -3.650  1.00 35.63  ?  104 LEU A HD12 1 
ATOM   1598  H  HD13 . LEU A  1 104 ? -44.853 -32.306 -2.307  1.00 35.63  ?  104 LEU A HD13 1 
ATOM   1599  H  HD21 . LEU A  1 104 ? -43.714 -34.672 -0.933  1.00 35.45  ?  104 LEU A HD21 1 
ATOM   1600  H  HD22 . LEU A  1 104 ? -44.710 -33.685 -0.186  1.00 35.45  ?  104 LEU A HD22 1 
ATOM   1601  H  HD23 . LEU A  1 104 ? -45.035 -35.238 -0.257  1.00 35.45  ?  104 LEU A HD23 1 
ATOM   1602  N  N    . THR A  1 105 ? -49.179 -33.923 0.431   1.00 19.10  ?  105 THR A N    1 
ATOM   1603  C  CA   . THR A  1 105 ? -50.476 -33.363 0.773   1.00 17.41  ?  105 THR A CA   1 
ATOM   1604  C  C    . THR A  1 105 ? -50.286 -32.168 1.693   1.00 19.13  ?  105 THR A C    1 
ATOM   1605  O  O    . THR A  1 105 ? -49.255 -32.009 2.354   1.00 19.17  ?  105 THR A O    1 
ATOM   1606  C  CB   . THR A  1 105 ? -51.406 -34.406 1.421   1.00 21.94  ?  105 THR A CB   1 
ATOM   1607  O  OG1  . THR A  1 105 ? -52.773 -34.014 1.245   1.00 22.93  ?  105 THR A OG1  1 
ATOM   1608  C  CG2  . THR A  1 105 ? -51.098 -34.652 2.922   1.00 23.47  ?  105 THR A CG2  1 
ATOM   1609  H  H    . THR A  1 105 ? -48.553 -33.740 0.991   1.00 22.92  ?  105 THR A H    1 
ATOM   1610  H  HA   . THR A  1 105 ? -50.904 -33.048 -0.038  1.00 20.90  ?  105 THR A HA   1 
ATOM   1611  H  HB   . THR A  1 105 ? -51.274 -35.250 0.962   1.00 26.33  ?  105 THR A HB   1 
ATOM   1612  H  HG1  . THR A  1 105 ? -52.907 -33.267 1.605   1.00 27.51  ?  105 THR A HG1  1 
ATOM   1613  H  HG21 . THR A  1 105 ? -51.709 -35.314 3.281   1.00 28.17  ?  105 THR A HG21 1 
ATOM   1614  H  HG22 . THR A  1 105 ? -50.188 -34.973 3.025   1.00 28.17  ?  105 THR A HG22 1 
ATOM   1615  H  HG23 . THR A  1 105 ? -51.199 -33.826 3.421   1.00 28.17  ?  105 THR A HG23 1 
ATOM   1616  N  N    . HIS A  1 106 ? -51.306 -31.319 1.705   1.00 18.94  ?  106 HIS A N    1 
ATOM   1617  C  CA   . HIS A  1 106 ? -51.346 -30.245 2.677   1.00 19.15  ?  106 HIS A CA   1 
ATOM   1618  C  C    . HIS A  1 106 ? -51.664 -30.807 4.057   1.00 17.99  ?  106 HIS A C    1 
ATOM   1619  O  O    . HIS A  1 106 ? -52.530 -31.681 4.200   1.00 21.11  ?  106 HIS A O    1 
ATOM   1620  C  CB   . HIS A  1 106 ? -52.394 -29.216 2.260   1.00 18.69  ?  106 HIS A CB   1 
ATOM   1621  C  CG   . HIS A  1 106 ? -52.271 -27.927 2.997   1.00 16.95  ?  106 HIS A CG   1 
ATOM   1622  N  ND1  . HIS A  1 106 ? -52.904 -27.695 4.204   1.00 19.38  ?  106 HIS A ND1  1 
ATOM   1623  C  CD2  . HIS A  1 106 ? -51.600 -26.795 2.687   1.00 18.31  ?  106 HIS A CD2  1 
ATOM   1624  C  CE1  . HIS A  1 106 ? -52.572 -26.484 4.624   1.00 18.28  ?  106 HIS A CE1  1 
ATOM   1625  N  NE2  . HIS A  1 106 ? -51.813 -25.912 3.709   1.00 18.47  ?  106 HIS A NE2  1 
ATOM   1626  H  H    . HIS A  1 106 ? -51.978 -31.345 1.169   1.00 22.73  ?  106 HIS A H    1 
ATOM   1627  H  HA   . HIS A  1 106 ? -50.481 -29.807 2.714   1.00 22.98  ?  106 HIS A HA   1 
ATOM   1628  H  HB2  . HIS A  1 106 ? -52.294 -29.030 1.314   1.00 22.42  ?  106 HIS A HB2  1 
ATOM   1629  H  HB3  . HIS A  1 106 ? -53.277 -29.577 2.435   1.00 22.42  ?  106 HIS A HB3  1 
ATOM   1630  H  HD2  . HIS A  1 106 ? -51.084 -26.649 1.927   1.00 21.97  ?  106 HIS A HD2  1 
ATOM   1631  H  HE1  . HIS A  1 106 ? -52.875 -26.081 5.405   1.00 21.93  ?  106 HIS A HE1  1 
ATOM   1632  H  HE2  . HIS A  1 106 ? -51.488 -25.117 3.757   1.00 22.16  ?  106 HIS A HE2  1 
ATOM   1633  N  N    . ASP A  1 107 ? -51.006 -30.261 5.089   1.00 18.29  ?  107 ASP A N    1 
ATOM   1634  C  CA   . ASP A  1 107 ? -51.191 -30.801 6.438   1.00 17.04  ?  107 ASP A CA   1 
ATOM   1635  C  C    . ASP A  1 107 ? -52.552 -30.485 7.045   1.00 19.39  ?  107 ASP A C    1 
ATOM   1636  O  O    . ASP A  1 107 ? -52.926 -31.138 8.031   1.00 23.29  ?  107 ASP A O    1 
ATOM   1637  C  CB   . ASP A  1 107 ? -50.073 -30.365 7.406   1.00 18.03  ?  107 ASP A CB   1 
ATOM   1638  C  CG   . ASP A  1 107 ? -49.972 -28.862 7.652   1.00 20.45  ?  107 ASP A CG   1 
ATOM   1639  O  OD1  . ASP A  1 107 ? -50.588 -28.046 6.963   1.00 21.33  ?  107 ASP A OD1  1 
ATOM   1640  O  OD2  . ASP A  1 107 ? -49.191 -28.513 8.561   1.00 23.46  -1 107 ASP A OD2  1 
ATOM   1641  H  H    . ASP A  1 107 ? -50.463 -29.597 5.036   1.00 21.95  ?  107 ASP A H    1 
ATOM   1642  H  HA   . ASP A  1 107 ? -51.138 -31.767 6.373   1.00 20.45  ?  107 ASP A HA   1 
ATOM   1643  H  HB2  . ASP A  1 107 ? -50.226 -30.791 8.264   1.00 21.63  ?  107 ASP A HB2  1 
ATOM   1644  H  HB3  . ASP A  1 107 ? -49.222 -30.660 7.046   1.00 21.63  ?  107 ASP A HB3  1 
ATOM   1645  N  N    . LEU A  1 108 ? -53.326 -29.560 6.473   1.00 18.46  ?  108 LEU A N    1 
ATOM   1646  C  CA   . LEU A  1 108 ? -54.670 -29.257 6.954   1.00 21.45  ?  108 LEU A CA   1 
ATOM   1647  C  C    . LEU A  1 108 ? -55.746 -29.832 6.029   1.00 27.82  ?  108 LEU A C    1 
ATOM   1648  O  O    . LEU A  1 108 ? -56.895 -29.366 6.022   1.00 27.56  ?  108 LEU A O    1 
ATOM   1649  C  CB   . LEU A  1 108 ? -54.856 -27.750 7.122   1.00 19.66  ?  108 LEU A CB   1 
ATOM   1650  C  CG   . LEU A  1 108 ? -53.861 -27.106 8.092   1.00 20.09  ?  108 LEU A CG   1 
ATOM   1651  C  CD1  . LEU A  1 108 ? -54.206 -25.622 8.274   1.00 21.32  ?  108 LEU A CD1  1 
ATOM   1652  C  CD2  . LEU A  1 108 ? -53.818 -27.832 9.461   1.00 24.01  ?  108 LEU A CD2  1 
ATOM   1653  H  H    . LEU A  1 108 ? -53.089 -29.089 5.794   1.00 22.15  ?  108 LEU A H    1 
ATOM   1654  H  HA   . LEU A  1 108 ? -54.785 -29.665 7.827   1.00 25.73  ?  108 LEU A HA   1 
ATOM   1655  H  HB2  . LEU A  1 108 ? -54.745 -27.323 6.258   1.00 23.60  ?  108 LEU A HB2  1 
ATOM   1656  H  HB3  . LEU A  1 108 ? -55.749 -27.581 7.459   1.00 23.60  ?  108 LEU A HB3  1 
ATOM   1657  H  HG   . LEU A  1 108 ? -52.973 -27.156 7.705   1.00 24.11  ?  108 LEU A HG   1 
ATOM   1658  H  HD11 . LEU A  1 108 ? -53.571 -25.223 8.890   1.00 25.59  ?  108 LEU A HD11 1 
ATOM   1659  H  HD12 . LEU A  1 108 ? -54.156 -25.178 7.413   1.00 25.59  ?  108 LEU A HD12 1 
ATOM   1660  H  HD13 . LEU A  1 108 ? -55.105 -25.548 8.632   1.00 25.59  ?  108 LEU A HD13 1 
ATOM   1661  H  HD21 . LEU A  1 108 ? -53.176 -27.386 10.034  1.00 28.82  ?  108 LEU A HD21 1 
ATOM   1662  H  HD22 . LEU A  1 108 ? -54.701 -27.799 9.863   1.00 28.82  ?  108 LEU A HD22 1 
ATOM   1663  H  HD23 . LEU A  1 108 ? -53.553 -28.754 9.320   1.00 28.82  ?  108 LEU A HD23 1 
ATOM   1664  N  N    . SER A  1 109 ? -55.382 -30.836 5.237   1.00 22.91  ?  109 SER A N    1 
ATOM   1665  C  CA   . SER A  1 109 ? -56.331 -31.518 4.357   1.00 24.57  ?  109 SER A CA   1 
ATOM   1666  C  C    . SER A  1 109 ? -57.638 -31.930 5.011   1.00 30.26  ?  109 SER A C    1 
ATOM   1667  O  O    . SER A  1 109 ? -58.631 -32.076 4.293   1.00 28.72  ?  109 SER A O    1 
ATOM   1668  C  CB   . SER A  1 109 ? -55.684 -32.771 3.761   1.00 25.89  ?  109 SER A CB   1 
ATOM   1669  O  OG   . SER A  1 109 ? -54.743 -32.374 2.823   1.00 25.86  ?  109 SER A OG   1 
ATOM   1670  H  H    . SER A  1 109 ? -54.581 -31.146 5.188   1.00 27.49  ?  109 SER A H    1 
ATOM   1671  H  HA   . SER A  1 109 ? -56.549 -30.924 3.622   1.00 29.49  ?  109 SER A HA   1 
ATOM   1672  H  HB2  . SER A  1 109 ? -55.247 -33.275 4.465   1.00 31.07  ?  109 SER A HB2  1 
ATOM   1673  H  HB3  . SER A  1 109 ? -56.364 -33.312 3.329   1.00 31.07  ?  109 SER A HB3  1 
ATOM   1674  H  HG   . SER A  1 109 ? -54.155 -31.898 3.189   1.00 31.04  ?  109 SER A HG   1 
ATOM   1675  N  N    . ILE A  1 110 ? -57.698 -32.125 6.334   1.00 31.04  ?  110 ILE A N    1 
ATOM   1676  C  CA   . ILE A  1 110 ? -58.982 -32.506 6.934   1.00 32.27  ?  110 ILE A CA   1 
ATOM   1677  C  C    . ILE A  1 110 ? -60.078 -31.473 6.681   1.00 38.06  ?  110 ILE A C    1 
ATOM   1678  O  O    . ILE A  1 110 ? -61.269 -31.815 6.719   1.00 31.91  ?  110 ILE A O    1 
ATOM   1679  C  CB   . ILE A  1 110 ? -58.857 -32.749 8.448   1.00 35.28  ?  110 ILE A CB   1 
ATOM   1680  C  CG1  . ILE A  1 110 ? -58.313 -31.495 9.153   1.00 37.33  ?  110 ILE A CG1  1 
ATOM   1681  C  CG2  . ILE A  1 110 ? -58.030 -33.990 8.694   1.00 50.79  ?  110 ILE A CG2  1 
ATOM   1682  C  CD1  . ILE A  1 110 ? -58.175 -31.661 10.651  1.00 48.67  ?  110 ILE A CD1  1 
ATOM   1683  H  H    . ILE A  1 110 ? -57.041 -32.048 6.884   1.00 37.25  ?  110 ILE A H    1 
ATOM   1684  H  HA   . ILE A  1 110 ? -59.271 -33.339 6.530   1.00 38.72  ?  110 ILE A HA   1 
ATOM   1685  H  HB   . ILE A  1 110 ? -59.748 -32.917 8.794   1.00 42.34  ?  110 ILE A HB   1 
ATOM   1686  H  HG12 . ILE A  1 110 ? -57.436 -31.289 8.794   1.00 44.80  ?  110 ILE A HG12 1 
ATOM   1687  H  HG13 . ILE A  1 110 ? -58.919 -30.756 8.990   1.00 44.80  ?  110 ILE A HG13 1 
ATOM   1688  H  HG21 . ILE A  1 110 ? -57.957 -34.136 9.650   1.00 60.95  ?  110 ILE A HG21 1 
ATOM   1689  H  HG22 . ILE A  1 110 ? -58.467 -34.749 8.276   1.00 60.95  ?  110 ILE A HG22 1 
ATOM   1690  H  HG23 . ILE A  1 110 ? -57.148 -33.863 8.310   1.00 60.95  ?  110 ILE A HG23 1 
ATOM   1691  H  HD11 . ILE A  1 110 ? -57.829 -30.837 11.028  1.00 58.40  ?  110 ILE A HD11 1 
ATOM   1692  H  HD12 . ILE A  1 110 ? -59.046 -31.857 11.028  1.00 58.40  ?  110 ILE A HD12 1 
ATOM   1693  H  HD13 . ILE A  1 110 ? -57.563 -32.391 10.832  1.00 58.40  ?  110 ILE A HD13 1 
ATOM   1694  N  N    . LEU A  1 111 ? -59.706 -30.214 6.432   1.00 30.71  ?  111 LEU A N    1 
ATOM   1695  C  CA   . LEU A  1 111 ? -60.689 -29.174 6.124   1.00 29.14  ?  111 LEU A CA   1 
ATOM   1696  C  C    . LEU A  1 111 ? -61.454 -29.461 4.839   1.00 40.92  ?  111 LEU A C    1 
ATOM   1697  O  O    . LEU A  1 111 ? -62.597 -29.011 4.688   1.00 48.78  ?  111 LEU A O    1 
ATOM   1698  C  CB   . LEU A  1 111 ? -59.985 -27.820 5.990   1.00 33.38  ?  111 LEU A CB   1 
ATOM   1699  C  CG   . LEU A  1 111 ? -59.487 -27.227 7.279   1.00 33.83  ?  111 LEU A CG   1 
ATOM   1700  C  CD1  . LEU A  1 111 ? -58.512 -26.113 6.936   1.00 36.28  ?  111 LEU A CD1  1 
ATOM   1701  C  CD2  . LEU A  1 111 ? -60.665 -26.706 8.101   1.00 37.06  ?  111 LEU A CD2  1 
ATOM   1702  H  H    . LEU A  1 111 ? -58.892 -29.937 6.436   1.00 36.85  ?  111 LEU A H    1 
ATOM   1703  H  HA   . LEU A  1 111 ? -61.329 -29.114 6.851   1.00 34.97  ?  111 LEU A HA   1 
ATOM   1704  H  HB2  . LEU A  1 111 ? -59.219 -27.928 5.404   1.00 40.06  ?  111 LEU A HB2  1 
ATOM   1705  H  HB3  . LEU A  1 111 ? -60.607 -27.187 5.598   1.00 40.06  ?  111 LEU A HB3  1 
ATOM   1706  H  HG   . LEU A  1 111 ? -59.020 -27.903 7.794   1.00 40.59  ?  111 LEU A HG   1 
ATOM   1707  H  HD11 . LEU A  1 111 ? -58.181 -25.719 7.758   1.00 43.53  ?  111 LEU A HD11 1 
ATOM   1708  H  HD12 . LEU A  1 111 ? -57.775 -26.486 6.427   1.00 43.53  ?  111 LEU A HD12 1 
ATOM   1709  H  HD13 . LEU A  1 111 ? -58.973 -25.442 6.409   1.00 43.53  ?  111 LEU A HD13 1 
ATOM   1710  H  HD21 . LEU A  1 111 ? -60.329 -26.326 8.928   1.00 44.47  ?  111 LEU A HD21 1 
ATOM   1711  H  HD22 . LEU A  1 111 ? -61.130 -26.025 7.589   1.00 44.47  ?  111 LEU A HD22 1 
ATOM   1712  H  HD23 . LEU A  1 111 ? -61.265 -27.443 8.294   1.00 44.47  ?  111 LEU A HD23 1 
ATOM   1713  N  N    . ALA A  1 112 ? -60.832 -30.169 3.897   1.00 38.04  ?  112 ALA A N    1 
ATOM   1714  C  CA   . ALA A  1 112 ? -61.375 -30.407 2.566   1.00 45.18  ?  112 ALA A CA   1 
ATOM   1715  C  C    . ALA A  1 112 ? -62.083 -31.751 2.456   1.00 48.32  ?  112 ALA A C    1 
ATOM   1716  O  O    . ALA A  1 112 ? -62.461 -32.157 1.350   1.00 54.00  ?  112 ALA A O    1 
ATOM   1717  C  CB   . ALA A  1 112 ? -60.253 -30.327 1.529   1.00 42.00  ?  112 ALA A CB   1 
ATOM   1718  H  H    . ALA A  1 112 ? -60.062 -30.534 4.014   1.00 45.65  ?  112 ALA A H    1 
ATOM   1719  H  HA   . ALA A  1 112 ? -62.021 -29.713 2.362   1.00 54.21  ?  112 ALA A HA   1 
ATOM   1720  H  HB1  . ALA A  1 112 ? -60.626 -30.487 0.648   1.00 50.40  ?  112 ALA A HB1  1 
ATOM   1721  H  HB2  . ALA A  1 112 ? -59.854 -29.444 1.564   1.00 50.40  ?  112 ALA A HB2  1 
ATOM   1722  H  HB3  . ALA A  1 112 ? -59.586 -31.001 1.733   1.00 50.40  ?  112 ALA A HB3  1 
ATOM   1723  N  N    . GLN A  1 113 ? -62.271 -32.442 3.577   1.00 45.26  ?  113 GLN A N    1 
ATOM   1724  C  CA   . GLN A  1 113 ? -62.919 -33.731 3.641   1.00 53.77  ?  113 GLN A CA   1 
ATOM   1725  C  C    . GLN A  1 113 ? -64.286 -33.547 4.303   1.00 67.35  ?  113 GLN A C    1 
ATOM   1726  O  O    . GLN A  1 113 ? -64.866 -32.449 4.267   1.00 72.51  ?  113 GLN A O    1 
ATOM   1727  C  CB   . GLN A  1 113 ? -61.995 -34.705 4.381   1.00 58.73  ?  113 GLN A CB   1 
ATOM   1728  C  CG   . GLN A  1 113 ? -60.625 -34.866 3.689   1.00 54.07  ?  113 GLN A CG   1 
ATOM   1729  C  CD   . GLN A  1 113 ? -59.570 -35.564 4.545   1.00 55.87  ?  113 GLN A CD   1 
ATOM   1730  O  OE1  . GLN A  1 113 ? -59.804 -35.884 5.711   1.00 64.75  ?  113 GLN A OE1  1 
ATOM   1731  N  NE2  . GLN A  1 113 ? -58.400 -35.797 3.962   1.00 60.10  ?  113 GLN A NE2  1 
ATOM   1732  H  H    . GLN A  1 113 ? -62.014 -32.162 4.348   1.00 54.31  ?  113 GLN A H    1 
ATOM   1733  H  HA   . GLN A  1 113 ? -63.059 -34.066 2.742   1.00 64.52  ?  113 GLN A HA   1 
ATOM   1734  H  HB2  . GLN A  1 113 ? -61.840 -34.374 5.279   1.00 70.48  ?  113 GLN A HB2  1 
ATOM   1735  H  HB3  . GLN A  1 113 ? -62.418 -35.577 4.416   1.00 70.48  ?  113 GLN A HB3  1 
ATOM   1736  H  HG2  . GLN A  1 113 ? -60.743 -35.389 2.881   1.00 64.89  ?  113 GLN A HG2  1 
ATOM   1737  H  HG3  . GLN A  1 113 ? -60.285 -33.986 3.462   1.00 64.89  ?  113 GLN A HG3  1 
ATOM   1738  H  HE21 . GLN A  1 113 ? -58.271 -35.557 3.146   1.00 72.12  ?  113 GLN A HE21 1 
ATOM   1739  H  HE22 . GLN A  1 113 ? -57.772 -36.188 4.400   1.00 72.12  ?  113 GLN A HE22 1 
ATOM   1740  N  N    . GLY A  1 114 ? -64.799 -34.607 4.909   1.00 62.04  ?  114 GLY A N    1 
ATOM   1741  C  CA   . GLY A  1 114 ? -66.111 -34.548 5.510   1.00 75.78  ?  114 GLY A CA   1 
ATOM   1742  C  C    . GLY A  1 114 ? -66.164 -33.593 6.693   1.00 70.51  ?  114 GLY A C    1 
ATOM   1743  O  O    . GLY A  1 114 ? -65.182 -32.962 7.086   1.00 71.08  ?  114 GLY A O    1 
ATOM   1744  H  H    . GLY A  1 114 ? -64.406 -35.368 4.983   1.00 74.45  ?  114 GLY A H    1 
ATOM   1745  H  HA2  . GLY A  1 114 ? -66.757 -34.254 4.849   1.00 90.94  ?  114 GLY A HA2  1 
ATOM   1746  H  HA3  . GLY A  1 114 ? -66.366 -35.432 5.817   1.00 90.94  ?  114 GLY A HA3  1 
ATOM   1747  N  N    . ASP A  1 115 ? -67.377 -33.466 7.235   1.00 61.88  ?  115 ASP A N    1 
ATOM   1748  C  CA   . ASP A  1 115 ? -67.650 -32.858 8.534   1.00 53.81  ?  115 ASP A CA   1 
ATOM   1749  C  C    . ASP A  1 115 ? -66.754 -31.660 8.835   1.00 55.91  ?  115 ASP A C    1 
ATOM   1750  O  O    . ASP A  1 115 ? -65.844 -31.758 9.670   1.00 41.62  ?  115 ASP A O    1 
ATOM   1751  C  CB   . ASP A  1 115 ? -67.507 -33.920 9.627   1.00 55.25  ?  115 ASP A CB   1 
ATOM   1752  C  CG   . ASP A  1 115 ? -68.187 -33.519 10.925  1.00 59.45  ?  115 ASP A CG   1 
ATOM   1753  O  OD1  . ASP A  1 115 ? -68.544 -32.325 11.071  1.00 55.67  ?  115 ASP A OD1  1 
ATOM   1754  O  OD2  . ASP A  1 115 ? -68.369 -34.403 11.794  1.00 62.38  -1 115 ASP A OD2  1 
ATOM   1755  H  H    . ASP A  1 115 ? -68.092 -33.740 6.844   1.00 74.25  ?  115 ASP A H    1 
ATOM   1756  H  HA   . ASP A  1 115 ? -68.569 -32.547 8.544   1.00 64.57  ?  115 ASP A HA   1 
ATOM   1757  H  HB2  . ASP A  1 115 ? -67.911 -34.747 9.320   1.00 66.30  ?  115 ASP A HB2  1 
ATOM   1758  H  HB3  . ASP A  1 115 ? -66.565 -34.059 9.812   1.00 66.30  ?  115 ASP A HB3  1 
ATOM   1759  N  N    . GLU A  1 116 ? -67.030 -30.524 8.177   1.00 56.09  ?  116 GLU A N    1 
ATOM   1760  C  CA   . GLU A  1 116 ? -66.195 -29.330 8.323   1.00 53.87  ?  116 GLU A CA   1 
ATOM   1761  C  C    . GLU A  1 116 ? -66.178 -28.828 9.765   1.00 50.01  ?  116 GLU A C    1 
ATOM   1762  O  O    . GLU A  1 116 ? -65.127 -28.410 10.274  1.00 38.28  ?  116 GLU A O    1 
ATOM   1763  C  CB   . GLU A  1 116 ? -66.695 -28.214 7.396   1.00 54.30  ?  116 GLU A CB   1 
ATOM   1764  C  CG   . GLU A  1 116 ? -66.491 -28.461 5.898   1.00 65.04  ?  116 GLU A CG   1 
ATOM   1765  C  CD   . GLU A  1 116 ? -67.690 -29.123 5.212   1.00 63.65  ?  116 GLU A CD   1 
ATOM   1766  O  OE1  . GLU A  1 116 ? -68.709 -29.411 5.885   1.00 58.84  ?  116 GLU A OE1  1 
ATOM   1767  O  OE2  . GLU A  1 116 ? -67.604 -29.357 3.985   1.00 66.99  -1 116 GLU A OE2  1 
ATOM   1768  H  H    . GLU A  1 116 ? -67.695 -30.424 7.641   1.00 67.30  ?  116 GLU A H    1 
ATOM   1769  H  HA   . GLU A  1 116 ? -65.284 -29.547 8.069   1.00 64.64  ?  116 GLU A HA   1 
ATOM   1770  H  HB2  . GLU A  1 116 ? -67.647 -28.096 7.544   1.00 65.16  ?  116 GLU A HB2  1 
ATOM   1771  H  HB3  . GLU A  1 116 ? -66.228 -27.395 7.622   1.00 65.16  ?  116 GLU A HB3  1 
ATOM   1772  H  HG2  . GLU A  1 116 ? -66.330 -27.611 5.460   1.00 78.05  ?  116 GLU A HG2  1 
ATOM   1773  H  HG3  . GLU A  1 116 ? -65.723 -29.042 5.779   1.00 78.05  ?  116 GLU A HG3  1 
ATOM   1774  N  N    . ASP A  1 117 ? -67.337 -28.838 10.428  1.00 41.33  ?  117 ASP A N    1 
ATOM   1775  C  CA   . ASP A  1 117 ? -67.428 -28.305 11.783  1.00 50.11  ?  117 ASP A CA   1 
ATOM   1776  C  C    . ASP A  1 117 ? -66.548 -29.096 12.734  1.00 44.68  ?  117 ASP A C    1 
ATOM   1777  O  O    . ASP A  1 117 ? -65.811 -28.518 13.544  1.00 37.30  ?  117 ASP A O    1 
ATOM   1778  C  CB   . ASP A  1 117 ? -68.881 -28.330 12.263  1.00 51.30  ?  117 ASP A CB   1 
ATOM   1779  C  CG   . ASP A  1 117 ? -69.662 -27.089 11.847  1.00 56.02  ?  117 ASP A CG   1 
ATOM   1780  O  OD1  . ASP A  1 117 ? -69.138 -26.274 11.053  1.00 52.84  ?  117 ASP A OD1  1 
ATOM   1781  O  OD2  . ASP A  1 117 ? -70.801 -26.923 12.336  1.00 67.14  -1 117 ASP A OD2  1 
ATOM   1782  H  H    . ASP A  1 117 ? -68.078 -29.145 10.116  1.00 49.59  ?  117 ASP A H    1 
ATOM   1783  H  HA   . ASP A  1 117 ? -67.124 -27.384 11.784  1.00 60.13  ?  117 ASP A HA   1 
ATOM   1784  H  HB2  . ASP A  1 117 ? -69.326 -29.104 11.884  1.00 61.55  ?  117 ASP A HB2  1 
ATOM   1785  H  HB3  . ASP A  1 117 ? -68.893 -28.381 13.231  1.00 61.55  ?  117 ASP A HB3  1 
ATOM   1786  N  N    . ALA A  1 118 ? -66.623 -30.426 12.660  1.00 41.12  ?  118 ALA A N    1 
ATOM   1787  C  CA   . ALA A  1 118 ? -65.825 -31.271 13.544  1.00 39.73  ?  118 ALA A CA   1 
ATOM   1788  C  C    . ALA A  1 118 ? -64.338 -31.075 13.295  1.00 30.99  ?  118 ALA A C    1 
ATOM   1789  O  O    . ALA A  1 118 ? -63.537 -31.043 14.243  1.00 32.51  ?  118 ALA A O    1 
ATOM   1790  C  CB   . ALA A  1 118 ? -66.200 -32.740 13.347  1.00 39.95  ?  118 ALA A CB   1 
ATOM   1791  H  H    . ALA A  1 118 ? -67.124 -30.859 12.112  1.00 49.35  ?  118 ALA A H    1 
ATOM   1792  H  HA   . ALA A  1 118 ? -66.011 -31.032 14.466  1.00 47.68  ?  118 ALA A HA   1 
ATOM   1793  H  HB1  . ALA A  1 118 ? -65.660 -33.286 13.941  1.00 47.94  ?  118 ALA A HB1  1 
ATOM   1794  H  HB2  . ALA A  1 118 ? -67.140 -32.856 13.554  1.00 47.94  ?  118 ALA A HB2  1 
ATOM   1795  H  HB3  . ALA A  1 118 ? -66.030 -32.988 12.425  1.00 47.94  ?  118 ALA A HB3  1 
ATOM   1796  N  N    . ALA A  1 119 ? -63.948 -30.957 12.022  1.00 28.01  ?  119 ALA A N    1 
ATOM   1797  C  CA   . ALA A  1 119 ? -62.556 -30.704 11.690  1.00 29.94  ?  119 ALA A CA   1 
ATOM   1798  C  C    . ALA A  1 119 ? -62.096 -29.374 12.264  1.00 30.29  ?  119 ALA A C    1 
ATOM   1799  O  O    . ALA A  1 119 ? -60.957 -29.252 12.737  1.00 25.88  ?  119 ALA A O    1 
ATOM   1800  C  CB   . ALA A  1 119 ? -62.371 -30.715 10.175  1.00 37.57  ?  119 ALA A CB   1 
ATOM   1801  H  H    . ALA A  1 119 ? -64.470 -31.019 11.341  1.00 33.61  ?  119 ALA A H    1 
ATOM   1802  H  HA   . ALA A  1 119 ? -62.004 -31.406 12.069  1.00 35.92  ?  119 ALA A HA   1 
ATOM   1803  H  HB1  . ALA A  1 119 ? -61.438 -30.545 9.970   1.00 45.09  ?  119 ALA A HB1  1 
ATOM   1804  H  HB2  . ALA A  1 119 ? -62.632 -31.584 9.832   1.00 45.09  ?  119 ALA A HB2  1 
ATOM   1805  H  HB3  . ALA A  1 119 ? -62.927 -30.023 9.784   1.00 45.09  ?  119 ALA A HB3  1 
ATOM   1806  N  N    . LYS A  1 120 ? -62.970 -28.360 12.223  1.00 28.83  ?  120 LYS A N    1 
ATOM   1807  C  CA   . LYS A  1 120 ? -62.579 -27.044 12.730  1.00 30.93  ?  120 LYS A CA   1 
ATOM   1808  C  C    . LYS A  1 120 ? -62.423 -27.057 14.245  1.00 28.88  ?  120 LYS A C    1 
ATOM   1809  O  O    . LYS A  1 120 ? -61.522 -26.402 14.776  1.00 24.98  ?  120 LYS A O    1 
ATOM   1810  C  CB   . LYS A  1 120 ? -63.588 -25.976 12.290  1.00 32.41  ?  120 LYS A CB   1 
ATOM   1811  C  CG   . LYS A  1 120 ? -63.377 -25.516 10.826  1.00 35.53  ?  120 LYS A CG   1 
ATOM   1812  C  CD   . LYS A  1 120 ? -64.345 -24.374 10.457  1.00 33.16  ?  120 LYS A CD   1 
ATOM   1813  C  CE   . LYS A  1 120 ? -63.976 -23.731 9.142   1.00 35.02  ?  120 LYS A CE   1 
ATOM   1814  N  NZ   . LYS A  1 120 ? -65.130 -22.984 8.547   1.00 41.13  1  120 LYS A NZ   1 
ATOM   1815  H  H    . LYS A  1 120 ? -63.771 -28.407 11.916  1.00 34.59  ?  120 LYS A H    1 
ATOM   1816  H  HA   . LYS A  1 120 ? -61.719 -26.809 12.349  1.00 37.11  ?  120 LYS A HA   1 
ATOM   1817  H  HB2  . LYS A  1 120 ? -64.485 -26.339 12.364  1.00 38.89  ?  120 LYS A HB2  1 
ATOM   1818  H  HB3  . LYS A  1 120 ? -63.496 -25.199 12.864  1.00 38.89  ?  120 LYS A HB3  1 
ATOM   1819  H  HG2  . LYS A  1 120 ? -62.469 -25.193 10.719  1.00 42.63  ?  120 LYS A HG2  1 
ATOM   1820  H  HG3  . LYS A  1 120 ? -63.542 -26.262 10.228  1.00 42.63  ?  120 LYS A HG3  1 
ATOM   1821  H  HD2  . LYS A  1 120 ? -65.244 -24.730 10.378  1.00 39.79  ?  120 LYS A HD2  1 
ATOM   1822  H  HD3  . LYS A  1 120 ? -64.314 -23.692 11.146  1.00 39.79  ?  120 LYS A HD3  1 
ATOM   1823  H  HE2  . LYS A  1 120 ? -63.250 -23.104 9.286   1.00 42.03  ?  120 LYS A HE2  1 
ATOM   1824  H  HE3  . LYS A  1 120 ? -63.704 -24.420 8.515   1.00 42.03  ?  120 LYS A HE3  1 
ATOM   1825  H  HZ1  . LYS A  1 120 ? -64.888 -22.615 7.774   1.00 49.36  ?  120 LYS A HZ1  1 
ATOM   1826  H  HZ2  . LYS A  1 120 ? -65.810 -23.540 8.401   1.00 49.36  ?  120 LYS A HZ2  1 
ATOM   1827  H  HZ3  . LYS A  1 120 ? -65.396 -22.342 9.103   1.00 49.36  ?  120 LYS A HZ3  1 
ATOM   1828  N  N    . LYS A  1 121 ? -63.281 -27.789 14.962  1.00 27.34  ?  121 LYS A N    1 
ATOM   1829  C  CA   . LYS A  1 121 ? -63.109 -27.922 16.411  1.00 24.64  ?  121 LYS A CA   1 
ATOM   1830  C  C    . LYS A  1 121 ? -61.794 -28.611 16.755  1.00 25.89  ?  121 LYS A C    1 
ATOM   1831  O  O    . LYS A  1 121 ? -61.081 -28.194 17.678  1.00 27.60  ?  121 LYS A O    1 
ATOM   1832  C  CB   . LYS A  1 121 ? -64.279 -28.698 17.013  1.00 40.18  ?  121 LYS A CB   1 
ATOM   1833  C  CG   . LYS A  1 121 ? -65.634 -28.033 16.818  1.00 42.74  ?  121 LYS A CG   1 
ATOM   1834  C  CD   . LYS A  1 121 ? -65.729 -26.676 17.529  1.00 57.50  ?  121 LYS A CD   1 
ATOM   1835  C  CE   . LYS A  1 121 ? -66.987 -25.914 17.116  1.00 61.90  ?  121 LYS A CE   1 
ATOM   1836  N  NZ   . LYS A  1 121 ? -67.087 -24.589 17.782  1.00 65.49  1  121 LYS A NZ   1 
ATOM   1837  H  H    . LYS A  1 121 ? -63.958 -28.211 14.641  1.00 32.80  ?  121 LYS A H    1 
ATOM   1838  H  HA   . LYS A  1 121 ? -63.098 -27.038 16.810  1.00 29.57  ?  121 LYS A HA   1 
ATOM   1839  H  HB2  . LYS A  1 121 ? -64.318 -29.574 16.598  1.00 48.22  ?  121 LYS A HB2  1 
ATOM   1840  H  HB3  . LYS A  1 121 ? -64.131 -28.794 17.967  1.00 48.22  ?  121 LYS A HB3  1 
ATOM   1841  H  HG2  . LYS A  1 121 ? -65.783 -27.887 15.871  1.00 51.29  ?  121 LYS A HG2  1 
ATOM   1842  H  HG3  . LYS A  1 121 ? -66.325 -28.611 17.178  1.00 51.29  ?  121 LYS A HG3  1 
ATOM   1843  H  HD2  . LYS A  1 121 ? -65.762 -26.819 18.488  1.00 69.00  ?  121 LYS A HD2  1 
ATOM   1844  H  HD3  . LYS A  1 121 ? -64.957 -26.138 17.296  1.00 69.00  ?  121 LYS A HD3  1 
ATOM   1845  H  HE2  . LYS A  1 121 ? -66.970 -25.769 16.157  1.00 74.28  ?  121 LYS A HE2  1 
ATOM   1846  H  HE3  . LYS A  1 121 ? -67.769 -26.434 17.360  1.00 74.28  ?  121 LYS A HE3  1 
ATOM   1847  H  HZ1  . LYS A  1 121 ? -66.383 -24.088 17.569  1.00 78.58  ?  121 LYS A HZ1  1 
ATOM   1848  H  HZ2  . LYS A  1 121 ? -67.828 -24.172 17.520  1.00 78.58  ?  121 LYS A HZ2  1 
ATOM   1849  H  HZ3  . LYS A  1 121 ? -67.110 -24.694 18.665  1.00 78.58  ?  121 LYS A HZ3  1 
ATOM   1850  N  N    . LYS A  1 122 ? -61.454 -29.663 16.010  1.00 26.88  ?  122 LYS A N    1 
ATOM   1851  C  CA   . LYS A  1 122 ? -60.177 -30.337 16.201  1.00 25.81  ?  122 LYS A CA   1 
ATOM   1852  C  C    . LYS A  1 122 ? -59.011 -29.403 15.874  1.00 21.55  ?  122 LYS A C    1 
ATOM   1853  O  O    . LYS A  1 122 ? -58.005 -29.360 16.604  1.00 23.00  ?  122 LYS A O    1 
ATOM   1854  C  CB   . LYS A  1 122 ? -60.135 -31.588 15.322  1.00 32.43  ?  122 LYS A CB   1 
ATOM   1855  C  CG   . LYS A  1 122 ? -58.792 -32.300 15.296  1.00 42.64  ?  122 LYS A CG   1 
ATOM   1856  C  CD   . LYS A  1 122 ? -58.893 -33.621 14.524  1.00 60.97  ?  122 LYS A CD   1 
ATOM   1857  C  CE   . LYS A  1 122 ? -57.520 -34.245 14.280  1.00 67.93  ?  122 LYS A CE   1 
ATOM   1858  N  NZ   . LYS A  1 122 ? -56.691 -33.421 13.348  1.00 65.97  1  122 LYS A NZ   1 
ATOM   1859  H  H    . LYS A  1 122 ? -61.944 -30.002 15.391  1.00 32.26  ?  122 LYS A H    1 
ATOM   1860  H  HA   . LYS A  1 122 ? -60.096 -30.613 17.128  1.00 30.97  ?  122 LYS A HA   1 
ATOM   1861  H  HB2  . LYS A  1 122 ? -60.795 -32.219 15.649  1.00 38.92  ?  122 LYS A HB2  1 
ATOM   1862  H  HB3  . LYS A  1 122 ? -60.350 -31.333 14.411  1.00 38.92  ?  122 LYS A HB3  1 
ATOM   1863  H  HG2  . LYS A  1 122 ? -58.137 -31.737 14.855  1.00 51.17  ?  122 LYS A HG2  1 
ATOM   1864  H  HG3  . LYS A  1 122 ? -58.513 -32.496 16.204  1.00 51.17  ?  122 LYS A HG3  1 
ATOM   1865  H  HD2  . LYS A  1 122 ? -59.424 -34.249 15.037  1.00 73.17  ?  122 LYS A HD2  1 
ATOM   1866  H  HD3  . LYS A  1 122 ? -59.308 -33.456 13.663  1.00 73.17  ?  122 LYS A HD3  1 
ATOM   1867  H  HE2  . LYS A  1 122 ? -57.046 -34.316 15.124  1.00 81.52  ?  122 LYS A HE2  1 
ATOM   1868  H  HE3  . LYS A  1 122 ? -57.635 -35.124 13.886  1.00 81.52  ?  122 LYS A HE3  1 
ATOM   1869  H  HZ1  . LYS A  1 122 ? -56.567 -32.609 13.689  1.00 79.16  ?  122 LYS A HZ1  1 
ATOM   1870  H  HZ2  . LYS A  1 122 ? -55.899 -33.807 13.223  1.00 79.16  ?  122 LYS A HZ2  1 
ATOM   1871  H  HZ3  . LYS A  1 122 ? -57.103 -33.345 12.562  1.00 79.16  ?  122 LYS A HZ3  1 
ATOM   1872  N  N    . LEU A  1 123 ? -59.125 -28.661 14.764  1.00 22.18  ?  123 LEU A N    1 
ATOM   1873  C  CA   . LEU A  1 123 ? -58.060 -27.739 14.396  1.00 20.01  ?  123 LEU A CA   1 
ATOM   1874  C  C    . LEU A  1 123 ? -57.936 -26.613 15.413  1.00 18.31  ?  123 LEU A C    1 
ATOM   1875  O  O    . LEU A  1 123 ? -56.813 -26.195 15.713  1.00 20.48  ?  123 LEU A O    1 
ATOM   1876  C  CB   . LEU A  1 123 ? -58.278 -27.182 12.990  1.00 26.14  ?  123 LEU A CB   1 
ATOM   1877  C  CG   . LEU A  1 123 ? -57.937 -28.162 11.853  1.00 33.03  ?  123 LEU A CG   1 
ATOM   1878  C  CD1  . LEU A  1 123 ? -58.212 -27.532 10.510  1.00 39.31  ?  123 LEU A CD1  1 
ATOM   1879  C  CD2  . LEU A  1 123 ? -56.500 -28.663 11.910  1.00 36.79  ?  123 LEU A CD2  1 
ATOM   1880  H  H    . LEU A  1 123 ? -59.794 -28.675 14.224  1.00 26.61  ?  123 LEU A H    1 
ATOM   1881  H  HA   . LEU A  1 123 ? -57.220 -28.224 14.392  1.00 24.01  ?  123 LEU A HA   1 
ATOM   1882  H  HB2  . LEU A  1 123 ? -59.212 -26.935 12.896  1.00 31.37  ?  123 LEU A HB2  1 
ATOM   1883  H  HB3  . LEU A  1 123 ? -57.720 -26.396 12.878  1.00 31.37  ?  123 LEU A HB3  1 
ATOM   1884  H  HG   . LEU A  1 123 ? -58.517 -28.936 11.933  1.00 39.63  ?  123 LEU A HG   1 
ATOM   1885  H  HD11 . LEU A  1 123 ? -57.990 -28.167 9.812   1.00 47.17  ?  123 LEU A HD11 1 
ATOM   1886  H  HD12 . LEU A  1 123 ? -59.152 -27.297 10.458  1.00 47.17  ?  123 LEU A HD12 1 
ATOM   1887  H  HD13 . LEU A  1 123 ? -57.666 -26.735 10.419  1.00 47.17  ?  123 LEU A HD13 1 
ATOM   1888  H  HD21 . LEU A  1 123 ? -56.349 -29.274 11.172  1.00 44.15  ?  123 LEU A HD21 1 
ATOM   1889  H  HD22 . LEU A  1 123 ? -55.899 -27.905 11.841  1.00 44.15  ?  123 LEU A HD22 1 
ATOM   1890  H  HD23 . LEU A  1 123 ? -56.359 -29.122 12.753  1.00 44.15  ?  123 LEU A HD23 1 
ATOM   1891  N  N    . ASN A  1 124 ? -59.050 -26.166 15.992  1.00 21.14  ?  124 ASN A N    1 
ATOM   1892  C  CA   . ASN A  1 124 ? -58.980 -25.123 17.019  1.00 18.01  ?  124 ASN A CA   1 
ATOM   1893  C  C    . ASN A  1 124 ? -58.063 -25.555 18.165  1.00 19.48  ?  124 ASN A C    1 
ATOM   1894  O  O    . ASN A  1 124 ? -57.174 -24.806 18.587  1.00 19.35  ?  124 ASN A O    1 
ATOM   1895  C  CB   . ASN A  1 124 ? -60.376 -24.804 17.532  1.00 21.61  ?  124 ASN A CB   1 
ATOM   1896  C  CG   . ASN A  1 124 ? -60.352 -23.839 18.709  1.00 20.94  ?  124 ASN A CG   1 
ATOM   1897  O  OD1  . ASN A  1 124 ? -59.846 -22.715 18.591  1.00 22.32  ?  124 ASN A OD1  1 
ATOM   1898  N  ND2  . ASN A  1 124 ? -60.921 -24.251 19.833  1.00 23.07  ?  124 ASN A ND2  1 
ATOM   1899  H  H    . ASN A  1 124 ? -59.844 -26.443 15.814  1.00 25.37  ?  124 ASN A H    1 
ATOM   1900  H  HA   . ASN A  1 124 ? -58.612 -24.316 16.626  1.00 21.61  ?  124 ASN A HA   1 
ATOM   1901  H  HB2  . ASN A  1 124 ? -60.891 -24.396 16.819  1.00 25.93  ?  124 ASN A HB2  1 
ATOM   1902  H  HB3  . ASN A  1 124 ? -60.802 -25.625 17.825  1.00 25.93  ?  124 ASN A HB3  1 
ATOM   1903  H  HD21 . ASN A  1 124 ? -60.930 -23.738 20.523  1.00 27.68  ?  124 ASN A HD21 1 
ATOM   1904  H  HD22 . ASN A  1 124 ? -61.280 -25.031 19.872  1.00 27.68  ?  124 ASN A HD22 1 
ATOM   1905  N  N    . LEU A  1 125 ? -58.237 -26.779 18.656  1.00 18.96  ?  125 LEU A N    1 
ATOM   1906  C  CA   . LEU A  1 125 ? -57.399 -27.229 19.759  1.00 20.52  ?  125 LEU A CA   1 
ATOM   1907  C  C    . LEU A  1 125 ? -55.956 -27.381 19.317  1.00 18.56  ?  125 LEU A C    1 
ATOM   1908  O  O    . LEU A  1 125 ? -55.035 -27.030 20.070  1.00 19.75  ?  125 LEU A O    1 
ATOM   1909  C  CB   . LEU A  1 125 ? -57.930 -28.548 20.326  1.00 22.86  ?  125 LEU A CB   1 
ATOM   1910  C  CG   . LEU A  1 125 ? -59.335 -28.474 20.888  1.00 27.65  ?  125 LEU A CG   1 
ATOM   1911  C  CD1  . LEU A  1 125 ? -59.710 -29.828 21.507  1.00 31.48  ?  125 LEU A CD1  1 
ATOM   1912  C  CD2  . LEU A  1 125 ? -59.545 -27.355 21.912  1.00 28.48  ?  125 LEU A CD2  1 
ATOM   1913  H  H    . LEU A  1 125 ? -58.815 -27.351 18.378  1.00 22.75  ?  125 LEU A H    1 
ATOM   1914  H  HA   . LEU A  1 125 ? -57.427 -26.567 20.467  1.00 24.62  ?  125 LEU A HA   1 
ATOM   1915  H  HB2  . LEU A  1 125 ? -57.931 -29.211 19.618  1.00 27.43  ?  125 LEU A HB2  1 
ATOM   1916  H  HB3  . LEU A  1 125 ? -57.342 -28.836 21.041  1.00 27.43  ?  125 LEU A HB3  1 
ATOM   1917  H  HG   . LEU A  1 125 ? -59.948 -28.312 20.154  1.00 33.19  ?  125 LEU A HG   1 
ATOM   1918  H  HD11 . LEU A  1 125 ? -60.610 -29.773 21.864  1.00 37.78  ?  125 LEU A HD11 1 
ATOM   1919  H  HD12 . LEU A  1 125 ? -59.667 -30.511 20.819  1.00 37.78  ?  125 LEU A HD12 1 
ATOM   1920  H  HD13 . LEU A  1 125 ? -59.083 -30.034 22.218  1.00 37.78  ?  125 LEU A HD13 1 
ATOM   1921  H  HD21 . LEU A  1 125 ? -60.464 -27.378 22.220  1.00 34.18  ?  125 LEU A HD21 1 
ATOM   1922  H  HD22 . LEU A  1 125 ? -58.942 -27.494 22.659  1.00 34.18  ?  125 LEU A HD22 1 
ATOM   1923  H  HD23 . LEU A  1 125 ? -59.358 -26.502 21.490  1.00 34.18  ?  125 LEU A HD23 1 
HETATM 1924  N  N    . MSE A  1 126 ? -55.721 -27.868 18.090  1.00 20.40  ?  126 MSE A N    1 
HETATM 1925  C  CA   A MSE A  1 126 ? -54.368 -27.977 17.529  0.47 20.57  ?  126 MSE A CA   1 
HETATM 1926  C  CA   B MSE A  1 126 ? -54.355 -27.978 17.626  0.53 21.16  ?  126 MSE A CA   1 
HETATM 1927  C  C    . MSE A  1 126 ? -53.691 -26.612 17.480  1.00 20.87  ?  126 MSE A C    1 
HETATM 1928  O  O    . MSE A  1 126 ? -52.496 -26.471 17.810  1.00 21.67  ?  126 MSE A O    1 
HETATM 1929  C  CB   A MSE A  1 126 ? -54.395 -28.594 16.113  0.47 24.67  ?  126 MSE A CB   1 
HETATM 1930  C  CB   B MSE A  1 126 ? -54.301 -28.746 16.318  0.53 25.20  ?  126 MSE A CB   1 
HETATM 1931  C  CG   A MSE A  1 126 ? -53.033 -28.648 15.388  0.47 27.14  ?  126 MSE A CG   1 
HETATM 1932  C  CG   B MSE A  1 126 ? -54.775 -30.153 16.506  0.53 32.05  ?  126 MSE A CG   1 
HETATM 1933  SE SE   A MSE A  1 126 ? -53.225 -29.162 13.512  0.47 38.13  ?  126 MSE A SE   1 
HETATM 1934  SE SE   B MSE A  1 126 ? -54.841 -31.077 14.829  0.53 54.53  ?  126 MSE A SE   1 
HETATM 1935  C  CE   A MSE A  1 126 ? -53.873 -30.984 13.754  0.47 47.38  ?  126 MSE A CE   1 
HETATM 1936  C  CE   B MSE A  1 126 ? -52.966 -30.786 14.345  0.53 39.32  ?  126 MSE A CE   1 
HETATM 1937  H  H    A MSE A  1 126 ? -56.338 -28.145 17.558  0.47 24.47  ?  126 MSE A H    1 
HETATM 1938  H  H    B MSE A  1 126 ? -56.321 -28.130 17.532  0.53 24.47  ?  126 MSE A H    1 
HETATM 1939  H  HA   A MSE A  1 126 ? -53.844 -28.564 18.095  0.47 24.69  ?  126 MSE A HA   1 
HETATM 1940  H  HA   B MSE A  1 126 ? -53.853 -28.490 18.280  0.53 25.39  ?  126 MSE A HA   1 
HETATM 1941  H  HB2  A MSE A  1 126 ? -54.725 -29.503 16.180  0.47 29.61  ?  126 MSE A HB2  1 
HETATM 1942  H  HB2  B MSE A  1 126 ? -54.876 -28.314 15.667  0.53 30.24  ?  126 MSE A HB2  1 
HETATM 1943  H  HB3  A MSE A  1 126 ? -54.997 -28.070 15.561  0.47 29.61  ?  126 MSE A HB3  1 
HETATM 1944  H  HB3  B MSE A  1 126 ? -53.387 -28.771 15.997  0.53 30.24  ?  126 MSE A HB3  1 
HETATM 1945  H  HG2  A MSE A  1 126 ? -52.619 -27.772 15.421  0.47 32.57  ?  126 MSE A HG2  1 
HETATM 1946  H  HG2  B MSE A  1 126 ? -54.162 -30.624 17.092  0.53 38.47  ?  126 MSE A HG2  1 
HETATM 1947  H  HG3  A MSE A  1 126 ? -52.465 -29.303 15.825  0.47 32.57  ?  126 MSE A HG3  1 
HETATM 1948  H  HG3  B MSE A  1 126 ? -55.667 -30.144 16.887  0.53 38.47  ?  126 MSE A HG3  1 
HETATM 1949  H  HE1  A MSE A  1 126 ? -54.020 -31.384 12.883  0.47 56.86  ?  126 MSE A HE1  1 
HETATM 1950  H  HE1  B MSE A  1 126 ? -52.794 -31.200 13.484  0.53 47.19  ?  126 MSE A HE1  1 
HETATM 1951  H  HE2  A MSE A  1 126 ? -53.209 -31.492 14.245  0.47 56.86  ?  126 MSE A HE2  1 
HETATM 1952  H  HE2  B MSE A  1 126 ? -52.798 -29.832 14.292  0.53 47.19  ?  126 MSE A HE2  1 
HETATM 1953  H  HE3  A MSE A  1 126 ? -54.706 -30.958 14.252  0.47 56.86  ?  126 MSE A HE3  1 
HETATM 1954  H  HE3  B MSE A  1 126 ? -52.399 -31.185 15.023  0.53 47.19  ?  126 MSE A HE3  1 
ATOM   1955  N  N    . GLY A  1 127 ? -54.446 -25.608 17.027  1.00 19.58  ?  127 GLY A N    1 
ATOM   1956  C  CA   . GLY A  1 127 ? -53.869 -24.283 16.868  1.00 19.75  ?  127 GLY A CA   1 
ATOM   1957  C  C    . GLY A  1 127 ? -53.481 -23.665 18.196  1.00 17.35  ?  127 GLY A C    1 
ATOM   1958  O  O    . GLY A  1 127 ? -52.480 -22.968 18.289  1.00 18.36  ?  127 GLY A O    1 
ATOM   1959  H  H    . GLY A  1 127 ? -55.276 -25.671 16.810  1.00 23.49  ?  127 GLY A H    1 
ATOM   1960  H  HA2  . GLY A  1 127 ? -53.077 -24.339 16.312  1.00 23.70  ?  127 GLY A HA2  1 
ATOM   1961  H  HA3  . GLY A  1 127 ? -54.511 -23.700 16.433  1.00 23.70  ?  127 GLY A HA3  1 
ATOM   1962  N  N    . ARG A  1 128 ? -54.294 -23.885 19.224  1.00 17.18  ?  128 ARG A N    1 
ATOM   1963  C  CA   . ARG A  1 128 ? -53.990 -23.336 20.535  1.00 17.57  ?  128 ARG A CA   1 
ATOM   1964  C  C    . ARG A  1 128 ? -52.705 -23.931 21.083  1.00 16.87  ?  128 ARG A C    1 
ATOM   1965  O  O    . ARG A  1 128 ? -51.908 -23.225 21.695  1.00 18.73  ?  128 ARG A O    1 
ATOM   1966  C  CB   . ARG A  1 128 ? -55.171 -23.582 21.479  1.00 18.38  ?  128 ARG A CB   1 
ATOM   1967  C  CG   . ARG A  1 128 ? -56.478 -22.825 21.088  1.00 17.46  ?  128 ARG A CG   1 
ATOM   1968  C  CD   . ARG A  1 128 ? -57.652 -23.206 21.949  1.00 18.80  ?  128 ARG A CD   1 
ATOM   1969  N  NE   . ARG A  1 128 ? -57.394 -22.849 23.343  1.00 19.24  ?  128 ARG A NE   1 
ATOM   1970  C  CZ   . ARG A  1 128 ? -57.790 -21.732 23.930  1.00 19.91  ?  128 ARG A CZ   1 
ATOM   1971  N  NH1  . ARG A  1 128 ? -58.509 -20.820 23.270  1.00 20.48  1  128 ARG A NH1  1 
ATOM   1972  N  NH2  . ARG A  1 128 ? -57.465 -21.529 25.203  1.00 21.06  ?  128 ARG A NH2  1 
ATOM   1973  H  H    . ARG A  1 128 ? -55.021 -24.343 19.188  1.00 20.61  ?  128 ARG A H    1 
ATOM   1974  H  HA   . ARG A  1 128 ? -53.866 -22.378 20.455  1.00 21.09  ?  128 ARG A HA   1 
ATOM   1975  H  HB2  . ARG A  1 128 ? -55.372 -24.531 21.485  1.00 22.05  ?  128 ARG A HB2  1 
ATOM   1976  H  HB3  . ARG A  1 128 ? -54.921 -23.295 22.371  1.00 22.05  ?  128 ARG A HB3  1 
ATOM   1977  H  HG2  . ARG A  1 128 ? -56.331 -21.871 21.185  1.00 20.95  ?  128 ARG A HG2  1 
ATOM   1978  H  HG3  . ARG A  1 128 ? -56.700 -23.035 20.167  1.00 20.95  ?  128 ARG A HG3  1 
ATOM   1979  H  HD2  . ARG A  1 128 ? -58.441 -22.728 21.650  1.00 22.56  ?  128 ARG A HD2  1 
ATOM   1980  H  HD3  . ARG A  1 128 ? -57.795 -24.164 21.897  1.00 22.56  ?  128 ARG A HD3  1 
ATOM   1981  H  HE   . ARG A  1 128 ? -56.948 -23.410 23.818  1.00 23.08  ?  128 ARG A HE   1 
ATOM   1982  H  HH11 . ARG A  1 128 ? -58.715 -20.950 22.445  1.00 24.57  ?  128 ARG A HH11 1 
ATOM   1983  H  HH12 . ARG A  1 128 ? -58.762 -20.101 23.669  1.00 24.57  ?  128 ARG A HH12 1 
ATOM   1984  H  HH21 . ARG A  1 128 ? -57.007 -22.119 25.629  1.00 25.27  ?  128 ARG A HH21 1 
ATOM   1985  H  HH22 . ARG A  1 128 ? -57.723 -20.813 25.604  1.00 25.27  ?  128 ARG A HH22 1 
ATOM   1986  N  N    . LYS A  1 129 ? -52.482 -25.232 20.860  1.00 17.75  ?  129 LYS A N    1 
ATOM   1987  C  CA   . LYS A  1 129 ? -51.239 -25.848 21.319  1.00 19.76  ?  129 LYS A CA   1 
ATOM   1988  C  C    . LYS A  1 129 ? -50.056 -25.414 20.465  1.00 17.15  ?  129 LYS A C    1 
ATOM   1989  O  O    . LYS A  1 129 ? -48.941 -25.222 20.984  1.00 20.01  ?  129 LYS A O    1 
ATOM   1990  C  CB   . LYS A  1 129 ? -51.363 -27.374 21.343  1.00 21.02  ?  129 LYS A CB   1 
ATOM   1991  C  CG   . LYS A  1 129 ? -52.259 -27.840 22.476  1.00 29.68  ?  129 LYS A CG   1 
ATOM   1992  C  CD   . LYS A  1 129 ? -52.224 -29.362 22.636  1.00 43.34  ?  129 LYS A CD   1 
ATOM   1993  C  CE   . LYS A  1 129 ? -53.274 -30.035 21.773  1.00 50.78  ?  129 LYS A CE   1 
ATOM   1994  N  NZ   . LYS A  1 129 ? -53.404 -31.492 22.087  1.00 63.43  1  129 LYS A NZ   1 
ATOM   1995  H  H    . LYS A  1 129 ? -53.021 -25.764 20.455  1.00 21.30  ?  129 LYS A H    1 
ATOM   1996  H  HA   . LYS A  1 129 ? -51.066 -25.555 22.228  1.00 23.71  ?  129 LYS A HA   1 
ATOM   1997  H  HB2  . LYS A  1 129 ? -51.749 -27.677 20.506  1.00 25.22  ?  129 LYS A HB2  1 
ATOM   1998  H  HB3  . LYS A  1 129 ? -50.485 -27.765 21.469  1.00 25.22  ?  129 LYS A HB3  1 
ATOM   1999  H  HG2  . LYS A  1 129 ? -51.956 -27.441 23.307  1.00 35.62  ?  129 LYS A HG2  1 
ATOM   2000  H  HG3  . LYS A  1 129 ? -53.173 -27.575 22.290  1.00 35.62  ?  129 LYS A HG3  1 
ATOM   2001  H  HD2  . LYS A  1 129 ? -51.353 -29.692 22.367  1.00 52.00  ?  129 LYS A HD2  1 
ATOM   2002  H  HD3  . LYS A  1 129 ? -52.400 -29.590 23.562  1.00 52.00  ?  129 LYS A HD3  1 
ATOM   2003  H  HE2  . LYS A  1 129 ? -54.134 -29.613 21.930  1.00 60.94  ?  129 LYS A HE2  1 
ATOM   2004  H  HE3  . LYS A  1 129 ? -53.024 -29.947 20.840  1.00 60.94  ?  129 LYS A HE3  1 
ATOM   2005  H  HZ1  . LYS A  1 129 ? -54.025 -31.860 21.567  1.00 76.11  ?  129 LYS A HZ1  1 
ATOM   2006  H  HZ2  . LYS A  1 129 ? -52.628 -31.903 21.946  1.00 76.11  ?  129 LYS A HZ2  1 
ATOM   2007  H  HZ3  . LYS A  1 129 ? -53.638 -31.599 22.939  1.00 76.11  ?  129 LYS A HZ3  1 
ATOM   2008  N  N    . ALA A  1 130 ? -50.279 -25.254 19.157  1.00 18.24  ?  130 ALA A N    1 
ATOM   2009  C  CA   . ALA A  1 130 ? -49.207 -24.827 18.267  1.00 17.58  ?  130 ALA A CA   1 
ATOM   2010  C  C    . ALA A  1 130 ? -48.675 -23.451 18.643  1.00 17.43  ?  130 ALA A C    1 
ATOM   2011  O  O    . ALA A  1 130 ? -47.464 -23.215 18.592  1.00 16.49  ?  130 ALA A O    1 
ATOM   2012  C  CB   . ALA A  1 130 ? -49.681 -24.837 16.804  1.00 18.33  ?  130 ALA A CB   1 
ATOM   2013  H  H    . ALA A  1 130 ? -51.035 -25.386 18.768  1.00 21.89  ?  130 ALA A H    1 
ATOM   2014  H  HA   . ALA A  1 130 ? -48.473 -25.456 18.343  1.00 21.10  ?  130 ALA A HA   1 
ATOM   2015  H  HB1  . ALA A  1 130 ? -48.950 -24.550 16.234  1.00 21.99  ?  130 ALA A HB1  1 
ATOM   2016  H  HB2  . ALA A  1 130 ? -49.951 -25.738 16.567  1.00 21.99  ?  130 ALA A HB2  1 
ATOM   2017  H  HB3  . ALA A  1 130 ? -50.432 -24.231 16.711  1.00 21.99  ?  130 ALA A HB3  1 
ATOM   2018  N  N    . LYS A  1 131 ? -49.553 -22.536 19.047  1.00 16.05  ?  131 LYS A N    1 
ATOM   2019  C  CA   . LYS A  1 131 ? -49.155 -21.170 19.339  1.00 15.23  ?  131 LYS A CA   1 
ATOM   2020  C  C    . LYS A  1 131 ? -48.200 -21.119 20.528  1.00 14.87  ?  131 LYS A C    1 
ATOM   2021  O  O    . LYS A  1 131 ? -47.319 -20.255 20.579  1.00 16.53  ?  131 LYS A O    1 
ATOM   2022  C  CB   . LYS A  1 131 ? -50.375 -20.303 19.609  1.00 17.24  ?  131 LYS A CB   1 
ATOM   2023  C  CG   . LYS A  1 131 ? -50.047 -18.852 19.739  1.00 20.81  ?  131 LYS A CG   1 
ATOM   2024  C  CD   . LYS A  1 131 ? -51.301 -17.969 19.648  1.00 26.91  ?  131 LYS A CD   1 
ATOM   2025  C  CE   . LYS A  1 131 ? -50.916 -16.487 19.612  1.00 29.97  ?  131 LYS A CE   1 
ATOM   2026  N  NZ   . LYS A  1 131 ? -52.136 -15.611 19.517  1.00 31.18  1  131 LYS A NZ   1 
ATOM   2027  H  H    . LYS A  1 131 ? -50.392 -22.687 19.160  1.00 19.26  ?  131 LYS A H    1 
ATOM   2028  H  HA   . LYS A  1 131 ? -48.693 -20.805 18.569  1.00 18.27  ?  131 LYS A HA   1 
ATOM   2029  H  HB2  . LYS A  1 131 ? -51.001 -20.404 18.875  1.00 20.68  ?  131 LYS A HB2  1 
ATOM   2030  H  HB3  . LYS A  1 131 ? -50.789 -20.591 20.438  1.00 20.68  ?  131 LYS A HB3  1 
ATOM   2031  H  HG2  . LYS A  1 131 ? -49.629 -18.696 20.600  1.00 24.97  ?  131 LYS A HG2  1 
ATOM   2032  H  HG3  . LYS A  1 131 ? -49.445 -18.597 19.023  1.00 24.97  ?  131 LYS A HG3  1 
ATOM   2033  H  HD2  . LYS A  1 131 ? -51.786 -18.179 18.835  1.00 32.29  ?  131 LYS A HD2  1 
ATOM   2034  H  HD3  . LYS A  1 131 ? -51.861 -18.121 20.425  1.00 32.29  ?  131 LYS A HD3  1 
ATOM   2035  H  HE2  . LYS A  1 131 ? -50.439 -16.260 20.425  1.00 35.96  ?  131 LYS A HE2  1 
ATOM   2036  H  HE3  . LYS A  1 131 ? -50.359 -16.319 18.836  1.00 35.96  ?  131 LYS A HE3  1 
ATOM   2037  H  HZ1  . LYS A  1 131 ? -52.590 -15.801 18.776  1.00 37.41  ?  131 LYS A HZ1  1 
ATOM   2038  H  HZ2  . LYS A  1 131 ? -52.663 -15.747 20.222  1.00 37.41  ?  131 LYS A HZ2  1 
ATOM   2039  H  HZ3  . LYS A  1 131 ? -51.895 -14.755 19.497  1.00 37.41  ?  131 LYS A HZ3  1 
ATOM   2040  N  N    . LEU A  1 132 ? -48.328 -22.089 21.435  1.00 16.00  ?  132 LEU A N    1 
ATOM   2041  C  CA   . LEU A  1 132 ? -47.475 -22.183 22.619  1.00 15.48  ?  132 LEU A CA   1 
ATOM   2042  C  C    . LEU A  1 132 ? -46.100 -22.741 22.336  1.00 16.22  ?  132 LEU A C    1 
ATOM   2043  O  O    . LEU A  1 132 ? -45.243 -22.721 23.243  1.00 17.42  ?  132 LEU A O    1 
ATOM   2044  C  CB   . LEU A  1 132 ? -48.180 -23.041 23.657  1.00 16.30  ?  132 LEU A CB   1 
ATOM   2045  C  CG   . LEU A  1 132 ? -49.501 -22.466 24.193  1.00 16.37  ?  132 LEU A CG   1 
ATOM   2046  C  CD1  . LEU A  1 132 ? -50.242 -23.514 25.075  1.00 18.54  ?  132 LEU A CD1  1 
ATOM   2047  C  CD2  . LEU A  1 132 ? -49.347 -21.138 24.930  1.00 19.65  ?  132 LEU A CD2  1 
ATOM   2048  H  H    . LEU A  1 132 ? -48.914 -22.716 21.384  1.00 19.20  ?  132 LEU A H    1 
ATOM   2049  H  HA   . LEU A  1 132 ? -47.363 -21.295 22.994  1.00 18.58  ?  132 LEU A HA   1 
ATOM   2050  H  HB2  . LEU A  1 132 ? -48.376 -23.904 23.261  1.00 19.56  ?  132 LEU A HB2  1 
ATOM   2051  H  HB3  . LEU A  1 132 ? -47.585 -23.159 24.414  1.00 19.56  ?  132 LEU A HB3  1 
ATOM   2052  H  HG   . LEU A  1 132 ? -50.074 -22.293 23.430  1.00 19.65  ?  132 LEU A HG   1 
ATOM   2053  H  HD11 . LEU A  1 132 ? -51.070 -23.126 25.399  1.00 22.24  ?  132 LEU A HD11 1 
ATOM   2054  H  HD12 . LEU A  1 132 ? -50.432 -24.300 24.539  1.00 22.24  ?  132 LEU A HD12 1 
ATOM   2055  H  HD13 . LEU A  1 132 ? -49.674 -23.754 25.824  1.00 22.24  ?  132 LEU A HD13 1 
ATOM   2056  H  HD21 . LEU A  1 132 ? -50.219 -20.843 25.235  1.00 23.58  ?  132 LEU A HD21 1 
ATOM   2057  H  HD22 . LEU A  1 132 ? -48.756 -21.265 25.689  1.00 23.58  ?  132 LEU A HD22 1 
ATOM   2058  H  HD23 . LEU A  1 132 ? -48.970 -20.482 24.323  1.00 23.58  ?  132 LEU A HD23 1 
ATOM   2059  N  N    . GLN A  1 133 ? -45.857 -23.256 21.130  1.00 17.31  ?  133 GLN A N    1 
ATOM   2060  C  CA   . GLN A  1 133 ? -44.530 -23.686 20.734  1.00 15.23  ?  133 GLN A CA   1 
ATOM   2061  C  C    . GLN A  1 133 ? -43.690 -22.460 20.423  1.00 17.33  ?  133 GLN A C    1 
ATOM   2062  O  O    . GLN A  1 133 ? -44.195 -21.351 20.241  1.00 19.00  ?  133 GLN A O    1 
ATOM   2063  C  CB   . GLN A  1 133 ? -44.611 -24.640 19.532  1.00 17.02  ?  133 GLN A CB   1 
ATOM   2064  C  CG   . GLN A  1 133 ? -45.339 -25.913 19.868  1.00 19.63  ?  133 GLN A CG   1 
ATOM   2065  C  CD   . GLN A  1 133 ? -45.461 -26.869 18.705  1.00 28.72  ?  133 GLN A CD   1 
ATOM   2066  O  OE1  . GLN A  1 133 ? -44.623 -26.892 17.800  1.00 36.14  ?  133 GLN A OE1  1 
ATOM   2067  N  NE2  . GLN A  1 133 ? -46.516 -27.672 18.728  1.00 39.95  ?  133 GLN A NE2  1 
ATOM   2068  H  H    . GLN A  1 133 ? -46.455 -23.365 20.522  1.00 20.78  ?  133 GLN A H    1 
ATOM   2069  H  HA   . GLN A  1 133 ? -44.114 -24.160 21.470  1.00 18.28  ?  133 GLN A HA   1 
ATOM   2070  H  HB2  . GLN A  1 133 ? -45.087 -24.202 18.809  1.00 20.42  ?  133 GLN A HB2  1 
ATOM   2071  H  HB3  . GLN A  1 133 ? -43.713 -24.871 19.248  1.00 20.42  ?  133 GLN A HB3  1 
ATOM   2072  H  HG2  . GLN A  1 133 ? -44.859 -26.369 20.578  1.00 23.56  ?  133 GLN A HG2  1 
ATOM   2073  H  HG3  . GLN A  1 133 ? -46.235 -25.692 20.166  1.00 23.56  ?  133 GLN A HG3  1 
ATOM   2074  H  HE21 . GLN A  1 133 ? -47.077 -27.627 19.378  1.00 47.94  ?  133 GLN A HE21 1 
ATOM   2075  H  HE22 . GLN A  1 133 ? -46.639 -28.238 18.092  1.00 47.94  ?  133 GLN A HE22 1 
ATOM   2076  N  N    . LYS A  1 134 ? -42.377 -22.643 20.450  1.00 17.58  ?  134 LYS A N    1 
ATOM   2077  C  CA   . LYS A  1 134 ? -41.480 -21.504 20.366  1.00 15.22  ?  134 LYS A CA   1 
ATOM   2078  C  C    . LYS A  1 134 ? -40.942 -21.212 18.971  1.00 17.87  ?  134 LYS A C    1 
ATOM   2079  O  O    . LYS A  1 134 ? -40.105 -20.304 18.819  1.00 28.59  ?  134 LYS A O    1 
ATOM   2080  C  CB   . LYS A  1 134 ? -40.309 -21.711 21.321  1.00 16.85  ?  134 LYS A CB   1 
ATOM   2081  C  CG   . LYS A  1 134 ? -40.715 -21.908 22.778  1.00 21.83  ?  134 LYS A CG   1 
ATOM   2082  C  CD   . LYS A  1 134 ? -41.326 -20.690 23.309  1.00 22.35  ?  134 LYS A CD   1 
ATOM   2083  C  CE   . LYS A  1 134 ? -41.472 -20.701 24.873  1.00 20.10  ?  134 LYS A CE   1 
ATOM   2084  N  NZ   . LYS A  1 134 ? -42.247 -19.475 25.173  1.00 17.78  1  134 LYS A NZ   1 
ATOM   2085  H  H    . LYS A  1 134 ? -41.985 -23.406 20.515  1.00 21.10  ?  134 LYS A H    1 
ATOM   2086  H  HA   . LYS A  1 134 ? -41.961 -20.715 20.662  1.00 18.27  ?  134 LYS A HA   1 
ATOM   2087  H  HB2  . LYS A  1 134 ? -39.816 -22.499 21.042  1.00 20.22  ?  134 LYS A HB2  1 
ATOM   2088  H  HB3  . LYS A  1 134 ? -39.732 -20.932 21.278  1.00 20.22  ?  134 LYS A HB3  1 
ATOM   2089  H  HG2  . LYS A  1 134 ? -41.362 -22.628 22.838  1.00 26.19  ?  134 LYS A HG2  1 
ATOM   2090  H  HG3  . LYS A  1 134 ? -39.929 -22.113 23.307  1.00 26.19  ?  134 LYS A HG3  1 
ATOM   2091  H  HD2  . LYS A  1 134 ? -40.775 -19.930 23.066  1.00 26.82  ?  134 LYS A HD2  1 
ATOM   2092  H  HD3  . LYS A  1 134 ? -42.213 -20.590 22.927  1.00 26.82  ?  134 LYS A HD3  1 
ATOM   2093  H  HE2  . LYS A  1 134 ? -41.970 -21.481 25.165  1.00 24.13  ?  134 LYS A HE2  1 
ATOM   2094  H  HE3  . LYS A  1 134 ? -40.602 -20.650 25.298  1.00 24.13  ?  134 LYS A HE3  1 
ATOM   2095  H  HZ1  . LYS A  1 134 ? -43.038 -19.508 24.767  1.00 21.33  ?  134 LYS A HZ1  1 
ATOM   2096  H  HZ2  . LYS A  1 134 ? -42.375 -19.404 26.051  1.00 21.33  ?  134 LYS A HZ2  1 
ATOM   2097  H  HZ3  . LYS A  1 134 ? -41.804 -18.758 24.887  1.00 21.33  ?  134 LYS A HZ3  1 
ATOM   2098  N  N    . THR A  1 135 ? -41.452 -21.859 17.956  1.00 17.01  ?  135 THR A N    1 
ATOM   2099  C  CA   . THR A  1 135 ? -40.980 -21.665 16.594  1.00 15.65  ?  135 THR A CA   1 
ATOM   2100  C  C    . THR A  1 135 ? -41.902 -20.793 15.768  1.00 15.21  ?  135 THR A C    1 
ATOM   2101  O  O    . THR A  1 135 ? -43.117 -20.767 15.965  1.00 16.72  ?  135 THR A O    1 
ATOM   2102  C  CB   . THR A  1 135 ? -40.863 -22.999 15.874  1.00 17.77  ?  135 THR A CB   1 
ATOM   2103  O  OG1  . THR A  1 135 ? -42.166 -23.579 15.694  1.00 18.22  ?  135 THR A OG1  1 
ATOM   2104  C  CG2  . THR A  1 135 ? -39.992 -23.971 16.689  1.00 21.71  ?  135 THR A CG2  1 
ATOM   2105  H  H    . THR A  1 135 ? -42.089 -22.432 18.022  1.00 20.41  ?  135 THR A H    1 
ATOM   2106  H  HA   . THR A  1 135 ? -40.103 -21.250 16.614  1.00 18.78  ?  135 THR A HA   1 
ATOM   2107  H  HB   . THR A  1 135 ? -40.446 -22.864 15.008  1.00 21.32  ?  135 THR A HB   1 
ATOM   2108  H  HG1  . THR A  1 135 ? -42.100 -24.316 15.297  1.00 21.87  ?  135 THR A HG1  1 
ATOM   2109  H  HG21 . THR A  1 135 ? -39.921 -24.820 16.225  1.00 26.05  ?  135 THR A HG21 1 
ATOM   2110  H  HG22 . THR A  1 135 ? -39.104 -23.600 16.806  1.00 26.05  ?  135 THR A HG22 1 
ATOM   2111  H  HG23 . THR A  1 135 ? -40.390 -24.120 17.561  1.00 26.05  ?  135 THR A HG23 1 
ATOM   2112  N  N    . GLU A  1 136 ? -41.309 -20.127 14.788  1.00 15.68  ?  136 GLU A N    1 
ATOM   2113  C  CA   . GLU A  1 136 ? -42.104 -19.364 13.823  1.00 17.05  ?  136 GLU A CA   1 
ATOM   2114  C  C    . GLU A  1 136 ? -43.047 -20.276 13.070  1.00 17.01  ?  136 GLU A C    1 
ATOM   2115  O  O    . GLU A  1 136 ? -44.196 -19.906 12.806  1.00 16.86  ?  136 GLU A O    1 
ATOM   2116  C  CB   . GLU A  1 136 ? -41.199 -18.616 12.842  1.00 18.53  ?  136 GLU A CB   1 
ATOM   2117  C  CG   . GLU A  1 136 ? -40.463 -17.443 13.527  1.00 20.45  ?  136 GLU A CG   1 
ATOM   2118  C  CD   . GLU A  1 136 ? -39.597 -16.614 12.605  1.00 17.74  ?  136 GLU A CD   1 
ATOM   2119  O  OE1  . GLU A  1 136 ? -39.091 -17.161 11.612  1.00 20.90  ?  136 GLU A OE1  1 
ATOM   2120  O  OE2  . GLU A  1 136 ? -39.411 -15.422 12.938  1.00 20.32  -1 136 GLU A OE2  1 
ATOM   2121  H  H    . GLU A  1 136 ? -40.460 -20.097 14.657  1.00 18.82  ?  136 GLU A H    1 
ATOM   2122  H  HA   . GLU A  1 136 ? -42.637 -18.709 14.300  1.00 20.46  ?  136 GLU A HA   1 
ATOM   2123  H  HB2  . GLU A  1 136 ? -40.533 -19.228 12.491  1.00 22.24  ?  136 GLU A HB2  1 
ATOM   2124  H  HB3  . GLU A  1 136 ? -41.738 -18.256 12.120  1.00 22.24  ?  136 GLU A HB3  1 
ATOM   2125  H  HG2  . GLU A  1 136 ? -41.123 -16.852 13.920  1.00 24.54  ?  136 GLU A HG2  1 
ATOM   2126  H  HG3  . GLU A  1 136 ? -39.890 -17.802 14.223  1.00 24.54  ?  136 GLU A HG3  1 
ATOM   2127  N  N    . ALA A  1 137 ? -42.583 -21.467 12.691  1.00 16.34  ?  137 ALA A N    1 
ATOM   2128  C  CA   . ALA A  1 137 ? -43.432 -22.356 11.916  1.00 15.77  ?  137 ALA A CA   1 
ATOM   2129  C  C    . ALA A  1 137 ? -44.707 -22.720 12.664  1.00 17.58  ?  137 ALA A C    1 
ATOM   2130  O  O    . ALA A  1 137 ? -45.795 -22.758 12.067  1.00 16.76  ?  137 ALA A O    1 
ATOM   2131  C  CB   . ALA A  1 137 ? -42.673 -23.619 11.530  1.00 17.81  ?  137 ALA A CB   1 
ATOM   2132  H  H    . ALA A  1 137 ? -41.799 -21.774 12.866  1.00 19.61  ?  137 ALA A H    1 
ATOM   2133  H  HA   . ALA A  1 137 ? -43.689 -21.904 11.097  1.00 18.93  ?  137 ALA A HA   1 
ATOM   2134  H  HB1  . ALA A  1 137 ? -43.261 -24.195 11.015  1.00 21.37  ?  137 ALA A HB1  1 
ATOM   2135  H  HB2  . ALA A  1 137 ? -41.901 -23.373 10.998  1.00 21.37  ?  137 ALA A HB2  1 
ATOM   2136  H  HB3  . ALA A  1 137 ? -42.388 -24.075 12.338  1.00 21.37  ?  137 ALA A HB3  1 
ATOM   2137  N  N    . ALA A  1 138 ? -44.609 -23.009 13.957  1.00 14.44  ?  138 ALA A N    1 
ATOM   2138  C  CA   . ALA A  1 138 ? -45.807 -23.363 14.711  1.00 17.06  ?  138 ALA A CA   1 
ATOM   2139  C  C    . ALA A  1 138 ? -46.732 -22.164 14.887  1.00 16.13  ?  138 ALA A C    1 
ATOM   2140  O  O    . ALA A  1 138 ? -47.960 -22.322 14.867  1.00 15.78  ?  138 ALA A O    1 
ATOM   2141  C  CB   . ALA A  1 138 ? -45.414 -23.923 16.082  1.00 16.40  ?  138 ALA A CB   1 
ATOM   2142  H  H    . ALA A  1 138 ? -43.880 -23.008 14.412  1.00 17.33  ?  138 ALA A H    1 
ATOM   2143  H  HA   . ALA A  1 138 ? -46.293 -24.052 14.232  1.00 20.47  ?  138 ALA A HA   1 
ATOM   2144  H  HB1  . ALA A  1 138 ? -46.220 -24.153 16.571  1.00 19.67  ?  138 ALA A HB1  1 
ATOM   2145  H  HB2  . ALA A  1 138 ? -44.866 -24.713 15.954  1.00 19.67  ?  138 ALA A HB2  1 
ATOM   2146  H  HB3  . ALA A  1 138 ? -44.914 -23.247 16.566  1.00 19.67  ?  138 ALA A HB3  1 
ATOM   2147  N  N    . LYS A  1 139 ? -46.162 -20.975 15.088  1.00 16.08  ?  139 LYS A N    1 
ATOM   2148  C  CA   . LYS A  1 139 ? -46.967 -19.771 15.300  1.00 15.00  ?  139 LYS A CA   1 
ATOM   2149  C  C    . LYS A  1 139 ? -47.708 -19.370 14.020  1.00 15.61  ?  139 LYS A C    1 
ATOM   2150  O  O    . LYS A  1 139 ? -48.862 -18.930 14.080  1.00 15.74  ?  139 LYS A O    1 
ATOM   2151  C  CB   . LYS A  1 139 ? -46.078 -18.644 15.833  1.00 16.33  ?  139 LYS A CB   1 
ATOM   2152  C  CG   . LYS A  1 139 ? -45.571 -18.934 17.270  1.00 17.40  ?  139 LYS A CG   1 
ATOM   2153  C  CD   . LYS A  1 139 ? -44.475 -17.986 17.666  1.00 16.01  ?  139 LYS A CD   1 
ATOM   2154  C  CE   . LYS A  1 139 ? -43.810 -18.399 18.968  1.00 16.13  ?  139 LYS A CE   1 
ATOM   2155  N  NZ   . LYS A  1 139 ? -44.809 -18.548 20.059  1.00 17.27  1  139 LYS A NZ   1 
ATOM   2156  H  H    . LYS A  1 139 ? -45.313 -20.839 15.106  1.00 19.30  ?  139 LYS A H    1 
ATOM   2157  H  HA   . LYS A  1 139 ? -47.635 -19.961 15.977  1.00 18.00  ?  139 LYS A HA   1 
ATOM   2158  H  HB2  . LYS A  1 139 ? -45.306 -18.547 15.254  1.00 19.59  ?  139 LYS A HB2  1 
ATOM   2159  H  HB3  . LYS A  1 139 ? -46.587 -17.819 15.853  1.00 19.59  ?  139 LYS A HB3  1 
ATOM   2160  H  HG2  . LYS A  1 139 ? -46.304 -18.829 17.896  1.00 20.88  ?  139 LYS A HG2  1 
ATOM   2161  H  HG3  . LYS A  1 139 ? -45.221 -19.837 17.310  1.00 20.88  ?  139 LYS A HG3  1 
ATOM   2162  H  HD2  . LYS A  1 139 ? -43.798 -17.973 16.972  1.00 19.21  ?  139 LYS A HD2  1 
ATOM   2163  H  HD3  . LYS A  1 139 ? -44.848 -17.099 17.786  1.00 19.21  ?  139 LYS A HD3  1 
ATOM   2164  H  HE2  . LYS A  1 139 ? -43.365 -19.252 18.844  1.00 19.35  ?  139 LYS A HE2  1 
ATOM   2165  H  HE3  . LYS A  1 139 ? -43.170 -17.720 19.231  1.00 19.35  ?  139 LYS A HE3  1 
ATOM   2166  H  HZ1  . LYS A  1 139 ? -45.230 -17.775 20.192  1.00 20.72  ?  139 LYS A HZ1  1 
ATOM   2167  H  HZ2  . LYS A  1 139 ? -45.408 -19.169 19.840  1.00 20.72  ?  139 LYS A HZ2  1 
ATOM   2168  H  HZ3  . LYS A  1 139 ? -44.403 -18.790 20.812  1.00 20.72  ?  139 LYS A HZ3  1 
ATOM   2169  N  N    . ILE A  1 140 ? -47.098 -19.610 12.858  1.00 14.89  ?  140 ILE A N    1 
ATOM   2170  C  CA   . ILE A  1 140 ? -47.791 -19.348 11.601  1.00 15.06  ?  140 ILE A CA   1 
ATOM   2171  C  C    . ILE A  1 140 ? -48.969 -20.297 11.446  1.00 15.64  ?  140 ILE A C    1 
ATOM   2172  O  O    . ILE A  1 140 ? -50.072 -19.885 11.065  1.00 15.00  ?  140 ILE A O    1 
ATOM   2173  C  CB   . ILE A  1 140 ? -46.826 -19.457 10.406  1.00 15.87  ?  140 ILE A CB   1 
ATOM   2174  C  CG1  . ILE A  1 140 ? -45.767 -18.355 10.452  1.00 17.16  ?  140 ILE A CG1  1 
ATOM   2175  C  CG2  . ILE A  1 140 ? -47.626 -19.423 9.050   1.00 16.77  ?  140 ILE A CG2  1 
ATOM   2176  C  CD1  . ILE A  1 140 ? -44.617 -18.628 9.528   1.00 18.73  ?  140 ILE A CD1  1 
ATOM   2177  H  H    . ILE A  1 140 ? -46.299 -19.918 12.773  1.00 17.87  ?  140 ILE A H    1 
ATOM   2178  H  HA   . ILE A  1 140 ? -48.140 -18.443 11.619  1.00 18.07  ?  140 ILE A HA   1 
ATOM   2179  H  HB   . ILE A  1 140 ? -46.372 -20.312 10.465  1.00 19.04  ?  140 ILE A HB   1 
ATOM   2180  H  HG12 . ILE A  1 140 ? -46.172 -17.514 10.188  1.00 20.59  ?  140 ILE A HG12 1 
ATOM   2181  H  HG13 . ILE A  1 140 ? -45.418 -18.288 11.354  1.00 20.59  ?  140 ILE A HG13 1 
ATOM   2182  H  HG21 . ILE A  1 140 ? -47.000 -19.492 8.313   1.00 20.13  ?  140 ILE A HG21 1 
ATOM   2183  H  HG22 . ILE A  1 140 ? -48.245 -20.169 9.031   1.00 20.13  ?  140 ILE A HG22 1 
ATOM   2184  H  HG23 . ILE A  1 140 ? -48.114 -18.586 8.993   1.00 20.13  ?  140 ILE A HG23 1 
ATOM   2185  H  HD11 . ILE A  1 140 ? -43.978 -17.901 9.597   1.00 22.48  ?  140 ILE A HD11 1 
ATOM   2186  H  HD12 . ILE A  1 140 ? -44.197 -19.464 9.785   1.00 22.48  ?  140 ILE A HD12 1 
ATOM   2187  H  HD13 . ILE A  1 140 ? -44.950 -18.691 8.619   1.00 22.48  ?  140 ILE A HD13 1 
ATOM   2188  N  N    . LEU A  1 141 ? -48.752 -21.575 11.732  1.00 15.06  ?  141 LEU A N    1 
ATOM   2189  C  CA   . LEU A  1 141 ? -49.829 -22.552 11.686  1.00 14.96  ?  141 LEU A CA   1 
ATOM   2190  C  C    . LEU A  1 141 ? -50.989 -22.140 12.595  1.00 15.12  ?  141 LEU A C    1 
ATOM   2191  O  O    . LEU A  1 141 ? -52.166 -22.231 12.208  1.00 15.10  ?  141 LEU A O    1 
ATOM   2192  C  CB   . LEU A  1 141 ? -49.296 -23.928 12.080  1.00 17.87  ?  141 LEU A CB   1 
ATOM   2193  C  CG   . LEU A  1 141 ? -50.336 -25.039 12.220  1.00 17.47  ?  141 LEU A CG   1 
ATOM   2194  C  CD1  . LEU A  1 141 ? -51.142 -25.260 10.970  1.00 16.80  ?  141 LEU A CD1  1 
ATOM   2195  C  CD2  . LEU A  1 141 ? -49.630 -26.346 12.711  1.00 22.18  ?  141 LEU A CD2  1 
ATOM   2196  H  H    . LEU A  1 141 ? -47.988 -21.902 11.955  1.00 18.07  ?  141 LEU A H    1 
ATOM   2197  H  HA   . LEU A  1 141 ? -50.165 -22.609 10.778  1.00 17.96  ?  141 LEU A HA   1 
ATOM   2198  H  HB2  . LEU A  1 141 ? -48.659 -24.212 11.405  1.00 21.45  ?  141 LEU A HB2  1 
ATOM   2199  H  HB3  . LEU A  1 141 ? -48.844 -23.846 12.934  1.00 21.45  ?  141 LEU A HB3  1 
ATOM   2200  H  HG   . LEU A  1 141 ? -50.960 -24.777 12.914  1.00 20.96  ?  141 LEU A HG   1 
ATOM   2201  H  HD11 . LEU A  1 141 ? -51.779 -25.974 11.127  1.00 20.17  ?  141 LEU A HD11 1 
ATOM   2202  H  HD12 . LEU A  1 141 ? -51.611 -24.440 10.748  1.00 20.17  ?  141 LEU A HD12 1 
ATOM   2203  H  HD13 . LEU A  1 141 ? -50.543 -25.504 10.247  1.00 20.17  ?  141 LEU A HD13 1 
ATOM   2204  H  HD21 . LEU A  1 141 ? -50.294 -27.049 12.799  1.00 26.61  ?  141 LEU A HD21 1 
ATOM   2205  H  HD22 . LEU A  1 141 ? -48.958 -26.605 12.062  1.00 26.61  ?  141 LEU A HD22 1 
ATOM   2206  H  HD23 . LEU A  1 141 ? -49.213 -26.176 13.570  1.00 26.61  ?  141 LEU A HD23 1 
ATOM   2207  N  N    . ALA A  1 142 ? -50.673 -21.689 13.811  1.00 15.18  ?  142 ALA A N    1 
ATOM   2208  C  CA   . ALA A  1 142 ? -51.721 -21.271 14.742  1.00 16.13  ?  142 ALA A CA   1 
ATOM   2209  C  C    . ALA A  1 142 ? -52.535 -20.098 14.194  1.00 14.34  ?  142 ALA A C    1 
ATOM   2210  O  O    . ALA A  1 142 ? -53.774 -20.107 14.258  1.00 16.43  ?  142 ALA A O    1 
ATOM   2211  C  CB   . ALA A  1 142 ? -51.086 -20.924 16.089  1.00 16.04  ?  142 ALA A CB   1 
ATOM   2212  H  H    . ALA A  1 142 ? -49.872 -21.617 14.117  1.00 18.21  ?  142 ALA A H    1 
ATOM   2213  H  HA   . ALA A  1 142 ? -52.328 -22.013 14.882  1.00 19.36  ?  142 ALA A HA   1 
ATOM   2214  H  HB1  . ALA A  1 142 ? -51.783 -20.647 16.704  1.00 19.25  ?  142 ALA A HB1  1 
ATOM   2215  H  HB2  . ALA A  1 142 ? -50.632 -21.708 16.435  1.00 19.25  ?  142 ALA A HB2  1 
ATOM   2216  H  HB3  . ALA A  1 142 ? -50.450 -20.202 15.962  1.00 19.25  ?  142 ALA A HB3  1 
ATOM   2217  N  N    . ILE A  1 143 ? -51.863 -19.084 13.635  1.00 15.50  ?  143 ILE A N    1 
ATOM   2218  C  CA   . ILE A  1 143 ? -52.563 -17.938 13.054  1.00 15.87  ?  143 ILE A CA   1 
ATOM   2219  C  C    . ILE A  1 143 ? -53.421 -18.376 11.880  1.00 15.76  ?  143 ILE A C    1 
ATOM   2220  O  O    . ILE A  1 143 ? -54.565 -17.941 11.726  1.00 16.20  ?  143 ILE A O    1 
ATOM   2221  C  CB   . ILE A  1 143 ? -51.555 -16.861 12.636  1.00 18.28  ?  143 ILE A CB   1 
ATOM   2222  C  CG1  . ILE A  1 143 ? -50.919 -16.238 13.872  1.00 19.29  ?  143 ILE A CG1  1 
ATOM   2223  C  CG2  . ILE A  1 143 ? -52.246 -15.777 11.774  1.00 19.04  ?  143 ILE A CG2  1 
ATOM   2224  C  CD1  . ILE A  1 143 ? -49.614 -15.507 13.615  1.00 20.91  ?  143 ILE A CD1  1 
ATOM   2225  H  H    . ILE A  1 143 ? -51.006 -19.037 13.582  1.00 18.60  ?  143 ILE A H    1 
ATOM   2226  H  HA   . ILE A  1 143 ? -53.149 -17.554 13.725  1.00 19.05  ?  143 ILE A HA   1 
ATOM   2227  H  HB   . ILE A  1 143 ? -50.857 -17.279 12.107  1.00 21.94  ?  143 ILE A HB   1 
ATOM   2228  H  HG12 . ILE A  1 143 ? -51.543 -15.600 14.252  1.00 23.15  ?  143 ILE A HG12 1 
ATOM   2229  H  HG13 . ILE A  1 143 ? -50.739 -16.941 14.515  1.00 23.15  ?  143 ILE A HG13 1 
ATOM   2230  H  HG21 . ILE A  1 143 ? -51.590 -15.108 11.522  1.00 22.84  ?  143 ILE A HG21 1 
ATOM   2231  H  HG22 . ILE A  1 143 ? -52.616 -16.194 10.980  1.00 22.84  ?  143 ILE A HG22 1 
ATOM   2232  H  HG23 . ILE A  1 143 ? -52.956 -15.366 12.293  1.00 22.84  ?  143 ILE A HG23 1 
ATOM   2233  H  HD11 . ILE A  1 143 ? -49.285 -15.145 14.452  1.00 25.09  ?  143 ILE A HD11 1 
ATOM   2234  H  HD12 . ILE A  1 143 ? -48.969 -16.132 13.247  1.00 25.09  ?  143 ILE A HD12 1 
ATOM   2235  H  HD13 . ILE A  1 143 ? -49.775 -14.788 12.984  1.00 25.09  ?  143 ILE A HD13 1 
ATOM   2236  N  N    . LEU A  1 144 ? -52.890 -19.253 11.040  1.00 14.85  ?  144 LEU A N    1 
ATOM   2237  C  CA   . LEU A  1 144 ? -53.674 -19.740 9.907   1.00 15.37  ?  144 LEU A CA   1 
ATOM   2238  C  C    . LEU A  1 144 ? -54.948 -20.427 10.368  1.00 15.71  ?  144 LEU A C    1 
ATOM   2239  O  O    . LEU A  1 144 ? -56.033 -20.154 9.849   1.00 15.98  ?  144 LEU A O    1 
ATOM   2240  C  CB   . LEU A  1 144 ? -52.822 -20.692 9.072   1.00 17.75  ?  144 LEU A CB   1 
ATOM   2241  C  CG   . LEU A  1 144 ? -53.493 -21.364 7.893   1.00 16.49  ?  144 LEU A CG   1 
ATOM   2242  C  CD1  . LEU A  1 144 ? -54.088 -20.315 6.974   1.00 20.32  ?  144 LEU A CD1  1 
ATOM   2243  C  CD2  . LEU A  1 144 ? -52.460 -22.262 7.172   1.00 19.15  ?  144 LEU A CD2  1 
ATOM   2244  H  H    . LEU A  1 144 ? -52.096 -19.578 11.098  1.00 17.83  ?  144 LEU A H    1 
ATOM   2245  H  HA   . LEU A  1 144 ? -53.923 -18.988 9.346   1.00 18.45  ?  144 LEU A HA   1 
ATOM   2246  H  HB2  . LEU A  1 144 ? -52.067 -20.193 8.724   1.00 21.30  ?  144 LEU A HB2  1 
ATOM   2247  H  HB3  . LEU A  1 144 ? -52.498 -21.396 9.655   1.00 21.30  ?  144 LEU A HB3  1 
ATOM   2248  H  HG   . LEU A  1 144 ? -54.213 -21.928 8.215   1.00 19.79  ?  144 LEU A HG   1 
ATOM   2249  H  HD11 . LEU A  1 144 ? -54.514 -20.758 6.224   1.00 24.38  ?  144 LEU A HD11 1 
ATOM   2250  H  HD12 . LEU A  1 144 ? -54.743 -19.797 7.468   1.00 24.38  ?  144 LEU A HD12 1 
ATOM   2251  H  HD13 . LEU A  1 144 ? -53.379 -19.735 6.656   1.00 24.38  ?  144 LEU A HD13 1 
ATOM   2252  H  HD21 . LEU A  1 144 ? -52.890 -22.693 6.416   1.00 22.98  ?  144 LEU A HD21 1 
ATOM   2253  H  HD22 . LEU A  1 144 ? -51.724 -21.711 6.864   1.00 22.98  ?  144 LEU A HD22 1 
ATOM   2254  H  HD23 . LEU A  1 144 ? -52.136 -22.932 7.794   1.00 22.98  ?  144 LEU A HD23 1 
ATOM   2255  N  N    . ILE A  1 145 ? -54.831 -21.341 11.342  1.00 15.41  ?  145 ILE A N    1 
ATOM   2256  C  CA   . ILE A  1 145 ? -56.003 -22.042 11.867  1.00 15.72  ?  145 ILE A CA   1 
ATOM   2257  C  C    . ILE A  1 145 ? -57.005 -21.043 12.435  1.00 15.55  ?  145 ILE A C    1 
ATOM   2258  O  O    . ILE A  1 145 ? -58.219 -21.145 12.198  1.00 16.45  ?  145 ILE A O    1 
ATOM   2259  C  CB   . ILE A  1 145 ? -55.557 -23.070 12.925  1.00 15.35  ?  145 ILE A CB   1 
ATOM   2260  C  CG1  . ILE A  1 145 ? -54.902 -24.275 12.250  1.00 16.91  ?  145 ILE A CG1  1 
ATOM   2261  C  CG2  . ILE A  1 145 ? -56.761 -23.503 13.813  1.00 19.58  ?  145 ILE A CG2  1 
ATOM   2262  C  CD1  . ILE A  1 145 ? -54.186 -25.251 13.207  1.00 17.49  ?  145 ILE A CD1  1 
ATOM   2263  H  H    . ILE A  1 145 ? -54.088 -21.569 11.711  1.00 18.49  ?  145 ILE A H    1 
ATOM   2264  H  HA   . ILE A  1 145 ? -56.435 -22.522 11.144  1.00 18.86  ?  145 ILE A HA   1 
ATOM   2265  H  HB   . ILE A  1 145 ? -54.896 -22.649 13.497  1.00 18.42  ?  145 ILE A HB   1 
ATOM   2266  H  HG12 . ILE A  1 145 ? -55.588 -24.776 11.781  1.00 20.29  ?  145 ILE A HG12 1 
ATOM   2267  H  HG13 . ILE A  1 145 ? -54.243 -23.953 11.615  1.00 20.29  ?  145 ILE A HG13 1 
ATOM   2268  H  HG21 . ILE A  1 145 ? -56.454 -24.149 14.468  1.00 23.50  ?  145 ILE A HG21 1 
ATOM   2269  H  HG22 . ILE A  1 145 ? -57.119 -22.721 14.261  1.00 23.50  ?  145 ILE A HG22 1 
ATOM   2270  H  HG23 . ILE A  1 145 ? -57.441 -23.902 13.248  1.00 23.50  ?  145 ILE A HG23 1 
ATOM   2271  H  HD11 . ILE A  1 145 ? -53.805 -25.978 12.689  1.00 20.99  ?  145 ILE A HD11 1 
ATOM   2272  H  HD12 . ILE A  1 145 ? -53.484 -24.775 13.676  1.00 20.99  ?  145 ILE A HD12 1 
ATOM   2273  H  HD13 . ILE A  1 145 ? -54.831 -25.600 13.842  1.00 20.99  ?  145 ILE A HD13 1 
ATOM   2274  N  N    . LYS A  1 146 ? -56.520 -20.079 13.227  1.00 16.15  ?  146 LYS A N    1 
ATOM   2275  C  CA   . LYS A  1 146 ? -57.440 -19.133 13.844  1.00 15.80  ?  146 LYS A CA   1 
ATOM   2276  C  C    . LYS A  1 146 ? -58.150 -18.278 12.808  1.00 17.20  ?  146 LYS A C    1 
ATOM   2277  O  O    . LYS A  1 146 ? -59.318 -17.929 12.990  1.00 17.63  ?  146 LYS A O    1 
ATOM   2278  C  CB   . LYS A  1 146 ? -56.697 -18.270 14.855  1.00 18.49  ?  146 LYS A CB   1 
ATOM   2279  C  CG   . LYS A  1 146 ? -56.280 -19.096 16.080  1.00 18.65  ?  146 LYS A CG   1 
ATOM   2280  C  CD   . LYS A  1 146 ? -55.356 -18.310 16.984  1.00 20.91  ?  146 LYS A CD   1 
ATOM   2281  C  CE   . LYS A  1 146 ? -54.799 -19.179 18.125  1.00 24.84  ?  146 LYS A CE   1 
ATOM   2282  N  NZ   . LYS A  1 146 ? -55.903 -19.703 18.965  1.00 24.40  1  146 LYS A NZ   1 
ATOM   2283  H  H    . LYS A  1 146 ? -55.689 -19.959 13.416  1.00 19.38  ?  146 LYS A H    1 
ATOM   2284  H  HA   . LYS A  1 146 ? -58.118 -19.631 14.327  1.00 18.96  ?  146 LYS A HA   1 
ATOM   2285  H  HB2  . LYS A  1 146 ? -55.897 -17.908 14.443  1.00 22.19  ?  146 LYS A HB2  1 
ATOM   2286  H  HB3  . LYS A  1 146 ? -57.277 -17.552 15.153  1.00 22.19  ?  146 LYS A HB3  1 
ATOM   2287  H  HG2  . LYS A  1 146 ? -57.071 -19.337 16.589  1.00 22.38  ?  146 LYS A HG2  1 
ATOM   2288  H  HG3  . LYS A  1 146 ? -55.813 -19.893 15.786  1.00 22.38  ?  146 LYS A HG3  1 
ATOM   2289  H  HD2  . LYS A  1 146 ? -54.608 -17.977 16.464  1.00 25.09  ?  146 LYS A HD2  1 
ATOM   2290  H  HD3  . LYS A  1 146 ? -55.846 -17.571 17.378  1.00 25.09  ?  146 LYS A HD3  1 
ATOM   2291  H  HE2  . LYS A  1 146 ? -54.315 -19.932 17.750  1.00 29.81  ?  146 LYS A HE2  1 
ATOM   2292  H  HE3  . LYS A  1 146 ? -54.215 -18.644 18.684  1.00 29.81  ?  146 LYS A HE3  1 
ATOM   2293  H  HZ1  . LYS A  1 146 ? -55.573 -20.205 19.622  1.00 29.27  ?  146 LYS A HZ1  1 
ATOM   2294  H  HZ2  . LYS A  1 146 ? -56.362 -19.028 19.320  1.00 29.27  ?  146 LYS A HZ2  1 
ATOM   2295  H  HZ3  . LYS A  1 146 ? -56.453 -20.198 18.471  1.00 29.27  ?  146 LYS A HZ3  1 
ATOM   2296  N  N    . THR A  1 147 ? -57.470 -17.958 11.718  1.00 17.46  ?  147 THR A N    1 
ATOM   2297  C  CA   . THR A  1 147 ? -58.077 -17.233 10.606  1.00 15.64  ?  147 THR A CA   1 
ATOM   2298  C  C    . THR A  1 147 ? -59.136 -18.071 9.907   1.00 18.37  ?  147 THR A C    1 
ATOM   2299  O  O    . THR A  1 147 ? -60.257 -17.604 9.654   1.00 18.60  ?  147 THR A O    1 
ATOM   2300  C  CB   . THR A  1 147 ? -56.967 -16.800 9.644   1.00 16.48  ?  147 THR A CB   1 
ATOM   2301  O  OG1  . THR A  1 147 ? -56.074 -15.912 10.317  1.00 17.71  ?  147 THR A OG1  1 
ATOM   2302  C  CG2  . THR A  1 147 ? -57.552 -16.078 8.418   1.00 19.91  ?  147 THR A CG2  1 
ATOM   2303  H  H    . THR A  1 147 ? -56.642 -18.152 11.593  1.00 20.95  ?  147 THR A H    1 
ATOM   2304  H  HA   . THR A  1 147 ? -58.507 -16.433 10.948  1.00 18.76  ?  147 THR A HA   1 
ATOM   2305  H  HB   . THR A  1 147 ? -56.480 -17.581 9.339   1.00 19.77  ?  147 THR A HB   1 
ATOM   2306  H  HG1  . THR A  1 147 ? -55.731 -16.297 10.980  1.00 21.25  ?  147 THR A HG1  1 
ATOM   2307  H  HG21 . THR A  1 147 ? -56.838 -15.810 7.819   1.00 23.89  ?  147 THR A HG21 1 
ATOM   2308  H  HG22 . THR A  1 147 ? -58.157 -16.669 7.943   1.00 23.89  ?  147 THR A HG22 1 
ATOM   2309  H  HG23 . THR A  1 147 ? -58.039 -15.288 8.700   1.00 23.89  ?  147 THR A HG23 1 
ATOM   2310  N  N    . ILE A  1 148 ? -58.783 -19.309 9.541   1.00 16.95  ?  148 ILE A N    1 
ATOM   2311  C  CA   . ILE A  1 148 ? -59.746 -20.240 8.942   1.00 17.96  ?  148 ILE A CA   1 
ATOM   2312  C  C    . ILE A  1 148 ? -61.007 -20.342 9.776   1.00 19.25  ?  148 ILE A C    1 
ATOM   2313  O  O    . ILE A  1 148 ? -62.130 -20.416 9.238   1.00 19.80  ?  148 ILE A O    1 
ATOM   2314  C  CB   . ILE A  1 148 ? -59.073 -21.610 8.785   1.00 18.57  ?  148 ILE A CB   1 
ATOM   2315  C  CG1  . ILE A  1 148 ? -58.033 -21.568 7.661   1.00 18.56  ?  148 ILE A CG1  1 
ATOM   2316  C  CG2  . ILE A  1 148 ? -60.094 -22.725 8.535   1.00 22.12  ?  148 ILE A CG2  1 
ATOM   2317  C  CD1  . ILE A  1 148 ? -57.092 -22.715 7.742   1.00 20.30  ?  148 ILE A CD1  1 
ATOM   2318  H  H    . ILE A  1 148 ? -57.992 -19.633 9.630   1.00 20.34  ?  148 ILE A H    1 
ATOM   2319  H  HA   . ILE A  1 148 ? -59.992 -19.921 8.060   1.00 21.55  ?  148 ILE A HA   1 
ATOM   2320  H  HB   . ILE A  1 148 ? -58.610 -21.811 9.613   1.00 22.29  ?  148 ILE A HB   1 
ATOM   2321  H  HG12 . ILE A  1 148 ? -58.486 -21.608 6.804   1.00 22.27  ?  148 ILE A HG12 1 
ATOM   2322  H  HG13 . ILE A  1 148 ? -57.520 -20.748 7.730   1.00 22.27  ?  148 ILE A HG13 1 
ATOM   2323  H  HG21 . ILE A  1 148 ? -59.624 -23.568 8.442   1.00 26.55  ?  148 ILE A HG21 1 
ATOM   2324  H  HG22 . ILE A  1 148 ? -60.706 -22.767 9.286   1.00 26.55  ?  148 ILE A HG22 1 
ATOM   2325  H  HG23 . ILE A  1 148 ? -60.584 -22.527 7.721   1.00 26.55  ?  148 ILE A HG23 1 
ATOM   2326  H  HD11 . ILE A  1 148 ? -56.452 -22.650 7.016   1.00 24.36  ?  148 ILE A HD11 1 
ATOM   2327  H  HD12 . ILE A  1 148 ? -56.629 -22.683 8.594   1.00 24.36  ?  148 ILE A HD12 1 
ATOM   2328  H  HD13 . ILE A  1 148 ? -57.594 -23.541 7.669   1.00 24.36  ?  148 ILE A HD13 1 
ATOM   2329  N  N    . ASN A  1 149 ? -60.849 -20.391 11.098  1.00 16.58  ?  149 ASN A N    1 
ATOM   2330  C  CA   . ASN A  1 149 ? -61.973 -20.593 12.004  1.00 18.80  ?  149 ASN A CA   1 
ATOM   2331  C  C    . ASN A  1 149 ? -62.731 -19.320 12.336  1.00 22.88  ?  149 ASN A C    1 
ATOM   2332  O  O    . ASN A  1 149 ? -63.711 -19.389 13.091  1.00 25.21  ?  149 ASN A O    1 
ATOM   2333  C  CB   . ASN A  1 149 ? -61.488 -21.259 13.291  1.00 18.43  ?  149 ASN A CB   1 
ATOM   2334  C  CG   . ASN A  1 149 ? -61.231 -22.739 13.118  1.00 22.99  ?  149 ASN A CG   1 
ATOM   2335  O  OD1  . ASN A  1 149 ? -61.714 -23.365 12.178  1.00 25.73  ?  149 ASN A OD1  1 
ATOM   2336  N  ND2  . ASN A  1 149 ? -60.502 -23.316 14.047  1.00 23.03  ?  149 ASN A ND2  1 
ATOM   2337  H  H    . ASN A  1 149 ? -60.091 -20.308 11.497  1.00 19.90  ?  149 ASN A H    1 
ATOM   2338  H  HA   . ASN A  1 149 ? -62.599 -21.200 11.581  1.00 22.56  ?  149 ASN A HA   1 
ATOM   2339  H  HB2  . ASN A  1 149 ? -60.658 -20.841 13.571  1.00 22.11  ?  149 ASN A HB2  1 
ATOM   2340  H  HB3  . ASN A  1 149 ? -62.163 -21.150 13.979  1.00 22.11  ?  149 ASN A HB3  1 
ATOM   2341  H  HD21 . ASN A  1 149 ? -60.326 -24.156 13.996  1.00 27.64  ?  149 ASN A HD21 1 
ATOM   2342  H  HD22 . ASN A  1 149 ? -60.201 -22.852 14.706  1.00 27.64  ?  149 ASN A HD22 1 
ATOM   2343  N  N    . SER A  1 150 ? -62.364 -18.196 11.739  1.00 20.17  ?  150 SER A N    1 
ATOM   2344  C  CA   . SER A  1 150 ? -63.060 -16.928 11.913  1.00 20.02  ?  150 SER A CA   1 
ATOM   2345  C  C    . SER A  1 150 ? -64.160 -16.790 10.865  1.00 27.91  ?  150 SER A C    1 
ATOM   2346  O  O    . SER A  1 150 ? -63.905 -16.958 9.670   1.00 33.35  ?  150 SER A O    1 
ATOM   2347  C  CB   . SER A  1 150 ? -62.087 -15.767 11.760  1.00 19.85  ?  150 SER A CB   1 
ATOM   2348  O  OG   . SER A  1 150 ? -61.107 -15.803 12.784  1.00 21.80  ?  150 SER A OG   1 
ATOM   2349  H  H    . SER A  1 150 ? -61.690 -18.140 11.208  1.00 24.20  ?  150 SER A H    1 
ATOM   2350  H  HA   . SER A  1 150 ? -63.460 -16.889 12.796  1.00 24.03  ?  150 SER A HA   1 
ATOM   2351  H  HB2  . SER A  1 150 ? -61.648 -15.834 10.898  1.00 23.82  ?  150 SER A HB2  1 
ATOM   2352  H  HB3  . SER A  1 150 ? -62.578 -14.932 11.820  1.00 23.82  ?  150 SER A HB3  1 
ATOM   2353  H  HG   . SER A  1 150 ? -60.676 -16.523 12.744  1.00 26.16  ?  150 SER A HG   1 
ATOM   2354  N  N    . GLU A  1 151 ? -65.362 -16.429 11.297  1.00 31.62  ?  151 GLU A N    1 
ATOM   2355  C  CA   . GLU A  1 151 ? -66.431 -16.253 10.309  1.00 40.98  ?  151 GLU A CA   1 
ATOM   2356  C  C    . GLU A  1 151 ? -66.539 -14.818 9.783   1.00 34.12  ?  151 GLU A C    1 
ATOM   2357  O  O    . GLU A  1 151 ? -66.715 -14.599 8.576   1.00 37.60  ?  151 GLU A O    1 
ATOM   2358  C  CB   . GLU A  1 151 ? -67.777 -16.679 10.904  1.00 45.91  ?  151 GLU A CB   1 
ATOM   2359  C  CG   . GLU A  1 151 ? -68.180 -18.127 10.571  1.00 58.17  ?  151 GLU A CG   1 
ATOM   2360  C  CD   . GLU A  1 151 ? -69.693 -18.295 10.331  1.00 55.38  ?  151 GLU A CD   1 
ATOM   2361  O  OE1  . GLU A  1 151 ? -70.497 -17.701 11.083  1.00 57.08  ?  151 GLU A OE1  1 
ATOM   2362  O  OE2  . GLU A  1 151 ? -70.071 -19.019 9.377   1.00 61.05  -1 151 GLU A OE2  1 
ATOM   2363  H  H    . GLU A  1 151 ? -65.583 -16.284 12.115  1.00 37.94  ?  151 GLU A H    1 
ATOM   2364  H  HA   . GLU A  1 151 ? -66.249 -16.830 9.551   1.00 49.17  ?  151 GLU A HA   1 
ATOM   2365  H  HB2  . GLU A  1 151 ? -67.729 -16.600 11.870  1.00 55.09  ?  151 GLU A HB2  1 
ATOM   2366  H  HB3  . GLU A  1 151 ? -68.469 -16.093 10.561  1.00 55.09  ?  151 GLU A HB3  1 
ATOM   2367  H  HG2  . GLU A  1 151 ? -67.717 -18.405 9.766   1.00 69.80  ?  151 GLU A HG2  1 
ATOM   2368  H  HG3  . GLU A  1 151 ? -67.930 -18.701 11.312  1.00 69.80  ?  151 GLU A HG3  1 
ATOM   2369  N  N    . GLU A  1 152 ? -66.507 -13.839 10.675  1.00 21.69  ?  152 GLU A N    1 
ATOM   2370  C  CA   . GLU A  1 152 ? -66.711 -12.450 10.298  1.00 24.58  ?  152 GLU A CA   1 
ATOM   2371  C  C    . GLU A  1 152 ? -65.410 -11.722 10.059  1.00 25.31  ?  152 GLU A C    1 
ATOM   2372  O  O    . GLU A  1 152 ? -64.356 -12.096 10.603  1.00 22.70  ?  152 GLU A O    1 
ATOM   2373  C  CB   . GLU A  1 152 ? -67.512 -11.698 11.364  1.00 28.69  ?  152 GLU A CB   1 
ATOM   2374  C  CG   . GLU A  1 152 ? -68.868 -12.267 11.602  1.00 35.87  ?  152 GLU A CG   1 
ATOM   2375  C  CD   . GLU A  1 152 ? -69.739 -12.284 10.341  1.00 33.46  ?  152 GLU A CD   1 
ATOM   2376  O  OE1  . GLU A  1 152 ? -69.689 -11.328 9.521   1.00 35.67  ?  152 GLU A OE1  1 
ATOM   2377  O  OE2  . GLU A  1 152 ? -70.436 -13.283 10.164  1.00 35.83  -1 152 GLU A OE2  1 
ATOM   2378  H  H    . GLU A  1 152 ? -66.367 -13.955 11.516  1.00 26.02  ?  152 GLU A H    1 
ATOM   2379  H  HA   . GLU A  1 152 ? -67.220 -12.423 9.473   1.00 29.50  ?  152 GLU A HA   1 
ATOM   2380  H  HB2  . GLU A  1 152 ? -67.024 -11.731 12.202  1.00 34.43  ?  152 GLU A HB2  1 
ATOM   2381  H  HB3  . GLU A  1 152 ? -67.621 -10.777 11.082  1.00 34.43  ?  152 GLU A HB3  1 
ATOM   2382  H  HG2  . GLU A  1 152 ? -68.777 -13.181 11.915  1.00 43.04  ?  152 GLU A HG2  1 
ATOM   2383  H  HG3  . GLU A  1 152 ? -69.322 -11.731 12.271  1.00 43.04  ?  152 GLU A HG3  1 
ATOM   2384  N  N    . ASN A  1 153 ? -65.496 -10.674 9.232   1.00 25.37  ?  153 ASN A N    1 
ATOM   2385  C  CA   . ASN A  1 153 ? -64.317 -9.898  8.860   1.00 24.11  ?  153 ASN A CA   1 
ATOM   2386  C  C    . ASN A  1 153 ? -63.581 -9.377  10.089  1.00 21.61  ?  153 ASN A C    1 
ATOM   2387  O  O    . ASN A  1 153 ? -62.356 -9.398  10.125  1.00 21.27  ?  153 ASN A O    1 
ATOM   2388  C  CB   . ASN A  1 153 ? -64.686 -8.719  7.947   1.00 25.94  ?  153 ASN A CB   1 
ATOM   2389  C  CG   . ASN A  1 153 ? -64.880 -9.139  6.501   1.00 38.76  ?  153 ASN A CG   1 
ATOM   2390  O  OD1  . ASN A  1 153 ? -64.781 -10.320 6.170   1.00 30.65  ?  153 ASN A OD1  1 
ATOM   2391  N  ND2  . ASN A  1 153 ? -65.151 -8.163  5.629   1.00 42.25  ?  153 ASN A ND2  1 
ATOM   2392  H  H    . ASN A  1 153 ? -66.227 -10.395 8.875   1.00 30.44  ?  153 ASN A H    1 
ATOM   2393  H  HA   . ASN A  1 153 ? -63.707 -10.472 8.371   1.00 28.93  ?  153 ASN A HA   1 
ATOM   2394  H  HB2  . ASN A  1 153 ? -65.516 -8.325  8.259   1.00 31.12  ?  153 ASN A HB2  1 
ATOM   2395  H  HB3  . ASN A  1 153 ? -63.974 -8.061  7.976   1.00 31.12  ?  153 ASN A HB3  1 
ATOM   2396  H  HD21 . ASN A  1 153 ? -65.269 -8.350  4.798   1.00 50.70  ?  153 ASN A HD21 1 
ATOM   2397  H  HD22 . ASN A  1 153 ? -65.208 -7.349  5.899   1.00 50.70  ?  153 ASN A HD22 1 
ATOM   2398  N  N    . TYR A  1 154 ? -64.304 -8.887  11.097  1.00 24.53  ?  154 TYR A N    1 
ATOM   2399  C  CA   . TYR A  1 154 ? -63.616 -8.307  12.244  1.00 21.14  ?  154 TYR A CA   1 
ATOM   2400  C  C    . TYR A  1 154 ? -62.783 -9.357  12.959  1.00 21.73  ?  154 TYR A C    1 
ATOM   2401  O  O    . TYR A  1 154 ? -61.650 -9.082  13.382  1.00 18.38  ?  154 TYR A O    1 
ATOM   2402  C  CB   . TYR A  1 154 ? -64.618 -7.681  13.212  1.00 20.80  ?  154 TYR A CB   1 
ATOM   2403  C  CG   . TYR A  1 154 ? -63.955 -6.862  14.295  1.00 21.69  ?  154 TYR A CG   1 
ATOM   2404  C  CD1  . TYR A  1 154 ? -63.777 -7.383  15.570  1.00 21.68  ?  154 TYR A CD1  1 
ATOM   2405  C  CD2  . TYR A  1 154 ? -63.511 -5.576  14.042  1.00 21.15  ?  154 TYR A CD2  1 
ATOM   2406  C  CE1  . TYR A  1 154 ? -63.172 -6.636  16.558  1.00 21.47  ?  154 TYR A CE1  1 
ATOM   2407  C  CE2  . TYR A  1 154 ? -62.908 -4.818  15.017  1.00 20.96  ?  154 TYR A CE2  1 
ATOM   2408  C  CZ   . TYR A  1 154 ? -62.755 -5.352  16.284  1.00 20.30  ?  154 TYR A CZ   1 
ATOM   2409  O  OH   . TYR A  1 154 ? -62.167 -4.594  17.274  1.00 24.09  ?  154 TYR A OH   1 
ATOM   2410  H  H    . TYR A  1 154 ? -65.163 -8.878  11.140  1.00 29.43  ?  154 TYR A H    1 
ATOM   2411  H  HA   . TYR A  1 154 ? -63.019 -7.607  11.935  1.00 25.36  ?  154 TYR A HA   1 
ATOM   2412  H  HB2  . TYR A  1 154 ? -65.213 -7.096  12.717  1.00 24.96  ?  154 TYR A HB2  1 
ATOM   2413  H  HB3  . TYR A  1 154 ? -65.127 -8.387  13.640  1.00 24.96  ?  154 TYR A HB3  1 
ATOM   2414  H  HD1  . TYR A  1 154 ? -64.068 -8.246  15.759  1.00 26.01  ?  154 TYR A HD1  1 
ATOM   2415  H  HD2  . TYR A  1 154 ? -63.625 -5.215  13.193  1.00 25.38  ?  154 TYR A HD2  1 
ATOM   2416  H  HE1  . TYR A  1 154 ? -63.067 -6.989  17.412  1.00 25.76  ?  154 TYR A HE1  1 
ATOM   2417  H  HE2  . TYR A  1 154 ? -62.626 -3.952  14.833  1.00 25.15  ?  154 TYR A HE2  1 
ATOM   2418  H  HH   . TYR A  1 154 ? -61.963 -3.837  16.973  1.00 28.91  ?  154 TYR A HH   1 
ATOM   2419  N  N    . GLU A  1 155 ? -63.347 -10.546 13.159  1.00 21.01  ?  155 GLU A N    1 
ATOM   2420  C  CA   . GLU A  1 155 ? -62.607 -11.638 13.780  1.00 23.54  ?  155 GLU A CA   1 
ATOM   2421  C  C    . GLU A  1 155 ? -61.426 -12.051 12.915  1.00 18.94  ?  155 GLU A C    1 
ATOM   2422  O  O    . GLU A  1 155 ? -60.323 -12.247 13.434  1.00 19.21  ?  155 GLU A O    1 
ATOM   2423  C  CB   . GLU A  1 155 ? -63.523 -12.837 14.047  1.00 27.03  ?  155 GLU A CB   1 
ATOM   2424  C  CG   . GLU A  1 155 ? -62.852 -13.904 14.946  1.00 32.39  ?  155 GLU A CG   1 
ATOM   2425  C  CD   . GLU A  1 155 ? -63.604 -15.239 15.105  1.00 46.76  ?  155 GLU A CD   1 
ATOM   2426  O  OE1  . GLU A  1 155 ? -64.709 -15.438 14.525  1.00 37.23  ?  155 GLU A OE1  1 
ATOM   2427  O  OE2  . GLU A  1 155 ? -63.057 -16.103 15.834  1.00 40.27  -1 155 GLU A OE2  1 
ATOM   2428  H  H    . GLU A  1 155 ? -64.156 -10.744 12.943  1.00 25.21  ?  155 GLU A H    1 
ATOM   2429  H  HA   . GLU A  1 155 ? -62.258 -11.335 14.632  1.00 28.25  ?  155 GLU A HA   1 
ATOM   2430  H  HB2  . GLU A  1 155 ? -64.326 -12.528 14.495  1.00 32.43  ?  155 GLU A HB2  1 
ATOM   2431  H  HB3  . GLU A  1 155 ? -63.752 -13.255 13.203  1.00 32.43  ?  155 GLU A HB3  1 
ATOM   2432  H  HG2  . GLU A  1 155 ? -61.979 -14.108 14.574  1.00 38.86  ?  155 GLU A HG2  1 
ATOM   2433  H  HG3  . GLU A  1 155 ? -62.742 -13.528 15.833  1.00 38.86  ?  155 GLU A HG3  1 
ATOM   2434  N  N    . LYS A  1 156 ? -61.629 -12.176 11.597  1.00 21.61  ?  156 LYS A N    1 
ATOM   2435  C  CA   . LYS A  1 156 ? -60.520 -12.483 10.698  1.00 19.27  ?  156 LYS A CA   1 
ATOM   2436  C  C    . LYS A  1 156 ? -59.408 -11.459 10.825  1.00 19.43  ?  156 LYS A C    1 
ATOM   2437  O  O    . LYS A  1 156 ? -58.223 -11.812 10.877  1.00 17.74  ?  156 LYS A O    1 
ATOM   2438  C  CB   . LYS A  1 156 ? -60.996 -12.514 9.246   1.00 22.59  ?  156 LYS A CB   1 
ATOM   2439  C  CG   . LYS A  1 156 ? -61.519 -13.825 8.819   1.00 34.00  ?  156 LYS A CG   1 
ATOM   2440  C  CD   . LYS A  1 156 ? -61.543 -13.929 7.288   1.00 38.75  ?  156 LYS A CD   1 
ATOM   2441  C  CE   . LYS A  1 156 ? -62.735 -13.207 6.663   1.00 52.61  ?  156 LYS A CE   1 
ATOM   2442  N  NZ   . LYS A  1 156 ? -62.925 -13.506 5.186   1.00 58.62  1  156 LYS A NZ   1 
ATOM   2443  H  H    . LYS A  1 156 ? -62.390 -12.089 11.207  1.00 25.93  ?  156 LYS A H    1 
ATOM   2444  H  HA   . LYS A  1 156 ? -60.159 -13.356 10.919  1.00 23.13  ?  156 LYS A HA   1 
ATOM   2445  H  HB2  . LYS A  1 156 ? -61.705 -11.861 9.136   1.00 27.10  ?  156 LYS A HB2  1 
ATOM   2446  H  HB3  . LYS A  1 156 ? -60.250 -12.290 8.667   1.00 27.10  ?  156 LYS A HB3  1 
ATOM   2447  H  HG2  . LYS A  1 156 ? -60.948 -14.529 9.165   1.00 40.80  ?  156 LYS A HG2  1 
ATOM   2448  H  HG3  . LYS A  1 156 ? -62.426 -13.933 9.147   1.00 40.80  ?  156 LYS A HG3  1 
ATOM   2449  H  HD2  . LYS A  1 156 ? -60.732 -13.532 6.932   1.00 46.50  ?  156 LYS A HD2  1 
ATOM   2450  H  HD3  . LYS A  1 156 ? -61.593 -14.864 7.035   1.00 46.50  ?  156 LYS A HD3  1 
ATOM   2451  H  HE2  . LYS A  1 156 ? -63.543 -13.477 7.127   1.00 63.13  ?  156 LYS A HE2  1 
ATOM   2452  H  HE3  . LYS A  1 156 ? -62.606 -12.250 6.757   1.00 63.13  ?  156 LYS A HE3  1 
ATOM   2453  H  HZ1  . LYS A  1 156 ? -63.058 -14.378 5.068   1.00 70.34  ?  156 LYS A HZ1  1 
ATOM   2454  H  HZ2  . LYS A  1 156 ? -63.630 -13.062 4.874   1.00 70.34  ?  156 LYS A HZ2  1 
ATOM   2455  H  HZ3  . LYS A  1 156 ? -62.202 -13.259 4.730   1.00 70.34  ?  156 LYS A HZ3  1 
ATOM   2456  N  N    . PHE A  1 157 ? -59.774 -10.182 10.853  1.00 18.22  ?  157 PHE A N    1 
ATOM   2457  C  CA   . PHE A  1 157 ? -58.794 -9.129  10.980  1.00 16.07  ?  157 PHE A CA   1 
ATOM   2458  C  C    . PHE A  1 157 ? -58.046 -9.248  12.298  1.00 16.97  ?  157 PHE A C    1 
ATOM   2459  O  O    . PHE A  1 157 ? -56.822 -9.059  12.347  1.00 17.03  ?  157 PHE A O    1 
ATOM   2460  C  CB   . PHE A  1 157 ? -59.460 -7.755  10.865  1.00 17.85  ?  157 PHE A CB   1 
ATOM   2461  C  CG   . PHE A  1 157 ? -58.515 -6.629  11.049  1.00 17.43  ?  157 PHE A CG   1 
ATOM   2462  C  CD1  . PHE A  1 157 ? -57.555 -6.353  10.066  1.00 18.13  ?  157 PHE A CD1  1 
ATOM   2463  C  CD2  . PHE A  1 157 ? -58.516 -5.881  12.209  1.00 18.22  ?  157 PHE A CD2  1 
ATOM   2464  C  CE1  . PHE A  1 157 ? -56.640 -5.333  10.225  1.00 18.29  ?  157 PHE A CE1  1 
ATOM   2465  C  CE2  . PHE A  1 157 ? -57.618 -4.839  12.377  1.00 20.67  ?  157 PHE A CE2  1 
ATOM   2466  C  CZ   . PHE A  1 157 ? -56.673 -4.563  11.409  1.00 21.63  ?  157 PHE A CZ   1 
ATOM   2467  H  H    . PHE A  1 157 ? -60.586 -9.905  10.799  1.00 21.87  ?  157 PHE A H    1 
ATOM   2468  H  HA   . PHE A  1 157 ? -58.148 -9.211  10.260  1.00 19.29  ?  157 PHE A HA   1 
ATOM   2469  H  HB2  . PHE A  1 157 ? -59.856 -7.671  9.983   1.00 21.42  ?  157 PHE A HB2  1 
ATOM   2470  H  HB3  . PHE A  1 157 ? -60.148 -7.682  11.545  1.00 21.42  ?  157 PHE A HB3  1 
ATOM   2471  H  HD1  . PHE A  1 157 ? -57.536 -6.865  9.290   1.00 21.76  ?  157 PHE A HD1  1 
ATOM   2472  H  HD2  . PHE A  1 157 ? -59.146 -6.057  12.870  1.00 21.86  ?  157 PHE A HD2  1 
ATOM   2473  H  HE1  . PHE A  1 157 ? -56.016 -5.151  9.560   1.00 21.95  ?  157 PHE A HE1  1 
ATOM   2474  H  HE2  . PHE A  1 157 ? -57.635 -4.337  13.159  1.00 24.80  ?  157 PHE A HE2  1 
ATOM   2475  H  HZ   . PHE A  1 157 ? -56.070 -3.866  11.530  1.00 25.96  ?  157 PHE A HZ   1 
ATOM   2476  N  N    . THR A  1 158 ? -58.774 -9.509  13.388  1.00 17.88  ?  158 THR A N    1 
ATOM   2477  C  CA   . THR A  1 158 ? -58.127 -9.652  14.690  1.00 16.05  ?  158 THR A CA   1 
ATOM   2478  C  C    . THR A  1 158 ? -57.118 -10.792 14.681  1.00 16.05  ?  158 THR A C    1 
ATOM   2479  O  O    . THR A  1 158 ? -55.991 -10.638 15.179  1.00 16.55  ?  158 THR A O    1 
ATOM   2480  C  CB   . THR A  1 158 ? -59.191 -9.866  15.768  1.00 18.60  ?  158 THR A CB   1 
ATOM   2481  O  OG1  . THR A  1 158 ? -60.113 -8.759  15.787  1.00 19.46  ?  158 THR A OG1  1 
ATOM   2482  C  CG2  . THR A  1 158 ? -58.564 -10.004 17.148  1.00 19.58  ?  158 THR A CG2  1 
ATOM   2483  H  H    . THR A  1 158 ? -59.629 -9.606  13.398  1.00 21.46  ?  158 THR A H    1 
ATOM   2484  H  HA   . THR A  1 158 ? -57.652 -8.832  14.897  1.00 19.26  ?  158 THR A HA   1 
ATOM   2485  H  HB   . THR A  1 158 ? -59.678 -10.682 15.576  1.00 22.32  ?  158 THR A HB   1 
ATOM   2486  H  HG1  . THR A  1 158 ? -60.494 -8.690  15.041  1.00 23.35  ?  158 THR A HG1  1 
ATOM   2487  H  HG21 . THR A  1 158 ? -59.256 -10.139 17.815  1.00 23.49  ?  158 THR A HG21 1 
ATOM   2488  H  HG22 . THR A  1 158 ? -57.960 -10.763 17.163  1.00 23.49  ?  158 THR A HG22 1 
ATOM   2489  H  HG23 . THR A  1 158 ? -58.067 -9.201  17.368  1.00 23.49  ?  158 THR A HG23 1 
ATOM   2490  N  N    . GLU A  1 159 ? -57.480 -11.917 14.073  1.00 15.96  ?  159 GLU A N    1 
ATOM   2491  C  CA   . GLU A  1 159 ? -56.565 -13.054 14.078  1.00 15.09  ?  159 GLU A CA   1 
ATOM   2492  C  C    . GLU A  1 159 ? -55.410 -12.828 13.116  1.00 16.87  ?  159 GLU A C    1 
ATOM   2493  O  O    . GLU A  1 159 ? -54.249 -13.114 13.458  1.00 17.16  ?  159 GLU A O    1 
ATOM   2494  C  CB   . GLU A  1 159 ? -57.306 -14.350 13.765  1.00 16.80  ?  159 GLU A CB   1 
ATOM   2495  C  CG   . GLU A  1 159 ? -58.379 -14.729 14.792  1.00 18.44  ?  159 GLU A CG   1 
ATOM   2496  C  CD   . GLU A  1 159 ? -57.861 -14.911 16.227  1.00 24.44  ?  159 GLU A CD   1 
ATOM   2497  O  OE1  . GLU A  1 159 ? -56.647 -15.042 16.496  1.00 20.44  ?  159 GLU A OE1  1 
ATOM   2498  O  OE2  . GLU A  1 159 ? -58.718 -14.941 17.145  1.00 32.54  -1 159 GLU A OE2  1 
ATOM   2499  H  H    . GLU A  1 159 ? -58.224 -12.047 13.662  1.00 19.15  ?  159 GLU A H    1 
ATOM   2500  H  HA   . GLU A  1 159 ? -56.190 -13.141 14.968  1.00 18.10  ?  159 GLU A HA   1 
ATOM   2501  H  HB2  . GLU A  1 159 ? -57.742 -14.258 12.904  1.00 20.16  ?  159 GLU A HB2  1 
ATOM   2502  H  HB3  . GLU A  1 159 ? -56.662 -15.074 13.730  1.00 20.16  ?  159 GLU A HB3  1 
ATOM   2503  H  HG2  . GLU A  1 159 ? -59.052 -14.031 14.809  1.00 22.13  ?  159 GLU A HG2  1 
ATOM   2504  H  HG3  . GLU A  1 159 ? -58.786 -15.567 14.519  1.00 22.13  ?  159 GLU A HG3  1 
ATOM   2505  N  N    . LEU A  1 160 ? -55.681 -12.278 11.937  1.00 16.50  ?  160 LEU A N    1 
ATOM   2506  C  CA   . LEU A  1 160 ? -54.582 -11.976 11.016  1.00 15.85  ?  160 LEU A CA   1 
ATOM   2507  C  C    . LEU A  1 160 ? -53.626 -10.916 11.567  1.00 16.00  ?  160 LEU A C    1 
ATOM   2508  O  O    . LEU A  1 160 ? -52.422 -10.927 11.242  1.00 16.13  ?  160 LEU A O    1 
ATOM   2509  C  CB   . LEU A  1 160 ? -55.150 -11.540 9.666   1.00 17.28  ?  160 LEU A CB   1 
ATOM   2510  C  CG   . LEU A  1 160 ? -55.707 -12.683 8.839   1.00 16.34  ?  160 LEU A CG   1 
ATOM   2511  C  CD1  . LEU A  1 160 ? -56.582 -12.107 7.722   1.00 19.09  ?  160 LEU A CD1  1 
ATOM   2512  C  CD2  . LEU A  1 160 ? -54.611 -13.571 8.303   1.00 19.93  ?  160 LEU A CD2  1 
ATOM   2513  H  H    . LEU A  1 160 ? -56.466 -12.074 11.650  1.00 19.80  ?  160 LEU A H    1 
ATOM   2514  H  HA   . LEU A  1 160 ? -54.069 -12.786 10.870  1.00 19.02  ?  160 LEU A HA   1 
ATOM   2515  H  HB2  . LEU A  1 160 ? -55.868 -10.907 9.819   1.00 20.74  ?  160 LEU A HB2  1 
ATOM   2516  H  HB3  . LEU A  1 160 ? -54.444 -11.119 9.152   1.00 20.74  ?  160 LEU A HB3  1 
ATOM   2517  H  HG   . LEU A  1 160 ? -56.275 -13.227 9.406   1.00 19.61  ?  160 LEU A HG   1 
ATOM   2518  H  HD11 . LEU A  1 160 ? -56.939 -12.837 7.192   1.00 22.91  ?  160 LEU A HD11 1 
ATOM   2519  H  HD12 . LEU A  1 160 ? -57.308 -11.600 8.119   1.00 22.91  ?  160 LEU A HD12 1 
ATOM   2520  H  HD13 . LEU A  1 160 ? -56.040 -11.527 7.164   1.00 22.91  ?  160 LEU A HD13 1 
ATOM   2521  H  HD21 . LEU A  1 160 ? -55.010 -14.285 7.783   1.00 23.92  ?  160 LEU A HD21 1 
ATOM   2522  H  HD22 . LEU A  1 160 ? -54.022 -13.041 7.743   1.00 23.92  ?  160 LEU A HD22 1 
ATOM   2523  H  HD23 . LEU A  1 160 ? -54.113 -13.942 9.049   1.00 23.92  ?  160 LEU A HD23 1 
ATOM   2524  N  N    . SER A  1 161 ? -54.115 -9.994  12.404  1.00 15.18  ?  161 SER A N    1 
ATOM   2525  C  CA   . SER A  1 161 ? -53.253 -8.999  13.028  1.00 13.89  ?  161 SER A CA   1 
ATOM   2526  C  C    . SER A  1 161 ? -52.105 -9.637  13.797  1.00 15.80  ?  161 SER A C    1 
ATOM   2527  O  O    . SER A  1 161 ? -51.055 -9.010  13.965  1.00 16.43  ?  161 SER A O    1 
ATOM   2528  C  CB   . SER A  1 161 ? -54.069 -8.099  13.958  1.00 14.98  ?  161 SER A CB   1 
ATOM   2529  O  OG   . SER A  1 161 ? -54.886 -7.211  13.192  1.00 18.74  ?  161 SER A OG   1 
ATOM   2530  H  H    . SER A  1 161 ? -54.943 -9.928  12.624  1.00 18.21  ?  161 SER A H    1 
ATOM   2531  H  HA   . SER A  1 161 ? -52.870 -8.439  12.334  1.00 16.66  ?  161 SER A HA   1 
ATOM   2532  H  HB2  . SER A  1 161 ? -54.638 -8.651  14.517  1.00 17.98  ?  161 SER A HB2  1 
ATOM   2533  H  HB3  . SER A  1 161 ? -53.464 -7.578  14.509  1.00 17.98  ?  161 SER A HB3  1 
ATOM   2534  H  HG   . SER A  1 161 ? -55.413 -7.651  12.709  1.00 22.49  ?  161 SER A HG   1 
ATOM   2535  N  N    . GLU A  1 162 ? -52.313 -10.852 14.306  1.00 16.52  ?  162 GLU A N    1 
ATOM   2536  C  CA   . GLU A  1 162 ? -51.266 -11.556 15.050  1.00 15.64  ?  162 GLU A CA   1 
ATOM   2537  C  C    . GLU A  1 162 ? -50.036 -11.802 14.193  1.00 15.50  ?  162 GLU A C    1 
ATOM   2538  O  O    . GLU A  1 162 ? -48.941 -11.966 14.744  1.00 15.02  ?  162 GLU A O    1 
ATOM   2539  C  CB   . GLU A  1 162 ? -51.772 -12.890 15.627  1.00 14.33  ?  162 GLU A CB   1 
ATOM   2540  C  CG   . GLU A  1 162 ? -52.837 -12.709 16.697  1.00 18.54  ?  162 GLU A CG   1 
ATOM   2541  C  CD   . GLU A  1 162 ? -52.288 -12.046 17.948  1.00 28.07  ?  162 GLU A CD   1 
ATOM   2542  O  OE1  . GLU A  1 162 ? -51.175 -12.425 18.370  1.00 25.46  ?  162 GLU A OE1  1 
ATOM   2543  O  OE2  . GLU A  1 162 ? -52.925 -11.104 18.472  1.00 32.74  -1 162 GLU A OE2  1 
ATOM   2544  H  H    . GLU A  1 162 ? -53.049 -11.290 14.235  1.00 19.82  ?  162 GLU A H    1 
ATOM   2545  H  HA   . GLU A  1 162 ? -50.994 -11.000 15.797  1.00 18.77  ?  162 GLU A HA   1 
ATOM   2546  H  HB2  . GLU A  1 162 ? -52.156 -13.418 14.909  1.00 17.19  ?  162 GLU A HB2  1 
ATOM   2547  H  HB3  . GLU A  1 162 ? -51.026 -13.365 16.024  1.00 17.19  ?  162 GLU A HB3  1 
ATOM   2548  H  HG2  . GLU A  1 162 ? -53.548 -12.150 16.347  1.00 22.25  ?  162 GLU A HG2  1 
ATOM   2549  H  HG3  . GLU A  1 162 ? -53.188 -13.579 16.947  1.00 22.25  ?  162 GLU A HG3  1 
ATOM   2550  N  N    . LEU A  1 163 ? -50.172 -11.770 12.861  1.00 14.66  ?  163 LEU A N    1 
ATOM   2551  C  CA   . LEU A  1 163 ? -48.985 -11.840 12.001  1.00 14.95  ?  163 LEU A CA   1 
ATOM   2552  C  C    . LEU A  1 163 ? -47.973 -10.753 12.318  1.00 14.75  ?  163 LEU A C    1 
ATOM   2553  O  O    . LEU A  1 163 ? -46.762 -10.951 12.124  1.00 15.49  ?  163 LEU A O    1 
ATOM   2554  C  CB   . LEU A  1 163 ? -49.400 -11.735 10.531  1.00 15.22  ?  163 LEU A CB   1 
ATOM   2555  C  CG   . LEU A  1 163 ? -50.147 -12.965 10.025  1.00 15.71  ?  163 LEU A CG   1 
ATOM   2556  C  CD1  . LEU A  1 163 ? -50.826 -12.676 8.681   1.00 17.41  ?  163 LEU A CD1  1 
ATOM   2557  C  CD2  . LEU A  1 163 ? -49.270 -14.220 9.895   1.00 20.00  ?  163 LEU A CD2  1 
ATOM   2558  H  H    . LEU A  1 163 ? -50.920 -11.710 12.441  1.00 17.59  ?  163 LEU A H    1 
ATOM   2559  H  HA   . LEU A  1 163 ? -48.552 -12.698 12.130  1.00 17.94  ?  163 LEU A HA   1 
ATOM   2560  H  HB2  . LEU A  1 163 ? -49.982 -10.967 10.423  1.00 18.26  ?  163 LEU A HB2  1 
ATOM   2561  H  HB3  . LEU A  1 163 ? -48.604 -11.625 9.987   1.00 18.26  ?  163 LEU A HB3  1 
ATOM   2562  H  HG   . LEU A  1 163 ? -50.849 -13.173 10.661  1.00 18.85  ?  163 LEU A HG   1 
ATOM   2563  H  HD11 . LEU A  1 163 ? -51.292 -13.474 8.386   1.00 20.89  ?  163 LEU A HD11 1 
ATOM   2564  H  HD12 . LEU A  1 163 ? -51.457 -11.948 8.797   1.00 20.89  ?  163 LEU A HD12 1 
ATOM   2565  H  HD13 . LEU A  1 163 ? -50.149 -12.428 8.032   1.00 20.89  ?  163 LEU A HD13 1 
ATOM   2566  H  HD21 . LEU A  1 163 ? -49.816 -14.954 9.570   1.00 24.00  ?  163 LEU A HD21 1 
ATOM   2567  H  HD22 . LEU A  1 163 ? -48.551 -14.040 9.269   1.00 24.00  ?  163 LEU A HD22 1 
ATOM   2568  H  HD23 . LEU A  1 163 ? -48.904 -14.441 10.766  1.00 24.00  ?  163 LEU A HD23 1 
ATOM   2569  N  N    . CYS A  1 164 ? -48.430 -9.586  12.778  1.00 15.53  ?  164 CYS A N    1 
ATOM   2570  C  CA   . CYS A  1 164 ? -47.516 -8.510  13.109  1.00 15.43  ?  164 CYS A CA   1 
ATOM   2571  C  C    . CYS A  1 164 ? -46.569 -8.900  14.238  1.00 15.31  ?  164 CYS A C    1 
ATOM   2572  O  O    . CYS A  1 164 ? -45.471 -8.356  14.327  1.00 15.87  ?  164 CYS A O    1 
ATOM   2573  C  CB   . CYS A  1 164 ? -48.282 -7.230  13.457  1.00 15.85  ?  164 CYS A CB   1 
ATOM   2574  S  SG   . CYS A  1 164 ? -49.354 -6.686  12.060  1.00 17.97  ?  164 CYS A SG   1 
ATOM   2575  H  H    . CYS A  1 164 ? -49.260 -9.399  12.903  1.00 18.63  ?  164 CYS A H    1 
ATOM   2576  H  HA   . CYS A  1 164 ? -46.972 -8.319  12.329  1.00 18.51  ?  164 CYS A HA   1 
ATOM   2577  H  HB2  . CYS A  1 164 ? -48.848 -7.395  14.228  1.00 19.02  ?  164 CYS A HB2  1 
ATOM   2578  H  HB3  . CYS A  1 164 ? -47.650 -6.520  13.650  1.00 19.02  ?  164 CYS A HB3  1 
ATOM   2579  H  HG   . CYS A  1 164 ? -48.666 -6.474  11.099  1.00 21.57  ?  164 CYS A HG   1 
ATOM   2580  N  N    . GLY A  1 165 ? -46.975 -9.828  15.100  1.00 15.71  ?  165 GLY A N    1 
ATOM   2581  C  CA   . GLY A  1 165 ? -46.104 -10.298 16.162  1.00 16.44  ?  165 GLY A CA   1 
ATOM   2582  C  C    . GLY A  1 165 ? -44.918 -11.093 15.676  1.00 15.14  ?  165 GLY A C    1 
ATOM   2583  O  O    . GLY A  1 165 ? -43.974 -11.299 16.448  1.00 17.08  ?  165 GLY A O    1 
ATOM   2584  H  H    . GLY A  1 165 ? -47.751 -10.199 15.089  1.00 18.85  ?  165 GLY A H    1 
ATOM   2585  H  HA2  . GLY A  1 165 ? -45.773 -9.535  16.662  1.00 19.73  ?  165 GLY A HA2  1 
ATOM   2586  H  HA3  . GLY A  1 165 ? -46.615 -10.858 16.767  1.00 19.73  ?  165 GLY A HA3  1 
ATOM   2587  N  N    . LEU A  1 166 ? -44.951 -11.532 14.429  1.00 14.85  ?  166 LEU A N    1 
ATOM   2588  C  CA   . LEU A  1 166 ? -43.840 -12.183 13.741  1.00 14.10  ?  166 LEU A CA   1 
ATOM   2589  C  C    . LEU A  1 166 ? -43.188 -11.256 12.730  1.00 14.57  ?  166 LEU A C    1 
ATOM   2590  O  O    . LEU A  1 166 ? -42.441 -11.720 11.861  1.00 15.36  ?  166 LEU A O    1 
ATOM   2591  C  CB   . LEU A  1 166 ? -44.341 -13.438 13.030  1.00 15.32  ?  166 LEU A CB   1 
ATOM   2592  C  CG   . LEU A  1 166 ? -45.088 -14.476 13.884  1.00 17.63  ?  166 LEU A CG   1 
ATOM   2593  C  CD1  . LEU A  1 166 ? -45.702 -15.602 13.047  1.00 20.46  ?  166 LEU A CD1  1 
ATOM   2594  C  CD2  . LEU A  1 166 ? -44.150 -15.035 14.927  1.00 28.32  ?  166 LEU A CD2  1 
ATOM   2595  H  H    . LEU A  1 166 ? -45.648 -11.461 13.930  1.00 17.82  ?  166 LEU A H    1 
ATOM   2596  H  HA   . LEU A  1 166 ? -43.170 -12.446 14.391  1.00 16.92  ?  166 LEU A HA   1 
ATOM   2597  H  HB2  . LEU A  1 166 ? -44.944 -13.163 12.322  1.00 18.39  ?  166 LEU A HB2  1 
ATOM   2598  H  HB3  . LEU A  1 166 ? -43.575 -13.888 12.640  1.00 18.39  ?  166 LEU A HB3  1 
ATOM   2599  H  HG   . LEU A  1 166 ? -45.812 -14.029 14.351  1.00 21.15  ?  166 LEU A HG   1 
ATOM   2600  H  HD11 . LEU A  1 166 ? -46.157 -16.222 13.638  1.00 24.55  ?  166 LEU A HD11 1 
ATOM   2601  H  HD12 . LEU A  1 166 ? -46.333 -15.219 12.418  1.00 24.55  ?  166 LEU A HD12 1 
ATOM   2602  H  HD13 . LEU A  1 166 ? -44.994 -16.060 12.568  1.00 24.55  ?  166 LEU A HD13 1 
ATOM   2603  H  HD21 . LEU A  1 166 ? -44.627 -15.688 15.462  1.00 33.99  ?  166 LEU A HD21 1 
ATOM   2604  H  HD22 . LEU A  1 166 ? -43.399 -15.456 14.481  1.00 33.99  ?  166 LEU A HD22 1 
ATOM   2605  H  HD23 . LEU A  1 166 ? -43.837 -14.310 15.490  1.00 33.99  ?  166 LEU A HD23 1 
ATOM   2606  N  N    . ASP A  1 167 ? -43.481 -9.963  12.807  1.00 16.04  ?  167 ASP A N    1 
ATOM   2607  C  CA   . ASP A  1 167 ? -43.022 -8.988  11.821  1.00 14.11  ?  167 ASP A CA   1 
ATOM   2608  C  C    . ASP A  1 167 ? -43.436 -9.403  10.416  1.00 16.69  ?  167 ASP A C    1 
ATOM   2609  O  O    . ASP A  1 167 ? -42.726 -9.170  9.436   1.00 17.56  ?  167 ASP A O    1 
ATOM   2610  C  CB   . ASP A  1 167 ? -41.517 -8.758  11.930  1.00 15.72  ?  167 ASP A CB   1 
ATOM   2611  C  CG   . ASP A  1 167 ? -41.110 -8.025  13.207  1.00 22.19  ?  167 ASP A CG   1 
ATOM   2612  O  OD1  . ASP A  1 167 ? -41.969 -7.543  13.969  1.00 18.45  ?  167 ASP A OD1  1 
ATOM   2613  O  OD2  . ASP A  1 167 ? -39.877 -7.950  13.462  1.00 24.29  -1 167 ASP A OD2  1 
ATOM   2614  H  H    . ASP A  1 167 ? -43.955 -9.617  13.436  1.00 19.25  ?  167 ASP A H    1 
ATOM   2615  H  HA   . ASP A  1 167 ? -43.455 -8.140  12.009  1.00 16.93  ?  167 ASP A HA   1 
ATOM   2616  H  HB2  . ASP A  1 167 ? -41.066 -9.617  11.923  1.00 18.86  ?  167 ASP A HB2  1 
ATOM   2617  H  HB3  . ASP A  1 167 ? -41.224 -8.225  11.174  1.00 18.86  ?  167 ASP A HB3  1 
ATOM   2618  N  N    . LEU A  1 168 ? -44.637 -9.970  10.324  1.00 14.99  ?  168 LEU A N    1 
ATOM   2619  C  CA   . LEU A  1 168 ? -45.283 -10.270 9.051   1.00 14.16  ?  168 LEU A CA   1 
ATOM   2620  C  C    . LEU A  1 168 ? -46.364 -9.232  8.742   1.00 13.08  ?  168 LEU A C    1 
ATOM   2621  O  O    . LEU A  1 168 ? -47.431 -9.530  8.158   1.00 14.95  ?  168 LEU A O    1 
ATOM   2622  C  CB   . LEU A  1 168 ? -45.823 -11.704 9.060   1.00 15.32  ?  168 LEU A CB   1 
ATOM   2623  C  CG   . LEU A  1 168 ? -44.743 -12.813 8.989   1.00 14.43  ?  168 LEU A CG   1 
ATOM   2624  C  CD1  . LEU A  1 168 ? -45.388 -14.160 9.148   1.00 15.87  ?  168 LEU A CD1  1 
ATOM   2625  C  CD2  . LEU A  1 168 ? -43.971 -12.719 7.662   1.00 15.65  ?  168 LEU A CD2  1 
ATOM   2626  H  H    . LEU A  1 168 ? -45.109 -10.197 11.006  1.00 17.99  ?  168 LEU A H    1 
ATOM   2627  H  HA   . LEU A  1 168 ? -44.618 -10.214 8.348   1.00 16.99  ?  168 LEU A HA   1 
ATOM   2628  H  HB2  . LEU A  1 168 ? -46.326 -11.838 9.878   1.00 18.38  ?  168 LEU A HB2  1 
ATOM   2629  H  HB3  . LEU A  1 168 ? -46.409 -11.817 8.296   1.00 18.38  ?  168 LEU A HB3  1 
ATOM   2630  H  HG   . LEU A  1 168 ? -44.113 -12.691 9.716   1.00 17.32  ?  168 LEU A HG   1 
ATOM   2631  H  HD11 . LEU A  1 168 ? -44.703 -14.845 9.102   1.00 19.05  ?  168 LEU A HD11 1 
ATOM   2632  H  HD12 . LEU A  1 168 ? -45.835 -14.196 10.008  1.00 19.05  ?  168 LEU A HD12 1 
ATOM   2633  H  HD13 . LEU A  1 168 ? -46.033 -14.287 8.434   1.00 19.05  ?  168 LEU A HD13 1 
ATOM   2634  H  HD21 . LEU A  1 168 ? -43.302 -13.420 7.636   1.00 18.78  ?  168 LEU A HD21 1 
ATOM   2635  H  HD22 . LEU A  1 168 ? -44.594 -12.829 6.926   1.00 18.78  ?  168 LEU A HD22 1 
ATOM   2636  H  HD23 . LEU A  1 168 ? -43.544 -11.850 7.607   1.00 18.78  ?  168 LEU A HD23 1 
ATOM   2637  N  N    . ASP A  1 169 ? -46.096 -7.975  9.118   1.00 15.88  ?  169 ASP A N    1 
ATOM   2638  C  CA   . ASP A  1 169 ? -46.982 -6.849  8.822   1.00 16.17  ?  169 ASP A CA   1 
ATOM   2639  C  C    . ASP A  1 169 ? -47.332 -6.772  7.340   1.00 14.97  ?  169 ASP A C    1 
ATOM   2640  O  O    . ASP A  1 169 ? -48.451 -6.392  6.981   1.00 16.29  ?  169 ASP A O    1 
ATOM   2641  C  CB   . ASP A  1 169 ? -46.341 -5.528  9.270   1.00 17.13  ?  169 ASP A CB   1 
ATOM   2642  C  CG   . ASP A  1 169 ? -45.861 -5.585  10.715  1.00 18.12  ?  169 ASP A CG   1 
ATOM   2643  O  OD1  . ASP A  1 169 ? -44.796 -6.213  10.941  1.00 18.90  ?  169 ASP A OD1  1 
ATOM   2644  O  OD2  . ASP A  1 169 ? -46.568 -5.050  11.598  1.00 18.66  -1 169 ASP A OD2  1 
ATOM   2645  H  H    . ASP A  1 169 ? -45.391 -7.748  9.555   1.00 19.06  ?  169 ASP A H    1 
ATOM   2646  H  HA   . ASP A  1 169 ? -47.809 -6.962  9.317   1.00 19.40  ?  169 ASP A HA   1 
ATOM   2647  H  HB2  . ASP A  1 169 ? -45.577 -5.338  8.705   1.00 20.55  ?  169 ASP A HB2  1 
ATOM   2648  H  HB3  . ASP A  1 169 ? -46.996 -4.816  9.197   1.00 20.55  ?  169 ASP A HB3  1 
ATOM   2649  N  N    . PHE A  1 170 ? -46.390 -7.111  6.455   1.00 14.31  ?  170 PHE A N    1 
ATOM   2650  C  CA   . PHE A  1 170 ? -46.706 -7.080  5.029   1.00 14.87  ?  170 PHE A CA   1 
ATOM   2651  C  C    . PHE A  1 170 ? -47.865 -8.011  4.712   1.00 16.80  ?  170 PHE A C    1 
ATOM   2652  O  O    . PHE A  1 170 ? -48.798 -7.635  3.991   1.00 16.54  ?  170 PHE A O    1 
ATOM   2653  C  CB   . PHE A  1 170 ? -45.482 -7.473  4.202   1.00 15.68  ?  170 PHE A CB   1 
ATOM   2654  C  CG   . PHE A  1 170 ? -45.760 -7.593  2.712   1.00 14.99  ?  170 PHE A CG   1 
ATOM   2655  C  CD1  . PHE A  1 170 ? -46.087 -6.457  1.974   1.00 18.24  ?  170 PHE A CD1  1 
ATOM   2656  C  CD2  . PHE A  1 170 ? -45.677 -8.806  2.071   1.00 14.86  ?  170 PHE A CD2  1 
ATOM   2657  C  CE1  . PHE A  1 170 ? -46.317 -6.540  0.602   1.00 17.68  ?  170 PHE A CE1  1 
ATOM   2658  C  CE2  . PHE A  1 170 ? -45.875 -8.900  0.711   1.00 17.17  ?  170 PHE A CE2  1 
ATOM   2659  C  CZ   . PHE A  1 170 ? -46.187 -7.775  -0.017  1.00 15.84  ?  170 PHE A CZ   1 
ATOM   2660  H  H    . PHE A  1 170 ? -45.587 -7.354  6.648   1.00 17.17  ?  170 PHE A H    1 
ATOM   2661  H  HA   . PHE A  1 170 ? -46.964 -6.179  4.779   1.00 17.84  ?  170 PHE A HA   1 
ATOM   2662  H  HB2  . PHE A  1 170 ? -44.795 -6.798  4.322   1.00 18.82  ?  170 PHE A HB2  1 
ATOM   2663  H  HB3  . PHE A  1 170 ? -45.157 -8.332  4.513   1.00 18.82  ?  170 PHE A HB3  1 
ATOM   2664  H  HD1  . PHE A  1 170 ? -46.144 -5.632  2.401   1.00 21.89  ?  170 PHE A HD1  1 
ATOM   2665  H  HD2  . PHE A  1 170 ? -45.440 -9.565  2.554   1.00 17.83  ?  170 PHE A HD2  1 
ATOM   2666  H  HE1  . PHE A  1 170 ? -46.528 -5.781  0.108   1.00 21.22  ?  170 PHE A HE1  1 
ATOM   2667  H  HE2  . PHE A  1 170 ? -45.816 -9.726  0.288   1.00 20.60  ?  170 PHE A HE2  1 
ATOM   2668  H  HZ   . PHE A  1 170 ? -46.355 -7.851  -0.929  1.00 19.01  ?  170 PHE A HZ   1 
ATOM   2669  N  N    . ASP A  1 171 ? -47.814 -9.241  5.242   1.00 15.56  ?  171 ASP A N    1 
ATOM   2670  C  CA   . ASP A  1 171 ? -48.858 -10.207 4.949   1.00 15.16  ?  171 ASP A CA   1 
ATOM   2671  C  C    . ASP A  1 171 ? -50.191 -9.735  5.521   1.00 14.90  ?  171 ASP A C    1 
ATOM   2672  O  O    . ASP A  1 171 ? -51.234 -9.857  4.859   1.00 15.99  ?  171 ASP A O    1 
ATOM   2673  C  CB   . ASP A  1 171 ? -48.485 -11.593 5.513   1.00 14.47  ?  171 ASP A CB   1 
ATOM   2674  C  CG   . ASP A  1 171 ? -47.335 -12.250 4.783   1.00 15.02  ?  171 ASP A CG   1 
ATOM   2675  O  OD1  . ASP A  1 171 ? -46.919 -11.709 3.735   1.00 17.98  ?  171 ASP A OD1  1 
ATOM   2676  O  OD2  . ASP A  1 171 ? -46.933 -13.325 5.280   1.00 15.83  -1 171 ASP A OD2  1 
ATOM   2677  H  H    . ASP A  1 171 ? -47.193 -9.528  5.763   1.00 18.67  ?  171 ASP A H    1 
ATOM   2678  H  HA   . ASP A  1 171 ? -48.954 -10.288 3.988   1.00 18.19  ?  171 ASP A HA   1 
ATOM   2679  H  HB2  . ASP A  1 171 ? -48.230 -11.495 6.443   1.00 17.37  ?  171 ASP A HB2  1 
ATOM   2680  H  HB3  . ASP A  1 171 ? -49.256 -12.178 5.442   1.00 17.37  ?  171 ASP A HB3  1 
ATOM   2681  N  N    . ALA A  1 172 ? -50.189 -9.209  6.760   1.00 16.62  ?  172 ALA A N    1 
ATOM   2682  C  CA   . ALA A  1 172 ? -51.422 -8.692  7.346   1.00 15.82  ?  172 ALA A CA   1 
ATOM   2683  C  C    . ALA A  1 172 ? -52.005 -7.578  6.493   1.00 16.62  ?  172 ALA A C    1 
ATOM   2684  O  O    . ALA A  1 172 ? -53.226 -7.541  6.260   1.00 17.36  ?  172 ALA A O    1 
ATOM   2685  C  CB   . ALA A  1 172 ? -51.161 -8.219  8.770   1.00 15.09  ?  172 ALA A CB   1 
ATOM   2686  H  H    . ALA A  1 172 ? -49.497 -9.144  7.266   1.00 19.94  ?  172 ALA A H    1 
ATOM   2687  H  HA   . ALA A  1 172 ? -52.075 -9.409  7.385   1.00 18.98  ?  172 ALA A HA   1 
ATOM   2688  H  HB1  . ALA A  1 172 ? -51.988 -7.879  9.146   1.00 18.10  ?  172 ALA A HB1  1 
ATOM   2689  H  HB2  . ALA A  1 172 ? -50.841 -8.968  9.298   1.00 18.10  ?  172 ALA A HB2  1 
ATOM   2690  H  HB3  . ALA A  1 172 ? -50.492 -7.517  8.752   1.00 18.10  ?  172 ALA A HB3  1 
ATOM   2691  N  N    . TYR A  1 173 ? -51.137 -6.708  5.967   1.00 17.27  ?  173 TYR A N    1 
ATOM   2692  C  CA   . TYR A  1 173 ? -51.571 -5.626  5.089   1.00 18.31  ?  173 TYR A CA   1 
ATOM   2693  C  C    . TYR A  1 173 ? -52.177 -6.162  3.790   1.00 17.60  ?  173 TYR A C    1 
ATOM   2694  O  O    . TYR A  1 173 ? -53.250 -5.709  3.365   1.00 17.38  ?  173 TYR A O    1 
ATOM   2695  C  CB   . TYR A  1 173 ? -50.391 -4.690  4.804   1.00 17.60  ?  173 TYR A CB   1 
ATOM   2696  C  CG   . TYR A  1 173 ? -50.843 -3.473  4.048   1.00 19.06  ?  173 TYR A CG   1 
ATOM   2697  C  CD1  . TYR A  1 173 ? -51.642 -2.550  4.683   1.00 23.87  ?  173 TYR A CD1  1 
ATOM   2698  C  CD2  . TYR A  1 173 ? -50.496 -3.266  2.727   1.00 24.77  ?  173 TYR A CD2  1 
ATOM   2699  C  CE1  . TYR A  1 173 ? -52.112 -1.432  4.045   1.00 27.62  ?  173 TYR A CE1  1 
ATOM   2700  C  CE2  . TYR A  1 173 ? -50.975 -2.104  2.051   1.00 21.52  ?  173 TYR A CE2  1 
ATOM   2701  C  CZ   . TYR A  1 173 ? -51.765 -1.211  2.736   1.00 23.84  ?  173 TYR A CZ   1 
ATOM   2702  O  OH   . TYR A  1 173 ? -52.264 -0.049  2.157   1.00 28.07  ?  173 TYR A OH   1 
ATOM   2703  H  H    . TYR A  1 173 ? -50.289 -6.726  6.107   1.00 20.72  ?  173 TYR A H    1 
ATOM   2704  H  HA   . TYR A  1 173 ? -52.255 -5.110  5.544   1.00 21.97  ?  173 TYR A HA   1 
ATOM   2705  H  HB2  . TYR A  1 173 ? -49.999 -4.401  5.642   1.00 21.12  ?  173 TYR A HB2  1 
ATOM   2706  H  HB3  . TYR A  1 173 ? -49.733 -5.157  4.266   1.00 21.12  ?  173 TYR A HB3  1 
ATOM   2707  H  HD1  . TYR A  1 173 ? -51.881 -2.696  5.570   1.00 28.64  ?  173 TYR A HD1  1 
ATOM   2708  H  HD2  . TYR A  1 173 ? -49.961 -3.881  2.279   1.00 29.73  ?  173 TYR A HD2  1 
ATOM   2709  H  HE1  . TYR A  1 173 ? -52.644 -0.820  4.500   1.00 33.14  ?  173 TYR A HE1  1 
ATOM   2710  H  HE2  . TYR A  1 173 ? -50.745 -1.945  1.164   1.00 25.82  ?  173 TYR A HE2  1 
ATOM   2711  H  HH   . TYR A  1 173 ? -52.005 0.009   1.360   1.00 33.69  ?  173 TYR A HH   1 
ATOM   2712  N  N    . VAL A  1 174 ? -51.511 -7.130  3.147   1.00 16.56  ?  174 VAL A N    1 
ATOM   2713  C  CA   . VAL A  1 174 ? -52.035 -7.682  1.901   1.00 16.72  ?  174 VAL A CA   1 
ATOM   2714  C  C    . VAL A  1 174 ? -53.396 -8.311  2.142   1.00 17.99  ?  174 VAL A C    1 
ATOM   2715  O  O    . VAL A  1 174 ? -54.336 -8.097  1.370   1.00 17.42  ?  174 VAL A O    1 
ATOM   2716  C  CB   . VAL A  1 174 ? -51.050 -8.698  1.290   1.00 17.97  ?  174 VAL A CB   1 
ATOM   2717  C  CG1  . VAL A  1 174 ? -51.670 -9.381  0.042   1.00 17.79  ?  174 VAL A CG1  1 
ATOM   2718  C  CG2  . VAL A  1 174 ? -49.686 -8.013  0.906   1.00 19.26  ?  174 VAL A CG2  1 
ATOM   2719  H  H    . VAL A  1 174 ? -50.768 -7.476  3.409   1.00 19.87  ?  174 VAL A H    1 
ATOM   2720  H  HA   . VAL A  1 174 ? -52.150 -6.960  1.263   1.00 20.07  ?  174 VAL A HA   1 
ATOM   2721  H  HB   . VAL A  1 174 ? -50.863 -9.388  1.945   1.00 21.56  ?  174 VAL A HB   1 
ATOM   2722  H  HG11 . VAL A  1 174 ? -51.031 -10.014 -0.321  1.00 21.35  ?  174 VAL A HG11 1 
ATOM   2723  H  HG12 . VAL A  1 174 ? -52.481 -9.844  0.307   1.00 21.35  ?  174 VAL A HG12 1 
ATOM   2724  H  HG13 . VAL A  1 174 ? -51.878 -8.702  -0.619  1.00 21.35  ?  174 VAL A HG13 1 
ATOM   2725  H  HG21 . VAL A  1 174 ? -49.094 -8.681  0.526   1.00 23.11  ?  174 VAL A HG21 1 
ATOM   2726  H  HG22 . VAL A  1 174 ? -49.856 -7.313  0.257   1.00 23.11  ?  174 VAL A HG22 1 
ATOM   2727  H  HG23 . VAL A  1 174 ? -49.287 -7.634  1.705   1.00 23.11  ?  174 VAL A HG23 1 
ATOM   2728  N  N    . PHE A  1 175 ? -53.508 -9.152  3.178   1.00 16.91  ?  175 PHE A N    1 
ATOM   2729  C  CA   . PHE A  1 175 ? -54.810 -9.765  3.456   1.00 18.70  ?  175 PHE A CA   1 
ATOM   2730  C  C    . PHE A  1 175 ? -55.873 -8.703  3.704   1.00 17.03  ?  175 PHE A C    1 
ATOM   2731  O  O    . PHE A  1 175 ? -57.019 -8.857  3.267   1.00 17.72  ?  175 PHE A O    1 
ATOM   2732  C  CB   . PHE A  1 175 ? -54.742 -10.704 4.664   1.00 17.14  ?  175 PHE A CB   1 
ATOM   2733  C  CG   . PHE A  1 175 ? -54.097 -12.045 4.390   1.00 14.79  ?  175 PHE A CG   1 
ATOM   2734  C  CD1  . PHE A  1 175 ? -54.628 -12.926 3.465   1.00 18.93  ?  175 PHE A CD1  1 
ATOM   2735  C  CD2  . PHE A  1 175 ? -52.974 -12.427 5.096   1.00 14.97  ?  175 PHE A CD2  1 
ATOM   2736  C  CE1  . PHE A  1 175 ? -54.020 -14.170 3.244   1.00 16.91  ?  175 PHE A CE1  1 
ATOM   2737  C  CE2  . PHE A  1 175 ? -52.378 -13.657 4.877   1.00 15.57  ?  175 PHE A CE2  1 
ATOM   2738  C  CZ   . PHE A  1 175 ? -52.875 -14.515 3.948   1.00 17.24  ?  175 PHE A CZ   1 
ATOM   2739  H  H    . PHE A  1 175 ? -52.874 -9.375  3.714   1.00 20.29  ?  175 PHE A H    1 
ATOM   2740  H  HA   . PHE A  1 175 ? -55.082 -10.287 2.686   1.00 22.44  ?  175 PHE A HA   1 
ATOM   2741  H  HB2  . PHE A  1 175 ? -54.230 -10.270 5.364   1.00 20.56  ?  175 PHE A HB2  1 
ATOM   2742  H  HB3  . PHE A  1 175 ? -55.645 -10.871 4.976   1.00 20.56  ?  175 PHE A HB3  1 
ATOM   2743  H  HD1  . PHE A  1 175 ? -55.387 -12.689 2.983   1.00 22.71  ?  175 PHE A HD1  1 
ATOM   2744  H  HD2  . PHE A  1 175 ? -52.610 -11.847 5.725   1.00 17.96  ?  175 PHE A HD2  1 
ATOM   2745  H  HE1  . PHE A  1 175 ? -54.372 -14.755 2.612   1.00 20.29  ?  175 PHE A HE1  1 
ATOM   2746  H  HE2  . PHE A  1 175 ? -51.613 -13.889 5.353   1.00 18.68  ?  175 PHE A HE2  1 
ATOM   2747  H  HZ   . PHE A  1 175 ? -52.472 -15.342 3.811   1.00 20.69  ?  175 PHE A HZ   1 
ATOM   2748  N  N    . THR A  1 176 ? -55.543 -7.663  4.460   1.00 18.36  ?  176 THR A N    1 
ATOM   2749  C  CA   . THR A  1 176 ? -56.503 -6.580  4.710   1.00 17.82  ?  176 THR A CA   1 
ATOM   2750  C  C    . THR A  1 176 ? -56.985 -5.976  3.400   1.00 18.56  ?  176 THR A C    1 
ATOM   2751  O  O    . THR A  1 176 ? -58.191 -5.749  3.209   1.00 21.00  ?  176 THR A O    1 
ATOM   2752  C  CB   . THR A  1 176 ? -55.869 -5.504  5.602   1.00 20.16  ?  176 THR A CB   1 
ATOM   2753  O  OG1  . THR A  1 176 ? -55.627 -6.055  6.902   1.00 22.42  ?  176 THR A OG1  1 
ATOM   2754  C  CG2  . THR A  1 176 ? -56.763 -4.247  5.758   1.00 21.94  ?  176 THR A CG2  1 
ATOM   2755  H  H    . THR A  1 176 ? -54.778 -7.555  4.838   1.00 22.03  ?  176 THR A H    1 
ATOM   2756  H  HA   . THR A  1 176 ? -57.273 -6.941  5.176   1.00 21.38  ?  176 THR A HA   1 
ATOM   2757  H  HB   . THR A  1 176 ? -55.025 -5.227  5.213   1.00 24.19  ?  176 THR A HB   1 
ATOM   2758  H  HG1  . THR A  1 176 ? -55.106 -6.711  6.844   1.00 26.90  ?  176 THR A HG1  1 
ATOM   2759  H  HG21 . THR A  1 176 ? -56.323 -3.597  6.328   1.00 26.33  ?  176 THR A HG21 1 
ATOM   2760  H  HG22 . THR A  1 176 ? -56.926 -3.846  4.890   1.00 26.33  ?  176 THR A HG22 1 
ATOM   2761  H  HG23 . THR A  1 176 ? -57.612 -4.492  6.157   1.00 26.33  ?  176 THR A HG23 1 
ATOM   2762  N  N    . LYS A  1 177 ? -56.057 -5.704  2.477   1.00 20.53  ?  177 LYS A N    1 
ATOM   2763  C  CA   . LYS A  1 177 ? -56.430 -5.114  1.193   1.00 22.44  ?  177 LYS A CA   1 
ATOM   2764  C  C    . LYS A  1 177 ? -57.323 -6.048  0.385   1.00 21.77  ?  177 LYS A C    1 
ATOM   2765  O  O    . LYS A  1 177 ? -58.379 -5.633  -0.132  1.00 21.13  ?  177 LYS A O    1 
ATOM   2766  C  CB   . LYS A  1 177 ? -55.169 -4.770  0.400   1.00 23.37  ?  177 LYS A CB   1 
ATOM   2767  C  CG   . LYS A  1 177 ? -54.354 -3.596  0.940   1.00 26.34  ?  177 LYS A CG   1 
ATOM   2768  C  CD   . LYS A  1 177 ? -55.039 -2.236  0.717   1.00 31.47  ?  177 LYS A CD   1 
ATOM   2769  C  CE   . LYS A  1 177 ? -55.012 -1.855  -0.752  1.00 33.48  ?  177 LYS A CE   1 
ATOM   2770  N  NZ   . LYS A  1 177 ? -55.365 -0.438  -0.974  1.00 39.53  1  177 LYS A NZ   1 
ATOM   2771  H  H    . LYS A  1 177 ? -55.215 -5.849  2.570   1.00 24.63  ?  177 LYS A H    1 
ATOM   2772  H  HA   . LYS A  1 177 ? -56.920 -4.292  1.352   1.00 26.92  ?  177 LYS A HA   1 
ATOM   2773  H  HB2  . LYS A  1 177 ? -54.589 -5.548  0.393   1.00 28.04  ?  177 LYS A HB2  1 
ATOM   2774  H  HB3  . LYS A  1 177 ? -55.428 -4.551  -0.509  1.00 28.04  ?  177 LYS A HB3  1 
ATOM   2775  H  HG2  . LYS A  1 177 ? -54.226 -3.713  1.894   1.00 31.60  ?  177 LYS A HG2  1 
ATOM   2776  H  HG3  . LYS A  1 177 ? -53.495 -3.576  0.490   1.00 31.60  ?  177 LYS A HG3  1 
ATOM   2777  H  HD2  . LYS A  1 177 ? -55.965 -2.290  1.002   1.00 37.76  ?  177 LYS A HD2  1 
ATOM   2778  H  HD3  . LYS A  1 177 ? -54.570 -1.552  1.219   1.00 37.76  ?  177 LYS A HD3  1 
ATOM   2779  H  HE2  . LYS A  1 177 ? -54.119 -2.001  -1.101  1.00 40.18  ?  177 LYS A HE2  1 
ATOM   2780  H  HE3  . LYS A  1 177 ? -55.651 -2.404  -1.233  1.00 40.18  ?  177 LYS A HE3  1 
ATOM   2781  H  HZ1  . LYS A  1 177 ? -56.185 -0.278  -0.668  1.00 47.44  ?  177 LYS A HZ1  1 
ATOM   2782  H  HZ2  . LYS A  1 177 ? -54.789 0.089   -0.547  1.00 47.44  ?  177 LYS A HZ2  1 
ATOM   2783  H  HZ3  . LYS A  1 177 ? -55.339 -0.251  -1.843  1.00 47.44  ?  177 LYS A HZ3  1 
ATOM   2784  N  N    . ILE A  1 178 ? -56.915 -7.310  0.251   1.00 18.76  ?  178 ILE A N    1 
ATOM   2785  C  CA   . ILE A  1 178 ? -57.587 -8.240  -0.650  1.00 19.47  ?  178 ILE A CA   1 
ATOM   2786  C  C    . ILE A  1 178 ? -58.938 -8.666  -0.098  1.00 22.60  ?  178 ILE A C    1 
ATOM   2787  O  O    . ILE A  1 178 ? -59.902 -8.850  -0.859  1.00 22.76  ?  178 ILE A O    1 
ATOM   2788  C  CB   . ILE A  1 178 ? -56.693 -9.465  -0.924  1.00 22.97  ?  178 ILE A CB   1 
ATOM   2789  C  CG1  . ILE A  1 178 ? -55.464 -9.051  -1.727  1.00 26.17  ?  178 ILE A CG1  1 
ATOM   2790  C  CG2  . ILE A  1 178 ? -57.489 -10.584 -1.637  1.00 23.17  ?  178 ILE A CG2  1 
ATOM   2791  C  CD1  . ILE A  1 178 ? -55.786 -8.513  -3.106  1.00 31.92  ?  178 ILE A CD1  1 
ATOM   2792  H  H    . ILE A  1 178 ? -56.248 -7.652  0.674   1.00 22.51  ?  178 ILE A H    1 
ATOM   2793  H  HA   . ILE A  1 178 ? -57.743 -7.794  -1.497  1.00 23.36  ?  178 ILE A HA   1 
ATOM   2794  H  HB   . ILE A  1 178 ? -56.390 -9.812  -0.070  1.00 27.57  ?  178 ILE A HB   1 
ATOM   2795  H  HG12 . ILE A  1 178 ? -54.992 -8.357  -1.241  1.00 31.40  ?  178 ILE A HG12 1 
ATOM   2796  H  HG13 . ILE A  1 178 ? -54.888 -9.824  -1.838  1.00 31.40  ?  178 ILE A HG13 1 
ATOM   2797  H  HG21 . ILE A  1 178 ? -56.901 -11.338 -1.794  1.00 27.80  ?  178 ILE A HG21 1 
ATOM   2798  H  HG22 . ILE A  1 178 ? -58.230 -10.854 -1.071  1.00 27.80  ?  178 ILE A HG22 1 
ATOM   2799  H  HG23 . ILE A  1 178 ? -57.825 -10.243 -2.481  1.00 27.80  ?  178 ILE A HG23 1 
ATOM   2800  H  HD11 . ILE A  1 178 ? -54.958 -8.273  -3.552  1.00 38.30  ?  178 ILE A HD11 1 
ATOM   2801  H  HD12 . ILE A  1 178 ? -56.248 -9.199  -3.612  1.00 38.30  ?  178 ILE A HD12 1 
ATOM   2802  H  HD13 . ILE A  1 178 ? -56.352 -7.731  -3.015  1.00 38.30  ?  178 ILE A HD13 1 
ATOM   2803  N  N    . LEU A  1 179 ? -59.039 -8.836  1.222   1.00 19.95  ?  179 LEU A N    1 
ATOM   2804  C  CA   . LEU A  1 179 ? -60.273 -9.294  1.847   1.00 21.23  ?  179 LEU A CA   1 
ATOM   2805  C  C    . LEU A  1 179 ? -61.195 -8.152  2.278   1.00 23.57  ?  179 LEU A C    1 
ATOM   2806  O  O    . LEU A  1 179 ? -62.265 -8.429  2.830   1.00 22.63  ?  179 LEU A O    1 
ATOM   2807  C  CB   . LEU A  1 179 ? -59.953 -10.192 3.052   1.00 17.71  ?  179 LEU A CB   1 
ATOM   2808  C  CG   . LEU A  1 179 ? -59.211 -11.474 2.698   1.00 19.01  ?  179 LEU A CG   1 
ATOM   2809  C  CD1  . LEU A  1 179 ? -58.835 -12.239 3.951   1.00 22.29  ?  179 LEU A CD1  1 
ATOM   2810  C  CD2  . LEU A  1 179 ? -60.000 -12.362 1.770   1.00 22.20  ?  179 LEU A CD2  1 
ATOM   2811  H  H    . LEU A  1 179 ? -58.400 -8.691  1.778   1.00 23.94  ?  179 LEU A H    1 
ATOM   2812  H  HA   . LEU A  1 179 ? -60.760 -9.833  1.204   1.00 25.48  ?  179 LEU A HA   1 
ATOM   2813  H  HB2  . LEU A  1 179 ? -59.400 -9.693  3.674   1.00 21.25  ?  179 LEU A HB2  1 
ATOM   2814  H  HB3  . LEU A  1 179 ? -60.785 -10.443 3.483   1.00 21.25  ?  179 LEU A HB3  1 
ATOM   2815  H  HG   . LEU A  1 179 ? -58.388 -11.236 2.243   1.00 22.81  ?  179 LEU A HG   1 
ATOM   2816  H  HD11 . LEU A  1 179 ? -58.364 -13.048 3.697   1.00 26.75  ?  179 LEU A HD11 1 
ATOM   2817  H  HD12 . LEU A  1 179 ? -58.261 -11.681 4.500   1.00 26.75  ?  179 LEU A HD12 1 
ATOM   2818  H  HD13 . LEU A  1 179 ? -59.643 -12.464 4.437   1.00 26.75  ?  179 LEU A HD13 1 
ATOM   2819  H  HD21 . LEU A  1 179 ? -59.482 -13.159 1.580   1.00 26.63  ?  179 LEU A HD21 1 
ATOM   2820  H  HD22 . LEU A  1 179 ? -60.835 -12.605 2.201   1.00 26.63  ?  179 LEU A HD22 1 
ATOM   2821  H  HD23 . LEU A  1 179 ? -60.180 -11.880 0.948   1.00 26.63  ?  179 LEU A HD23 1 
ATOM   2822  N  N    . GLY A  1 180 ? -60.810 -6.904  2.055   1.00 22.98  ?  180 GLY A N    1 
ATOM   2823  C  CA   . GLY A  1 180 ? -61.670 -5.775  2.404   1.00 24.27  ?  180 GLY A CA   1 
ATOM   2824  C  C    . GLY A  1 180 ? -61.891 -5.616  3.896   1.00 24.84  ?  180 GLY A C    1 
ATOM   2825  O  O    . GLY A  1 180 ? -63.011 -5.299  4.324   1.00 24.13  ?  180 GLY A O    1 
ATOM   2826  H  H    . GLY A  1 180 ? -60.057 -6.680  1.703   1.00 27.58  ?  180 GLY A H    1 
ATOM   2827  H  HA2  . GLY A  1 180 ? -61.275 -4.956  2.067   1.00 29.12  ?  180 GLY A HA2  1 
ATOM   2828  H  HA3  . GLY A  1 180 ? -62.536 -5.890  1.981   1.00 29.12  ?  180 GLY A HA3  1 
ATOM   2829  N  N    . LEU A  1 181 ? -60.847 -5.823  4.700   1.00 20.86  ?  181 LEU A N    1 
ATOM   2830  C  CA   . LEU A  1 181 ? -60.992 -5.804  6.151   1.00 19.09  ?  181 LEU A CA   1 
ATOM   2831  C  C    . LEU A  1 181 ? -60.906 -4.418  6.756   1.00 20.49  ?  181 LEU A C    1 
ATOM   2832  O  O    . LEU A  1 181 ? -61.193 -4.274  7.958   1.00 23.62  ?  181 LEU A O    1 
ATOM   2833  C  CB   . LEU A  1 181 ? -59.932 -6.700  6.815   1.00 20.51  ?  181 LEU A CB   1 
ATOM   2834  C  CG   . LEU A  1 181 ? -59.913 -8.141  6.296   1.00 20.25  ?  181 LEU A CG   1 
ATOM   2835  C  CD1  . LEU A  1 181 ? -58.853 -9.034  6.978   1.00 22.49  ?  181 LEU A CD1  1 
ATOM   2836  C  CD2  . LEU A  1 181 ? -61.241 -8.798  6.442   1.00 22.89  ?  181 LEU A CD2  1 
ATOM   2837  H  H    . LEU A  1 181 ? -60.046 -5.977  4.429   1.00 25.03  ?  181 LEU A H    1 
ATOM   2838  H  HA   . LEU A  1 181 ? -61.863 -6.167  6.377   1.00 22.91  ?  181 LEU A HA   1 
ATOM   2839  H  HB2  . LEU A  1 181 ? -59.056 -6.316  6.654   1.00 24.61  ?  181 LEU A HB2  1 
ATOM   2840  H  HB3  . LEU A  1 181 ? -60.105 -6.732  7.769   1.00 24.61  ?  181 LEU A HB3  1 
ATOM   2841  H  HG   . LEU A  1 181 ? -59.705 -8.120  5.348   1.00 24.30  ?  181 LEU A HG   1 
ATOM   2842  H  HD11 . LEU A  1 181 ? -58.901 -9.926  6.600   1.00 26.98  ?  181 LEU A HD11 1 
ATOM   2843  H  HD12 . LEU A  1 181 ? -57.974 -8.654  6.822   1.00 26.98  ?  181 LEU A HD12 1 
ATOM   2844  H  HD13 . LEU A  1 181 ? -59.035 -9.067  7.930   1.00 26.98  ?  181 LEU A HD13 1 
ATOM   2845  H  HD21 . LEU A  1 181 ? -61.183 -9.705  6.102   1.00 27.46  ?  181 LEU A HD21 1 
ATOM   2846  H  HD22 . LEU A  1 181 ? -61.484 -8.812  7.381   1.00 27.46  ?  181 LEU A HD22 1 
ATOM   2847  H  HD23 . LEU A  1 181 ? -61.899 -8.296  5.937   1.00 27.46  ?  181 LEU A HD23 1 
ATOM   2848  N  N    . GLU A  1 182 ? -60.517 -3.401  5.976   1.00 21.95  ?  182 GLU A N    1 
ATOM   2849  C  CA   . GLU A  1 182 ? -60.438 -2.030  6.480   1.00 22.29  ?  182 GLU A CA   1 
ATOM   2850  C  C    . GLU A  1 182 ? -61.831 -1.404  6.444   1.00 26.82  ?  182 GLU A C    1 
ATOM   2851  O  O    . GLU A  1 182 ? -62.445 -1.289  5.374   1.00 26.64  ?  182 GLU A O    1 
ATOM   2852  C  CB   . GLU A  1 182 ? -59.428 -1.204  5.674   1.00 24.22  ?  182 GLU A CB   1 
ATOM   2853  C  CG   . GLU A  1 182 ? -59.294 0.205   6.224   1.00 27.65  ?  182 GLU A CG   1 
ATOM   2854  C  CD   . GLU A  1 182 ? -58.268 1.051   5.497   1.00 37.81  ?  182 GLU A CD   1 
ATOM   2855  O  OE1  . GLU A  1 182 ? -57.608 0.547   4.560   1.00 39.83  ?  182 GLU A OE1  1 
ATOM   2856  O  OE2  . GLU A  1 182 ? -58.137 2.235   5.881   1.00 49.22  -1 182 GLU A OE2  1 
ATOM   2857  H  H    . GLU A  1 182 ? -60.293 -3.483  5.150   1.00 26.34  ?  182 GLU A H    1 
ATOM   2858  H  HA   . GLU A  1 182 ? -60.142 -2.049  7.403   1.00 26.74  ?  182 GLU A HA   1 
ATOM   2859  H  HB2  . GLU A  1 182 ? -58.558 -1.631  5.718   1.00 29.07  ?  182 GLU A HB2  1 
ATOM   2860  H  HB3  . GLU A  1 182 ? -59.726 -1.144  4.753   1.00 29.07  ?  182 GLU A HB3  1 
ATOM   2861  H  HG2  . GLU A  1 182 ? -60.152 0.651   6.151   1.00 33.18  ?  182 GLU A HG2  1 
ATOM   2862  H  HG3  . GLU A  1 182 ? -59.029 0.153   7.155   1.00 33.18  ?  182 GLU A HG3  1 
ATOM   2863  N  N    . ASP A  1 183 ? -62.343 -1.031  7.612   1.00 25.25  ?  183 ASP A N    1 
ATOM   2864  C  CA   . ASP A  1 183 ? -63.597 -0.288  7.697   1.00 26.93  ?  183 ASP A CA   1 
ATOM   2865  C  C    . ASP A  1 183 ? -63.500 0.669   8.876   1.00 26.29  ?  183 ASP A C    1 
ATOM   2866  O  O    . ASP A  1 183 ? -62.419 0.885   9.433   1.00 25.64  ?  183 ASP A O    1 
ATOM   2867  C  CB   . ASP A  1 183 ? -64.801 -1.237  7.788   1.00 28.14  ?  183 ASP A CB   1 
ATOM   2868  C  CG   . ASP A  1 183 ? -64.821 -2.071  9.064   1.00 36.94  ?  183 ASP A CG   1 
ATOM   2869  O  OD1  . ASP A  1 183 ? -64.145 -1.740  10.063  1.00 29.76  ?  183 ASP A OD1  1 
ATOM   2870  O  OD2  . ASP A  1 183 ? -65.555 -3.079  9.075   1.00 54.36  -1 183 ASP A OD2  1 
ATOM   2871  H  H    . ASP A  1 183 ? -61.982 -1.197  8.375   1.00 30.30  ?  183 ASP A H    1 
ATOM   2872  H  HA   . ASP A  1 183 ? -63.700 0.243   6.892   1.00 32.31  ?  183 ASP A HA   1 
ATOM   2873  H  HB2  . ASP A  1 183 ? -65.616 -0.713  7.763   1.00 33.77  ?  183 ASP A HB2  1 
ATOM   2874  H  HB3  . ASP A  1 183 ? -64.777 -1.847  7.034   1.00 33.77  ?  183 ASP A HB3  1 
ATOM   2875  N  N    . GLU A  1 184 ? -64.634 1.285   9.236   1.00 29.28  ?  184 GLU A N    1 
ATOM   2876  C  CA   . GLU A  1 184 ? -64.613 2.289   10.293  1.00 37.18  ?  184 GLU A CA   1 
ATOM   2877  C  C    . GLU A  1 184 ? -64.093 1.716   11.603  1.00 30.86  ?  184 GLU A C    1 
ATOM   2878  O  O    . GLU A  1 184 ? -63.422 2.422   12.360  1.00 33.11  ?  184 GLU A O    1 
ATOM   2879  C  CB   . GLU A  1 184 ? -66.024 2.875   10.486  1.00 34.90  ?  184 GLU A CB   1 
ATOM   2880  C  CG   . GLU A  1 184 ? -66.069 4.065   11.432  1.00 68.84  ?  184 GLU A CG   1 
ATOM   2881  C  CD   . GLU A  1 184 ? -67.488 4.538   11.717  1.00 75.27  ?  184 GLU A CD   1 
ATOM   2882  O  OE1  . GLU A  1 184 ? -68.446 3.894   11.226  1.00 73.91  ?  184 GLU A OE1  1 
ATOM   2883  O  OE2  . GLU A  1 184 ? -67.639 5.550   12.437  1.00 77.55  -1 184 GLU A OE2  1 
ATOM   2884  H  H    . GLU A  1 184 ? -65.408 1.141   8.889   1.00 35.14  ?  184 GLU A H    1 
ATOM   2885  H  HA   . GLU A  1 184 ? -64.024 3.012   10.028  1.00 44.62  ?  184 GLU A HA   1 
ATOM   2886  H  HB2  . GLU A  1 184 ? -66.362 3.167   9.625   1.00 41.88  ?  184 GLU A HB2  1 
ATOM   2887  H  HB3  . GLU A  1 184 ? -66.602 2.185   10.849  1.00 41.88  ?  184 GLU A HB3  1 
ATOM   2888  H  HG2  . GLU A  1 184 ? -65.662 3.813   12.276  1.00 82.61  ?  184 GLU A HG2  1 
ATOM   2889  H  HG3  . GLU A  1 184 ? -65.581 4.803   11.035  1.00 82.61  ?  184 GLU A HG3  1 
ATOM   2890  N  N    . ASP A  1 185 ? -64.362 0.440   11.876  1.00 26.52  ?  185 ASP A N    1 
ATOM   2891  C  CA   . ASP A  1 185 ? -63.960 -0.151  13.151  1.00 26.47  ?  185 ASP A CA   1 
ATOM   2892  C  C    . ASP A  1 185 ? -62.473 -0.520  13.187  1.00 29.22  ?  185 ASP A C    1 
ATOM   2893  O  O    . ASP A  1 185 ? -61.864 -0.493  14.262  1.00 31.26  ?  185 ASP A O    1 
ATOM   2894  C  CB   . ASP A  1 185 ? -64.775 -1.400  13.444  1.00 27.57  ?  185 ASP A CB   1 
ATOM   2895  C  CG   . ASP A  1 185 ? -66.266 -1.122  13.541  1.00 43.09  ?  185 ASP A CG   1 
ATOM   2896  O  OD1  . ASP A  1 185 ? -66.634 -0.115  14.170  1.00 42.93  ?  185 ASP A OD1  1 
ATOM   2897  O  OD2  . ASP A  1 185 ? -67.048 -1.908  12.980  1.00 44.35  -1 185 ASP A OD2  1 
ATOM   2898  H  H    . ASP A  1 185 ? -64.773 -0.099  11.346  1.00 31.82  ?  185 ASP A H    1 
ATOM   2899  H  HA   . ASP A  1 185 ? -64.126 0.489   13.861  1.00 31.76  ?  185 ASP A HA   1 
ATOM   2900  H  HB2  . ASP A  1 185 ? -64.636 -2.043  12.731  1.00 33.09  ?  185 ASP A HB2  1 
ATOM   2901  H  HB3  . ASP A  1 185 ? -64.485 -1.776  14.290  1.00 33.09  ?  185 ASP A HB3  1 
ATOM   2902  N  N    . THR A  1 186 ? -61.878 -0.850  12.039  1.00 23.77  ?  186 THR A N    1 
ATOM   2903  C  CA   . THR A  1 186 ? -60.489 -1.323  11.979  1.00 22.91  ?  186 THR A CA   1 
ATOM   2904  C  C    . THR A  1 186 ? -59.506 -0.309  11.406  1.00 22.02  ?  186 THR A C    1 
ATOM   2905  O  O    . THR A  1 186 ? -58.298 -0.566  11.417  1.00 20.70  ?  186 THR A O    1 
ATOM   2906  C  CB   . THR A  1 186 ? -60.406 -2.595  11.122  1.00 21.63  ?  186 THR A CB   1 
ATOM   2907  O  OG1  . THR A  1 186 ? -60.776 -2.261  9.780   1.00 22.51  ?  186 THR A OG1  1 
ATOM   2908  C  CG2  . THR A  1 186 ? -61.282 -3.685  11.673  1.00 23.12  ?  186 THR A CG2  1 
ATOM   2909  H  H    . THR A  1 186 ? -62.261 -0.810  11.271  1.00 28.52  ?  186 THR A H    1 
ATOM   2910  H  HA   . THR A  1 186 ? -60.196 -1.547  12.876  1.00 27.49  ?  186 THR A HA   1 
ATOM   2911  H  HB   . THR A  1 186 ? -59.491 -2.917  11.125  1.00 25.96  ?  186 THR A HB   1 
ATOM   2912  H  HG1  . THR A  1 186 ? -60.737 -2.944  9.293   1.00 27.02  ?  186 THR A HG1  1 
ATOM   2913  H  HG21 . THR A  1 186 ? -61.214 -4.478  11.117  1.00 27.74  ?  186 THR A HG21 1 
ATOM   2914  H  HG22 . THR A  1 186 ? -61.005 -3.908  12.575  1.00 27.74  ?  186 THR A HG22 1 
ATOM   2915  H  HG23 . THR A  1 186 ? -62.206 -3.391  11.690  1.00 27.74  ?  186 THR A HG23 1 
ATOM   2916  N  N    . ALA A  1 187 ? -59.969 0.837   10.907  1.00 24.80  ?  187 ALA A N    1 
ATOM   2917  C  CA   . ALA A  1 187 ? -59.093 1.737   10.154  1.00 24.30  ?  187 ALA A CA   1 
ATOM   2918  C  C    . ALA A  1 187 ? -57.865 2.185   10.948  1.00 23.66  ?  187 ALA A C    1 
ATOM   2919  O  O    . ALA A  1 187 ? -56.767 2.264   10.393  1.00 23.38  ?  187 ALA A O    1 
ATOM   2920  C  CB   . ALA A  1 187 ? -59.894 2.959   9.681   1.00 29.37  ?  187 ALA A CB   1 
ATOM   2921  H  H    . ALA A  1 187 ? -60.779 1.115   10.989  1.00 29.76  ?  187 ALA A H    1 
ATOM   2922  H  HA   . ALA A  1 187 ? -58.776 1.271   9.365   1.00 29.15  ?  187 ALA A HA   1 
ATOM   2923  H  HB1  . ALA A  1 187 ? -59.306 3.549   9.184   1.00 35.25  ?  187 ALA A HB1  1 
ATOM   2924  H  HB2  . ALA A  1 187 ? -60.620 2.659   9.112   1.00 35.25  ?  187 ALA A HB2  1 
ATOM   2925  H  HB3  . ALA A  1 187 ? -60.250 3.422   10.456  1.00 35.25  ?  187 ALA A HB3  1 
ATOM   2926  N  N    . ASP A  1 188 ? -58.016 2.510   12.236  1.00 24.66  ?  188 ASP A N    1 
ATOM   2927  C  CA   . ASP A  1 188 ? -56.865 2.966   13.011  1.00 25.26  ?  188 ASP A CA   1 
ATOM   2928  C  C    . ASP A  1 188 ? -55.813 1.866   13.146  1.00 20.33  ?  188 ASP A C    1 
ATOM   2929  O  O    . ASP A  1 188 ? -54.608 2.136   13.077  1.00 23.88  ?  188 ASP A O    1 
ATOM   2930  C  CB   . ASP A  1 188 ? -57.305 3.433   14.398  1.00 29.56  ?  188 ASP A CB   1 
ATOM   2931  C  CG   . ASP A  1 188 ? -58.120 4.723   14.353  1.00 47.54  ?  188 ASP A CG   1 
ATOM   2932  O  OD1  . ASP A  1 188 ? -58.043 5.461   13.344  1.00 43.80  ?  188 ASP A OD1  1 
ATOM   2933  O  OD2  . ASP A  1 188 ? -58.836 4.989   15.335  1.00 52.76  -1 188 ASP A OD2  1 
ATOM   2934  H  H    . ASP A  1 188 ? -58.756 2.476   12.673  1.00 29.60  ?  188 ASP A H    1 
ATOM   2935  H  HA   . ASP A  1 188 ? -56.455 3.719   12.556  1.00 30.31  ?  188 ASP A HA   1 
ATOM   2936  H  HB2  . ASP A  1 188 ? -57.855 2.745   14.804  1.00 35.48  ?  188 ASP A HB2  1 
ATOM   2937  H  HB3  . ASP A  1 188 ? -56.519 3.594   14.943  1.00 35.48  ?  188 ASP A HB3  1 
ATOM   2938  N  N    . GLU A  1 189 ? -56.259 0.621   13.339  1.00 20.47  ?  189 GLU A N    1 
ATOM   2939  C  CA   . GLU A  1 189 ? -55.324 -0.497  13.444  1.00 18.19  ?  189 GLU A CA   1 
ATOM   2940  C  C    . GLU A  1 189 ? -54.684 -0.800  12.098  1.00 20.12  ?  189 GLU A C    1 
ATOM   2941  O  O    . GLU A  1 189 ? -53.485 -1.113  12.031  1.00 18.58  ?  189 GLU A O    1 
ATOM   2942  C  CB   . GLU A  1 189 ? -56.043 -1.730  13.996  1.00 18.03  ?  189 GLU A CB   1 
ATOM   2943  C  CG   . GLU A  1 189 ? -56.375 -1.563  15.485  1.00 21.23  ?  189 GLU A CG   1 
ATOM   2944  C  CD   . GLU A  1 189 ? -57.509 -2.462  15.939  1.00 20.48  ?  189 GLU A CD   1 
ATOM   2945  O  OE1  . GLU A  1 189 ? -57.565 -3.646  15.524  1.00 20.25  ?  189 GLU A OE1  1 
ATOM   2946  O  OE2  . GLU A  1 189 ? -58.386 -1.992  16.712  1.00 21.40  -1 189 GLU A OE2  1 
ATOM   2947  H  H    . GLU A  1 189 ? -57.087 0.402   13.410  1.00 24.56  ?  189 GLU A H    1 
ATOM   2948  H  HA   . GLU A  1 189 ? -54.618 -0.260  14.065  1.00 21.83  ?  189 GLU A HA   1 
ATOM   2949  H  HB2  . GLU A  1 189 ? -56.873 -1.861  13.512  1.00 21.63  ?  189 GLU A HB2  1 
ATOM   2950  H  HB3  . GLU A  1 189 ? -55.470 -2.506  13.897  1.00 21.63  ?  189 GLU A HB3  1 
ATOM   2951  H  HG2  . GLU A  1 189 ? -55.589 -1.782  16.010  1.00 25.48  ?  189 GLU A HG2  1 
ATOM   2952  H  HG3  . GLU A  1 189 ? -56.637 -0.643  15.649  1.00 25.48  ?  189 GLU A HG3  1 
ATOM   2953  N  N    . VAL A  1 190 ? -55.464 -0.703  11.019  1.00 20.67  ?  190 VAL A N    1 
ATOM   2954  C  CA   . VAL A  1 190 ? -54.907 -0.901  9.684   1.00 21.60  ?  190 VAL A CA   1 
ATOM   2955  C  C    . VAL A  1 190 ? -53.810 0.115   9.427   1.00 18.83  ?  190 VAL A C    1 
ATOM   2956  O  O    . VAL A  1 190 ? -52.768 -0.208  8.842   1.00 19.62  ?  190 VAL A O    1 
ATOM   2957  C  CB   . VAL A  1 190 ? -56.010 -0.824  8.605   1.00 17.95  ?  190 VAL A CB   1 
ATOM   2958  C  CG1  . VAL A  1 190 ? -55.380 -0.804  7.196   1.00 21.72  ?  190 VAL A CG1  1 
ATOM   2959  C  CG2  . VAL A  1 190 ? -56.957 -1.955  8.712   1.00 19.55  ?  190 VAL A CG2  1 
ATOM   2960  H  H    . VAL A  1 190 ? -56.305 -0.526  11.033  1.00 24.80  ?  190 VAL A H    1 
ATOM   2961  H  HA   . VAL A  1 190 ? -54.509 -1.785  9.639   1.00 25.92  ?  190 VAL A HA   1 
ATOM   2962  H  HB   . VAL A  1 190 ? -56.510 -0.001  8.722   1.00 21.54  ?  190 VAL A HB   1 
ATOM   2963  H  HG11 . VAL A  1 190 ? -56.088 -0.755  6.535   1.00 26.06  ?  190 VAL A HG11 1 
ATOM   2964  H  HG12 . VAL A  1 190 ? -54.801 -0.029  7.120   1.00 26.06  ?  190 VAL A HG12 1 
ATOM   2965  H  HG13 . VAL A  1 190 ? -54.864 -1.615  7.070   1.00 26.06  ?  190 VAL A HG13 1 
ATOM   2966  H  HG21 . VAL A  1 190 ? -57.631 -1.869  8.019   1.00 23.46  ?  190 VAL A HG21 1 
ATOM   2967  H  HG22 . VAL A  1 190 ? -56.470 -2.786  8.599   1.00 23.46  ?  190 VAL A HG22 1 
ATOM   2968  H  HG23 . VAL A  1 190 ? -57.376 -1.933  9.586   1.00 23.46  ?  190 VAL A HG23 1 
ATOM   2969  N  N    . GLU A  1 191 ? -54.007 1.358   9.884   1.00 19.39  ?  191 GLU A N    1 
ATOM   2970  C  CA   . GLU A  1 191 ? -52.972 2.367   9.701   1.00 21.86  ?  191 GLU A CA   1 
ATOM   2971  C  C    . GLU A  1 191 ? -51.675 2.000   10.417  1.00 20.43  ?  191 GLU A C    1 
ATOM   2972  O  O    . GLU A  1 191 ? -50.585 2.185   9.869   1.00 20.44  ?  191 GLU A O    1 
ATOM   2973  C  CB   . GLU A  1 191 ? -53.505 3.730   10.161  1.00 28.61  ?  191 GLU A CB   1 
ATOM   2974  C  CG   . GLU A  1 191 ? -52.532 4.860   9.925   1.00 36.82  ?  191 GLU A CG   1 
ATOM   2975  C  CD   . GLU A  1 191 ? -53.137 6.222   10.254  1.00 54.88  ?  191 GLU A CD   1 
ATOM   2976  O  OE1  . GLU A  1 191 ? -53.785 6.351   11.321  1.00 51.37  ?  191 GLU A OE1  1 
ATOM   2977  O  OE2  . GLU A  1 191 ? -52.977 7.149   9.431   1.00 72.77  -1 191 GLU A OE2  1 
ATOM   2978  H  H    . GLU A  1 191 ? -54.713 1.632   10.293  1.00 23.27  ?  191 GLU A H    1 
ATOM   2979  H  HA   . GLU A  1 191 ? -52.773 2.436   8.754   1.00 26.23  ?  191 GLU A HA   1 
ATOM   2980  H  HB2  . GLU A  1 191 ? -54.319 3.930   9.673   1.00 34.33  ?  191 GLU A HB2  1 
ATOM   2981  H  HB3  . GLU A  1 191 ? -53.691 3.690   11.112  1.00 34.33  ?  191 GLU A HB3  1 
ATOM   2982  H  HG2  . GLU A  1 191 ? -51.753 4.731   10.489  1.00 44.19  ?  191 GLU A HG2  1 
ATOM   2983  H  HG3  . GLU A  1 191 ? -52.271 4.864   8.991   1.00 44.19  ?  191 GLU A HG3  1 
ATOM   2984  N  N    . VAL A  1 192 ? -51.758 1.442   11.630  1.00 20.07  ?  192 VAL A N    1 
ATOM   2985  C  CA   . VAL A  1 192 ? -50.556 0.991   12.332  1.00 19.26  ?  192 VAL A CA   1 
ATOM   2986  C  C    . VAL A  1 192 ? -49.858 -0.125  11.563  1.00 17.68  ?  192 VAL A C    1 
ATOM   2987  O  O    . VAL A  1 192 ? -48.637 -0.125  11.415  1.00 18.08  ?  192 VAL A O    1 
ATOM   2988  C  CB   . VAL A  1 192 ? -50.889 0.545   13.770  1.00 21.21  ?  192 VAL A CB   1 
ATOM   2989  C  CG1  . VAL A  1 192 ? -49.625 0.036   14.469  1.00 21.36  ?  192 VAL A CG1  1 
ATOM   2990  C  CG2  . VAL A  1 192 ? -51.496 1.697   14.536  1.00 24.96  ?  192 VAL A CG2  1 
ATOM   2991  H  H    . VAL A  1 192 ? -52.491 1.315   12.061  1.00 24.08  ?  192 VAL A H    1 
ATOM   2992  H  HA   . VAL A  1 192 ? -49.938 1.736   12.393  1.00 23.11  ?  192 VAL A HA   1 
ATOM   2993  H  HB   . VAL A  1 192 ? -51.535 -0.178  13.742  1.00 25.45  ?  192 VAL A HB   1 
ATOM   2994  H  HG11 . VAL A  1 192 ? -49.852 -0.240  15.371  1.00 25.63  ?  192 VAL A HG11 1 
ATOM   2995  H  HG12 . VAL A  1 192 ? -49.271 -0.718  13.971  1.00 25.63  ?  192 VAL A HG12 1 
ATOM   2996  H  HG13 . VAL A  1 192 ? -48.970 0.751   14.497  1.00 25.63  ?  192 VAL A HG13 1 
ATOM   2997  H  HG21 . VAL A  1 192 ? -51.700 1.404   15.437  1.00 29.95  ?  192 VAL A HG21 1 
ATOM   2998  H  HG22 . VAL A  1 192 ? -50.859 2.429   14.561  1.00 29.95  ?  192 VAL A HG22 1 
ATOM   2999  H  HG23 . VAL A  1 192 ? -52.308 1.981   14.087  1.00 29.95  ?  192 VAL A HG23 1 
ATOM   3000  N  N    . ILE A  1 193 ? -50.622 -1.113  11.091  1.00 18.66  ?  193 ILE A N    1 
ATOM   3001  C  CA   . ILE A  1 193 ? -50.041 -2.222  10.332  1.00 17.07  ?  193 ILE A CA   1 
ATOM   3002  C  C    . ILE A  1 193 ? -49.366 -1.709  9.073   1.00 17.19  ?  193 ILE A C    1 
ATOM   3003  O  O    . ILE A  1 193 ? -48.244 -2.114  8.738   1.00 17.15  ?  193 ILE A O    1 
ATOM   3004  C  CB   . ILE A  1 193 ? -51.115 -3.269  9.999   1.00 16.96  ?  193 ILE A CB   1 
ATOM   3005  C  CG1  . ILE A  1 193 ? -51.686 -3.897  11.271  1.00 17.87  ?  193 ILE A CG1  1 
ATOM   3006  C  CG2  . ILE A  1 193 ? -50.560 -4.345  9.051   1.00 18.22  ?  193 ILE A CG2  1 
ATOM   3007  C  CD1  . ILE A  1 193 ? -52.856 -4.805  11.044  1.00 22.53  ?  193 ILE A CD1  1 
ATOM   3008  H  H    . ILE A  1 193 ? -51.474 -1.165  11.195  1.00 22.39  ?  193 ILE A H    1 
ATOM   3009  H  HA   . ILE A  1 193 ? -49.364 -2.654  10.877  1.00 20.49  ?  193 ILE A HA   1 
ATOM   3010  H  HB   . ILE A  1 193 ? -51.840 -2.815  9.541   1.00 20.36  ?  193 ILE A HB   1 
ATOM   3011  H  HG12 . ILE A  1 193 ? -50.989 -4.418  11.700  1.00 21.44  ?  193 ILE A HG12 1 
ATOM   3012  H  HG13 . ILE A  1 193 ? -51.976 -3.187  11.865  1.00 21.44  ?  193 ILE A HG13 1 
ATOM   3013  H  HG21 . ILE A  1 193 ? -51.260 -4.989  8.860   1.00 21.86  ?  193 ILE A HG21 1 
ATOM   3014  H  HG22 . ILE A  1 193 ? -50.267 -3.920  8.229   1.00 21.86  ?  193 ILE A HG22 1 
ATOM   3015  H  HG23 . ILE A  1 193 ? -49.811 -4.787  9.480   1.00 21.86  ?  193 ILE A HG23 1 
ATOM   3016  H  HD11 . ILE A  1 193 ? -53.152 -5.157  11.898  1.00 27.04  ?  193 ILE A HD11 1 
ATOM   3017  H  HD12 . ILE A  1 193 ? -53.571 -4.299  10.628  1.00 27.04  ?  193 ILE A HD12 1 
ATOM   3018  H  HD13 . ILE A  1 193 ? -52.583 -5.532  10.463  1.00 27.04  ?  193 ILE A HD13 1 
ATOM   3019  N  N    . ARG A  1 194 ? -50.050 -0.823  8.351   1.00 17.45  ?  194 ARG A N    1 
ATOM   3020  C  CA   . ARG A  1 194 ? -49.482 -0.236  7.145   1.00 18.77  ?  194 ARG A CA   1 
ATOM   3021  C  C    . ARG A  1 194 ? -48.196 0.493   7.473   1.00 19.99  ?  194 ARG A C    1 
ATOM   3022  O  O    . ARG A  1 194 ? -47.178 0.329   6.795   1.00 20.59  ?  194 ARG A O    1 
ATOM   3023  C  CB   . ARG A  1 194 ? -50.485 0.722   6.498   1.00 19.51  ?  194 ARG A CB   1 
ATOM   3024  C  CG   . ARG A  1 194 ? -49.982 1.310   5.170   1.00 22.11  ?  194 ARG A CG   1 
ATOM   3025  C  CD   . ARG A  1 194 ? -50.915 2.390   4.585   1.00 27.73  ?  194 ARG A CD   1 
ATOM   3026  N  NE   . ARG A  1 194 ? -51.982 2.777   5.488   1.00 51.78  ?  194 ARG A NE   1 
ATOM   3027  C  CZ   . ARG A  1 194 ? -53.262 2.422   5.369   1.00 46.14  ?  194 ARG A CZ   1 
ATOM   3028  N  NH1  . ARG A  1 194 ? -53.715 1.678   4.361   1.00 47.45  1  194 ARG A NH1  1 
ATOM   3029  N  NH2  . ARG A  1 194 ? -54.105 2.833   6.279   1.00 37.12  ?  194 ARG A NH2  1 
ATOM   3030  H  H    . ARG A  1 194 ? -50.842 -0.547  8.539   1.00 20.94  ?  194 ARG A H    1 
ATOM   3031  H  HA   . ARG A  1 194 ? -49.280 -0.941  6.509   1.00 22.52  ?  194 ARG A HA   1 
ATOM   3032  H  HB2  . ARG A  1 194 ? -51.309 0.243   6.320   1.00 23.41  ?  194 ARG A HB2  1 
ATOM   3033  H  HB3  . ARG A  1 194 ? -50.654 1.458   7.107   1.00 23.41  ?  194 ARG A HB3  1 
ATOM   3034  H  HG2  . ARG A  1 194 ? -49.112 1.715   5.315   1.00 26.53  ?  194 ARG A HG2  1 
ATOM   3035  H  HG3  . ARG A  1 194 ? -49.908 0.595   4.518   1.00 26.53  ?  194 ARG A HG3  1 
ATOM   3036  H  HD2  . ARG A  1 194 ? -50.392 3.182   4.385   1.00 33.28  ?  194 ARG A HD2  1 
ATOM   3037  H  HD3  . ARG A  1 194 ? -51.321 2.048   3.773   1.00 33.28  ?  194 ARG A HD3  1 
ATOM   3038  H  HE   . ARG A  1 194 ? -51.772 3.277   6.155   1.00 62.13  ?  194 ARG A HE   1 
ATOM   3039  H  HH11 . ARG A  1 194 ? -53.171 1.395   3.757   1.00 56.94  ?  194 ARG A HH11 1 
ATOM   3040  H  HH12 . ARG A  1 194 ? -54.549 1.474   4.317   1.00 56.94  ?  194 ARG A HH12 1 
ATOM   3041  H  HH21 . ARG A  1 194 ? -53.829 3.319   6.932   1.00 44.55  ?  194 ARG A HH21 1 
ATOM   3042  H  HH22 . ARG A  1 194 ? -54.938 2.627   6.218   1.00 44.55  ?  194 ARG A HH22 1 
ATOM   3043  N  N    . ASP A  1 195 ? -48.222 1.310   8.525   1.00 20.87  ?  195 ASP A N    1 
ATOM   3044  C  CA   . ASP A  1 195 ? -47.035 2.081   8.886   1.00 22.68  ?  195 ASP A CA   1 
ATOM   3045  C  C    . ASP A  1 195 ? -45.897 1.179   9.326   1.00 19.79  ?  195 ASP A C    1 
ATOM   3046  O  O    . ASP A  1 195 ? -44.728 1.469   9.051   1.00 19.77  ?  195 ASP A O    1 
ATOM   3047  C  CB   . ASP A  1 195 ? -47.375 3.093   9.985   1.00 22.65  ?  195 ASP A CB   1 
ATOM   3048  C  CG   . ASP A  1 195 ? -48.149 4.285   9.448   1.00 33.84  ?  195 ASP A CG   1 
ATOM   3049  O  OD1  . ASP A  1 195 ? -48.235 4.414   8.204   1.00 36.34  ?  195 ASP A OD1  1 
ATOM   3050  O  OD2  . ASP A  1 195 ? -48.690 5.070   10.266  1.00 39.04  -1 195 ASP A OD2  1 
ATOM   3051  H  H    . ASP A  1 195 ? -48.902 1.434   9.037   1.00 25.04  ?  195 ASP A H    1 
ATOM   3052  H  HA   . ASP A  1 195 ? -46.736 2.577   8.107   1.00 27.21  ?  195 ASP A HA   1 
ATOM   3053  H  HB2  . ASP A  1 195 ? -47.920 2.659   10.660  1.00 27.19  ?  195 ASP A HB2  1 
ATOM   3054  H  HB3  . ASP A  1 195 ? -46.552 3.421   10.381  1.00 27.19  ?  195 ASP A HB3  1 
ATOM   3055  N  N    . ASN A  1 196 ? -46.205 0.074   10.015  1.00 19.48  ?  196 ASN A N    1 
ATOM   3056  C  CA   . ASN A  1 196 ? -45.160 -0.882  10.389  1.00 19.84  ?  196 ASN A CA   1 
ATOM   3057  C  C    . ASN A  1 196 ? -44.462 -1.435  9.152   1.00 17.26  ?  196 ASN A C    1 
ATOM   3058  O  O    . ASN A  1 196 ? -43.223 -1.551  9.110   1.00 18.99  ?  196 ASN A O    1 
ATOM   3059  C  CB   . ASN A  1 196 ? -45.745 -2.046  11.183  1.00 17.31  ?  196 ASN A CB   1 
ATOM   3060  C  CG   . ASN A  1 196 ? -46.075 -1.698  12.607  1.00 18.89  ?  196 ASN A CG   1 
ATOM   3061  O  OD1  . ASN A  1 196 ? -45.721 -0.632  13.120  1.00 22.46  ?  196 ASN A OD1  1 
ATOM   3062  N  ND2  . ASN A  1 196 ? -46.758 -2.629  13.271  1.00 18.92  ?  196 ASN A ND2  1 
ATOM   3063  H  H    . ASN A  1 196 ? -46.997 -0.141  10.273  1.00 23.38  ?  196 ASN A H    1 
ATOM   3064  H  HA   . ASN A  1 196 ? -44.498 -0.437  10.941  1.00 23.80  ?  196 ASN A HA   1 
ATOM   3065  H  HB2  . ASN A  1 196 ? -46.563 -2.339  10.751  1.00 20.77  ?  196 ASN A HB2  1 
ATOM   3066  H  HB3  . ASN A  1 196 ? -45.101 -2.771  11.195  1.00 20.77  ?  196 ASN A HB3  1 
ATOM   3067  H  HD21 . ASN A  1 196 ? -46.980 -2.496  14.091  1.00 22.70  ?  196 ASN A HD21 1 
ATOM   3068  H  HD22 . ASN A  1 196 ? -46.976 -3.363  12.879  1.00 22.70  ?  196 ASN A HD22 1 
ATOM   3069  N  N    . PHE A  1 197 ? -45.249 -1.807  8.135   1.00 18.78  ?  197 PHE A N    1 
ATOM   3070  C  CA   . PHE A  1 197 ? -44.656 -2.302  6.901   1.00 17.46  ?  197 PHE A CA   1 
ATOM   3071  C  C    . PHE A  1 197 ? -43.843 -1.201  6.222   1.00 17.94  ?  197 PHE A C    1 
ATOM   3072  O  O    . PHE A  1 197 ? -42.718 -1.447  5.763   1.00 18.53  ?  197 PHE A O    1 
ATOM   3073  C  CB   . PHE A  1 197 ? -45.745 -2.844  5.957   1.00 18.97  ?  197 PHE A CB   1 
ATOM   3074  C  CG   . PHE A  1 197 ? -45.231 -3.153  4.565   1.00 17.13  ?  197 PHE A CG   1 
ATOM   3075  C  CD1  . PHE A  1 197 ? -44.107 -3.953  4.393   1.00 19.18  ?  197 PHE A CD1  1 
ATOM   3076  C  CD2  . PHE A  1 197 ? -45.865 -2.636  3.451   1.00 19.66  ?  197 PHE A CD2  1 
ATOM   3077  C  CE1  . PHE A  1 197 ? -43.621 -4.223  3.124   1.00 20.91  ?  197 PHE A CE1  1 
ATOM   3078  C  CE2  . PHE A  1 197 ? -45.380 -2.921  2.179   1.00 20.42  ?  197 PHE A CE2  1 
ATOM   3079  C  CZ   . PHE A  1 197 ? -44.265 -3.709  2.027   1.00 21.21  ?  197 PHE A CZ   1 
ATOM   3080  H  H    . PHE A  1 197 ? -46.109 -1.781  8.138   1.00 22.53  ?  197 PHE A H    1 
ATOM   3081  H  HA   . PHE A  1 197 ? -44.053 -3.032  7.112   1.00 20.96  ?  197 PHE A HA   1 
ATOM   3082  H  HB2  . PHE A  1 197 ? -46.105 -3.664  6.330   1.00 22.77  ?  197 PHE A HB2  1 
ATOM   3083  H  HB3  . PHE A  1 197 ? -46.449 -2.182  5.875   1.00 22.77  ?  197 PHE A HB3  1 
ATOM   3084  H  HD1  . PHE A  1 197 ? -43.670 -4.299  5.138   1.00 23.02  ?  197 PHE A HD1  1 
ATOM   3085  H  HD2  . PHE A  1 197 ? -46.619 -2.100  3.552   1.00 23.60  ?  197 PHE A HD2  1 
ATOM   3086  H  HE1  . PHE A  1 197 ? -42.871 -4.762  3.015   1.00 25.09  ?  197 PHE A HE1  1 
ATOM   3087  H  HE2  . PHE A  1 197 ? -45.808 -2.573  1.431   1.00 24.50  ?  197 PHE A HE2  1 
ATOM   3088  H  HZ   . PHE A  1 197 ? -43.945 -3.896  1.174   1.00 25.46  ?  197 PHE A HZ   1 
ATOM   3089  N  N    . LEU A  1 198 ? -44.400 0.005   6.148   1.00 19.81  ?  198 LEU A N    1 
ATOM   3090  C  CA   . LEU A  1 198 ? -43.721 1.083   5.434   1.00 21.05  ?  198 LEU A CA   1 
ATOM   3091  C  C    . LEU A  1 198 ? -42.446 1.480   6.141   1.00 22.64  ?  198 LEU A C    1 
ATOM   3092  O  O    . LEU A  1 198 ? -41.475 1.885   5.483   1.00 23.07  ?  198 LEU A O    1 
ATOM   3093  C  CB   . LEU A  1 198 ? -44.623 2.289   5.279   1.00 22.72  ?  198 LEU A CB   1 
ATOM   3094  C  CG   . LEU A  1 198 ? -45.871 2.089   4.426   1.00 23.74  ?  198 LEU A CG   1 
ATOM   3095  C  CD1  . LEU A  1 198 ? -46.632 3.393   4.399   1.00 31.45  ?  198 LEU A CD1  1 
ATOM   3096  C  CD2  . LEU A  1 198 ? -45.493 1.618   3.032   1.00 29.04  ?  198 LEU A CD2  1 
ATOM   3097  H  H    . LEU A  1 198 ? -45.155 0.223   6.495   1.00 23.77  ?  198 LEU A H    1 
ATOM   3098  H  HA   . LEU A  1 198 ? -43.485 0.771   4.546   1.00 25.27  ?  198 LEU A HA   1 
ATOM   3099  H  HB2  . LEU A  1 198 ? -44.918 2.564   6.162   1.00 27.26  ?  198 LEU A HB2  1 
ATOM   3100  H  HB3  . LEU A  1 198 ? -44.108 3.004   4.874   1.00 27.26  ?  198 LEU A HB3  1 
ATOM   3101  H  HG   . LEU A  1 198 ? -46.436 1.414   4.835   1.00 28.49  ?  198 LEU A HG   1 
ATOM   3102  H  HD11 . LEU A  1 198 ? -47.430 3.281   3.860   1.00 37.74  ?  198 LEU A HD11 1 
ATOM   3103  H  HD12 . LEU A  1 198 ? -46.877 3.634   5.307   1.00 37.74  ?  198 LEU A HD12 1 
ATOM   3104  H  HD13 . LEU A  1 198 ? -46.066 4.080   4.015   1.00 37.74  ?  198 LEU A HD13 1 
ATOM   3105  H  HD21 . LEU A  1 198 ? -46.301 1.498   2.509   1.00 34.85  ?  198 LEU A HD21 1 
ATOM   3106  H  HD22 . LEU A  1 198 ? -44.925 2.285   2.616   1.00 34.85  ?  198 LEU A HD22 1 
ATOM   3107  H  HD23 . LEU A  1 198 ? -45.016 0.776   3.103   1.00 34.85  ?  198 LEU A HD23 1 
ATOM   3108  N  N    . ASN A  1 199 ? -42.421 1.369   7.474   1.00 24.00  ?  199 ASN A N    1 
ATOM   3109  C  CA   . ASN A  1 199 ? -41.189 1.675   8.193   1.00 24.91  ?  199 ASN A CA   1 
ATOM   3110  C  C    . ASN A  1 199 ? -40.057 0.766   7.750   1.00 24.55  ?  199 ASN A C    1 
ATOM   3111  O  O    . ASN A  1 199 ? -38.891 1.177   7.735   1.00 27.36  ?  199 ASN A O    1 
ATOM   3112  C  CB   . ASN A  1 199 ? -41.421 1.577   9.706   1.00 25.42  ?  199 ASN A CB   1 
ATOM   3113  C  CG   . ASN A  1 199 ? -42.248 2.739   10.250  1.00 37.34  ?  199 ASN A CG   1 
ATOM   3114  O  OD1  . ASN A  1 199 ? -42.385 3.787   9.603   1.00 47.05  ?  199 ASN A OD1  1 
ATOM   3115  N  ND2  . ASN A  1 199 ? -42.804 2.560   11.452  1.00 39.63  ?  199 ASN A ND2  1 
ATOM   3116  H  H    . ASN A  1 199 ? -43.082 1.127   7.968   1.00 28.80  ?  199 ASN A H    1 
ATOM   3117  H  HA   . ASN A  1 199 ? -40.930 2.588   7.992   1.00 29.90  ?  199 ASN A HA   1 
ATOM   3118  H  HB2  . ASN A  1 199 ? -41.896 0.754   9.900   1.00 30.50  ?  199 ASN A HB2  1 
ATOM   3119  H  HB3  . ASN A  1 199 ? -40.563 1.581   10.158  1.00 30.50  ?  199 ASN A HB3  1 
ATOM   3120  H  HD21 . ASN A  1 199 ? -43.279 3.185   11.804  1.00 47.55  ?  199 ASN A HD21 1 
ATOM   3121  H  HD22 . ASN A  1 199 ? -42.686 1.820   11.875  1.00 47.55  ?  199 ASN A HD22 1 
ATOM   3122  N  N    . ARG A  1 200 ? -40.371 -0.462  7.351   1.00 22.99  ?  200 ARG A N    1 
ATOM   3123  C  CA   . ARG A  1 200 ? -39.353 -1.349  6.815   1.00 18.98  ?  200 ARG A CA   1 
ATOM   3124  C  C    . ARG A  1 200 ? -39.092 -1.073  5.334   1.00 22.15  ?  200 ARG A C    1 
ATOM   3125  O  O    . ARG A  1 200 ? -37.928 -0.987  4.903   1.00 24.05  ?  200 ARG A O    1 
ATOM   3126  C  CB   . ARG A  1 200 ? -39.779 -2.799  7.061   1.00 25.66  ?  200 ARG A CB   1 
ATOM   3127  C  CG   . ARG A  1 200 ? -38.798 -3.768  6.633   1.00 26.33  ?  200 ARG A CG   1 
ATOM   3128  C  CD   . ARG A  1 200 ? -37.507 -3.697  7.438   1.00 31.37  ?  200 ARG A CD   1 
ATOM   3129  N  NE   . ARG A  1 200 ? -36.598 -4.702  6.908   1.00 32.26  ?  200 ARG A NE   1 
ATOM   3130  C  CZ   . ARG A  1 200 ? -35.486 -4.451  6.216   1.00 37.93  ?  200 ARG A CZ   1 
ATOM   3131  N  NH1  . ARG A  1 200 ? -35.074 -3.202  5.983   1.00 40.68  1  200 ARG A NH1  1 
ATOM   3132  N  NH2  . ARG A  1 200 ? -34.780 -5.479  5.755   1.00 34.87  ?  200 ARG A NH2  1 
ATOM   3133  H  H    . ARG A  1 200 ? -41.161 -0.802  7.380   1.00 27.58  ?  200 ARG A H    1 
ATOM   3134  H  HA   . ARG A  1 200 ? -38.524 -1.198  7.294   1.00 22.78  ?  200 ARG A HA   1 
ATOM   3135  H  HB2  . ARG A  1 200 ? -39.926 -2.925  8.012   1.00 30.79  ?  200 ARG A HB2  1 
ATOM   3136  H  HB3  . ARG A  1 200 ? -40.600 -2.971  6.575   1.00 30.79  ?  200 ARG A HB3  1 
ATOM   3137  H  HG2  . ARG A  1 200 ? -39.168 -4.659  6.736   1.00 31.59  ?  200 ARG A HG2  1 
ATOM   3138  H  HG3  . ARG A  1 200 ? -38.580 -3.606  5.702   1.00 31.59  ?  200 ARG A HG3  1 
ATOM   3139  H  HD2  . ARG A  1 200 ? -37.102 -2.821  7.339   1.00 37.65  ?  200 ARG A HD2  1 
ATOM   3140  H  HD3  . ARG A  1 200 ? -37.687 -3.894  8.370   1.00 37.65  ?  200 ARG A HD3  1 
ATOM   3141  H  HE   . ARG A  1 200 ? -36.793 -5.526  7.054   1.00 38.71  ?  200 ARG A HE   1 
ATOM   3142  H  HH11 . ARG A  1 200 ? -35.536 -2.536  6.270   1.00 48.81  ?  200 ARG A HH11 1 
ATOM   3143  H  HH12 . ARG A  1 200 ? -34.350 -3.063  5.540   1.00 48.81  ?  200 ARG A HH12 1 
ATOM   3144  H  HH21 . ARG A  1 200 ? -35.038 -6.284  5.914   1.00 41.84  ?  200 ARG A HH21 1 
ATOM   3145  H  HH22 . ARG A  1 200 ? -34.049 -5.339  5.325   1.00 41.84  ?  200 ARG A HH22 1 
ATOM   3146  N  N    . LEU A  1 201 ? -40.152 -0.901  4.543   1.00 19.77  ?  201 LEU A N    1 
ATOM   3147  C  CA   . LEU A  1 201 ? -39.993 -0.693  3.106   1.00 21.10  ?  201 LEU A CA   1 
ATOM   3148  C  C    . LEU A  1 201 ? -39.258 0.613   2.805   1.00 22.26  ?  201 LEU A C    1 
ATOM   3149  O  O    . LEU A  1 201 ? -38.527 0.680   1.811   1.00 23.66  ?  201 LEU A O    1 
ATOM   3150  C  CB   . LEU A  1 201 ? -41.370 -0.726  2.417   1.00 19.88  ?  201 LEU A CB   1 
ATOM   3151  C  CG   . LEU A  1 201 ? -41.383 -0.782  0.881   1.00 19.66  ?  201 LEU A CG   1 
ATOM   3152  C  CD1  . LEU A  1 201 ? -40.679 -2.052  0.390   1.00 26.78  ?  201 LEU A CD1  1 
ATOM   3153  C  CD2  . LEU A  1 201 ? -42.804 -0.655  0.303   1.00 22.35  ?  201 LEU A CD2  1 
ATOM   3154  H  H    . LEU A  1 201 ? -40.968 -0.900  4.813   1.00 23.72  ?  201 LEU A H    1 
ATOM   3155  H  HA   . LEU A  1 201 ? -39.463 -1.420  2.743   1.00 25.32  ?  201 LEU A HA   1 
ATOM   3156  H  HB2  . LEU A  1 201 ? -41.847 -1.508  2.735   1.00 23.86  ?  201 LEU A HB2  1 
ATOM   3157  H  HB3  . LEU A  1 201 ? -41.856 0.072   2.677   1.00 23.86  ?  201 LEU A HB3  1 
ATOM   3158  H  HG   . LEU A  1 201 ? -40.873 -0.028  0.549   1.00 23.59  ?  201 LEU A HG   1 
ATOM   3159  H  HD11 . LEU A  1 201 ? -40.699 -2.069  -0.579  1.00 32.13  ?  201 LEU A HD11 1 
ATOM   3160  H  HD12 . LEU A  1 201 ? -39.761 -2.045  0.703   1.00 32.13  ?  201 LEU A HD12 1 
ATOM   3161  H  HD13 . LEU A  1 201 ? -41.144 -2.827  0.744   1.00 32.13  ?  201 LEU A HD13 1 
ATOM   3162  H  HD21 . LEU A  1 201 ? -42.755 -0.697  -0.665  1.00 26.82  ?  201 LEU A HD21 1 
ATOM   3163  H  HD22 . LEU A  1 201 ? -43.347 -1.385  0.639   1.00 26.82  ?  201 LEU A HD22 1 
ATOM   3164  H  HD23 . LEU A  1 201 ? -43.182 0.194   0.579   1.00 26.82  ?  201 LEU A HD23 1 
ATOM   3165  N  N    . ASP A  1 202 ? -39.475 1.660   3.622   1.00 22.91  ?  202 ASP A N    1 
ATOM   3166  C  CA   . ASP A  1 202 ? -38.772 2.944   3.469   1.00 23.52  ?  202 ASP A CA   1 
ATOM   3167  C  C    . ASP A  1 202 ? -37.265 2.764   3.438   1.00 27.56  ?  202 ASP A C    1 
ATOM   3168  O  O    . ASP A  1 202 ? -36.554 3.581   2.835   1.00 28.00  ?  202 ASP A O    1 
ATOM   3169  C  CB   . ASP A  1 202 ? -39.098 3.895   4.623   1.00 25.59  ?  202 ASP A CB   1 
ATOM   3170  C  CG   . ASP A  1 202 ? -40.362 4.676   4.410   1.00 27.45  ?  202 ASP A CG   1 
ATOM   3171  O  OD1  . ASP A  1 202 ? -40.829 4.759   3.259   1.00 29.17  ?  202 ASP A OD1  1 
ATOM   3172  O  OD2  . ASP A  1 202 ? -40.887 5.208   5.421   1.00 31.11  -1 202 ASP A OD2  1 
ATOM   3173  H  H    . ASP A  1 202 ? -40.031 1.648   4.279   1.00 27.49  ?  202 ASP A H    1 
ATOM   3174  H  HA   . ASP A  1 202 ? -39.047 3.364   2.639   1.00 28.22  ?  202 ASP A HA   1 
ATOM   3175  H  HB2  . ASP A  1 202 ? -39.200 3.378   5.437   1.00 30.71  ?  202 ASP A HB2  1 
ATOM   3176  H  HB3  . ASP A  1 202 ? -38.370 4.528   4.723   1.00 30.71  ?  202 ASP A HB3  1 
ATOM   3177  N  N    . GLN A  1 203 ? -36.753 1.739   4.122   1.00 26.32  ?  203 GLN A N    1 
ATOM   3178  C  CA   . GLN A  1 203 ? -35.315 1.519   4.205   1.00 24.74  ?  203 GLN A CA   1 
ATOM   3179  C  C    . GLN A  1 203 ? -34.723 0.933   2.924   1.00 27.27  ?  203 GLN A C    1 
ATOM   3180  O  O    . GLN A  1 203 ? -33.515 1.089   2.708   1.00 33.93  ?  203 GLN A O    1 
ATOM   3181  C  CB   . GLN A  1 203 ? -34.988 0.622   5.402   1.00 26.14  ?  203 GLN A CB   1 
ATOM   3182  C  CG   . GLN A  1 203 ? -35.544 1.141   6.750   1.00 27.97  ?  203 GLN A CG   1 
ATOM   3183  C  CD   . GLN A  1 203 ? -35.212 0.261   7.955   1.00 41.23  ?  203 GLN A CD   1 
ATOM   3184  O  OE1  . GLN A  1 203 ? -35.304 -0.965  7.899   1.00 40.13  ?  203 GLN A OE1  1 
ATOM   3185  N  NE2  . GLN A  1 203 ? -34.828 0.896   9.061   1.00 45.80  ?  203 GLN A NE2  1 
ATOM   3186  H  H    . GLN A  1 203 ? -37.222 1.157   4.548   1.00 31.58  ?  203 GLN A H    1 
ATOM   3187  H  HA   . GLN A  1 203 ? -34.884 2.375   4.358   1.00 29.69  ?  203 GLN A HA   1 
ATOM   3188  H  HB2  . GLN A  1 203 ? -35.367 -0.257  5.245   1.00 31.36  ?  203 GLN A HB2  1 
ATOM   3189  H  HB3  . GLN A  1 203 ? -34.025 0.553   5.486   1.00 31.36  ?  203 GLN A HB3  1 
ATOM   3190  H  HG2  . GLN A  1 203 ? -35.174 2.022   6.919   1.00 33.57  ?  203 GLN A HG2  1 
ATOM   3191  H  HG3  . GLN A  1 203 ? -36.510 1.199   6.686   1.00 33.57  ?  203 GLN A HG3  1 
ATOM   3192  H  HE21 . GLN A  1 203 ? -34.778 1.755   9.068   1.00 54.96  ?  203 GLN A HE21 1 
ATOM   3193  H  HE22 . GLN A  1 203 ? -34.630 0.448   9.767   1.00 54.96  ?  203 GLN A HE22 1 
ATOM   3194  N  N    . THR A  1 204 ? -35.526 0.302   2.046   1.00 22.65  ?  204 THR A N    1 
ATOM   3195  C  CA   . THR A  1 204 ? -35.035 -0.349  0.831   1.00 22.65  ?  204 THR A CA   1 
ATOM   3196  C  C    . THR A  1 204 ? -35.637 0.197   -0.455  1.00 26.26  ?  204 THR A C    1 
ATOM   3197  O  O    . THR A  1 204 ? -34.928 0.308   -1.470  1.00 28.22  ?  204 THR A O    1 
ATOM   3198  C  CB   . THR A  1 204 ? -35.278 -1.881  0.893   1.00 24.66  ?  204 THR A CB   1 
ATOM   3199  O  OG1  . THR A  1 204 ? -36.690 -2.145  0.935   1.00 23.94  ?  204 THR A OG1  1 
ATOM   3200  C  CG2  . THR A  1 204 ? -34.617 -2.479  2.113   1.00 26.73  ?  204 THR A CG2  1 
ATOM   3201  H  H    . THR A  1 204 ? -36.378 0.241   2.142   1.00 27.18  ?  204 THR A H    1 
ATOM   3202  H  HA   . THR A  1 204 ? -34.076 -0.211  0.780   1.00 27.18  ?  204 THR A HA   1 
ATOM   3203  H  HB   . THR A  1 204 ? -34.897 -2.298  0.105   1.00 29.59  ?  204 THR A HB   1 
ATOM   3204  H  HG1  . THR A  1 204 ? -36.827 -2.973  0.969   1.00 28.73  ?  204 THR A HG1  1 
ATOM   3205  H  HG21 . THR A  1 204 ? -34.776 -3.436  2.141   1.00 32.07  ?  204 THR A HG21 1 
ATOM   3206  H  HG22 . THR A  1 204 ? -33.660 -2.319  2.084   1.00 32.07  ?  204 THR A HG22 1 
ATOM   3207  H  HG23 . THR A  1 204 ? -34.979 -2.076  2.918   1.00 32.07  ?  204 THR A HG23 1 
ATOM   3208  N  N    . LYS A  1 205 ? -36.916 0.562   -0.454  1.00 23.99  ?  205 LYS A N    1 
ATOM   3209  C  CA   . LYS A  1 205 ? -37.629 1.015   -1.649  1.00 28.96  ?  205 LYS A CA   1 
ATOM   3210  C  C    . LYS A  1 205 ? -38.562 2.150   -1.259  1.00 28.72  ?  205 LYS A C    1 
ATOM   3211  O  O    . LYS A  1 205 ? -39.796 2.020   -1.299  1.00 24.39  ?  205 LYS A O    1 
ATOM   3212  C  CB   . LYS A  1 205 ? -38.401 -0.135  -2.293  1.00 26.92  ?  205 LYS A CB   1 
ATOM   3213  C  CG   . LYS A  1 205 ? -37.514 -1.248  -2.708  1.00 33.07  ?  205 LYS A CG   1 
ATOM   3214  C  CD   . LYS A  1 205 ? -38.150 -2.149  -3.723  1.00 42.50  ?  205 LYS A CD   1 
ATOM   3215  C  CE   . LYS A  1 205 ? -37.062 -2.999  -4.383  1.00 42.18  ?  205 LYS A CE   1 
ATOM   3216  N  NZ   . LYS A  1 205 ? -36.038 -2.171  -5.078  1.00 38.92  1  205 LYS A NZ   1 
ATOM   3217  H  H    . LYS A  1 205 ? -37.410 0.556   0.251   1.00 28.79  ?  205 LYS A H    1 
ATOM   3218  H  HA   . LYS A  1 205 ? -36.990 1.353   -2.296  1.00 34.75  ?  205 LYS A HA   1 
ATOM   3219  H  HB2  . LYS A  1 205 ? -39.043 -0.484  -1.654  1.00 32.30  ?  205 LYS A HB2  1 
ATOM   3220  H  HB3  . LYS A  1 205 ? -38.861 0.193   -3.082  1.00 32.30  ?  205 LYS A HB3  1 
ATOM   3221  H  HG2  . LYS A  1 205 ? -36.707 -0.879  -3.099  1.00 39.68  ?  205 LYS A HG2  1 
ATOM   3222  H  HG3  . LYS A  1 205 ? -37.292 -1.782  -1.930  1.00 39.68  ?  205 LYS A HG3  1 
ATOM   3223  H  HD2  . LYS A  1 205 ? -38.784 -2.739  -3.286  1.00 51.00  ?  205 LYS A HD2  1 
ATOM   3224  H  HD3  . LYS A  1 205 ? -38.588 -1.618  -4.406  1.00 51.00  ?  205 LYS A HD3  1 
ATOM   3225  H  HE2  . LYS A  1 205 ? -36.613 -3.525  -3.703  1.00 50.62  ?  205 LYS A HE2  1 
ATOM   3226  H  HE3  . LYS A  1 205 ? -37.472 -3.585  -5.040  1.00 50.62  ?  205 LYS A HE3  1 
ATOM   3227  H  HZ1  . LYS A  1 205 ? -36.423 -1.682  -5.714  1.00 46.71  ?  205 LYS A HZ1  1 
ATOM   3228  H  HZ2  . LYS A  1 205 ? -35.641 -1.628  -4.496  1.00 46.71  ?  205 LYS A HZ2  1 
ATOM   3229  H  HZ3  . LYS A  1 205 ? -35.423 -2.697  -5.449  1.00 46.71  ?  205 LYS A HZ3  1 
ATOM   3230  N  N    . PRO A  1 206 ? -37.995 3.300   -0.889  1.00 27.12  ?  206 PRO A N    1 
ATOM   3231  C  CA   . PRO A  1 206 ? -38.828 4.427   -0.447  1.00 25.82  ?  206 PRO A CA   1 
ATOM   3232  C  C    . PRO A  1 206 ? -39.796 4.949   -1.503  1.00 27.13  ?  206 PRO A C    1 
ATOM   3233  O  O    . PRO A  1 206 ? -40.870 5.444   -1.143  1.00 27.65  ?  206 PRO A O    1 
ATOM   3234  C  CB   . PRO A  1 206 ? -37.791 5.489   -0.052  1.00 28.59  ?  206 PRO A CB   1 
ATOM   3235  C  CG   . PRO A  1 206 ? -36.548 5.103   -0.785  1.00 28.62  ?  206 PRO A CG   1 
ATOM   3236  C  CD   . PRO A  1 206 ? -36.557 3.605   -0.798  1.00 27.98  ?  206 PRO A CD   1 
ATOM   3237  H  HA   . PRO A  1 206 ? -39.332 4.173   0.341   1.00 30.98  ?  206 PRO A HA   1 
ATOM   3238  H  HB2  . PRO A  1 206 ? -38.097 6.366   -0.332  1.00 34.31  ?  206 PRO A HB2  1 
ATOM   3239  H  HB3  . PRO A  1 206 ? -37.647 5.465   0.907   1.00 34.31  ?  206 PRO A HB3  1 
ATOM   3240  H  HG2  . PRO A  1 206 ? -36.577 5.455   -1.688  1.00 34.35  ?  206 PRO A HG2  1 
ATOM   3241  H  HG3  . PRO A  1 206 ? -35.770 5.437   -0.310  1.00 34.35  ?  206 PRO A HG3  1 
ATOM   3242  H  HD2  . PRO A  1 206 ? -36.087 3.267   -1.576  1.00 33.57  ?  206 PRO A HD2  1 
ATOM   3243  H  HD3  . PRO A  1 206 ? -36.186 3.254   0.027   1.00 33.57  ?  206 PRO A HD3  1 
ATOM   3244  N  N    . LYS A  1 207 ? -39.472 4.866   -2.795  1.00 31.47  ?  207 LYS A N    1 
ATOM   3245  C  CA   . LYS A  1 207 ? -40.420 5.372   -3.786  1.00 34.57  ?  207 LYS A CA   1 
ATOM   3246  C  C    . LYS A  1 207 ? -41.649 4.478   -3.875  1.00 29.09  ?  207 LYS A C    1 
ATOM   3247  O  O    . LYS A  1 207 ? -42.759 4.969   -4.096  1.00 31.40  ?  207 LYS A O    1 
ATOM   3248  C  CB   . LYS A  1 207 ? -39.739 5.516   -5.157  1.00 35.64  ?  207 LYS A CB   1 
ATOM   3249  C  CG   . LYS A  1 207 ? -38.693 6.626   -5.199  1.00 39.90  ?  207 LYS A CG   1 
ATOM   3250  C  CD   . LYS A  1 207 ? -37.791 6.506   -6.429  1.00 60.79  ?  207 LYS A CD   1 
ATOM   3251  C  CE   . LYS A  1 207 ? -36.800 7.663   -6.519  1.00 78.99  ?  207 LYS A CE   1 
ATOM   3252  N  NZ   . LYS A  1 207 ? -36.014 7.842   -5.257  1.00 90.73  1  207 LYS A NZ   1 
ATOM   3253  H  H    . LYS A  1 207 ? -38.743 4.537   -3.112  1.00 37.76  ?  207 LYS A H    1 
ATOM   3254  H  HA   . LYS A  1 207 ? -40.716 6.254   -3.511  1.00 41.48  ?  207 LYS A HA   1 
ATOM   3255  H  HB2  . LYS A  1 207 ? -39.297 4.681   -5.376  1.00 42.77  ?  207 LYS A HB2  1 
ATOM   3256  H  HB3  . LYS A  1 207 ? -40.415 5.717   -5.823  1.00 42.77  ?  207 LYS A HB3  1 
ATOM   3257  H  HG2  . LYS A  1 207 ? -39.141 7.486   -5.234  1.00 47.88  ?  207 LYS A HG2  1 
ATOM   3258  H  HG3  . LYS A  1 207 ? -38.136 6.571   -4.407  1.00 47.88  ?  207 LYS A HG3  1 
ATOM   3259  H  HD2  . LYS A  1 207 ? -37.287 5.679   -6.376  1.00 72.94  ?  207 LYS A HD2  1 
ATOM   3260  H  HD3  . LYS A  1 207 ? -38.340 6.513   -7.229  1.00 72.94  ?  207 LYS A HD3  1 
ATOM   3261  H  HE2  . LYS A  1 207 ? -36.176 7.489   -7.241  1.00 94.79  ?  207 LYS A HE2  1 
ATOM   3262  H  HE3  . LYS A  1 207 ? -37.287 8.484   -6.690  1.00 94.79  ?  207 LYS A HE3  1 
ATOM   3263  H  HZ1  . LYS A  1 207 ? -36.564 8.009   -4.577  1.00 108.88 ?  207 LYS A HZ1  1 
ATOM   3264  H  HZ2  . LYS A  1 207 ? -35.552 7.102   -5.079  1.00 108.88 ?  207 LYS A HZ2  1 
ATOM   3265  H  HZ3  . LYS A  1 207 ? -35.448 8.523   -5.345  1.00 108.88 ?  207 LYS A HZ3  1 
ATOM   3266  N  N    . LEU A  1 208 ? -41.475 3.175   -3.657  1.00 28.87  ?  208 LEU A N    1 
ATOM   3267  C  CA   . LEU A  1 208 ? -42.605 2.261   -3.619  1.00 26.85  ?  208 LEU A CA   1 
ATOM   3268  C  C    . LEU A  1 208 ? -43.440 2.464   -2.359  1.00 24.95  ?  208 LEU A C    1 
ATOM   3269  O  O    . LEU A  1 208 ? -44.674 2.456   -2.411  1.00 23.68  ?  208 LEU A O    1 
ATOM   3270  C  CB   . LEU A  1 208 ? -42.066 0.834   -3.720  1.00 33.95  ?  208 LEU A CB   1 
ATOM   3271  C  CG   . LEU A  1 208 ? -43.002 -0.285  -4.097  1.00 33.72  ?  208 LEU A CG   1 
ATOM   3272  C  CD1  . LEU A  1 208 ? -43.764 0.057   -5.385  1.00 32.42  ?  208 LEU A CD1  1 
ATOM   3273  C  CD2  . LEU A  1 208 ? -42.177 -1.517  -4.299  1.00 28.39  ?  208 LEU A CD2  1 
ATOM   3274  H  H    . LEU A  1 208 ? -40.712 2.799   -3.529  1.00 34.64  ?  208 LEU A H    1 
ATOM   3275  H  HA   . LEU A  1 208 ? -43.173 2.425   -4.388  1.00 32.23  ?  208 LEU A HA   1 
ATOM   3276  H  HB2  . LEU A  1 208 ? -41.355 0.836   -4.379  1.00 40.74  ?  208 LEU A HB2  1 
ATOM   3277  H  HB3  . LEU A  1 208 ? -41.690 0.602   -2.856  1.00 40.74  ?  208 LEU A HB3  1 
ATOM   3278  H  HG   . LEU A  1 208 ? -43.639 -0.443  -3.383  1.00 40.46  ?  208 LEU A HG   1 
ATOM   3279  H  HD11 . LEU A  1 208 ? -44.357 -0.678  -5.605  1.00 38.91  ?  208 LEU A HD11 1 
ATOM   3280  H  HD12 . LEU A  1 208 ? -44.278 0.866   -5.241  1.00 38.91  ?  208 LEU A HD12 1 
ATOM   3281  H  HD13 . LEU A  1 208 ? -43.125 0.193   -6.102  1.00 38.91  ?  208 LEU A HD13 1 
ATOM   3282  H  HD21 . LEU A  1 208 ? -42.762 -2.251  -4.543  1.00 34.07  ?  208 LEU A HD21 1 
ATOM   3283  H  HD22 . LEU A  1 208 ? -41.536 -1.354  -5.008  1.00 34.07  ?  208 LEU A HD22 1 
ATOM   3284  H  HD23 . LEU A  1 208 ? -41.713 -1.724  -3.473  1.00 34.07  ?  208 LEU A HD23 1 
ATOM   3285  N  N    . ALA A  1 209 ? -42.782 2.635   -1.212  1.00 22.03  ?  209 ALA A N    1 
ATOM   3286  C  CA   . ALA A  1 209 ? -43.491 3.002   0.000   1.00 23.90  ?  209 ALA A CA   1 
ATOM   3287  C  C    . ALA A  1 209 ? -44.308 4.275   -0.205  1.00 27.13  ?  209 ALA A C    1 
ATOM   3288  O  O    . ALA A  1 209 ? -45.425 4.399   0.303   1.00 25.47  ?  209 ALA A O    1 
ATOM   3289  C  CB   . ALA A  1 209 ? -42.466 3.166   1.130   1.00 22.27  ?  209 ALA A CB   1 
ATOM   3290  H  H    . ALA A  1 209 ? -41.932 2.545   -1.115  1.00 26.44  ?  209 ALA A H    1 
ATOM   3291  H  HA   . ALA A  1 209 ? -44.100 2.287   0.244   1.00 28.68  ?  209 ALA A HA   1 
ATOM   3292  H  HB1  . ALA A  1 209 ? -42.932 3.412   1.945   1.00 26.73  ?  209 ALA A HB1  1 
ATOM   3293  H  HB2  . ALA A  1 209 ? -41.999 2.326   1.256   1.00 26.73  ?  209 ALA A HB2  1 
ATOM   3294  H  HB3  . ALA A  1 209 ? -41.837 3.863   0.886   1.00 26.73  ?  209 ALA A HB3  1 
ATOM   3295  N  N    . ASP A  1 210 ? -43.772 5.228   -0.974  1.00 25.70  ?  210 ASP A N    1 
ATOM   3296  C  CA   . ASP A  1 210 ? -44.494 6.472   -1.222  1.00 35.08  ?  210 ASP A CA   1 
ATOM   3297  C  C    . ASP A  1 210 ? -45.790 6.240   -1.989  1.00 30.02  ?  210 ASP A C    1 
ATOM   3298  O  O    . ASP A  1 210 ? -46.777 6.960   -1.777  1.00 27.70  ?  210 ASP A O    1 
ATOM   3299  C  CB   . ASP A  1 210 ? -43.587 7.440   -1.982  1.00 35.20  ?  210 ASP A CB   1 
ATOM   3300  C  CG   . ASP A  1 210 ? -44.196 8.824   -2.121  1.00 54.95  ?  210 ASP A CG   1 
ATOM   3301  O  OD1  . ASP A  1 210 ? -44.370 9.487   -1.074  1.00 52.29  ?  210 ASP A OD1  1 
ATOM   3302  O  OD2  . ASP A  1 210 ? -44.494 9.248   -3.265  1.00 55.77  -1 210 ASP A OD2  1 
ATOM   3303  H  H    . ASP A  1 210 ? -43.003 5.178   -1.356  1.00 30.84  ?  210 ASP A H    1 
ATOM   3304  H  HA   . ASP A  1 210 ? -44.720 6.880   -0.371  1.00 42.10  ?  210 ASP A HA   1 
ATOM   3305  H  HB2  . ASP A  1 210 ? -42.747 7.528   -1.505  1.00 42.24  ?  210 ASP A HB2  1 
ATOM   3306  H  HB3  . ASP A  1 210 ? -43.428 7.091   -2.873  1.00 42.24  ?  210 ASP A HB3  1 
ATOM   3307  N  N    . ILE A  1 211 ? -45.817 5.254   -2.888  1.00 27.33  ?  211 ILE A N    1 
ATOM   3308  C  CA   . ILE A  1 211 ? -47.051 4.936   -3.600  1.00 25.36  ?  211 ILE A CA   1 
ATOM   3309  C  C    . ILE A  1 211 ? -48.102 4.432   -2.628  1.00 27.22  ?  211 ILE A C    1 
ATOM   3310  O  O    . ILE A  1 211 ? -49.289 4.765   -2.739  1.00 28.43  ?  211 ILE A O    1 
ATOM   3311  C  CB   . ILE A  1 211 ? -46.800 3.896   -4.712  1.00 30.96  ?  211 ILE A CB   1 
ATOM   3312  C  CG1  . ILE A  1 211 ? -45.634 4.296   -5.610  1.00 36.55  ?  211 ILE A CG1  1 
ATOM   3313  C  CG2  . ILE A  1 211 ? -48.071 3.712   -5.533  1.00 35.04  ?  211 ILE A CG2  1 
ATOM   3314  C  CD1  . ILE A  1 211 ? -45.744 5.705   -6.181  1.00 45.72  ?  211 ILE A CD1  1 
ATOM   3315  H  H    . ILE A  1 211 ? -45.144 4.763   -3.100  1.00 32.80  ?  211 ILE A H    1 
ATOM   3316  H  HA   . ILE A  1 211 ? -47.392 5.743   -4.016  1.00 30.43  ?  211 ILE A HA   1 
ATOM   3317  H  HB   . ILE A  1 211 ? -46.583 3.049   -4.293  1.00 37.16  ?  211 ILE A HB   1 
ATOM   3318  H  HG12 . ILE A  1 211 ? -44.813 4.249   -5.094  1.00 43.86  ?  211 ILE A HG12 1 
ATOM   3319  H  HG13 . ILE A  1 211 ? -45.588 3.677   -6.356  1.00 43.86  ?  211 ILE A HG13 1 
ATOM   3320  H  HG21 . ILE A  1 211 ? -47.905 3.058   -6.229  1.00 42.05  ?  211 ILE A HG21 1 
ATOM   3321  H  HG22 . ILE A  1 211 ? -48.781 3.402   -4.949  1.00 42.05  ?  211 ILE A HG22 1 
ATOM   3322  H  HG23 . ILE A  1 211 ? -48.316 4.563   -5.929  1.00 42.05  ?  211 ILE A HG23 1 
ATOM   3323  H  HD11 . ILE A  1 211 ? -44.969 5.881   -6.737  1.00 54.86  ?  211 ILE A HD11 1 
ATOM   3324  H  HD12 . ILE A  1 211 ? -46.553 5.768   -6.711  1.00 54.86  ?  211 ILE A HD12 1 
ATOM   3325  H  HD13 . ILE A  1 211 ? -45.778 6.340   -5.448  1.00 54.86  ?  211 ILE A HD13 1 
ATOM   3326  N  N    . ILE A  1 212 ? -47.699 3.580   -1.681  1.00 24.60  ?  212 ILE A N    1 
ATOM   3327  C  CA   . ILE A  1 212 ? -48.672 3.112   -0.699  1.00 23.72  ?  212 ILE A CA   1 
ATOM   3328  C  C    . ILE A  1 212 ? -49.220 4.286   0.105   1.00 28.29  ?  212 ILE A C    1 
ATOM   3329  O  O    . ILE A  1 212 ? -50.431 4.394   0.328   1.00 31.93  ?  212 ILE A O    1 
ATOM   3330  C  CB   . ILE A  1 212 ? -48.040 2.038   0.204   1.00 25.00  ?  212 ILE A CB   1 
ATOM   3331  C  CG1  . ILE A  1 212 ? -47.890 0.749   -0.586  1.00 24.21  ?  212 ILE A CG1  1 
ATOM   3332  C  CG2  . ILE A  1 212 ? -48.920 1.776   1.426   1.00 28.58  ?  212 ILE A CG2  1 
ATOM   3333  C  CD1  . ILE A  1 212 ? -47.016 -0.266  0.071   1.00 28.56  ?  212 ILE A CD1  1 
ATOM   3334  H  H    . ILE A  1 212 ? -46.901 3.271   -1.589  1.00 29.52  ?  212 ILE A H    1 
ATOM   3335  H  HA   . ILE A  1 212 ? -49.415 2.703   -1.169  1.00 28.46  ?  212 ILE A HA   1 
ATOM   3336  H  HB   . ILE A  1 212 ? -47.166 2.338   0.497   1.00 30.00  ?  212 ILE A HB   1 
ATOM   3337  H  HG12 . ILE A  1 212 ? -48.767 0.352   -0.705  1.00 29.06  ?  212 ILE A HG12 1 
ATOM   3338  H  HG13 . ILE A  1 212 ? -47.504 0.956   -1.451  1.00 29.06  ?  212 ILE A HG13 1 
ATOM   3339  H  HG21 . ILE A  1 212 ? -48.500 1.097   1.977   1.00 34.30  ?  212 ILE A HG21 1 
ATOM   3340  H  HG22 . ILE A  1 212 ? -49.013 2.600   1.930   1.00 34.30  ?  212 ILE A HG22 1 
ATOM   3341  H  HG23 . ILE A  1 212 ? -49.791 1.469   1.128   1.00 34.30  ?  212 ILE A HG23 1 
ATOM   3342  H  HD11 . ILE A  1 212 ? -46.971 -1.055  -0.491  1.00 34.27  ?  212 ILE A HD11 1 
ATOM   3343  H  HD12 . ILE A  1 212 ? -46.130 0.110   0.188   1.00 34.27  ?  212 ILE A HD12 1 
ATOM   3344  H  HD13 . ILE A  1 212 ? -47.394 -0.496  0.935   1.00 34.27  ?  212 ILE A HD13 1 
ATOM   3345  N  N    . ARG A  1 213 ? -48.346 5.195   0.532   1.00 27.41  ?  213 ARG A N    1 
ATOM   3346  C  CA   . ARG A  1 213 ? -48.797 6.365   1.294   1.00 38.12  ?  213 ARG A CA   1 
ATOM   3347  C  C    . ARG A  1 213 ? -49.702 7.283   0.483   1.00 38.82  ?  213 ARG A C    1 
ATOM   3348  O  O    . ARG A  1 213 ? -50.695 7.802   1.009   1.00 48.24  ?  213 ARG A O    1 
ATOM   3349  C  CB   . ARG A  1 213 ? -47.604 7.185   1.776   1.00 40.87  ?  213 ARG A CB   1 
ATOM   3350  C  CG   . ARG A  1 213 ? -46.859 6.593   2.874   1.00 41.39  ?  213 ARG A CG   1 
ATOM   3351  C  CD   . ARG A  1 213 ? -45.961 7.623   3.523   1.00 37.67  ?  213 ARG A CD   1 
ATOM   3352  N  NE   . ARG A  1 213 ? -45.239 6.986   4.607   1.00 37.29  ?  213 ARG A NE   1 
ATOM   3353  C  CZ   . ARG A  1 213 ? -44.070 6.372   4.464   1.00 33.78  ?  213 ARG A CZ   1 
ATOM   3354  N  NH1  . ARG A  1 213 ? -43.468 6.337   3.288   1.00 37.18  1  213 ARG A NH1  1 
ATOM   3355  N  NH2  . ARG A  1 213 ? -43.502 5.800   5.508   1.00 33.76  ?  213 ARG A NH2  1 
ATOM   3356  H  H    . ARG A  1 213 ? -47.497 5.161   0.397   1.00 32.89  ?  213 ARG A H    1 
ATOM   3357  H  HA   . ARG A  1 213 ? -49.291 6.065   2.073   1.00 45.74  ?  213 ARG A HA   1 
ATOM   3358  H  HB2  . ARG A  1 213 ? -46.990 7.302   1.035   1.00 49.05  ?  213 ARG A HB2  1 
ATOM   3359  H  HB3  . ARG A  1 213 ? -47.925 8.051   2.073   1.00 49.05  ?  213 ARG A HB3  1 
ATOM   3360  H  HG2  . ARG A  1 213 ? -47.479 6.260   3.543   1.00 49.67  ?  213 ARG A HG2  1 
ATOM   3361  H  HG3  . ARG A  1 213 ? -46.306 5.871   2.537   1.00 49.67  ?  213 ARG A HG3  1 
ATOM   3362  H  HD2  . ARG A  1 213 ? -45.321 7.959   2.875   1.00 45.20  ?  213 ARG A HD2  1 
ATOM   3363  H  HD3  . ARG A  1 213 ? -46.496 8.346   3.886   1.00 45.20  ?  213 ARG A HD3  1 
ATOM   3364  H  HE   . ARG A  1 213 ? -45.610 6.968   5.383   1.00 44.75  ?  213 ARG A HE   1 
ATOM   3365  H  HH11 . ARG A  1 213 ? -43.839 6.704   2.604   1.00 44.62  ?  213 ARG A HH11 1 
ATOM   3366  H  HH12 . ARG A  1 213 ? -42.709 5.941   3.205   1.00 44.62  ?  213 ARG A HH12 1 
ATOM   3367  H  HH21 . ARG A  1 213 ? -43.888 5.827   6.276   1.00 40.52  ?  213 ARG A HH21 1 
ATOM   3368  H  HH22 . ARG A  1 213 ? -42.739 5.412   5.424   1.00 40.52  ?  213 ARG A HH22 1 
ATOM   3369  N  N    . ASN A  1 214 ? -49.358 7.533   -0.788  1.00 37.72  ?  214 ASN A N    1 
ATOM   3370  C  CA   . ASN A  1 214 ? -49.866 8.692   -1.515  1.00 40.83  ?  214 ASN A CA   1 
ATOM   3371  C  C    . ASN A  1 214 ? -50.453 8.390   -2.886  1.00 53.09  ?  214 ASN A C    1 
ATOM   3372  O  O    . ASN A  1 214 ? -50.851 9.332   -3.585  1.00 65.03  ?  214 ASN A O    1 
ATOM   3373  C  CB   . ASN A  1 214 ? -48.743 9.735   -1.699  1.00 44.99  ?  214 ASN A CB   1 
ATOM   3374  C  CG   . ASN A  1 214 ? -48.157 10.210  -0.374  1.00 50.06  ?  214 ASN A CG   1 
ATOM   3375  O  OD1  . ASN A  1 214 ? -48.888 10.575  0.550   1.00 56.36  ?  214 ASN A OD1  1 
ATOM   3376  N  ND2  . ASN A  1 214 ? -46.834 10.214  -0.281  1.00 47.95  ?  214 ASN A ND2  1 
ATOM   3377  H  H    . ASN A  1 214 ? -48.827 7.039   -1.250  1.00 45.26  ?  214 ASN A H    1 
ATOM   3378  H  HA   . ASN A  1 214 ? -50.564 9.105   -0.984  1.00 49.00  ?  214 ASN A HA   1 
ATOM   3379  H  HB2  . ASN A  1 214 ? -48.026 9.339   -2.219  1.00 53.99  ?  214 ASN A HB2  1 
ATOM   3380  H  HB3  . ASN A  1 214 ? -49.102 10.508  -2.163  1.00 53.99  ?  214 ASN A HB3  1 
ATOM   3381  H  HD21 . ASN A  1 214 ? -46.455 10.474  0.447   1.00 57.54  ?  214 ASN A HD21 1 
ATOM   3382  H  HD22 . ASN A  1 214 ? -46.355 9.957   -0.947  1.00 57.54  ?  214 ASN A HD22 1 
ATOM   3383  N  N    . GLY A  1 215 ? -50.513 7.131   -3.301  1.00 44.84  ?  215 GLY A N    1 
ATOM   3384  C  CA   . GLY A  1 215 ? -51.041 6.801   -4.617  1.00 41.13  ?  215 GLY A CA   1 
ATOM   3385  C  C    . GLY A  1 215 ? -50.043 7.032   -5.736  1.00 50.12  ?  215 GLY A C    1 
ATOM   3386  O  O    . GLY A  1 215 ? -48.908 7.437   -5.476  1.00 47.48  ?  215 GLY A O    1 
ATOM   3387  H  H    . GLY A  1 215 ? -50.256 6.451   -2.840  1.00 53.81  ?  215 GLY A H    1 
ATOM   3388  H  HA2  . GLY A  1 215 ? -51.304 5.867   -4.632  1.00 49.36  ?  215 GLY A HA2  1 
ATOM   3389  H  HA3  . GLY A  1 215 ? -51.826 7.343   -4.793  1.00 49.36  ?  215 GLY A HA3  1 
HETATM 3390  N  N    . MSE B  1 1   ? -28.874 0.287   -3.090  1.00 35.47  ?  1   MSE B N    1 
HETATM 3391  C  CA   . MSE B  1 1   ? -29.906 1.176   -2.477  1.00 37.46  ?  1   MSE B CA   1 
HETATM 3392  C  C    . MSE B  1 1   ? -29.384 2.587   -2.245  1.00 42.98  ?  1   MSE B C    1 
HETATM 3393  O  O    . MSE B  1 1   ? -28.190 2.792   -2.052  1.00 38.95  ?  1   MSE B O    1 
HETATM 3394  C  CB   . MSE B  1 1   ? -30.386 0.586   -1.158  1.00 40.23  ?  1   MSE B CB   1 
HETATM 3395  C  CG   . MSE B  1 1   ? -30.876 -0.833  -1.309  1.00 41.77  ?  1   MSE B CG   1 
HETATM 3396  SE SE   . MSE B  1 1   ? -31.480 -1.522  0.369   1.00 56.43  ?  1   MSE B SE   1 
HETATM 3397  C  CE   . MSE B  1 1   ? -29.815 -1.721  1.374   1.00 41.33  ?  1   MSE B CE   1 
HETATM 3398  H  H1   . MSE B  1 1   ? -29.271 -0.305  -3.623  1.00 42.57  ?  1   MSE B H1   1 
HETATM 3399  H  H2   . MSE B  1 1   ? -28.303 0.778   -3.565  1.00 42.57  ?  1   MSE B H2   1 
HETATM 3400  H  H3   . MSE B  1 1   ? -28.432 -0.142  -2.447  1.00 42.57  ?  1   MSE B H3   1 
HETATM 3401  H  HA   . MSE B  1 1   ? -30.669 1.222   -3.074  1.00 44.95  ?  1   MSE B HA   1 
HETATM 3402  H  HB2  . MSE B  1 1   ? -29.652 0.585   -0.525  1.00 48.27  ?  1   MSE B HB2  1 
HETATM 3403  H  HB3  . MSE B  1 1   ? -31.119 1.123   -0.819  1.00 48.27  ?  1   MSE B HB3  1 
HETATM 3404  H  HG2  . MSE B  1 1   ? -31.618 -0.854  -1.933  1.00 50.12  ?  1   MSE B HG2  1 
HETATM 3405  H  HG3  . MSE B  1 1   ? -30.150 -1.393  -1.626  1.00 50.12  ?  1   MSE B HG3  1 
HETATM 3406  H  HE1  . MSE B  1 1   ? -30.019 -2.071  2.256   1.00 49.59  ?  1   MSE B HE1  1 
HETATM 3407  H  HE2  . MSE B  1 1   ? -29.233 -2.335  0.901   1.00 49.59  ?  1   MSE B HE2  1 
HETATM 3408  H  HE3  . MSE B  1 1   ? -29.389 -0.853  1.452   1.00 49.59  ?  1   MSE B HE3  1 
ATOM   3409  N  N    . ASP B  1 2   ? -30.291 3.565   -2.240  1.00 41.41  ?  2   ASP B N    1 
ATOM   3410  C  CA   . ASP B  1 2   ? -29.893 4.971   -2.151  1.00 44.93  ?  2   ASP B CA   1 
ATOM   3411  C  C    . ASP B  1 2   ? -29.543 5.309   -0.700  1.00 47.25  ?  2   ASP B C    1 
ATOM   3412  O  O    . ASP B  1 2   ? -30.292 5.972   0.025   1.00 44.49  ?  2   ASP B O    1 
ATOM   3413  C  CB   . ASP B  1 2   ? -31.002 5.869   -2.688  1.00 49.15  ?  2   ASP B CB   1 
ATOM   3414  C  CG   . ASP B  1 2   ? -30.560 7.311   -2.831  1.00 63.22  ?  2   ASP B CG   1 
ATOM   3415  O  OD1  . ASP B  1 2   ? -29.333 7.550   -2.906  1.00 61.84  ?  2   ASP B OD1  1 
ATOM   3416  O  OD2  . ASP B  1 2   ? -31.437 8.203   -2.857  1.00 75.99  -1 2   ASP B OD2  1 
ATOM   3417  H  H    . ASP B  1 2   ? -31.141 3.441   -2.287  1.00 49.69  ?  2   ASP B H    1 
ATOM   3418  H  HA   . ASP B  1 2   ? -29.101 5.112   -2.693  1.00 53.92  ?  2   ASP B HA   1 
ATOM   3419  H  HB2  . ASP B  1 2   ? -31.274 5.549   -3.563  1.00 58.98  ?  2   ASP B HB2  1 
ATOM   3420  H  HB3  . ASP B  1 2   ? -31.755 5.844   -2.077  1.00 58.98  ?  2   ASP B HB3  1 
ATOM   3421  N  N    . THR B  1 3   ? -28.367 4.848   -0.270  1.00 44.05  ?  3   THR B N    1 
ATOM   3422  C  CA   . THR B  1 3   ? -27.943 5.039   1.114   1.00 36.84  ?  3   THR B CA   1 
ATOM   3423  C  C    . THR B  1 3   ? -26.449 4.777   1.216   1.00 33.16  ?  3   THR B C    1 
ATOM   3424  O  O    . THR B  1 3   ? -25.870 4.037   0.413   1.00 44.87  ?  3   THR B O    1 
ATOM   3425  C  CB   . THR B  1 3   ? -28.703 4.114   2.077   1.00 36.99  ?  3   THR B CB   1 
ATOM   3426  O  OG1  . THR B  1 3   ? -28.258 4.354   3.422   1.00 31.70  ?  3   THR B OG1  1 
ATOM   3427  C  CG2  . THR B  1 3   ? -28.479 2.623   1.698   1.00 46.18  ?  3   THR B CG2  1 
ATOM   3428  H  H    . THR B  1 3   ? -27.801 4.424   -0.759  1.00 52.86  ?  3   THR B H    1 
ATOM   3429  H  HA   . THR B  1 3   ? -28.110 5.957   1.377   1.00 44.21  ?  3   THR B HA   1 
ATOM   3430  H  HB   . THR B  1 3   ? -29.652 4.302   2.016   1.00 44.38  ?  3   THR B HB   1 
ATOM   3431  H  HG1  . THR B  1 3   ? -28.670 3.852   3.954   1.00 38.04  ?  3   THR B HG1  1 
ATOM   3432  H  HG21 . THR B  1 3   ? -28.964 2.049   2.312   1.00 55.42  ?  3   THR B HG21 1 
ATOM   3433  H  HG22 . THR B  1 3   ? -28.797 2.458   0.797   1.00 55.42  ?  3   THR B HG22 1 
ATOM   3434  H  HG23 . THR B  1 3   ? -27.535 2.407   1.744   1.00 55.42  ?  3   THR B HG23 1 
ATOM   3435  N  N    . ASN B  1 4   ? -25.835 5.375   2.229   1.00 35.50  ?  4   ASN B N    1 
ATOM   3436  C  CA   . ASN B  1 4   ? -24.437 5.111   2.520   1.00 31.47  ?  4   ASN B CA   1 
ATOM   3437  C  C    . ASN B  1 4   ? -24.248 4.095   3.646   1.00 34.17  ?  4   ASN B C    1 
ATOM   3438  O  O    . ASN B  1 4   ? -23.104 3.770   3.984   1.00 34.07  ?  4   ASN B O    1 
ATOM   3439  C  CB   . ASN B  1 4   ? -23.714 6.423   2.861   1.00 40.71  ?  4   ASN B CB   1 
ATOM   3440  C  CG   . ASN B  1 4   ? -24.050 6.945   4.254   1.00 49.10  ?  4   ASN B CG   1 
ATOM   3441  O  OD1  . ASN B  1 4   ? -25.099 6.633   4.819   1.00 49.05  ?  4   ASN B OD1  1 
ATOM   3442  N  ND2  . ASN B  1 4   ? -23.157 7.763   4.807   1.00 53.23  ?  4   ASN B ND2  1 
ATOM   3443  H  H    . ASN B  1 4   ? -26.208 5.938   2.761   1.00 42.61  ?  4   ASN B H    1 
ATOM   3444  H  HA   . ASN B  1 4   ? -24.020 4.745   1.724   1.00 37.77  ?  4   ASN B HA   1 
ATOM   3445  H  HB2  . ASN B  1 4   ? -22.757 6.275   2.820   1.00 48.85  ?  4   ASN B HB2  1 
ATOM   3446  H  HB3  . ASN B  1 4   ? -23.973 7.101   2.218   1.00 48.85  ?  4   ASN B HB3  1 
ATOM   3447  H  HD21 . ASN B  1 4   ? -23.297 8.086   5.591   1.00 63.88  ?  4   ASN B HD21 1 
ATOM   3448  H  HD22 . ASN B  1 4   ? -22.440 7.969   4.379   1.00 63.88  ?  4   ASN B HD22 1 
ATOM   3449  N  N    . LYS B  1 5   ? -25.329 3.564   4.218   1.00 28.64  ?  5   LYS B N    1 
ATOM   3450  C  CA   . LYS B  1 5   ? -25.214 2.617   5.327   1.00 27.45  ?  5   LYS B CA   1 
ATOM   3451  C  C    . LYS B  1 5   ? -24.917 1.206   4.816   1.00 21.65  ?  5   LYS B C    1 
ATOM   3452  O  O    . LYS B  1 5   ? -25.423 0.800   3.767   1.00 26.25  ?  5   LYS B O    1 
ATOM   3453  C  CB   . LYS B  1 5   ? -26.518 2.585   6.125   1.00 29.19  ?  5   LYS B CB   1 
ATOM   3454  C  CG   . LYS B  1 5   ? -26.411 1.855   7.465   1.00 37.93  ?  5   LYS B CG   1 
ATOM   3455  C  CD   . LYS B  1 5   ? -27.800 1.624   8.063   1.00 47.16  ?  5   LYS B CD   1 
ATOM   3456  C  CE   . LYS B  1 5   ? -27.733 1.357   9.557   1.00 52.98  ?  5   LYS B CE   1 
ATOM   3457  N  NZ   . LYS B  1 5   ? -29.103 1.272   10.161  1.00 64.44  1  5   LYS B NZ   1 
ATOM   3458  H  H    . LYS B  1 5   ? -26.138 3.736   3.984   1.00 34.37  ?  5   LYS B H    1 
ATOM   3459  H  HA   . LYS B  1 5   ? -24.495 2.892   5.918   1.00 32.94  ?  5   LYS B HA   1 
ATOM   3460  H  HB2  . LYS B  1 5   ? -26.795 3.497   6.306   1.00 35.03  ?  5   LYS B HB2  1 
ATOM   3461  H  HB3  . LYS B  1 5   ? -27.196 2.136   5.596   1.00 35.03  ?  5   LYS B HB3  1 
ATOM   3462  H  HG2  . LYS B  1 5   ? -25.988 0.993   7.330   1.00 45.52  ?  5   LYS B HG2  1 
ATOM   3463  H  HG3  . LYS B  1 5   ? -25.895 2.393   8.085   1.00 45.52  ?  5   LYS B HG3  1 
ATOM   3464  H  HD2  . LYS B  1 5   ? -28.345 2.414   7.921   1.00 56.59  ?  5   LYS B HD2  1 
ATOM   3465  H  HD3  . LYS B  1 5   ? -28.208 0.855   7.635   1.00 56.59  ?  5   LYS B HD3  1 
ATOM   3466  H  HE2  . LYS B  1 5   ? -27.280 0.513   9.712   1.00 63.57  ?  5   LYS B HE2  1 
ATOM   3467  H  HE3  . LYS B  1 5   ? -27.254 2.080   9.991   1.00 63.57  ?  5   LYS B HE3  1 
ATOM   3468  H  HZ1  . LYS B  1 5   ? -29.041 1.115   11.035  1.00 77.32  ?  5   LYS B HZ1  1 
ATOM   3469  H  HZ2  . LYS B  1 5   ? -29.539 2.038   10.035  1.00 77.32  ?  5   LYS B HZ2  1 
ATOM   3470  H  HZ3  . LYS B  1 5   ? -29.562 0.612   9.781   1.00 77.32  ?  5   LYS B HZ3  1 
ATOM   3471  N  N    . ARG B  1 6   ? -24.097 0.461   5.572   1.00 19.80  ?  6   ARG B N    1 
ATOM   3472  C  CA   . ARG B  1 6   ? -23.846 -0.966  5.304   1.00 17.85  ?  6   ARG B CA   1 
ATOM   3473  C  C    . ARG B  1 6   ? -25.052 -1.751  5.805   1.00 20.72  ?  6   ARG B C    1 
ATOM   3474  O  O    . ARG B  1 6   ? -25.299 -1.798  7.014   1.00 24.00  ?  6   ARG B O    1 
ATOM   3475  C  CB   . ARG B  1 6   ? -22.570 -1.462  5.994   1.00 18.86  ?  6   ARG B CB   1 
ATOM   3476  C  CG   . ARG B  1 6   ? -21.273 -0.869  5.396   1.00 18.40  ?  6   ARG B CG   1 
ATOM   3477  C  CD   . ARG B  1 6   ? -20.030 -1.563  5.941   1.00 18.09  ?  6   ARG B CD   1 
ATOM   3478  N  NE   . ARG B  1 6   ? -18.859 -1.171  5.155   1.00 16.59  ?  6   ARG B NE   1 
ATOM   3479  C  CZ   . ARG B  1 6   ? -18.154 -0.054  5.326   1.00 16.80  ?  6   ARG B CZ   1 
ATOM   3480  N  NH1  . ARG B  1 6   ? -18.440 0.818   6.296   1.00 18.14  1  6   ARG B NH1  1 
ATOM   3481  N  NH2  . ARG B  1 6   ? -17.161 0.197   4.483   1.00 18.29  ?  6   ARG B NH2  1 
ATOM   3482  H  H    . ARG B  1 6   ? -23.669 0.763   6.254   1.00 23.76  ?  6   ARG B H    1 
ATOM   3483  H  HA   . ARG B  1 6   ? -23.757 -1.109  4.349   1.00 21.42  ?  6   ARG B HA   1 
ATOM   3484  H  HB2  . ARG B  1 6   ? -22.605 -1.216  6.931   1.00 22.63  ?  6   ARG B HB2  1 
ATOM   3485  H  HB3  . ARG B  1 6   ? -22.522 -2.427  5.908   1.00 22.63  ?  6   ARG B HB3  1 
ATOM   3486  H  HG2  . ARG B  1 6   ? -21.285 -0.982  4.432   1.00 22.08  ?  6   ARG B HG2  1 
ATOM   3487  H  HG3  . ARG B  1 6   ? -21.218 0.073   5.622   1.00 22.08  ?  6   ARG B HG3  1 
ATOM   3488  H  HD2  . ARG B  1 6   ? -19.887 -1.297  6.862   1.00 21.70  ?  6   ARG B HD2  1 
ATOM   3489  H  HD3  . ARG B  1 6   ? -20.139 -2.524  5.876   1.00 21.70  ?  6   ARG B HD3  1 
ATOM   3490  H  HE   . ARG B  1 6   ? -18.605 -1.707  4.531   1.00 19.91  ?  6   ARG B HE   1 
ATOM   3491  H  HH11 . ARG B  1 6   ? -19.097 0.666   6.829   1.00 21.77  ?  6   ARG B HH11 1 
ATOM   3492  H  HH12 . ARG B  1 6   ? -17.966 1.529   6.389   1.00 21.77  ?  6   ARG B HH12 1 
ATOM   3493  H  HH21 . ARG B  1 6   ? -16.968 -0.370  3.865   1.00 21.95  ?  6   ARG B HH21 1 
ATOM   3494  H  HH22 . ARG B  1 6   ? -16.674 0.898   4.589   1.00 21.95  ?  6   ARG B HH22 1 
ATOM   3495  N  N    . GLU B  1 7   ? -25.795 -2.367  4.886   1.00 16.88  ?  7   GLU B N    1 
ATOM   3496  C  CA   . GLU B  1 7   ? -27.018 -3.069  5.237   1.00 17.42  ?  7   GLU B CA   1 
ATOM   3497  C  C    . GLU B  1 7   ? -27.023 -4.474  4.648   1.00 16.90  ?  7   GLU B C    1 
ATOM   3498  O  O    . GLU B  1 7   ? -26.800 -4.651  3.446   1.00 19.87  ?  7   GLU B O    1 
ATOM   3499  C  CB   . GLU B  1 7   ? -28.236 -2.293  4.728   1.00 21.13  ?  7   GLU B CB   1 
ATOM   3500  C  CG   . GLU B  1 7   ? -28.287 -0.891  5.309   1.00 30.13  ?  7   GLU B CG   1 
ATOM   3501  C  CD   . GLU B  1 7   ? -29.632 -0.226  5.087   1.00 46.08  ?  7   GLU B CD   1 
ATOM   3502  O  OE1  . GLU B  1 7   ? -29.659 0.855   4.465   1.00 48.11  ?  7   GLU B OE1  1 
ATOM   3503  O  OE2  . GLU B  1 7   ? -30.661 -0.806  5.517   1.00 55.92  -1 7   GLU B OE2  1 
ATOM   3504  H  H    . GLU B  1 7   ? -25.607 -2.391  4.047   1.00 20.25  ?  7   GLU B H    1 
ATOM   3505  H  HA   . GLU B  1 7   ? -27.082 -3.141  6.202   1.00 20.90  ?  7   GLU B HA   1 
ATOM   3506  H  HB2  . GLU B  1 7   ? -28.188 -2.220  3.762   1.00 25.36  ?  7   GLU B HB2  1 
ATOM   3507  H  HB3  . GLU B  1 7   ? -29.045 -2.760  4.990   1.00 25.36  ?  7   GLU B HB3  1 
ATOM   3508  H  HG2  . GLU B  1 7   ? -28.127 -0.937  6.264   1.00 36.16  ?  7   GLU B HG2  1 
ATOM   3509  H  HG3  . GLU B  1 7   ? -27.607 -0.345  4.883   1.00 36.16  ?  7   GLU B HG3  1 
ATOM   3510  N  N    . ILE B  1 8   ? -27.344 -5.461  5.480   1.00 16.50  ?  8   ILE B N    1 
ATOM   3511  C  CA   . ILE B  1 8   ? -27.590 -6.815  4.994   1.00 14.66  ?  8   ILE B CA   1 
ATOM   3512  C  C    . ILE B  1 8   ? -28.947 -6.870  4.294   1.00 16.92  ?  8   ILE B C    1 
ATOM   3513  O  O    . ILE B  1 8   ? -29.918 -6.234  4.733   1.00 18.81  ?  8   ILE B O    1 
ATOM   3514  C  CB   . ILE B  1 8   ? -27.537 -7.816  6.162   1.00 15.43  ?  8   ILE B CB   1 
ATOM   3515  C  CG1  . ILE B  1 8   ? -26.126 -7.865  6.742   1.00 18.41  ?  8   ILE B CG1  1 
ATOM   3516  C  CG2  . ILE B  1 8   ? -27.979 -9.246  5.753   1.00 16.16  ?  8   ILE B CG2  1 
ATOM   3517  C  CD1  . ILE B  1 8   ? -26.027 -8.606  8.077   1.00 17.92  ?  8   ILE B CD1  1 
ATOM   3518  H  H    . ILE B  1 8   ? -27.425 -5.372  6.332   1.00 19.80  ?  8   ILE B H    1 
ATOM   3519  H  HA   . ILE B  1 8   ? -26.905 -7.057  4.352   1.00 17.59  ?  8   ILE B HA   1 
ATOM   3520  H  HB   . ILE B  1 8   ? -28.137 -7.501  6.856   1.00 18.51  ?  8   ILE B HB   1 
ATOM   3521  H  HG12 . ILE B  1 8   ? -25.544 -8.316  6.110   1.00 22.09  ?  8   ILE B HG12 1 
ATOM   3522  H  HG13 . ILE B  1 8   ? -25.815 -6.958  6.884   1.00 22.09  ?  8   ILE B HG13 1 
ATOM   3523  H  HG21 . ILE B  1 8   ? -27.924 -9.826  6.528   1.00 19.39  ?  8   ILE B HG21 1 
ATOM   3524  H  HG22 . ILE B  1 8   ? -28.893 -9.212  5.429   1.00 19.39  ?  8   ILE B HG22 1 
ATOM   3525  H  HG23 . ILE B  1 8   ? -27.391 -9.570  5.054   1.00 19.39  ?  8   ILE B HG23 1 
ATOM   3526  H  HD11 . ILE B  1 8   ? -25.105 -8.594  8.377   1.00 21.50  ?  8   ILE B HD11 1 
ATOM   3527  H  HD12 . ILE B  1 8   ? -26.593 -8.161  8.727   1.00 21.50  ?  8   ILE B HD12 1 
ATOM   3528  H  HD13 . ILE B  1 8   ? -26.323 -9.522  7.952   1.00 21.50  ?  8   ILE B HD13 1 
ATOM   3529  N  N    . VAL B  1 9   ? -29.009 -7.607  3.191   1.00 15.72  ?  9   VAL B N    1 
ATOM   3530  C  CA   . VAL B  1 9   ? -30.261 -7.800  2.458   1.00 15.69  ?  9   VAL B CA   1 
ATOM   3531  C  C    . VAL B  1 9   ? -30.485 -9.297  2.276   1.00 15.20  ?  9   VAL B C    1 
ATOM   3532  O  O    . VAL B  1 9   ? -29.591 -10.133 2.472   1.00 18.13  ?  9   VAL B O    1 
ATOM   3533  C  CB   . VAL B  1 9   ? -30.258 -7.069  1.112   1.00 19.54  ?  9   VAL B CB   1 
ATOM   3534  C  CG1  . VAL B  1 9   ? -30.068 -5.550  1.304   1.00 22.56  ?  9   VAL B CG1  1 
ATOM   3535  C  CG2  . VAL B  1 9   ? -29.190 -7.631  0.194   1.00 23.12  ?  9   VAL B CG2  1 
ATOM   3536  H  H    . VAL B  1 9   ? -28.335 -8.010  2.842   1.00 18.86  ?  9   VAL B H    1 
ATOM   3537  H  HA   . VAL B  1 9   ? -30.995 -7.449  2.987   1.00 18.83  ?  9   VAL B HA   1 
ATOM   3538  H  HB   . VAL B  1 9   ? -31.117 -7.206  0.683   1.00 23.45  ?  9   VAL B HB   1 
ATOM   3539  H  HG11 . VAL B  1 9   ? -30.071 -5.120  0.435   1.00 27.07  ?  9   VAL B HG11 1 
ATOM   3540  H  HG12 . VAL B  1 9   ? -30.795 -5.207  1.846   1.00 27.07  ?  9   VAL B HG12 1 
ATOM   3541  H  HG13 . VAL B  1 9   ? -29.220 -5.393  1.749   1.00 27.07  ?  9   VAL B HG13 1 
ATOM   3542  H  HG21 . VAL B  1 9   ? -29.213 -7.150  -0.648  1.00 27.74  ?  9   VAL B HG21 1 
ATOM   3543  H  HG22 . VAL B  1 9   ? -28.323 -7.521  0.615   1.00 27.74  ?  9   VAL B HG22 1 
ATOM   3544  H  HG23 . VAL B  1 9   ? -29.368 -8.572  0.043   1.00 27.74  ?  9   VAL B HG23 1 
ATOM   3545  N  N    . GLU B  1 10  ? -31.727 -9.648  1.915   1.00 16.80  ?  10  GLU B N    1 
ATOM   3546  C  CA   . GLU B  1 10  ? -32.088 -11.041 1.784   1.00 15.18  ?  10  GLU B CA   1 
ATOM   3547  C  C    . GLU B  1 10  ? -32.969 -11.178 0.547   1.00 14.87  ?  10  GLU B C    1 
ATOM   3548  O  O    . GLU B  1 10  ? -33.768 -10.290 0.250   1.00 16.31  ?  10  GLU B O    1 
ATOM   3549  C  CB   . GLU B  1 10  ? -32.783 -11.566 3.044   1.00 18.77  ?  10  GLU B CB   1 
ATOM   3550  C  CG   . GLU B  1 10  ? -33.067 -13.011 3.088   1.00 21.82  ?  10  GLU B CG   1 
ATOM   3551  C  CD   . GLU B  1 10  ? -33.412 -13.478 4.523   1.00 25.96  ?  10  GLU B CD   1 
ATOM   3552  O  OE1  . GLU B  1 10  ? -32.730 -13.003 5.460   1.00 33.12  ?  10  GLU B OE1  1 
ATOM   3553  O  OE2  . GLU B  1 10  ? -34.333 -14.306 4.671   1.00 31.77  -1 10  GLU B OE2  1 
ATOM   3554  H  H    . GLU B  1 10  ? -32.364 -9.097  1.744   1.00 20.16  ?  10  GLU B H    1 
ATOM   3555  H  HA   . GLU B  1 10  ? -31.285 -11.566 1.642   1.00 18.21  ?  10  GLU B HA   1 
ATOM   3556  H  HB2  . GLU B  1 10  ? -32.222 -11.360 3.808   1.00 22.53  ?  10  GLU B HB2  1 
ATOM   3557  H  HB3  . GLU B  1 10  ? -33.631 -11.104 3.137   1.00 22.53  ?  10  GLU B HB3  1 
ATOM   3558  H  HG2  . GLU B  1 10  ? -33.824 -13.207 2.514   1.00 26.19  ?  10  GLU B HG2  1 
ATOM   3559  H  HG3  . GLU B  1 10  ? -32.284 -13.500 2.789   1.00 26.19  ?  10  GLU B HG3  1 
ATOM   3560  N  N    . PHE B  1 11  ? -32.785 -12.285 -0.165  1.00 14.71  ?  11  PHE B N    1 
ATOM   3561  C  CA   . PHE B  1 11  ? -33.632 -12.700 -1.280  1.00 17.16  ?  11  PHE B CA   1 
ATOM   3562  C  C    . PHE B  1 11  ? -33.928 -14.186 -1.121  1.00 18.26  ?  11  PHE B C    1 
ATOM   3563  O  O    . PHE B  1 11  ? -33.050 -15.020 -1.335  1.00 17.28  ?  11  PHE B O    1 
ATOM   3564  C  CB   . PHE B  1 11  ? -32.962 -12.429 -2.639  1.00 20.16  ?  11  PHE B CB   1 
ATOM   3565  C  CG   . PHE B  1 11  ? -32.641 -10.999 -2.908  1.00 21.07  ?  11  PHE B CG   1 
ATOM   3566  C  CD1  . PHE B  1 11  ? -31.361 -10.517 -2.702  1.00 23.57  ?  11  PHE B CD1  1 
ATOM   3567  C  CD2  . PHE B  1 11  ? -33.606 -10.151 -3.405  1.00 20.76  ?  11  PHE B CD2  1 
ATOM   3568  C  CE1  . PHE B  1 11  ? -31.064 -9.148  -2.990  1.00 26.78  ?  11  PHE B CE1  1 
ATOM   3569  C  CE2  . PHE B  1 11  ? -33.300 -8.813  -3.678  1.00 24.08  ?  11  PHE B CE2  1 
ATOM   3570  C  CZ   . PHE B  1 11  ? -32.031 -8.338  -3.474  1.00 24.96  ?  11  PHE B CZ   1 
ATOM   3571  H  H    . PHE B  1 11  ? -32.145 -12.838 -0.012  1.00 17.65  ?  11  PHE B H    1 
ATOM   3572  H  HA   . PHE B  1 11  ? -34.471 -12.214 -1.248  1.00 20.59  ?  11  PHE B HA   1 
ATOM   3573  H  HB2  . PHE B  1 11  ? -32.131 -12.928 -2.678  1.00 24.20  ?  11  PHE B HB2  1 
ATOM   3574  H  HB3  . PHE B  1 11  ? -33.557 -12.733 -3.342  1.00 24.20  ?  11  PHE B HB3  1 
ATOM   3575  H  HD1  . PHE B  1 11  ? -30.697 -11.080 -2.376  1.00 28.29  ?  11  PHE B HD1  1 
ATOM   3576  H  HD2  . PHE B  1 11  ? -34.468 -10.468 -3.553  1.00 24.91  ?  11  PHE B HD2  1 
ATOM   3577  H  HE1  . PHE B  1 11  ? -30.206 -8.817  -2.848  1.00 32.13  ?  11  PHE B HE1  1 
ATOM   3578  H  HE2  . PHE B  1 11  ? -33.959 -8.246  -4.008  1.00 28.89  ?  11  PHE B HE2  1 
ATOM   3579  H  HZ   . PHE B  1 11  ? -31.839 -7.446  -3.652  1.00 29.96  ?  11  PHE B HZ   1 
ATOM   3580  N  N    . LEU B  1 12  ? -35.178 -14.525 -0.798  1.00 19.25  ?  12  LEU B N    1 
ATOM   3581  C  CA   . LEU B  1 12  ? -35.665 -15.921 -0.807  1.00 18.37  ?  12  LEU B CA   1 
ATOM   3582  C  C    . LEU B  1 12  ? -34.637 -16.953 -0.281  1.00 24.50  ?  12  LEU B C    1 
ATOM   3583  O  O    . LEU B  1 12  ? -34.163 -17.855 -0.989  1.00 25.47  ?  12  LEU B O    1 
ATOM   3584  C  CB   . LEU B  1 12  ? -36.111 -16.306 -2.210  1.00 16.62  ?  12  LEU B CB   1 
ATOM   3585  C  CG   . LEU B  1 12  ? -36.834 -17.646 -2.338  1.00 26.02  ?  12  LEU B CG   1 
ATOM   3586  C  CD1  . LEU B  1 12  ? -38.035 -17.734 -1.460  1.00 25.83  ?  12  LEU B CD1  1 
ATOM   3587  C  CD2  . LEU B  1 12  ? -37.268 -17.787 -3.795  1.00 32.85  ?  12  LEU B CD2  1 
ATOM   3588  H  H    . LEU B  1 12  ? -35.780 -13.956 -0.564  1.00 23.11  ?  12  LEU B H    1 
ATOM   3589  H  HA   . LEU B  1 12  ? -36.445 -15.973 -0.232  1.00 22.04  ?  12  LEU B HA   1 
ATOM   3590  H  HB2  . LEU B  1 12  ? -36.713 -15.620 -2.538  1.00 19.95  ?  12  LEU B HB2  1 
ATOM   3591  H  HB3  . LEU B  1 12  ? -35.326 -16.345 -2.779  1.00 19.95  ?  12  LEU B HB3  1 
ATOM   3592  H  HG   . LEU B  1 12  ? -36.229 -18.371 -2.118  1.00 31.22  ?  12  LEU B HG   1 
ATOM   3593  H  HD11 . LEU B  1 12  ? -38.452 -18.601 -1.582  1.00 31.00  ?  12  LEU B HD11 1 
ATOM   3594  H  HD12 . LEU B  1 12  ? -37.758 -17.626 -0.536  1.00 31.00  ?  12  LEU B HD12 1 
ATOM   3595  H  HD13 . LEU B  1 12  ? -38.656 -17.030 -1.704  1.00 31.00  ?  12  LEU B HD13 1 
ATOM   3596  H  HD21 . LEU B  1 12  ? -37.732 -18.632 -3.905  1.00 39.42  ?  12  LEU B HD21 1 
ATOM   3597  H  HD22 . LEU B  1 12  ? -37.860 -17.052 -4.020  1.00 39.42  ?  12  LEU B HD22 1 
ATOM   3598  H  HD23 . LEU B  1 12  ? -36.481 -17.764 -4.362  1.00 39.42  ?  12  LEU B HD23 1 
ATOM   3599  N  N    . GLY B  1 13  ? -34.310 -16.815 0.978   1.00 21.63  ?  13  GLY B N    1 
ATOM   3600  C  CA   . GLY B  1 13  ? -33.435 -17.733 1.663   1.00 22.08  ?  13  GLY B CA   1 
ATOM   3601  C  C    . GLY B  1 13  ? -31.960 -17.380 1.631   1.00 21.18  ?  13  GLY B C    1 
ATOM   3602  O  O    . GLY B  1 13  ? -31.171 -18.047 2.304   1.00 24.07  ?  13  GLY B O    1 
ATOM   3603  H  H    . GLY B  1 13  ? -34.592 -16.174 1.478   1.00 25.95  ?  13  GLY B H    1 
ATOM   3604  H  HA2  . GLY B  1 13  ? -33.707 -17.789 2.592   1.00 26.49  ?  13  GLY B HA2  1 
ATOM   3605  H  HA3  . GLY B  1 13  ? -33.538 -18.614 1.269   1.00 26.49  ?  13  GLY B HA3  1 
ATOM   3606  N  N    . ILE B  1 14  ? -31.558 -16.408 0.825   1.00 16.75  ?  14  ILE B N    1 
ATOM   3607  C  CA   . ILE B  1 14  ? -30.154 -16.036 0.680   1.00 17.60  ?  14  ILE B CA   1 
ATOM   3608  C  C    . ILE B  1 14  ? -29.949 -14.677 1.352   1.00 16.44  ?  14  ILE B C    1 
ATOM   3609  O  O    . ILE B  1 14  ? -30.354 -13.627 0.817   1.00 17.74  ?  14  ILE B O    1 
ATOM   3610  C  CB   . ILE B  1 14  ? -29.730 -15.993 -0.794  1.00 18.47  ?  14  ILE B CB   1 
ATOM   3611  C  CG1  . ILE B  1 14  ? -30.100 -17.308 -1.517  1.00 18.41  ?  14  ILE B CG1  1 
ATOM   3612  C  CG2  . ILE B  1 14  ? -28.177 -15.653 -0.883  1.00 20.14  ?  14  ILE B CG2  1 
ATOM   3613  C  CD1  . ILE B  1 14  ? -29.732 -17.325 -3.000  1.00 24.81  ?  14  ILE B CD1  1 
ATOM   3614  H  H    . ILE B  1 14  ? -32.090 -15.937 0.340   1.00 20.10  ?  14  ILE B H    1 
ATOM   3615  H  HA   . ILE B  1 14  ? -29.601 -16.689 1.136   1.00 21.12  ?  14  ILE B HA   1 
ATOM   3616  H  HB   . ILE B  1 14  ? -30.217 -15.272 -1.223  1.00 22.16  ?  14  ILE B HB   1 
ATOM   3617  H  HG12 . ILE B  1 14  ? -29.632 -18.041 -1.087  1.00 22.10  ?  14  ILE B HG12 1 
ATOM   3618  H  HG13 . ILE B  1 14  ? -31.058 -17.443 -1.447  1.00 22.10  ?  14  ILE B HG13 1 
ATOM   3619  H  HG21 . ILE B  1 14  ? -27.912 -15.627 -1.816  1.00 24.16  ?  14  ILE B HG21 1 
ATOM   3620  H  HG22 . ILE B  1 14  ? -28.019 -14.790 -0.470  1.00 24.16  ?  14  ILE B HG22 1 
ATOM   3621  H  HG23 . ILE B  1 14  ? -27.676 -16.340 -0.416  1.00 24.16  ?  14  ILE B HG23 1 
ATOM   3622  H  HD11 . ILE B  1 14  ? -29.995 -18.178 -3.380  1.00 29.77  ?  14  ILE B HD11 1 
ATOM   3623  H  HD12 . ILE B  1 14  ? -30.201 -16.604 -3.450  1.00 29.77  ?  14  ILE B HD12 1 
ATOM   3624  H  HD13 . ILE B  1 14  ? -28.774 -17.203 -3.089  1.00 29.77  ?  14  ILE B HD13 1 
ATOM   3625  N  N    . ARG B  1 15  ? -29.237 -14.705 2.483   1.00 16.58  ?  15  ARG B N    1 
ATOM   3626  C  CA   . ARG B  1 15  ? -28.905 -13.533 3.276   1.00 15.55  ?  15  ARG B CA   1 
ATOM   3627  C  C    . ARG B  1 15  ? -27.469 -13.140 2.942   1.00 14.11  ?  15  ARG B C    1 
ATOM   3628  O  O    . ARG B  1 15  ? -26.569 -13.978 3.016   1.00 16.47  ?  15  ARG B O    1 
ATOM   3629  C  CB   . ARG B  1 15  ? -29.068 -13.863 4.758   1.00 15.56  ?  15  ARG B CB   1 
ATOM   3630  C  CG   . ARG B  1 15  ? -28.634 -12.814 5.713   1.00 16.67  ?  15  ARG B CG   1 
ATOM   3631  C  CD   . ARG B  1 15  ? -28.985 -13.270 7.157   1.00 18.54  ?  15  ARG B CD   1 
ATOM   3632  N  NE   . ARG B  1 15  ? -28.281 -12.513 8.174   1.00 17.49  ?  15  ARG B NE   1 
ATOM   3633  C  CZ   . ARG B  1 15  ? -28.717 -11.418 8.782   1.00 16.09  ?  15  ARG B CZ   1 
ATOM   3634  N  NH1  . ARG B  1 15  ? -29.918 -10.890 8.485   1.00 18.71  1  15  ARG B NH1  1 
ATOM   3635  N  NH2  . ARG B  1 15  ? -27.988 -10.888 9.723   1.00 17.61  ?  15  ARG B NH2  1 
ATOM   3636  H  H    . ARG B  1 15  ? -28.923 -15.431 2.820   1.00 19.89  ?  15  ARG B H    1 
ATOM   3637  H  HA   . ARG B  1 15  ? -29.496 -12.798 3.048   1.00 18.66  ?  15  ARG B HA   1 
ATOM   3638  H  HB2  . ARG B  1 15  ? -30.007 -14.039 4.930   1.00 18.67  ?  15  ARG B HB2  1 
ATOM   3639  H  HB3  . ARG B  1 15  ? -28.551 -14.661 4.951   1.00 18.67  ?  15  ARG B HB3  1 
ATOM   3640  H  HG2  . ARG B  1 15  ? -27.674 -12.689 5.649   1.00 20.00  ?  15  ARG B HG2  1 
ATOM   3641  H  HG3  . ARG B  1 15  ? -29.102 -11.985 5.525   1.00 20.00  ?  15  ARG B HG3  1 
ATOM   3642  H  HD2  . ARG B  1 15  ? -29.937 -13.154 7.302   1.00 22.24  ?  15  ARG B HD2  1 
ATOM   3643  H  HD3  . ARG B  1 15  ? -28.746 -14.204 7.260   1.00 22.24  ?  15  ARG B HD3  1 
ATOM   3644  H  HE   . ARG B  1 15  ? -27.505 -12.802 8.405   1.00 20.99  ?  15  ARG B HE   1 
ATOM   3645  H  HH11 . ARG B  1 15  ? -30.409 -11.252 7.878   1.00 22.45  ?  15  ARG B HH11 1 
ATOM   3646  H  HH12 . ARG B  1 15  ? -30.188 -10.180 8.888   1.00 22.45  ?  15  ARG B HH12 1 
ATOM   3647  H  HH21 . ARG B  1 15  ? -27.219 -11.223 9.911   1.00 21.13  ?  15  ARG B HH21 1 
ATOM   3648  H  HH22 . ARG B  1 15  ? -28.252 -10.170 10.117  1.00 21.13  ?  15  ARG B HH22 1 
ATOM   3649  N  N    . THR B  1 16  ? -27.259 -11.871 2.595   1.00 14.24  ?  16  THR B N    1 
ATOM   3650  C  CA   . THR B  1 16  ? -25.978 -11.421 2.061   1.00 13.50  ?  16  THR B CA   1 
ATOM   3651  C  C    . THR B  1 16  ? -25.747 -9.942  2.365   1.00 16.00  ?  16  THR B C    1 
ATOM   3652  O  O    . THR B  1 16  ? -26.676 -9.139  2.388   1.00 15.35  ?  16  THR B O    1 
ATOM   3653  C  CB   . THR B  1 16  ? -25.935 -11.690 0.552   1.00 15.20  ?  16  THR B CB   1 
ATOM   3654  O  OG1  . THR B  1 16  ? -24.644 -11.333 0.032   1.00 16.04  ?  16  THR B OG1  1 
ATOM   3655  C  CG2  . THR B  1 16  ? -26.994 -10.920 -0.223  1.00 15.85  ?  16  THR B CG2  1 
ATOM   3656  H  H    . THR B  1 16  ? -27.848 -11.248 2.660   1.00 17.09  ?  16  THR B H    1 
ATOM   3657  H  HA   . THR B  1 16  ? -25.264 -11.929 2.478   1.00 16.20  ?  16  THR B HA   1 
ATOM   3658  H  HB   . THR B  1 16  ? -26.084 -12.636 0.399   1.00 18.24  ?  16  THR B HB   1 
ATOM   3659  H  HG1  . THR B  1 16  ? -24.047 -11.788 0.409   1.00 19.25  ?  16  THR B HG1  1 
ATOM   3660  H  HG21 . THR B  1 16  ? -26.925 -11.124 -1.168  1.00 19.03  ?  16  THR B HG21 1 
ATOM   3661  H  HG22 . THR B  1 16  ? -27.878 -11.168 0.090   1.00 19.03  ?  16  THR B HG22 1 
ATOM   3662  H  HG23 . THR B  1 16  ? -26.870 -9.967  -0.095  1.00 19.03  ?  16  THR B HG23 1 
ATOM   3663  N  N    . TYR B  1 17  ? -24.477 -9.596  2.610   1.00 13.77  ?  17  TYR B N    1 
ATOM   3664  C  CA   . TYR B  1 17  ? -24.013 -8.218  2.560   1.00 15.31  ?  17  TYR B CA   1 
ATOM   3665  C  C    . TYR B  1 17  ? -23.226 -7.949  1.286   1.00 15.63  ?  17  TYR B C    1 
ATOM   3666  O  O    . TYR B  1 17  ? -23.538 -7.019  0.541   1.00 15.34  ?  17  TYR B O    1 
ATOM   3667  C  CB   . TYR B  1 17  ? -23.125 -7.866  3.781   1.00 15.55  ?  17  TYR B CB   1 
ATOM   3668  C  CG   . TYR B  1 17  ? -22.537 -6.477  3.551   1.00 13.97  ?  17  TYR B CG   1 
ATOM   3669  C  CD1  . TYR B  1 17  ? -23.366 -5.367  3.577   1.00 15.75  ?  17  TYR B CD1  1 
ATOM   3670  C  CD2  . TYR B  1 17  ? -21.200 -6.294  3.181   1.00 14.30  ?  17  TYR B CD2  1 
ATOM   3671  C  CE1  . TYR B  1 17  ? -22.904 -4.110  3.291   1.00 18.11  ?  17  TYR B CE1  1 
ATOM   3672  C  CE2  . TYR B  1 17  ? -20.718 -5.040  2.881   1.00 16.53  ?  17  TYR B CE2  1 
ATOM   3673  C  CZ   . TYR B  1 17  ? -21.594 -3.955  2.907   1.00 18.26  ?  17  TYR B CZ   1 
ATOM   3674  O  OH   . TYR B  1 17  ? -21.159 -2.684  2.627   1.00 19.66  ?  17  TYR B OH   1 
ATOM   3675  H  H    . TYR B  1 17  ? -23.858 -10.158 2.811   1.00 16.53  ?  17  TYR B H    1 
ATOM   3676  H  HA   . TYR B  1 17  ? -24.781 -7.626  2.568   1.00 18.37  ?  17  TYR B HA   1 
ATOM   3677  H  HB2  . TYR B  1 17  ? -23.662 -7.850  4.588   1.00 18.66  ?  17  TYR B HB2  1 
ATOM   3678  H  HB3  . TYR B  1 17  ? -22.400 -8.506  3.859   1.00 18.66  ?  17  TYR B HB3  1 
ATOM   3679  H  HD1  . TYR B  1 17  ? -24.263 -5.479  3.795   1.00 18.91  ?  17  TYR B HD1  1 
ATOM   3680  H  HD2  . TYR B  1 17  ? -20.634 -7.029  3.125   1.00 17.16  ?  17  TYR B HD2  1 
ATOM   3681  H  HE1  . TYR B  1 17  ? -23.479 -3.379  3.313   1.00 21.73  ?  17  TYR B HE1  1 
ATOM   3682  H  HE2  . TYR B  1 17  ? -19.828 -4.922  2.637   1.00 19.84  ?  17  TYR B HE2  1 
ATOM   3683  H  HH   . TYR B  1 17  ? -20.350 -2.700  2.403   1.00 23.60  ?  17  TYR B HH   1 
ATOM   3684  N  N    . PHE B  1 18  ? -22.234 -8.790  1.020   1.00 15.22  ?  18  PHE B N    1 
ATOM   3685  C  CA   . PHE B  1 18  ? -21.256 -8.525  -0.035  1.00 14.73  ?  18  PHE B CA   1 
ATOM   3686  C  C    . PHE B  1 18  ? -21.737 -8.863  -1.445  1.00 15.47  ?  18  PHE B C    1 
ATOM   3687  O  O    . PHE B  1 18  ? -21.152 -8.364  -2.426  1.00 16.44  ?  18  PHE B O    1 
ATOM   3688  C  CB   . PHE B  1 18  ? -19.978 -9.310  0.257   1.00 15.59  ?  18  PHE B CB   1 
ATOM   3689  C  CG   . PHE B  1 18  ? -19.190 -8.760  1.414   1.00 16.09  ?  18  PHE B CG   1 
ATOM   3690  C  CD1  . PHE B  1 18  ? -19.277 -9.329  2.664   1.00 15.57  ?  18  PHE B CD1  1 
ATOM   3691  C  CD2  . PHE B  1 18  ? -18.320 -7.682  1.220   1.00 18.52  ?  18  PHE B CD2  1 
ATOM   3692  C  CE1  . PHE B  1 18  ? -18.526 -8.813  3.729   1.00 17.34  ?  18  PHE B CE1  1 
ATOM   3693  C  CE2  . PHE B  1 18  ? -17.557 -7.186  2.275   1.00 18.13  ?  18  PHE B CE2  1 
ATOM   3694  C  CZ   . PHE B  1 18  ? -17.679 -7.742  3.540   1.00 18.26  ?  18  PHE B CZ   1 
ATOM   3695  H  H    . PHE B  1 18  ? -22.103 -9.529  1.439   1.00 18.27  ?  18  PHE B H    1 
ATOM   3696  H  HA   . PHE B  1 18  ? -21.033 -7.582  -0.019  1.00 17.68  ?  18  PHE B HA   1 
ATOM   3697  H  HB2  . PHE B  1 18  ? -20.213 -10.227 0.466   1.00 18.71  ?  18  PHE B HB2  1 
ATOM   3698  H  HB3  . PHE B  1 18  ? -19.409 -9.286  -0.528  1.00 18.71  ?  18  PHE B HB3  1 
ATOM   3699  H  HD1  . PHE B  1 18  ? -19.852 -10.046 2.807   1.00 18.68  ?  18  PHE B HD1  1 
ATOM   3700  H  HD2  . PHE B  1 18  ? -18.241 -7.300  0.375   1.00 22.22  ?  18  PHE B HD2  1 
ATOM   3701  H  HE1  . PHE B  1 18  ? -18.600 -9.197  4.573   1.00 20.81  ?  18  PHE B HE1  1 
ATOM   3702  H  HE2  . PHE B  1 18  ? -16.993 -6.459  2.140   1.00 21.76  ?  18  PHE B HE2  1 
ATOM   3703  H  HZ   . PHE B  1 18  ? -17.176 -7.410  4.249   1.00 21.92  ?  18  PHE B HZ   1 
ATOM   3704  N  N    . PHE B  1 19  ? -22.789 -9.687  -1.601  1.00 16.23  ?  19  PHE B N    1 
ATOM   3705  C  CA   . PHE B  1 19  ? -23.174 -10.211 -2.915  1.00 16.88  ?  19  PHE B CA   1 
ATOM   3706  C  C    . PHE B  1 19  ? -24.675 -10.113 -3.188  1.00 17.25  ?  19  PHE B C    1 
ATOM   3707  O  O    . PHE B  1 19  ? -25.278 -11.076 -3.642  1.00 15.80  ?  19  PHE B O    1 
ATOM   3708  C  CB   . PHE B  1 19  ? -22.707 -11.660 -3.013  1.00 16.45  ?  19  PHE B CB   1 
ATOM   3709  C  CG   . PHE B  1 19  ? -21.196 -11.825 -2.885  1.00 15.55  ?  19  PHE B CG   1 
ATOM   3710  C  CD1  . PHE B  1 19  ? -20.355 -11.461 -3.920  1.00 16.64  ?  19  PHE B CD1  1 
ATOM   3711  C  CD2  . PHE B  1 19  ? -20.637 -12.338 -1.728  1.00 16.96  ?  19  PHE B CD2  1 
ATOM   3712  C  CE1  . PHE B  1 19  ? -18.983 -11.612 -3.800  1.00 18.74  ?  19  PHE B CE1  1 
ATOM   3713  C  CE2  . PHE B  1 19  ? -19.247 -12.478 -1.576  1.00 18.23  ?  19  PHE B CE2  1 
ATOM   3714  C  CZ   . PHE B  1 19  ? -18.431 -12.101 -2.616  1.00 17.49  ?  19  PHE B CZ   1 
ATOM   3715  H  H    . PHE B  1 19  ? -23.293 -9.954  -0.957  1.00 19.47  ?  19  PHE B H    1 
ATOM   3716  H  HA   . PHE B  1 19  ? -22.714 -9.703  -3.602  1.00 20.26  ?  19  PHE B HA   1 
ATOM   3717  H  HB2  . PHE B  1 19  ? -23.123 -12.172 -2.302  1.00 19.73  ?  19  PHE B HB2  1 
ATOM   3718  H  HB3  . PHE B  1 19  ? -22.973 -12.017 -3.875  1.00 19.73  ?  19  PHE B HB3  1 
ATOM   3719  H  HD1  . PHE B  1 19  ? -20.714 -11.119 -4.707  1.00 19.97  ?  19  PHE B HD1  1 
ATOM   3720  H  HD2  . PHE B  1 19  ? -21.195 -12.575 -1.022  1.00 20.35  ?  19  PHE B HD2  1 
ATOM   3721  H  HE1  . PHE B  1 19  ? -18.426 -11.357 -4.500  1.00 22.49  ?  19  PHE B HE1  1 
ATOM   3722  H  HE2  . PHE B  1 19  ? -18.887 -12.822 -0.790  1.00 21.88  ?  19  PHE B HE2  1 
ATOM   3723  H  HZ   . PHE B  1 19  ? -17.510 -12.206 -2.544  1.00 20.99  ?  19  PHE B HZ   1 
ATOM   3724  N  N    . PRO B  1 20  ? -25.305 -8.952  -2.973  1.00 15.63  ?  20  PRO B N    1 
ATOM   3725  C  CA   . PRO B  1 20  ? -26.763 -8.865  -3.213  1.00 18.24  ?  20  PRO B CA   1 
ATOM   3726  C  C    . PRO B  1 20  ? -27.200 -9.171  -4.632  1.00 16.66  ?  20  PRO B C    1 
ATOM   3727  O  O    . PRO B  1 20  ? -28.240 -9.831  -4.809  1.00 17.56  ?  20  PRO B O    1 
ATOM   3728  C  CB   . PRO B  1 20  ? -27.101 -7.420  -2.830  1.00 21.61  ?  20  PRO B CB   1 
ATOM   3729  C  CG   . PRO B  1 20  ? -25.829 -6.695  -2.903  1.00 20.16  ?  20  PRO B CG   1 
ATOM   3730  C  CD   . PRO B  1 20  ? -24.756 -7.671  -2.504  1.00 18.68  ?  20  PRO B CD   1 
ATOM   3731  H  HA   . PRO B  1 20  ? -27.230 -9.464  -2.609  1.00 21.89  ?  20  PRO B HA   1 
ATOM   3732  H  HB2  . PRO B  1 20  ? -27.741 -7.055  -3.461  1.00 25.94  ?  20  PRO B HB2  1 
ATOM   3733  H  HB3  . PRO B  1 20  ? -27.458 -7.396  -1.928  1.00 25.94  ?  20  PRO B HB3  1 
ATOM   3734  H  HG2  . PRO B  1 20  ? -25.685 -6.386  -3.812  1.00 24.19  ?  20  PRO B HG2  1 
ATOM   3735  H  HG3  . PRO B  1 20  ? -25.849 -5.944  -2.290  1.00 24.19  ?  20  PRO B HG3  1 
ATOM   3736  H  HD2  . PRO B  1 20  ? -23.924 -7.469  -2.960  1.00 22.42  ?  20  PRO B HD2  1 
ATOM   3737  H  HD3  . PRO B  1 20  ? -24.645 -7.680  -1.541  1.00 22.42  ?  20  PRO B HD3  1 
ATOM   3738  N  N    . ASN B  1 21  ? -26.475 -8.703  -5.649  1.00 17.89  ?  21  ASN B N    1 
ATOM   3739  C  CA   . ASN B  1 21  ? -26.928 -8.994  -7.003  1.00 18.26  ?  21  ASN B CA   1 
ATOM   3740  C  C    . ASN B  1 21  ? -26.660 -10.450 -7.394  1.00 18.99  ?  21  ASN B C    1 
ATOM   3741  O  O    . ASN B  1 21  ? -27.379 -10.991 -8.230  1.00 18.40  ?  21  ASN B O    1 
ATOM   3742  C  CB   . ASN B  1 21  ? -26.284 -8.040  -8.007  1.00 18.65  ?  21  ASN B CB   1 
ATOM   3743  C  CG   . ASN B  1 21  ? -26.988 -8.066  -9.353  1.00 24.34  ?  21  ASN B CG   1 
ATOM   3744  O  OD1  . ASN B  1 21  ? -28.233 -8.077  -9.424  1.00 25.02  ?  21  ASN B OD1  1 
ATOM   3745  N  ND2  . ASN B  1 21  ? -26.204 -8.104  -10.425 1.00 26.91  ?  21  ASN B ND2  1 
ATOM   3746  H  H    . ASN B  1 21  ? -25.754 -8.238  -5.587  1.00 21.46  ?  21  ASN B H    1 
ATOM   3747  H  HA   . ASN B  1 21  ? -27.887 -8.854  -7.042  1.00 21.91  ?  21  ASN B HA   1 
ATOM   3748  H  HB2  . ASN B  1 21  ? -26.328 -7.135  -7.660  1.00 22.38  ?  21  ASN B HB2  1 
ATOM   3749  H  HB3  . ASN B  1 21  ? -25.359 -8.299  -8.145  1.00 22.38  ?  21  ASN B HB3  1 
ATOM   3750  H  HD21 . ASN B  1 21  ? -26.551 -8.120  -11.211 1.00 32.30  ?  21  ASN B HD21 1 
ATOM   3751  H  HD22 . ASN B  1 21  ? -25.349 -8.113  -10.331 1.00 32.30  ?  21  ASN B HD22 1 
ATOM   3752  N  N    . LEU B  1 22  ? -25.678 -11.113 -6.786  1.00 18.71  ?  22  LEU B N    1 
ATOM   3753  C  CA   . LEU B  1 22  ? -25.507 -12.540 -7.026  1.00 16.57  ?  22  LEU B CA   1 
ATOM   3754  C  C    . LEU B  1 22  ? -26.680 -13.318 -6.446  1.00 20.14  ?  22  LEU B C    1 
ATOM   3755  O  O    . LEU B  1 22  ? -27.183 -14.255 -7.068  1.00 18.31  ?  22  LEU B O    1 
ATOM   3756  C  CB   . LEU B  1 22  ? -24.196 -13.033 -6.419  1.00 16.35  ?  22  LEU B CB   1 
ATOM   3757  C  CG   . LEU B  1 22  ? -23.911 -14.529 -6.508  1.00 18.40  ?  22  LEU B CG   1 
ATOM   3758  C  CD1  . LEU B  1 22  ? -23.725 -14.964 -7.933  1.00 23.34  ?  22  LEU B CD1  1 
ATOM   3759  C  CD2  . LEU B  1 22  ? -22.645 -14.863 -5.728  1.00 20.67  ?  22  LEU B CD2  1 
ATOM   3760  H  H    . LEU B  1 22  ? -25.110 -10.767 -6.241  1.00 22.45  ?  22  LEU B H    1 
ATOM   3761  H  HA   . LEU B  1 22  ? -25.479 -12.701 -7.982  1.00 19.88  ?  22  LEU B HA   1 
ATOM   3762  H  HB2  . LEU B  1 22  ? -23.466 -12.576 -6.867  1.00 19.62  ?  22  LEU B HB2  1 
ATOM   3763  H  HB3  . LEU B  1 22  ? -24.191 -12.797 -5.478  1.00 19.62  ?  22  LEU B HB3  1 
ATOM   3764  H  HG   . LEU B  1 22  ? -24.651 -15.026 -6.125  1.00 22.09  ?  22  LEU B HG   1 
ATOM   3765  H  HD11 . LEU B  1 22  ? -23.547 -15.917 -7.951  1.00 28.01  ?  22  LEU B HD11 1 
ATOM   3766  H  HD12 . LEU B  1 22  ? -24.535 -14.769 -8.430  1.00 28.01  ?  22  LEU B HD12 1 
ATOM   3767  H  HD13 . LEU B  1 22  ? -22.977 -14.479 -8.316  1.00 28.01  ?  22  LEU B HD13 1 
ATOM   3768  H  HD21 . LEU B  1 22  ? -22.477 -15.816 -5.793  1.00 24.81  ?  22  LEU B HD21 1 
ATOM   3769  H  HD22 . LEU B  1 22  ? -21.902 -14.368 -6.107  1.00 24.81  ?  22  LEU B HD22 1 
ATOM   3770  H  HD23 . LEU B  1 22  ? -22.772 -14.611 -4.799  1.00 24.81  ?  22  LEU B HD23 1 
ATOM   3771  N  N    . ALA B  1 23  ? -27.098 -12.964 -5.233  1.00 17.70  ?  23  ALA B N    1 
ATOM   3772  C  CA   . ALA B  1 23  ? -28.242 -13.624 -4.613  1.00 17.50  ?  23  ALA B CA   1 
ATOM   3773  C  C    . ALA B  1 23  ? -29.497 -13.407 -5.456  1.00 17.95  ?  23  ALA B C    1 
ATOM   3774  O  O    . ALA B  1 23  ? -30.244 -14.347 -5.737  1.00 17.26  ?  23  ALA B O    1 
ATOM   3775  C  CB   . ALA B  1 23  ? -28.435 -13.080 -3.194  1.00 17.39  ?  23  ALA B CB   1 
ATOM   3776  H  H    . ALA B  1 23  ? -26.739 -12.348 -4.752  1.00 21.24  ?  23  ALA B H    1 
ATOM   3777  H  HA   . ALA B  1 23  ? -28.072 -14.577 -4.555  1.00 21.00  ?  23  ALA B HA   1 
ATOM   3778  H  HB1  . ALA B  1 23  ? -29.196 -13.523 -2.788  1.00 20.87  ?  23  ALA B HB1  1 
ATOM   3779  H  HB2  . ALA B  1 23  ? -27.634 -13.257 -2.677  1.00 20.87  ?  23  ALA B HB2  1 
ATOM   3780  H  HB3  . ALA B  1 23  ? -28.594 -12.124 -3.242  1.00 20.87  ?  23  ALA B HB3  1 
ATOM   3781  N  N    . LEU B  1 24  ? -29.733 -12.169 -5.878  1.00 17.76  ?  24  LEU B N    1 
ATOM   3782  C  CA   . LEU B  1 24  ? -30.899 -11.888 -6.720  1.00 17.52  ?  24  LEU B CA   1 
ATOM   3783  C  C    . LEU B  1 24  ? -30.829 -12.667 -8.030  1.00 21.27  ?  24  LEU B C    1 
ATOM   3784  O  O    . LEU B  1 24  ? -31.851 -13.192 -8.502  1.00 18.70  ?  24  LEU B O    1 
ATOM   3785  C  CB   . LEU B  1 24  ? -31.008 -10.386 -6.992  1.00 20.61  ?  24  LEU B CB   1 
ATOM   3786  C  CG   . LEU B  1 24  ? -32.215 -9.962  -7.864  1.00 19.84  ?  24  LEU B CG   1 
ATOM   3787  C  CD1  . LEU B  1 24  ? -33.548 -10.435 -7.248  1.00 24.89  ?  24  LEU B CD1  1 
ATOM   3788  C  CD2  . LEU B  1 24  ? -32.174 -8.466  -8.037  1.00 27.82  ?  24  LEU B CD2  1 
ATOM   3789  H  H    . LEU B  1 24  ? -29.246 -11.484 -5.697  1.00 21.31  ?  24  LEU B H    1 
ATOM   3790  H  HA   . LEU B  1 24  ? -31.700 -12.166 -6.250  1.00 21.03  ?  24  LEU B HA   1 
ATOM   3791  H  HB2  . LEU B  1 24  ? -31.085 -9.924  -6.142  1.00 24.73  ?  24  LEU B HB2  1 
ATOM   3792  H  HB3  . LEU B  1 24  ? -30.203 -10.096 -7.447  1.00 24.73  ?  24  LEU B HB3  1 
ATOM   3793  H  HG   . LEU B  1 24  ? -32.129 -10.368 -8.741  1.00 23.81  ?  24  LEU B HG   1 
ATOM   3794  H  HD11 . LEU B  1 24  ? -34.278 -10.151 -7.821  1.00 29.86  ?  24  LEU B HD11 1 
ATOM   3795  H  HD12 . LEU B  1 24  ? -33.537 -11.402 -7.179  1.00 29.86  ?  24  LEU B HD12 1 
ATOM   3796  H  HD13 . LEU B  1 24  ? -33.645 -10.041 -6.367  1.00 29.86  ?  24  LEU B HD13 1 
ATOM   3797  H  HD21 . LEU B  1 24  ? -32.928 -8.191  -8.583  1.00 33.38  ?  24  LEU B HD21 1 
ATOM   3798  H  HD22 . LEU B  1 24  ? -32.227 -8.046  -7.164  1.00 33.38  ?  24  LEU B HD22 1 
ATOM   3799  H  HD23 . LEU B  1 24  ? -31.343 -8.221  -8.473  1.00 33.38  ?  24  LEU B HD23 1 
ATOM   3800  N  N    . TYR B  1 25  ? -29.651 -12.697 -8.667  1.00 17.71  ?  25  TYR B N    1 
ATOM   3801  C  CA   . TYR B  1 25  ? -29.484 -13.478 -9.894  1.00 20.96  ?  25  TYR B CA   1 
ATOM   3802  C  C    . TYR B  1 25  ? -29.909 -14.937 -9.693  1.00 21.06  ?  25  TYR B C    1 
ATOM   3803  O  O    . TYR B  1 25  ? -30.616 -15.523 -10.526 1.00 19.09  ?  25  TYR B O    1 
ATOM   3804  C  CB   . TYR B  1 25  ? -28.029 -13.428 -10.380 1.00 18.78  ?  25  TYR B CB   1 
ATOM   3805  C  CG   . TYR B  1 25  ? -27.875 -14.171 -11.685 1.00 20.12  ?  25  TYR B CG   1 
ATOM   3806  C  CD1  . TYR B  1 25  ? -27.655 -15.560 -11.714 1.00 20.26  ?  25  TYR B CD1  1 
ATOM   3807  C  CD2  . TYR B  1 25  ? -28.041 -13.511 -12.883 1.00 23.07  ?  25  TYR B CD2  1 
ATOM   3808  C  CE1  . TYR B  1 25  ? -27.585 -16.252 -12.925 1.00 24.16  ?  25  TYR B CE1  1 
ATOM   3809  C  CE2  . TYR B  1 25  ? -27.944 -14.195 -14.092 1.00 26.76  ?  25  TYR B CE2  1 
ATOM   3810  C  CZ   . TYR B  1 25  ? -27.720 -15.558 -14.096 1.00 28.52  ?  25  TYR B CZ   1 
ATOM   3811  O  OH   . TYR B  1 25  ? -27.636 -16.259 -15.281 1.00 29.75  ?  25  TYR B OH   1 
ATOM   3812  H  H    . TYR B  1 25  ? -28.944 -12.279 -8.411  1.00 21.25  ?  25  TYR B H    1 
ATOM   3813  H  HA   . TYR B  1 25  ? -30.044 -13.097 -10.588 1.00 25.15  ?  25  TYR B HA   1 
ATOM   3814  H  HB2  . TYR B  1 25  ? -27.768 -12.504 -10.520 1.00 22.53  ?  25  TYR B HB2  1 
ATOM   3815  H  HB3  . TYR B  1 25  ? -27.454 -13.845 -9.719  1.00 22.53  ?  25  TYR B HB3  1 
ATOM   3816  H  HD1  . TYR B  1 25  ? -27.570 -16.027 -10.915 1.00 24.31  ?  25  TYR B HD1  1 
ATOM   3817  H  HD2  . TYR B  1 25  ? -28.195 -12.594 -12.885 1.00 27.68  ?  25  TYR B HD2  1 
ATOM   3818  H  HE1  . TYR B  1 25  ? -27.423 -17.168 -12.936 1.00 28.99  ?  25  TYR B HE1  1 
ATOM   3819  H  HE2  . TYR B  1 25  ? -28.046 -13.737 -14.895 1.00 32.11  ?  25  TYR B HE2  1 
ATOM   3820  H  HH   . TYR B  1 25  ? -27.733 -15.736 -15.932 1.00 35.70  ?  25  TYR B HH   1 
ATOM   3821  N  N    . ALA B  1 26  ? -29.473 -15.546 -8.593  1.00 19.76  ?  26  ALA B N    1 
ATOM   3822  C  CA   . ALA B  1 26  ? -29.769 -16.955 -8.345  1.00 18.31  ?  26  ALA B CA   1 
ATOM   3823  C  C    . ALA B  1 26  ? -31.258 -17.188 -8.142  1.00 20.77  ?  26  ALA B C    1 
ATOM   3824  O  O    . ALA B  1 26  ? -31.792 -18.213 -8.588  1.00 21.10  ?  26  ALA B O    1 
ATOM   3825  C  CB   . ALA B  1 26  ? -28.987 -17.455 -7.133  1.00 20.84  ?  26  ALA B CB   1 
ATOM   3826  H  H    . ALA B  1 26  ? -29.005 -15.169 -7.978  1.00 23.71  ?  26  ALA B H    1 
ATOM   3827  H  HA   . ALA B  1 26  ? -29.489 -17.474 -9.115  1.00 21.97  ?  26  ALA B HA   1 
ATOM   3828  H  HB1  . ALA B  1 26  ? -29.198 -18.391 -6.985  1.00 25.01  ?  26  ALA B HB1  1 
ATOM   3829  H  HB2  . ALA B  1 26  ? -28.038 -17.353 -7.305  1.00 25.01  ?  26  ALA B HB2  1 
ATOM   3830  H  HB3  . ALA B  1 26  ? -29.241 -16.932 -6.356  1.00 25.01  ?  26  ALA B HB3  1 
ATOM   3831  N  N    . VAL B  1 27  ? -31.939 -16.254 -7.465  1.00 17.79  ?  27  VAL B N    1 
ATOM   3832  C  CA   . VAL B  1 27  ? -33.366 -16.376 -7.235  1.00 19.14  ?  27  VAL B CA   1 
ATOM   3833  C  C    . VAL B  1 27  ? -34.145 -16.155 -8.532  1.00 23.41  ?  27  VAL B C    1 
ATOM   3834  O  O    . VAL B  1 27  ? -35.136 -16.846 -8.797  1.00 26.09  ?  27  VAL B O    1 
ATOM   3835  C  CB   . VAL B  1 27  ? -33.797 -15.396 -6.130  1.00 20.89  ?  27  VAL B CB   1 
ATOM   3836  C  CG1  . VAL B  1 27  ? -35.345 -15.264 -6.088  1.00 24.93  ?  27  VAL B CG1  1 
ATOM   3837  C  CG2  . VAL B  1 27  ? -33.233 -15.857 -4.805  1.00 26.43  ?  27  VAL B CG2  1 
ATOM   3838  H  H    . VAL B  1 27  ? -31.589 -15.544 -7.131  1.00 21.35  ?  27  VAL B H    1 
ATOM   3839  H  HA   . VAL B  1 27  ? -33.557 -17.275 -6.925  1.00 22.97  ?  27  VAL B HA   1 
ATOM   3840  H  HB   . VAL B  1 27  ? -33.427 -14.521 -6.324  1.00 25.07  ?  27  VAL B HB   1 
ATOM   3841  H  HG11 . VAL B  1 27  ? -35.590 -14.642 -5.385  1.00 29.92  ?  27  VAL B HG11 1 
ATOM   3842  H  HG12 . VAL B  1 27  ? -35.656 -14.933 -6.946  1.00 29.92  ?  27  VAL B HG12 1 
ATOM   3843  H  HG13 . VAL B  1 27  ? -35.732 -16.135 -5.909  1.00 29.92  ?  27  VAL B HG13 1 
ATOM   3844  H  HG21 . VAL B  1 27  ? -33.508 -15.236 -4.113  1.00 31.71  ?  27  VAL B HG21 1 
ATOM   3845  H  HG22 . VAL B  1 27  ? -33.573 -16.744 -4.609  1.00 31.71  ?  27  VAL B HG22 1 
ATOM   3846  H  HG23 . VAL B  1 27  ? -32.265 -15.879 -4.865  1.00 31.71  ?  27  VAL B HG23 1 
ATOM   3847  N  N    . ASN B  1 28  ? -33.731 -15.191 -9.355  1.00 19.84  ?  28  ASN B N    1 
ATOM   3848  C  CA   . ASN B  1 28  ? -34.445 -14.932 -10.605 1.00 21.54  ?  28  ASN B CA   1 
ATOM   3849  C  C    . ASN B  1 28  ? -34.097 -15.909 -11.723 1.00 24.91  ?  28  ASN B C    1 
ATOM   3850  O  O    . ASN B  1 28  ? -34.839 -15.996 -12.721 1.00 26.62  ?  28  ASN B O    1 
ATOM   3851  C  CB   . ASN B  1 28  ? -34.142 -13.525 -11.120 1.00 22.28  ?  28  ASN B CB   1 
ATOM   3852  C  CG   . ASN B  1 28  ? -34.978 -12.480 -10.445 1.00 24.98  ?  28  ASN B CG   1 
ATOM   3853  O  OD1  . ASN B  1 28  ? -36.093 -12.765 -10.026 1.00 25.17  ?  28  ASN B OD1  1 
ATOM   3854  N  ND2  . ASN B  1 28  ? -34.461 -11.265 -10.344 1.00 23.78  ?  28  ASN B ND2  1 
ATOM   3855  H  H    . ASN B  1 28  ? -33.052 -14.682 -9.217  1.00 23.81  ?  28  ASN B H    1 
ATOM   3856  H  HA   . ASN B  1 28  ? -35.399 -14.992 -10.441 1.00 25.85  ?  28  ASN B HA   1 
ATOM   3857  H  HB2  . ASN B  1 28  ? -33.209 -13.320 -10.951 1.00 26.74  ?  28  ASN B HB2  1 
ATOM   3858  H  HB3  . ASN B  1 28  ? -34.324 -13.489 -12.072 1.00 26.74  ?  28  ASN B HB3  1 
ATOM   3859  H  HD21 . ASN B  1 28  ? -34.910 -10.637 -9.963  1.00 28.54  ?  28  ASN B HD21 1 
ATOM   3860  H  HD22 . ASN B  1 28  ? -33.677 -11.103 -10.659 1.00 28.54  ?  28  ASN B HD22 1 
ATOM   3861  N  N    . ASN B  1 29  ? -32.973 -16.603 -11.630 1.00 19.68  ?  29  ASN B N    1 
ATOM   3862  C  CA   . ASN B  1 29  ? -32.500 -17.442 -12.734 1.00 22.09  ?  29  ASN B CA   1 
ATOM   3863  C  C    . ASN B  1 29  ? -32.125 -18.839 -12.261 1.00 20.43  ?  29  ASN B C    1 
ATOM   3864  O  O    . ASN B  1 29  ? -31.268 -19.489 -12.868 1.00 18.94  ?  29  ASN B O    1 
ATOM   3865  C  CB   . ASN B  1 29  ? -31.314 -16.800 -13.455 1.00 21.22  ?  29  ASN B CB   1 
ATOM   3866  C  CG   . ASN B  1 29  ? -31.648 -15.457 -14.030 1.00 26.37  ?  29  ASN B CG   1 
ATOM   3867  O  OD1  . ASN B  1 29  ? -32.217 -15.364 -15.128 1.00 27.75  ?  29  ASN B OD1  1 
ATOM   3868  N  ND2  . ASN B  1 29  ? -31.308 -14.406 -13.309 1.00 25.93  ?  29  ASN B ND2  1 
ATOM   3869  H  H    . ASN B  1 29  ? -32.461 -16.610 -10.939 1.00 23.62  ?  29  ASN B H    1 
ATOM   3870  H  HA   . ASN B  1 29  ? -33.218 -17.535 -13.379 1.00 26.51  ?  29  ASN B HA   1 
ATOM   3871  H  HB2  . ASN B  1 29  ? -30.586 -16.684 -12.824 1.00 25.46  ?  29  ASN B HB2  1 
ATOM   3872  H  HB3  . ASN B  1 29  ? -31.035 -17.377 -14.182 1.00 25.46  ?  29  ASN B HB3  1 
ATOM   3873  H  HD21 . ASN B  1 29  ? -31.479 -13.614 -13.597 1.00 31.12  ?  29  ASN B HD21 1 
ATOM   3874  H  HD22 . ASN B  1 29  ? -30.917 -14.513 -12.551 1.00 31.12  ?  29  ASN B HD22 1 
ATOM   3875  N  N    . ASP B  1 30  ? -32.772 -19.342 -11.195 1.00 18.70  ?  30  ASP B N    1 
ATOM   3876  C  CA   . ASP B  1 30  ? -32.447 -20.688 -10.751 1.00 21.65  ?  30  ASP B CA   1 
ATOM   3877  C  C    . ASP B  1 30  ? -32.729 -21.716 -11.831 1.00 19.66  ?  30  ASP B C    1 
ATOM   3878  O  O    . ASP B  1 30  ? -32.004 -22.716 -11.926 1.00 21.25  ?  30  ASP B O    1 
ATOM   3879  C  CB   . ASP B  1 30  ? -33.166 -21.053 -9.441  1.00 27.90  ?  30  ASP B CB   1 
ATOM   3880  C  CG   . ASP B  1 30  ? -34.649 -21.033 -9.538  1.00 34.36  ?  30  ASP B CG   1 
ATOM   3881  O  OD1  . ASP B  1 30  ? -35.208 -19.984 -9.912  1.00 39.27  ?  30  ASP B OD1  1 
ATOM   3882  O  OD2  . ASP B  1 30  ? -35.273 -22.077 -9.191  1.00 30.01  -1 30  ASP B OD2  1 
ATOM   3883  H  H    . ASP B  1 30  ? -33.375 -18.936 -10.737 1.00 22.44  ?  30  ASP B H    1 
ATOM   3884  H  HA   . ASP B  1 30  ? -31.494 -20.722 -10.570 1.00 25.99  ?  30  ASP B HA   1 
ATOM   3885  H  HB2  . ASP B  1 30  ? -32.899 -21.948 -9.178  1.00 33.48  ?  30  ASP B HB2  1 
ATOM   3886  H  HB3  . ASP B  1 30  ? -32.906 -20.419 -8.755  1.00 33.48  ?  30  ASP B HB3  1 
ATOM   3887  N  N    . GLU B  1 31  ? -33.726 -21.465 -12.700 1.00 22.81  ?  31  GLU B N    1 
ATOM   3888  C  CA   . GLU B  1 31  ? -33.995 -22.427 -13.765 1.00 19.56  ?  31  GLU B CA   1 
ATOM   3889  C  C    . GLU B  1 31  ? -32.854 -22.507 -14.776 1.00 18.61  ?  31  GLU B C    1 
ATOM   3890  O  O    . GLU B  1 31  ? -32.639 -23.560 -15.385 1.00 21.70  ?  31  GLU B O    1 
ATOM   3891  C  CB   . GLU B  1 31  ? -35.322 -22.122 -14.466 1.00 21.62  ?  31  GLU B CB   1 
ATOM   3892  C  CG   . GLU B  1 31  ? -35.399 -20.805 -15.248 1.00 25.66  ?  31  GLU B CG   1 
ATOM   3893  C  CD   . GLU B  1 31  ? -35.702 -19.564 -14.400 1.00 32.37  ?  31  GLU B CD   1 
ATOM   3894  O  OE1  . GLU B  1 31  ? -35.559 -19.588 -13.157 1.00 26.08  ?  31  GLU B OE1  1 
ATOM   3895  O  OE2  . GLU B  1 31  ? -36.123 -18.544 -14.996 1.00 32.38  -1 31  GLU B OE2  1 
ATOM   3896  H  H    . GLU B  1 31  ? -34.238 -20.773 -12.690 1.00 27.37  ?  31  GLU B H    1 
ATOM   3897  H  HA   . GLU B  1 31  ? -34.081 -23.306 -13.363 1.00 23.47  ?  31  GLU B HA   1 
ATOM   3898  H  HB2  . GLU B  1 31  ? -35.505 -22.839 -15.093 1.00 25.95  ?  31  GLU B HB2  1 
ATOM   3899  H  HB3  . GLU B  1 31  ? -36.021 -22.098 -13.794 1.00 25.95  ?  31  GLU B HB3  1 
ATOM   3900  H  HG2  . GLU B  1 31  ? -34.548 -20.658 -15.689 1.00 30.80  ?  31  GLU B HG2  1 
ATOM   3901  H  HG3  . GLU B  1 31  ? -36.100 -20.883 -15.914 1.00 30.80  ?  31  GLU B HG3  1 
ATOM   3902  N  N    . LEU B  1 32  ? -32.089 -21.424 -14.960 1.00 23.20  ?  32  LEU B N    1 
ATOM   3903  C  CA   . LEU B  1 32  ? -30.896 -21.520 -15.798 1.00 23.80  ?  32  LEU B CA   1 
ATOM   3904  C  C    . LEU B  1 32  ? -29.792 -22.284 -15.087 1.00 21.98  ?  32  LEU B C    1 
ATOM   3905  O  O    . LEU B  1 32  ? -29.131 -23.140 -15.687 1.00 22.80  ?  32  LEU B O    1 
ATOM   3906  C  CB   . LEU B  1 32  ? -30.394 -20.127 -16.186 1.00 25.62  ?  32  LEU B CB   1 
ATOM   3907  C  CG   . LEU B  1 32  ? -31.348 -19.198 -16.927 1.00 33.01  ?  32  LEU B CG   1 
ATOM   3908  C  CD1  . LEU B  1 32  ? -30.630 -17.896 -17.343 1.00 36.52  ?  32  LEU B CD1  1 
ATOM   3909  C  CD2  . LEU B  1 32  ? -31.954 -19.912 -18.140 1.00 33.60  ?  32  LEU B CD2  1 
ATOM   3910  H  H    . LEU B  1 32  ? -32.235 -20.647 -14.620 1.00 27.84  ?  32  LEU B H    1 
ATOM   3911  H  HA   . LEU B  1 32  ? -31.118 -21.999 -16.612 1.00 28.56  ?  32  LEU B HA   1 
ATOM   3912  H  HB2  . LEU B  1 32  ? -30.130 -19.669 -15.372 1.00 30.75  ?  32  LEU B HB2  1 
ATOM   3913  H  HB3  . LEU B  1 32  ? -29.614 -20.239 -16.752 1.00 30.75  ?  32  LEU B HB3  1 
ATOM   3914  H  HG   . LEU B  1 32  ? -32.075 -18.958 -16.331 1.00 39.61  ?  32  LEU B HG   1 
ATOM   3915  H  HD11 . LEU B  1 32  ? -31.258 -17.325 -17.811 1.00 43.82  ?  32  LEU B HD11 1 
ATOM   3916  H  HD12 . LEU B  1 32  ? -30.304 -17.448 -16.547 1.00 43.82  ?  32  LEU B HD12 1 
ATOM   3917  H  HD13 . LEU B  1 32  ? -29.887 -18.119 -17.925 1.00 43.82  ?  32  LEU B HD13 1 
ATOM   3918  H  HD21 . LEU B  1 32  ? -32.556 -19.303 -18.595 1.00 40.32  ?  32  LEU B HD21 1 
ATOM   3919  H  HD22 . LEU B  1 32  ? -31.238 -20.178 -18.738 1.00 40.32  ?  32  LEU B HD22 1 
ATOM   3920  H  HD23 . LEU B  1 32  ? -32.440 -20.694 -17.835 1.00 40.32  ?  32  LEU B HD23 1 
ATOM   3921  N  N    . LEU B  1 33  ? -29.564 -21.988 -13.800 1.00 22.51  ?  33  LEU B N    1 
ATOM   3922  C  CA   . LEU B  1 33  ? -28.513 -22.696 -13.091 1.00 19.15  ?  33  LEU B CA   1 
ATOM   3923  C  C    . LEU B  1 33  ? -28.798 -24.188 -13.035 1.00 22.13  ?  33  LEU B C    1 
ATOM   3924  O  O    . LEU B  1 33  ? -27.869 -25.003 -13.080 1.00 24.18  ?  33  LEU B O    1 
ATOM   3925  C  CB   . LEU B  1 33  ? -28.362 -22.115 -11.682 1.00 21.79  ?  33  LEU B CB   1 
ATOM   3926  C  CG   . LEU B  1 33  ? -27.747 -20.715 -11.604 1.00 23.46  ?  33  LEU B CG   1 
ATOM   3927  C  CD1  . LEU B  1 33  ? -28.038 -20.056 -10.228 1.00 24.45  ?  33  LEU B CD1  1 
ATOM   3928  C  CD2  . LEU B  1 33  ? -26.245 -20.757 -11.858 1.00 23.27  ?  33  LEU B CD2  1 
ATOM   3929  H  H    . LEU B  1 33  ? -29.991 -21.403 -13.336 1.00 27.01  ?  33  LEU B H    1 
ATOM   3930  H  HA   . LEU B  1 33  ? -27.673 -22.567 -13.560 1.00 22.97  ?  33  LEU B HA   1 
ATOM   3931  H  HB2  . LEU B  1 33  ? -29.242 -22.068 -11.274 1.00 26.15  ?  33  LEU B HB2  1 
ATOM   3932  H  HB3  . LEU B  1 33  ? -27.798 -22.710 -11.164 1.00 26.15  ?  33  LEU B HB3  1 
ATOM   3933  H  HG   . LEU B  1 33  ? -28.148 -20.159 -12.289 1.00 28.16  ?  33  LEU B HG   1 
ATOM   3934  H  HD11 . LEU B  1 33  ? -27.636 -19.174 -10.209 1.00 29.34  ?  33  LEU B HD11 1 
ATOM   3935  H  HD12 . LEU B  1 33  ? -28.998 -19.986 -10.109 1.00 29.34  ?  33  LEU B HD12 1 
ATOM   3936  H  HD13 . LEU B  1 33  ? -27.657 -20.608 -9.527  1.00 29.34  ?  33  LEU B HD13 1 
ATOM   3937  H  HD21 . LEU B  1 33  ? -25.891 -19.855 -11.801 1.00 27.92  ?  33  LEU B HD21 1 
ATOM   3938  H  HD22 . LEU B  1 33  ? -25.827 -21.320 -11.188 1.00 27.92  ?  33  LEU B HD22 1 
ATOM   3939  H  HD23 . LEU B  1 33  ? -26.085 -21.120 -12.743 1.00 27.92  ?  33  LEU B HD23 1 
ATOM   3940  N  N    . VAL B  1 34  ? -30.079 -24.562 -12.945 1.00 22.50  ?  34  VAL B N    1 
ATOM   3941  C  CA   . VAL B  1 34  ? -30.455 -25.967 -12.844 1.00 24.82  ?  34  VAL B CA   1 
ATOM   3942  C  C    . VAL B  1 34  ? -30.510 -26.623 -14.217 1.00 24.60  ?  34  VAL B C    1 
ATOM   3943  O  O    . VAL B  1 34  ? -29.959 -27.711 -14.415 1.00 28.86  ?  34  VAL B O    1 
ATOM   3944  C  CB   . VAL B  1 34  ? -31.805 -26.104 -12.112 1.00 27.14  ?  34  VAL B CB   1 
ATOM   3945  C  CG1  . VAL B  1 34  ? -32.316 -27.556 -12.193 1.00 32.17  ?  34  VAL B CG1  1 
ATOM   3946  C  CG2  . VAL B  1 34  ? -31.679 -25.655 -10.667 1.00 26.53  ?  34  VAL B CG2  1 
ATOM   3947  H  H    . VAL B  1 34  ? -30.745 -24.018 -12.940 1.00 26.99  ?  34  VAL B H    1 
ATOM   3948  H  HA   . VAL B  1 34  ? -29.785 -26.433 -12.320 1.00 29.79  ?  34  VAL B HA   1 
ATOM   3949  H  HB   . VAL B  1 34  ? -32.458 -25.533 -12.546 1.00 32.57  ?  34  VAL B HB   1 
ATOM   3950  H  HG11 . VAL B  1 34  ? -33.165 -27.618 -11.727 1.00 38.60  ?  34  VAL B HG11 1 
ATOM   3951  H  HG12 . VAL B  1 34  ? -32.433 -27.797 -13.125 1.00 38.60  ?  34  VAL B HG12 1 
ATOM   3952  H  HG13 . VAL B  1 34  ? -31.666 -28.143 -11.778 1.00 38.60  ?  34  VAL B HG13 1 
ATOM   3953  H  HG21 . VAL B  1 34  ? -32.540 -25.752 -10.231 1.00 31.84  ?  34  VAL B HG21 1 
ATOM   3954  H  HG22 . VAL B  1 34  ? -31.018 -26.208 -10.221 1.00 31.84  ?  34  VAL B HG22 1 
ATOM   3955  H  HG23 . VAL B  1 34  ? -31.401 -24.726 -10.648 1.00 31.84  ?  34  VAL B HG23 1 
ATOM   3956  N  N    . SER B  1 35  ? -31.213 -25.999 -15.174 1.00 24.26  ?  35  SER B N    1 
ATOM   3957  C  CA   . SER B  1 35  ? -31.600 -26.693 -16.398 1.00 27.02  ?  35  SER B CA   1 
ATOM   3958  C  C    . SER B  1 35  ? -30.968 -26.138 -17.664 1.00 33.42  ?  35  SER B C    1 
ATOM   3959  O  O    . SER B  1 35  ? -31.140 -26.747 -18.724 1.00 31.97  ?  35  SER B O    1 
ATOM   3960  C  CB   . SER B  1 35  ? -33.130 -26.679 -16.551 1.00 28.90  ?  35  SER B CB   1 
ATOM   3961  O  OG   . SER B  1 35  ? -33.722 -27.352 -15.458 1.00 33.35  ?  35  SER B OG   1 
ATOM   3962  H  H    . SER B  1 35  ? -31.474 -25.181 -15.133 1.00 29.12  ?  35  SER B H    1 
ATOM   3963  H  HA   . SER B  1 35  ? -31.326 -27.620 -16.321 1.00 32.42  ?  35  SER B HA   1 
ATOM   3964  H  HB2  . SER B  1 35  ? -33.441 -25.760 -16.568 1.00 34.68  ?  35  SER B HB2  1 
ATOM   3965  H  HB3  . SER B  1 35  ? -33.373 -27.131 -17.375 1.00 34.68  ?  35  SER B HB3  1 
ATOM   3966  H  HG   . SER B  1 35  ? -34.558 -27.348 -15.537 1.00 40.02  ?  35  SER B HG   1 
ATOM   3967  N  N    . ASP B  1 36  ? -30.233 -25.022 -17.592 1.00 26.02  ?  36  ASP B N    1 
ATOM   3968  C  CA   . ASP B  1 36  ? -29.487 -24.505 -18.739 1.00 26.05  ?  36  ASP B CA   1 
ATOM   3969  C  C    . ASP B  1 36  ? -28.196 -23.852 -18.250 1.00 26.07  ?  36  ASP B C    1 
ATOM   3970  O  O    . ASP B  1 36  ? -27.948 -22.663 -18.478 1.00 23.12  ?  36  ASP B O    1 
ATOM   3971  C  CB   . ASP B  1 36  ? -30.374 -23.539 -19.528 1.00 26.40  ?  36  ASP B CB   1 
ATOM   3972  C  CG   . ASP B  1 36  ? -29.880 -23.299 -20.932 1.00 37.69  ?  36  ASP B CG   1 
ATOM   3973  O  OD1  . ASP B  1 36  ? -28.870 -23.918 -21.342 1.00 30.20  ?  36  ASP B OD1  1 
ATOM   3974  O  OD2  . ASP B  1 36  ? -30.535 -22.489 -21.627 1.00 38.82  -1 36  ASP B OD2  1 
ATOM   3975  H  H    . ASP B  1 36  ? -30.151 -24.544 -16.882 1.00 31.23  ?  36  ASP B H    1 
ATOM   3976  H  HA   . ASP B  1 36  ? -29.250 -25.242 -19.323 1.00 31.26  ?  36  ASP B HA   1 
ATOM   3977  H  HB2  . ASP B  1 36  ? -31.269 -23.907 -19.584 1.00 31.68  ?  36  ASP B HB2  1 
ATOM   3978  H  HB3  . ASP B  1 36  ? -30.396 -22.684 -19.069 1.00 31.68  ?  36  ASP B HB3  1 
ATOM   3979  N  N    . PRO B  1 37  ? -27.327 -24.629 -17.579 1.00 23.80  ?  37  PRO B N    1 
ATOM   3980  C  CA   . PRO B  1 37  ? -26.191 -24.015 -16.885 1.00 29.04  ?  37  PRO B CA   1 
ATOM   3981  C  C    . PRO B  1 37  ? -25.205 -23.340 -17.829 1.00 29.37  ?  37  PRO B C    1 
ATOM   3982  O  O    . PRO B  1 37  ? -24.551 -22.370 -17.436 1.00 26.60  ?  37  PRO B O    1 
ATOM   3983  C  CB   . PRO B  1 37  ? -25.567 -25.207 -16.125 1.00 26.48  ?  37  PRO B CB   1 
ATOM   3984  C  CG   . PRO B  1 37  ? -26.035 -26.426 -16.855 1.00 28.72  ?  37  PRO B CG   1 
ATOM   3985  C  CD   . PRO B  1 37  ? -27.430 -26.068 -17.290 1.00 29.26  ?  37  PRO B CD   1 
ATOM   3986  H  HA   . PRO B  1 37  ? -26.509 -23.363 -16.242 1.00 34.85  ?  37  PRO B HA   1 
ATOM   3987  H  HB2  . PRO B  1 37  ? -24.599 -25.142 -16.152 1.00 31.77  ?  37  PRO B HB2  1 
ATOM   3988  H  HB3  . PRO B  1 37  ? -25.885 -25.213 -15.208 1.00 31.77  ?  37  PRO B HB3  1 
ATOM   3989  H  HG2  . PRO B  1 37  ? -25.464 -26.592 -17.622 1.00 34.47  ?  37  PRO B HG2  1 
ATOM   3990  H  HG3  . PRO B  1 37  ? -26.043 -27.189 -16.256 1.00 34.47  ?  37  PRO B HG3  1 
ATOM   3991  H  HD2  . PRO B  1 37  ? -27.672 -26.559 -18.091 1.00 35.11  ?  37  PRO B HD2  1 
ATOM   3992  H  HD3  . PRO B  1 37  ? -28.060 -26.225 -16.570 1.00 35.11  ?  37  PRO B HD3  1 
ATOM   3993  N  N    . ASN B  1 38  ? -25.134 -23.782 -19.082 1.00 26.49  ?  38  ASN B N    1 
ATOM   3994  C  CA   . ASN B  1 38  ? -24.219 -23.183 -20.045 1.00 30.59  ?  38  ASN B CA   1 
ATOM   3995  C  C    . ASN B  1 38  ? -24.570 -21.741 -20.370 1.00 31.98  ?  38  ASN B C    1 
ATOM   3996  O  O    . ASN B  1 38  ? -23.695 -20.993 -20.847 1.00 29.02  ?  38  ASN B O    1 
ATOM   3997  C  CB   . ASN B  1 38  ? -24.228 -24.016 -21.329 1.00 34.00  ?  38  ASN B CB   1 
ATOM   3998  C  CG   . ASN B  1 38  ? -23.593 -25.373 -21.138 1.00 39.35  ?  38  ASN B CG   1 
ATOM   3999  O  OD1  . ASN B  1 38  ? -22.563 -25.492 -20.477 1.00 32.84  ?  38  ASN B OD1  1 
ATOM   4000  N  ND2  . ASN B  1 38  ? -24.198 -26.404 -21.730 1.00 36.26  ?  38  ASN B ND2  1 
ATOM   4001  H  H    . ASN B  1 38  ? -25.607 -24.428 -19.398 1.00 31.79  ?  38  ASN B H    1 
ATOM   4002  H  HA   . ASN B  1 38  ? -23.320 -23.200 -19.681 1.00 36.71  ?  38  ASN B HA   1 
ATOM   4003  H  HB2  . ASN B  1 38  ? -25.146 -24.151 -21.613 1.00 40.80  ?  38  ASN B HB2  1 
ATOM   4004  H  HB3  . ASN B  1 38  ? -23.732 -23.545 -22.016 1.00 40.80  ?  38  ASN B HB3  1 
ATOM   4005  H  HD21 . ASN B  1 38  ? -23.873 -27.197 -21.650 1.00 43.52  ?  38  ASN B HD21 1 
ATOM   4006  H  HD22 . ASN B  1 38  ? -24.913 -26.277 -22.190 1.00 43.52  ?  38  ASN B HD22 1 
ATOM   4007  N  N    . LYS B  1 39  ? -25.824 -21.345 -20.143 1.00 28.24  ?  39  LYS B N    1 
ATOM   4008  C  CA   . LYS B  1 39  ? -26.275 -19.978 -20.357 1.00 29.85  ?  39  LYS B CA   1 
ATOM   4009  C  C    . LYS B  1 39  ? -26.288 -19.157 -19.085 1.00 34.50  ?  39  LYS B C    1 
ATOM   4010  O  O    . LYS B  1 39  ? -26.538 -17.948 -19.155 1.00 34.66  ?  39  LYS B O    1 
ATOM   4011  C  CB   . LYS B  1 39  ? -27.689 -19.960 -20.961 1.00 28.91  ?  39  LYS B CB   1 
ATOM   4012  C  CG   . LYS B  1 39  ? -27.795 -20.612 -22.327 1.00 42.58  ?  39  LYS B CG   1 
ATOM   4013  C  CD   . LYS B  1 39  ? -26.840 -19.988 -23.333 1.00 42.06  ?  39  LYS B CD   1 
ATOM   4014  C  CE   . LYS B  1 39  ? -26.901 -20.728 -24.666 1.00 57.12  ?  39  LYS B CE   1 
ATOM   4015  N  NZ   . LYS B  1 39  ? -28.298 -20.803 -25.167 1.00 60.90  1  39  LYS B NZ   1 
ATOM   4016  H  H    . LYS B  1 39  ? -26.444 -21.868 -19.858 1.00 33.89  ?  39  LYS B H    1 
ATOM   4017  H  HA   . LYS B  1 39  ? -25.676 -19.545 -20.986 1.00 35.83  ?  39  LYS B HA   1 
ATOM   4018  H  HB2  . LYS B  1 39  ? -28.288 -20.431 -20.361 1.00 34.69  ?  39  LYS B HB2  1 
ATOM   4019  H  HB3  . LYS B  1 39  ? -27.975 -19.038 -21.051 1.00 34.69  ?  39  LYS B HB3  1 
ATOM   4020  H  HG2  . LYS B  1 39  ? -27.577 -21.554 -22.247 1.00 51.10  ?  39  LYS B HG2  1 
ATOM   4021  H  HG3  . LYS B  1 39  ? -28.699 -20.505 -22.661 1.00 51.10  ?  39  LYS B HG3  1 
ATOM   4022  H  HD2  . LYS B  1 39  ? -27.090 -19.063 -23.485 1.00 50.48  ?  39  LYS B HD2  1 
ATOM   4023  H  HD3  . LYS B  1 39  ? -25.933 -20.042 -22.994 1.00 50.48  ?  39  LYS B HD3  1 
ATOM   4024  H  HE2  . LYS B  1 39  ? -26.366 -20.254 -25.321 1.00 68.54  ?  39  LYS B HE2  1 
ATOM   4025  H  HE3  . LYS B  1 39  ? -26.569 -21.631 -24.548 1.00 68.54  ?  39  LYS B HE3  1 
ATOM   4026  H  HZ1  . LYS B  1 39  ? -28.318 -21.237 -25.944 1.00 73.08  ?  39  LYS B HZ1  1 
ATOM   4027  H  HZ2  . LYS B  1 39  ? -28.808 -21.236 -24.581 1.00 73.08  ?  39  LYS B HZ2  1 
ATOM   4028  H  HZ3  . LYS B  1 39  ? -28.623 -19.983 -25.285 1.00 73.08  ?  39  LYS B HZ3  1 
ATOM   4029  N  N    . ALA B  1 40  ? -26.062 -19.783 -17.934 1.00 26.00  ?  40  ALA B N    1 
ATOM   4030  C  CA   . ALA B  1 40  ? -26.036 -19.034 -16.692 1.00 29.81  ?  40  ALA B CA   1 
ATOM   4031  C  C    . ALA B  1 40  ? -24.790 -18.152 -16.624 1.00 30.85  ?  40  ALA B C    1 
ATOM   4032  O  O    . ALA B  1 40  ? -23.723 -18.481 -17.151 1.00 26.76  ?  40  ALA B O    1 
ATOM   4033  C  CB   . ALA B  1 40  ? -26.075 -19.993 -15.506 1.00 29.20  ?  40  ALA B CB   1 
ATOM   4034  H  H    . ALA B  1 40  ? -25.923 -20.627 -17.849 1.00 31.21  ?  40  ALA B H    1 
ATOM   4035  H  HA   . ALA B  1 40  ? -26.817 -18.461 -16.646 1.00 35.77  ?  40  ALA B HA   1 
ATOM   4036  H  HB1  . ALA B  1 40  ? -26.057 -19.479 -14.684 1.00 35.04  ?  40  ALA B HB1  1 
ATOM   4037  H  HB2  . ALA B  1 40  ? -26.889 -20.518 -15.551 1.00 35.04  ?  40  ALA B HB2  1 
ATOM   4038  H  HB3  . ALA B  1 40  ? -25.302 -20.578 -15.548 1.00 35.04  ?  40  ALA B HB3  1 
ATOM   4039  N  N    . ASN B  1 41  ? -24.933 -17.021 -15.952 1.00 26.27  ?  41  ASN B N    1 
ATOM   4040  C  CA   . ASN B  1 41  ? -23.784 -16.213 -15.587 1.00 27.71  ?  41  ASN B CA   1 
ATOM   4041  C  C    . ASN B  1 41  ? -22.642 -17.064 -15.006 1.00 25.03  ?  41  ASN B C    1 
ATOM   4042  O  O    . ASN B  1 41  ? -22.875 -17.911 -14.141 1.00 22.39  ?  41  ASN B O    1 
ATOM   4043  C  CB   . ASN B  1 41  ? -24.248 -15.195 -14.551 1.00 31.18  ?  41  ASN B CB   1 
ATOM   4044  C  CG   . ASN B  1 41  ? -23.150 -14.320 -14.120 1.00 29.69  ?  41  ASN B CG   1 
ATOM   4045  O  OD1  . ASN B  1 41  ? -22.415 -14.636 -13.169 1.00 27.44  ?  41  ASN B OD1  1 
ATOM   4046  N  ND2  . ASN B  1 41  ? -22.990 -13.213 -14.815 1.00 32.55  ?  41  ASN B ND2  1 
ATOM   4047  H  H    . ASN B  1 41  ? -25.688 -16.699 -15.695 1.00 31.52  ?  41  ASN B H    1 
ATOM   4048  H  HA   . ASN B  1 41  ? -23.455 -15.739 -16.366 1.00 33.26  ?  41  ASN B HA   1 
ATOM   4049  H  HB2  . ASN B  1 41  ? -24.943 -14.640 -14.938 1.00 37.41  ?  41  ASN B HB2  1 
ATOM   4050  H  HB3  . ASN B  1 41  ? -24.587 -15.663 -13.772 1.00 37.41  ?  41  ASN B HB3  1 
ATOM   4051  H  HD21 . ASN B  1 41  ? -22.362 -12.662 -14.608 1.00 39.06  ?  41  ASN B HD21 1 
ATOM   4052  H  HD22 . ASN B  1 41  ? -23.512 -13.041 -15.476 1.00 39.06  ?  41  ASN B HD22 1 
ATOM   4053  N  N    . SER B  1 42  ? -21.398 -16.821 -15.463 1.00 25.60  ?  42  SER B N    1 
ATOM   4054  C  CA   . SER B  1 42  ? -20.270 -17.691 -15.095 1.00 24.12  ?  42  SER B CA   1 
ATOM   4055  C  C    . SER B  1 42  ? -19.934 -17.627 -13.614 1.00 22.52  ?  42  SER B C    1 
ATOM   4056  O  O    . SER B  1 42  ? -19.529 -18.628 -13.031 1.00 22.69  ?  42  SER B O    1 
ATOM   4057  C  CB   . SER B  1 42  ? -19.004 -17.334 -15.886 1.00 28.42  ?  42  SER B CB   1 
ATOM   4058  O  OG   . SER B  1 42  ? -19.053 -17.905 -17.183 1.00 54.25  ?  42  SER B OG   1 
ATOM   4059  H  H    . SER B  1 42  ? -21.187 -16.168 -15.981 1.00 30.72  ?  42  SER B H    1 
ATOM   4060  H  HA   . SER B  1 42  ? -20.502 -18.609 -15.306 1.00 28.94  ?  42  SER B HA   1 
ATOM   4061  H  HB2  . SER B  1 42  ? -18.943 -16.369 -15.967 1.00 34.10  ?  42  SER B HB2  1 
ATOM   4062  H  HB3  . SER B  1 42  ? -18.229 -17.678 -15.417 1.00 34.10  ?  42  SER B HB3  1 
ATOM   4063  H  HG   . SER B  1 42  ? -19.108 -18.741 -17.127 1.00 65.09  ?  42  SER B HG   1 
ATOM   4064  N  N    . PHE B  1 43  ? -20.041 -16.446 -13.005 1.00 23.30  ?  43  PHE B N    1 
ATOM   4065  C  CA   . PHE B  1 43  ? -19.788 -16.305 -11.574 1.00 21.08  ?  43  PHE B CA   1 
ATOM   4066  C  C    . PHE B  1 43  ? -20.831 -17.074 -10.773 1.00 20.88  ?  43  PHE B C    1 
ATOM   4067  O  O    . PHE B  1 43  ? -20.493 -17.907 -9.928  1.00 20.30  ?  43  PHE B O    1 
ATOM   4068  C  CB   . PHE B  1 43  ? -19.763 -14.795 -11.260 1.00 26.30  ?  43  PHE B CB   1 
ATOM   4069  C  CG   . PHE B  1 43  ? -19.584 -14.414 -9.801  1.00 21.63  ?  43  PHE B CG   1 
ATOM   4070  C  CD1  . PHE B  1 43  ? -19.024 -15.257 -8.863  1.00 23.72  ?  43  PHE B CD1  1 
ATOM   4071  C  CD2  . PHE B  1 43  ? -19.976 -13.146 -9.406  1.00 22.98  ?  43  PHE B CD2  1 
ATOM   4072  C  CE1  . PHE B  1 43  ? -18.856 -14.842 -7.535  1.00 23.46  ?  43  PHE B CE1  1 
ATOM   4073  C  CE2  . PHE B  1 43  ? -19.837 -12.736 -8.070  1.00 24.13  ?  43  PHE B CE2  1 
ATOM   4074  C  CZ   . PHE B  1 43  ? -19.260 -13.583 -7.154  1.00 21.36  ?  43  PHE B CZ   1 
ATOM   4075  H  H    . PHE B  1 43  ? -20.258 -15.713 -13.398 1.00 27.96  ?  43  PHE B H    1 
ATOM   4076  H  HA   . PHE B  1 43  ? -18.915 -16.673 -11.366 1.00 25.30  ?  43  PHE B HA   1 
ATOM   4077  H  HB2  . PHE B  1 43  ? -19.032 -14.394 -11.755 1.00 31.56  ?  43  PHE B HB2  1 
ATOM   4078  H  HB3  . PHE B  1 43  ? -20.602 -14.409 -11.558 1.00 31.56  ?  43  PHE B HB3  1 
ATOM   4079  H  HD1  . PHE B  1 43  ? -18.742 -16.106 -9.118  1.00 28.47  ?  43  PHE B HD1  1 
ATOM   4080  H  HD2  . PHE B  1 43  ? -20.360 -12.569 -10.027 1.00 27.57  ?  43  PHE B HD2  1 
ATOM   4081  H  HE1  . PHE B  1 43  ? -18.482 -15.420 -6.910  1.00 28.16  ?  43  PHE B HE1  1 
ATOM   4082  H  HE2  . PHE B  1 43  ? -20.102 -11.882 -7.814  1.00 28.96  ?  43  PHE B HE2  1 
ATOM   4083  H  HZ   . PHE B  1 43  ? -19.163 -13.312 -6.269  1.00 25.63  ?  43  PHE B HZ   1 
ATOM   4084  N  N    . ALA B  1 44  ? -22.112 -16.869 -11.081 1.00 18.89  ?  44  ALA B N    1 
ATOM   4085  C  CA   . ALA B  1 44  ? -23.169 -17.634 -10.420 1.00 19.45  ?  44  ALA B CA   1 
ATOM   4086  C  C    . ALA B  1 44  ? -23.012 -19.132 -10.649 1.00 19.63  ?  44  ALA B C    1 
ATOM   4087  O  O    . ALA B  1 44  ? -23.208 -19.934 -9.737  1.00 20.88  ?  44  ALA B O    1 
ATOM   4088  C  CB   . ALA B  1 44  ? -24.539 -17.178 -10.921 1.00 19.91  ?  44  ALA B CB   1 
ATOM   4089  H  H    . ALA B  1 44  ? -22.393 -16.300 -11.661 1.00 22.66  ?  44  ALA B H    1 
ATOM   4090  H  HA   . ALA B  1 44  ? -23.128 -17.470 -9.465  1.00 23.34  ?  44  ALA B HA   1 
ATOM   4091  H  HB1  . ALA B  1 44  ? -25.227 -17.695 -10.473 1.00 23.90  ?  44  ALA B HB1  1 
ATOM   4092  H  HB2  . ALA B  1 44  ? -24.650 -16.235 -10.721 1.00 23.90  ?  44  ALA B HB2  1 
ATOM   4093  H  HB3  . ALA B  1 44  ? -24.588 -17.321 -11.879 1.00 23.90  ?  44  ALA B HB3  1 
ATOM   4094  N  N    . ALA B  1 45  ? -22.699 -19.537 -11.873 1.00 20.90  ?  45  ALA B N    1 
ATOM   4095  C  CA   . ALA B  1 45  ? -22.627 -20.971 -12.145 1.00 21.64  ?  45  ALA B CA   1 
ATOM   4096  C  C    . ALA B  1 45  ? -21.528 -21.630 -11.323 1.00 21.51  ?  45  ALA B C    1 
ATOM   4097  O  O    . ALA B  1 45  ? -21.689 -22.745 -10.807 1.00 22.91  ?  45  ALA B O    1 
ATOM   4098  C  CB   . ALA B  1 45  ? -22.394 -21.182 -13.638 1.00 21.42  ?  45  ALA B CB   1 
ATOM   4099  H  H    . ALA B  1 45  ? -22.530 -19.026 -12.543 1.00 25.09  ?  45  ALA B H    1 
ATOM   4100  H  HA   . ALA B  1 45  ? -23.472 -21.384 -11.908 1.00 25.97  ?  45  ALA B HA   1 
ATOM   4101  H  HB1  . ALA B  1 45  ? -22.346 -22.134 -13.818 1.00 25.70  ?  45  ALA B HB1  1 
ATOM   4102  H  HB2  . ALA B  1 45  ? -23.131 -20.788 -14.131 1.00 25.70  ?  45  ALA B HB2  1 
ATOM   4103  H  HB3  . ALA B  1 45  ? -21.561 -20.755 -13.890 1.00 25.70  ?  45  ALA B HB3  1 
ATOM   4104  N  N    . TYR B  1 46  ? -20.385 -20.955 -11.203 1.00 20.65  ?  46  TYR B N    1 
ATOM   4105  C  CA   . TYR B  1 46  ? -19.289 -21.490 -10.409 1.00 21.66  ?  46  TYR B CA   1 
ATOM   4106  C  C    . TYR B  1 46  ? -19.638 -21.563 -8.923  1.00 20.03  ?  46  TYR B C    1 
ATOM   4107  O  O    . TYR B  1 46  ? -19.421 -22.591 -8.273  1.00 23.51  ?  46  TYR B O    1 
ATOM   4108  C  CB   . TYR B  1 46  ? -18.053 -20.630 -10.652 1.00 20.16  ?  46  TYR B CB   1 
ATOM   4109  C  CG   . TYR B  1 46  ? -16.814 -21.151 -9.993  1.00 24.28  ?  46  TYR B CG   1 
ATOM   4110  C  CD1  . TYR B  1 46  ? -16.172 -22.272 -10.495 1.00 31.72  ?  46  TYR B CD1  1 
ATOM   4111  C  CD2  . TYR B  1 46  ? -16.271 -20.522 -8.882  1.00 28.67  ?  46  TYR B CD2  1 
ATOM   4112  C  CE1  . TYR B  1 46  ? -15.028 -22.759 -9.916  1.00 33.52  ?  46  TYR B CE1  1 
ATOM   4113  C  CE2  . TYR B  1 46  ? -15.122 -21.012 -8.286  1.00 33.38  ?  46  TYR B CE2  1 
ATOM   4114  C  CZ   . TYR B  1 46  ? -14.506 -22.132 -8.815  1.00 39.57  ?  46  TYR B CZ   1 
ATOM   4115  O  OH   . TYR B  1 46  ? -13.350 -22.636 -8.257  1.00 39.58  ?  46  TYR B OH   1 
ATOM   4116  H  H    . TYR B  1 46  ? -20.224 -20.194 -11.568 1.00 24.78  ?  46  TYR B H    1 
ATOM   4117  H  HA   . TYR B  1 46  ? -19.090 -22.389 -10.713 1.00 25.99  ?  46  TYR B HA   1 
ATOM   4118  H  HB2  . TYR B  1 46  ? -17.885 -20.587 -11.607 1.00 24.19  ?  46  TYR B HB2  1 
ATOM   4119  H  HB3  . TYR B  1 46  ? -18.220 -19.739 -10.307 1.00 24.19  ?  46  TYR B HB3  1 
ATOM   4120  H  HD1  . TYR B  1 46  ? -16.521 -22.700 -11.243 1.00 38.07  ?  46  TYR B HD1  1 
ATOM   4121  H  HD2  . TYR B  1 46  ? -16.687 -19.769 -8.530  1.00 34.40  ?  46  TYR B HD2  1 
ATOM   4122  H  HE1  . TYR B  1 46  ? -14.610 -23.512 -10.267 1.00 40.22  ?  46  TYR B HE1  1 
ATOM   4123  H  HE2  . TYR B  1 46  ? -14.761 -20.585 -7.543  1.00 40.05  ?  46  TYR B HE2  1 
ATOM   4124  H  HH   . TYR B  1 46  ? -13.126 -22.173 -7.592  1.00 47.49  ?  46  TYR B HH   1 
ATOM   4125  N  N    . VAL B  1 47  ? -20.210 -20.488 -8.368  1.00 21.40  ?  47  VAL B N    1 
ATOM   4126  C  CA   . VAL B  1 47  ? -20.548 -20.465 -6.944  1.00 24.15  ?  47  VAL B CA   1 
ATOM   4127  C  C    . VAL B  1 47  ? -21.540 -21.563 -6.593  1.00 26.31  ?  47  VAL B C    1 
ATOM   4128  O  O    . VAL B  1 47  ? -21.432 -22.199 -5.539  1.00 24.61  ?  47  VAL B O    1 
ATOM   4129  C  CB   . VAL B  1 47  ? -21.095 -19.080 -6.561  1.00 22.84  ?  47  VAL B CB   1 
ATOM   4130  C  CG1  . VAL B  1 47  ? -21.882 -19.117 -5.222  1.00 23.53  ?  47  VAL B CG1  1 
ATOM   4131  C  CG2  . VAL B  1 47  ? -19.929 -18.112 -6.508  1.00 23.74  ?  47  VAL B CG2  1 
ATOM   4132  H  H    . VAL B  1 47  ? -20.409 -19.767 -8.791  1.00 25.68  ?  47  VAL B H    1 
ATOM   4133  H  HA   . VAL B  1 47  ? -19.741 -20.619 -6.429  1.00 28.98  ?  47  VAL B HA   1 
ATOM   4134  H  HB   . VAL B  1 47  ? -21.701 -18.778 -7.255  1.00 27.41  ?  47  VAL B HB   1 
ATOM   4135  H  HG11 . VAL B  1 47  ? -22.206 -18.225 -5.022  1.00 28.24  ?  47  VAL B HG11 1 
ATOM   4136  H  HG12 . VAL B  1 47  ? -22.630 -19.728 -5.313  1.00 28.24  ?  47  VAL B HG12 1 
ATOM   4137  H  HG13 . VAL B  1 47  ? -21.290 -19.420 -4.516  1.00 28.24  ?  47  VAL B HG13 1 
ATOM   4138  H  HG21 . VAL B  1 47  ? -20.260 -17.232 -6.267  1.00 28.49  ?  47  VAL B HG21 1 
ATOM   4139  H  HG22 . VAL B  1 47  ? -19.293 -18.420 -5.844  1.00 28.49  ?  47  VAL B HG22 1 
ATOM   4140  H  HG23 . VAL B  1 47  ? -19.507 -18.079 -7.381  1.00 28.49  ?  47  VAL B HG23 1 
ATOM   4141  N  N    . PHE B  1 48  ? -22.544 -21.779 -7.445  1.00 20.52  ?  48  PHE B N    1 
ATOM   4142  C  CA   . PHE B  1 48  ? -23.619 -22.705 -7.136  1.00 21.93  ?  48  PHE B CA   1 
ATOM   4143  C  C    . PHE B  1 48  ? -23.346 -24.118 -7.645  1.00 23.82  ?  48  PHE B C    1 
ATOM   4144  O  O    . PHE B  1 48  ? -24.258 -24.950 -7.598  1.00 25.92  ?  48  PHE B O    1 
ATOM   4145  C  CB   . PHE B  1 48  ? -24.960 -22.163 -7.669  1.00 21.16  ?  48  PHE B CB   1 
ATOM   4146  C  CG   . PHE B  1 48  ? -25.526 -21.063 -6.813  1.00 18.14  ?  48  PHE B CG   1 
ATOM   4147  C  CD1  . PHE B  1 48  ? -26.355 -21.365 -5.737  1.00 23.86  ?  48  PHE B CD1  1 
ATOM   4148  C  CD2  . PHE B  1 48  ? -25.196 -19.736 -7.044  1.00 20.58  ?  48  PHE B CD2  1 
ATOM   4149  C  CE1  . PHE B  1 48  ? -26.830 -20.365 -4.926  1.00 22.16  ?  48  PHE B CE1  1 
ATOM   4150  C  CE2  . PHE B  1 48  ? -25.680 -18.728 -6.215  1.00 21.30  ?  48  PHE B CE2  1 
ATOM   4151  C  CZ   . PHE B  1 48  ? -26.489 -19.052 -5.149  1.00 19.53  ?  48  PHE B CZ   1 
ATOM   4152  H  H    . PHE B  1 48  ? -22.620 -21.397 -8.212  1.00 24.63  ?  48  PHE B H    1 
ATOM   4153  H  HA   . PHE B  1 48  ? -23.698 -22.762 -6.171  1.00 26.32  ?  48  PHE B HA   1 
ATOM   4154  H  HB2  . PHE B  1 48  ? -24.826 -21.809 -8.562  1.00 25.40  ?  48  PHE B HB2  1 
ATOM   4155  H  HB3  . PHE B  1 48  ? -25.606 -22.887 -7.692  1.00 25.40  ?  48  PHE B HB3  1 
ATOM   4156  H  HD1  . PHE B  1 48  ? -26.576 -22.250 -5.558  1.00 28.63  ?  48  PHE B HD1  1 
ATOM   4157  H  HD2  . PHE B  1 48  ? -24.631 -19.520 -7.750  1.00 24.70  ?  48  PHE B HD2  1 
ATOM   4158  H  HE1  . PHE B  1 48  ? -27.385 -20.579 -4.211  1.00 26.59  ?  48  PHE B HE1  1 
ATOM   4159  H  HE2  . PHE B  1 48  ? -25.456 -17.840 -6.380  1.00 25.56  ?  48  PHE B HE2  1 
ATOM   4160  H  HZ   . PHE B  1 48  ? -26.837 -18.381 -4.607  1.00 23.43  ?  48  PHE B HZ   1 
ATOM   4161  N  N    . GLY B  1 49  ? -22.119 -24.398 -8.090  1.00 22.80  ?  49  GLY B N    1 
ATOM   4162  C  CA   . GLY B  1 49  ? -21.673 -25.735 -8.427  1.00 22.35  ?  49  GLY B CA   1 
ATOM   4163  C  C    . GLY B  1 49  ? -22.174 -26.257 -9.748  1.00 30.89  ?  49  GLY B C    1 
ATOM   4164  O  O    . GLY B  1 49  ? -22.012 -27.456 -10.028 1.00 30.58  ?  49  GLY B O    1 
ATOM   4165  H  H    . GLY B  1 49  ? -21.511 -23.801 -8.206  1.00 27.36  ?  49  GLY B H    1 
ATOM   4166  H  HA2  . GLY B  1 49  ? -20.703 -25.747 -8.451  1.00 26.81  ?  49  GLY B HA2  1 
ATOM   4167  H  HA3  . GLY B  1 49  ? -21.963 -26.348 -7.734  1.00 26.81  ?  49  GLY B HA3  1 
ATOM   4168  N  N    . ALA B  1 50  ? -22.762 -25.397 -10.574 1.00 23.44  ?  50  ALA B N    1 
ATOM   4169  C  CA   . ALA B  1 50  ? -23.269 -25.829 -11.878 1.00 27.94  ?  50  ALA B CA   1 
ATOM   4170  C  C    . ALA B  1 50  ? -22.162 -25.958 -12.911 1.00 32.40  ?  50  ALA B C    1 
ATOM   4171  O  O    . ALA B  1 50  ? -22.346 -26.653 -13.920 1.00 31.77  ?  50  ALA B O    1 
ATOM   4172  C  CB   . ALA B  1 50  ? -24.336 -24.853 -12.356 1.00 23.70  ?  50  ALA B CB   1 
ATOM   4173  H  H    . ALA B  1 50  ? -22.881 -24.562 -10.407 1.00 28.13  ?  50  ALA B H    1 
ATOM   4174  H  HA   . ALA B  1 50  ? -23.685 -26.699 -11.779 1.00 33.53  ?  50  ALA B HA   1 
ATOM   4175  H  HB1  . ALA B  1 50  ? -24.666 -25.145 -13.220 1.00 28.44  ?  50  ALA B HB1  1 
ATOM   4176  H  HB2  . ALA B  1 50  ? -25.061 -24.838 -11.711 1.00 28.44  ?  50  ALA B HB2  1 
ATOM   4177  H  HB3  . ALA B  1 50  ? -23.943 -23.969 -12.433 1.00 28.44  ?  50  ALA B HB3  1 
ATOM   4178  N  N    . SER B  1 51  ? -21.020 -25.321 -12.670 1.00 25.54  ?  51  SER B N    1 
ATOM   4179  C  CA   . SER B  1 51  ? -19.867 -25.357 -13.553 1.00 26.54  ?  51  SER B CA   1 
ATOM   4180  C  C    . SER B  1 51  ? -18.596 -25.320 -12.725 1.00 35.09  ?  51  SER B C    1 
ATOM   4181  O  O    . SER B  1 51  ? -18.564 -24.723 -11.648 1.00 29.16  ?  51  SER B O    1 
ATOM   4182  C  CB   . SER B  1 51  ? -19.873 -24.165 -14.506 1.00 30.51  ?  51  SER B CB   1 
ATOM   4183  O  OG   . SER B  1 51  ? -18.697 -24.144 -15.296 1.00 37.12  ?  51  SER B OG   1 
ATOM   4184  H  H    . SER B  1 51  ? -20.888 -24.841 -11.968 1.00 30.65  ?  51  SER B H    1 
ATOM   4185  H  HA   . SER B  1 51  ? -19.878 -26.175 -14.074 1.00 31.85  ?  51  SER B HA   1 
ATOM   4186  H  HB2  . SER B  1 51  ? -20.645 -24.232 -15.090 1.00 36.61  ?  51  SER B HB2  1 
ATOM   4187  H  HB3  . SER B  1 51  ? -19.919 -23.347 -13.987 1.00 36.61  ?  51  SER B HB3  1 
ATOM   4188  H  HG   . SER B  1 51  ? -18.713 -23.484 -15.816 1.00 44.54  ?  51  SER B HG   1 
ATOM   4189  N  N    . ASP B  1 52  ? -17.536 -25.940 -13.248 1.00 35.83  ?  52  ASP B N    1 
ATOM   4190  C  CA   . ASP B  1 52  ? -16.202 -25.835 -12.660 1.00 39.67  ?  52  ASP B CA   1 
ATOM   4191  C  C    . ASP B  1 52  ? -15.348 -24.766 -13.332 1.00 31.48  ?  52  ASP B C    1 
ATOM   4192  O  O    . ASP B  1 52  ? -14.200 -24.563 -12.937 1.00 37.52  ?  52  ASP B O    1 
ATOM   4193  C  CB   . ASP B  1 52  ? -15.484 -27.193 -12.725 1.00 51.17  ?  52  ASP B CB   1 
ATOM   4194  C  CG   . ASP B  1 52  ? -16.023 -28.199 -11.704 1.00 65.58  ?  52  ASP B CG   1 
ATOM   4195  O  OD1  . ASP B  1 52  ? -16.484 -27.786 -10.613 1.00 68.41  ?  52  ASP B OD1  1 
ATOM   4196  O  OD2  . ASP B  1 52  ? -15.982 -29.414 -11.993 1.00 77.54  -1 52  ASP B OD2  1 
ATOM   4197  H  H    . ASP B  1 52  ? -17.565 -26.433 -13.952 1.00 42.99  ?  52  ASP B H    1 
ATOM   4198  H  HA   . ASP B  1 52  ? -16.294 -25.594 -11.725 1.00 47.60  ?  52  ASP B HA   1 
ATOM   4199  H  HB2  . ASP B  1 52  ? -15.603 -27.571 -13.610 1.00 61.41  ?  52  ASP B HB2  1 
ATOM   4200  H  HB3  . ASP B  1 52  ? -14.540 -27.059 -12.545 1.00 61.41  ?  52  ASP B HB3  1 
ATOM   4201  N  N    . LYS B  1 53  ? -15.873 -24.084 -14.331 1.00 29.72  ?  53  LYS B N    1 
ATOM   4202  C  CA   . LYS B  1 53  ? -15.158 -22.979 -14.960 1.00 38.96  ?  53  LYS B CA   1 
ATOM   4203  C  C    . LYS B  1 53  ? -15.128 -21.780 -14.014 1.00 48.65  ?  53  LYS B C    1 
ATOM   4204  O  O    . LYS B  1 53  ? -16.180 -21.227 -13.665 1.00 35.01  ?  53  LYS B O    1 
ATOM   4205  C  CB   . LYS B  1 53  ? -15.829 -22.607 -16.279 1.00 38.78  ?  53  LYS B CB   1 
ATOM   4206  C  CG   . LYS B  1 53  ? -14.991 -21.681 -17.170 1.00 55.83  ?  53  LYS B CG   1 
ATOM   4207  C  CD   . LYS B  1 53  ? -15.850 -20.908 -18.168 1.00 64.43  ?  53  LYS B CD   1 
ATOM   4208  C  CE   . LYS B  1 53  ? -16.591 -21.823 -19.141 1.00 71.03  ?  53  LYS B CE   1 
ATOM   4209  N  NZ   . LYS B  1 53  ? -17.662 -21.081 -19.866 1.00 79.01  1  53  LYS B NZ   1 
ATOM   4210  H  H    . LYS B  1 53  ? -16.648 -24.238 -14.670 1.00 35.66  ?  53  LYS B H    1 
ATOM   4211  H  HA   . LYS B  1 53  ? -14.244 -23.249 -15.144 1.00 46.76  ?  53  LYS B HA   1 
ATOM   4212  H  HB2  . LYS B  1 53  ? -16.005 -23.419 -16.780 1.00 46.53  ?  53  LYS B HB2  1 
ATOM   4213  H  HB3  . LYS B  1 53  ? -16.665 -22.154 -16.087 1.00 46.53  ?  53  LYS B HB3  1 
ATOM   4214  H  HG2  . LYS B  1 53  ? -14.526 -21.039 -16.611 1.00 67.00  ?  53  LYS B HG2  1 
ATOM   4215  H  HG3  . LYS B  1 53  ? -14.353 -22.214 -17.670 1.00 67.00  ?  53  LYS B HG3  1 
ATOM   4216  H  HD2  . LYS B  1 53  ? -16.510 -20.389 -17.682 1.00 77.31  ?  53  LYS B HD2  1 
ATOM   4217  H  HD3  . LYS B  1 53  ? -15.280 -20.318 -18.686 1.00 77.31  ?  53  LYS B HD3  1 
ATOM   4218  H  HE2  . LYS B  1 53  ? -15.965 -22.172 -19.795 1.00 85.24  ?  53  LYS B HE2  1 
ATOM   4219  H  HE3  . LYS B  1 53  ? -17.003 -22.550 -18.648 1.00 85.24  ?  53  LYS B HE3  1 
ATOM   4220  H  HZ1  . LYS B  1 53  ? -18.084 -21.627 -20.428 1.00 94.81  ?  53  LYS B HZ1  1 
ATOM   4221  H  HZ2  . LYS B  1 53  ? -18.251 -20.753 -19.285 1.00 94.81  ?  53  LYS B HZ2  1 
ATOM   4222  H  HZ3  . LYS B  1 53  ? -17.307 -20.409 -20.329 1.00 94.81  ?  53  LYS B HZ3  1 
ATOM   4223  N  N    . LYS B  1 54  ? -13.925 -21.373 -13.606 1.00 41.03  ?  54  LYS B N    1 
ATOM   4224  C  CA   . LYS B  1 54  ? -13.787 -20.222 -12.725 1.00 44.42  ?  54  LYS B CA   1 
ATOM   4225  C  C    . LYS B  1 54  ? -14.113 -18.938 -13.490 1.00 41.91  ?  54  LYS B C    1 
ATOM   4226  O  O    . LYS B  1 54  ? -13.725 -18.796 -14.647 1.00 38.46  ?  54  LYS B O    1 
ATOM   4227  C  CB   . LYS B  1 54  ? -12.365 -20.162 -12.160 1.00 47.03  ?  54  LYS B CB   1 
ATOM   4228  C  CG   . LYS B  1 54  ? -12.005 -21.378 -11.303 1.00 59.90  ?  54  LYS B CG   1 
ATOM   4229  C  CD   . LYS B  1 54  ? -10.510 -21.694 -11.319 1.00 70.56  ?  54  LYS B CD   1 
ATOM   4230  C  CE   . LYS B  1 54  ? -10.162 -22.725 -10.250 1.00 72.23  ?  54  LYS B CE   1 
ATOM   4231  N  NZ   . LYS B  1 54  ? -8.693  -22.825 -10.008 1.00 72.78  1  54  LYS B NZ   1 
ATOM   4232  H  H    . LYS B  1 54  ? -13.181 -21.745 -13.826 1.00 49.24  ?  54  LYS B H    1 
ATOM   4233  H  HA   . LYS B  1 54  ? -14.408 -20.305 -11.985 1.00 53.30  ?  54  LYS B HA   1 
ATOM   4234  H  HB2  . LYS B  1 54  ? -11.736 -20.118 -12.897 1.00 56.44  ?  54  LYS B HB2  1 
ATOM   4235  H  HB3  . LYS B  1 54  ? -12.280 -19.370 -11.606 1.00 56.44  ?  54  LYS B HB3  1 
ATOM   4236  H  HG2  . LYS B  1 54  ? -12.265 -21.205 -10.385 1.00 71.88  ?  54  LYS B HG2  1 
ATOM   4237  H  HG3  . LYS B  1 54  ? -12.479 -22.154 -11.641 1.00 71.88  ?  54  LYS B HG3  1 
ATOM   4238  H  HD2  . LYS B  1 54  ? -10.266 -22.057 -12.185 1.00 84.67  ?  54  LYS B HD2  1 
ATOM   4239  H  HD3  . LYS B  1 54  ? -10.007 -20.884 -11.138 1.00 84.67  ?  54  LYS B HD3  1 
ATOM   4240  H  HE2  . LYS B  1 54  ? -10.588 -22.472 -9.415  1.00 86.68  ?  54  LYS B HE2  1 
ATOM   4241  H  HE3  . LYS B  1 54  ? -10.480 -23.596 -10.534 1.00 86.68  ?  54  LYS B HE3  1 
ATOM   4242  H  HZ1  . LYS B  1 54  ? -8.278  -23.063 -10.758 1.00 87.33  ?  54  LYS B HZ1  1 
ATOM   4243  H  HZ2  . LYS B  1 54  ? -8.376  -22.039 -9.738  1.00 87.33  ?  54  LYS B HZ2  1 
ATOM   4244  H  HZ3  . LYS B  1 54  ? -8.529  -23.434 -9.380  1.00 87.33  ?  54  LYS B HZ3  1 
ATOM   4245  N  N    . PRO B  1 55  ? -14.849 -18.003 -12.891 1.00 33.27  ?  55  PRO B N    1 
ATOM   4246  C  CA   . PRO B  1 55  ? -15.162 -16.750 -13.585 1.00 29.03  ?  55  PRO B CA   1 
ATOM   4247  C  C    . PRO B  1 55  ? -13.957 -15.823 -13.638 1.00 32.12  ?  55  PRO B C    1 
ATOM   4248  O  O    . PRO B  1 55  ? -13.049 -15.891 -12.807 1.00 32.44  ?  55  PRO B O    1 
ATOM   4249  C  CB   . PRO B  1 55  ? -16.290 -16.143 -12.736 1.00 33.36  ?  55  PRO B CB   1 
ATOM   4250  C  CG   . PRO B  1 55  ? -16.022 -16.696 -11.356 1.00 32.15  ?  55  PRO B CG   1 
ATOM   4251  C  CD   . PRO B  1 55  ? -15.522 -18.090 -11.581 1.00 35.67  ?  55  PRO B CD   1 
ATOM   4252  H  HA   . PRO B  1 55  ? -15.484 -16.925 -14.484 1.00 34.84  ?  55  PRO B HA   1 
ATOM   4253  H  HB2  . PRO B  1 55  ? -16.226 -15.175 -12.742 1.00 40.03  ?  55  PRO B HB2  1 
ATOM   4254  H  HB3  . PRO B  1 55  ? -17.152 -16.439 -13.069 1.00 40.03  ?  55  PRO B HB3  1 
ATOM   4255  H  HG2  . PRO B  1 55  ? -15.348 -16.157 -10.914 1.00 38.58  ?  55  PRO B HG2  1 
ATOM   4256  H  HG3  . PRO B  1 55  ? -16.845 -16.706 -10.843 1.00 38.58  ?  55  PRO B HG3  1 
ATOM   4257  H  HD2  . PRO B  1 55  ? -14.887 -18.337 -10.891 1.00 42.80  ?  55  PRO B HD2  1 
ATOM   4258  H  HD3  . PRO B  1 55  ? -16.264 -18.714 -11.623 1.00 42.80  ?  55  PRO B HD3  1 
ATOM   4259  N  N    . SER B  1 56  ? -13.969 -14.950 -14.639 1.00 33.82  ?  56  SER B N    1 
ATOM   4260  C  CA   . SER B  1 56  ? -12.961 -13.910 -14.765 1.00 35.35  ?  56  SER B CA   1 
ATOM   4261  C  C    . SER B  1 56  ? -13.212 -12.784 -13.764 1.00 33.36  ?  56  SER B C    1 
ATOM   4262  O  O    . SER B  1 56  ? -14.289 -12.670 -13.168 1.00 27.11  ?  56  SER B O    1 
ATOM   4263  C  CB   . SER B  1 56  ? -12.955 -13.323 -16.185 1.00 38.35  ?  56  SER B CB   1 
ATOM   4264  O  OG   . SER B  1 56  ? -14.137 -12.567 -16.455 1.00 33.46  ?  56  SER B OG   1 
ATOM   4265  H  H    . SER B  1 56  ? -14.558 -14.941 -15.266 1.00 40.59  ?  56  SER B H    1 
ATOM   4266  H  HA   . SER B  1 56  ? -12.086 -14.287 -14.587 1.00 42.42  ?  56  SER B HA   1 
ATOM   4267  H  HB2  . SER B  1 56  ? -12.184 -12.743 -16.280 1.00 46.02  ?  56  SER B HB2  1 
ATOM   4268  H  HB3  . SER B  1 56  ? -12.898 -14.052 -16.823 1.00 46.02  ?  56  SER B HB3  1 
ATOM   4269  H  HG   . SER B  1 56  ? -14.108 -12.258 -17.236 1.00 40.15  ?  56  SER B HG   1 
ATOM   4270  N  N    . VAL B  1 57  ? -12.185 -11.945 -13.578 1.00 28.35  ?  57  VAL B N    1 
ATOM   4271  C  CA   . VAL B  1 57  ? -12.373 -10.689 -12.848 1.00 26.03  ?  57  VAL B CA   1 
ATOM   4272  C  C    . VAL B  1 57  ? -13.554 -9.913  -13.415 1.00 34.06  ?  57  VAL B C    1 
ATOM   4273  O  O    . VAL B  1 57  ? -14.406 -9.413  -12.675 1.00 30.64  ?  57  VAL B O    1 
ATOM   4274  C  CB   . VAL B  1 57  ? -11.081 -9.847  -12.898 1.00 26.67  ?  57  VAL B CB   1 
ATOM   4275  C  CG1  . VAL B  1 57  ? -11.325 -8.428  -12.424 1.00 33.56  ?  57  VAL B CG1  1 
ATOM   4276  C  CG2  . VAL B  1 57  ? -10.032 -10.495 -12.040 1.00 33.00  ?  57  VAL B CG2  1 
ATOM   4277  H  H    . VAL B  1 57  ? -11.383 -12.078 -13.859 1.00 34.02  ?  57  VAL B H    1 
ATOM   4278  H  HA   . VAL B  1 57  ? -12.564 -10.889 -11.919 1.00 31.24  ?  57  VAL B HA   1 
ATOM   4279  H  HB   . VAL B  1 57  ? -10.753 -9.813  -13.811 1.00 32.00  ?  57  VAL B HB   1 
ATOM   4280  H  HG11 . VAL B  1 57  ? -10.493 -7.932  -12.470 1.00 40.27  ?  57  VAL B HG11 1 
ATOM   4281  H  HG12 . VAL B  1 57  ? -11.990 -8.013  -12.996 1.00 40.27  ?  57  VAL B HG12 1 
ATOM   4282  H  HG13 . VAL B  1 57  ? -11.646 -8.452  -11.508 1.00 40.27  ?  57  VAL B HG13 1 
ATOM   4283  H  HG21 . VAL B  1 57  ? -9.222  -9.962  -12.075 1.00 39.60  ?  57  VAL B HG21 1 
ATOM   4284  H  HG22 . VAL B  1 57  ? -10.357 -10.544 -11.127 1.00 39.60  ?  57  VAL B HG22 1 
ATOM   4285  H  HG23 . VAL B  1 57  ? -9.855  -11.388 -12.376 1.00 39.60  ?  57  VAL B HG23 1 
ATOM   4286  N  N    . ASP B  1 58  ? -13.617 -9.785  -14.743 1.00 34.24  ?  58  ASP B N    1 
ATOM   4287  C  CA   . ASP B  1 58  ? -14.682 -8.982  -15.336 1.00 30.01  ?  58  ASP B CA   1 
ATOM   4288  C  C    . ASP B  1 58  ? -16.048 -9.640  -15.175 1.00 29.56  ?  58  ASP B C    1 
ATOM   4289  O  O    . ASP B  1 58  ? -17.049 -8.932  -15.021 1.00 29.38  ?  58  ASP B O    1 
ATOM   4290  C  CB   . ASP B  1 58  ? -14.385 -8.719  -16.819 1.00 33.14  ?  58  ASP B CB   1 
ATOM   4291  C  CG   . ASP B  1 58  ? -13.324 -7.636  -17.028 1.00 59.49  ?  58  ASP B CG   1 
ATOM   4292  O  OD1  . ASP B  1 58  ? -12.949 -6.941  -16.048 1.00 48.22  ?  58  ASP B OD1  1 
ATOM   4293  O  OD2  . ASP B  1 58  ? -12.874 -7.478  -18.184 1.00 65.25  -1 58  ASP B OD2  1 
ATOM   4294  H  H    . ASP B  1 58  ? -13.072 -10.141 -15.305 1.00 41.09  ?  58  ASP B H    1 
ATOM   4295  H  HA   . ASP B  1 58  ? -14.713 -8.124  -14.884 1.00 36.01  ?  58  ASP B HA   1 
ATOM   4296  H  HB2  . ASP B  1 58  ? -14.062 -9.538  -17.227 1.00 39.77  ?  58  ASP B HB2  1 
ATOM   4297  H  HB3  . ASP B  1 58  ? -15.200 -8.429  -17.258 1.00 39.77  ?  58  ASP B HB3  1 
ATOM   4298  N  N    . ASP B  1 59  ? -16.109 -10.981 -15.183 1.00 27.78  ?  59  ASP B N    1 
ATOM   4299  C  CA   . ASP B  1 59  ? -17.370 -11.674 -14.910 1.00 28.33  ?  59  ASP B CA   1 
ATOM   4300  C  C    . ASP B  1 59  ? -17.902 -11.306 -13.531 1.00 24.04  ?  59  ASP B C    1 
ATOM   4301  O  O    . ASP B  1 59  ? -19.112 -11.106 -13.342 1.00 30.30  ?  59  ASP B O    1 
ATOM   4302  C  CB   . ASP B  1 59  ? -17.180 -13.194 -14.948 1.00 30.74  ?  59  ASP B CB   1 
ATOM   4303  C  CG   . ASP B  1 59  ? -16.926 -13.750 -16.341 1.00 35.76  ?  59  ASP B CG   1 
ATOM   4304  O  OD1  . ASP B  1 59  ? -17.263 -13.084 -17.336 1.00 42.65  ?  59  ASP B OD1  1 
ATOM   4305  O  OD2  . ASP B  1 59  ? -16.392 -14.885 -16.400 1.00 39.06  -1 59  ASP B OD2  1 
ATOM   4306  H  H    . ASP B  1 59  ? -15.443 -11.502 -15.340 1.00 33.34  ?  59  ASP B H    1 
ATOM   4307  H  HA   . ASP B  1 59  ? -18.031 -11.426 -15.576 1.00 33.99  ?  59  ASP B HA   1 
ATOM   4308  H  HB2  . ASP B  1 59  ? -16.419 -13.427 -14.393 1.00 36.88  ?  59  ASP B HB2  1 
ATOM   4309  H  HB3  . ASP B  1 59  ? -17.980 -13.617 -14.601 1.00 36.88  ?  59  ASP B HB3  1 
ATOM   4310  N  N    . ILE B  1 60  ? -17.004 -11.259 -12.546 1.00 23.29  ?  60  ILE B N    1 
ATOM   4311  C  CA   . ILE B  1 60  ? -17.391 -10.909 -11.180 1.00 24.22  ?  60  ILE B CA   1 
ATOM   4312  C  C    . ILE B  1 60  ? -17.822 -9.444  -11.101 1.00 23.57  ?  60  ILE B C    1 
ATOM   4313  O  O    . ILE B  1 60  ? -18.872 -9.111  -10.525 1.00 25.09  ?  60  ILE B O    1 
ATOM   4314  C  CB   . ILE B  1 60  ? -16.213 -11.215 -10.234 1.00 23.58  ?  60  ILE B CB   1 
ATOM   4315  C  CG1  . ILE B  1 60  ? -16.011 -12.735 -10.120 1.00 26.37  ?  60  ILE B CG1  1 
ATOM   4316  C  CG2  . ILE B  1 60  ? -16.420 -10.577 -8.832  1.00 25.00  ?  60  ILE B CG2  1 
ATOM   4317  C  CD1  . ILE B  1 60  ? -14.647 -13.137 -9.557  1.00 27.77  ?  60  ILE B CD1  1 
ATOM   4318  H  H    . ILE B  1 60  ? -16.166 -11.426 -12.643 1.00 27.95  ?  60  ILE B H    1 
ATOM   4319  H  HA   . ILE B  1 60  ? -18.143 -11.459 -10.912 1.00 29.06  ?  60  ILE B HA   1 
ATOM   4320  H  HB   . ILE B  1 60  ? -15.409 -10.833 -10.621 1.00 28.30  ?  60  ILE B HB   1 
ATOM   4321  H  HG12 . ILE B  1 60  ? -16.692 -13.098 -9.533  1.00 31.65  ?  60  ILE B HG12 1 
ATOM   4322  H  HG13 . ILE B  1 60  ? -16.094 -13.128 -11.003 1.00 31.65  ?  60  ILE B HG13 1 
ATOM   4323  H  HG21 . ILE B  1 60  ? -15.659 -10.793 -8.271  1.00 30.00  ?  60  ILE B HG21 1 
ATOM   4324  H  HG22 . ILE B  1 60  ? -16.495 -9.615  -8.931  1.00 30.00  ?  60  ILE B HG22 1 
ATOM   4325  H  HG23 . ILE B  1 60  ? -17.232 -10.934 -8.440  1.00 30.00  ?  60  ILE B HG23 1 
ATOM   4326  H  HD11 . ILE B  1 60  ? -14.596 -14.105 -9.516  1.00 33.32  ?  60  ILE B HD11 1 
ATOM   4327  H  HD12 . ILE B  1 60  ? -13.952 -12.792 -10.139 1.00 33.32  ?  60  ILE B HD12 1 
ATOM   4328  H  HD13 . ILE B  1 60  ? -14.551 -12.762 -8.667  1.00 33.32  ?  60  ILE B HD13 1 
ATOM   4329  N  N    . VAL B  1 61  ? -17.023 -8.549  -11.691 1.00 24.12  ?  61  VAL B N    1 
ATOM   4330  C  CA   . VAL B  1 61  ? -17.326 -7.118  -11.647 1.00 25.12  ?  61  VAL B CA   1 
ATOM   4331  C  C    . VAL B  1 61  ? -18.690 -6.823  -12.272 1.00 29.68  ?  61  VAL B C    1 
ATOM   4332  O  O    . VAL B  1 61  ? -19.429 -5.961  -11.792 1.00 26.43  ?  61  VAL B O    1 
ATOM   4333  C  CB   . VAL B  1 61  ? -16.187 -6.330  -12.325 1.00 29.86  ?  61  VAL B CB   1 
ATOM   4334  C  CG1  . VAL B  1 61  ? -16.540 -4.844  -12.455 1.00 33.46  ?  61  VAL B CG1  1 
ATOM   4335  C  CG2  . VAL B  1 61  ? -14.902 -6.505  -11.507 1.00 31.36  ?  61  VAL B CG2  1 
ATOM   4336  H  H    . VAL B  1 61  ? -16.304 -8.745  -12.120 1.00 28.95  ?  61  VAL B H    1 
ATOM   4337  H  HA   . VAL B  1 61  ? -17.363 -6.839  -10.718 1.00 30.14  ?  61  VAL B HA   1 
ATOM   4338  H  HB   . VAL B  1 61  ? -16.034 -6.686  -13.214 1.00 35.83  ?  61  VAL B HB   1 
ATOM   4339  H  HG11 . VAL B  1 61  ? -15.803 -4.382  -12.885 1.00 40.16  ?  61  VAL B HG11 1 
ATOM   4340  H  HG12 . VAL B  1 61  ? -17.344 -4.757  -12.991 1.00 40.16  ?  61  VAL B HG12 1 
ATOM   4341  H  HG13 . VAL B  1 61  ? -16.691 -4.477  -11.570 1.00 40.16  ?  61  VAL B HG13 1 
ATOM   4342  H  HG21 . VAL B  1 61  ? -14.186 -6.009  -11.934 1.00 37.64  ?  61  VAL B HG21 1 
ATOM   4343  H  HG22 . VAL B  1 61  ? -15.050 -6.167  -10.610 1.00 37.64  ?  61  VAL B HG22 1 
ATOM   4344  H  HG23 . VAL B  1 61  ? -14.676 -7.448  -11.472 1.00 37.64  ?  61  VAL B HG23 1 
ATOM   4345  N  N    . GLN B  1 62  ? -19.041 -7.523  -13.354 1.00 25.81  ?  62  GLN B N    1 
ATOM   4346  C  CA   . GLN B  1 62  ? -20.335 -7.308  -14.002 1.00 31.75  ?  62  GLN B CA   1 
ATOM   4347  C  C    . GLN B  1 62  ? -21.503 -7.579  -13.052 1.00 29.91  ?  62  GLN B C    1 
ATOM   4348  O  O    . GLN B  1 62  ? -22.499 -6.840  -13.048 1.00 31.07  ?  62  GLN B O    1 
ATOM   4349  C  CB   . GLN B  1 62  ? -20.448 -8.200  -15.248 1.00 36.15  ?  62  GLN B CB   1 
ATOM   4350  C  CG   . GLN B  1 62  ? -19.633 -7.737  -16.469 1.00 41.91  ?  62  GLN B CG   1 
ATOM   4351  C  CD   . GLN B  1 62  ? -19.848 -8.638  -17.670 1.00 56.97  ?  62  GLN B CD   1 
ATOM   4352  O  OE1  . GLN B  1 62  ? -18.918 -9.282  -18.159 1.00 65.72  ?  62  GLN B OE1  1 
ATOM   4353  N  NE2  . GLN B  1 62  ? -21.084 -8.689  -18.149 1.00 63.23  ?  62  GLN B NE2  1 
ATOM   4354  H  H    . GLN B  1 62  ? -18.552 -8.123  -13.728 1.00 30.98  ?  62  GLN B H    1 
ATOM   4355  H  HA   . GLN B  1 62  ? -20.392 -6.384  -14.290 1.00 38.11  ?  62  GLN B HA   1 
ATOM   4356  H  HB2  . GLN B  1 62  ? -20.144 -9.091  -15.016 1.00 43.38  ?  62  GLN B HB2  1 
ATOM   4357  H  HB3  . GLN B  1 62  ? -21.379 -8.235  -15.516 1.00 43.38  ?  62  GLN B HB3  1 
ATOM   4358  H  HG2  . GLN B  1 62  ? -19.906 -6.839  -16.712 1.00 50.29  ?  62  GLN B HG2  1 
ATOM   4359  H  HG3  . GLN B  1 62  ? -18.690 -7.751  -16.246 1.00 50.29  ?  62  GLN B HG3  1 
ATOM   4360  H  HE21 . GLN B  1 62  ? -21.708 -8.227  -17.780 1.00 75.88  ?  62  GLN B HE21 1 
ATOM   4361  H  HE22 . GLN B  1 62  ? -21.261 -9.184  -18.830 1.00 75.88  ?  62  GLN B HE22 1 
ATOM   4362  N  N    . ILE B  1 63  ? -21.421 -8.661  -12.271 1.00 23.65  ?  63  ILE B N    1 
ATOM   4363  C  CA   . ILE B  1 63  ? -22.444 -8.966  -11.285 1.00 23.32  ?  63  ILE B CA   1 
ATOM   4364  C  C    . ILE B  1 63  ? -22.410 -7.951  -10.152 1.00 25.06  ?  63  ILE B C    1 
ATOM   4365  O  O    . ILE B  1 63  ? -23.457 -7.516  -9.657  1.00 23.28  ?  63  ILE B O    1 
ATOM   4366  C  CB   . ILE B  1 63  ? -22.262 -10.406 -10.772 1.00 23.34  ?  63  ILE B CB   1 
ATOM   4367  C  CG1  . ILE B  1 63  ? -22.760 -11.411 -11.819 1.00 27.63  ?  63  ILE B CG1  1 
ATOM   4368  C  CG2  . ILE B  1 63  ? -22.978 -10.641 -9.436  1.00 27.07  ?  63  ILE B CG2  1 
ATOM   4369  C  CD1  . ILE B  1 63  ? -24.291 -11.396 -12.021 1.00 27.59  ?  63  ILE B CD1  1 
ATOM   4370  H  H    . ILE B  1 63  ? -20.778 -9.231  -12.298 1.00 28.38  ?  63  ILE B H    1 
ATOM   4371  H  HA   . ILE B  1 63  ? -23.314 -8.909  -11.709 1.00 27.99  ?  63  ILE B HA   1 
ATOM   4372  H  HB   . ILE B  1 63  ? -21.314 -10.559 -10.636 1.00 28.01  ?  63  ILE B HB   1 
ATOM   4373  H  HG12 . ILE B  1 63  ? -22.346 -11.204 -12.672 1.00 33.16  ?  63  ILE B HG12 1 
ATOM   4374  H  HG13 . ILE B  1 63  ? -22.506 -12.305 -11.539 1.00 33.16  ?  63  ILE B HG13 1 
ATOM   4375  H  HG21 . ILE B  1 63  ? -22.834 -11.559 -9.158  1.00 32.48  ?  63  ILE B HG21 1 
ATOM   4376  H  HG22 . ILE B  1 63  ? -22.615 -10.033 -8.773  1.00 32.48  ?  63  ILE B HG22 1 
ATOM   4377  H  HG23 . ILE B  1 63  ? -23.927 -10.476 -9.554  1.00 32.48  ?  63  ILE B HG23 1 
ATOM   4378  H  HD11 . ILE B  1 63  ? -24.527 -12.054 -12.694 1.00 33.10  ?  63  ILE B HD11 1 
ATOM   4379  H  HD12 . ILE B  1 63  ? -24.722 -11.613 -11.180 1.00 33.10  ?  63  ILE B HD12 1 
ATOM   4380  H  HD13 . ILE B  1 63  ? -24.562 -10.512 -12.313 1.00 33.10  ?  63  ILE B HD13 1 
ATOM   4381  N  N    . LEU B  1 64  ? -21.212 -7.530  -9.739  1.00 21.40  ?  64  LEU B N    1 
ATOM   4382  C  CA   . LEU B  1 64  ? -21.137 -6.593  -8.624  1.00 20.28  ?  64  LEU B CA   1 
ATOM   4383  C  C    . LEU B  1 64  ? -21.636 -5.208  -9.001  1.00 21.64  ?  64  LEU B C    1 
ATOM   4384  O  O    . LEU B  1 64  ? -22.203 -4.507  -8.151  1.00 21.39  ?  64  LEU B O    1 
ATOM   4385  C  CB   . LEU B  1 64  ? -19.691 -6.508  -8.133  1.00 20.69  ?  64  LEU B CB   1 
ATOM   4386  C  CG   . LEU B  1 64  ? -19.124 -7.750  -7.453  1.00 23.69  ?  64  LEU B CG   1 
ATOM   4387  C  CD1  . LEU B  1 64  ? -17.678 -7.473  -6.998  1.00 23.14  ?  64  LEU B CD1  1 
ATOM   4388  C  CD2  . LEU B  1 64  ? -20.005 -8.208  -6.285  1.00 25.93  ?  64  LEU B CD2  1 
ATOM   4389  H  H    . LEU B  1 64  ? -20.455 -7.763  -10.075 1.00 25.68  ?  64  LEU B H    1 
ATOM   4390  H  HA   . LEU B  1 64  ? -21.684 -6.923  -7.895  1.00 24.34  ?  64  LEU B HA   1 
ATOM   4391  H  HB2  . LEU B  1 64  ? -19.123 -6.315  -8.896  1.00 24.83  ?  64  LEU B HB2  1 
ATOM   4392  H  HB3  . LEU B  1 64  ? -19.630 -5.779  -7.496  1.00 24.83  ?  64  LEU B HB3  1 
ATOM   4393  H  HG   . LEU B  1 64  ? -19.095 -8.472  -8.100  1.00 28.43  ?  64  LEU B HG   1 
ATOM   4394  H  HD11 . LEU B  1 64  ? -17.326 -8.268  -6.567  1.00 27.76  ?  64  LEU B HD11 1 
ATOM   4395  H  HD12 . LEU B  1 64  ? -17.140 -7.251  -7.774  1.00 27.76  ?  64  LEU B HD12 1 
ATOM   4396  H  HD13 . LEU B  1 64  ? -17.681 -6.731  -6.373  1.00 27.76  ?  64  LEU B HD13 1 
ATOM   4397  H  HD21 . LEU B  1 64  ? -19.609 -8.997  -5.882  1.00 31.11  ?  64  LEU B HD21 1 
ATOM   4398  H  HD22 . LEU B  1 64  ? -20.057 -7.494  -5.631  1.00 31.11  ?  64  LEU B HD22 1 
ATOM   4399  H  HD23 . LEU B  1 64  ? -20.891 -8.416  -6.620  1.00 31.11  ?  64  LEU B HD23 1 
ATOM   4400  N  N    . PHE B  1 65  ? -21.432 -4.782  -10.251 1.00 23.36  ?  65  PHE B N    1 
ATOM   4401  C  CA   . PHE B  1 65  ? -21.773 -3.429  -10.700 1.00 24.80  ?  65  PHE B CA   1 
ATOM   4402  C  C    . PHE B  1 65  ? -22.637 -3.502  -11.953 1.00 21.85  ?  65  PHE B C    1 
ATOM   4403  O  O    . PHE B  1 65  ? -22.213 -3.099  -13.039 1.00 28.25  ?  65  PHE B O    1 
ATOM   4404  C  CB   . PHE B  1 65  ? -20.516 -2.604  -10.972 1.00 23.00  ?  65  PHE B CB   1 
ATOM   4405  C  CG   . PHE B  1 65  ? -19.591 -2.477  -9.786  1.00 19.81  ?  65  PHE B CG   1 
ATOM   4406  C  CD1  . PHE B  1 65  ? -19.724 -1.421  -8.904  1.00 21.61  ?  65  PHE B CD1  1 
ATOM   4407  C  CD2  . PHE B  1 65  ? -18.553 -3.370  -9.596  1.00 22.26  ?  65  PHE B CD2  1 
ATOM   4408  C  CE1  . PHE B  1 65  ? -18.842 -1.293  -7.809  1.00 22.63  ?  65  PHE B CE1  1 
ATOM   4409  C  CE2  . PHE B  1 65  ? -17.689 -3.258  -8.516  1.00 22.21  ?  65  PHE B CE2  1 
ATOM   4410  C  CZ   . PHE B  1 65  ? -17.837 -2.234  -7.624  1.00 21.77  ?  65  PHE B CZ   1 
ATOM   4411  H  H    . PHE B  1 65  ? -21.090 -5.270  -10.871 1.00 28.03  ?  65  PHE B H    1 
ATOM   4412  H  HA   . PHE B  1 65  ? -22.283 -2.983  -10.006 1.00 29.76  ?  65  PHE B HA   1 
ATOM   4413  H  HB2  . PHE B  1 65  ? -20.018 -3.024  -11.691 1.00 27.59  ?  65  PHE B HB2  1 
ATOM   4414  H  HB3  . PHE B  1 65  ? -20.782 -1.710  -11.237 1.00 27.59  ?  65  PHE B HB3  1 
ATOM   4415  H  HD1  . PHE B  1 65  ? -20.408 -0.802  -9.022  1.00 25.93  ?  65  PHE B HD1  1 
ATOM   4416  H  HD2  . PHE B  1 65  ? -18.452 -4.081  -10.186 1.00 26.72  ?  65  PHE B HD2  1 
ATOM   4417  H  HE1  . PHE B  1 65  ? -18.945 -0.593  -7.205  1.00 27.16  ?  65  PHE B HE1  1 
ATOM   4418  H  HE2  . PHE B  1 65  ? -17.009 -3.881  -8.399  1.00 26.65  ?  65  PHE B HE2  1 
ATOM   4419  H  HZ   . PHE B  1 65  ? -17.248 -2.152  -6.909  1.00 26.12  ?  65  PHE B HZ   1 
ATOM   4420  N  N    . PRO B  1 66  ? -23.863 -3.986  -11.829 1.00 23.76  ?  66  PRO B N    1 
ATOM   4421  C  CA   . PRO B  1 66  ? -24.742 -4.042  -13.001 1.00 33.04  ?  66  PRO B CA   1 
ATOM   4422  C  C    . PRO B  1 66  ? -25.139 -2.651  -13.474 1.00 34.93  ?  66  PRO B C    1 
ATOM   4423  O  O    . PRO B  1 66  ? -24.981 -1.650  -12.769 1.00 27.84  ?  66  PRO B O    1 
ATOM   4424  C  CB   . PRO B  1 66  ? -25.948 -4.834  -12.494 1.00 31.53  ?  66  PRO B CB   1 
ATOM   4425  C  CG   . PRO B  1 66  ? -25.989 -4.575  -11.059 1.00 31.15  ?  66  PRO B CG   1 
ATOM   4426  C  CD   . PRO B  1 66  ? -24.541 -4.467  -10.616 1.00 23.66  ?  66  PRO B CD   1 
ATOM   4427  H  HA   . PRO B  1 66  ? -24.316 -4.525  -13.726 1.00 39.64  ?  66  PRO B HA   1 
ATOM   4428  H  HB2  . PRO B  1 66  ? -26.755 -4.512  -12.925 1.00 37.83  ?  66  PRO B HB2  1 
ATOM   4429  H  HB3  . PRO B  1 66  ? -25.816 -5.778  -12.670 1.00 37.83  ?  66  PRO B HB3  1 
ATOM   4430  H  HG2  . PRO B  1 66  ? -26.459 -3.744  -10.892 1.00 37.38  ?  66  PRO B HG2  1 
ATOM   4431  H  HG3  . PRO B  1 66  ? -26.429 -5.313  -10.609 1.00 37.38  ?  66  PRO B HG3  1 
ATOM   4432  H  HD2  . PRO B  1 66  ? -24.453 -3.820  -9.898  1.00 28.39  ?  66  PRO B HD2  1 
ATOM   4433  H  HD3  . PRO B  1 66  ? -24.198 -5.337  -10.357 1.00 28.39  ?  66  PRO B HD3  1 
ATOM   4434  N  N    . SER B  1 67  ? -25.638 -2.594  -14.709 1.00 33.43  ?  67  SER B N    1 
ATOM   4435  C  CA   . SER B  1 67  ? -26.128 -1.328  -15.242 1.00 39.73  ?  67  SER B CA   1 
ATOM   4436  C  C    . SER B  1 67  ? -27.205 -0.753  -14.330 1.00 27.45  ?  67  SER B C    1 
ATOM   4437  O  O    . SER B  1 67  ? -28.058 -1.479  -13.807 1.00 33.07  ?  67  SER B O    1 
ATOM   4438  C  CB   . SER B  1 67  ? -26.680 -1.519  -16.659 1.00 51.36  ?  67  SER B CB   1 
ATOM   4439  O  OG   . SER B  1 67  ? -25.622 -1.729  -17.580 1.00 57.67  ?  67  SER B OG   1 
ATOM   4440  H  H    . SER B  1 67  ? -25.703 -3.261  -15.248 1.00 40.12  ?  67  SER B H    1 
ATOM   4441  H  HA   . SER B  1 67  ? -25.395 -0.694  -15.284 1.00 47.68  ?  67  SER B HA   1 
ATOM   4442  H  HB2  . SER B  1 67  ? -27.266 -2.291  -16.669 1.00 61.64  ?  67  SER B HB2  1 
ATOM   4443  H  HB3  . SER B  1 67  ? -27.172 -0.724  -16.917 1.00 61.64  ?  67  SER B HB3  1 
ATOM   4444  H  HG   . SER B  1 67  ? -25.931 -1.833  -18.354 1.00 69.21  ?  67  SER B HG   1 
ATOM   4445  N  N    . GLY B  1 68  ? -27.127 0.554   -14.092 1.00 35.29  ?  68  GLY B N    1 
ATOM   4446  C  CA   . GLY B  1 68  ? -28.090 1.212   -13.238 1.00 40.86  ?  68  GLY B CA   1 
ATOM   4447  C  C    . GLY B  1 68  ? -27.786 1.160   -11.758 1.00 36.07  ?  68  GLY B C    1 
ATOM   4448  O  O    . GLY B  1 68  ? -28.622 1.598   -10.959 1.00 36.11  ?  68  GLY B O    1 
ATOM   4449  H  H    . GLY B  1 68  ? -26.525 1.075   -14.415 1.00 42.35  ?  68  GLY B H    1 
ATOM   4450  H  HA2  . GLY B  1 68  ? -28.151 2.145   -13.496 1.00 49.03  ?  68  GLY B HA2  1 
ATOM   4451  H  HA3  . GLY B  1 68  ? -28.960 0.806   -13.377 1.00 49.03  ?  68  GLY B HA3  1 
ATOM   4452  N  N    . SER B  1 69  ? -26.620 0.658   -11.365 1.00 31.87  ?  69  SER B N    1 
ATOM   4453  C  CA   . SER B  1 69  ? -26.301 0.578   -9.943  1.00 28.13  ?  69  SER B CA   1 
ATOM   4454  C  C    . SER B  1 69  ? -26.371 1.961   -9.316  1.00 29.83  ?  69  SER B C    1 
ATOM   4455  O  O    . SER B  1 69  ? -25.832 2.927   -9.860  1.00 30.32  ?  69  SER B O    1 
ATOM   4456  C  CB   . SER B  1 69  ? -24.898 0.005   -9.735  1.00 28.35  ?  69  SER B CB   1 
ATOM   4457  O  OG   . SER B  1 69  ? -24.833 -1.361  -10.118 1.00 28.93  ?  69  SER B OG   1 
ATOM   4458  H  H    . SER B  1 69  ? -26.006 0.361   -11.890 1.00 38.24  ?  69  SER B H    1 
ATOM   4459  H  HA   . SER B  1 69  ? -26.941 0.002   -9.497  1.00 33.76  ?  69  SER B HA   1 
ATOM   4460  H  HB2  . SER B  1 69  ? -24.269 0.512   -10.273 1.00 34.02  ?  69  SER B HB2  1 
ATOM   4461  H  HB3  . SER B  1 69  ? -24.665 0.079   -8.797  1.00 34.02  ?  69  SER B HB3  1 
ATOM   4462  H  HG   . SER B  1 69  ? -25.032 -1.442  -10.930 1.00 34.72  ?  69  SER B HG   1 
ATOM   4463  N  N    . ASP B  1 70  ? -26.992 2.048   -8.148  1.00 25.88  ?  70  ASP B N    1 
ATOM   4464  C  CA   . ASP B  1 70  ? -27.036 3.306   -7.427  1.00 28.22  ?  70  ASP B CA   1 
ATOM   4465  C  C    . ASP B  1 70  ? -25.882 3.414   -6.420  1.00 25.31  ?  70  ASP B C    1 
ATOM   4466  O  O    . ASP B  1 70  ? -25.012 2.537   -6.315  1.00 24.30  ?  70  ASP B O    1 
ATOM   4467  C  CB   . ASP B  1 70  ? -28.393 3.488   -6.750  1.00 31.04  ?  70  ASP B CB   1 
ATOM   4468  C  CG   . ASP B  1 70  ? -28.657 2.510   -5.639  1.00 34.19  ?  70  ASP B CG   1 
ATOM   4469  O  OD1  . ASP B  1 70  ? -27.738 1.822   -5.141  1.00 28.33  ?  70  ASP B OD1  1 
ATOM   4470  O  OD2  . ASP B  1 70  ? -29.839 2.408   -5.245  1.00 34.80  -1 70  ASP B OD2  1 
ATOM   4471  H  H    . ASP B  1 70  ? -27.393 1.396   -7.755  1.00 31.06  ?  70  ASP B H    1 
ATOM   4472  H  HA   . ASP B  1 70  ? -26.931 4.029   -8.066  1.00 33.87  ?  70  ASP B HA   1 
ATOM   4473  H  HB2  . ASP B  1 70  ? -28.438 4.381   -6.375  1.00 37.25  ?  70  ASP B HB2  1 
ATOM   4474  H  HB3  . ASP B  1 70  ? -29.091 3.376   -7.414  1.00 37.25  ?  70  ASP B HB3  1 
ATOM   4475  N  N    . SER B  1 71  ? -25.865 4.530   -5.686  1.00 26.46  ?  71  SER B N    1 
ATOM   4476  C  CA   . SER B  1 71  ? -24.715 4.849   -4.836  1.00 25.13  ?  71  SER B CA   1 
ATOM   4477  C  C    . SER B  1 71  ? -24.445 3.766   -3.803  1.00 25.56  ?  71  SER B C    1 
ATOM   4478  O  O    . SER B  1 71  ? -23.287 3.377   -3.601  1.00 21.16  ?  71  SER B O    1 
ATOM   4479  C  CB   . SER B  1 71  ? -24.927 6.208   -4.150  1.00 29.14  ?  71  SER B CB   1 
ATOM   4480  O  OG   . SER B  1 71  ? -25.996 6.164   -3.224  1.00 36.23  ?  71  SER B OG   1 
ATOM   4481  H  H    . SER B  1 71  ? -26.499 5.112   -5.662  1.00 31.75  ?  71  SER B H    1 
ATOM   4482  H  HA   . SER B  1 71  ? -23.926 4.923   -5.397  1.00 30.16  ?  71  SER B HA   1 
ATOM   4483  H  HB2  . SER B  1 71  ? -24.115 6.451   -3.679  1.00 34.97  ?  71  SER B HB2  1 
ATOM   4484  H  HB3  . SER B  1 71  ? -25.127 6.873   -4.827  1.00 34.97  ?  71  SER B HB3  1 
ATOM   4485  H  HG   . SER B  1 71  ? -26.708 5.956   -3.617  1.00 43.48  ?  71  SER B HG   1 
ATOM   4486  N  N    . GLY B  1 72  ? -25.484 3.263   -3.124  1.00 21.93  ?  72  GLY B N    1 
ATOM   4487  C  CA   . GLY B  1 72  ? -25.268 2.233   -2.118  1.00 24.21  ?  72  GLY B CA   1 
ATOM   4488  C  C    . GLY B  1 72  ? -24.814 0.910   -2.706  1.00 20.30  ?  72  GLY B C    1 
ATOM   4489  O  O    . GLY B  1 72  ? -23.983 0.212   -2.118  1.00 20.67  ?  72  GLY B O    1 
ATOM   4490  H  H    . GLY B  1 72  ? -26.304 3.499   -3.229  1.00 26.32  ?  72  GLY B H    1 
ATOM   4491  H  HA2  . GLY B  1 72  ? -24.593 2.535   -1.490  1.00 29.05  ?  72  GLY B HA2  1 
ATOM   4492  H  HA3  . GLY B  1 72  ? -26.093 2.083   -1.631  1.00 29.05  ?  72  GLY B HA3  1 
ATOM   4493  N  N    . THR B  1 73  ? -25.339 0.556   -3.886  1.00 19.80  ?  73  THR B N    1 
ATOM   4494  C  CA   . THR B  1 73  ? -24.889 -0.648  -4.576  1.00 21.87  ?  73  THR B CA   1 
ATOM   4495  C  C    . THR B  1 73  ? -23.414 -0.554  -4.928  1.00 20.43  ?  73  THR B C    1 
ATOM   4496  O  O    . THR B  1 73  ? -22.653 -1.509  -4.722  1.00 20.07  ?  73  THR B O    1 
ATOM   4497  C  CB   . THR B  1 73  ? -25.723 -0.867  -5.843  1.00 25.84  ?  73  THR B CB   1 
ATOM   4498  O  OG1  . THR B  1 73  ? -27.047 -1.243  -5.468  1.00 29.14  ?  73  THR B OG1  1 
ATOM   4499  C  CG2  . THR B  1 73  ? -25.139 -1.974  -6.731  1.00 27.66  ?  73  THR B CG2  1 
ATOM   4500  H  H    . THR B  1 73  ? -25.952 0.995   -4.300  1.00 23.76  ?  73  THR B H    1 
ATOM   4501  H  HA   . THR B  1 73  ? -25.014 -1.415  -3.995  1.00 26.24  ?  73  THR B HA   1 
ATOM   4502  H  HB   . THR B  1 73  ? -25.754 -0.045  -6.357  1.00 31.01  ?  73  THR B HB   1 
ATOM   4503  H  HG1  . THR B  1 73  ? -27.397 -0.637  -5.003  1.00 34.97  ?  73  THR B HG1  1 
ATOM   4504  H  HG21 . THR B  1 73  ? -25.688 -2.088  -7.523  1.00 33.19  ?  73  THR B HG21 1 
ATOM   4505  H  HG22 . THR B  1 73  ? -24.238 -1.740  -7.003  1.00 33.19  ?  73  THR B HG22 1 
ATOM   4506  H  HG23 . THR B  1 73  ? -25.113 -2.812  -6.242  1.00 33.19  ?  73  THR B HG23 1 
ATOM   4507  N  N    . ILE B  1 74  ? -22.993 0.603   -5.436  1.00 19.41  ?  74  ILE B N    1 
ATOM   4508  C  CA   . ILE B  1 74  ? -21.587 0.811   -5.782  1.00 18.89  ?  74  ILE B CA   1 
ATOM   4509  C  C    . ILE B  1 74  ? -20.714 0.744   -4.529  1.00 17.50  ?  74  ILE B C    1 
ATOM   4510  O  O    . ILE B  1 74  ? -19.675 0.076   -4.517  1.00 18.34  ?  74  ILE B O    1 
ATOM   4511  C  CB   . ILE B  1 74  ? -21.413 2.148   -6.529  1.00 21.23  ?  74  ILE B CB   1 
ATOM   4512  C  CG1  . ILE B  1 74  ? -22.098 2.090   -7.913  1.00 23.53  ?  74  ILE B CG1  1 
ATOM   4513  C  CG2  . ILE B  1 74  ? -19.977 2.518   -6.706  1.00 21.01  ?  74  ILE B CG2  1 
ATOM   4514  C  CD1  . ILE B  1 74  ? -22.296 3.475   -8.549  1.00 25.23  ?  74  ILE B CD1  1 
ATOM   4515  H  H    . ILE B  1 74  ? -23.499 1.281   -5.589  1.00 23.29  ?  74  ILE B H    1 
ATOM   4516  H  HA   . ILE B  1 74  ? -21.303 0.100   -6.378  1.00 22.66  ?  74  ILE B HA   1 
ATOM   4517  H  HB   . ILE B  1 74  ? -21.842 2.844   -6.007  1.00 25.48  ?  74  ILE B HB   1 
ATOM   4518  H  HG12 . ILE B  1 74  ? -21.549 1.562   -8.514  1.00 28.24  ?  74  ILE B HG12 1 
ATOM   4519  H  HG13 . ILE B  1 74  ? -22.971 1.679   -7.816  1.00 28.24  ?  74  ILE B HG13 1 
ATOM   4520  H  HG21 . ILE B  1 74  ? -19.925 3.363   -7.180  1.00 25.22  ?  74  ILE B HG21 1 
ATOM   4521  H  HG22 . ILE B  1 74  ? -19.562 2.602   -5.833  1.00 25.22  ?  74  ILE B HG22 1 
ATOM   4522  H  HG23 . ILE B  1 74  ? -19.533 1.824   -7.218  1.00 25.22  ?  74  ILE B HG23 1 
ATOM   4523  H  HD11 . ILE B  1 74  ? -22.728 3.368   -9.411  1.00 30.28  ?  74  ILE B HD11 1 
ATOM   4524  H  HD12 . ILE B  1 74  ? -22.852 4.014   -7.964  1.00 30.28  ?  74  ILE B HD12 1 
ATOM   4525  H  HD13 . ILE B  1 74  ? -21.430 3.897   -8.663  1.00 30.28  ?  74  ILE B HD13 1 
ATOM   4526  N  N    . LEU B  1 75  ? -21.101 1.452   -3.471  1.00 18.87  ?  75  LEU B N    1 
ATOM   4527  C  CA   . LEU B  1 75  ? -20.266 1.461   -2.267  1.00 18.67  ?  75  LEU B CA   1 
ATOM   4528  C  C    . LEU B  1 75  ? -20.160 0.063   -1.647  1.00 19.56  ?  75  LEU B C    1 
ATOM   4529  O  O    . LEU B  1 75  ? -19.079 -0.345  -1.196  1.00 18.36  ?  75  LEU B O    1 
ATOM   4530  C  CB   . LEU B  1 75  ? -20.816 2.480   -1.262  1.00 16.99  ?  75  LEU B CB   1 
ATOM   4531  C  CG   . LEU B  1 75  ? -20.611 3.957   -1.608  1.00 19.90  ?  75  LEU B CG   1 
ATOM   4532  C  CD1  . LEU B  1 75  ? -21.482 4.824   -0.716  1.00 20.98  ?  75  LEU B CD1  1 
ATOM   4533  C  CD2  . LEU B  1 75  ? -19.122 4.336   -1.444  1.00 22.37  ?  75  LEU B CD2  1 
ATOM   4534  H  H    . LEU B  1 75  ? -21.819 1.923   -3.421  1.00 22.64  ?  75  LEU B H    1 
ATOM   4535  H  HA   . LEU B  1 75  ? -19.371 1.742   -2.512  1.00 22.41  ?  75  LEU B HA   1 
ATOM   4536  H  HB2  . LEU B  1 75  ? -21.771 2.335   -1.174  1.00 20.38  ?  75  LEU B HB2  1 
ATOM   4537  H  HB3  . LEU B  1 75  ? -20.387 2.323   -0.406  1.00 20.38  ?  75  LEU B HB3  1 
ATOM   4538  H  HG   . LEU B  1 75  ? -20.867 4.111   -2.530  1.00 23.88  ?  75  LEU B HG   1 
ATOM   4539  H  HD11 . LEU B  1 75  ? -21.340 5.755   -0.947  1.00 25.18  ?  75  LEU B HD11 1 
ATOM   4540  H  HD12 . LEU B  1 75  ? -22.411 4.585   -0.855  1.00 25.18  ?  75  LEU B HD12 1 
ATOM   4541  H  HD13 . LEU B  1 75  ? -21.235 4.671   0.210   1.00 25.18  ?  75  LEU B HD13 1 
ATOM   4542  H  HD21 . LEU B  1 75  ? -19.009 5.274   -1.666  1.00 26.84  ?  75  LEU B HD21 1 
ATOM   4543  H  HD22 . LEU B  1 75  ? -18.855 4.180   -0.524  1.00 26.84  ?  75  LEU B HD22 1 
ATOM   4544  H  HD23 . LEU B  1 75  ? -18.589 3.788   -2.041  1.00 26.84  ?  75  LEU B HD23 1 
ATOM   4545  N  N    . THR B  1 76  ? -21.270 -0.674  -1.617  1.00 17.45  ?  76  THR B N    1 
ATOM   4546  C  CA   . THR B  1 76  ? -21.266 -2.047  -1.103  1.00 18.73  ?  76  THR B CA   1 
ATOM   4547  C  C    . THR B  1 76  ? -20.369 -2.946  -1.939  1.00 17.47  ?  76  THR B C    1 
ATOM   4548  O  O    . THR B  1 76  ? -19.532 -3.679  -1.394  1.00 17.83  ?  76  THR B O    1 
ATOM   4549  C  CB   . THR B  1 76  ? -22.711 -2.563  -1.042  1.00 21.07  ?  76  THR B CB   1 
ATOM   4550  O  OG1  . THR B  1 76  ? -23.426 -1.739  -0.122  1.00 23.98  ?  76  THR B OG1  1 
ATOM   4551  C  CG2  . THR B  1 76  ? -22.795 -4.016  -0.562  1.00 21.96  ?  76  THR B CG2  1 
ATOM   4552  H  H    . THR B  1 76  ? -22.040 -0.404  -1.888  1.00 20.93  ?  76  THR B H    1 
ATOM   4553  H  HA   . THR B  1 76  ? -20.916 -2.041  -0.199  1.00 22.48  ?  76  THR B HA   1 
ATOM   4554  H  HB   . THR B  1 76  ? -23.118 -2.502  -1.920  1.00 25.28  ?  76  THR B HB   1 
ATOM   4555  H  HG1  . THR B  1 76  ? -23.415 -0.941  -0.383  1.00 28.78  ?  76  THR B HG1  1 
ATOM   4556  H  HG21 . THR B  1 76  ? -23.721 -4.303  -0.537  1.00 26.35  ?  76  THR B HG21 1 
ATOM   4557  H  HG22 . THR B  1 76  ? -22.302 -4.594  -1.166  1.00 26.35  ?  76  THR B HG22 1 
ATOM   4558  H  HG23 . THR B  1 76  ? -22.417 -4.094  0.327   1.00 26.35  ?  76  THR B HG23 1 
ATOM   4559  N  N    . SER B  1 77  ? -20.481 -2.865  -3.275  1.00 18.22  ?  77  SER B N    1 
ATOM   4560  C  CA   . SER B  1 77  ? -19.642 -3.715  -4.101  1.00 17.16  ?  77  SER B CA   1 
ATOM   4561  C  C    . SER B  1 77  ? -18.181 -3.298  -4.050  1.00 18.14  ?  77  SER B C    1 
ATOM   4562  O  O    . SER B  1 77  ? -17.304 -4.146  -4.241  1.00 18.00  ?  77  SER B O    1 
ATOM   4563  C  CB   . SER B  1 77  ? -20.141 -3.698  -5.542  1.00 18.94  ?  77  SER B CB   1 
ATOM   4564  O  OG   . SER B  1 77  ? -21.345 -4.448  -5.580  1.00 20.89  ?  77  SER B OG   1 
ATOM   4565  H  H    . SER B  1 77  ? -21.015 -2.346  -3.704  1.00 21.86  ?  77  SER B H    1 
ATOM   4566  H  HA   . SER B  1 77  ? -19.703 -4.627  -3.776  1.00 20.60  ?  77  SER B HA   1 
ATOM   4567  H  HB2  . SER B  1 77  ? -20.317 -2.784  -5.816  1.00 22.73  ?  77  SER B HB2  1 
ATOM   4568  H  HB3  . SER B  1 77  ? -19.481 -4.109  -6.122  1.00 22.73  ?  77  SER B HB3  1 
ATOM   4569  H  HG   . SER B  1 77  ? -21.652 -4.461  -6.362  1.00 25.07  ?  77  SER B HG   1 
HETATM 4570  N  N    . MSE B  1 78  ? -17.898 -2.028  -3.738  1.00 16.76  ?  78  MSE B N    1 
HETATM 4571  C  CA   . MSE B  1 78  ? -16.507 -1.626  -3.517  1.00 16.01  ?  78  MSE B CA   1 
HETATM 4572  C  C    . MSE B  1 78  ? -15.930 -2.248  -2.237  1.00 17.07  ?  78  MSE B C    1 
HETATM 4573  O  O    . MSE B  1 78  ? -14.751 -2.590  -2.223  1.00 17.10  ?  78  MSE B O    1 
HETATM 4574  C  CB   . MSE B  1 78  ? -16.392 -0.115  -3.476  1.00 15.74  ?  78  MSE B CB   1 
HETATM 4575  C  CG   . MSE B  1 78  ? -16.583 0.485   -4.861  1.00 15.54  ?  78  MSE B CG   1 
HETATM 4576  SE SE   . MSE B  1 78  ? -16.672 2.389   -4.770  1.00 21.00  ?  78  MSE B SE   1 
HETATM 4577  C  CE   . MSE B  1 78  ? -14.869 2.716   -4.304  1.00 18.07  ?  78  MSE B CE   1 
HETATM 4578  H  H    . MSE B  1 78  ? -18.477 -1.398  -3.650  1.00 20.12  ?  78  MSE B H    1 
HETATM 4579  H  HA   . MSE B  1 78  ? -15.979 -1.935  -4.270  1.00 19.21  ?  78  MSE B HA   1 
HETATM 4580  H  HB2  . MSE B  1 78  ? -17.077 0.244   -2.890  1.00 18.88  ?  78  MSE B HB2  1 
HETATM 4581  H  HB3  . MSE B  1 78  ? -15.511 0.132   -3.155  1.00 18.88  ?  78  MSE B HB3  1 
HETATM 4582  H  HG2  . MSE B  1 78  ? -15.832 0.240   -5.424  1.00 18.65  ?  78  MSE B HG2  1 
HETATM 4583  H  HG3  . MSE B  1 78  ? -17.412 0.158   -5.243  1.00 18.65  ?  78  MSE B HG3  1 
HETATM 4584  H  HE1  . MSE B  1 78  ? -14.735 3.673   -4.214  1.00 21.69  ?  78  MSE B HE1  1 
HETATM 4585  H  HE2  . MSE B  1 78  ? -14.675 2.274   -3.463  1.00 21.69  ?  78  MSE B HE2  1 
HETATM 4586  H  HE3  . MSE B  1 78  ? -14.294 2.366   -5.002  1.00 21.69  ?  78  MSE B HE3  1 
ATOM   4587  N  N    . ASP B  1 79  ? -16.758 -2.433  -1.195  1.00 17.79  ?  79  ASP B N    1 
ATOM   4588  C  CA   . ASP B  1 79  ? -16.330 -3.273  -0.069  1.00 18.10  ?  79  ASP B CA   1 
ATOM   4589  C  C    . ASP B  1 79  ? -15.914 -4.660  -0.565  1.00 16.56  ?  79  ASP B C    1 
ATOM   4590  O  O    . ASP B  1 79  ? -14.871 -5.202  -0.166  1.00 16.85  ?  79  ASP B O    1 
ATOM   4591  C  CB   . ASP B  1 79  ? -17.442 -3.452  0.966   1.00 15.87  ?  79  ASP B CB   1 
ATOM   4592  C  CG   . ASP B  1 79  ? -17.605 -2.300  1.936   1.00 19.71  ?  79  ASP B CG   1 
ATOM   4593  O  OD1  . ASP B  1 79  ? -16.829 -1.322  1.938   1.00 18.10  ?  79  ASP B OD1  1 
ATOM   4594  O  OD2  . ASP B  1 79  ? -18.553 -2.410  2.746   1.00 18.71  -1 79  ASP B OD2  1 
ATOM   4595  H  H    . ASP B  1 79  ? -17.545 -2.094  -1.119  1.00 21.35  ?  79  ASP B H    1 
ATOM   4596  H  HA   . ASP B  1 79  ? -15.568 -2.862  0.368   1.00 21.73  ?  79  ASP B HA   1 
ATOM   4597  H  HB2  . ASP B  1 79  ? -18.284 -3.561  0.497   1.00 19.04  ?  79  ASP B HB2  1 
ATOM   4598  H  HB3  . ASP B  1 79  ? -17.253 -4.248  1.486   1.00 19.04  ?  79  ASP B HB3  1 
ATOM   4599  N  N    . THR B  1 80  ? -16.760 -5.273  -1.403  1.00 16.55  ?  80  THR B N    1 
ATOM   4600  C  CA   . THR B  1 80  ? -16.446 -6.593  -1.926  1.00 17.81  ?  80  THR B CA   1 
ATOM   4601  C  C    . THR B  1 80  ? -15.119 -6.591  -2.683  1.00 18.60  ?  80  THR B C    1 
ATOM   4602  O  O    . THR B  1 80  ? -14.310 -7.512  -2.530  1.00 18.82  ?  80  THR B O    1 
ATOM   4603  C  CB   . THR B  1 80  ? -17.596 -7.066  -2.811  1.00 19.14  ?  80  THR B CB   1 
ATOM   4604  O  OG1  . THR B  1 80  ? -18.801 -6.868  -2.077  1.00 17.83  ?  80  THR B OG1  1 
ATOM   4605  C  CG2  . THR B  1 80  ? -17.445 -8.553  -3.180  1.00 16.99  ?  80  THR B CG2  1 
ATOM   4606  H  H    . THR B  1 80  ? -17.507 -4.946  -1.676  1.00 19.85  ?  80  THR B H    1 
ATOM   4607  H  HA   . THR B  1 80  ? -16.366 -7.214  -1.185  1.00 21.38  ?  80  THR B HA   1 
ATOM   4608  H  HB   . THR B  1 80  ? -17.619 -6.542  -3.627  1.00 22.97  ?  80  THR B HB   1 
ATOM   4609  H  HG1  . THR B  1 80  ? -19.460 -7.118  -2.533  1.00 21.39  ?  80  THR B HG1  1 
ATOM   4610  H  HG21 . THR B  1 80  ? -18.186 -8.832  -3.742  1.00 20.39  ?  80  THR B HG21 1 
ATOM   4611  H  HG22 . THR B  1 80  ? -16.615 -8.693  -3.662  1.00 20.39  ?  80  THR B HG22 1 
ATOM   4612  H  HG23 . THR B  1 80  ? -17.439 -9.095  -2.376  1.00 20.39  ?  80  THR B HG23 1 
ATOM   4613  N  N    . LEU B  1 81  ? -14.890 -5.571  -3.519  1.00 17.47  ?  81  LEU B N    1 
ATOM   4614  C  CA   . LEU B  1 81  ? -13.622 -5.481  -4.232  1.00 18.33  ?  81  LEU B CA   1 
ATOM   4615  C  C    . LEU B  1 81  ? -12.445 -5.471  -3.260  1.00 16.75  ?  81  LEU B C    1 
ATOM   4616  O  O    . LEU B  1 81  ? -11.438 -6.139  -3.491  1.00 19.72  ?  81  LEU B O    1 
ATOM   4617  C  CB   . LEU B  1 81  ? -13.572 -4.238  -5.130  1.00 18.57  ?  81  LEU B CB   1 
ATOM   4618  C  CG   . LEU B  1 81  ? -14.586 -4.094  -6.265  1.00 21.18  ?  81  LEU B CG   1 
ATOM   4619  C  CD1  . LEU B  1 81  ? -14.375 -2.733  -6.954  1.00 23.24  ?  81  LEU B CD1  1 
ATOM   4620  C  CD2  . LEU B  1 81  ? -14.469 -5.215  -7.288  1.00 22.61  ?  81  LEU B CD2  1 
ATOM   4621  H  H    . LEU B  1 81  ? -15.443 -4.934  -3.685  1.00 20.96  ?  81  LEU B H    1 
ATOM   4622  H  HA   . LEU B  1 81  ? -13.528 -6.260  -4.802  1.00 21.99  ?  81  LEU B HA   1 
ATOM   4623  H  HB2  . LEU B  1 81  ? -13.681 -3.460  -4.561  1.00 22.28  ?  81  LEU B HB2  1 
ATOM   4624  H  HB3  . LEU B  1 81  ? -12.693 -4.206  -5.538  1.00 22.28  ?  81  LEU B HB3  1 
ATOM   4625  H  HG   . LEU B  1 81  ? -15.483 -4.112  -5.896  1.00 25.41  ?  81  LEU B HG   1 
ATOM   4626  H  HD11 . LEU B  1 81  ? -15.018 -2.641  -7.674  1.00 27.89  ?  81  LEU B HD11 1 
ATOM   4627  H  HD12 . LEU B  1 81  ? -14.504 -2.026  -6.302  1.00 27.89  ?  81  LEU B HD12 1 
ATOM   4628  H  HD13 . LEU B  1 81  ? -13.473 -2.696  -7.309  1.00 27.89  ?  81  LEU B HD13 1 
ATOM   4629  H  HD21 . LEU B  1 81  ? -15.131 -5.077  -7.983  1.00 27.14  ?  81  LEU B HD21 1 
ATOM   4630  H  HD22 . LEU B  1 81  ? -13.578 -5.200  -7.671  1.00 27.14  ?  81  LEU B HD22 1 
ATOM   4631  H  HD23 . LEU B  1 81  ? -14.625 -6.063  -6.845  1.00 27.14  ?  81  LEU B HD23 1 
ATOM   4632  N  N    . LEU B  1 82  ? -12.534 -4.699  -2.179  1.00 17.52  ?  82  LEU B N    1 
ATOM   4633  C  CA   . LEU B  1 82  ? -11.443 -4.684  -1.204  1.00 18.93  ?  82  LEU B CA   1 
ATOM   4634  C  C    . LEU B  1 82  ? -11.212 -6.055  -0.573  1.00 22.35  ?  82  LEU B C    1 
ATOM   4635  O  O    . LEU B  1 82  ? -10.056 -6.483  -0.391  1.00 21.64  ?  82  LEU B O    1 
ATOM   4636  C  CB   . LEU B  1 82  ? -11.719 -3.652  -0.112  1.00 19.54  ?  82  LEU B CB   1 
ATOM   4637  C  CG   . LEU B  1 82  ? -11.652 -2.185  -0.538  1.00 20.70  ?  82  LEU B CG   1 
ATOM   4638  C  CD1  . LEU B  1 82  ? -12.003 -1.329  0.688   1.00 23.43  ?  82  LEU B CD1  1 
ATOM   4639  C  CD2  . LEU B  1 82  ? -10.252 -1.811  -1.079  1.00 21.48  ?  82  LEU B CD2  1 
ATOM   4640  H  H    . LEU B  1 82  ? -13.198 -4.187  -1.988  1.00 21.03  ?  82  LEU B H    1 
ATOM   4641  H  HA   . LEU B  1 82  ? -10.624 -4.425  -1.656  1.00 22.71  ?  82  LEU B HA   1 
ATOM   4642  H  HB2  . LEU B  1 82  ? -12.610 -3.810  0.237   1.00 23.44  ?  82  LEU B HB2  1 
ATOM   4643  H  HB3  . LEU B  1 82  ? -11.069 -3.777  0.597   1.00 23.44  ?  82  LEU B HB3  1 
ATOM   4644  H  HG   . LEU B  1 82  ? -12.308 -2.016  -1.232  1.00 24.84  ?  82  LEU B HG   1 
ATOM   4645  H  HD11 . LEU B  1 82  ? -11.966 -0.392  0.439   1.00 28.11  ?  82  LEU B HD11 1 
ATOM   4646  H  HD12 . LEU B  1 82  ? -12.897 -1.557  0.987   1.00 28.11  ?  82  LEU B HD12 1 
ATOM   4647  H  HD13 . LEU B  1 82  ? -11.362 -1.510  1.393   1.00 28.11  ?  82  LEU B HD13 1 
ATOM   4648  H  HD21 . LEU B  1 82  ? -10.254 -0.875  -1.336  1.00 25.78  ?  82  LEU B HD21 1 
ATOM   4649  H  HD22 . LEU B  1 82  ? -9.594  -1.962  -0.382  1.00 25.78  ?  82  LEU B HD22 1 
ATOM   4650  H  HD23 . LEU B  1 82  ? -10.053 -2.366  -1.849  1.00 25.78  ?  82  LEU B HD23 1 
ATOM   4651  N  N    . ALA B  1 83  ? -12.289 -6.737  -0.174  1.00 21.99  ?  83  ALA B N    1 
ATOM   4652  C  CA   . ALA B  1 83  ? -12.160 -8.079  0.391   1.00 21.99  ?  83  ALA B CA   1 
ATOM   4653  C  C    . ALA B  1 83  ? -11.589 -9.068  -0.611  1.00 22.25  ?  83  ALA B C    1 
ATOM   4654  O  O    . ALA B  1 83  ? -10.925 -10.033 -0.219  1.00 26.19  ?  83  ALA B O    1 
ATOM   4655  C  CB   . ALA B  1 83  ? -13.511 -8.558  0.898   1.00 20.53  ?  83  ALA B CB   1 
ATOM   4656  H  H    . ALA B  1 83  ? -13.098 -6.447  -0.221  1.00 26.38  ?  83  ALA B H    1 
ATOM   4657  H  HA   . ALA B  1 83  ? -11.555 -8.042  1.148   1.00 26.39  ?  83  ALA B HA   1 
ATOM   4658  H  HB1  . ALA B  1 83  ? -13.411 -9.448  1.270   1.00 24.64  ?  83  ALA B HB1  1 
ATOM   4659  H  HB2  . ALA B  1 83  ? -13.826 -7.946  1.582   1.00 24.64  ?  83  ALA B HB2  1 
ATOM   4660  H  HB3  . ALA B  1 83  ? -14.137 -8.577  0.157   1.00 24.64  ?  83  ALA B HB3  1 
ATOM   4661  N  N    . LEU B  1 84  ? -11.806 -8.840  -1.903  1.00 20.19  ?  84  LEU B N    1 
ATOM   4662  C  CA   . LEU B  1 84  ? -11.316 -9.770  -2.921  1.00 20.64  ?  84  LEU B CA   1 
ATOM   4663  C  C    . LEU B  1 84  ? -9.826  -9.627  -3.205  1.00 27.72  ?  84  LEU B C    1 
ATOM   4664  O  O    . LEU B  1 84  ? -9.250  -10.529 -3.816  1.00 33.56  ?  84  LEU B O    1 
ATOM   4665  C  CB   . LEU B  1 84  ? -12.096 -9.610  -4.220  1.00 21.83  ?  84  LEU B CB   1 
ATOM   4666  C  CG   . LEU B  1 84  ? -13.513 -10.200 -4.185  1.00 20.96  ?  84  LEU B CG   1 
ATOM   4667  C  CD1  . LEU B  1 84  ? -14.314 -9.793  -5.427  1.00 23.56  ?  84  LEU B CD1  1 
ATOM   4668  C  CD2  . LEU B  1 84  ? -13.507 -11.730 -4.021  1.00 25.31  ?  84  LEU B CD2  1 
ATOM   4669  H  H    . LEU B  1 84  ? -12.229 -8.160  -2.217  1.00 24.23  ?  84  LEU B H    1 
ATOM   4670  H  HA   . LEU B  1 84  ? -11.465 -10.674 -2.603  1.00 24.76  ?  84  LEU B HA   1 
ATOM   4671  H  HB2  . LEU B  1 84  ? -12.176 -8.664  -4.420  1.00 26.20  ?  84  LEU B HB2  1 
ATOM   4672  H  HB3  . LEU B  1 84  ? -11.609 -10.055 -4.932  1.00 26.20  ?  84  LEU B HB3  1 
ATOM   4673  H  HG   . LEU B  1 84  ? -13.973 -9.832  -3.415  1.00 25.15  ?  84  LEU B HG   1 
ATOM   4674  H  HD11 . LEU B  1 84  ? -15.201 -10.183 -5.371  1.00 28.27  ?  84  LEU B HD11 1 
ATOM   4675  H  HD12 . LEU B  1 84  ? -14.379 -8.826  -5.458  1.00 28.27  ?  84  LEU B HD12 1 
ATOM   4676  H  HD13 . LEU B  1 84  ? -13.858 -10.120 -6.218  1.00 28.27  ?  84  LEU B HD13 1 
ATOM   4677  H  HD21 . LEU B  1 84  ? -14.423 -12.049 -4.006  1.00 30.38  ?  84  LEU B HD21 1 
ATOM   4678  H  HD22 . LEU B  1 84  ? -13.032 -12.125 -4.769  1.00 30.38  ?  84  LEU B HD22 1 
ATOM   4679  H  HD23 . LEU B  1 84  ? -13.063 -11.956 -3.189  1.00 30.38  ?  84  LEU B HD23 1 
ATOM   4680  N  N    . GLY B  1 85  ? -9.206  -8.510  -2.841  1.00 24.84  ?  85  GLY B N    1 
ATOM   4681  C  CA   . GLY B  1 85  ? -7.762  -8.417  -2.830  1.00 28.06  ?  85  GLY B CA   1 
ATOM   4682  C  C    . GLY B  1 85  ? -7.156  -7.799  -4.081  1.00 27.71  ?  85  GLY B C    1 
ATOM   4683  O  O    . GLY B  1 85  ? -7.786  -7.010  -4.790  1.00 26.00  ?  85  GLY B O    1 
ATOM   4684  H  H    . GLY B  1 85  ? -9.606  -7.790  -2.596  1.00 29.81  ?  85  GLY B H    1 
ATOM   4685  H  HA2  . GLY B  1 85  ? -7.486  -7.883  -2.069  1.00 33.67  ?  85  GLY B HA2  1 
ATOM   4686  H  HA3  . GLY B  1 85  ? -7.389  -9.306  -2.724  1.00 33.67  ?  85  GLY B HA3  1 
ATOM   4687  N  N    . PRO B  1 86  ? -5.889  -8.152  -4.376  1.00 30.95  ?  86  PRO B N    1 
ATOM   4688  C  CA   . PRO B  1 86  ? -5.111  -7.368  -5.361  1.00 27.95  ?  86  PRO B CA   1 
ATOM   4689  C  C    . PRO B  1 86  ? -5.639  -7.346  -6.778  1.00 27.62  ?  86  PRO B C    1 
ATOM   4690  O  O    . PRO B  1 86  ? -5.504  -6.321  -7.454  1.00 35.57  ?  86  PRO B O    1 
ATOM   4691  C  CB   . PRO B  1 86  ? -3.732  -8.046  -5.321  1.00 41.61  ?  86  PRO B CB   1 
ATOM   4692  C  CG   . PRO B  1 86  ? -3.654  -8.662  -4.003  1.00 40.47  ?  86  PRO B CG   1 
ATOM   4693  C  CD   . PRO B  1 86  ? -5.037  -9.083  -3.615  1.00 35.88  ?  86  PRO B CD   1 
ATOM   4694  H  HA   . PRO B  1 86  ? -5.018  -6.454  -5.051  1.00 33.54  ?  86  PRO B HA   1 
ATOM   4695  H  HB2  . PRO B  1 86  ? -3.677  -8.718  -6.018  1.00 49.93  ?  86  PRO B HB2  1 
ATOM   4696  H  HB3  . PRO B  1 86  ? -3.036  -7.379  -5.431  1.00 49.93  ?  86  PRO B HB3  1 
ATOM   4697  H  HG2  . PRO B  1 86  ? -3.068  -9.434  -4.045  1.00 48.57  ?  86  PRO B HG2  1 
ATOM   4698  H  HG3  . PRO B  1 86  ? -3.311  -8.014  -3.368  1.00 48.57  ?  86  PRO B HG3  1 
ATOM   4699  H  HD2  . PRO B  1 86  ? -5.203  -9.998  -3.891  1.00 43.05  ?  86  PRO B HD2  1 
ATOM   4700  H  HD3  . PRO B  1 86  ? -5.173  -8.966  -2.662  1.00 43.05  ?  86  PRO B HD3  1 
ATOM   4701  N  N    . ASP B  1 87  ? -6.215  -8.444  -7.268  1.00 36.12  ?  87  ASP B N    1 
ATOM   4702  C  CA   . ASP B  1 87  ? -6.751  -8.443  -8.626  1.00 39.77  ?  87  ASP B CA   1 
ATOM   4703  C  C    . ASP B  1 87  ? -7.913  -7.470  -8.811  1.00 35.04  ?  87  ASP B C    1 
ATOM   4704  O  O    . ASP B  1 87  ? -8.371  -7.282  -9.948  1.00 30.43  ?  87  ASP B O    1 
ATOM   4705  C  CB   . ASP B  1 87  ? -7.232  -9.850  -9.008  1.00 34.27  ?  87  ASP B CB   1 
ATOM   4706  C  CG   . ASP B  1 87  ? -6.096  -10.820 -9.211  1.00 55.43  ?  87  ASP B CG   1 
ATOM   4707  O  OD1  . ASP B  1 87  ? -4.970  -10.354 -9.470  1.00 46.59  ?  87  ASP B OD1  1 
ATOM   4708  O  OD2  . ASP B  1 87  ? -6.339  -12.044 -9.115  1.00 53.93  -1 87  ASP B OD2  1 
ATOM   4709  H  H    . ASP B  1 87  ? -6.306  -9.186  -6.844  1.00 43.35  ?  87  ASP B H    1 
ATOM   4710  H  HA   . ASP B  1 87  ? -6.047  -8.189  -9.243  1.00 47.73  ?  87  ASP B HA   1 
ATOM   4711  H  HB2  . ASP B  1 87  ? -7.797  -10.194 -8.298  1.00 41.12  ?  87  ASP B HB2  1 
ATOM   4712  H  HB3  . ASP B  1 87  ? -7.734  -9.798  -9.836  1.00 41.12  ?  87  ASP B HB3  1 
ATOM   4713  N  N    . PHE B  1 88  ? -8.422  -6.872  -7.729  1.00 29.80  ?  88  PHE B N    1 
ATOM   4714  C  CA   . PHE B  1 88  ? -9.601  -6.031  -7.806  1.00 25.71  ?  88  PHE B CA   1 
ATOM   4715  C  C    . PHE B  1 88  ? -9.345  -4.606  -7.352  1.00 33.98  ?  88  PHE B C    1 
ATOM   4716  O  O    . PHE B  1 88  ? -10.266 -3.785  -7.364  1.00 25.05  ?  88  PHE B O    1 
ATOM   4717  C  CB   . PHE B  1 88  ? -10.722 -6.661  -6.979  1.00 25.01  ?  88  PHE B CB   1 
ATOM   4718  C  CG   . PHE B  1 88  ? -11.178 -7.986  -7.534  1.00 23.94  ?  88  PHE B CG   1 
ATOM   4719  C  CD1  . PHE B  1 88  ? -10.507 -9.158  -7.222  1.00 29.82  ?  88  PHE B CD1  1 
ATOM   4720  C  CD2  . PHE B  1 88  ? -12.261 -8.054  -8.398  1.00 30.70  ?  88  PHE B CD2  1 
ATOM   4721  C  CE1  . PHE B  1 88  ? -10.916 -10.364 -7.740  1.00 30.82  ?  88  PHE B CE1  1 
ATOM   4722  C  CE2  . PHE B  1 88  ? -12.670 -9.275  -8.917  1.00 31.29  ?  88  PHE B CE2  1 
ATOM   4723  C  CZ   . PHE B  1 88  ? -12.002 -10.422 -8.583  1.00 32.19  ?  88  PHE B CZ   1 
ATOM   4724  H  H    . PHE B  1 88  ? -8.094  -6.943  -6.937  1.00 35.76  ?  88  PHE B H    1 
ATOM   4725  H  HA   . PHE B  1 88  ? -9.899  -5.997  -8.729  1.00 30.85  ?  88  PHE B HA   1 
ATOM   4726  H  HB2  . PHE B  1 88  ? -10.404 -6.808  -6.074  1.00 30.01  ?  88  PHE B HB2  1 
ATOM   4727  H  HB3  . PHE B  1 88  ? -11.484 -6.061  -6.970  1.00 30.01  ?  88  PHE B HB3  1 
ATOM   4728  H  HD1  . PHE B  1 88  ? -9.775  -9.129  -6.649  1.00 35.78  ?  88  PHE B HD1  1 
ATOM   4729  H  HD2  . PHE B  1 88  ? -12.722 -7.279  -8.624  1.00 36.84  ?  88  PHE B HD2  1 
ATOM   4730  H  HE1  . PHE B  1 88  ? -10.461 -11.144 -7.515  1.00 36.99  ?  88  PHE B HE1  1 
ATOM   4731  H  HE2  . PHE B  1 88  ? -13.403 -9.314  -9.489  1.00 37.55  ?  88  PHE B HE2  1 
ATOM   4732  H  HZ   . PHE B  1 88  ? -12.276 -11.239 -8.935  1.00 38.63  ?  88  PHE B HZ   1 
ATOM   4733  N  N    . LEU B  1 89  ? -8.104  -4.273  -7.022  1.00 26.81  ?  89  LEU B N    1 
ATOM   4734  C  CA   A LEU B  1 89  ? -7.812  -2.952  -6.472  0.19 31.98  ?  89  LEU B CA   1 
ATOM   4735  C  CA   B LEU B  1 89  ? -7.828  -2.955  -6.473  0.81 30.80  ?  89  LEU B CA   1 
ATOM   4736  C  C    . LEU B  1 89  ? -7.851  -1.877  -7.551  1.00 29.22  ?  89  LEU B C    1 
ATOM   4737  O  O    . LEU B  1 89  ? -8.267  -0.742  -7.289  1.00 26.46  ?  89  LEU B O    1 
ATOM   4738  C  CB   A LEU B  1 89  ? -6.451  -2.964  -5.772  0.19 32.13  ?  89  LEU B CB   1 
ATOM   4739  C  CB   B LEU B  1 89  ? -6.487  -3.007  -5.747  0.81 29.88  ?  89  LEU B CB   1 
ATOM   4740  C  CG   A LEU B  1 89  ? -6.455  -2.809  -4.249  0.19 34.36  ?  89  LEU B CG   1 
ATOM   4741  C  CG   B LEU B  1 89  ? -5.989  -1.736  -5.078  0.81 31.18  ?  89  LEU B CG   1 
ATOM   4742  C  CD1  A LEU B  1 89  ? -5.037  -2.908  -3.707  0.19 39.44  ?  89  LEU B CD1  1 
ATOM   4743  C  CD1  B LEU B  1 89  ? -7.053  -1.194  -4.115  0.81 38.09  ?  89  LEU B CD1  1 
ATOM   4744  C  CD2  A LEU B  1 89  ? -7.094  -1.490  -3.822  0.19 35.54  ?  89  LEU B CD2  1 
ATOM   4745  C  CD2  B LEU B  1 89  ? -4.702  -2.052  -4.334  0.81 39.58  ?  89  LEU B CD2  1 
ATOM   4746  H  H    A LEU B  1 89  ? -7.419  -4.786  -7.104  0.19 32.17  ?  89  LEU B H    1 
ATOM   4747  H  H    B LEU B  1 89  ? -7.416  -4.782  -7.104  0.81 32.17  ?  89  LEU B H    1 
ATOM   4748  H  HA   A LEU B  1 89  ? -8.486  -2.733  -5.809  0.19 38.37  ?  89  LEU B HA   1 
ATOM   4749  H  HA   B LEU B  1 89  ? -8.512  -2.738  -5.820  0.81 36.96  ?  89  LEU B HA   1 
ATOM   4750  H  HB2  A LEU B  1 89  ? -6.016  -3.807  -5.973  0.19 38.56  ?  89  LEU B HB2  1 
ATOM   4751  H  HB2  B LEU B  1 89  ? -6.548  -3.685  -5.056  0.81 35.85  ?  89  LEU B HB2  1 
ATOM   4752  H  HB3  A LEU B  1 89  ? -5.921  -2.236  -6.132  0.19 38.56  ?  89  LEU B HB3  1 
ATOM   4753  H  HB3  B LEU B  1 89  ? -5.811  -3.272  -6.390  0.81 35.85  ?  89  LEU B HB3  1 
ATOM   4754  H  HG   A LEU B  1 89  ? -6.974  -3.531  -3.861  0.19 41.23  ?  89  LEU B HG   1 
ATOM   4755  H  HG   B LEU B  1 89  ? -5.803  -1.062  -5.751  0.81 37.42  ?  89  LEU B HG   1 
ATOM   4756  H  HD11 A LEU B  1 89  ? -5.060  -2.808  -2.742  0.19 47.33  ?  89  LEU B HD11 1 
ATOM   4757  H  HD11 B LEU B  1 89  ? -6.718  -0.384  -3.698  0.81 45.71  ?  89  LEU B HD11 1 
ATOM   4758  H  HD12 A LEU B  1 89  ? -4.670  -3.775  -3.941  0.19 47.33  ?  89  LEU B HD12 1 
ATOM   4759  H  HD12 B LEU B  1 89  ? -7.861  -0.999  -4.615  0.81 45.71  ?  89  LEU B HD12 1 
ATOM   4760  H  HD13 A LEU B  1 89  ? -4.499  -2.203  -4.100  0.19 47.33  ?  89  LEU B HD13 1 
ATOM   4761  H  HD13 B LEU B  1 89  ? -7.236  -1.864  -3.438  0.81 45.71  ?  89  LEU B HD13 1 
ATOM   4762  H  HD21 A LEU B  1 89  ? -7.077  -1.430  -2.854  0.19 42.65  ?  89  LEU B HD21 1 
ATOM   4763  H  HD21 B LEU B  1 89  ? -4.379  -1.245  -3.905  0.81 47.50  ?  89  LEU B HD21 1 
ATOM   4764  H  HD22 A LEU B  1 89  ? -6.590  -0.756  -4.209  0.19 42.65  ?  89  LEU B HD22 1 
ATOM   4765  H  HD22 B LEU B  1 89  ? -4.882  -2.733  -3.667  0.81 47.50  ?  89  LEU B HD22 1 
ATOM   4766  H  HD23 A LEU B  1 89  ? -8.010  -1.466  -4.140  0.19 42.65  ?  89  LEU B HD23 1 
ATOM   4767  H  HD23 B LEU B  1 89  ? -4.043  -2.377  -4.968  0.81 47.50  ?  89  LEU B HD23 1 
ATOM   4768  N  N    . THR B  1 90  ? -7.423  -2.199  -8.775  1.00 35.08  ?  90  THR B N    1 
ATOM   4769  C  CA   . THR B  1 90  ? -7.525  -1.212  -9.842  1.00 33.45  ?  90  THR B CA   1 
ATOM   4770  C  C    . THR B  1 90  ? -8.975  -0.834  -10.083 1.00 32.75  ?  90  THR B C    1 
ATOM   4771  O  O    . THR B  1 90  ? -9.294  0.338   -10.314 1.00 28.20  ?  90  THR B O    1 
ATOM   4772  C  CB   . THR B  1 90  ? -6.898  -1.744  -11.133 1.00 37.88  ?  90  THR B CB   1 
ATOM   4773  O  OG1  . THR B  1 90  ? -5.491  -1.910  -10.937 1.00 36.70  ?  90  THR B OG1  1 
ATOM   4774  C  CG2  . THR B  1 90  ? -7.126  -0.772  -12.287 1.00 41.37  ?  90  THR B CG2  1 
ATOM   4775  H  H    . THR B  1 90  ? -7.081  -2.954  -9.004  1.00 42.10  ?  90  THR B H    1 
ATOM   4776  H  HA   . THR B  1 90  ? -7.044  -0.411  -9.581  1.00 40.14  ?  90  THR B HA   1 
ATOM   4777  H  HB   . THR B  1 90  ? -7.298  -2.597  -11.363 1.00 45.45  ?  90  THR B HB   1 
ATOM   4778  H  HG1  . THR B  1 90  ? -5.350  -2.455  -10.313 1.00 44.04  ?  90  THR B HG1  1 
ATOM   4779  H  HG21 . THR B  1 90  ? -6.724  -1.120  -13.099 1.00 49.64  ?  90  THR B HG21 1 
ATOM   4780  H  HG22 . THR B  1 90  ? -8.077  -0.649  -12.434 1.00 49.64  ?  90  THR B HG22 1 
ATOM   4781  H  HG23 . THR B  1 90  ? -6.726  0.088   -12.081 1.00 49.64  ?  90  THR B HG23 1 
ATOM   4782  N  N    . GLU B  1 91  ? -9.867  -1.822  -10.043 1.00 29.02  ?  91  GLU B N    1 
ATOM   4783  C  CA   . GLU B  1 91  ? -11.284 -1.549  -10.222 1.00 30.01  ?  91  GLU B CA   1 
ATOM   4784  C  C    . GLU B  1 91  ? -11.815 -0.683  -9.083  1.00 23.84  ?  91  GLU B C    1 
ATOM   4785  O  O    . GLU B  1 91  ? -12.614 0.231   -9.311  1.00 24.35  ?  91  GLU B O    1 
ATOM   4786  C  CB   . GLU B  1 91  ? -12.063 -2.869  -10.321 1.00 26.08  ?  91  GLU B CB   1 
ATOM   4787  C  CG   . GLU B  1 91  ? -13.531 -2.707  -10.659 1.00 26.65  ?  91  GLU B CG   1 
ATOM   4788  C  CD   . GLU B  1 91  ? -13.776 -2.282  -12.095 1.00 35.35  ?  91  GLU B CD   1 
ATOM   4789  O  OE1  . GLU B  1 91  ? -12.926 -2.592  -12.955 1.00 38.68  ?  91  GLU B OE1  1 
ATOM   4790  O  OE2  . GLU B  1 91  ? -14.810 -1.628  -12.361 1.00 30.07  -1 91  GLU B OE2  1 
ATOM   4791  H  H    . GLU B  1 91  ? -9.677  -2.651  -9.915  1.00 34.82  ?  91  GLU B H    1 
ATOM   4792  H  HA   . GLU B  1 91  ? -11.410 -1.063  -11.052 1.00 36.02  ?  91  GLU B HA   1 
ATOM   4793  H  HB2  . GLU B  1 91  ? -11.660 -3.416  -11.014 1.00 31.30  ?  91  GLU B HB2  1 
ATOM   4794  H  HB3  . GLU B  1 91  ? -12.007 -3.328  -9.469  1.00 31.30  ?  91  GLU B HB3  1 
ATOM   4795  H  HG2  . GLU B  1 91  ? -13.980 -3.555  -10.519 1.00 31.98  ?  91  GLU B HG2  1 
ATOM   4796  H  HG3  . GLU B  1 91  ? -13.913 -2.030  -10.079 1.00 31.98  ?  91  GLU B HG3  1 
ATOM   4797  N  N    . PHE B  1 92  ? -11.382 -0.958  -7.849  1.00 22.69  ?  92  PHE B N    1 
ATOM   4798  C  CA   . PHE B  1 92  ? -11.808 -0.129  -6.723  1.00 21.54  ?  92  PHE B CA   1 
ATOM   4799  C  C    . PHE B  1 92  ? -11.422 1.329   -6.946  1.00 24.34  ?  92  PHE B C    1 
ATOM   4800  O  O    . PHE B  1 92  ? -12.239 2.234   -6.758  1.00 23.75  ?  92  PHE B O    1 
ATOM   4801  C  CB   . PHE B  1 92  ? -11.180 -0.649  -5.437  1.00 20.48  ?  92  PHE B CB   1 
ATOM   4802  C  CG   . PHE B  1 92  ? -11.466 0.183   -4.219  1.00 19.60  ?  92  PHE B CG   1 
ATOM   4803  C  CD1  . PHE B  1 92  ? -10.664 1.250   -3.892  1.00 25.11  ?  92  PHE B CD1  1 
ATOM   4804  C  CD2  . PHE B  1 92  ? -12.529 -0.133  -3.391  1.00 18.81  ?  92  PHE B CD2  1 
ATOM   4805  C  CE1  . PHE B  1 92  ? -10.940 2.015   -2.762  1.00 25.79  ?  92  PHE B CE1  1 
ATOM   4806  C  CE2  . PHE B  1 92  ? -12.793 0.614   -2.266  1.00 19.53  ?  92  PHE B CE2  1 
ATOM   4807  C  CZ   . PHE B  1 92  ? -11.998 1.687   -1.960  1.00 21.17  ?  92  PHE B CZ   1 
ATOM   4808  H  H    . PHE B  1 92  ? -10.853 -1.604  -7.643  1.00 27.23  ?  92  PHE B H    1 
ATOM   4809  H  HA   . PHE B  1 92  ? -12.773 -0.179  -6.634  1.00 25.84  ?  92  PHE B HA   1 
ATOM   4810  H  HB2  . PHE B  1 92  ? -11.517 -1.543  -5.268  1.00 24.57  ?  92  PHE B HB2  1 
ATOM   4811  H  HB3  . PHE B  1 92  ? -10.218 -0.679  -5.553  1.00 24.57  ?  92  PHE B HB3  1 
ATOM   4812  H  HD1  . PHE B  1 92  ? -9.947  1.476   -4.441  1.00 30.13  ?  92  PHE B HD1  1 
ATOM   4813  H  HD2  . PHE B  1 92  ? -13.073 -0.858  -3.599  1.00 22.57  ?  92  PHE B HD2  1 
ATOM   4814  H  HE1  . PHE B  1 92  ? -10.399 2.740   -2.546  1.00 30.95  ?  92  PHE B HE1  1 
ATOM   4815  H  HE2  . PHE B  1 92  ? -13.515 0.397   -1.721  1.00 23.44  ?  92  PHE B HE2  1 
ATOM   4816  H  HZ   . PHE B  1 92  ? -12.177 2.194   -1.202  1.00 25.41  ?  92  PHE B HZ   1 
ATOM   4817  N  N    . LYS B  1 93  ? -10.166 1.571   -7.353  1.00 25.59  ?  93  LYS B N    1 
ATOM   4818  C  CA   . LYS B  1 93  ? -9.719  2.949   -7.552  1.00 32.79  ?  93  LYS B CA   1 
ATOM   4819  C  C    . LYS B  1 93  ? -10.516 3.638   -8.645  1.00 27.84  ?  93  LYS B C    1 
ATOM   4820  O  O    . LYS B  1 93  ? -10.899 4.802   -8.498  1.00 27.12  ?  93  LYS B O    1 
ATOM   4821  C  CB   . LYS B  1 93  ? -8.220  2.961   -7.856  1.00 28.98  ?  93  LYS B CB   1 
ATOM   4822  C  CG   . LYS B  1 93  ? -7.408  2.512   -6.658  1.00 35.11  ?  93  LYS B CG   1 
ATOM   4823  C  CD   . LYS B  1 93  ? -5.924  2.354   -6.987  1.00 47.96  ?  93  LYS B CD   1 
ATOM   4824  C  CE   . LYS B  1 93  ? -5.153  3.630   -6.713  1.00 63.19  ?  93  LYS B CE   1 
ATOM   4825  N  NZ   . LYS B  1 93  ? -3.808  3.616   -7.357  1.00 70.15  1  93  LYS B NZ   1 
ATOM   4826  H  H    . LYS B  1 93  ? -9.573  0.971   -7.515  1.00 30.71  ?  93  LYS B H    1 
ATOM   4827  H  HA   . LYS B  1 93  ? -9.857  3.443   -6.729  1.00 39.35  ?  93  LYS B HA   1 
ATOM   4828  H  HB2  . LYS B  1 93  ? -8.037  2.354   -8.591  1.00 34.78  ?  93  LYS B HB2  1 
ATOM   4829  H  HB3  . LYS B  1 93  ? -7.947  3.862   -8.088  1.00 34.78  ?  93  LYS B HB3  1 
ATOM   4830  H  HG2  . LYS B  1 93  ? -7.492  3.173   -5.953  1.00 42.13  ?  93  LYS B HG2  1 
ATOM   4831  H  HG3  . LYS B  1 93  ? -7.741  1.654   -6.352  1.00 42.13  ?  93  LYS B HG3  1 
ATOM   4832  H  HD2  . LYS B  1 93  ? -5.548  1.649   -6.438  1.00 57.56  ?  93  LYS B HD2  1 
ATOM   4833  H  HD3  . LYS B  1 93  ? -5.826  2.136   -7.927  1.00 57.56  ?  93  LYS B HD3  1 
ATOM   4834  H  HE2  . LYS B  1 93  ? -5.649  4.384   -7.066  1.00 75.83  ?  93  LYS B HE2  1 
ATOM   4835  H  HE3  . LYS B  1 93  ? -5.029  3.728   -5.756  1.00 75.83  ?  93  LYS B HE3  1 
ATOM   4836  H  HZ1  . LYS B  1 93  ? -3.379  4.375   -7.180  1.00 84.17  ?  93  LYS B HZ1  1 
ATOM   4837  H  HZ2  . LYS B  1 93  ? -3.329  2.933   -7.046  1.00 84.17  ?  93  LYS B HZ2  1 
ATOM   4838  H  HZ3  . LYS B  1 93  ? -3.894  3.530   -8.239  1.00 84.17  ?  93  LYS B HZ3  1 
ATOM   4839  N  N    . LYS B  1 94  ? -10.830 2.923   -9.734  1.00 26.55  ?  94  LYS B N    1 
ATOM   4840  C  CA   . LYS B  1 94  ? -11.633 3.508   -10.804 1.00 30.27  ?  94  LYS B CA   1 
ATOM   4841  C  C    . LYS B  1 94  ? -13.038 3.837   -10.330 1.00 35.19  ?  94  LYS B C    1 
ATOM   4842  O  O    . LYS B  1 94  ? -13.589 4.890   -10.667 1.00 30.06  ?  94  LYS B O    1 
ATOM   4843  C  CB   . LYS B  1 94  ? -11.706 2.550   -12.001 1.00 39.20  ?  94  LYS B CB   1 
ATOM   4844  C  CG   . LYS B  1 94  ? -10.381 2.305   -12.700 1.00 51.72  ?  94  LYS B CG   1 
ATOM   4845  C  CD   . LYS B  1 94  ? -10.564 1.438   -13.953 1.00 62.99  ?  94  LYS B CD   1 
ATOM   4846  C  CE   . LYS B  1 94  ? -9.240  1.199   -14.665 1.00 72.54  ?  94  LYS B CE   1 
ATOM   4847  N  NZ   . LYS B  1 94  ? -9.396  0.287   -15.829 1.00 87.88  1  94  LYS B NZ   1 
ATOM   4848  H  H    . LYS B  1 94  ? -10.592 2.109   -9.871  1.00 31.86  ?  94  LYS B H    1 
ATOM   4849  H  HA   . LYS B  1 94  ? -11.215 4.331   -11.102 1.00 36.33  ?  94  LYS B HA   1 
ATOM   4850  H  HB2  . LYS B  1 94  ? -12.037 1.692   -11.692 1.00 47.04  ?  94  LYS B HB2  1 
ATOM   4851  H  HB3  . LYS B  1 94  ? -12.319 2.919   -12.656 1.00 47.04  ?  94  LYS B HB3  1 
ATOM   4852  H  HG2  . LYS B  1 94  ? -9.999  3.155   -12.971 1.00 62.06  ?  94  LYS B HG2  1 
ATOM   4853  H  HG3  . LYS B  1 94  ? -9.779  1.844   -12.095 1.00 62.06  ?  94  LYS B HG3  1 
ATOM   4854  H  HD2  . LYS B  1 94  ? -10.930 0.578   -13.695 1.00 75.59  ?  94  LYS B HD2  1 
ATOM   4855  H  HD3  . LYS B  1 94  ? -11.163 1.888   -14.568 1.00 75.59  ?  94  LYS B HD3  1 
ATOM   4856  H  HE2  . LYS B  1 94  ? -8.893  2.046   -14.987 1.00 87.05  ?  94  LYS B HE2  1 
ATOM   4857  H  HE3  . LYS B  1 94  ? -8.612  0.794   -14.045 1.00 87.05  ?  94  LYS B HE3  1 
ATOM   4858  H  HZ1  . LYS B  1 94  ? -8.610  0.164   -16.227 1.00 105.46 ?  94  LYS B HZ1  1 
ATOM   4859  H  HZ2  . LYS B  1 94  ? -9.710  -0.500  -15.558 1.00 105.46 ?  94  LYS B HZ2  1 
ATOM   4860  H  HZ3  . LYS B  1 94  ? -9.965  0.639   -16.416 1.00 105.46 ?  94  LYS B HZ3  1 
ATOM   4861  N  N    . ARG B  1 95  ? -13.656 2.929   -9.571  1.00 25.43  ?  95  ARG B N    1 
ATOM   4862  C  CA   . ARG B  1 95  ? -15.000 3.191   -9.110  1.00 22.84  ?  95  ARG B CA   1 
ATOM   4863  C  C    . ARG B  1 95  ? -15.003 4.378   -8.173  1.00 25.44  ?  95  ARG B C    1 
ATOM   4864  O  O    . ARG B  1 95  ? -15.926 5.192   -8.201  1.00 23.83  ?  95  ARG B O    1 
ATOM   4865  C  CB   . ARG B  1 95  ? -15.576 1.972   -8.392  1.00 24.05  ?  95  ARG B CB   1 
ATOM   4866  C  CG   . ARG B  1 95  ? -15.830 0.769   -9.282  1.00 25.18  ?  95  ARG B CG   1 
ATOM   4867  C  CD   . ARG B  1 95  ? -16.980 0.940   -10.249 1.00 27.78  ?  95  ARG B CD   1 
ATOM   4868  N  NE   . ARG B  1 95  ? -16.951 -0.150  -11.221 1.00 28.60  ?  95  ARG B NE   1 
ATOM   4869  C  CZ   . ARG B  1 95  ? -17.909 -0.419  -12.099 1.00 29.34  ?  95  ARG B CZ   1 
ATOM   4870  N  NH1  . ARG B  1 95  ? -19.023 0.303   -12.143 1.00 32.92  1  95  ARG B NH1  1 
ATOM   4871  N  NH2  . ARG B  1 95  ? -17.747 -1.443  -12.928 1.00 31.13  ?  95  ARG B NH2  1 
ATOM   4872  H  H    . ARG B  1 95  ? -13.323 2.178   -9.319  1.00 30.52  ?  95  ARG B H    1 
ATOM   4873  H  HA   . ARG B  1 95  ? -15.567 3.397   -9.870  1.00 27.41  ?  95  ARG B HA   1 
ATOM   4874  H  HB2  . ARG B  1 95  ? -14.954 1.699   -7.700  1.00 28.86  ?  95  ARG B HB2  1 
ATOM   4875  H  HB3  . ARG B  1 95  ? -16.422 2.222   -7.988  1.00 28.86  ?  95  ARG B HB3  1 
ATOM   4876  H  HG2  . ARG B  1 95  ? -15.031 0.594   -9.803  1.00 30.22  ?  95  ARG B HG2  1 
ATOM   4877  H  HG3  . ARG B  1 95  ? -16.029 0.003   -8.721  1.00 30.22  ?  95  ARG B HG3  1 
ATOM   4878  H  HD2  . ARG B  1 95  ? -17.821 0.906   -9.767  1.00 33.34  ?  95  ARG B HD2  1 
ATOM   4879  H  HD3  . ARG B  1 95  ? -16.888 1.782   -10.721 1.00 33.34  ?  95  ARG B HD3  1 
ATOM   4880  H  HE   . ARG B  1 95  ? -16.257 -0.658  -11.224 1.00 34.32  ?  95  ARG B HE   1 
ATOM   4881  H  HH11 . ARG B  1 95  ? -19.127 0.966   -11.605 1.00 39.51  ?  95  ARG B HH11 1 
ATOM   4882  H  HH12 . ARG B  1 95  ? -19.636 0.114   -12.716 1.00 39.51  ?  95  ARG B HH12 1 
ATOM   4883  H  HH21 . ARG B  1 95  ? -17.027 -1.913  -12.896 1.00 37.35  ?  95  ARG B HH21 1 
ATOM   4884  H  HH22 . ARG B  1 95  ? -18.360 -1.635  -13.500 1.00 37.35  ?  95  ARG B HH22 1 
ATOM   4885  N  N    . ASN B  1 96  ? -13.980 4.470   -7.326  1.00 22.77  ?  96  ASN B N    1 
ATOM   4886  C  CA   . ASN B  1 96  ? -13.876 5.592   -6.397  1.00 24.01  ?  96  ASN B CA   1 
ATOM   4887  C  C    . ASN B  1 96  ? -13.662 6.904   -7.133  1.00 28.68  ?  96  ASN B C    1 
ATOM   4888  O  O    . ASN B  1 96  ? -14.239 7.931   -6.758  1.00 24.99  ?  96  ASN B O    1 
ATOM   4889  C  CB   . ASN B  1 96  ? -12.744 5.349   -5.402  1.00 23.20  ?  96  ASN B CB   1 
ATOM   4890  C  CG   . ASN B  1 96  ? -13.019 5.970   -4.050  1.00 23.13  ?  96  ASN B CG   1 
ATOM   4891  O  OD1  . ASN B  1 96  ? -14.150 6.002   -3.595  1.00 21.59  ?  96  ASN B OD1  1 
ATOM   4892  N  ND2  . ASN B  1 96  ? -11.978 6.460   -3.404  1.00 28.42  ?  96  ASN B ND2  1 
ATOM   4893  H  H    . ASN B  1 96  ? -13.338 3.900   -7.270  1.00 27.32  ?  96  ASN B H    1 
ATOM   4894  H  HA   . ASN B  1 96  ? -14.704 5.663   -5.895  1.00 28.81  ?  96  ASN B HA   1 
ATOM   4895  H  HB2  . ASN B  1 96  ? -12.632 4.393   -5.277  1.00 27.84  ?  96  ASN B HB2  1 
ATOM   4896  H  HB3  . ASN B  1 96  ? -11.927 5.737   -5.751  1.00 27.84  ?  96  ASN B HB3  1 
ATOM   4897  H  HD21 . ASN B  1 96  ? -12.083 6.824   -2.631  1.00 34.10  ?  96  ASN B HD21 1 
ATOM   4898  H  HD22 . ASN B  1 96  ? -11.194 6.416   -3.755  1.00 34.10  ?  96  ASN B HD22 1 
ATOM   4899  N  N    . GLN B  1 97  ? -12.830 6.890   -8.178  1.00 28.95  ?  97  GLN B N    1 
ATOM   4900  C  CA   . GLN B  1 97  ? -12.622 8.102   -8.966  1.00 35.78  ?  97  GLN B CA   1 
ATOM   4901  C  C    . GLN B  1 97  ? -13.925 8.561   -9.614  1.00 31.80  ?  97  GLN B C    1 
ATOM   4902  O  O    . GLN B  1 97  ? -14.240 9.760   -9.614  1.00 32.57  ?  97  GLN B O    1 
ATOM   4903  C  CB   . GLN B  1 97  ? -11.523 7.849   -10.004 1.00 34.60  ?  97  GLN B CB   1 
ATOM   4904  C  CG   . GLN B  1 97  ? -11.380 8.928   -11.087 1.00 56.53  ?  97  GLN B CG   1 
ATOM   4905  C  CD   . GLN B  1 97  ? -11.785 8.448   -12.482 1.00 66.63  ?  97  GLN B CD   1 
ATOM   4906  O  OE1  . GLN B  1 97  ? -12.074 7.261   -12.698 1.00 64.88  ?  97  GLN B OE1  1 
ATOM   4907  N  NE2  . GLN B  1 97  ? -11.809 9.378   -13.439 1.00 71.70  ?  97  GLN B NE2  1 
ATOM   4908  H  H    . GLN B  1 97  ? -12.383 6.205   -8.446  1.00 34.74  ?  97  GLN B H    1 
ATOM   4909  H  HA   . GLN B  1 97  ? -12.317 8.810   -8.377  1.00 42.94  ?  97  GLN B HA   1 
ATOM   4910  H  HB2  . GLN B  1 97  ? -10.672 7.785   -9.542  1.00 41.52  ?  97  GLN B HB2  1 
ATOM   4911  H  HB3  . GLN B  1 97  ? -11.711 7.009   -10.452 1.00 41.52  ?  97  GLN B HB3  1 
ATOM   4912  H  HG2  . GLN B  1 97  ? -11.945 9.682   -10.855 1.00 67.84  ?  97  GLN B HG2  1 
ATOM   4913  H  HG3  . GLN B  1 97  ? -10.453 9.211   -11.127 1.00 67.84  ?  97  GLN B HG3  1 
ATOM   4914  H  HE21 . GLN B  1 97  ? -11.603 10.191  -13.252 1.00 86.05  ?  97  GLN B HE21 1 
ATOM   4915  H  HE22 . GLN B  1 97  ? -12.029 9.163   -14.241 1.00 86.05  ?  97  GLN B HE22 1 
ATOM   4916  N  N    . ASP B  1 98  ? -14.722 7.621   -10.136 1.00 27.06  ?  98  ASP B N    1 
ATOM   4917  C  CA   A ASP B  1 98  ? -16.001 7.972   -10.750 0.46 35.26  ?  98  ASP B CA   1 
ATOM   4918  C  CA   B ASP B  1 98  ? -16.000 7.981   -10.748 0.54 35.11  ?  98  ASP B CA   1 
ATOM   4919  C  C    . ASP B  1 98  ? -16.996 8.530   -9.732  1.00 37.52  ?  98  ASP B C    1 
ATOM   4920  O  O    . ASP B  1 98  ? -17.824 9.382   -10.076 1.00 36.86  ?  98  ASP B O    1 
ATOM   4921  C  CB   A ASP B  1 98  ? -16.607 6.748   -11.447 0.46 37.84  ?  98  ASP B CB   1 
ATOM   4922  C  CB   B ASP B  1 98  ? -16.626 6.778   -11.453 0.54 37.80  ?  98  ASP B CB   1 
ATOM   4923  C  CG   A ASP B  1 98  ? -15.921 6.413   -12.766 0.46 38.69  ?  98  ASP B CG   1 
ATOM   4924  C  CG   B ASP B  1 98  ? -18.069 7.035   -11.856 0.54 41.47  ?  98  ASP B CG   1 
ATOM   4925  O  OD1  A ASP B  1 98  ? -14.780 6.870   -12.999 0.46 49.78  ?  98  ASP B OD1  1 
ATOM   4926  O  OD1  B ASP B  1 98  ? -18.281 7.703   -12.892 0.54 46.94  ?  98  ASP B OD1  1 
ATOM   4927  O  OD2  A ASP B  1 98  ? -16.535 5.687   -13.576 0.46 47.65  -1 98  ASP B OD2  1 
ATOM   4928  O  OD2  B ASP B  1 98  ? -18.988 6.591   -11.127 0.54 40.33  -1 98  ASP B OD2  1 
ATOM   4929  H  H    A ASP B  1 98  ? -14.544 6.780   -10.147 0.46 32.48  ?  98  ASP B H    1 
ATOM   4930  H  H    B ASP B  1 98  ? -14.546 6.779   -10.148 0.54 32.48  ?  98  ASP B H    1 
ATOM   4931  H  HA   A ASP B  1 98  ? -15.850 8.653   -11.423 0.46 42.32  ?  98  ASP B HA   1 
ATOM   4932  H  HA   B ASP B  1 98  ? -15.845 8.669   -11.414 0.54 42.13  ?  98  ASP B HA   1 
ATOM   4933  H  HB2  A ASP B  1 98  ? -16.522 5.978   -10.862 0.46 45.41  ?  98  ASP B HB2  1 
ATOM   4934  H  HB2  B ASP B  1 98  ? -16.119 6.581   -12.256 0.54 45.36  ?  98  ASP B HB2  1 
ATOM   4935  H  HB3  A ASP B  1 98  ? -17.543 6.922   -11.631 0.46 45.41  ?  98  ASP B HB3  1 
ATOM   4936  H  HB3  B ASP B  1 98  ? -16.611 6.015   -10.854 0.54 45.36  ?  98  ASP B HB3  1 
ATOM   4937  N  N    . LEU B  1 99  ? -16.953 8.054   -8.486  1.00 27.76  ?  99  LEU B N    1 
ATOM   4938  C  CA   . LEU B  1 99  ? -17.884 8.540   -7.477  1.00 24.07  ?  99  LEU B CA   1 
ATOM   4939  C  C    . LEU B  1 99  ? -17.624 10.005  -7.122  1.00 21.59  ?  99  LEU B C    1 
ATOM   4940  O  O    . LEU B  1 99  ? -18.552 10.712  -6.700  1.00 23.54  ?  99  LEU B O    1 
ATOM   4941  C  CB   . LEU B  1 99  ? -17.772 7.692   -6.202  1.00 24.13  ?  99  LEU B CB   1 
ATOM   4942  C  CG   . LEU B  1 99  ? -18.482 6.322   -6.173  1.00 24.44  ?  99  LEU B CG   1 
ATOM   4943  C  CD1  . LEU B  1 99  ? -18.231 5.678   -4.828  1.00 28.06  ?  99  LEU B CD1  1 
ATOM   4944  C  CD2  . LEU B  1 99  ? -19.969 6.461   -6.409  1.00 28.99  ?  99  LEU B CD2  1 
ATOM   4945  H  H    . LEU B  1 99  ? -16.401 7.457   -8.206  1.00 33.31  ?  99  LEU B H    1 
ATOM   4946  H  HA   . LEU B  1 99  ? -18.791 8.465   -7.815  1.00 28.89  ?  99  LEU B HA   1 
ATOM   4947  H  HB2  . LEU B  1 99  ? -16.831 7.524   -6.038  1.00 28.96  ?  99  LEU B HB2  1 
ATOM   4948  H  HB3  . LEU B  1 99  ? -18.133 8.211   -5.467  1.00 28.96  ?  99  LEU B HB3  1 
ATOM   4949  H  HG   . LEU B  1 99  ? -18.111 5.749   -6.862  1.00 29.32  ?  99  LEU B HG   1 
ATOM   4950  H  HD11 . LEU B  1 99  ? -18.675 4.816   -4.803  1.00 33.67  ?  99  LEU B HD11 1 
ATOM   4951  H  HD12 . LEU B  1 99  ? -17.276 5.563   -4.706  1.00 33.67  ?  99  LEU B HD12 1 
ATOM   4952  H  HD13 . LEU B  1 99  ? -18.586 6.254   -4.132  1.00 33.67  ?  99  LEU B HD13 1 
ATOM   4953  H  HD21 . LEU B  1 99  ? -20.376 5.581   -6.383  1.00 34.79  ?  99  LEU B HD21 1 
ATOM   4954  H  HD22 . LEU B  1 99  ? -20.347 7.022   -5.714  1.00 34.79  ?  99  LEU B HD22 1 
ATOM   4955  H  HD23 . LEU B  1 99  ? -20.113 6.868   -7.278  1.00 34.79  ?  99  LEU B HD23 1 
ATOM   4956  N  N    . ALA B  1 100 ? -16.375 10.440  -7.231  1.00 24.11  ?  100 ALA B N    1 
ATOM   4957  C  CA   . ALA B  1 100 ? -16.008 11.787  -6.797  1.00 24.50  ?  100 ALA B CA   1 
ATOM   4958  C  C    . ALA B  1 100 ? -16.804 12.840  -7.549  1.00 23.53  ?  100 ALA B C    1 
ATOM   4959  O  O    . ALA B  1 100 ? -17.112 13.896  -6.984  1.00 21.77  ?  100 ALA B O    1 
ATOM   4960  C  CB   . ALA B  1 100 ? -14.521 12.012  -6.984  1.00 28.09  ?  100 ALA B CB   1 
ATOM   4961  H  H    . ALA B  1 100 ? -15.723 9.980   -7.551  1.00 28.93  ?  100 ALA B H    1 
ATOM   4962  H  HA   . ALA B  1 100 ? -16.208 11.879  -5.852  1.00 29.40  ?  100 ALA B HA   1 
ATOM   4963  H  HB1  . ALA B  1 100 ? -14.298 12.909  -6.691  1.00 33.71  ?  100 ALA B HB1  1 
ATOM   4964  H  HB2  . ALA B  1 100 ? -14.034 11.360  -6.455  1.00 33.71  ?  100 ALA B HB2  1 
ATOM   4965  H  HB3  . ALA B  1 100 ? -14.301 11.906  -7.923  1.00 33.71  ?  100 ALA B HB3  1 
ATOM   4966  N  N    . ARG B  1 101 ? -17.168 12.561  -8.816  1.00 26.15  ?  101 ARG B N    1 
ATOM   4967  C  CA   . ARG B  1 101 ? -17.954 13.521  -9.598  1.00 31.71  ?  101 ARG B CA   1 
ATOM   4968  C  C    . ARG B  1 101 ? -19.285 13.826  -8.936  1.00 25.60  ?  101 ARG B C    1 
ATOM   4969  O  O    . ARG B  1 101 ? -19.863 14.901  -9.166  1.00 27.84  ?  101 ARG B O    1 
ATOM   4970  C  CB   . ARG B  1 101 ? -18.213 12.981  -11.013 1.00 37.72  ?  101 ARG B CB   1 
ATOM   4971  C  CG   . ARG B  1 101 ? -16.974 12.522  -11.757 1.00 53.18  ?  101 ARG B CG   1 
ATOM   4972  C  CD   . ARG B  1 101 ? -17.283 12.198  -13.236 1.00 64.01  ?  101 ARG B CD   1 
ATOM   4973  N  NE   . ARG B  1 101 ? -18.001 10.930  -13.412 1.00 69.98  ?  101 ARG B NE   1 
ATOM   4974  C  CZ   . ARG B  1 101 ? -19.240 10.804  -13.896 1.00 76.26  ?  101 ARG B CZ   1 
ATOM   4975  N  NH1  . ARG B  1 101 ? -19.947 11.868  -14.272 1.00 72.82  1  101 ARG B NH1  1 
ATOM   4976  N  NH2  . ARG B  1 101 ? -19.778 9.593   -14.010 1.00 67.27  ?  101 ARG B NH2  1 
ATOM   4977  H  H    . ARG B  1 101 ? -16.973 11.836  -9.235  1.00 31.38  ?  101 ARG B H    1 
ATOM   4978  H  HA   . ARG B  1 101 ? -17.458 14.350  -9.677  1.00 38.05  ?  101 ARG B HA   1 
ATOM   4979  H  HB2  . ARG B  1 101 ? -18.814 12.222  -10.949 1.00 45.26  ?  101 ARG B HB2  1 
ATOM   4980  H  HB3  . ARG B  1 101 ? -18.628 13.682  -11.539 1.00 45.26  ?  101 ARG B HB3  1 
ATOM   4981  H  HG2  . ARG B  1 101 ? -16.308 13.226  -11.734 1.00 63.82  ?  101 ARG B HG2  1 
ATOM   4982  H  HG3  . ARG B  1 101 ? -16.628 11.719  -11.337 1.00 63.82  ?  101 ARG B HG3  1 
ATOM   4983  H  HD2  . ARG B  1 101 ? -17.833 12.907  -13.604 1.00 76.81  ?  101 ARG B HD2  1 
ATOM   4984  H  HD3  . ARG B  1 101 ? -16.448 12.139  -13.726 1.00 76.81  ?  101 ARG B HD3  1 
ATOM   4985  H  HE   . ARG B  1 101 ? -17.591 10.209  -13.185 1.00 83.98  ?  101 ARG B HE   1 
ATOM   4986  H  HH11 . ARG B  1 101 ? -19.608 12.655  -14.204 1.00 87.38  ?  101 ARG B HH11 1 
ATOM   4987  H  HH12 . ARG B  1 101 ? -20.743 11.768  -14.582 1.00 87.38  ?  101 ARG B HH12 1 
ATOM   4988  H  HH21 . ARG B  1 101 ? -19.330 8.899   -13.770 1.00 80.72  ?  101 ARG B HH21 1 
ATOM   4989  H  HH22 . ARG B  1 101 ? -20.575 9.504   -14.320 1.00 80.72  ?  101 ARG B HH22 1 
ATOM   4990  N  N    . PHE B  1 102 ? -19.799 12.882  -8.152  1.00 22.92  ?  102 PHE B N    1 
ATOM   4991  C  CA   . PHE B  1 102 ? -21.053 12.992  -7.432  1.00 24.58  ?  102 PHE B CA   1 
ATOM   4992  C  C    . PHE B  1 102 ? -20.872 13.354  -5.963  1.00 25.73  ?  102 PHE B C    1 
ATOM   4993  O  O    . PHE B  1 102 ? -21.813 13.203  -5.179  1.00 26.12  ?  102 PHE B O    1 
ATOM   4994  C  CB   . PHE B  1 102 ? -21.810 11.667  -7.553  1.00 30.67  ?  102 PHE B CB   1 
ATOM   4995  C  CG   . PHE B  1 102 ? -22.001 11.217  -8.977  1.00 34.61  ?  102 PHE B CG   1 
ATOM   4996  C  CD1  . PHE B  1 102 ? -22.998 11.762  -9.759  1.00 43.98  ?  102 PHE B CD1  1 
ATOM   4997  C  CD2  . PHE B  1 102 ? -21.167 10.263  -9.530  1.00 37.77  ?  102 PHE B CD2  1 
ATOM   4998  C  CE1  . PHE B  1 102 ? -23.174 11.353  -11.066 1.00 41.95  ?  102 PHE B CE1  1 
ATOM   4999  C  CE2  . PHE B  1 102 ? -21.326 9.850   -10.838 1.00 50.15  ?  102 PHE B CE2  1 
ATOM   5000  C  CZ   . PHE B  1 102 ? -22.336 10.398  -11.609 1.00 44.57  ?  102 PHE B CZ   1 
ATOM   5001  H  H    . PHE B  1 102 ? -19.411 12.127  -8.019  1.00 27.51  ?  102 PHE B H    1 
ATOM   5002  H  HA   . PHE B  1 102 ? -21.593 13.684  -7.845  1.00 29.49  ?  102 PHE B HA   1 
ATOM   5003  H  HB2  . PHE B  1 102 ? -21.313 10.977  -7.086  1.00 36.80  ?  102 PHE B HB2  1 
ATOM   5004  H  HB3  . PHE B  1 102 ? -22.688 11.768  -7.153  1.00 36.80  ?  102 PHE B HB3  1 
ATOM   5005  H  HD1  . PHE B  1 102 ? -23.565 12.405  -9.398  1.00 52.78  ?  102 PHE B HD1  1 
ATOM   5006  H  HD2  . PHE B  1 102 ? -20.488 9.893   -9.013  1.00 45.32  ?  102 PHE B HD2  1 
ATOM   5007  H  HE1  . PHE B  1 102 ? -23.851 11.726  -11.583 1.00 50.34  ?  102 PHE B HE1  1 
ATOM   5008  H  HE2  . PHE B  1 102 ? -20.762 9.204   -11.197 1.00 60.18  ?  102 PHE B HE2  1 
ATOM   5009  H  HZ   . PHE B  1 102 ? -22.451 10.123  -12.490 1.00 53.48  ?  102 PHE B HZ   1 
ATOM   5010  N  N    . ASN B  1 103 ? -19.666 13.763  -5.574  1.00 22.35  ?  103 ASN B N    1 
ATOM   5011  C  CA   . ASN B  1 103 ? -19.339 14.111  -4.187  1.00 22.69  ?  103 ASN B CA   1 
ATOM   5012  C  C    . ASN B  1 103 ? -19.455 12.920  -3.255  1.00 23.08  ?  103 ASN B C    1 
ATOM   5013  O  O    . ASN B  1 103 ? -19.695 13.074  -2.050  1.00 22.99  ?  103 ASN B O    1 
ATOM   5014  C  CB   . ASN B  1 103 ? -20.205 15.273  -3.665  1.00 24.82  ?  103 ASN B CB   1 
ATOM   5015  C  CG   . ASN B  1 103 ? -19.916 16.564  -4.379  1.00 28.89  ?  103 ASN B CG   1 
ATOM   5016  O  OD1  . ASN B  1 103 ? -20.775 17.098  -5.076  1.00 28.78  ?  103 ASN B OD1  1 
ATOM   5017  N  ND2  . ASN B  1 103 ? -18.698 17.063  -4.249  1.00 25.30  ?  103 ASN B ND2  1 
ATOM   5018  H  H    . ASN B  1 103 ? -18.999 13.849  -6.110  1.00 26.82  ?  103 ASN B H    1 
ATOM   5019  H  HA   . ASN B  1 103 ? -18.416 14.407  -4.159  1.00 27.23  ?  103 ASN B HA   1 
ATOM   5020  H  HB2  . ASN B  1 103 ? -21.141 15.057  -3.800  1.00 29.78  ?  103 ASN B HB2  1 
ATOM   5021  H  HB3  . ASN B  1 103 ? -20.026 15.404  -2.721  1.00 29.78  ?  103 ASN B HB3  1 
ATOM   5022  H  HD21 . ASN B  1 103 ? -18.491 17.800  -4.641  1.00 30.35  ?  103 ASN B HD21 1 
ATOM   5023  H  HD22 . ASN B  1 103 ? -18.113 16.651  -3.772  1.00 30.35  ?  103 ASN B HD22 1 
ATOM   5024  N  N    . LEU B  1 104 ? -19.244 11.730  -3.786  1.00 21.00  ?  104 LEU B N    1 
ATOM   5025  C  CA   . LEU B  1 104 ? -19.263 10.503  -3.000  1.00 22.90  ?  104 LEU B CA   1 
ATOM   5026  C  C    . LEU B  1 104 ? -17.878 9.874   -2.979  1.00 17.21  ?  104 LEU B C    1 
ATOM   5027  O  O    . LEU B  1 104 ? -17.096 10.049  -3.902  1.00 19.99  ?  104 LEU B O    1 
ATOM   5028  C  CB   . LEU B  1 104 ? -20.251 9.486   -3.568  1.00 24.06  ?  104 LEU B CB   1 
ATOM   5029  C  CG   . LEU B  1 104 ? -21.707 9.937   -3.589  1.00 29.37  ?  104 LEU B CG   1 
ATOM   5030  C  CD1  . LEU B  1 104 ? -22.580 8.903   -4.304  1.00 29.79  ?  104 LEU B CD1  1 
ATOM   5031  C  CD2  . LEU B  1 104 ? -22.190 10.185  -2.165  1.00 32.60  ?  104 LEU B CD2  1 
ATOM   5032  H  H    . LEU B  1 104 ? -19.083 11.600  -4.621  1.00 25.21  ?  104 LEU B H    1 
ATOM   5033  H  HA   . LEU B  1 104 ? -19.522 10.708  -2.088  1.00 27.49  ?  104 LEU B HA   1 
ATOM   5034  H  HB2  . LEU B  1 104 ? -19.995 9.284   -4.481  1.00 28.87  ?  104 LEU B HB2  1 
ATOM   5035  H  HB3  . LEU B  1 104 ? -20.204 8.679   -3.032  1.00 28.87  ?  104 LEU B HB3  1 
ATOM   5036  H  HG   . LEU B  1 104 ? -21.772 10.773  -4.077  1.00 35.24  ?  104 LEU B HG   1 
ATOM   5037  H  HD11 . LEU B  1 104 ? -23.499 9.213   -4.304  1.00 35.75  ?  104 LEU B HD11 1 
ATOM   5038  H  HD12 . LEU B  1 104 ? -22.265 8.801   -5.216  1.00 35.75  ?  104 LEU B HD12 1 
ATOM   5039  H  HD13 . LEU B  1 104 ? -22.516 8.057   -3.834  1.00 35.75  ?  104 LEU B HD13 1 
ATOM   5040  H  HD21 . LEU B  1 104 ? -23.116 10.470  -2.191  1.00 39.12  ?  104 LEU B HD21 1 
ATOM   5041  H  HD22 . LEU B  1 104 ? -22.111 9.361   -1.658  1.00 39.12  ?  104 LEU B HD22 1 
ATOM   5042  H  HD23 . LEU B  1 104 ? -21.641 10.875  -1.762  1.00 39.12  ?  104 LEU B HD23 1 
ATOM   5043  N  N    . THR B  1 105 ? -17.595 9.114   -1.923  1.00 18.68  ?  105 THR B N    1 
ATOM   5044  C  CA   . THR B  1 105 ? -16.332 8.388   -1.850  1.00 21.01  ?  105 THR B CA   1 
ATOM   5045  C  C    . THR B  1 105 ? -16.494 7.211   -0.905  1.00 18.45  ?  105 THR B C    1 
ATOM   5046  O  O    . THR B  1 105 ? -17.383 7.187   -0.053  1.00 19.37  ?  105 THR B O    1 
ATOM   5047  C  CB   . THR B  1 105 ? -15.174 9.286   -1.390  1.00 22.57  ?  105 THR B CB   1 
ATOM   5048  O  OG1  . THR B  1 105 ? -13.929 8.693   -1.755  1.00 23.97  ?  105 THR B OG1  1 
ATOM   5049  C  CG2  . THR B  1 105 ? -15.188 9.501   0.142   1.00 23.15  ?  105 THR B CG2  1 
ATOM   5050  H  H    . THR B  1 105 ? -18.112 9.002   -1.244  1.00 22.41  ?  105 THR B H    1 
ATOM   5051  H  HA   . THR B  1 105 ? -16.114 8.042   -2.729  1.00 25.21  ?  105 THR B HA   1 
ATOM   5052  H  HB   . THR B  1 105 ? -15.252 10.153  -1.819  1.00 27.08  ?  105 THR B HB   1 
ATOM   5053  H  HG1  . THR B  1 105 ? -13.853 7.939   -1.392  1.00 28.76  ?  105 THR B HG1  1 
ATOM   5054  H  HG21 . THR B  1 105 ? -14.448 10.070  0.404   1.00 27.78  ?  105 THR B HG21 1 
ATOM   5055  H  HG22 . THR B  1 105 ? -16.020 9.922   0.410   1.00 27.78  ?  105 THR B HG22 1 
ATOM   5056  H  HG23 . THR B  1 105 ? -15.106 8.648   0.597   1.00 27.78  ?  105 THR B HG23 1 
ATOM   5057  N  N    . HIS B  1 106 ? -15.632 6.220   -1.084  1.00 18.59  ?  106 HIS B N    1 
ATOM   5058  C  CA   . HIS B  1 106 ? -15.613 5.086   -0.167  1.00 18.57  ?  106 HIS B CA   1 
ATOM   5059  C  C    . HIS B  1 106 ? -14.984 5.516   1.152   1.00 17.86  ?  106 HIS B C    1 
ATOM   5060  O  O    . HIS B  1 106 ? -14.001 6.270   1.164   1.00 19.54  ?  106 HIS B O    1 
ATOM   5061  C  CB   . HIS B  1 106 ? -14.831 3.942   -0.786  1.00 19.63  ?  106 HIS B CB   1 
ATOM   5062  C  CG   . HIS B  1 106 ? -15.055 2.646   -0.093  1.00 18.79  ?  106 HIS B CG   1 
ATOM   5063  N  ND1  . HIS B  1 106 ? -14.317 2.259   0.997   1.00 18.41  ?  106 HIS B ND1  1 
ATOM   5064  C  CD2  . HIS B  1 106 ? -15.940 1.656   -0.338  1.00 18.71  ?  106 HIS B CD2  1 
ATOM   5065  C  CE1  . HIS B  1 106 ? -14.766 1.083   1.413   1.00 18.53  ?  106 HIS B CE1  1 
ATOM   5066  N  NE2  . HIS B  1 106 ? -15.759 0.708   0.626   1.00 19.34  ?  106 HIS B NE2  1 
ATOM   5067  H  H    . HIS B  1 106 ? -15.054 6.178   -1.719  1.00 22.31  ?  106 HIS B H    1 
ATOM   5068  H  HA   . HIS B  1 106 ? -16.520 4.787   0.004   1.00 22.29  ?  106 HIS B HA   1 
ATOM   5069  H  HB2  . HIS B  1 106 ? -15.104 3.838   -1.711  1.00 23.56  ?  106 HIS B HB2  1 
ATOM   5070  H  HB3  . HIS B  1 106 ? -13.884 4.147   -0.741  1.00 23.56  ?  106 HIS B HB3  1 
ATOM   5071  H  HD2  . HIS B  1 106 ? -16.584 1.644   -1.009  1.00 22.45  ?  106 HIS B HD2  1 
ATOM   5072  H  HE1  . HIS B  1 106 ? -14.434 0.600   2.135   1.00 22.23  ?  106 HIS B HE1  1 
ATOM   5073  H  HE2  . HIS B  1 106 ? -16.191 -0.033  0.686   1.00 23.21  ?  106 HIS B HE2  1 
ATOM   5074  N  N    . ASP B  1 107 ? -15.547 5.035   2.257   1.00 18.83  ?  107 ASP B N    1 
ATOM   5075  C  CA   . ASP B  1 107 ? -15.051 5.473   3.562   1.00 18.52  ?  107 ASP B CA   1 
ATOM   5076  C  C    . ASP B  1 107 ? -13.681 4.904   3.918   1.00 20.30  ?  107 ASP B C    1 
ATOM   5077  O  O    . ASP B  1 107 ? -13.052 5.416   4.852   1.00 23.27  ?  107 ASP B O    1 
ATOM   5078  C  CB   . ASP B  1 107 ? -16.079 5.097   4.605   1.00 18.24  ?  107 ASP B CB   1 
ATOM   5079  C  CG   . ASP B  1 107 ? -16.572 3.649   4.427   1.00 24.75  ?  107 ASP B CG   1 
ATOM   5080  O  OD1  . ASP B  1 107 ? -17.221 3.336   3.405   1.00 27.75  ?  107 ASP B OD1  1 
ATOM   5081  O  OD2  . ASP B  1 107 ? -16.335 2.870   5.314   1.00 28.19  -1 107 ASP B OD2  1 
ATOM   5082  H  H    . ASP B  1 107 ? -16.197 4.472   2.282   1.00 22.59  ?  107 ASP B H    1 
ATOM   5083  H  HA   . ASP B  1 107 ? -14.976 6.440   3.557   1.00 22.22  ?  107 ASP B HA   1 
ATOM   5084  H  HB2  . ASP B  1 107 ? -15.682 5.176   5.487   1.00 21.88  ?  107 ASP B HB2  1 
ATOM   5085  H  HB3  . ASP B  1 107 ? -16.843 5.690   4.528   1.00 21.88  ?  107 ASP B HB3  1 
ATOM   5086  N  N    . LEU B  1 108 ? -13.205 3.876   3.219   1.00 19.82  ?  108 LEU B N    1 
ATOM   5087  C  CA   . LEU B  1 108 ? -11.857 3.347   3.420   1.00 21.06  ?  108 LEU B CA   1 
ATOM   5088  C  C    . LEU B  1 108 ? -10.903 3.748   2.290   1.00 26.90  ?  108 LEU B C    1 
ATOM   5089  O  O    . LEU B  1 108 ? -9.899  3.069   2.029   1.00 28.01  ?  108 LEU B O    1 
ATOM   5090  C  CB   . LEU B  1 108 ? -11.892 1.831   3.550   1.00 22.42  ?  108 LEU B CB   1 
ATOM   5091  C  CG   . LEU B  1 108 ? -12.841 1.275   4.621   1.00 24.96  ?  108 LEU B CG   1 
ATOM   5092  C  CD1  . LEU B  1 108 ? -12.727 -0.251  4.668   1.00 25.87  ?  108 LEU B CD1  1 
ATOM   5093  C  CD2  . LEU B  1 108 ? -12.597 1.920   5.986   1.00 24.66  ?  108 LEU B CD2  1 
ATOM   5094  H  H    . LEU B  1 108 ? -13.651 3.461   2.612   1.00 23.79  ?  108 LEU B H    1 
ATOM   5095  H  HA   . LEU B  1 108 ? -11.501 3.706   4.248   1.00 25.27  ?  108 LEU B HA   1 
ATOM   5096  H  HB2  . LEU B  1 108 ? -12.166 1.458   2.698   1.00 26.90  ?  108 LEU B HB2  1 
ATOM   5097  H  HB3  . LEU B  1 108 ? -10.998 1.522   3.766   1.00 26.90  ?  108 LEU B HB3  1 
ATOM   5098  H  HG   . LEU B  1 108 ? -13.751 1.487   4.361   1.00 29.95  ?  108 LEU B HG   1 
ATOM   5099  H  HD11 . LEU B  1 108 ? -13.330 -0.592  5.347   1.00 31.04  ?  108 LEU B HD11 1 
ATOM   5100  H  HD12 . LEU B  1 108 ? -12.967 -0.612  3.800   1.00 31.04  ?  108 LEU B HD12 1 
ATOM   5101  H  HD13 . LEU B  1 108 ? -11.813 -0.493  4.886   1.00 31.04  ?  108 LEU B HD13 1 
ATOM   5102  H  HD21 . LEU B  1 108 ? -13.216 1.541   6.630   1.00 29.59  ?  108 LEU B HD21 1 
ATOM   5103  H  HD22 . LEU B  1 108 ? -11.684 1.743   6.260   1.00 29.59  ?  108 LEU B HD22 1 
ATOM   5104  H  HD23 . LEU B  1 108 ? -12.741 2.877   5.912   1.00 29.59  ?  108 LEU B HD23 1 
ATOM   5105  N  N    . SER B  1 109 ? -11.188 4.868   1.637   1.00 22.99  ?  109 SER B N    1 
ATOM   5106  C  CA   . SER B  1 109 ? -10.314 5.388   0.595   1.00 25.67  ?  109 SER B CA   1 
ATOM   5107  C  C    . SER B  1 109 ? -8.873  5.564   1.035   1.00 33.42  ?  109 SER B C    1 
ATOM   5108  O  O    . SER B  1 109 ? -7.997  5.632   0.170   1.00 33.78  ?  109 SER B O    1 
ATOM   5109  C  CB   . SER B  1 109 ? -10.812 6.753   0.115   1.00 30.94  ?  109 SER B CB   1 
ATOM   5110  O  OG   . SER B  1 109 ? -12.033 6.649   -0.562  1.00 27.84  ?  109 SER B OG   1 
ATOM   5111  H  H    . SER B  1 109 ? -11.887 5.349   1.781   1.00 27.59  ?  109 SER B H    1 
ATOM   5112  H  HA   . SER B  1 109 ? -10.326 4.780   -0.161  1.00 30.81  ?  109 SER B HA   1 
ATOM   5113  H  HB2  . SER B  1 109 ? -10.930 7.332   0.885   1.00 37.12  ?  109 SER B HB2  1 
ATOM   5114  H  HB3  . SER B  1 109 ? -10.153 7.134   -0.485  1.00 37.12  ?  109 SER B HB3  1 
ATOM   5115  H  HG   . SER B  1 109 ? -12.617 6.323   -0.054  1.00 33.40  ?  109 SER B HG   1 
ATOM   5116  N  N    . ILE B  1 110 ? -8.596  5.674   2.338   1.00 32.20  ?  110 ILE B N    1 
ATOM   5117  C  CA   . ILE B  1 110 ? -7.209  5.868   2.771   1.00 29.79  ?  110 ILE B CA   1 
ATOM   5118  C  C    . ILE B  1 110 ? -6.323  4.715   2.325   1.00 43.69  ?  110 ILE B C    1 
ATOM   5119  O  O    . ILE B  1 110 ? -5.103  4.877   2.213   1.00 39.84  ?  110 ILE B O    1 
ATOM   5120  C  CB   . ILE B  1 110 ? -7.096  6.046   4.297   1.00 36.75  ?  110 ILE B CB   1 
ATOM   5121  C  CG1  . ILE B  1 110 ? -7.646  4.818   5.021   1.00 36.98  ?  110 ILE B CG1  1 
ATOM   5122  C  CG2  . ILE B  1 110 ? -7.736  7.370   4.716   1.00 50.93  ?  110 ILE B CG2  1 
ATOM   5123  C  CD1  . ILE B  1 110 ? -7.541  4.905   6.539   1.00 52.84  ?  110 ILE B CD1  1 
ATOM   5124  H  H    . ILE B  1 110 ? -9.174  5.640   2.974   1.00 38.64  ?  110 ILE B H    1 
ATOM   5125  H  HA   . ILE B  1 110 ? -6.868  6.676   2.356   1.00 35.75  ?  110 ILE B HA   1 
ATOM   5126  H  HB   . ILE B  1 110 ? -6.151  6.105   4.510   1.00 44.10  ?  110 ILE B HB   1 
ATOM   5127  H  HG12 . ILE B  1 110 ? -8.583  4.714   4.794   1.00 44.37  ?  110 ILE B HG12 1 
ATOM   5128  H  HG13 . ILE B  1 110 ? -7.148  4.036   4.734   1.00 44.37  ?  110 ILE B HG13 1 
ATOM   5129  H  HG21 . ILE B  1 110 ? -7.656  7.468   5.678   1.00 61.12  ?  110 ILE B HG21 1 
ATOM   5130  H  HG22 . ILE B  1 110 ? -7.276  8.098   4.270   1.00 61.12  ?  110 ILE B HG22 1 
ATOM   5131  H  HG23 . ILE B  1 110 ? -8.671  7.362   4.460   1.00 61.12  ?  110 ILE B HG23 1 
ATOM   5132  H  HD11 . ILE B  1 110 ? -8.043  5.676   6.846   1.00 63.41  ?  110 ILE B HD11 1 
ATOM   5133  H  HD12 . ILE B  1 110 ? -7.908  4.095   6.927   1.00 63.41  ?  110 ILE B HD12 1 
ATOM   5134  H  HD13 . ILE B  1 110 ? -6.608  4.997   6.786   1.00 63.41  ?  110 ILE B HD13 1 
ATOM   5135  N  N    . LEU B  1 111 ? -6.909  3.543   2.090   1.00 30.94  ?  111 LEU B N    1 
ATOM   5136  C  CA   . LEU B  1 111 ? -6.171  2.419   1.520   1.00 41.54  ?  111 LEU B CA   1 
ATOM   5137  C  C    . LEU B  1 111 ? -5.708  2.715   0.097   1.00 60.79  ?  111 LEU B C    1 
ATOM   5138  O  O    . LEU B  1 111 ? -4.565  2.410   -0.266  1.00 66.75  ?  111 LEU B O    1 
ATOM   5139  C  CB   . LEU B  1 111 ? -7.048  1.171   1.529   1.00 36.51  ?  111 LEU B CB   1 
ATOM   5140  C  CG   . LEU B  1 111 ? -7.340  0.535   2.888   1.00 38.14  ?  111 LEU B CG   1 
ATOM   5141  C  CD1  . LEU B  1 111 ? -8.384  -0.580  2.711   1.00 32.95  ?  111 LEU B CD1  1 
ATOM   5142  C  CD2  . LEU B  1 111 ? -6.069  -0.030  3.510   1.00 41.61  ?  111 LEU B CD2  1 
ATOM   5143  H  H    . LEU B  1 111 ? -7.736  3.373   2.254   1.00 37.13  ?  111 LEU B H    1 
ATOM   5144  H  HA   . LEU B  1 111 ? -5.387  2.243   2.063   1.00 49.85  ?  111 LEU B HA   1 
ATOM   5145  H  HB2  . LEU B  1 111 ? -7.903  1.402   1.132   1.00 43.82  ?  111 LEU B HB2  1 
ATOM   5146  H  HB3  . LEU B  1 111 ? -6.616  0.495   0.984   1.00 43.82  ?  111 LEU B HB3  1 
ATOM   5147  H  HG   . LEU B  1 111 ? -7.705  1.204   3.488   1.00 45.77  ?  111 LEU B HG   1 
ATOM   5148  H  HD11 . LEU B  1 111 ? -8.567  -0.981  3.575   1.00 39.54  ?  111 LEU B HD11 1 
ATOM   5149  H  HD12 . LEU B  1 111 ? -9.197  -0.196  2.346   1.00 39.54  ?  111 LEU B HD12 1 
ATOM   5150  H  HD13 . LEU B  1 111 ? -8.032  -1.248  2.103   1.00 39.54  ?  111 LEU B HD13 1 
ATOM   5151  H  HD21 . LEU B  1 111 ? -6.287  -0.426  4.368   1.00 49.93  ?  111 LEU B HD21 1 
ATOM   5152  H  HD22 . LEU B  1 111 ? -5.702  -0.705  2.918   1.00 49.93  ?  111 LEU B HD22 1 
ATOM   5153  H  HD23 . LEU B  1 111 ? -5.430  0.690   3.629   1.00 49.93  ?  111 LEU B HD23 1 
ATOM   5154  N  N    . ALA B  1 112 ? -6.590  3.292   -0.724  1.00 62.96  ?  112 ALA B N    1 
ATOM   5155  C  CA   . ALA B  1 112 ? -6.316  3.555   -2.130  1.00 68.42  ?  112 ALA B CA   1 
ATOM   5156  C  C    . ALA B  1 112 ? -5.511  4.829   -2.362  1.00 70.03  ?  112 ALA B C    1 
ATOM   5157  O  O    . ALA B  1 112 ? -5.154  5.111   -3.511  1.00 82.13  ?  112 ALA B O    1 
ATOM   5158  C  CB   . ALA B  1 112 ? -7.637  3.647   -2.904  1.00 59.93  ?  112 ALA B CB   1 
ATOM   5159  H  H    . ALA B  1 112 ? -7.374  3.544   -0.477  1.00 75.56  ?  112 ALA B H    1 
ATOM   5160  H  HA   . ALA B  1 112 ? -5.809  2.813   -2.495  1.00 82.10  ?  112 ALA B HA   1 
ATOM   5161  H  HB1  . ALA B  1 112 ? -7.444  3.823   -3.839  1.00 71.92  ?  112 ALA B HB1  1 
ATOM   5162  H  HB2  . ALA B  1 112 ? -8.113  2.806   -2.817  1.00 71.92  ?  112 ALA B HB2  1 
ATOM   5163  H  HB3  . ALA B  1 112 ? -8.170  4.369   -2.535  1.00 71.92  ?  112 ALA B HB3  1 
ATOM   5164  N  N    . GLN B  1 113 ? -5.217  5.596   -1.316  1.00 59.70  ?  113 GLN B N    1 
ATOM   5165  C  CA   . GLN B  1 113 ? -4.578  6.902   -1.442  1.00 69.08  ?  113 GLN B CA   1 
ATOM   5166  C  C    . GLN B  1 113 ? -3.379  7.066   -0.526  1.00 81.10  ?  113 GLN B C    1 
ATOM   5167  O  O    . GLN B  1 113 ? -2.339  7.565   -0.964  1.00 84.69  ?  113 GLN B O    1 
ATOM   5168  C  CB   . GLN B  1 113 ? -5.596  8.020   -1.146  1.00 76.01  ?  113 GLN B CB   1 
ATOM   5169  C  CG   . GLN B  1 113 ? -6.733  8.129   -2.159  1.00 76.44  ?  113 GLN B CG   1 
ATOM   5170  C  CD   . GLN B  1 113 ? -7.956  8.837   -1.587  1.00 69.55  ?  113 GLN B CD   1 
ATOM   5171  O  OE1  . GLN B  1 113 ? -7.868  9.522   -0.564  1.00 72.28  ?  113 GLN B OE1  1 
ATOM   5172  N  NE2  . GLN B  1 113 ? -9.106  8.660   -2.236  1.00 47.01  ?  113 GLN B NE2  1 
ATOM   5173  H  H    . GLN B  1 113 ? -5.383  5.374   -0.502  1.00 71.65  ?  113 GLN B H    1 
ATOM   5174  H  HA   . GLN B  1 113 ? -4.271  7.014   -2.356  1.00 82.90  ?  113 GLN B HA   1 
ATOM   5175  H  HB2  . GLN B  1 113 ? -5.992  7.856   -0.276  1.00 91.21  ?  113 GLN B HB2  1 
ATOM   5176  H  HB3  . GLN B  1 113 ? -5.128  8.870   -1.136  1.00 91.21  ?  113 GLN B HB3  1 
ATOM   5177  H  HG2  . GLN B  1 113 ? -6.425  8.634   -2.928  1.00 91.72  ?  113 GLN B HG2  1 
ATOM   5178  H  HG3  . GLN B  1 113 ? -7.001  7.238   -2.432  1.00 91.72  ?  113 GLN B HG3  1 
ATOM   5179  H  HE21 . GLN B  1 113 ? -9.823  9.039   -1.951  1.00 56.41  ?  113 GLN B HE21 1 
ATOM   5180  H  HE22 . GLN B  1 113 ? -9.131  8.166   -2.940  1.00 56.41  ?  113 GLN B HE22 1 
ATOM   5181  N  N    . GLY B  1 114 ? -3.494  6.666   0.732   1.00 88.63  ?  114 GLY B N    1 
ATOM   5182  C  CA   . GLY B  1 114 ? -2.400  6.835   1.658   1.00 99.09  ?  114 GLY B CA   1 
ATOM   5183  C  C    . GLY B  1 114 ? -1.360  5.737   1.535   1.00 102.78 ?  114 GLY B C    1 
ATOM   5184  O  O    . GLY B  1 114 ? -1.545  4.728   0.850   1.00 98.53  ?  114 GLY B O    1 
ATOM   5185  H  H    . GLY B  1 114 ? -4.193  6.295   1.068   1.00 106.36 ?  114 GLY B H    1 
ATOM   5186  H  HA2  . GLY B  1 114 ? -1.967  7.687   1.494   1.00 118.91 ?  114 GLY B HA2  1 
ATOM   5187  H  HA3  . GLY B  1 114 ? -2.742  6.834   2.566   1.00 118.91 ?  114 GLY B HA3  1 
ATOM   5188  N  N    . ASP B  1 115 ? -0.234  5.956   2.215   1.00 95.14  ?  115 ASP B N    1 
ATOM   5189  C  CA   . ASP B  1 115 ? 0.763   4.906   2.359   1.00 90.52  ?  115 ASP B CA   1 
ATOM   5190  C  C    . ASP B  1 115 ? 0.072   3.752   3.081   1.00 84.27  ?  115 ASP B C    1 
ATOM   5191  O  O    . ASP B  1 115 ? -0.388  3.896   4.219   1.00 70.72  ?  115 ASP B O    1 
ATOM   5192  C  CB   . ASP B  1 115 ? 2.020   5.454   3.063   1.00 84.57  ?  115 ASP B CB   1 
ATOM   5193  C  CG   . ASP B  1 115 ? 2.138   5.046   4.522   1.00 82.18  ?  115 ASP B CG   1 
ATOM   5194  O  OD1  . ASP B  1 115 ? 2.381   3.848   4.785   1.00 73.63  ?  115 ASP B OD1  1 
ATOM   5195  O  OD2  . ASP B  1 115 ? 2.046   5.939   5.402   1.00 72.11  -1 115 ASP B OD2  1 
ATOM   5196  H  H    . ASP B  1 115 ? -0.029  6.698   2.598   1.00 114.17 ?  115 ASP B H    1 
ATOM   5197  H  HA   . ASP B  1 115 ? 1.025   4.595   1.478   1.00 108.63 ?  115 ASP B HA   1 
ATOM   5198  H  HB2  . ASP B  1 115 ? 2.805   5.125   2.599   1.00 101.49 ?  115 ASP B HB2  1 
ATOM   5199  H  HB3  . ASP B  1 115 ? 1.999   6.423   3.028   1.00 101.49 ?  115 ASP B HB3  1 
ATOM   5200  N  N    . GLU B  1 116 ? -0.070  2.618   2.391   1.00 87.97  ?  116 GLU B N    1 
ATOM   5201  C  CA   . GLU B  1 116 ? -1.050  1.622   2.808   1.00 87.64  ?  116 GLU B CA   1 
ATOM   5202  C  C    . GLU B  1 116 ? -0.673  0.935   4.121   1.00 85.51  ?  116 GLU B C    1 
ATOM   5203  O  O    . GLU B  1 116 ? -1.569  0.449   4.819   1.00 74.67  ?  116 GLU B O    1 
ATOM   5204  C  CB   . GLU B  1 116 ? -1.263  0.607   1.670   1.00 88.55  ?  116 GLU B CB   1 
ATOM   5205  C  CG   . GLU B  1 116 ? -0.913  -0.849  1.966   1.00 90.58  ?  116 GLU B CG   1 
ATOM   5206  C  CD   . GLU B  1 116 ? 0.587   -1.091  2.082   1.00 96.02  ?  116 GLU B CD   1 
ATOM   5207  O  OE1  . GLU B  1 116 ? 1.363   -0.345  1.446   1.00 95.65  ?  116 GLU B OE1  1 
ATOM   5208  O  OE2  . GLU B  1 116 ? 0.989   -2.027  2.808   1.00 94.23  -1 116 GLU B OE2  1 
ATOM   5209  H  H    . GLU B  1 116 ? 0.383   2.406   1.691   1.00 105.57 ?  116 GLU B H    1 
ATOM   5210  H  HA   . GLU B  1 116 ? -1.896  2.072   2.953   1.00 105.17 ?  116 GLU B HA   1 
ATOM   5211  H  HB2  . GLU B  1 116 ? -2.199  0.630   1.417   1.00 106.26 ?  116 GLU B HB2  1 
ATOM   5212  H  HB3  . GLU B  1 116 ? -0.721  0.883   0.914   1.00 106.26 ?  116 GLU B HB3  1 
ATOM   5213  H  HG2  . GLU B  1 116 ? -1.324  -1.106  2.806   1.00 108.70 ?  116 GLU B HG2  1 
ATOM   5214  H  HG3  . GLU B  1 116 ? -1.252  -1.406  1.248   1.00 108.70 ?  116 GLU B HG3  1 
ATOM   5215  N  N    . ASP B  1 117 ? 0.614   0.903   4.491   1.00 76.59  ?  117 ASP B N    1 
ATOM   5216  C  CA   . ASP B  1 117 ? 1.001   0.317   5.775   1.00 69.47  ?  117 ASP B CA   1 
ATOM   5217  C  C    . ASP B  1 117 ? 0.438   1.123   6.944   1.00 66.08  ?  117 ASP B C    1 
ATOM   5218  O  O    . ASP B  1 117 ? -0.101  0.549   7.900   1.00 55.80  ?  117 ASP B O    1 
ATOM   5219  C  CB   . ASP B  1 117 ? 2.529   0.213   5.866   1.00 73.58  ?  117 ASP B CB   1 
ATOM   5220  C  CG   . ASP B  1 117 ? 3.016   -0.350  7.208   1.00 66.72  ?  117 ASP B CG   1 
ATOM   5221  O  OD1  . ASP B  1 117 ? 3.328   0.451   8.118   1.00 55.28  ?  117 ASP B OD1  1 
ATOM   5222  O  OD2  . ASP B  1 117 ? 3.098   -1.594  7.355   1.00 66.62  -1 117 ASP B OD2  1 
ATOM   5223  H  H    . ASP B  1 117 ? 1.268   1.208   4.024   1.00 91.90  ?  117 ASP B H    1 
ATOM   5224  H  HA   . ASP B  1 117 ? 0.638   -0.581  5.831   1.00 83.36  ?  117 ASP B HA   1 
ATOM   5225  H  HB2  . ASP B  1 117 ? 2.847   -0.374  5.163   1.00 88.29  ?  117 ASP B HB2  1 
ATOM   5226  H  HB3  . ASP B  1 117 ? 2.912   1.098   5.756   1.00 88.29  ?  117 ASP B HB3  1 
ATOM   5227  N  N    . ALA B  1 118 ? 0.549   2.453   6.887   1.00 61.39  ?  118 ALA B N    1 
ATOM   5228  C  CA   . ALA B  1 118 ? -0.018  3.285   7.944   1.00 57.87  ?  118 ALA B CA   1 
ATOM   5229  C  C    . ALA B  1 118 ? -1.544  3.303   7.890   1.00 43.25  ?  118 ALA B C    1 
ATOM   5230  O  O    . ALA B  1 118 ? -2.199  3.387   8.935   1.00 33.90  ?  118 ALA B O    1 
ATOM   5231  C  CB   . ALA B  1 118 ? 0.538   4.707   7.847   1.00 64.20  ?  118 ALA B CB   1 
ATOM   5232  H  H    . ALA B  1 118 ? 0.940   2.889   6.257   1.00 73.66  ?  118 ALA B H    1 
ATOM   5233  H  HA   . ALA B  1 118 ? 0.245   2.921   8.804   1.00 69.44  ?  118 ALA B HA   1 
ATOM   5234  H  HB1  . ALA B  1 118 ? 0.152   5.245   8.556   1.00 77.04  ?  118 ALA B HB1  1 
ATOM   5235  H  HB2  . ALA B  1 118 ? 1.503   4.675   7.943   1.00 77.04  ?  118 ALA B HB2  1 
ATOM   5236  H  HB3  . ALA B  1 118 ? 0.303   5.079   6.983   1.00 77.04  ?  118 ALA B HB3  1 
ATOM   5237  N  N    . ALA B  1 119 ? -2.132  3.231   6.694   1.00 46.16  ?  119 ALA B N    1 
ATOM   5238  C  CA   . ALA B  1 119 ? -3.579  3.080   6.610   1.00 41.87  ?  119 ALA B CA   1 
ATOM   5239  C  C    . ALA B  1 119 ? -4.019  1.795   7.305   1.00 41.07  ?  119 ALA B C    1 
ATOM   5240  O  O    . ALA B  1 119 ? -4.974  1.795   8.093   1.00 39.79  ?  119 ALA B O    1 
ATOM   5241  C  CB   . ALA B  1 119 ? -4.032  3.081   5.148   1.00 47.45  ?  119 ALA B CB   1 
ATOM   5242  H  H    . ALA B  1 119 ? -1.725  3.267   5.937   1.00 55.39  ?  119 ALA B H    1 
ATOM   5243  H  HA   . ALA B  1 119 ? -4.004  3.827   7.059   1.00 50.24  ?  119 ALA B HA   1 
ATOM   5244  H  HB1  . ALA B  1 119 ? -4.996  2.980   5.116   1.00 56.94  ?  119 ALA B HB1  1 
ATOM   5245  H  HB2  . ALA B  1 119 ? -3.774  3.922   4.739   1.00 56.94  ?  119 ALA B HB2  1 
ATOM   5246  H  HB3  . ALA B  1 119 ? -3.605  2.343   4.685   1.00 56.94  ?  119 ALA B HB3  1 
ATOM   5247  N  N    . LYS B  1 120 ? -3.331  0.683   7.022   1.00 42.23  ?  120 LYS B N    1 
ATOM   5248  C  CA   . LYS B  1 120 ? -3.731  -0.599  7.595   1.00 42.90  ?  120 LYS B CA   1 
ATOM   5249  C  C    . LYS B  1 120 ? -3.623  -0.581  9.121   1.00 44.34  ?  120 LYS B C    1 
ATOM   5250  O  O    . LYS B  1 120 ? -4.481  -1.131  9.816   1.00 30.19  ?  120 LYS B O    1 
ATOM   5251  C  CB   . LYS B  1 120 ? -2.892  -1.729  6.987   1.00 44.57  ?  120 LYS B CB   1 
ATOM   5252  C  CG   . LYS B  1 120 ? -3.217  -2.062  5.496   1.00 47.55  ?  120 LYS B CG   1 
ATOM   5253  C  CD   . LYS B  1 120 ? -2.682  -3.464  5.114   1.00 61.90  ?  120 LYS B CD   1 
ATOM   5254  C  CE   . LYS B  1 120 ? -2.657  -3.743  3.609   1.00 68.95  ?  120 LYS B CE   1 
ATOM   5255  N  NZ   . LYS B  1 120 ? -3.992  -3.696  2.959   1.00 69.84  1  120 LYS B NZ   1 
ATOM   5256  H  H    . LYS B  1 120 ? -2.642  0.648   6.509   1.00 50.67  ?  120 LYS B H    1 
ATOM   5257  H  HA   . LYS B  1 120 ? -4.659  -0.765  7.368   1.00 51.48  ?  120 LYS B HA   1 
ATOM   5258  H  HB2  . LYS B  1 120 ? -1.956  -1.477  7.033   1.00 53.48  ?  120 LYS B HB2  1 
ATOM   5259  H  HB3  . LYS B  1 120 ? -3.038  -2.535  7.506   1.00 53.48  ?  120 LYS B HB3  1 
ATOM   5260  H  HG2  . LYS B  1 120 ? -4.178  -2.056  5.367   1.00 57.06  ?  120 LYS B HG2  1 
ATOM   5261  H  HG3  . LYS B  1 120 ? -2.794  -1.406  4.920   1.00 57.06  ?  120 LYS B HG3  1 
ATOM   5262  H  HD2  . LYS B  1 120 ? -1.774  -3.551  5.445   1.00 74.28  ?  120 LYS B HD2  1 
ATOM   5263  H  HD3  . LYS B  1 120 ? -3.247  -4.135  5.528   1.00 74.28  ?  120 LYS B HD3  1 
ATOM   5264  H  HE2  . LYS B  1 120 ? -2.095  -3.079  3.178   1.00 82.74  ?  120 LYS B HE2  1 
ATOM   5265  H  HE3  . LYS B  1 120 ? -2.288  -4.628  3.462   1.00 82.74  ?  120 LYS B HE3  1 
ATOM   5266  H  HZ1  . LYS B  1 120 ? -3.913  -3.865  2.089   1.00 83.81  ?  120 LYS B HZ1  1 
ATOM   5267  H  HZ2  . LYS B  1 120 ? -4.529  -4.304  3.325   1.00 83.81  ?  120 LYS B HZ2  1 
ATOM   5268  H  HZ3  . LYS B  1 120 ? -4.354  -2.890  3.066   1.00 83.81  ?  120 LYS B HZ3  1 
ATOM   5269  N  N    . LYS B  1 121 ? -2.589  0.060   9.667   1.00 35.95  ?  121 LYS B N    1 
ATOM   5270  C  CA   . LYS B  1 121 ? -2.442  0.098   11.119  1.00 30.22  ?  121 LYS B CA   1 
ATOM   5271  C  C    . LYS B  1 121 ? -3.528  0.949   11.765  1.00 36.20  ?  121 LYS B C    1 
ATOM   5272  O  O    . LYS B  1 121 ? -4.077  0.579   12.816  1.00 31.41  ?  121 LYS B O    1 
ATOM   5273  C  CB   . LYS B  1 121 ? -1.052  0.610   11.488  1.00 39.32  ?  121 LYS B CB   1 
ATOM   5274  C  CG   . LYS B  1 121 ? 0.049   -0.391  11.158  1.00 47.85  ?  121 LYS B CG   1 
ATOM   5275  C  CD   . LYS B  1 121 ? 1.429   0.231   11.317  1.00 60.59  ?  121 LYS B CD   1 
ATOM   5276  C  CE   . LYS B  1 121 ? 2.535   -0.717  10.856  1.00 62.20  ?  121 LYS B CE   1 
ATOM   5277  N  NZ   . LYS B  1 121 ? 3.756   0.012   10.356  1.00 59.40  1  121 LYS B NZ   1 
ATOM   5278  H  H    . LYS B  1 121 ? -1.973  0.471   9.230   1.00 43.14  ?  121 LYS B H    1 
ATOM   5279  H  HA   . LYS B  1 121 ? -2.528  -0.804  11.466  1.00 36.27  ?  121 LYS B HA   1 
ATOM   5280  H  HB2  . LYS B  1 121 ? -0.874  1.426   10.995  1.00 47.19  ?  121 LYS B HB2  1 
ATOM   5281  H  HB3  . LYS B  1 121 ? -1.023  0.786   12.442  1.00 47.19  ?  121 LYS B HB3  1 
ATOM   5282  H  HG2  . LYS B  1 121 ? -0.016  -1.149  11.760  1.00 57.42  ?  121 LYS B HG2  1 
ATOM   5283  H  HG3  . LYS B  1 121 ? -0.049  -0.683  10.238  1.00 57.42  ?  121 LYS B HG3  1 
ATOM   5284  H  HD2  . LYS B  1 121 ? 1.479   1.038   10.783  1.00 72.70  ?  121 LYS B HD2  1 
ATOM   5285  H  HD3  . LYS B  1 121 ? 1.579   0.439   12.253  1.00 72.70  ?  121 LYS B HD3  1 
ATOM   5286  H  HE2  . LYS B  1 121 ? 2.804   -1.276  11.601  1.00 74.64  ?  121 LYS B HE2  1 
ATOM   5287  H  HE3  . LYS B  1 121 ? 2.198   -1.268  10.132  1.00 74.64  ?  121 LYS B HE3  1 
ATOM   5288  H  HZ1  . LYS B  1 121 ? 3.540   0.529   9.664   1.00 71.28  ?  121 LYS B HZ1  1 
ATOM   5289  H  HZ2  . LYS B  1 121 ? 4.092   0.522   11.004  1.00 71.28  ?  121 LYS B HZ2  1 
ATOM   5290  H  HZ3  . LYS B  1 121 ? 4.375   -0.573  10.097  1.00 71.28  ?  121 LYS B HZ3  1 
ATOM   5291  N  N    . LYS B  1 122 ? -3.869  2.080   11.145  1.00 35.82  ?  122 LYS B N    1 
ATOM   5292  C  CA   . LYS B  1 122 ? -4.970  2.892   11.654  1.00 37.92  ?  122 LYS B CA   1 
ATOM   5293  C  C    . LYS B  1 122 ? -6.287  2.126   11.570  1.00 29.90  ?  122 LYS B C    1 
ATOM   5294  O  O    . LYS B  1 122 ? -7.090  2.116   12.521  1.00 30.05  ?  122 LYS B O    1 
ATOM   5295  C  CB   . LYS B  1 122 ? -5.066  4.195   10.859  1.00 31.61  ?  122 LYS B CB   1 
ATOM   5296  C  CG   . LYS B  1 122 ? -6.172  5.116   11.331  1.00 47.69  ?  122 LYS B CG   1 
ATOM   5297  C  CD   . LYS B  1 122 ? -6.278  6.367   10.479  1.00 62.67  ?  122 LYS B CD   1 
ATOM   5298  C  CE   . LYS B  1 122 ? -7.394  7.268   10.997  1.00 68.71  ?  122 LYS B CE   1 
ATOM   5299  N  NZ   . LYS B  1 122 ? -7.604  8.476   10.151  1.00 77.27  1  122 LYS B NZ   1 
ATOM   5300  H  H    . LYS B  1 122 ? -3.486  2.393   10.442  1.00 42.98  ?  122 LYS B H    1 
ATOM   5301  H  HA   . LYS B  1 122 ? -4.804  3.113   12.584  1.00 45.51  ?  122 LYS B HA   1 
ATOM   5302  H  HB2  . LYS B  1 122 ? -4.226  4.673   10.941  1.00 37.93  ?  122 LYS B HB2  1 
ATOM   5303  H  HB3  . LYS B  1 122 ? -5.234  3.982   9.928   1.00 37.93  ?  122 LYS B HB3  1 
ATOM   5304  H  HG2  . LYS B  1 122 ? -7.019  4.646   11.284  1.00 57.22  ?  122 LYS B HG2  1 
ATOM   5305  H  HG3  . LYS B  1 122 ? -5.991  5.388   12.244  1.00 57.22  ?  122 LYS B HG3  1 
ATOM   5306  H  HD2  . LYS B  1 122 ? -5.443  6.859   10.519  1.00 75.20  ?  122 LYS B HD2  1 
ATOM   5307  H  HD3  . LYS B  1 122 ? -6.483  6.119   9.564   1.00 75.20  ?  122 LYS B HD3  1 
ATOM   5308  H  HE2  . LYS B  1 122 ? -8.223  6.765   11.012  1.00 82.45  ?  122 LYS B HE2  1 
ATOM   5309  H  HE3  . LYS B  1 122 ? -7.170  7.565   11.892  1.00 82.45  ?  122 LYS B HE3  1 
ATOM   5310  H  HZ1  . LYS B  1 122 ? -8.262  8.972   10.488  1.00 92.73  ?  122 LYS B HZ1  1 
ATOM   5311  H  HZ2  . LYS B  1 122 ? -6.860  8.963   10.125  1.00 92.73  ?  122 LYS B HZ2  1 
ATOM   5312  H  HZ3  . LYS B  1 122 ? -7.820  8.233   9.322   1.00 92.73  ?  122 LYS B HZ3  1 
ATOM   5313  N  N    . LEU B  1 123 ? -6.532  1.485   10.427  1.00 30.45  ?  123 LEU B N    1 
ATOM   5314  C  CA   . LEU B  1 123 ? -7.781  0.754   10.261  1.00 26.27  ?  123 LEU B CA   1 
ATOM   5315  C  C    . LEU B  1 123 ? -7.870  -0.401  11.256  1.00 27.20  ?  123 LEU B C    1 
ATOM   5316  O  O    . LEU B  1 123 ? -8.957  -0.722  11.742  1.00 24.28  ?  123 LEU B O    1 
ATOM   5317  C  CB   . LEU B  1 123 ? -7.917  0.252   8.821   1.00 33.11  ?  123 LEU B CB   1 
ATOM   5318  C  CG   . LEU B  1 123 ? -8.258  1.351   7.810   1.00 37.52  ?  123 LEU B CG   1 
ATOM   5319  C  CD1  . LEU B  1 123 ? -8.284  0.783   6.409   1.00 42.53  ?  123 LEU B CD1  1 
ATOM   5320  C  CD2  . LEU B  1 123 ? -9.598  2.041   8.137   1.00 43.32  ?  123 LEU B CD2  1 
ATOM   5321  H  H    . LEU B  1 123 ? -6.004  1.460   9.749   1.00 36.54  ?  123 LEU B H    1 
ATOM   5322  H  HA   . LEU B  1 123 ? -8.522  1.354   10.437  1.00 31.52  ?  123 LEU B HA   1 
ATOM   5323  H  HB2  . LEU B  1 123 ? -7.076  -0.149  8.550   1.00 39.73  ?  123 LEU B HB2  1 
ATOM   5324  H  HB3  . LEU B  1 123 ? -8.624  -0.412  8.787   1.00 39.73  ?  123 LEU B HB3  1 
ATOM   5325  H  HG   . LEU B  1 123 ? -7.564  2.027   7.840   1.00 45.03  ?  123 LEU B HG   1 
ATOM   5326  H  HD11 . LEU B  1 123 ? -8.502  1.492   5.785   1.00 51.04  ?  123 LEU B HD11 1 
ATOM   5327  H  HD12 . LEU B  1 123 ? -7.411  0.415   6.202   1.00 51.04  ?  123 LEU B HD12 1 
ATOM   5328  H  HD13 . LEU B  1 123 ? -8.957  0.085   6.365   1.00 51.04  ?  123 LEU B HD13 1 
ATOM   5329  H  HD21 . LEU B  1 123 ? -9.771  2.726   7.473   1.00 51.98  ?  123 LEU B HD21 1 
ATOM   5330  H  HD22 . LEU B  1 123 ? -10.306 1.378   8.122   1.00 51.98  ?  123 LEU B HD22 1 
ATOM   5331  H  HD23 . LEU B  1 123 ? -9.539  2.442   9.019   1.00 51.98  ?  123 LEU B HD23 1 
ATOM   5332  N  N    . ASN B  1 124 ? -6.745  -1.048  11.563  1.00 24.60  ?  124 ASN B N    1 
ATOM   5333  C  CA   . ASN B  1 124 ? -6.775  -2.141  12.530  1.00 23.87  ?  124 ASN B CA   1 
ATOM   5334  C  C    . ASN B  1 124 ? -7.416  -1.689  13.845  1.00 23.43  ?  124 ASN B C    1 
ATOM   5335  O  O    . ASN B  1 124 ? -8.302  -2.371  14.379  1.00 21.90  ?  124 ASN B O    1 
ATOM   5336  C  CB   . ASN B  1 124 ? -5.353  -2.688  12.752  1.00 23.84  ?  124 ASN B CB   1 
ATOM   5337  C  CG   . ASN B  1 124 ? -5.269  -3.659  13.919  1.00 27.63  ?  124 ASN B CG   1 
ATOM   5338  O  OD1  . ASN B  1 124 ? -4.559  -3.414  14.914  1.00 31.38  ?  124 ASN B OD1  1 
ATOM   5339  N  ND2  . ASN B  1 124 ? -5.987  -4.753  13.813  1.00 22.94  ?  124 ASN B ND2  1 
ATOM   5340  H  H    . ASN B  1 124 ? -5.969  -0.878  11.233  1.00 29.52  ?  124 ASN B H    1 
ATOM   5341  H  HA   . ASN B  1 124 ? -7.315  -2.861  12.169  1.00 28.64  ?  124 ASN B HA   1 
ATOM   5342  H  HB2  . ASN B  1 124 ? -5.066  -3.155  11.952  1.00 28.61  ?  124 ASN B HB2  1 
ATOM   5343  H  HB3  . ASN B  1 124 ? -4.755  -1.946  12.936  1.00 28.61  ?  124 ASN B HB3  1 
ATOM   5344  H  HD21 . ASN B  1 124 ? -5.976  -5.337  14.444  1.00 27.53  ?  124 ASN B HD21 1 
ATOM   5345  H  HD22 . ASN B  1 124 ? -6.467  -4.886  13.112  1.00 27.53  ?  124 ASN B HD22 1 
ATOM   5346  N  N    . LEU B  1 125 ? -6.980  -0.547  14.403  1.00 24.19  ?  125 LEU B N    1 
ATOM   5347  C  CA   . LEU B  1 125 ? -7.554  -0.085  15.666  1.00 24.67  ?  125 LEU B CA   1 
ATOM   5348  C  C    . LEU B  1 125 ? -9.024  0.305   15.510  1.00 24.88  ?  125 LEU B C    1 
ATOM   5349  O  O    . LEU B  1 125 ? -9.851  0.010   16.386  1.00 26.16  ?  125 LEU B O    1 
ATOM   5350  C  CB   . LEU B  1 125 ? -6.727  1.084   16.214  1.00 32.86  ?  125 LEU B CB   1 
ATOM   5351  C  CG   . LEU B  1 125 ? -5.261  0.720   16.476  1.00 32.78  ?  125 LEU B CG   1 
ATOM   5352  C  CD1  . LEU B  1 125 ? -4.496  1.939   16.996  1.00 39.51  ?  125 LEU B CD1  1 
ATOM   5353  C  CD2  . LEU B  1 125 ? -5.130  -0.442  17.436  1.00 34.92  ?  125 LEU B CD2  1 
ATOM   5354  H  H    . LEU B  1 125 ? -6.369  -0.037  14.075  1.00 29.03  ?  125 LEU B H    1 
ATOM   5355  H  HA   . LEU B  1 125 ? -7.508  -0.808  16.311  1.00 29.61  ?  125 LEU B HA   1 
ATOM   5356  H  HB2  . LEU B  1 125 ? -6.744  1.809   15.571  1.00 39.44  ?  125 LEU B HB2  1 
ATOM   5357  H  HB3  . LEU B  1 125 ? -7.116  1.377   17.053  1.00 39.44  ?  125 LEU B HB3  1 
ATOM   5358  H  HG   . LEU B  1 125 ? -4.854  0.454   15.637  1.00 39.33  ?  125 LEU B HG   1 
ATOM   5359  H  HD11 . LEU B  1 125 ? -3.573  1.688   17.155  1.00 47.41  ?  125 LEU B HD11 1 
ATOM   5360  H  HD12 . LEU B  1 125 ? -4.537  2.645   16.331  1.00 47.41  ?  125 LEU B HD12 1 
ATOM   5361  H  HD13 . LEU B  1 125 ? -4.905  2.239   17.823  1.00 47.41  ?  125 LEU B HD13 1 
ATOM   5362  H  HD21 . LEU B  1 125 ? -4.189  -0.635  17.571  1.00 41.90  ?  125 LEU B HD21 1 
ATOM   5363  H  HD22 . LEU B  1 125 ? -5.542  -0.201  18.281  1.00 41.90  ?  125 LEU B HD22 1 
ATOM   5364  H  HD23 . LEU B  1 125 ? -5.576  -1.215  17.059  1.00 41.90  ?  125 LEU B HD23 1 
HETATM 5365  N  N    . MSE B  1 126 ? -9.377  0.940   14.391  1.00 24.99  ?  126 MSE B N    1 
HETATM 5366  C  CA   . MSE B  1 126 ? -10.758 1.274   14.114  1.00 27.31  ?  126 MSE B CA   1 
HETATM 5367  C  C    . MSE B  1 126 ? -11.619 0.005   14.055  1.00 22.65  ?  126 MSE B C    1 
HETATM 5368  O  O    . MSE B  1 126 ? -12.735 -0.008  14.602  1.00 23.34  ?  126 MSE B O    1 
HETATM 5369  C  CB   . MSE B  1 126 ? -10.860 2.052   12.792  1.00 33.37  ?  126 MSE B CB   1 
HETATM 5370  C  CG   . MSE B  1 126 ? -12.324 2.235   12.271  1.00 50.69  ?  126 MSE B CG   1 
HETATM 5371  SE SE   . MSE B  1 126 ? -12.402 2.911   10.432  1.00 81.71  ?  126 MSE B SE   1 
HETATM 5372  C  CE   . MSE B  1 126 ? -10.960 4.239   10.566  1.00 70.37  ?  126 MSE B CE   1 
HETATM 5373  H  H    . MSE B  1 126 ? -8.827  1.186   13.778  1.00 29.99  ?  126 MSE B H    1 
HETATM 5374  H  HA   . MSE B  1 126 ? -11.090 1.847   14.823  1.00 32.78  ?  126 MSE B HA   1 
HETATM 5375  H  HB2  . MSE B  1 126 ? -10.479 2.935   12.920  1.00 40.04  ?  126 MSE B HB2  1 
HETATM 5376  H  HB3  . MSE B  1 126 ? -10.361 1.576   12.110  1.00 40.04  ?  126 MSE B HB3  1 
HETATM 5377  H  HG2  . MSE B  1 126 ? -12.776 1.378   12.294  1.00 60.82  ?  126 MSE B HG2  1 
HETATM 5378  H  HG3  . MSE B  1 126 ? -12.785 2.869   12.843  1.00 60.82  ?  126 MSE B HG3  1 
HETATM 5379  H  HE1  . MSE B  1 126 ? -10.861 4.684   9.710   1.00 84.44  ?  126 MSE B HE1  1 
HETATM 5380  H  HE2  . MSE B  1 126 ? -11.190 4.886   11.251  1.00 84.44  ?  126 MSE B HE2  1 
HETATM 5381  H  HE3  . MSE B  1 126 ? -10.135 3.786   10.801  1.00 84.44  ?  126 MSE B HE3  1 
ATOM   5382  N  N    . GLY B  1 127 ? -11.104 -1.037  13.392  1.00 22.34  ?  127 GLY B N    1 
ATOM   5383  C  CA   . GLY B  1 127 ? -11.869 -2.271  13.252  1.00 20.71  ?  127 GLY B CA   1 
ATOM   5384  C  C    . GLY B  1 127 ? -12.122 -2.961  14.579  1.00 24.41  ?  127 GLY B C    1 
ATOM   5385  O  O    . GLY B  1 127 ? -13.214 -3.483  14.832  1.00 20.43  ?  127 GLY B O    1 
ATOM   5386  H  H    . GLY B  1 127 ? -10.328 -1.051  13.022  1.00 26.81  ?  127 GLY B H    1 
ATOM   5387  H  HA2  . GLY B  1 127 ? -12.726 -2.074  12.842  1.00 24.85  ?  127 GLY B HA2  1 
ATOM   5388  H  HA3  . GLY B  1 127 ? -11.388 -2.884  12.675  1.00 24.85  ?  127 GLY B HA3  1 
ATOM   5389  N  N    . ARG B  1 128 ? -11.129 -2.946  15.465  1.00 20.55  ?  128 ARG B N    1 
ATOM   5390  C  CA   . ARG B  1 128 ? -11.320 -3.563  16.773  1.00 21.23  ?  128 ARG B CA   1 
ATOM   5391  C  C    . ARG B  1 128 ? -12.402 -2.840  17.578  1.00 21.10  ?  128 ARG B C    1 
ATOM   5392  O  O    . ARG B  1 128 ? -13.201 -3.477  18.281  1.00 20.62  ?  128 ARG B O    1 
ATOM   5393  C  CB   . ARG B  1 128 ? -9.986  -3.572  17.536  1.00 19.30  ?  128 ARG B CB   1 
ATOM   5394  C  CG   . ARG B  1 128 ? -8.906  -4.437  16.897  1.00 21.50  ?  128 ARG B CG   1 
ATOM   5395  C  CD   . ARG B  1 128 ? -7.584  -4.299  17.642  1.00 20.80  ?  128 ARG B CD   1 
ATOM   5396  N  NE   . ARG B  1 128 ? -7.678  -4.806  18.999  1.00 22.24  ?  128 ARG B NE   1 
ATOM   5397  C  CZ   . ARG B  1 128 ? -7.360  -6.034  19.385  1.00 24.08  ?  128 ARG B CZ   1 
ATOM   5398  N  NH1  . ARG B  1 128 ? -6.914  -6.944  18.529  1.00 23.69  1  128 ARG B NH1  1 
ATOM   5399  N  NH2  . ARG B  1 128 ? -7.490  -6.354  20.659  1.00 25.05  ?  128 ARG B NH2  1 
ATOM   5400  H  H    . ARG B  1 128 ? -10.354 -2.594  15.338  1.00 24.67  ?  128 ARG B H    1 
ATOM   5401  H  HA   . ARG B  1 128 ? -11.602 -4.483  16.650  1.00 25.47  ?  128 ARG B HA   1 
ATOM   5402  H  HB2  . ARG B  1 128 ? -9.648  -2.664  17.582  1.00 23.16  ?  128 ARG B HB2  1 
ATOM   5403  H  HB3  . ARG B  1 128 ? -10.142 -3.908  18.432  1.00 23.16  ?  128 ARG B HB3  1 
ATOM   5404  H  HG2  . ARG B  1 128 ? -9.178  -5.367  16.928  1.00 25.80  ?  128 ARG B HG2  1 
ATOM   5405  H  HG3  . ARG B  1 128 ? -8.769  -4.156  15.979  1.00 25.80  ?  128 ARG B HG3  1 
ATOM   5406  H  HD2  . ARG B  1 128 ? -6.900  -4.806  17.176  1.00 24.96  ?  128 ARG B HD2  1 
ATOM   5407  H  HD3  . ARG B  1 128 ? -7.337  -3.362  17.684  1.00 24.96  ?  128 ARG B HD3  1 
ATOM   5408  H  HE   . ARG B  1 128 ? -7.963  -4.264  19.603  1.00 26.69  ?  128 ARG B HE   1 
ATOM   5409  H  HH11 . ARG B  1 128 ? -6.823  -6.744  17.698  1.00 28.43  ?  128 ARG B HH11 1 
ATOM   5410  H  HH12 . ARG B  1 128 ? -6.715  -7.733  18.806  1.00 28.43  ?  128 ARG B HH12 1 
ATOM   5411  H  HH21 . ARG B  1 128 ? -7.779  -5.772  21.222  1.00 30.06  ?  128 ARG B HH21 1 
ATOM   5412  H  HH22 . ARG B  1 128 ? -7.290  -7.147  20.926  1.00 30.06  ?  128 ARG B HH22 1 
ATOM   5413  N  N    . LYS B  1 129 ? -12.458 -1.507  17.483  1.00 20.61  ?  129 LYS B N    1 
ATOM   5414  C  CA   . LYS B  1 129 ? -13.487 -0.769  18.203  1.00 18.54  ?  129 LYS B CA   1 
ATOM   5415  C  C    . LYS B  1 129 ? -14.840 -0.969  17.557  1.00 19.30  ?  129 LYS B C    1 
ATOM   5416  O  O    . LYS B  1 129 ? -15.846 -1.076  18.252  1.00 19.31  ?  129 LYS B O    1 
ATOM   5417  C  CB   . LYS B  1 129 ? -13.146 0.725   18.266  1.00 21.76  ?  129 LYS B CB   1 
ATOM   5418  C  CG   . LYS B  1 129 ? -11.963 1.034   19.162  1.00 33.69  ?  129 LYS B CG   1 
ATOM   5419  C  CD   . LYS B  1 129 ? -11.723 2.538   19.184  1.00 41.74  ?  129 LYS B CD   1 
ATOM   5420  C  CE   . LYS B  1 129 ? -10.350 2.866   19.717  1.00 55.29  ?  129 LYS B CE   1 
ATOM   5421  N  NZ   . LYS B  1 129 ? -10.210 4.330   19.946  1.00 67.50  1  129 LYS B NZ   1 
ATOM   5422  H  H    . LYS B  1 129 ? -11.922 -1.021  17.019  1.00 24.73  ?  129 LYS B H    1 
ATOM   5423  H  HA   . LYS B  1 129 ? -13.537 -1.104  19.112  1.00 22.24  ?  129 LYS B HA   1 
ATOM   5424  H  HB2  . LYS B  1 129 ? -12.933 1.036   17.372  1.00 26.11  ?  129 LYS B HB2  1 
ATOM   5425  H  HB3  . LYS B  1 129 ? -13.914 1.208   18.609  1.00 26.11  ?  129 LYS B HB3  1 
ATOM   5426  H  HG2  . LYS B  1 129 ? -12.151 0.737   20.066  1.00 40.43  ?  129 LYS B HG2  1 
ATOM   5427  H  HG3  . LYS B  1 129 ? -11.168 0.598   18.817  1.00 40.43  ?  129 LYS B HG3  1 
ATOM   5428  H  HD2  . LYS B  1 129 ? -11.791 2.887   18.281  1.00 50.09  ?  129 LYS B HD2  1 
ATOM   5429  H  HD3  . LYS B  1 129 ? -12.381 2.960   19.758  1.00 50.09  ?  129 LYS B HD3  1 
ATOM   5430  H  HE2  . LYS B  1 129 ? -10.214 2.409   20.562  1.00 66.35  ?  129 LYS B HE2  1 
ATOM   5431  H  HE3  . LYS B  1 129 ? -9.679  2.592   19.072  1.00 66.35  ?  129 LYS B HE3  1 
ATOM   5432  H  HZ1  . LYS B  1 129 ? -9.397  4.512   20.260  1.00 81.00  ?  129 LYS B HZ1  1 
ATOM   5433  H  HZ2  . LYS B  1 129 ? -10.330 4.770   19.182  1.00 81.00  ?  129 LYS B HZ2  1 
ATOM   5434  H  HZ3  . LYS B  1 129 ? -10.816 4.604   20.537  1.00 81.00  ?  129 LYS B HZ3  1 
ATOM   5435  N  N    . ALA B  1 130 ? -14.869 -1.038  16.226  1.00 20.18  ?  130 ALA B N    1 
ATOM   5436  C  CA   . ALA B  1 130 ? -16.124 -1.229  15.506  1.00 21.04  ?  130 ALA B CA   1 
ATOM   5437  C  C    . ALA B  1 130 ? -16.777 -2.552  15.874  1.00 17.69  ?  130 ALA B C    1 
ATOM   5438  O  O    . ALA B  1 130 ? -17.999 -2.628  16.026  1.00 18.01  ?  130 ALA B O    1 
ATOM   5439  C  CB   . ALA B  1 130 ? -15.874 -1.163  14.001  1.00 21.50  ?  130 ALA B CB   1 
ATOM   5440  H  H    . ALA B  1 130 ? -14.177 -0.976  15.719  1.00 24.22  ?  130 ALA B H    1 
ATOM   5441  H  HA   . ALA B  1 130 ? -16.736 -0.515  15.741  1.00 25.25  ?  130 ALA B HA   1 
ATOM   5442  H  HB1  . ALA B  1 130 ? -16.716 -1.291  13.536  1.00 25.80  ?  130 ALA B HB1  1 
ATOM   5443  H  HB2  . ALA B  1 130 ? -15.504 -0.294  13.781  1.00 25.80  ?  130 ALA B HB2  1 
ATOM   5444  H  HB3  . ALA B  1 130 ? -15.249 -1.862  13.754  1.00 25.80  ?  130 ALA B HB3  1 
ATOM   5445  N  N    . LYS B  1 131 ? -15.981 -3.610  16.035  1.00 17.32  ?  131 LYS B N    1 
ATOM   5446  C  CA   A LYS B  1 131 ? -16.582 -4.910  16.308  0.52 16.75  ?  131 LYS B CA   1 
ATOM   5447  C  CA   B LYS B  1 131 ? -16.559 -4.918  16.317  0.48 16.91  ?  131 LYS B CA   1 
ATOM   5448  C  C    . LYS B  1 131 ? -17.317 -4.922  17.637  1.00 17.37  ?  131 LYS B C    1 
ATOM   5449  O  O    . LYS B  1 131 ? -18.247 -5.711  17.813  1.00 18.35  ?  131 LYS B O    1 
ATOM   5450  C  CB   A LYS B  1 131 ? -15.539 -6.020  16.283  0.52 18.77  ?  131 LYS B CB   1 
ATOM   5451  C  CB   B LYS B  1 131 ? -15.433 -5.959  16.324  0.48 19.20  ?  131 LYS B CB   1 
ATOM   5452  C  CG   A LYS B  1 131 ? -16.198 -7.387  16.158  0.52 25.90  ?  131 LYS B CG   1 
ATOM   5453  C  CG   B LYS B  1 131 ? -15.852 -7.402  16.541  0.48 22.19  ?  131 LYS B CG   1 
ATOM   5454  C  CD   A LYS B  1 131 ? -15.224 -8.465  15.805  0.52 26.23  ?  131 LYS B CD   1 
ATOM   5455  C  CD   B LYS B  1 131 ? -14.673 -8.346  16.311  0.48 27.62  ?  131 LYS B CD   1 
ATOM   5456  C  CE   A LYS B  1 131 ? -15.904 -9.812  15.756  0.52 31.02  ?  131 LYS B CE   1 
ATOM   5457  C  CE   B LYS B  1 131 ? -15.108 -9.809  16.280  0.48 23.35  ?  131 LYS B CE   1 
ATOM   5458  N  NZ   A LYS B  1 131 ? -14.909 -10.883 15.524  0.52 22.24  1  131 LYS B NZ   1 
ATOM   5459  N  NZ   B LYS B  1 131 ? -16.131 -10.094 15.213  0.48 27.50  1  131 LYS B NZ   1 
ATOM   5460  H  H    . LYS B  1 131 ? -15.122 -3.606  15.990  1.00 20.79  ?  131 LYS B H    1 
ATOM   5461  H  HA   . LYS B  1 131 ? -17.206 -5.126  15.611  1.00 20.29  ?  131 LYS B HA   1 
ATOM   5462  H  HB2  A LYS B  1 131 ? -14.952 -5.893  15.521  0.52 22.52  ?  131 LYS B HB2  1 
ATOM   5463  H  HB2  B LYS B  1 131 ? -14.975 -5.917  15.470  0.48 23.04  ?  131 LYS B HB2  1 
ATOM   5464  H  HB3  A LYS B  1 131 ? -15.030 -6.001  17.108  0.52 22.52  ?  131 LYS B HB3  1 
ATOM   5465  H  HB3  B LYS B  1 131 ? -14.812 -5.729  17.033  0.48 23.04  ?  131 LYS B HB3  1 
ATOM   5466  H  HG2  A LYS B  1 131 ? -16.608 -7.619  17.005  0.52 31.08  ?  131 LYS B HG2  1 
ATOM   5467  H  HG2  B LYS B  1 131 ? -16.162 -7.514  17.454  0.48 26.62  ?  131 LYS B HG2  1 
ATOM   5468  H  HG3  A LYS B  1 131 ? -16.872 -7.351  15.461  0.52 31.08  ?  131 LYS B HG3  1 
ATOM   5469  H  HG3  B LYS B  1 131 ? -16.556 -7.631  15.914  0.48 26.62  ?  131 LYS B HG3  1 
ATOM   5470  H  HD2  A LYS B  1 131 ? -14.844 -8.283  14.931  0.52 31.48  ?  131 LYS B HD2  1 
ATOM   5471  H  HD2  B LYS B  1 131 ? -14.259 -8.136  15.460  0.48 33.14  ?  131 LYS B HD2  1 
ATOM   5472  H  HD3  A LYS B  1 131 ? -14.525 -8.500  16.476  0.52 31.48  ?  131 LYS B HD3  1 
ATOM   5473  H  HD3  B LYS B  1 131 ? -14.033 -8.237  17.031  0.48 33.14  ?  131 LYS B HD3  1 
ATOM   5474  H  HE2  A LYS B  1 131 ? -16.347 -9.982  16.602  0.52 37.23  ?  131 LYS B HE2  1 
ATOM   5475  H  HE2  B LYS B  1 131 ? -14.332 -10.365 16.107  0.48 28.02  ?  131 LYS B HE2  1 
ATOM   5476  H  HE3  A LYS B  1 131 ? -16.545 -9.825  15.028  0.52 37.23  ?  131 LYS B HE3  1 
ATOM   5477  H  HE3  B LYS B  1 131 ? -15.497 -10.041 17.137  0.48 28.02  ?  131 LYS B HE3  1 
ATOM   5478  H  HZ1  A LYS B  1 131 ? -14.489 -10.746 14.751  0.52 26.69  ?  131 LYS B HZ1  1 
ATOM   5479  H  HZ1  B LYS B  1 131 ? -16.356 -10.955 15.229  0.48 33.00  ?  131 LYS B HZ1  1 
ATOM   5480  H  HZ2  A LYS B  1 131 ? -14.309 -10.889 16.182  0.52 26.69  ?  131 LYS B HZ2  1 
ATOM   5481  H  HZ2  B LYS B  1 131 ? -16.860 -9.602  15.351  0.48 33.00  ?  131 LYS B HZ2  1 
ATOM   5482  H  HZ3  A LYS B  1 131 ? -15.315 -11.675 15.496  0.52 26.69  ?  131 LYS B HZ3  1 
ATOM   5483  H  HZ3  B LYS B  1 131 ? -15.798 -9.898  14.411  0.48 33.00  ?  131 LYS B HZ3  1 
ATOM   5484  N  N    . LEU B  1 132 ? -16.909 -4.067  18.584  1.00 18.15  ?  132 LEU B N    1 
ATOM   5485  C  CA   . LEU B  1 132 ? -17.513 -3.976  19.899  1.00 18.20  ?  132 LEU B CA   1 
ATOM   5486  C  C    . LEU B  1 132 ? -18.797 -3.183  19.903  1.00 18.97  ?  132 LEU B C    1 
ATOM   5487  O  O    . LEU B  1 132 ? -19.493 -3.175  20.926  1.00 19.06  ?  132 LEU B O    1 
ATOM   5488  C  CB   . LEU B  1 132 ? -16.526 -3.326  20.876  1.00 18.40  ?  132 LEU B CB   1 
ATOM   5489  C  CG   . LEU B  1 132 ? -15.217 -4.074  21.085  1.00 18.19  ?  132 LEU B CG   1 
ATOM   5490  C  CD1  . LEU B  1 132 ? -14.217 -3.219  21.934  1.00 22.21  ?  132 LEU B CD1  1 
ATOM   5491  C  CD2  . LEU B  1 132 ? -15.453 -5.419  21.745  1.00 19.23  ?  132 LEU B CD2  1 
ATOM   5492  H  H    . LEU B  1 132 ? -16.260 -3.514  18.473  1.00 21.78  ?  132 LEU B H    1 
ATOM   5493  H  HA   . LEU B  1 132 ? -17.710 -4.870  20.219  1.00 21.84  ?  132 LEU B HA   1 
ATOM   5494  H  HB2  . LEU B  1 132 ? -16.306 -2.442  20.545  1.00 22.08  ?  132 LEU B HB2  1 
ATOM   5495  H  HB3  . LEU B  1 132 ? -16.958 -3.249  21.741  1.00 22.08  ?  132 LEU B HB3  1 
ATOM   5496  H  HG   . LEU B  1 132 ? -14.808 -4.236  20.221  1.00 21.82  ?  132 LEU B HG   1 
ATOM   5497  H  HD11 . LEU B  1 132 ? -13.395 -3.720  22.051  1.00 26.65  ?  132 LEU B HD11 1 
ATOM   5498  H  HD12 . LEU B  1 132 ? -14.036 -2.389  21.466  1.00 26.65  ?  132 LEU B HD12 1 
ATOM   5499  H  HD13 . LEU B  1 132 ? -14.617 -3.032  22.798  1.00 26.65  ?  132 LEU B HD13 1 
ATOM   5500  H  HD21 . LEU B  1 132 ? -14.601 -5.867  21.863  1.00 23.07  ?  132 LEU B HD21 1 
ATOM   5501  H  HD22 . LEU B  1 132 ? -15.875 -5.278  22.607  1.00 23.07  ?  132 LEU B HD22 1 
ATOM   5502  H  HD23 . LEU B  1 132 ? -16.031 -5.952  21.176  1.00 23.07  ?  132 LEU B HD23 1 
ATOM   5503  N  N    . GLN B  1 133 ? -19.132 -2.539  18.792  1.00 18.02  ?  133 GLN B N    1 
ATOM   5504  C  CA   . GLN B  1 133 ? -20.436 -1.914  18.666  1.00 18.83  ?  133 GLN B CA   1 
ATOM   5505  C  C    . GLN B  1 133 ? -21.504 -2.980  18.442  1.00 21.63  ?  133 GLN B C    1 
ATOM   5506  O  O    . GLN B  1 133 ? -21.221 -4.109  18.031  1.00 21.13  ?  133 GLN B O    1 
ATOM   5507  C  CB   . GLN B  1 133 ? -20.435 -0.884  17.534  1.00 19.12  ?  133 GLN B CB   1 
ATOM   5508  C  CG   . GLN B  1 133 ? -19.444 0.290   17.756  1.00 26.14  ?  133 GLN B CG   1 
ATOM   5509  C  CD   . GLN B  1 133 ? -19.522 1.332   16.651  1.00 36.34  ?  133 GLN B CD   1 
ATOM   5510  O  OE1  . GLN B  1 133 ? -20.598 1.602   16.103  1.00 39.01  ?  133 GLN B OE1  1 
ATOM   5511  N  NE2  . GLN B  1 133 ? -18.377 1.919   16.312  1.00 53.97  ?  133 GLN B NE2  1 
ATOM   5512  H  H    . GLN B  1 133 ? -18.625 -2.451  18.103  1.00 21.62  ?  133 GLN B H    1 
ATOM   5513  H  HA   . GLN B  1 133 ? -20.645 -1.450  19.493  1.00 22.60  ?  133 GLN B HA   1 
ATOM   5514  H  HB2  . GLN B  1 133 ? -20.189 -1.328  16.708  1.00 22.95  ?  133 GLN B HB2  1 
ATOM   5515  H  HB3  . GLN B  1 133 ? -21.326 -0.508  17.453  1.00 22.95  ?  133 GLN B HB3  1 
ATOM   5516  H  HG2  . GLN B  1 133 ? -19.652 0.727   18.597  1.00 31.37  ?  133 GLN B HG2  1 
ATOM   5517  H  HG3  . GLN B  1 133 ? -18.539 -0.059  17.777  1.00 31.37  ?  133 GLN B HG3  1 
ATOM   5518  H  HE21 . GLN B  1 133 ? -17.647 1.702   16.713  1.00 64.76  ?  133 GLN B HE21 1 
ATOM   5519  H  HE22 . GLN B  1 133 ? -18.366 2.515   15.693  1.00 64.76  ?  133 GLN B HE22 1 
ATOM   5520  N  N    . LYS B  1 134 ? -22.746 -2.621  18.755  1.00 18.68  ?  134 LYS B N    1 
ATOM   5521  C  CA   . LYS B  1 134 ? -23.858 -3.552  18.732  1.00 18.06  ?  134 LYS B CA   1 
ATOM   5522  C  C    . LYS B  1 134 ? -24.630 -3.585  17.404  1.00 21.86  ?  134 LYS B C    1 
ATOM   5523  O  O    . LYS B  1 134 ? -25.678 -4.244  17.332  1.00 28.86  ?  134 LYS B O    1 
ATOM   5524  C  CB   . LYS B  1 134 ? -24.801 -3.207  19.888  1.00 18.91  ?  134 LYS B CB   1 
ATOM   5525  C  CG   . LYS B  1 134 ? -24.137 -3.254  21.272  1.00 24.12  ?  134 LYS B CG   1 
ATOM   5526  C  CD   . LYS B  1 134 ? -23.757 -4.656  21.605  1.00 19.47  ?  134 LYS B CD   1 
ATOM   5527  C  CE   . LYS B  1 134 ? -23.214 -4.811  23.067  1.00 22.10  ?  134 LYS B CE   1 
ATOM   5528  N  NZ   . LYS B  1 134 ? -22.676 -6.190  23.201  1.00 19.45  1  134 LYS B NZ   1 
ATOM   5529  H  H    . LYS B  1 134 ? -22.969 -1.824  18.989  1.00 22.41  ?  134 LYS B H    1 
ATOM   5530  H  HA   . LYS B  1 134 ? -23.515 -4.445  18.891  1.00 21.68  ?  134 LYS B HA   1 
ATOM   5531  H  HB2  . LYS B  1 134 ? -25.142 -2.309  19.755  1.00 22.69  ?  134 LYS B HB2  1 
ATOM   5532  H  HB3  . LYS B  1 134 ? -25.536 -3.840  19.891  1.00 22.69  ?  134 LYS B HB3  1 
ATOM   5533  H  HG2  . LYS B  1 134 ? -23.334 -2.710  21.265  1.00 28.94  ?  134 LYS B HG2  1 
ATOM   5534  H  HG3  . LYS B  1 134 ? -24.760 -2.935  21.943  1.00 28.94  ?  134 LYS B HG3  1 
ATOM   5535  H  HD2  . LYS B  1 134 ? -24.537 -5.224  21.514  1.00 23.36  ?  134 LYS B HD2  1 
ATOM   5536  H  HD3  . LYS B  1 134 ? -23.061 -4.947  20.995  1.00 23.36  ?  134 LYS B HD3  1 
ATOM   5537  H  HE2  . LYS B  1 134 ? -22.498 -4.176  23.225  1.00 26.52  ?  134 LYS B HE2  1 
ATOM   5538  H  HE3  . LYS B  1 134 ? -23.935 -4.689  23.704  1.00 26.52  ?  134 LYS B HE3  1 
ATOM   5539  H  HZ1  . LYS B  1 134 ? -23.322 -6.784  23.048  1.00 23.34  ?  134 LYS B HZ1  1 
ATOM   5540  H  HZ2  . LYS B  1 134 ? -22.020 -6.319  22.614  1.00 23.34  ?  134 LYS B HZ2  1 
ATOM   5541  H  HZ3  . LYS B  1 134 ? -22.358 -6.313  24.023  1.00 23.34  ?  134 LYS B HZ3  1 
ATOM   5542  N  N    . THR B  1 135 ? -24.125 -2.960  16.358  1.00 18.32  ?  135 THR B N    1 
ATOM   5543  C  CA   . THR B  1 135 ? -24.841 -2.923  15.089  1.00 17.44  ?  135 THR B CA   1 
ATOM   5544  C  C    . THR B  1 135 ? -24.212 -3.879  14.092  1.00 17.39  ?  135 THR B C    1 
ATOM   5545  O  O    . THR B  1 135 ? -23.004 -4.144  14.116  1.00 17.81  ?  135 THR B O    1 
ATOM   5546  C  CB   . THR B  1 135 ? -24.836 -1.518  14.499  1.00 19.44  ?  135 THR B CB   1 
ATOM   5547  O  OG1  . THR B  1 135 ? -23.494 -1.176  14.150  1.00 20.49  ?  135 THR B OG1  1 
ATOM   5548  C  CG2  . THR B  1 135 ? -25.378 -0.511  15.486  1.00 25.25  ?  135 THR B CG2  1 
ATOM   5549  H  H    . THR B  1 135 ? -23.370 -2.549  16.351  1.00 21.99  ?  135 THR B H    1 
ATOM   5550  H  HA   . THR B  1 135 ? -25.762 -3.191  15.232  1.00 20.92  ?  135 THR B HA   1 
ATOM   5551  H  HB   . THR B  1 135 ? -25.392 -1.499  13.704  1.00 23.32  ?  135 THR B HB   1 
ATOM   5552  H  HG1  . THR B  1 135 ? -23.470 -0.403  13.822  1.00 24.58  ?  135 THR B HG1  1 
ATOM   5553  H  HG21 . THR B  1 135 ? -25.368 0.376   15.093  1.00 30.29  ?  135 THR B HG21 1 
ATOM   5554  H  HG22 . THR B  1 135 ? -26.290 -0.739  15.725  1.00 30.29  ?  135 THR B HG22 1 
ATOM   5555  H  HG23 . THR B  1 135 ? -24.833 -0.507  16.288  1.00 30.29  ?  135 THR B HG23 1 
ATOM   5556  N  N    . GLU B  1 136 ? -25.039 -4.347  13.167  1.00 16.77  ?  136 GLU B N    1 
ATOM   5557  C  CA   . GLU B  1 136 ? -24.530 -5.157  12.067  1.00 16.24  ?  136 GLU B CA   1 
ATOM   5558  C  C    . GLU B  1 136 ? -23.597 -4.342  11.177  1.00 15.61  ?  136 GLU B C    1 
ATOM   5559  O  O    . GLU B  1 136 ? -22.568 -4.859  10.717  1.00 16.72  ?  136 GLU B O    1 
ATOM   5560  C  CB   . GLU B  1 136 ? -25.681 -5.735  11.234  1.00 15.85  ?  136 GLU B CB   1 
ATOM   5561  C  CG   . GLU B  1 136 ? -26.491 -6.761  11.968  1.00 15.87  ?  136 GLU B CG   1 
ATOM   5562  C  CD   . GLU B  1 136 ? -27.611 -7.388  11.157  1.00 18.26  ?  136 GLU B CD   1 
ATOM   5563  O  OE1  . GLU B  1 136 ? -28.208 -6.714  10.289  1.00 18.87  ?  136 GLU B OE1  1 
ATOM   5564  O  OE2  . GLU B  1 136 ? -27.909 -8.573  11.424  1.00 22.55  -1 136 GLU B OE2  1 
ATOM   5565  H  H    . GLU B  1 136 ? -25.889 -4.213  13.151  1.00 20.12  ?  136 GLU B H    1 
ATOM   5566  H  HA   . GLU B  1 136 ? -24.023 -5.899  12.432  1.00 19.49  ?  136 GLU B HA   1 
ATOM   5567  H  HB2  . GLU B  1 136 ? -26.277 -5.014  10.978  1.00 19.02  ?  136 GLU B HB2  1 
ATOM   5568  H  HB3  . GLU B  1 136 ? -25.314 -6.157  10.442  1.00 19.02  ?  136 GLU B HB3  1 
ATOM   5569  H  HG2  . GLU B  1 136 ? -25.900 -7.475  12.253  1.00 19.05  ?  136 GLU B HG2  1 
ATOM   5570  H  HG3  . GLU B  1 136 ? -26.891 -6.340  12.745  1.00 19.05  ?  136 GLU B HG3  1 
ATOM   5571  N  N    . ALA B  1 137 ? -23.917 -3.067  10.925  1.00 16.15  ?  137 ALA B N    1 
ATOM   5572  C  CA   . ALA B  1 137 ? -23.067 -2.250  10.060  1.00 17.25  ?  137 ALA B CA   1 
ATOM   5573  C  C    . ALA B  1 137 ? -21.638 -2.143  10.601  1.00 15.94  ?  137 ALA B C    1 
ATOM   5574  O  O    . ALA B  1 137 ? -20.659 -2.225  9.844   1.00 18.43  ?  137 ALA B O    1 
ATOM   5575  C  CB   . ALA B  1 137 ? -23.662 -0.845  9.889   1.00 19.82  ?  137 ALA B CB   1 
ATOM   5576  H  H    . ALA B  1 137 ? -24.607 -2.661  11.237  1.00 19.38  ?  137 ALA B H    1 
ATOM   5577  H  HA   . ALA B  1 137 ? -23.023 -2.663  9.183   1.00 20.70  ?  137 ALA B HA   1 
ATOM   5578  H  HB1  . ALA B  1 137 ? -23.081 -0.324  9.313   1.00 23.78  ?  137 ALA B HB1  1 
ATOM   5579  H  HB2  . ALA B  1 137 ? -24.542 -0.922  9.490   1.00 23.78  ?  137 ALA B HB2  1 
ATOM   5580  H  HB3  . ALA B  1 137 ? -23.729 -0.423  10.760  1.00 23.78  ?  137 ALA B HB3  1 
ATOM   5581  N  N    . ALA B  1 138 ? -21.491 -1.965  11.908  1.00 16.05  ?  138 ALA B N    1 
ATOM   5582  C  CA   . ALA B  1 138 ? -20.157 -1.836  12.485  1.00 16.95  ?  138 ALA B CA   1 
ATOM   5583  C  C    . ALA B  1 138 ? -19.405 -3.161  12.469  1.00 19.67  ?  138 ALA B C    1 
ATOM   5584  O  O    . ALA B  1 138 ? -18.184 -3.195  12.255  1.00 17.58  ?  138 ALA B O    1 
ATOM   5585  C  CB   . ALA B  1 138 ? -20.257 -1.316  13.924  1.00 19.78  ?  138 ALA B CB   1 
ATOM   5586  H  H    . ALA B  1 138 ? -22.135 -1.917  12.476  1.00 19.26  ?  138 ALA B H    1 
ATOM   5587  H  HA   . ALA B  1 138 ? -19.647 -1.194  11.966  1.00 20.34  ?  138 ALA B HA   1 
ATOM   5588  H  HB1  . ALA B  1 138 ? -19.364 -1.235  14.293  1.00 23.74  ?  138 ALA B HB1  1 
ATOM   5589  H  HB2  . ALA B  1 138 ? -20.691 -0.449  13.916  1.00 23.74  ?  138 ALA B HB2  1 
ATOM   5590  H  HB3  . ALA B  1 138 ? -20.778 -1.943  14.450  1.00 23.74  ?  138 ALA B HB3  1 
ATOM   5591  N  N    . LYS B  1 139 ? -20.108 -4.244  12.729  1.00 17.41  ?  139 LYS B N    1 
ATOM   5592  C  CA   . LYS B  1 139 ? -19.497 -5.576  12.714  1.00 15.67  ?  139 LYS B CA   1 
ATOM   5593  C  C    . LYS B  1 139 ? -19.036 -5.965  11.307  1.00 17.67  ?  139 LYS B C    1 
ATOM   5594  O  O    . LYS B  1 139 ? -17.966 -6.559  11.149  1.00 16.31  ?  139 LYS B O    1 
ATOM   5595  C  CB   . LYS B  1 139 ? -20.470 -6.590  13.311  1.00 14.25  ?  139 LYS B CB   1 
ATOM   5596  C  CG   . LYS B  1 139 ? -20.723 -6.389  14.809  1.00 17.33  ?  139 LYS B CG   1 
ATOM   5597  C  CD   . LYS B  1 139 ? -21.825 -7.252  15.308  1.00 16.64  ?  139 LYS B CD   1 
ATOM   5598  C  CE   . LYS B  1 139 ? -22.250 -6.882  16.707  1.00 18.22  ?  139 LYS B CE   1 
ATOM   5599  N  NZ   . LYS B  1 139 ? -21.112 -6.865  17.675  1.00 18.09  1  139 LYS B NZ   1 
ATOM   5600  H  H    . LYS B  1 139 ? -20.947 -4.245  12.919  1.00 20.89  ?  139 LYS B H    1 
ATOM   5601  H  HA   . LYS B  1 139 ? -18.711 -5.558  13.283  1.00 18.80  ?  139 LYS B HA   1 
ATOM   5602  H  HB2  . LYS B  1 139 ? -21.322 -6.515  12.853  1.00 17.10  ?  139 LYS B HB2  1 
ATOM   5603  H  HB3  . LYS B  1 139 ? -20.108 -7.482  13.187  1.00 17.10  ?  139 LYS B HB3  1 
ATOM   5604  H  HG2  . LYS B  1 139 ? -19.918 -6.613  15.301  1.00 20.79  ?  139 LYS B HG2  1 
ATOM   5605  H  HG3  . LYS B  1 139 ? -20.967 -5.464  14.970  1.00 20.79  ?  139 LYS B HG3  1 
ATOM   5606  H  HD2  . LYS B  1 139 ? -22.593 -7.155  14.724  1.00 19.96  ?  139 LYS B HD2  1 
ATOM   5607  H  HD3  . LYS B  1 139 ? -21.527 -8.175  15.317  1.00 19.96  ?  139 LYS B HD3  1 
ATOM   5608  H  HE2  . LYS B  1 139 ? -22.645 -5.996  16.693  1.00 21.87  ?  139 LYS B HE2  1 
ATOM   5609  H  HE3  . LYS B  1 139 ? -22.901 -7.530  17.020  1.00 21.87  ?  139 LYS B HE3  1 
ATOM   5610  H  HZ1  . LYS B  1 139 ? -20.502 -6.272  17.416  1.00 21.71  ?  139 LYS B HZ1  1 
ATOM   5611  H  HZ2  . LYS B  1 139 ? -21.406 -6.644  18.485  1.00 21.71  ?  139 LYS B HZ2  1 
ATOM   5612  H  HZ3  . LYS B  1 139 ? -20.735 -7.670  17.714  1.00 21.71  ?  139 LYS B HZ3  1 
ATOM   5613  N  N    . ILE B  1 140 ? -19.817 -5.627  10.269  1.00 15.64  ?  140 ILE B N    1 
ATOM   5614  C  CA   . ILE B  1 140 ? -19.384 -5.872  8.894   1.00 16.93  ?  140 ILE B CA   1 
ATOM   5615  C  C    . ILE B  1 140 ? -18.110 -5.088  8.585   1.00 15.34  ?  140 ILE B C    1 
ATOM   5616  O  O    . ILE B  1 140 ? -17.151 -5.627  8.015   1.00 17.54  ?  140 ILE B O    1 
ATOM   5617  C  CB   . ILE B  1 140 ? -20.520 -5.515  7.921   1.00 17.56  ?  140 ILE B CB   1 
ATOM   5618  C  CG1  . ILE B  1 140 ? -21.679 -6.496  8.067   1.00 16.15  ?  140 ILE B CG1  1 
ATOM   5619  C  CG2  . ILE B  1 140 ? -20.036 -5.520  6.482   1.00 16.76  ?  140 ILE B CG2  1 
ATOM   5620  C  CD1  . ILE B  1 140 ? -22.968 -5.948  7.421   1.00 17.79  ?  140 ILE B CD1  1 
ATOM   5621  H  H    . ILE B  1 140 ? -20.592 -5.260  10.337  1.00 18.76  ?  140 ILE B H    1 
ATOM   5622  H  HA   . ILE B  1 140 ? -19.186 -6.816  8.789   1.00 20.32  ?  140 ILE B HA   1 
ATOM   5623  H  HB   . ILE B  1 140 ? -20.841 -4.625  8.136   1.00 21.07  ?  140 ILE B HB   1 
ATOM   5624  H  HG12 . ILE B  1 140 ? -21.450 -7.330  7.629   1.00 19.39  ?  140 ILE B HG12 1 
ATOM   5625  H  HG13 . ILE B  1 140 ? -21.853 -6.648  9.010   1.00 19.39  ?  140 ILE B HG13 1 
ATOM   5626  H  HG21 . ILE B  1 140 ? -20.777 -5.291  5.899   1.00 20.11  ?  140 ILE B HG21 1 
ATOM   5627  H  HG22 . ILE B  1 140 ? -19.325 -4.867  6.386   1.00 20.11  ?  140 ILE B HG22 1 
ATOM   5628  H  HG23 . ILE B  1 140 ? -19.704 -6.406  6.264   1.00 20.11  ?  140 ILE B HG23 1 
ATOM   5629  H  HD11 . ILE B  1 140 ? -23.679 -6.598  7.534   1.00 21.35  ?  140 ILE B HD11 1 
ATOM   5630  H  HD12 . ILE B  1 140 ? -23.209 -5.114  7.854   1.00 21.35  ?  140 ILE B HD12 1 
ATOM   5631  H  HD13 . ILE B  1 140 ? -22.806 -5.795  6.476   1.00 21.35  ?  140 ILE B HD13 1 
ATOM   5632  N  N    . LEU B  1 141 ? -18.067 -3.812  8.977   1.00 16.34  ?  141 LEU B N    1 
ATOM   5633  C  CA   . LEU B  1 141 ? -16.860 -3.008  8.796   1.00 15.53  ?  141 LEU B CA   1 
ATOM   5634  C  C    . LEU B  1 141 ? -15.648 -3.647  9.465   1.00 15.36  ?  141 LEU B C    1 
ATOM   5635  O  O    . LEU B  1 141 ? -14.568 -3.726  8.860   1.00 17.66  ?  141 LEU B O    1 
ATOM   5636  C  CB   . LEU B  1 141 ? -17.086 -1.606  9.349   1.00 16.31  ?  141 LEU B CB   1 
ATOM   5637  C  CG   . LEU B  1 141 ? -15.874 -0.692  9.308   1.00 18.81  ?  141 LEU B CG   1 
ATOM   5638  C  CD1  . LEU B  1 141 ? -15.295 -0.481  7.900   1.00 20.57  ?  141 LEU B CD1  1 
ATOM   5639  C  CD2  . LEU B  1 141 ? -16.287 0.632   9.951   1.00 22.70  ?  141 LEU B CD2  1 
ATOM   5640  H  H    . LEU B  1 141 ? -18.720 -3.392  9.347   1.00 19.61  ?  141 LEU B H    1 
ATOM   5641  H  HA   . LEU B  1 141 ? -16.672 -2.929  7.848   1.00 18.64  ?  141 LEU B HA   1 
ATOM   5642  H  HB2  . LEU B  1 141 ? -17.789 -1.182  8.833   1.00 19.57  ?  141 LEU B HB2  1 
ATOM   5643  H  HB3  . LEU B  1 141 ? -17.364 -1.682  10.275  1.00 19.57  ?  141 LEU B HB3  1 
ATOM   5644  H  HG   . LEU B  1 141 ? -15.175 -1.080  9.858   1.00 22.57  ?  141 LEU B HG   1 
ATOM   5645  H  HD11 . LEU B  1 141 ? -14.529 0.111   7.960   1.00 24.69  ?  141 LEU B HD11 1 
ATOM   5646  H  HD12 . LEU B  1 141 ? -15.023 -1.339  7.539   1.00 24.69  ?  141 LEU B HD12 1 
ATOM   5647  H  HD13 . LEU B  1 141 ? -15.976 -0.085  7.335   1.00 24.69  ?  141 LEU B HD13 1 
ATOM   5648  H  HD21 . LEU B  1 141 ? -15.529 1.238   9.939   1.00 27.24  ?  141 LEU B HD21 1 
ATOM   5649  H  HD22 . LEU B  1 141 ? -17.023 1.012   9.446   1.00 27.24  ?  141 LEU B HD22 1 
ATOM   5650  H  HD23 . LEU B  1 141 ? -16.563 0.466   10.866  1.00 27.24  ?  141 LEU B HD23 1 
ATOM   5651  N  N    . ALA B  1 142 ? -15.834 -4.159  10.691  1.00 17.40  ?  142 ALA B N    1 
ATOM   5652  C  CA   . ALA B  1 142 ? -14.724 -4.803  11.405  1.00 16.85  ?  142 ALA B CA   1 
ATOM   5653  C  C    . ALA B  1 142 ? -14.213 -6.010  10.644  1.00 17.21  ?  142 ALA B C    1 
ATOM   5654  O  O    . ALA B  1 142 ? -12.997 -6.204  10.499  1.00 19.27  ?  142 ALA B O    1 
ATOM   5655  C  CB   . ALA B  1 142 ? -15.167 -5.207  12.805  1.00 18.51  ?  142 ALA B CB   1 
ATOM   5656  H  H    . ALA B  1 142 ? -16.578 -4.146  11.122  1.00 20.88  ?  142 ALA B H    1 
ATOM   5657  H  HA   . ALA B  1 142 ? -13.994 -4.170  11.492  1.00 20.22  ?  142 ALA B HA   1 
ATOM   5658  H  HB1  . ALA B  1 142 ? -14.423 -5.630  13.261  1.00 22.21  ?  142 ALA B HB1  1 
ATOM   5659  H  HB2  . ALA B  1 142 ? -15.445 -4.414  13.289  1.00 22.21  ?  142 ALA B HB2  1 
ATOM   5660  H  HB3  . ALA B  1 142 ? -15.909 -5.829  12.734  1.00 22.21  ?  142 ALA B HB3  1 
ATOM   5661  N  N    . ILE B  1 143 ? -15.121 -6.862  10.182  1.00 16.21  ?  143 ILE B N    1 
ATOM   5662  C  CA   . ILE B  1 143 ? -14.714 -8.055  9.441   1.00 18.72  ?  143 ILE B CA   1 
ATOM   5663  C  C    . ILE B  1 143 ? -14.020 -7.666  8.141   1.00 18.01  ?  143 ILE B C    1 
ATOM   5664  O  O    . ILE B  1 143 ? -13.016 -8.271  7.766   1.00 18.67  ?  143 ILE B O    1 
ATOM   5665  C  CB   . ILE B  1 143 ? -15.930 -8.978  9.205   1.00 20.28  ?  143 ILE B CB   1 
ATOM   5666  C  CG1  . ILE B  1 143 ? -16.429 -9.514  10.527  1.00 21.52  ?  143 ILE B CG1  1 
ATOM   5667  C  CG2  . ILE B  1 143 ? -15.555 -10.156 8.291   1.00 22.75  ?  143 ILE B CG2  1 
ATOM   5668  C  CD1  . ILE B  1 143 ? -17.826 -10.132 10.444  1.00 23.93  ?  143 ILE B CD1  1 
ATOM   5669  H  H    . ILE B  1 143 ? -15.971 -6.775  10.281  1.00 19.45  ?  143 ILE B H    1 
ATOM   5670  H  HA   . ILE B  1 143 ? -14.073 -8.548  9.977   1.00 22.47  ?  143 ILE B HA   1 
ATOM   5671  H  HB   . ILE B  1 143 ? -16.638 -8.466  8.785   1.00 24.33  ?  143 ILE B HB   1 
ATOM   5672  H  HG12 . ILE B  1 143 ? -15.818 -10.200 10.838  1.00 25.82  ?  143 ILE B HG12 1 
ATOM   5673  H  HG13 . ILE B  1 143 ? -16.463 -8.787  11.168  1.00 25.82  ?  143 ILE B HG13 1 
ATOM   5674  H  HG21 . ILE B  1 143 ? -16.337 -10.716 8.162   1.00 27.30  ?  143 ILE B HG21 1 
ATOM   5675  H  HG22 . ILE B  1 143 ? -15.253 -9.808  7.437   1.00 27.30  ?  143 ILE B HG22 1 
ATOM   5676  H  HG23 . ILE B  1 143 ? -14.846 -10.668 8.710   1.00 27.30  ?  143 ILE B HG23 1 
ATOM   5677  H  HD11 . ILE B  1 143 ? -18.081 -10.453 11.323  1.00 28.72  ?  143 ILE B HD11 1 
ATOM   5678  H  HD12 . ILE B  1 143 ? -18.453 -9.455  10.143  1.00 28.72  ?  143 ILE B HD12 1 
ATOM   5679  H  HD13 . ILE B  1 143 ? -17.808 -10.869 9.814   1.00 28.72  ?  143 ILE B HD13 1 
ATOM   5680  N  N    . LEU B  1 144 ? -14.528 -6.639  7.445   1.00 16.76  ?  144 LEU B N    1 
ATOM   5681  C  CA   . LEU B  1 144 ? -13.891 -6.170  6.218   1.00 17.14  ?  144 LEU B CA   1 
ATOM   5682  C  C    . LEU B  1 144 ? -12.456 -5.736  6.487   1.00 17.22  ?  144 LEU B C    1 
ATOM   5683  O  O    . LEU B  1 144 ? -11.525 -6.124  5.765   1.00 19.82  ?  144 LEU B O    1 
ATOM   5684  C  CB   . LEU B  1 144 ? -14.704 -5.021  5.629   1.00 18.38  ?  144 LEU B CB   1 
ATOM   5685  C  CG   . LEU B  1 144 ? -14.125 -4.360  4.397   1.00 18.80  ?  144 LEU B CG   1 
ATOM   5686  C  CD1  . LEU B  1 144 ? -13.915 -5.378  3.301   1.00 23.93  ?  144 LEU B CD1  1 
ATOM   5687  C  CD2  . LEU B  1 144 ? -15.033 -3.243  3.942   1.00 24.68  ?  144 LEU B CD2  1 
ATOM   5688  H  H    . LEU B  1 144 ? -15.236 -6.203  7.665   1.00 20.12  ?  144 LEU B H    1 
ATOM   5689  H  HA   . LEU B  1 144 ? -13.873 -6.892  5.570   1.00 20.57  ?  144 LEU B HA   1 
ATOM   5690  H  HB2  . LEU B  1 144 ? -15.582 -5.359  5.391   1.00 22.06  ?  144 LEU B HB2  1 
ATOM   5691  H  HB3  . LEU B  1 144 ? -14.798 -4.334  6.308   1.00 22.06  ?  144 LEU B HB3  1 
ATOM   5692  H  HG   . LEU B  1 144 ? -13.263 -3.976  4.619   1.00 22.57  ?  144 LEU B HG   1 
ATOM   5693  H  HD11 . LEU B  1 144 ? -13.544 -4.932  2.524   1.00 28.72  ?  144 LEU B HD11 1 
ATOM   5694  H  HD12 . LEU B  1 144 ? -13.301 -6.059  3.617   1.00 28.72  ?  144 LEU B HD12 1 
ATOM   5695  H  HD13 . LEU B  1 144 ? -14.769 -5.780  3.077   1.00 28.72  ?  144 LEU B HD13 1 
ATOM   5696  H  HD21 . LEU B  1 144 ? -14.651 -2.829  3.153   1.00 29.62  ?  144 LEU B HD21 1 
ATOM   5697  H  HD22 . LEU B  1 144 ? -15.906 -3.611  3.734   1.00 29.62  ?  144 LEU B HD22 1 
ATOM   5698  H  HD23 . LEU B  1 144 ? -15.110 -2.590  4.655   1.00 29.62  ?  144 LEU B HD23 1 
ATOM   5699  N  N    . ILE B  1 145 ? -12.268 -4.927  7.527   1.00 18.42  ?  145 ILE B N    1 
ATOM   5700  C  CA   . ILE B  1 145 ? -10.936 -4.446  7.884   1.00 19.55  ?  145 ILE B CA   1 
ATOM   5701  C  C    . ILE B  1 145 ? -9.995  -5.614  8.205   1.00 21.13  ?  145 ILE B C    1 
ATOM   5702  O  O    . ILE B  1 145 ? -8.864  -5.666  7.709   1.00 19.73  ?  145 ILE B O    1 
ATOM   5703  C  CB   . ILE B  1 145 ? -11.024 -3.439  9.044   1.00 18.14  ?  145 ILE B CB   1 
ATOM   5704  C  CG1  . ILE B  1 145 ? -11.604 -2.097  8.564   1.00 19.18  ?  145 ILE B CG1  1 
ATOM   5705  C  CG2  . ILE B  1 145 ? -9.638  -3.212  9.669   1.00 20.54  ?  145 ILE B CG2  1 
ATOM   5706  C  CD1  . ILE B  1 145 ? -11.942 -1.133  9.649   1.00 20.96  ?  145 ILE B CD1  1 
ATOM   5707  H  H    . ILE B  1 145 ? -12.896 -4.642  8.041   1.00 22.11  ?  145 ILE B H    1 
ATOM   5708  H  HA   . ILE B  1 145 ? -10.565 -3.976  7.121   1.00 23.46  ?  145 ILE B HA   1 
ATOM   5709  H  HB   . ILE B  1 145 ? -11.612 -3.803  9.723   1.00 21.77  ?  145 ILE B HB   1 
ATOM   5710  H  HG12 . ILE B  1 145 ? -10.954 -1.669  7.984   1.00 23.01  ?  145 ILE B HG12 1 
ATOM   5711  H  HG13 . ILE B  1 145 ? -12.418 -2.273  8.066   1.00 23.01  ?  145 ILE B HG13 1 
ATOM   5712  H  HG21 . ILE B  1 145 ? -9.720  -2.574  10.395  1.00 24.64  ?  145 ILE B HG21 1 
ATOM   5713  H  HG22 . ILE B  1 145 ? -9.301  -4.057  10.006  1.00 24.64  ?  145 ILE B HG22 1 
ATOM   5714  H  HG23 . ILE B  1 145 ? -9.039  -2.864  8.989   1.00 24.64  ?  145 ILE B HG23 1 
ATOM   5715  H  HD11 . ILE B  1 145 ? -12.298 -0.323  9.252   1.00 25.16  ?  145 ILE B HD11 1 
ATOM   5716  H  HD12 . ILE B  1 145 ? -12.604 -1.534  10.233  1.00 25.16  ?  145 ILE B HD12 1 
ATOM   5717  H  HD13 . ILE B  1 145 ? -11.137 -0.929  10.152  1.00 25.16  ?  145 ILE B HD13 1 
ATOM   5718  N  N    . LYS B  1 146 ? -10.465 -6.589  9.002   1.00 18.26  ?  146 LYS B N    1 
ATOM   5719  C  CA   . LYS B  1 146 ? -9.639  -7.739  9.372   1.00 17.56  ?  146 LYS B CA   1 
ATOM   5720  C  C    . LYS B  1 146 ? -9.281  -8.598  8.160   1.00 21.46  ?  146 LYS B C    1 
ATOM   5721  O  O    . LYS B  1 146 ? -8.171  -9.142  8.076   1.00 20.25  ?  146 LYS B O    1 
ATOM   5722  C  CB   . LYS B  1 146 ? -10.347 -8.561  10.453  1.00 19.60  ?  146 LYS B CB   1 
ATOM   5723  C  CG   . LYS B  1 146 ? -10.479 -7.764  11.770  1.00 24.26  ?  146 LYS B CG   1 
ATOM   5724  C  CD   . LYS B  1 146 ? -11.368 -8.436  12.809  1.00 25.75  ?  146 LYS B CD   1 
ATOM   5725  C  CE   . LYS B  1 146 ? -11.554 -7.539  14.040  1.00 26.85  ?  146 LYS B CE   1 
ATOM   5726  N  NZ   . LYS B  1 146 ? -10.223 -7.349  14.753  1.00 28.61  1  146 LYS B NZ   1 
ATOM   5727  H  H    . LYS B  1 146 ? -11.256 -6.603  9.338   1.00 21.91  ?  146 LYS B H    1 
ATOM   5728  H  HA   . LYS B  1 146 ? -8.808  -7.412  9.752   1.00 21.08  ?  146 LYS B HA   1 
ATOM   5729  H  HB2  . LYS B  1 146 ? -11.238 -8.793  10.147  1.00 23.52  ?  146 LYS B HB2  1 
ATOM   5730  H  HB3  . LYS B  1 146 ? -9.834  -9.364  10.634  1.00 23.52  ?  146 LYS B HB3  1 
ATOM   5731  H  HG2  . LYS B  1 146 ? -9.598  -7.656  12.160  1.00 29.11  ?  146 LYS B HG2  1 
ATOM   5732  H  HG3  . LYS B  1 146 ? -10.860 -6.894  11.572  1.00 29.11  ?  146 LYS B HG3  1 
ATOM   5733  H  HD2  . LYS B  1 146 ? -12.241 -8.608  12.423  1.00 30.91  ?  146 LYS B HD2  1 
ATOM   5734  H  HD3  . LYS B  1 146 ? -10.957 -9.266  13.096  1.00 30.91  ?  146 LYS B HD3  1 
ATOM   5735  H  HE2  . LYS B  1 146 ? -11.882 -6.669  13.762  1.00 32.22  ?  146 LYS B HE2  1 
ATOM   5736  H  HE3  . LYS B  1 146 ? -12.176 -7.957  14.656  1.00 32.22  ?  146 LYS B HE3  1 
ATOM   5737  H  HZ1  . LYS B  1 146 ? -9.903  -8.137  15.015  1.00 34.34  ?  146 LYS B HZ1  1 
ATOM   5738  H  HZ2  . LYS B  1 146 ? -9.636  -6.967  14.204  1.00 34.34  ?  146 LYS B HZ2  1 
ATOM   5739  H  HZ3  . LYS B  1 146 ? -10.332 -6.828  15.467  1.00 34.34  ?  146 LYS B HZ3  1 
ATOM   5740  N  N    . THR B  1 147 ? -10.198 -8.711  7.202   1.00 19.99  ?  147 THR B N    1 
ATOM   5741  C  CA   . THR B  1 147 ? -9.924  -9.420  5.965   1.00 19.89  ?  147 THR B CA   1 
ATOM   5742  C  C    . THR B  1 147 ? -8.866  -8.688  5.133   1.00 20.35  ?  147 THR B C    1 
ATOM   5743  O  O    . THR B  1 147 ? -7.886  -9.298  4.672   1.00 22.09  ?  147 THR B O    1 
ATOM   5744  C  CB   . THR B  1 147 ? -11.245 -9.569  5.201   1.00 18.53  ?  147 THR B CB   1 
ATOM   5745  O  OG1  . THR B  1 147 ? -12.162 -10.348 5.976   1.00 19.52  ?  147 THR B OG1  1 
ATOM   5746  C  CG2  . THR B  1 147 ? -11.040 -10.238 3.846   1.00 22.97  ?  147 THR B CG2  1 
ATOM   5747  H  H    . THR B  1 147 ? -10.992 -8.382  7.249   1.00 23.98  ?  147 THR B H    1 
ATOM   5748  H  HA   . THR B  1 147 ? -9.590  -10.307 6.170   1.00 23.86  ?  147 THR B HA   1 
ATOM   5749  H  HB   . THR B  1 147 ? -11.625 -8.689  5.048   1.00 22.24  ?  147 THR B HB   1 
ATOM   5750  H  HG1  . THR B  1 147 ? -12.310 -9.970  6.711   1.00 23.42  ?  147 THR B HG1  1 
ATOM   5751  H  HG21 . THR B  1 147 ? -11.889 -10.320 3.385   1.00 27.56  ?  147 THR B HG21 1 
ATOM   5752  H  HG22 . THR B  1 147 ? -10.436 -9.709  3.303   1.00 27.56  ?  147 THR B HG22 1 
ATOM   5753  H  HG23 . THR B  1 147 ? -10.661 -11.123 3.968   1.00 27.56  ?  147 THR B HG23 1 
ATOM   5754  N  N    . ILE B  1 148 ? -9.043  -7.377  4.949   1.00 20.76  ?  148 ILE B N    1 
ATOM   5755  C  CA   . ILE B  1 148 ? -8.102  -6.552  4.187   1.00 22.75  ?  148 ILE B CA   1 
ATOM   5756  C  C    . ILE B  1 148 ? -6.701  -6.662  4.773   1.00 22.64  ?  148 ILE B C    1 
ATOM   5757  O  O    . ILE B  1 148 ? -5.699  -6.705  4.040   1.00 24.98  ?  148 ILE B O    1 
ATOM   5758  C  CB   . ILE B  1 148 ? -8.580  -5.089  4.171   1.00 21.59  ?  148 ILE B CB   1 
ATOM   5759  C  CG1  . ILE B  1 148 ? -9.819  -4.958  3.299   1.00 25.63  ?  148 ILE B CG1  1 
ATOM   5760  C  CG2  . ILE B  1 148 ? -7.440  -4.164  3.698   1.00 28.51  ?  148 ILE B CG2  1 
ATOM   5761  C  CD1  . ILE B  1 148 ? -10.556 -3.654  3.504   1.00 28.22  ?  148 ILE B CD1  1 
ATOM   5762  H  H    . ILE B  1 148 ? -9.712  -6.936  5.261   1.00 24.92  ?  148 ILE B H    1 
ATOM   5763  H  HA   . ILE B  1 148 ? -8.071  -6.870  3.270   1.00 27.30  ?  148 ILE B HA   1 
ATOM   5764  H  HB   . ILE B  1 148 ? -8.819  -4.838  5.077   1.00 25.91  ?  148 ILE B HB   1 
ATOM   5765  H  HG12 . ILE B  1 148 ? -9.554  -5.007  2.367   1.00 30.75  ?  148 ILE B HG12 1 
ATOM   5766  H  HG13 . ILE B  1 148 ? -10.429 -5.682  3.508   1.00 30.75  ?  148 ILE B HG13 1 
ATOM   5767  H  HG21 . ILE B  1 148 ? -7.758  -3.247  3.694   1.00 34.22  ?  148 ILE B HG21 1 
ATOM   5768  H  HG22 . ILE B  1 148 ? -6.690  -4.251  4.307   1.00 34.22  ?  148 ILE B HG22 1 
ATOM   5769  H  HG23 . ILE B  1 148 ? -7.172  -4.425  2.803   1.00 34.22  ?  148 ILE B HG23 1 
ATOM   5770  H  HD11 . ILE B  1 148 ? -11.331 -3.635  2.921   1.00 33.86  ?  148 ILE B HD11 1 
ATOM   5771  H  HD12 . ILE B  1 148 ? -10.837 -3.593  4.430   1.00 33.86  ?  148 ILE B HD12 1 
ATOM   5772  H  HD13 . ILE B  1 148 ? -9.961  -2.918  3.289   1.00 33.86  ?  148 ILE B HD13 1 
ATOM   5773  N  N    . ASN B  1 149 ? -6.607  -6.704  6.094   1.00 21.13  ?  149 ASN B N    1 
ATOM   5774  C  CA   . ASN B  1 149 ? -5.308  -6.703  6.776   1.00 23.28  ?  149 ASN B CA   1 
ATOM   5775  C  C    . ASN B  1 149 ? -4.686  -8.088  6.898   1.00 29.13  ?  149 ASN B C    1 
ATOM   5776  O  O    . ASN B  1 149 ? -3.557  -8.208  7.417   1.00 25.98  ?  149 ASN B O    1 
ATOM   5777  C  CB   . ASN B  1 149 ? -5.438  -6.083  8.167   1.00 25.14  ?  149 ASN B CB   1 
ATOM   5778  C  CG   . ASN B  1 149 ? -5.520  -4.564  8.134   1.00 27.41  ?  149 ASN B CG   1 
ATOM   5779  O  OD1  . ASN B  1 149 ? -5.147  -3.917  7.139   1.00 28.57  ?  149 ASN B OD1  1 
ATOM   5780  N  ND2  . ASN B  1 149 ? -5.981  -3.978  9.241   1.00 25.89  ?  149 ASN B ND2  1 
ATOM   5781  H  H    . ASN B  1 149 ? -7.281  -6.733  6.627   1.00 25.36  ?  149 ASN B H    1 
ATOM   5782  H  HA   . ASN B  1 149 ? -4.694  -6.151  6.267   1.00 27.94  ?  149 ASN B HA   1 
ATOM   5783  H  HB2  . ASN B  1 149 ? -6.246  -6.418  8.588   1.00 30.17  ?  149 ASN B HB2  1 
ATOM   5784  H  HB3  . ASN B  1 149 ? -4.663  -6.330  8.696   1.00 30.17  ?  149 ASN B HB3  1 
ATOM   5785  H  HD21 . ASN B  1 149 ? -6.049  -3.122  9.278   1.00 31.07  ?  149 ASN B HD21 1 
ATOM   5786  H  HD22 . ASN B  1 149 ? -6.210  -4.457  9.918   1.00 31.07  ?  149 ASN B HD22 1 
ATOM   5787  N  N    . SER B  1 150 ? -5.366  -9.131  6.423   1.00 23.18  ?  150 SER B N    1 
ATOM   5788  C  CA   . SER B  1 150 ? -4.835  -10.482 6.467   1.00 21.02  ?  150 SER B CA   1 
ATOM   5789  C  C    . SER B  1 150 ? -3.791  -10.644 5.375   1.00 27.67  ?  150 SER B C    1 
ATOM   5790  O  O    . SER B  1 150 ? -3.948  -10.145 4.259   1.00 31.40  ?  150 SER B O    1 
ATOM   5791  C  CB   . SER B  1 150 ? -5.940  -11.525 6.266   1.00 25.68  ?  150 SER B CB   1 
ATOM   5792  O  OG   . SER B  1 150 ? -6.859  -11.530 7.331   1.00 25.03  ?  150 SER B OG   1 
ATOM   5793  H  H    . SER B  1 150 ? -6.147  -9.076  6.067   1.00 27.82  ?  150 SER B H    1 
ATOM   5794  H  HA   . SER B  1 150 ? -4.413  -10.639 7.326   1.00 25.23  ?  150 SER B HA   1 
ATOM   5795  H  HB2  . SER B  1 150 ? -6.415  -11.322 5.445   1.00 30.81  ?  150 SER B HB2  1 
ATOM   5796  H  HB3  . SER B  1 150 ? -5.532  -12.403 6.201   1.00 30.81  ?  150 SER B HB3  1 
ATOM   5797  H  HG   . SER B  1 150 ? -7.224  -10.776 7.400   1.00 30.04  ?  150 SER B HG   1 
ATOM   5798  N  N    . GLU B  1 151 ? -2.709  -11.338 5.690   1.00 26.45  ?  151 GLU B N    1 
ATOM   5799  C  CA   A GLU B  1 151 ? -1.663  -11.524 4.694   0.67 29.46  ?  151 GLU B CA   1 
ATOM   5800  C  CA   B GLU B  1 151 ? -1.657  -11.530 4.699   0.33 30.74  ?  151 GLU B CA   1 
ATOM   5801  C  C    . GLU B  1 151 ? -1.778  -12.860 3.960   1.00 37.82  ?  151 GLU B C    1 
ATOM   5802  O  O    . GLU B  1 151 ? -1.736  -12.883 2.726   1.00 52.15  ?  151 GLU B O    1 
ATOM   5803  C  CB   A GLU B  1 151 ? -0.290  -11.370 5.363   0.67 34.72  ?  151 GLU B CB   1 
ATOM   5804  C  CB   B GLU B  1 151 ? -0.276  -11.416 5.357   0.33 35.11  ?  151 GLU B CB   1 
ATOM   5805  C  CG   A GLU B  1 151 ? 0.017   -9.924  5.765   0.67 32.70  ?  151 GLU B CG   1 
ATOM   5806  C  CG   B GLU B  1 151 ? 0.875   -11.372 4.352   0.33 40.70  ?  151 GLU B CG   1 
ATOM   5807  C  CD   A GLU B  1 151 ? 0.088   -8.975  4.576   0.67 39.54  ?  151 GLU B CD   1 
ATOM   5808  C  CD   B GLU B  1 151 ? 0.676   -10.318 3.269   0.33 36.80  ?  151 GLU B CD   1 
ATOM   5809  O  OE1  A GLU B  1 151 ? 0.376   -9.441  3.451   0.67 42.17  ?  151 GLU B OE1  1 
ATOM   5810  O  OE1  B GLU B  1 151 ? 0.281   -9.179  3.604   0.33 41.52  ?  151 GLU B OE1  1 
ATOM   5811  O  OE2  A GLU B  1 151 ? -0.150  -7.764  4.765   0.67 40.93  -1 151 GLU B OE2  1 
ATOM   5812  O  OE2  B GLU B  1 151 ? 0.898   -10.633 2.080   0.33 44.36  -1 151 GLU B OE2  1 
ATOM   5813  H  H    A GLU B  1 151 ? -2.556  -11.705 6.453   0.67 31.74  ?  151 GLU B H    1 
ATOM   5814  H  H    B GLU B  1 151 ? -2.558  -11.703 6.454   0.33 31.74  ?  151 GLU B H    1 
ATOM   5815  H  HA   A GLU B  1 151 ? -1.744  -10.821 4.031   0.67 35.35  ?  151 GLU B HA   1 
ATOM   5816  H  HA   B GLU B  1 151 ? -1.725  -10.823 4.038   0.33 36.89  ?  151 GLU B HA   1 
ATOM   5817  H  HB2  A GLU B  1 151 ? -0.266  -11.915 6.165   0.67 41.67  ?  151 GLU B HB2  1 
ATOM   5818  H  HB2  B GLU B  1 151 ? -0.244  -10.601 5.882   0.33 42.14  ?  151 GLU B HB2  1 
ATOM   5819  H  HB3  A GLU B  1 151 ? 0.397   -11.660 4.743   0.67 41.67  ?  151 GLU B HB3  1 
ATOM   5820  H  HB3  B GLU B  1 151 ? -0.138  -12.185 5.933   0.33 42.14  ?  151 GLU B HB3  1 
ATOM   5821  H  HG2  A GLU B  1 151 ? -0.682  -9.607  6.359   0.67 39.24  ?  151 GLU B HG2  1 
ATOM   5822  H  HG2  B GLU B  1 151 ? 1.698   -11.167 4.822   0.33 48.84  ?  151 GLU B HG2  1 
ATOM   5823  H  HG3  A GLU B  1 151 ? 0.874   -9.899  6.219   0.67 39.24  ?  151 GLU B HG3  1 
ATOM   5824  H  HG3  B GLU B  1 151 ? 0.948   -12.236 3.918   0.33 48.84  ?  151 GLU B HG3  1 
ATOM   5825  N  N    . GLU B  1 152 ? -1.943  -13.970 4.677   1.00 28.76  ?  152 GLU B N    1 
ATOM   5826  C  CA   A GLU B  1 152 ? -1.982  -15.297 4.076   0.58 32.71  ?  152 GLU B CA   1 
ATOM   5827  C  CA   B GLU B  1 152 ? -1.982  -15.301 4.076   0.42 32.92  ?  152 GLU B CA   1 
ATOM   5828  C  C    . GLU B  1 152 ? -3.419  -15.803 3.995   1.00 26.17  ?  152 GLU B C    1 
ATOM   5829  O  O    . GLU B  1 152 ? -4.312  -15.315 4.697   1.00 23.40  ?  152 GLU B O    1 
ATOM   5830  C  CB   A GLU B  1 152 ? -1.135  -16.285 4.885   0.58 35.51  ?  152 GLU B CB   1 
ATOM   5831  C  CB   B GLU B  1 152 ? -1.131  -16.298 4.879   0.42 35.67  ?  152 GLU B CB   1 
ATOM   5832  C  CG   A GLU B  1 152 ? 0.268   -15.806 5.229   0.58 40.73  ?  152 GLU B CG   1 
ATOM   5833  C  CG   B GLU B  1 152 ? -0.882  -17.651 4.186   0.42 41.85  ?  152 GLU B CG   1 
ATOM   5834  C  CD   A GLU B  1 152 ? 1.214   -15.914 4.058   0.58 45.02  ?  152 GLU B CD   1 
ATOM   5835  C  CD   B GLU B  1 152 ? -1.513  -18.851 4.901   0.42 32.64  ?  152 GLU B CD   1 
ATOM   5836  O  OE1  A GLU B  1 152 ? 0.761   -16.305 2.963   0.58 47.75  ?  152 GLU B OE1  1 
ATOM   5837  O  OE1  B GLU B  1 152 ? -1.235  -19.034 6.107   0.42 45.02  ?  152 GLU B OE1  1 
ATOM   5838  O  OE2  A GLU B  1 152 ? 2.409   -15.614 4.235   0.58 47.89  -1 152 GLU B OE2  1 
ATOM   5839  O  OE2  B GLU B  1 152 ? -2.258  -19.626 4.250   0.42 23.72  -1 152 GLU B OE2  1 
ATOM   5840  H  H    . GLU B  1 152 ? -2.035  -13.978 5.532   1.00 34.51  ?  152 GLU B H    1 
ATOM   5841  H  HA   A GLU B  1 152 ? -1.622  -15.253 3.176   0.58 39.25  ?  152 GLU B HA   1 
ATOM   5842  H  HA   B GLU B  1 152 ? -1.626  -15.255 3.175   0.42 39.50  ?  152 GLU B HA   1 
ATOM   5843  H  HB2  A GLU B  1 152 ? -1.593  -16.471 5.720   0.58 42.61  ?  152 GLU B HB2  1 
ATOM   5844  H  HB2  B GLU B  1 152 ? -0.266  -15.895 5.052   0.42 42.80  ?  152 GLU B HB2  1 
ATOM   5845  H  HB3  A GLU B  1 152 ? -1.046  -17.105 4.374   0.58 42.61  ?  152 GLU B HB3  1 
ATOM   5846  H  HB3  B GLU B  1 152 ? -1.579  -16.479 5.720   0.42 42.80  ?  152 GLU B HB3  1 
ATOM   5847  H  HG2  A GLU B  1 152 ? 0.228   -14.875 5.500   0.58 48.87  ?  152 GLU B HG2  1 
ATOM   5848  H  HG2  B GLU B  1 152 ? -1.251  -17.614 3.290   0.42 50.22  ?  152 GLU B HG2  1 
ATOM   5849  H  HG3  A GLU B  1 152 ? 0.621   -16.348 5.952   0.58 48.87  ?  152 GLU B HG3  1 
ATOM   5850  H  HG3  B GLU B  1 152 ? 0.075   -17.805 4.139   0.42 50.22  ?  152 GLU B HG3  1 
ATOM   5851  N  N    . ASN B  1 153 ? -3.628  -16.808 3.134   1.00 25.49  ?  153 ASN B N    1 
ATOM   5852  C  CA   . ASN B  1 153 ? -4.983  -17.335 2.909   1.00 24.90  ?  153 ASN B CA   1 
ATOM   5853  C  C    . ASN B  1 153 ? -5.598  -17.902 4.188   1.00 20.46  ?  153 ASN B C    1 
ATOM   5854  O  O    . ASN B  1 153 ? -6.797  -17.740 4.428   1.00 21.70  ?  153 ASN B O    1 
ATOM   5855  C  CB   . ASN B  1 153 ? -4.967  -18.412 1.821   1.00 28.90  ?  153 ASN B CB   1 
ATOM   5856  C  CG   . ASN B  1 153 ? -5.021  -17.841 0.413   1.00 28.59  ?  153 ASN B CG   1 
ATOM   5857  O  OD1  . ASN B  1 153 ? -5.057  -16.630 0.207   1.00 37.92  ?  153 ASN B OD1  1 
ATOM   5858  N  ND2  . ASN B  1 153 ? -5.035  -18.733 -0.570  1.00 40.67  ?  153 ASN B ND2  1 
ATOM   5859  H  H    . ASN B  1 153 ? -3.014  -17.197 2.675   1.00 30.59  ?  153 ASN B H    1 
ATOM   5860  H  HA   . ASN B  1 153 ? -5.552  -16.611 2.603   1.00 29.88  ?  153 ASN B HA   1 
ATOM   5861  H  HB2  . ASN B  1 153 ? -4.151  -18.929 1.903   1.00 34.68  ?  153 ASN B HB2  1 
ATOM   5862  H  HB3  . ASN B  1 153 ? -5.738  -18.989 1.939   1.00 34.68  ?  153 ASN B HB3  1 
ATOM   5863  H  HD21 . ASN B  1 153 ? -5.065  -18.471 -1.389  1.00 48.80  ?  153 ASN B HD21 1 
ATOM   5864  H  HD22 . ASN B  1 153 ? -5.014  -19.574 -0.389  1.00 48.80  ?  153 ASN B HD22 1 
ATOM   5865  N  N    . TYR B  1 154 ? -4.816  -18.575 5.029   1.00 21.45  ?  154 TYR B N    1 
ATOM   5866  C  CA   . TYR B  1 154 ? -5.418  -19.177 6.216   1.00 21.04  ?  154 TYR B CA   1 
ATOM   5867  C  C    . TYR B  1 154 ? -5.966  -18.107 7.153   1.00 21.70  ?  154 TYR B C    1 
ATOM   5868  O  O    . TYR B  1 154 ? -7.080  -18.242 7.681   1.00 19.19  ?  154 TYR B O    1 
ATOM   5869  C  CB   . TYR B  1 154 ? -4.404  -20.050 6.931   1.00 21.01  ?  154 TYR B CB   1 
ATOM   5870  C  CG   . TYR B  1 154 ? -4.997  -20.848 8.073   1.00 21.02  ?  154 TYR B CG   1 
ATOM   5871  C  CD1  . TYR B  1 154 ? -4.887  -20.398 9.376   1.00 20.16  ?  154 TYR B CD1  1 
ATOM   5872  C  CD2  . TYR B  1 154 ? -5.690  -22.031 7.844   1.00 21.60  ?  154 TYR B CD2  1 
ATOM   5873  C  CE1  . TYR B  1 154 ? -5.419  -21.131 10.433  1.00 23.10  ?  154 TYR B CE1  1 
ATOM   5874  C  CE2  . TYR B  1 154 ? -6.219  -22.764 8.878   1.00 25.08  ?  154 TYR B CE2  1 
ATOM   5875  C  CZ   . TYR B  1 154 ? -6.083  -22.308 10.177  1.00 20.57  ?  154 TYR B CZ   1 
ATOM   5876  O  OH   . TYR B  1 154 ? -6.591  -23.033 11.232  1.00 22.79  ?  154 TYR B OH   1 
ATOM   5877  H  H    . TYR B  1 154 ? -3.969  -18.695 4.942   1.00 25.74  ?  154 TYR B H    1 
ATOM   5878  H  HA   . TYR B  1 154 ? -6.158  -19.741 5.942   1.00 25.25  ?  154 TYR B HA   1 
ATOM   5879  H  HB2  . TYR B  1 154 ? -4.026  -20.677 6.295   1.00 25.21  ?  154 TYR B HB2  1 
ATOM   5880  H  HB3  . TYR B  1 154 ? -3.704  -19.486 7.294   1.00 25.21  ?  154 TYR B HB3  1 
ATOM   5881  H  HD1  . TYR B  1 154 ? -4.428  -19.608 9.551   1.00 24.19  ?  154 TYR B HD1  1 
ATOM   5882  H  HD2  . TYR B  1 154 ? -5.774  -22.348 6.974   1.00 25.92  ?  154 TYR B HD2  1 
ATOM   5883  H  HE1  . TYR B  1 154 ? -5.325  -20.827 11.307  1.00 27.72  ?  154 TYR B HE1  1 
ATOM   5884  H  HE2  . TYR B  1 154 ? -6.665  -23.561 8.705   1.00 30.09  ?  154 TYR B HE2  1 
ATOM   5885  H  HH   . TYR B  1 154 ? -6.970  -23.726 10.948  1.00 27.35  ?  154 TYR B HH   1 
ATOM   5886  N  N    . GLU B  1 155 ? -5.198  -17.036 7.366   1.00 23.01  ?  155 GLU B N    1 
ATOM   5887  C  CA   . GLU B  1 155 ? -5.667  -15.908 8.163   1.00 21.02  ?  155 GLU B CA   1 
ATOM   5888  C  C    . GLU B  1 155 ? -6.884  -15.253 7.522   1.00 19.63  ?  155 GLU B C    1 
ATOM   5889  O  O    . GLU B  1 155 ? -7.859  -14.922 8.211   1.00 19.90  ?  155 GLU B O    1 
ATOM   5890  C  CB   . GLU B  1 155 ? -4.536  -14.891 8.326   1.00 24.94  ?  155 GLU B CB   1 
ATOM   5891  C  CG   . GLU B  1 155 ? -4.917  -13.738 9.207   1.00 28.50  ?  155 GLU B CG   1 
ATOM   5892  C  CD   . GLU B  1 155 ? -3.898  -12.612 9.238   1.00 30.42  ?  155 GLU B CD   1 
ATOM   5893  O  OE1  . GLU B  1 155 ? -2.917  -12.639 8.475   1.00 31.20  ?  155 GLU B OE1  1 
ATOM   5894  O  OE2  . GLU B  1 155 ? -4.128  -11.678 10.029  1.00 30.45  -1 155 GLU B OE2  1 
ATOM   5895  H  H    . GLU B  1 155 ? -4.401  -16.941 7.058   1.00 27.61  ?  155 GLU B H    1 
ATOM   5896  H  HA   . GLU B  1 155 ? -5.921  -16.223 9.044   1.00 25.22  ?  155 GLU B HA   1 
ATOM   5897  H  HB2  . GLU B  1 155 ? -3.769  -15.332 8.724   1.00 29.93  ?  155 GLU B HB2  1 
ATOM   5898  H  HB3  . GLU B  1 155 ? -4.300  -14.537 7.455   1.00 29.93  ?  155 GLU B HB3  1 
ATOM   5899  H  HG2  . GLU B  1 155 ? -5.756  -13.368 8.890   1.00 34.20  ?  155 GLU B HG2  1 
ATOM   5900  H  HG3  . GLU B  1 155 ? -5.025  -14.062 10.115  1.00 34.20  ?  155 GLU B HG3  1 
ATOM   5901  N  N    . LYS B  1 156 ? -6.841  -15.042 6.208   1.00 19.47  ?  156 LYS B N    1 
ATOM   5902  C  CA   . LYS B  1 156 ? -7.972  -14.425 5.521   1.00 19.00  ?  156 LYS B CA   1 
ATOM   5903  C  C    . LYS B  1 156 ? -9.233  -15.259 5.709   1.00 21.96  ?  156 LYS B C    1 
ATOM   5904  O  O    . LYS B  1 156 ? -10.313 -14.720 5.973   1.00 18.95  ?  156 LYS B O    1 
ATOM   5905  C  CB   . LYS B  1 156 ? -7.676  -14.271 4.030   1.00 21.57  ?  156 LYS B CB   1 
ATOM   5906  C  CG   . LYS B  1 156 ? -8.578  -13.270 3.337   1.00 26.51  ?  156 LYS B CG   1 
ATOM   5907  C  CD   . LYS B  1 156 ? -8.087  -12.917 1.931   1.00 32.39  ?  156 LYS B CD   1 
ATOM   5908  C  CE   . LYS B  1 156 ? -8.870  -11.706 1.370   1.00 36.92  ?  156 LYS B CE   1 
ATOM   5909  N  NZ   . LYS B  1 156 ? -8.407  -11.204 0.025   1.00 32.91  1  156 LYS B NZ   1 
ATOM   5910  H  H    . LYS B  1 156 ? -6.179  -15.244 5.698   1.00 23.37  ?  156 LYS B H    1 
ATOM   5911  H  HA   . LYS B  1 156 ? -8.131  -13.543 5.893   1.00 22.79  ?  156 LYS B HA   1 
ATOM   5912  H  HB2  . LYS B  1 156 ? -6.760  -13.972 3.921   1.00 25.89  ?  156 LYS B HB2  1 
ATOM   5913  H  HB3  . LYS B  1 156 ? -7.797  -15.130 3.596   1.00 25.89  ?  156 LYS B HB3  1 
ATOM   5914  H  HG2  . LYS B  1 156 ? -9.469  -13.645 3.260   1.00 31.82  ?  156 LYS B HG2  1 
ATOM   5915  H  HG3  . LYS B  1 156 ? -8.605  -12.453 3.860   1.00 31.82  ?  156 LYS B HG3  1 
ATOM   5916  H  HD2  . LYS B  1 156 ? -7.146  -12.685 1.966   1.00 38.87  ?  156 LYS B HD2  1 
ATOM   5917  H  HD3  . LYS B  1 156 ? -8.229  -13.674 1.340   1.00 38.87  ?  156 LYS B HD3  1 
ATOM   5918  H  HE2  . LYS B  1 156 ? -9.803  -11.957 1.282   1.00 44.31  ?  156 LYS B HE2  1 
ATOM   5919  H  HE3  . LYS B  1 156 ? -8.790  -10.971 1.998   1.00 44.31  ?  156 LYS B HE3  1 
ATOM   5920  H  HZ1  . LYS B  1 156 ? -7.555  -10.949 0.073   1.00 39.49  ?  156 LYS B HZ1  1 
ATOM   5921  H  HZ2  . LYS B  1 156 ? -8.481  -11.851 -0.582  1.00 39.49  ?  156 LYS B HZ2  1 
ATOM   5922  H  HZ3  . LYS B  1 156 ? -8.903  -10.510 -0.228  1.00 39.49  ?  156 LYS B HZ3  1 
ATOM   5923  N  N    . PHE B  1 157 ? -9.107  -16.576 5.555   1.00 19.15  ?  157 PHE B N    1 
ATOM   5924  C  CA   . PHE B  1 157 ? -10.227 -17.481 5.790   1.00 18.07  ?  157 PHE B CA   1 
ATOM   5925  C  C    . PHE B  1 157 ? -10.744 -17.386 7.227   1.00 17.92  ?  157 PHE B C    1 
ATOM   5926  O  O    . PHE B  1 157 ? -11.967 -17.365 7.465   1.00 17.47  ?  157 PHE B O    1 
ATOM   5927  C  CB   . PHE B  1 157 ? -9.802  -18.923 5.485   1.00 19.32  ?  157 PHE B CB   1 
ATOM   5928  C  CG   . PHE B  1 157 ? -10.877 -19.907 5.773   1.00 21.29  ?  157 PHE B CG   1 
ATOM   5929  C  CD1  . PHE B  1 157 ? -12.019 -19.931 5.003   1.00 19.85  ?  157 PHE B CD1  1 
ATOM   5930  C  CD2  . PHE B  1 157 ? -10.801 -20.755 6.855   1.00 19.15  ?  157 PHE B CD2  1 
ATOM   5931  C  CE1  . PHE B  1 157 ? -13.035 -20.812 5.285   1.00 18.33  ?  157 PHE B CE1  1 
ATOM   5932  C  CE2  . PHE B  1 157 ? -11.828 -21.641 7.131   1.00 18.69  ?  157 PHE B CE2  1 
ATOM   5933  C  CZ   . PHE B  1 157 ? -12.931 -21.674 6.330   1.00 18.90  ?  157 PHE B CZ   1 
ATOM   5934  H  H    . PHE B  1 157 ? -8.382  -16.969 5.314   1.00 22.98  ?  157 PHE B H    1 
ATOM   5935  H  HA   . PHE B  1 157 ? -10.954 -17.248 5.193   1.00 21.68  ?  157 PHE B HA   1 
ATOM   5936  H  HB2  . PHE B  1 157 ? -9.574  -18.993 4.545   1.00 23.18  ?  157 PHE B HB2  1 
ATOM   5937  H  HB3  . PHE B  1 157 ? -9.033  -19.149 6.032   1.00 23.18  ?  157 PHE B HB3  1 
ATOM   5938  H  HD1  . PHE B  1 157 ? -12.096 -19.356 4.276   1.00 23.83  ?  157 PHE B HD1  1 
ATOM   5939  H  HD2  . PHE B  1 157 ? -10.043 -20.746 7.395   1.00 22.99  ?  157 PHE B HD2  1 
ATOM   5940  H  HE1  . PHE B  1 157 ? -13.791 -20.833 4.743   1.00 22.00  ?  157 PHE B HE1  1 
ATOM   5941  H  HE2  . PHE B  1 157 ? -11.757 -22.226 7.851   1.00 22.43  ?  157 PHE B HE2  1 
ATOM   5942  H  HZ   . PHE B  1 157 ? -13.625 -22.264 6.517   1.00 22.68  ?  157 PHE B HZ   1 
ATOM   5943  N  N    . THR B  1 158 ? -9.829  -17.369 8.199   1.00 17.80  ?  158 THR B N    1 
ATOM   5944  C  CA   . THR B  1 158 ? -10.219 -17.238 9.597   1.00 17.76  ?  158 THR B CA   1 
ATOM   5945  C  C    . THR B  1 158 ? -11.030 -15.967 9.826   1.00 18.14  ?  158 THR B C    1 
ATOM   5946  O  O    . THR B  1 158 ? -12.038 -15.985 10.543  1.00 18.42  ?  158 THR B O    1 
ATOM   5947  C  CB   . THR B  1 158 ? -8.971  -17.254 10.486  1.00 19.88  ?  158 THR B CB   1 
ATOM   5948  O  OG1  . THR B  1 158 ? -8.279  -18.495 10.305  1.00 21.69  ?  158 THR B OG1  1 
ATOM   5949  C  CG2  . THR B  1 158 ? -9.340  -17.126 11.932  1.00 21.63  ?  158 THR B CG2  1 
ATOM   5950  H  H    . THR B  1 158 ? -8.980  -17.433 8.073   1.00 21.36  ?  158 THR B H    1 
ATOM   5951  H  HA   . THR B  1 158 ? -10.773 -17.996 9.843   1.00 21.31  ?  158 THR B HA   1 
ATOM   5952  H  HB   . THR B  1 158 ? -8.389  -16.516 10.247  1.00 23.85  ?  158 THR B HB   1 
ATOM   5953  H  HG1  . THR B  1 158 ? -8.050  -18.582 9.502   1.00 26.03  ?  158 THR B HG1  1 
ATOM   5954  H  HG21 . THR B  1 158 ? -8.540  -17.137 12.480  1.00 25.96  ?  158 THR B HG21 1 
ATOM   5955  H  HG22 . THR B  1 158 ? -9.812  -16.291 12.081  1.00 25.96  ?  158 THR B HG22 1 
ATOM   5956  H  HG23 . THR B  1 158 ? -9.913  -17.863 12.194  1.00 25.96  ?  158 THR B HG23 1 
ATOM   5957  N  N    . GLU B  1 159 ? -10.599 -14.854 9.234   1.00 17.29  ?  159 GLU B N    1 
ATOM   5958  C  CA   . GLU B  1 159 ? -11.297 -13.598 9.468   1.00 16.87  ?  159 GLU B CA   1 
ATOM   5959  C  C    . GLU B  1 159 ? -12.632 -13.561 8.723   1.00 16.63  ?  159 GLU B C    1 
ATOM   5960  O  O    . GLU B  1 159 ? -13.636 -13.104 9.274   1.00 17.74  ?  159 GLU B O    1 
ATOM   5961  C  CB   . GLU B  1 159 ? -10.414 -12.417 9.100   1.00 18.35  ?  159 GLU B CB   1 
ATOM   5962  C  CG   . GLU B  1 159 ? -9.161  -12.309 9.988   1.00 20.12  ?  159 GLU B CG   1 
ATOM   5963  C  CD   . GLU B  1 159 ? -9.446  -12.066 11.478  1.00 25.33  ?  159 GLU B CD   1 
ATOM   5964  O  OE1  . GLU B  1 159 ? -10.588 -11.829 11.895  1.00 21.91  ?  159 GLU B OE1  1 
ATOM   5965  O  OE2  . GLU B  1 159 ? -8.465  -12.105 12.260  1.00 31.12  -1 159 GLU B OE2  1 
ATOM   5966  H  H    . GLU B  1 159 ? -9.922  -14.802 8.705   1.00 20.75  ?  159 GLU B H    1 
ATOM   5967  H  HA   . GLU B  1 159 ? -11.492 -13.530 10.415  1.00 20.24  ?  159 GLU B HA   1 
ATOM   5968  H  HB2  . GLU B  1 159 ? -10.122 -12.516 8.180   1.00 22.02  ?  159 GLU B HB2  1 
ATOM   5969  H  HB3  . GLU B  1 159 ? -10.924 -11.598 9.200   1.00 22.02  ?  159 GLU B HB3  1 
ATOM   5970  H  HG2  . GLU B  1 159 ? -8.659  -13.135 9.917   1.00 24.14  ?  159 GLU B HG2  1 
ATOM   5971  H  HG3  . GLU B  1 159 ? -8.619  -11.570 9.669   1.00 24.14  ?  159 GLU B HG3  1 
ATOM   5972  N  N    . LEU B  1 160 ? -12.665 -14.050 7.479   1.00 17.67  ?  160 LEU B N    1 
ATOM   5973  C  CA   . LEU B  1 160 ? -13.920 -14.111 6.731   1.00 17.02  ?  160 LEU B CA   1 
ATOM   5974  C  C    . LEU B  1 160 ? -14.923 -15.046 7.406   1.00 15.30  ?  160 LEU B C    1 
ATOM   5975  O  O    . LEU B  1 160 ? -16.144 -14.853 7.269   1.00 16.04  ?  160 LEU B O    1 
ATOM   5976  C  CB   . LEU B  1 160 ? -13.616 -14.538 5.284   1.00 17.29  ?  160 LEU B CB   1 
ATOM   5977  C  CG   . LEU B  1 160 ? -13.028 -13.446 4.390   1.00 18.37  ?  160 LEU B CG   1 
ATOM   5978  C  CD1  . LEU B  1 160 ? -12.455 -14.120 3.167   1.00 22.40  ?  160 LEU B CD1  1 
ATOM   5979  C  CD2  . LEU B  1 160 ? -14.080 -12.421 4.026   1.00 21.36  ?  160 LEU B CD2  1 
ATOM   5980  H  H    . LEU B  1 160 ? -11.982 -14.351 7.053   1.00 21.21  ?  160 LEU B H    1 
ATOM   5981  H  HA   . LEU B  1 160 ? -14.312 -13.224 6.704   1.00 20.43  ?  160 LEU B HA   1 
ATOM   5982  H  HB2  . LEU B  1 160 ? -12.980 -15.270 5.307   1.00 20.75  ?  160 LEU B HB2  1 
ATOM   5983  H  HB3  . LEU B  1 160 ? -14.441 -14.839 4.872   1.00 20.75  ?  160 LEU B HB3  1 
ATOM   5984  H  HG   . LEU B  1 160 ? -12.308 -12.996 4.860   1.00 22.04  ?  160 LEU B HG   1 
ATOM   5985  H  HD11 . LEU B  1 160 ? -12.075 -13.445 2.584   1.00 26.88  ?  160 LEU B HD11 1 
ATOM   5986  H  HD12 . LEU B  1 160 ? -11.766 -14.744 3.444   1.00 26.88  ?  160 LEU B HD12 1 
ATOM   5987  H  HD13 . LEU B  1 160 ? -13.165 -14.594 2.707   1.00 26.88  ?  160 LEU B HD13 1 
ATOM   5988  H  HD21 . LEU B  1 160 ? -13.678 -11.744 3.460   1.00 25.64  ?  160 LEU B HD21 1 
ATOM   5989  H  HD22 . LEU B  1 160 ? -14.801 -12.865 3.550   1.00 25.64  ?  160 LEU B HD22 1 
ATOM   5990  H  HD23 . LEU B  1 160 ? -14.420 -12.015 4.838   1.00 25.64  ?  160 LEU B HD23 1 
ATOM   5991  N  N    . SER B  1 161 ? -14.439 -16.068 8.124   1.00 17.03  ?  161 SER B N    1 
ATOM   5992  C  CA   . SER B  1 161 ? -15.323 -17.000 8.807   1.00 15.59  ?  161 SER B CA   1 
ATOM   5993  C  C    . SER B  1 161 ? -16.193 -16.289 9.833   1.00 15.17  ?  161 SER B C    1 
ATOM   5994  O  O    . SER B  1 161 ? -17.284 -16.781 10.140  1.00 16.91  ?  161 SER B O    1 
ATOM   5995  C  CB   . SER B  1 161 ? -14.511 -18.125 9.478   1.00 16.97  ?  161 SER B CB   1 
ATOM   5996  O  OG   . SER B  1 161 ? -14.003 -19.037 8.507   1.00 17.64  ?  161 SER B OG   1 
ATOM   5997  H  H    . SER B  1 161 ? -13.602 -16.237 8.226   1.00 20.43  ?  161 SER B H    1 
ATOM   5998  H  HA   . SER B  1 161 ? -15.912 -17.409 8.153   1.00 18.71  ?  161 SER B HA   1 
ATOM   5999  H  HB2  . SER B  1 161 ? -13.768 -17.732 9.962   1.00 20.37  ?  161 SER B HB2  1 
ATOM   6000  H  HB3  . SER B  1 161 ? -15.088 -18.607 10.092  1.00 20.37  ?  161 SER B HB3  1 
ATOM   6001  H  HG   . SER B  1 161 ? -13.501 -18.633 7.968   1.00 21.17  ?  161 SER B HG   1 
ATOM   6002  N  N    . GLU B  1 162 ? -15.747 -15.136 10.337  1.00 15.21  ?  162 GLU B N    1 
ATOM   6003  C  CA   . GLU B  1 162 ? -16.534 -14.360 11.285  1.00 16.54  ?  162 GLU B CA   1 
ATOM   6004  C  C    . GLU B  1 162 ? -17.849 -13.893 10.671  1.00 16.70  ?  162 GLU B C    1 
ATOM   6005  O  O    . GLU B  1 162 ? -18.784 -13.571 11.414  1.00 16.02  ?  162 GLU B O    1 
ATOM   6006  C  CB   . GLU B  1 162 ? -15.721 -13.175 11.820  1.00 18.25  ?  162 GLU B CB   1 
ATOM   6007  C  CG   . GLU B  1 162 ? -14.502 -13.570 12.638  1.00 19.69  ?  162 GLU B CG   1 
ATOM   6008  C  CD   . GLU B  1 162 ? -14.872 -14.203 13.972  1.00 31.35  ?  162 GLU B CD   1 
ATOM   6009  O  OE1  . GLU B  1 162 ? -15.848 -13.746 14.625  1.00 27.84  ?  162 GLU B OE1  1 
ATOM   6010  O  OE2  . GLU B  1 162 ? -14.231 -15.209 14.342  1.00 36.76  -1 162 GLU B OE2  1 
ATOM   6011  H  H    . GLU B  1 162 ? -14.987 -14.784 10.143  1.00 18.25  ?  162 GLU B H    1 
ATOM   6012  H  HA   . GLU B  1 162 ? -16.751 -14.928 12.040  1.00 19.85  ?  162 GLU B HA   1 
ATOM   6013  H  HB2  . GLU B  1 162 ? -15.412 -12.645 11.068  1.00 21.90  ?  162 GLU B HB2  1 
ATOM   6014  H  HB3  . GLU B  1 162 ? -16.294 -12.635 12.386  1.00 21.90  ?  162 GLU B HB3  1 
ATOM   6015  H  HG2  . GLU B  1 162 ? -13.979 -14.213 12.135  1.00 23.63  ?  162 GLU B HG2  1 
ATOM   6016  H  HG3  . GLU B  1 162 ? -13.972 -12.778 12.818  1.00 23.63  ?  162 GLU B HG3  1 
ATOM   6017  N  N    . LEU B  1 163 ? -17.957 -13.868 9.332   1.00 15.47  ?  163 LEU B N    1 
ATOM   6018  C  CA   . LEU B  1 163 ? -19.234 -13.527 8.697   1.00 15.50  ?  163 LEU B CA   1 
ATOM   6019  C  C    . LEU B  1 163 ? -20.344 -14.469 9.125   1.00 15.52  ?  163 LEU B C    1 
ATOM   6020  O  O    . LEU B  1 163 ? -21.510 -14.060 9.225   1.00 15.86  ?  163 LEU B O    1 
ATOM   6021  C  CB   . LEU B  1 163 ? -19.086 -13.544 7.168   1.00 14.38  ?  163 LEU B CB   1 
ATOM   6022  C  CG   . LEU B  1 163 ? -18.271 -12.403 6.583   1.00 17.29  ?  163 LEU B CG   1 
ATOM   6023  C  CD1  . LEU B  1 163 ? -17.912 -12.705 5.131   1.00 18.03  ?  163 LEU B CD1  1 
ATOM   6024  C  CD2  . LEU B  1 163 ? -19.050 -11.040 6.682   1.00 22.76  ?  163 LEU B CD2  1 
ATOM   6025  H  H    . LEU B  1 163 ? -17.318 -14.041 8.782   1.00 18.56  ?  163 LEU B H    1 
ATOM   6026  H  HA   . LEU B  1 163 ? -19.487 -12.629 8.962   1.00 18.60  ?  163 LEU B HA   1 
ATOM   6027  H  HB2  . LEU B  1 163 ? -18.654 -14.374 6.911   1.00 17.26  ?  163 LEU B HB2  1 
ATOM   6028  H  HB3  . LEU B  1 163 ? -19.971 -13.503 6.773   1.00 17.26  ?  163 LEU B HB3  1 
ATOM   6029  H  HG   . LEU B  1 163 ? -17.445 -12.315 7.084   1.00 20.75  ?  163 LEU B HG   1 
ATOM   6030  H  HD11 . LEU B  1 163 ? -17.393 -11.967 4.774   1.00 21.64  ?  163 LEU B HD11 1 
ATOM   6031  H  HD12 . LEU B  1 163 ? -17.391 -13.523 5.098   1.00 21.64  ?  163 LEU B HD12 1 
ATOM   6032  H  HD13 . LEU B  1 163 ? -18.729 -12.812 4.619   1.00 21.64  ?  163 LEU B HD13 1 
ATOM   6033  H  HD21 . LEU B  1 163 ? -18.503 -10.335 6.301   1.00 27.31  ?  163 LEU B HD21 1 
ATOM   6034  H  HD22 . LEU B  1 163 ? -19.883 -11.116 6.190   1.00 27.31  ?  163 LEU B HD22 1 
ATOM   6035  H  HD23 . LEU B  1 163 ? -19.233 -10.849 7.615   1.00 27.31  ?  163 LEU B HD23 1 
ATOM   6036  N  N    . CYS B  1 164 ? -20.009 -15.728 9.429   1.00 15.69  ?  164 CYS B N    1 
ATOM   6037  C  CA   . CYS B  1 164 ? -21.014 -16.688 9.887   1.00 15.49  ?  164 CYS B CA   1 
ATOM   6038  C  C    . CYS B  1 164 ? -21.656 -16.272 11.200  1.00 16.50  ?  164 CYS B C    1 
ATOM   6039  O  O    . CYS B  1 164 ? -22.807 -16.663 11.465  1.00 16.56  ?  164 CYS B O    1 
ATOM   6040  C  CB   . CYS B  1 164 ? -20.377 -18.073 10.011  1.00 16.41  ?  164 CYS B CB   1 
ATOM   6041  S  SG   . CYS B  1 164 ? -19.661 -18.663 8.466   1.00 17.95  ?  164 CYS B SG   1 
ATOM   6042  H  H    . CYS B  1 164 ? -19.212 -16.047 9.378   1.00 18.82  ?  164 CYS B H    1 
ATOM   6043  H  HA   . CYS B  1 164 ? -21.716 -16.744 9.221   1.00 18.59  ?  164 CYS B HA   1 
ATOM   6044  H  HB2  . CYS B  1 164 ? -19.669 -18.037 10.674  1.00 19.70  ?  164 CYS B HB2  1 
ATOM   6045  H  HB3  . CYS B  1 164 ? -21.056 -18.708 10.287  1.00 19.70  ?  164 CYS B HB3  1 
ATOM   6046  H  HG   . CYS B  1 164 ? -20.524 -18.727 7.635   1.00 21.54  ?  164 CYS B HG   1 
ATOM   6047  N  N    . GLY B  1 165 ? -20.970 -15.438 11.987  1.00 15.83  ?  165 GLY B N    1 
ATOM   6048  C  CA   . GLY B  1 165 ? -21.541 -14.928 13.227  1.00 16.44  ?  165 GLY B CA   1 
ATOM   6049  C  C    . GLY B  1 165 ? -22.651 -13.919 13.024  1.00 17.13  ?  165 GLY B C    1 
ATOM   6050  O  O    . GLY B  1 165 ? -23.387 -13.620 13.977  1.00 18.12  ?  165 GLY B O    1 
ATOM   6051  H  H    . GLY B  1 165 ? -20.175 -15.156 11.822  1.00 18.99  ?  165 GLY B H    1 
ATOM   6052  H  HA2  . GLY B  1 165 ? -21.897 -15.669 13.741  1.00 19.73  ?  165 GLY B HA2  1 
ATOM   6053  H  HA3  . GLY B  1 165 ? -20.841 -14.506 13.749  1.00 19.73  ?  165 GLY B HA3  1 
ATOM   6054  N  N    . LEU B  1 166 ? -22.758 -13.363 11.817  1.00 15.84  ?  166 LEU B N    1 
ATOM   6055  C  CA   . LEU B  1 166 ? -23.870 -12.519 11.376  1.00 14.80  ?  166 LEU B CA   1 
ATOM   6056  C  C    . LEU B  1 166 ? -24.852 -13.265 10.484  1.00 15.18  ?  166 LEU B C    1 
ATOM   6057  O  O    . LEU B  1 166 ? -25.675 -12.630 9.788   1.00 16.33  ?  166 LEU B O    1 
ATOM   6058  C  CB   . LEU B  1 166 ? -23.308 -11.314 10.635  1.00 16.54  ?  166 LEU B CB   1 
ATOM   6059  C  CG   . LEU B  1 166 ? -22.330 -10.440 11.416  1.00 19.44  ?  166 LEU B CG   1 
ATOM   6060  C  CD1  . LEU B  1 166 ? -21.739 -9.357  10.544  1.00 22.90  ?  166 LEU B CD1  1 
ATOM   6061  C  CD2  . LEU B  1 166 ? -23.047 -9.818  12.604  1.00 33.22  ?  166 LEU B CD2  1 
ATOM   6062  H  H    . LEU B  1 166 ? -22.164 -13.468 11.204  1.00 19.01  ?  166 LEU B H    1 
ATOM   6063  H  HA   . LEU B  1 166 ? -24.353 -12.197 12.153  1.00 17.76  ?  166 LEU B HA   1 
ATOM   6064  H  HB2  . LEU B  1 166 ? -22.844 -11.632 9.845   1.00 19.84  ?  166 LEU B HB2  1 
ATOM   6065  H  HB3  . LEU B  1 166 ? -24.049 -10.749 10.367  1.00 19.84  ?  166 LEU B HB3  1 
ATOM   6066  H  HG   . LEU B  1 166 ? -21.605 -10.991 11.752  1.00 23.33  ?  166 LEU B HG   1 
ATOM   6067  H  HD11 . LEU B  1 166 ? -21.125 -8.825  11.074  1.00 27.48  ?  166 LEU B HD11 1 
ATOM   6068  H  HD12 . LEU B  1 166 ? -21.267 -9.770  9.805   1.00 27.48  ?  166 LEU B HD12 1 
ATOM   6069  H  HD13 . LEU B  1 166 ? -22.457 -8.797  10.208  1.00 27.48  ?  166 LEU B HD13 1 
ATOM   6070  H  HD21 . LEU B  1 166 ? -22.420 -9.264  13.096  1.00 39.86  ?  166 LEU B HD21 1 
ATOM   6071  H  HD22 . LEU B  1 166 ? -23.783 -9.276  12.279  1.00 39.86  ?  166 LEU B HD22 1 
ATOM   6072  H  HD23 . LEU B  1 166 ? -23.383 -10.526 13.175  1.00 39.86  ?  166 LEU B HD23 1 
ATOM   6073  N  N    . ASP B  1 167 ? -24.766 -14.591 10.455  1.00 14.67  ?  167 ASP B N    1 
ATOM   6074  C  CA   . ASP B  1 167 ? -25.531 -15.435 9.534   1.00 13.06  ?  167 ASP B CA   1 
ATOM   6075  C  C    . ASP B  1 167 ? -25.316 -14.998 8.091   1.00 15.67  ?  167 ASP B C    1 
ATOM   6076  O  O    . ASP B  1 167 ? -26.217 -15.055 7.248   1.00 15.68  ?  167 ASP B O    1 
ATOM   6077  C  CB   . ASP B  1 167 ? -27.005 -15.468 9.917   1.00 14.66  ?  167 ASP B CB   1 
ATOM   6078  C  CG   . ASP B  1 167 ? -27.279 -16.239 11.226  1.00 21.70  ?  167 ASP B CG   1 
ATOM   6079  O  OD1  . ASP B  1 167 ? -26.401 -16.888 11.797  1.00 19.81  ?  167 ASP B OD1  1 
ATOM   6080  O  OD2  . ASP B  1 167 ? -28.457 -16.221 11.666  1.00 26.85  -1 167 ASP B OD2  1 
ATOM   6081  H  H    . ASP B  1 167 ? -24.253 -15.043 10.977  1.00 17.60  ?  167 ASP B H    1 
ATOM   6082  H  HA   . ASP B  1 167 ? -25.197 -16.343 9.610   1.00 15.68  ?  167 ASP B HA   1 
ATOM   6083  H  HB2  . ASP B  1 167 ? -27.319 -14.559 10.036  1.00 17.60  ?  167 ASP B HB2  1 
ATOM   6084  H  HB3  . ASP B  1 167 ? -27.504 -15.900 9.207   1.00 17.60  ?  167 ASP B HB3  1 
ATOM   6085  N  N    . LEU B  1 168 ? -24.075 -14.607 7.804   1.00 15.22  ?  168 LEU B N    1 
ATOM   6086  C  CA   . LEU B  1 168 ? -23.611 -14.299 6.449   1.00 15.88  ?  168 LEU B CA   1 
ATOM   6087  C  C    . LEU B  1 168 ? -22.755 -15.445 5.913   1.00 13.41  ?  168 LEU B C    1 
ATOM   6088  O  O    . LEU B  1 168 ? -21.795 -15.251 5.137   1.00 14.30  ?  168 LEU B O    1 
ATOM   6089  C  CB   . LEU B  1 168 ? -22.869 -12.957 6.424   1.00 14.72  ?  168 LEU B CB   1 
ATOM   6090  C  CG   . LEU B  1 168 ? -23.735 -11.710 6.659   1.00 14.37  ?  168 LEU B CG   1 
ATOM   6091  C  CD1  . LEU B  1 168 ? -22.902 -10.454 6.694   1.00 15.86  ?  168 LEU B CD1  1 
ATOM   6092  C  CD2  . LEU B  1 168 ? -24.797 -11.568 5.569   1.00 18.17  ?  168 LEU B CD2  1 
ATOM   6093  H  H    . LEU B  1 168 ? -23.461 -14.510 8.399   1.00 18.27  ?  168 LEU B H    1 
ATOM   6094  H  HA   . LEU B  1 168 ? -24.384 -14.216 5.869   1.00 19.06  ?  168 LEU B HA   1 
ATOM   6095  H  HB2  . LEU B  1 168 ? -22.189 -12.972 7.116   1.00 17.67  ?  168 LEU B HB2  1 
ATOM   6096  H  HB3  . LEU B  1 168 ? -22.446 -12.858 5.557   1.00 17.67  ?  168 LEU B HB3  1 
ATOM   6097  H  HG   . LEU B  1 168 ? -24.188 -11.794 7.512   1.00 17.24  ?  168 LEU B HG   1 
ATOM   6098  H  HD11 . LEU B  1 168 ? -23.485 -9.693  6.844   1.00 19.04  ?  168 LEU B HD11 1 
ATOM   6099  H  HD12 . LEU B  1 168 ? -22.257 -10.523 7.416   1.00 19.04  ?  168 LEU B HD12 1 
ATOM   6100  H  HD13 . LEU B  1 168 ? -22.441 -10.357 5.846   1.00 19.04  ?  168 LEU B HD13 1 
ATOM   6101  H  HD21 . LEU B  1 168 ? -25.325 -10.774 5.745   1.00 21.81  ?  168 LEU B HD21 1 
ATOM   6102  H  HD22 . LEU B  1 168 ? -24.357 -11.489 4.708   1.00 21.81  ?  168 LEU B HD22 1 
ATOM   6103  H  HD23 . LEU B  1 168 ? -25.366 -12.353 5.579   1.00 21.81  ?  168 LEU B HD23 1 
ATOM   6104  N  N    . ASP B  1 169 ? -23.176 -16.673 6.243   1.00 16.42  ?  169 ASP B N    1 
ATOM   6105  C  CA   . ASP B  1 169 ? -22.522 -17.879 5.734   1.00 15.84  ?  169 ASP B CA   1 
ATOM   6106  C  C    . ASP B  1 169 ? -22.447 -17.893 4.219   1.00 16.20  ?  169 ASP B C    1 
ATOM   6107  O  O    . ASP B  1 169 ? -21.479 -18.417 3.657   1.00 16.40  ?  169 ASP B O    1 
ATOM   6108  C  CB   . ASP B  1 169 ? -23.267 -19.115 6.259   1.00 15.70  ?  169 ASP B CB   1 
ATOM   6109  C  CG   . ASP B  1 169 ? -23.450 -19.073 7.751   1.00 16.24  ?  169 ASP B CG   1 
ATOM   6110  O  OD1  . ASP B  1 169 ? -24.341 -18.305 8.196   1.00 18.31  ?  169 ASP B OD1  1 
ATOM   6111  O  OD2  . ASP B  1 169 ? -22.681 -19.767 8.467   1.00 18.83  -1 169 ASP B OD2  1 
ATOM   6112  H  H    . ASP B  1 169 ? -23.842 -16.832 6.764   1.00 19.70  ?  169 ASP B H    1 
ATOM   6113  H  HA   . ASP B  1 169 ? -21.615 -17.911 6.076   1.00 19.00  ?  169 ASP B HA   1 
ATOM   6114  H  HB2  . ASP B  1 169 ? -24.145 -19.156 5.848   1.00 18.84  ?  169 ASP B HB2  1 
ATOM   6115  H  HB3  . ASP B  1 169 ? -22.758 -19.911 6.039   1.00 18.84  ?  169 ASP B HB3  1 
ATOM   6116  N  N    . PHE B  1 170 ? -23.473 -17.369 3.532   1.00 14.35  ?  170 PHE B N    1 
ATOM   6117  C  CA   . PHE B  1 170 ? -23.410 -17.312 2.071   1.00 16.26  ?  170 PHE B CA   1 
ATOM   6118  C  C    . PHE B  1 170 ? -22.181 -16.541 1.616   1.00 15.30  ?  170 PHE B C    1 
ATOM   6119  O  O    . PHE B  1 170 ? -21.452 -16.996 0.725   1.00 15.29  ?  170 PHE B O    1 
ATOM   6120  C  CB   . PHE B  1 170 ? -24.680 -16.661 1.504   1.00 14.95  ?  170 PHE B CB   1 
ATOM   6121  C  CG   . PHE B  1 170 ? -24.671 -16.469 0.021   1.00 14.44  ?  170 PHE B CG   1 
ATOM   6122  C  CD1  . PHE B  1 170 ? -24.690 -17.562 -0.832  1.00 15.99  ?  170 PHE B CD1  1 
ATOM   6123  C  CD2  . PHE B  1 170 ? -24.660 -15.200 -0.510  1.00 15.70  ?  170 PHE B CD2  1 
ATOM   6124  C  CE1  . PHE B  1 170 ? -24.709 -17.375 -2.216  1.00 17.24  ?  170 PHE B CE1  1 
ATOM   6125  C  CE2  . PHE B  1 170 ? -24.683 -15.001 -1.888  1.00 16.12  ?  170 PHE B CE2  1 
ATOM   6126  C  CZ   . PHE B  1 170 ? -24.724 -16.109 -2.729  1.00 15.95  ?  170 PHE B CZ   1 
ATOM   6127  H  H    . PHE B  1 170 ? -24.193 -17.051 3.878   1.00 17.22  ?  170 PHE B H    1 
ATOM   6128  H  HA   . PHE B  1 170 ? -23.349 -18.214 1.719   1.00 19.52  ?  170 PHE B HA   1 
ATOM   6129  H  HB2  . PHE B  1 170 ? -25.440 -17.222 1.723   1.00 17.94  ?  170 PHE B HB2  1 
ATOM   6130  H  HB3  . PHE B  1 170 ? -24.790 -15.788 1.913   1.00 17.94  ?  170 PHE B HB3  1 
ATOM   6131  H  HD1  . PHE B  1 170 ? -24.704 -18.423 -0.481  1.00 19.19  ?  170 PHE B HD1  1 
ATOM   6132  H  HD2  . PHE B  1 170 ? -24.656 -14.465 0.059   1.00 18.85  ?  170 PHE B HD2  1 
ATOM   6133  H  HE1  . PHE B  1 170 ? -24.727 -18.109 -2.786  1.00 20.69  ?  170 PHE B HE1  1 
ATOM   6134  H  HE2  . PHE B  1 170 ? -24.680 -14.141 -2.241  1.00 19.35  ?  170 PHE B HE2  1 
ATOM   6135  H  HZ   . PHE B  1 170 ? -24.717 -15.987 -3.651  1.00 19.14  ?  170 PHE B HZ   1 
ATOM   6136  N  N    . ASP B  1 171 ? -21.945 -15.366 2.213   1.00 16.04  ?  171 ASP B N    1 
ATOM   6137  C  CA   . ASP B  1 171 ? -20.815 -14.552 1.767   1.00 15.12  ?  171 ASP B CA   1 
ATOM   6138  C  C    . ASP B  1 171 ? -19.496 -15.276 2.041   1.00 16.52  ?  171 ASP B C    1 
ATOM   6139  O  O    . ASP B  1 171 ? -18.580 -15.252 1.207   1.00 15.71  ?  171 ASP B O    1 
ATOM   6140  C  CB   . ASP B  1 171 ? -20.836 -13.183 2.449   1.00 14.85  ?  171 ASP B CB   1 
ATOM   6141  C  CG   . ASP B  1 171 ? -22.004 -12.317 2.050   1.00 15.38  ?  171 ASP B CG   1 
ATOM   6142  O  OD1  . ASP B  1 171 ? -22.727 -12.688 1.124   1.00 17.53  ?  171 ASP B OD1  1 
ATOM   6143  O  OD2  . ASP B  1 171 ? -22.153 -11.220 2.652   1.00 15.48  -1 171 ASP B OD2  1 
ATOM   6144  H  H    . ASP B  1 171 ? -22.408 -15.030 2.855   1.00 19.25  ?  171 ASP B H    1 
ATOM   6145  H  HA   . ASP B  1 171 ? -20.885 -14.411 0.810   1.00 18.15  ?  171 ASP B HA   1 
ATOM   6146  H  HB2  . ASP B  1 171 ? -20.879 -13.314 3.409   1.00 17.82  ?  171 ASP B HB2  1 
ATOM   6147  H  HB3  . ASP B  1 171 ? -20.022 -12.708 2.219   1.00 17.82  ?  171 ASP B HB3  1 
ATOM   6148  N  N    . ALA B  1 172 ? -19.374 -15.919 3.210   1.00 15.38  ?  172 ALA B N    1 
ATOM   6149  C  CA   . ALA B  1 172 ? -18.147 -16.642 3.534   1.00 15.11  ?  172 ALA B CA   1 
ATOM   6150  C  C    . ALA B  1 172 ? -17.917 -17.759 2.544   1.00 17.81  ?  172 ALA B C    1 
ATOM   6151  O  O    . ALA B  1 172 ? -16.778 -17.976 2.092   1.00 17.15  ?  172 ALA B O    1 
ATOM   6152  C  CB   . ALA B  1 172 ? -18.235 -17.166 4.964   1.00 15.69  ?  172 ALA B CB   1 
ATOM   6153  H  H    . ALA B  1 172 ? -19.979 -15.949 3.820   1.00 18.45  ?  172 ALA B H    1 
ATOM   6154  H  HA   . ALA B  1 172 ? -17.395 -16.033 3.481   1.00 18.13  ?  172 ALA B HA   1 
ATOM   6155  H  HB1  . ALA B  1 172 ? -17.419 -17.646 5.175   1.00 18.83  ?  172 ALA B HB1  1 
ATOM   6156  H  HB2  . ALA B  1 172 ? -18.344 -16.415 5.569   1.00 18.83  ?  172 ALA B HB2  1 
ATOM   6157  H  HB3  . ALA B  1 172 ? -18.997 -17.762 5.035   1.00 18.83  ?  172 ALA B HB3  1 
ATOM   6158  N  N    . TYR B  1 173 ? -18.995 -18.457 2.166   1.00 17.34  ?  173 TYR B N    1 
ATOM   6159  C  CA   . TYR B  1 173 ? -18.916 -19.514 1.160   1.00 15.34  ?  173 TYR B CA   1 
ATOM   6160  C  C    . TYR B  1 173 ? -18.468 -18.976 -0.206  1.00 16.06  ?  173 TYR B C    1 
ATOM   6161  O  O    . TYR B  1 173 ? -17.573 -19.561 -0.848  1.00 17.47  ?  173 TYR B O    1 
ATOM   6162  C  CB   . TYR B  1 173 ? -20.277 -20.218 1.052   1.00 17.17  ?  173 TYR B CB   1 
ATOM   6163  C  CG   . TYR B  1 173 ? -20.204 -21.403 0.125   1.00 21.17  ?  173 TYR B CG   1 
ATOM   6164  C  CD1  . TYR B  1 173 ? -19.492 -22.528 0.518   1.00 24.59  ?  173 TYR B CD1  1 
ATOM   6165  C  CD2  . TYR B  1 173 ? -20.764 -21.385 -1.131  1.00 26.15  ?  173 TYR B CD2  1 
ATOM   6166  C  CE1  . TYR B  1 173 ? -19.353 -23.609 -0.274  1.00 31.38  ?  173 TYR B CE1  1 
ATOM   6167  C  CE2  . TYR B  1 173 ? -20.628 -22.544 -1.987  1.00 22.37  ?  173 TYR B CE2  1 
ATOM   6168  C  CZ   . TYR B  1 173 ? -19.925 -23.626 -1.516  1.00 26.29  ?  173 TYR B CZ   1 
ATOM   6169  O  OH   . TYR B  1 173 ? -19.707 -24.776 -2.279  1.00 31.40  ?  173 TYR B OH   1 
ATOM   6170  H  H    . TYR B  1 173 ? -19.785 -18.335 2.482   1.00 20.81  ?  173 TYR B H    1 
ATOM   6171  H  HA   . TYR B  1 173 ? -18.264 -20.172 1.447   1.00 18.40  ?  173 TYR B HA   1 
ATOM   6172  H  HB2  . TYR B  1 173 ? -20.546 -20.533 1.929   1.00 20.61  ?  173 TYR B HB2  1 
ATOM   6173  H  HB3  . TYR B  1 173 ? -20.934 -19.596 0.702   1.00 20.61  ?  173 TYR B HB3  1 
ATOM   6174  H  HD1  . TYR B  1 173 ? -19.099 -22.537 1.361   1.00 29.51  ?  173 TYR B HD1  1 
ATOM   6175  H  HD2  . TYR B  1 173 ? -21.240 -20.640 -1.422  1.00 31.38  ?  173 TYR B HD2  1 
ATOM   6176  H  HE1  . TYR B  1 173 ? -18.874 -24.347 0.027   1.00 37.65  ?  173 TYR B HE1  1 
ATOM   6177  H  HE2  . TYR B  1 173 ? -21.005 -22.555 -2.837  1.00 26.84  ?  173 TYR B HE2  1 
ATOM   6178  H  HH   . TYR B  1 173 ? -19.234 -25.321 -1.849  1.00 37.67  ?  173 TYR B HH   1 
ATOM   6179  N  N    . VAL B  1 174 ? -19.076 -17.870 -0.663  1.00 17.07  ?  174 VAL B N    1 
ATOM   6180  C  CA   . VAL B  1 174 ? -18.706 -17.284 -1.945  1.00 17.04  ?  174 VAL B CA   1 
ATOM   6181  C  C    . VAL B  1 174 ? -17.247 -16.864 -1.930  1.00 18.29  ?  174 VAL B C    1 
ATOM   6182  O  O    . VAL B  1 174 ? -16.496 -17.165 -2.864  1.00 18.06  ?  174 VAL B O    1 
ATOM   6183  C  CB   . VAL B  1 174 ? -19.613 -16.095 -2.291  1.00 17.16  ?  174 VAL B CB   1 
ATOM   6184  C  CG1  . VAL B  1 174 ? -19.152 -15.429 -3.594  1.00 16.93  ?  174 VAL B CG1  1 
ATOM   6185  C  CG2  . VAL B  1 174 ? -21.080 -16.543 -2.464  1.00 18.84  ?  174 VAL B CG2  1 
ATOM   6186  H  H    . VAL B  1 174 ? -19.700 -17.447 -0.248  1.00 20.49  ?  174 VAL B H    1 
ATOM   6187  H  HA   . VAL B  1 174 ? -18.815 -17.954 -2.639  1.00 20.45  ?  174 VAL B HA   1 
ATOM   6188  H  HB   . VAL B  1 174 ? -19.573 -15.439 -1.578  1.00 20.59  ?  174 VAL B HB   1 
ATOM   6189  H  HG11 . VAL B  1 174 ? -19.739 -14.682 -3.791  1.00 20.32  ?  174 VAL B HG11 1 
ATOM   6190  H  HG12 . VAL B  1 174 ? -18.241 -15.114 -3.482  1.00 20.32  ?  174 VAL B HG12 1 
ATOM   6191  H  HG13 . VAL B  1 174 ? -19.191 -16.080 -4.312  1.00 20.32  ?  174 VAL B HG13 1 
ATOM   6192  H  HG21 . VAL B  1 174 ? -21.623 -15.769 -2.681  1.00 22.61  ?  174 VAL B HG21 1 
ATOM   6193  H  HG22 . VAL B  1 174 ? -21.129 -17.193 -3.183  1.00 22.61  ?  174 VAL B HG22 1 
ATOM   6194  H  HG23 . VAL B  1 174 ? -21.388 -16.942 -1.635  1.00 22.61  ?  174 VAL B HG23 1 
ATOM   6195  N  N    . PHE B  1 175 ? -16.826 -16.149 -0.886  1.00 19.16  ?  175 PHE B N    1 
ATOM   6196  C  CA   . PHE B  1 175 ? -15.425 -15.738 -0.826  1.00 18.60  ?  175 PHE B CA   1 
ATOM   6197  C  C    . PHE B  1 175 ? -14.493 -16.950 -0.856  1.00 18.24  ?  175 PHE B C    1 
ATOM   6198  O  O    . PHE B  1 175 ? -13.424 -16.918 -1.503  1.00 18.23  ?  175 PHE B O    1 
ATOM   6199  C  CB   . PHE B  1 175 ? -15.139 -14.902 0.429   1.00 16.82  ?  175 PHE B CB   1 
ATOM   6200  C  CG   . PHE B  1 175 ? -15.569 -13.474 0.333   1.00 16.18  ?  175 PHE B CG   1 
ATOM   6201  C  CD1  . PHE B  1 175 ? -15.026 -12.642 -0.644  1.00 17.67  ?  175 PHE B CD1  1 
ATOM   6202  C  CD2  . PHE B  1 175 ? -16.478 -12.935 1.252   1.00 17.24  ?  175 PHE B CD2  1 
ATOM   6203  C  CE1  . PHE B  1 175 ? -15.402 -11.304 -0.737  1.00 18.84  ?  175 PHE B CE1  1 
ATOM   6204  C  CE2  . PHE B  1 175 ? -16.841 -11.586 1.186   1.00 19.22  ?  175 PHE B CE2  1 
ATOM   6205  C  CZ   . PHE B  1 175 ? -16.303 -10.776 0.194   1.00 20.35  ?  175 PHE B CZ   1 
ATOM   6206  H  H    . PHE B  1 175 ? -17.312 -15.897 -0.223  1.00 23.00  ?  175 PHE B H    1 
ATOM   6207  H  HA   . PHE B  1 175 ? -15.225 -15.190 -1.601  1.00 22.33  ?  175 PHE B HA   1 
ATOM   6208  H  HB2  . PHE B  1 175 ? -15.606 -15.300 1.180   1.00 20.19  ?  175 PHE B HB2  1 
ATOM   6209  H  HB3  . PHE B  1 175 ? -14.183 -14.911 0.597   1.00 20.19  ?  175 PHE B HB3  1 
ATOM   6210  H  HD1  . PHE B  1 175 ? -14.421 -12.991 -1.258  1.00 21.20  ?  175 PHE B HD1  1 
ATOM   6211  H  HD2  . PHE B  1 175 ? -16.831 -13.475 1.922   1.00 20.68  ?  175 PHE B HD2  1 
ATOM   6212  H  HE1  . PHE B  1 175 ? -15.037 -10.759 -1.396  1.00 22.61  ?  175 PHE B HE1  1 
ATOM   6213  H  HE2  . PHE B  1 175 ? -17.453 -11.237 1.793   1.00 23.07  ?  175 PHE B HE2  1 
ATOM   6214  H  HZ   . PHE B  1 175 ? -16.559 -9.884  0.136   1.00 24.42  ?  175 PHE B HZ   1 
ATOM   6215  N  N    . THR B  1 176 ? -14.833 -18.001 -0.101  1.00 18.44  ?  176 THR B N    1 
ATOM   6216  C  CA   . THR B  1 176 ? -14.011 -19.210 -0.087  1.00 18.70  ?  176 THR B CA   1 
ATOM   6217  C  C    . THR B  1 176 ? -13.851 -19.780 -1.491  1.00 23.85  ?  176 THR B C    1 
ATOM   6218  O  O    . THR B  1 176 ? -12.738 -20.123 -1.918  1.00 22.34  ?  176 THR B O    1 
ATOM   6219  C  CB   . THR B  1 176 ? -14.615 -20.244 0.868   1.00 21.78  ?  176 THR B CB   1 
ATOM   6220  O  OG1  . THR B  1 176 ? -14.503 -19.779 2.221   1.00 22.03  ?  176 THR B OG1  1 
ATOM   6221  C  CG2  . THR B  1 176 ? -13.874 -21.568 0.769   1.00 25.23  ?  176 THR B CG2  1 
ATOM   6222  H  H    . THR B  1 176 ? -15.527 -18.037 0.406   1.00 22.12  ?  176 THR B H    1 
ATOM   6223  H  HA   . THR B  1 176 ? -13.127 -18.984 0.243   1.00 22.44  ?  176 THR B HA   1 
ATOM   6224  H  HB   . THR B  1 176 ? -15.548 -20.391 0.646   1.00 26.14  ?  176 THR B HB   1 
ATOM   6225  H  HG1  . THR B  1 176 ? -14.913 -19.051 2.310   1.00 26.44  ?  176 THR B HG1  1 
ATOM   6226  H  HG21 . THR B  1 176 ? -14.266 -22.214 1.378   1.00 30.27  ?  176 THR B HG21 1 
ATOM   6227  H  HG22 . THR B  1 176 ? -13.930 -21.913 -0.136  1.00 30.27  ?  176 THR B HG22 1 
ATOM   6228  H  HG23 . THR B  1 176 ? -12.940 -21.443 1.000   1.00 30.27  ?  176 THR B HG23 1 
ATOM   6229  N  N    . LYS B  1 177 ? -14.955 -19.867 -2.233  1.00 20.41  ?  177 LYS B N    1 
ATOM   6230  C  CA   . LYS B  1 177 ? -14.920 -20.402 -3.592  1.00 21.06  ?  177 LYS B CA   1 
ATOM   6231  C  C    . LYS B  1 177 ? -14.083 -19.524 -4.501  1.00 20.56  ?  177 LYS B C    1 
ATOM   6232  O  O    . LYS B  1 177 ? -13.228 -20.021 -5.248  1.00 25.32  ?  177 LYS B O    1 
ATOM   6233  C  CB   . LYS B  1 177 ? -16.345 -20.509 -4.140  1.00 25.97  ?  177 LYS B CB   1 
ATOM   6234  C  CG   . LYS B  1 177 ? -17.178 -21.613 -3.519  1.00 31.69  ?  177 LYS B CG   1 
ATOM   6235  C  CD   . LYS B  1 177 ? -16.824 -23.002 -4.070  1.00 37.85  ?  177 LYS B CD   1 
ATOM   6236  C  CE   . LYS B  1 177 ? -17.261 -23.172 -5.518  1.00 42.06  ?  177 LYS B CE   1 
ATOM   6237  N  NZ   . LYS B  1 177 ? -16.766 -24.466 -6.067  1.00 53.12  1  177 LYS B NZ   1 
ATOM   6238  H  H    . LYS B  1 177 ? -15.737 -19.622 -1.972  1.00 24.49  ?  177 LYS B H    1 
ATOM   6239  H  HA   . LYS B  1 177 ? -14.529 -21.290 -3.579  1.00 25.27  ?  177 LYS B HA   1 
ATOM   6240  H  HB2  . LYS B  1 177 ? -16.803 -19.669 -3.979  1.00 31.17  ?  177 LYS B HB2  1 
ATOM   6241  H  HB3  . LYS B  1 177 ? -16.298 -20.677 -5.094  1.00 31.17  ?  177 LYS B HB3  1 
ATOM   6242  H  HG2  . LYS B  1 177 ? -17.026 -21.622 -2.561  1.00 38.03  ?  177 LYS B HG2  1 
ATOM   6243  H  HG3  . LYS B  1 177 ? -18.115 -21.446 -3.705  1.00 38.03  ?  177 LYS B HG3  1 
ATOM   6244  H  HD2  . LYS B  1 177 ? -15.863 -23.125 -4.028  1.00 45.41  ?  177 LYS B HD2  1 
ATOM   6245  H  HD3  . LYS B  1 177 ? -17.271 -23.679 -3.537  1.00 45.41  ?  177 LYS B HD3  1 
ATOM   6246  H  HE2  . LYS B  1 177 ? -18.230 -23.170 -5.566  1.00 50.47  ?  177 LYS B HE2  1 
ATOM   6247  H  HE3  . LYS B  1 177 ? -16.894 -22.451 -6.053  1.00 50.47  ?  177 LYS B HE3  1 
ATOM   6248  H  HZ1  . LYS B  1 177 ? -15.877 -24.490 -6.034  1.00 63.75  ?  177 LYS B HZ1  1 
ATOM   6249  H  HZ2  . LYS B  1 177 ? -17.092 -25.143 -5.590  1.00 63.75  ?  177 LYS B HZ2  1 
ATOM   6250  H  HZ3  . LYS B  1 177 ? -17.026 -24.557 -6.914  1.00 63.75  ?  177 LYS B HZ3  1 
ATOM   6251  N  N    . ILE B  1 178 ? -14.321 -18.214 -4.473  1.00 19.48  ?  178 ILE B N    1 
ATOM   6252  C  CA   . ILE B  1 178 ? -13.679 -17.341 -5.454  1.00 20.11  ?  178 ILE B CA   1 
ATOM   6253  C  C    . ILE B  1 178 ? -12.204 -17.176 -5.145  1.00 24.03  ?  178 ILE B C    1 
ATOM   6254  O  O    . ILE B  1 178 ? -11.383 -17.081 -6.060  1.00 25.71  ?  178 ILE B O    1 
ATOM   6255  C  CB   . ILE B  1 178 ? -14.406 -15.981 -5.510  1.00 23.65  ?  178 ILE B CB   1 
ATOM   6256  C  CG1  . ILE B  1 178 ? -15.784 -16.159 -6.144  1.00 30.78  ?  178 ILE B CG1  1 
ATOM   6257  C  CG2  . ILE B  1 178 ? -13.564 -14.924 -6.251  1.00 30.81  ?  178 ILE B CG2  1 
ATOM   6258  C  CD1  . ILE B  1 178 ? -15.757 -16.610 -7.590  1.00 33.83  ?  178 ILE B CD1  1 
ATOM   6259  H  H    . ILE B  1 178 ? -14.836 -17.814 -3.913  1.00 23.38  ?  178 ILE B H    1 
ATOM   6260  H  HA   . ILE B  1 178 ? -13.752 -17.751 -6.330  1.00 24.13  ?  178 ILE B HA   1 
ATOM   6261  H  HB   . ILE B  1 178 ? -14.535 -15.673 -4.599  1.00 28.38  ?  178 ILE B HB   1 
ATOM   6262  H  HG12 . ILE B  1 178 ? -16.274 -16.825 -5.637  1.00 36.94  ?  178 ILE B HG12 1 
ATOM   6263  H  HG13 . ILE B  1 178 ? -16.253 -15.311 -6.109  1.00 36.94  ?  178 ILE B HG13 1 
ATOM   6264  H  HG21 . ILE B  1 178 ? -14.052 -14.086 -6.265  1.00 36.97  ?  178 ILE B HG21 1 
ATOM   6265  H  HG22 . ILE B  1 178 ? -12.722 -14.808 -5.784  1.00 36.97  ?  178 ILE B HG22 1 
ATOM   6266  H  HG23 . ILE B  1 178 ? -13.402 -15.228 -7.157  1.00 36.97  ?  178 ILE B HG23 1 
ATOM   6267  H  HD11 . ILE B  1 178 ? -16.669 -16.698 -7.910  1.00 40.60  ?  178 ILE B HD11 1 
ATOM   6268  H  HD12 . ILE B  1 178 ? -15.283 -15.949 -8.118  1.00 40.60  ?  178 ILE B HD12 1 
ATOM   6269  H  HD13 . ILE B  1 178 ? -15.303 -17.466 -7.645  1.00 40.60  ?  178 ILE B HD13 1 
ATOM   6270  N  N    . LEU B  1 179 ? -11.835 -17.176 -3.879  1.00 20.75  ?  179 LEU B N    1 
ATOM   6271  C  CA   . LEU B  1 179 ? -10.463 -16.907 -3.496  1.00 22.85  ?  179 LEU B CA   1 
ATOM   6272  C  C    . LEU B  1 179 ? -9.658  -18.172 -3.308  1.00 25.07  ?  179 LEU B C    1 
ATOM   6273  O  O    . LEU B  1 179 ? -8.455  -18.086 -3.040  1.00 25.37  ?  179 LEU B O    1 
ATOM   6274  C  CB   . LEU B  1 179 ? -10.442 -16.065 -2.222  1.00 21.48  ?  179 LEU B CB   1 
ATOM   6275  C  CG   . LEU B  1 179 ? -11.011 -14.650 -2.389  1.00 20.95  ?  179 LEU B CG   1 
ATOM   6276  C  CD1  . LEU B  1 179 ? -11.014 -13.962 -1.043  1.00 22.60  ?  179 LEU B CD1  1 
ATOM   6277  C  CD2  . LEU B  1 179 ? -10.230 -13.852 -3.422  1.00 24.52  ?  179 LEU B CD2  1 
ATOM   6278  H  H    . LEU B  1 179 ? -12.363 -17.330 -3.218  1.00 24.90  ?  179 LEU B H    1 
ATOM   6279  H  HA   . LEU B  1 179 ? -10.040 -16.390 -4.199  1.00 27.42  ?  179 LEU B HA   1 
ATOM   6280  H  HB2  . LEU B  1 179 ? -10.967 -16.516 -1.543  1.00 25.78  ?  179 LEU B HB2  1 
ATOM   6281  H  HB3  . LEU B  1 179 ? -9.523  -15.980 -1.922  1.00 25.78  ?  179 LEU B HB3  1 
ATOM   6282  H  HG   . LEU B  1 179 ? -11.930 -14.714 -2.694  1.00 25.14  ?  179 LEU B HG   1 
ATOM   6283  H  HD11 . LEU B  1 179 ? -11.374 -13.067 -1.147  1.00 27.12  ?  179 LEU B HD11 1 
ATOM   6284  H  HD12 . LEU B  1 179 ? -11.566 -14.472 -0.429  1.00 27.12  ?  179 LEU B HD12 1 
ATOM   6285  H  HD13 . LEU B  1 179 ? -10.104 -13.916 -0.710  1.00 27.12  ?  179 LEU B HD13 1 
ATOM   6286  H  HD21 . LEU B  1 179 ? -10.619 -12.967 -3.498  1.00 29.42  ?  179 LEU B HD21 1 
ATOM   6287  H  HD22 . LEU B  1 179 ? -9.306  -13.784 -3.134  1.00 29.42  ?  179 LEU B HD22 1 
ATOM   6288  H  HD23 . LEU B  1 179 ? -10.278 -14.310 -4.276  1.00 29.42  ?  179 LEU B HD23 1 
ATOM   6289  N  N    . GLY B  1 180 ? -10.283 -19.332 -3.452  1.00 22.01  ?  180 GLY B N    1 
ATOM   6290  C  CA   . GLY B  1 180 ? -9.575  -20.593 -3.344  1.00 23.07  ?  180 GLY B CA   1 
ATOM   6291  C  C    . GLY B  1 180 ? -9.094  -20.903 -1.950  1.00 25.12  ?  180 GLY B C    1 
ATOM   6292  O  O    . GLY B  1 180 ? -7.983  -21.416 -1.780  1.00 24.71  ?  180 GLY B O    1 
ATOM   6293  H  H    . GLY B  1 180 ? -11.124 -19.414 -3.614  1.00 26.41  ?  180 GLY B H    1 
ATOM   6294  H  HA2  . GLY B  1 180 ? -10.160 -21.313 -3.629  1.00 27.68  ?  180 GLY B HA2  1 
ATOM   6295  H  HA3  . GLY B  1 180 ? -8.805  -20.578 -3.933  1.00 27.68  ?  180 GLY B HA3  1 
ATOM   6296  N  N    . LEU B  1 181 ? -9.912  -20.613 -0.944  1.00 23.00  ?  181 LEU B N    1 
ATOM   6297  C  CA   . LEU B  1 181 ? -9.492  -20.739 0.438   1.00 22.80  ?  181 LEU B CA   1 
ATOM   6298  C  C    . LEU B  1 181 ? -9.682  -22.132 1.006   1.00 22.97  ?  181 LEU B C    1 
ATOM   6299  O  O    . LEU B  1 181 ? -9.279  -22.364 2.155   1.00 24.67  ?  181 LEU B O    1 
ATOM   6300  C  CB   . LEU B  1 181 ? -10.258 -19.741 1.321   1.00 22.21  ?  181 LEU B CB   1 
ATOM   6301  C  CG   . LEU B  1 181 ? -10.143 -18.274 0.885   1.00 24.15  ?  181 LEU B CG   1 
ATOM   6302  C  CD1  . LEU B  1 181 ? -10.911 -17.346 1.799   1.00 24.49  ?  181 LEU B CD1  1 
ATOM   6303  C  CD2  . LEU B  1 181 ? -8.706  -17.833 0.833   1.00 25.56  ?  181 LEU B CD2  1 
ATOM   6304  H  H    . LEU B  1 181 ? -10.721 -20.339 -1.040  1.00 27.60  ?  181 LEU B H    1 
ATOM   6305  H  HA   . LEU B  1 181 ? -8.548  -20.522 0.497   1.00 27.35  ?  181 LEU B HA   1 
ATOM   6306  H  HB2  . LEU B  1 181 ? -11.198 -19.978 1.310   1.00 26.65  ?  181 LEU B HB2  1 
ATOM   6307  H  HB3  . LEU B  1 181 ? -9.917  -19.806 2.227   1.00 26.65  ?  181 LEU B HB3  1 
ATOM   6308  H  HG   . LEU B  1 181 ? -10.513 -18.183 -0.007  1.00 28.98  ?  181 LEU B HG   1 
ATOM   6309  H  HD11 . LEU B  1 181 ? -10.807 -16.435 1.483   1.00 29.38  ?  181 LEU B HD11 1 
ATOM   6310  H  HD12 . LEU B  1 181 ? -11.848 -17.597 1.787   1.00 29.38  ?  181 LEU B HD12 1 
ATOM   6311  H  HD13 . LEU B  1 181 ? -10.557 -17.427 2.699   1.00 29.38  ?  181 LEU B HD13 1 
ATOM   6312  H  HD21 . LEU B  1 181 ? -8.670  -16.904 0.556   1.00 30.67  ?  181 LEU B HD21 1 
ATOM   6313  H  HD22 . LEU B  1 181 ? -8.314  -17.930 1.716   1.00 30.67  ?  181 LEU B HD22 1 
ATOM   6314  H  HD23 . LEU B  1 181 ? -8.229  -18.388 0.196   1.00 30.67  ?  181 LEU B HD23 1 
ATOM   6315  N  N    . GLU B  1 182 ? -10.316 -23.040 0.269   1.00 24.74  ?  182 GLU B N    1 
ATOM   6316  C  CA   . GLU B  1 182 ? -10.513 -24.406 0.737   1.00 24.20  ?  182 GLU B CA   1 
ATOM   6317  C  C    . GLU B  1 182 ? -9.260  -25.213 0.418   1.00 31.23  ?  182 GLU B C    1 
ATOM   6318  O  O    . GLU B  1 182 ? -8.833  -25.287 -0.745  1.00 30.62  ?  182 GLU B O    1 
ATOM   6319  C  CB   . GLU B  1 182 ? -11.760 -25.034 0.101   1.00 26.90  ?  182 GLU B CB   1 
ATOM   6320  C  CG   . GLU B  1 182 ? -11.988 -26.464 0.592   1.00 31.80  ?  182 GLU B CG   1 
ATOM   6321  C  CD   . GLU B  1 182 ? -13.238 -27.141 0.042   1.00 37.32  ?  182 GLU B CD   1 
ATOM   6322  O  OE1  . GLU B  1 182 ? -14.020 -26.504 -0.689  1.00 40.54  ?  182 GLU B OE1  1 
ATOM   6323  O  OE2  . GLU B  1 182 ? -13.434 -28.330 0.375   1.00 41.01  -1 182 GLU B OE2  1 
ATOM   6324  H  H    . GLU B  1 182 ? -10.645 -22.887 -0.511  1.00 29.69  ?  182 GLU B H    1 
ATOM   6325  H  HA   . GLU B  1 182 ? -10.633 -24.400 1.699   1.00 29.03  ?  182 GLU B HA   1 
ATOM   6326  H  HB2  . GLU B  1 182 ? -12.539 -24.505 0.336   1.00 32.28  ?  182 GLU B HB2  1 
ATOM   6327  H  HB3  . GLU B  1 182 ? -11.650 -25.059 -0.862  1.00 32.28  ?  182 GLU B HB3  1 
ATOM   6328  H  HG2  . GLU B  1 182 ? -11.225 -27.004 0.334   1.00 38.16  ?  182 GLU B HG2  1 
ATOM   6329  H  HG3  . GLU B  1 182 ? -12.064 -26.449 1.559   1.00 38.16  ?  182 GLU B HG3  1 
ATOM   6330  N  N    . ASP B  1 183 ? -8.652  -25.775 1.455   1.00 25.42  ?  183 ASP B N    1 
ATOM   6331  C  CA   . ASP B  1 183 ? -7.488  -26.647 1.302   1.00 25.86  ?  183 ASP B CA   1 
ATOM   6332  C  C    . ASP B  1 183 ? -7.572  -27.699 2.401   1.00 27.02  ?  183 ASP B C    1 
ATOM   6333  O  O    . ASP B  1 183 ? -8.579  -27.802 3.103   1.00 26.89  ?  183 ASP B O    1 
ATOM   6334  C  CB   . ASP B  1 183 ? -6.185  -25.833 1.310   1.00 31.30  ?  183 ASP B CB   1 
ATOM   6335  C  CG   . ASP B  1 183 ? -5.868  -25.190 2.654   1.00 35.96  ?  183 ASP B CG   1 
ATOM   6336  O  OD1  . ASP B  1 183 ? -6.433  -25.584 3.700   1.00 32.35  ?  183 ASP B OD1  1 
ATOM   6337  O  OD2  . ASP B  1 183 ? -5.021  -24.266 2.670   1.00 44.61  -1 183 ASP B OD2  1 
ATOM   6338  H  H    . ASP B  1 183 ? -8.897  -25.667 2.272   1.00 30.50  ?  183 ASP B H    1 
ATOM   6339  H  HA   . ASP B  1 183 ? -7.548  -27.103 0.448   1.00 31.03  ?  183 ASP B HA   1 
ATOM   6340  H  HB2  . ASP B  1 183 ? -5.448  -26.422 1.082   1.00 37.56  ?  183 ASP B HB2  1 
ATOM   6341  H  HB3  . ASP B  1 183 ? -6.255  -25.125 0.651   1.00 37.56  ?  183 ASP B HB3  1 
ATOM   6342  N  N    . GLU B  1 184 ? -6.526  -28.523 2.539   1.00 30.08  ?  184 GLU B N    1 
ATOM   6343  C  CA   . GLU B  1 184 ? -6.599  -29.608 3.511   1.00 32.35  ?  184 GLU B CA   1 
ATOM   6344  C  C    . GLU B  1 184 ? -6.768  -29.095 4.940   1.00 32.79  ?  184 GLU B C    1 
ATOM   6345  O  O    . GLU B  1 184 ? -7.420  -29.753 5.755   1.00 34.35  ?  184 GLU B O    1 
ATOM   6346  C  CB   . GLU B  1 184 ? -5.351  -30.500 3.393   1.00 40.16  ?  184 GLU B CB   1 
ATOM   6347  C  CG   . GLU B  1 184 ? -5.204  -31.128 2.008   1.00 55.84  ?  184 GLU B CG   1 
ATOM   6348  C  CD   . GLU B  1 184 ? -3.948  -31.969 1.862   1.00 78.88  ?  184 GLU B CD   1 
ATOM   6349  O  OE1  . GLU B  1 184 ? -2.964  -31.717 2.598   1.00 72.99  ?  184 GLU B OE1  1 
ATOM   6350  O  OE2  . GLU B  1 184 ? -3.952  -32.887 1.009   1.00 86.78  -1 184 GLU B OE2  1 
ATOM   6351  H  H    . GLU B  1 184 ? -5.790  -28.475 2.097   1.00 36.10  ?  184 GLU B H    1 
ATOM   6352  H  HA   . GLU B  1 184 ? -7.372  -30.156 3.304   1.00 38.83  ?  184 GLU B HA   1 
ATOM   6353  H  HB2  . GLU B  1 184 ? -4.562  -29.963 3.565   1.00 48.19  ?  184 GLU B HB2  1 
ATOM   6354  H  HB3  . GLU B  1 184 ? -5.413  -31.217 4.043   1.00 48.19  ?  184 GLU B HB3  1 
ATOM   6355  H  HG2  . GLU B  1 184 ? -5.969  -31.701 1.840   1.00 67.01  ?  184 GLU B HG2  1 
ATOM   6356  H  HG3  . GLU B  1 184 ? -5.169  -30.422 1.345   1.00 67.01  ?  184 GLU B HG3  1 
ATOM   6357  N  N    . ASP B  1 185 ? -6.219  -27.921 5.267   1.00 28.38  ?  185 ASP B N    1 
ATOM   6358  C  CA   . ASP B  1 185 ? -6.348  -27.416 6.631   1.00 24.73  ?  185 ASP B CA   1 
ATOM   6359  C  C    . ASP B  1 185 ? -7.711  -26.781 6.905   1.00 26.70  ?  185 ASP B C    1 
ATOM   6360  O  O    . ASP B  1 185 ? -8.161  -26.795 8.051   1.00 28.92  ?  185 ASP B O    1 
ATOM   6361  C  CB   . ASP B  1 185 ? -5.261  -26.395 6.920   1.00 30.92  ?  185 ASP B CB   1 
ATOM   6362  C  CG   . ASP B  1 185 ? -3.878  -27.015 6.923   1.00 42.21  ?  185 ASP B CG   1 
ATOM   6363  O  OD1  . ASP B  1 185 ? -3.699  -28.056 7.587   1.00 42.39  ?  185 ASP B OD1  1 
ATOM   6364  O  OD2  . ASP B  1 185 ? -3.000  -26.455 6.258   1.00 42.79  -1 185 ASP B OD2  1 
ATOM   6365  H  H    . ASP B  1 185 ? -5.778  -27.412 4.731   1.00 34.06  ?  185 ASP B H    1 
ATOM   6366  H  HA   . ASP B  1 185 ? -6.234  -28.154 7.250   1.00 29.68  ?  185 ASP B HA   1 
ATOM   6367  H  HB2  . ASP B  1 185 ? -5.281  -25.707 6.237   1.00 37.11  ?  185 ASP B HB2  1 
ATOM   6368  H  HB3  . ASP B  1 185 ? -5.417  -26.002 7.793   1.00 37.11  ?  185 ASP B HB3  1 
ATOM   6369  N  N    . THR B  1 186 ? -8.371  -26.228 5.890   1.00 26.62  ?  186 THR B N    1 
ATOM   6370  C  CA   . THR B  1 186 ? -9.637  -25.530 6.106   1.00 22.90  ?  186 THR B CA   1 
ATOM   6371  C  C    . THR B  1 186 ? -10.858 -26.339 5.689   1.00 24.98  ?  186 THR B C    1 
ATOM   6372  O  O    . THR B  1 186 ? -11.981 -25.894 5.925   1.00 20.53  ?  186 THR B O    1 
ATOM   6373  C  CB   . THR B  1 186 ? -9.657  -24.206 5.332   1.00 20.49  ?  186 THR B CB   1 
ATOM   6374  O  OG1  . THR B  1 186 ? -9.600  -24.475 3.916   1.00 22.37  ?  186 THR B OG1  1 
ATOM   6375  C  CG2  . THR B  1 186 ? -8.516  -23.299 5.753   1.00 22.98  ?  186 THR B CG2  1 
ATOM   6376  H  H    . THR B  1 186 ? -8.110  -26.242 5.071   1.00 31.94  ?  186 THR B H    1 
ATOM   6377  H  HA   . THR B  1 186 ? -9.724  -25.324 7.050   1.00 27.48  ?  186 THR B HA   1 
ATOM   6378  H  HB   . THR B  1 186 ? -10.488 -23.745 5.528   1.00 24.59  ?  186 THR B HB   1 
ATOM   6379  H  HG1  . THR B  1 186 ? -9.611  -23.753 3.486   1.00 26.84  ?  186 THR B HG1  1 
ATOM   6380  H  HG21 . THR B  1 186 ? -8.550  -22.470 5.250   1.00 27.57  ?  186 THR B HG21 1 
ATOM   6381  H  HG22 . THR B  1 186 ? -8.585  -23.097 6.699   1.00 27.57  ?  186 THR B HG22 1 
ATOM   6382  H  HG23 . THR B  1 186 ? -7.667  -23.735 5.584   1.00 27.57  ?  186 THR B HG23 1 
ATOM   6383  N  N    . ALA B  1 187 ? -10.669 -27.500 5.064   1.00 25.24  ?  187 ALA B N    1 
ATOM   6384  C  CA   . ALA B  1 187 ? -11.778 -28.220 4.440   1.00 27.63  ?  187 ALA B CA   1 
ATOM   6385  C  C    . ALA B  1 187 ? -12.937 -28.497 5.396   1.00 22.80  ?  187 ALA B C    1 
ATOM   6386  O  O    . ALA B  1 187 ? -14.110 -28.354 5.019   1.00 22.85  ?  187 ALA B O    1 
ATOM   6387  C  CB   . ALA B  1 187 ? -11.259 -29.537 3.855   1.00 27.90  ?  187 ALA B CB   1 
ATOM   6388  H  H    . ALA B  1 187 ? -9.908  -27.892 4.988   1.00 30.29  ?  187 ALA B H    1 
ATOM   6389  H  HA   . ALA B  1 187 ? -12.122 -27.686 3.707   1.00 33.15  ?  187 ALA B HA   1 
ATOM   6390  H  HB1  . ALA B  1 187 ? -11.998 -30.011 3.442   1.00 33.48  ?  187 ALA B HB1  1 
ATOM   6391  H  HB2  . ALA B  1 187 ? -10.579 -29.342 3.192   1.00 33.48  ?  187 ALA B HB2  1 
ATOM   6392  H  HB3  . ALA B  1 187 ? -10.881 -30.072 4.570   1.00 33.48  ?  187 ALA B HB3  1 
ATOM   6393  N  N    . ASP B  1 188 ? -12.641 -28.960 6.619   1.00 21.59  ?  188 ASP B N    1 
ATOM   6394  C  CA   . ASP B  1 188 ? -13.712 -29.291 7.551   1.00 26.68  ?  188 ASP B CA   1 
ATOM   6395  C  C    . ASP B  1 188 ? -14.536 -28.065 7.905   1.00 23.85  ?  188 ASP B C    1 
ATOM   6396  O  O    . ASP B  1 188 ? -15.767 -28.144 7.994   1.00 24.62  ?  188 ASP B O    1 
ATOM   6397  C  CB   . ASP B  1 188 ? -13.138 -29.923 8.821   1.00 31.03  ?  188 ASP B CB   1 
ATOM   6398  C  CG   . ASP B  1 188 ? -12.721 -31.371 8.614   1.00 46.77  ?  188 ASP B CG   1 
ATOM   6399  O  OD1  . ASP B  1 188 ? -12.882 -31.898 7.486   1.00 37.97  ?  188 ASP B OD1  1 
ATOM   6400  O  OD2  . ASP B  1 188 ? -12.244 -31.973 9.592   1.00 49.64  -1 188 ASP B OD2  1 
ATOM   6401  H  H    . ASP B  1 188 ? -11.846 -29.086 6.922   1.00 25.91  ?  188 ASP B H    1 
ATOM   6402  H  HA   . ASP B  1 188 ? -14.303 -29.938 7.135   1.00 32.02  ?  188 ASP B HA   1 
ATOM   6403  H  HB2  . ASP B  1 188 ? -12.355 -29.422 9.099   1.00 37.24  ?  188 ASP B HB2  1 
ATOM   6404  H  HB3  . ASP B  1 188 ? -13.811 -29.901 9.519   1.00 37.24  ?  188 ASP B HB3  1 
ATOM   6405  N  N    . GLU B  1 189 ? -13.874 -26.926 8.112   1.00 21.03  ?  189 GLU B N    1 
ATOM   6406  C  CA   . GLU B  1 189 ? -14.589 -25.694 8.428   1.00 18.75  ?  189 GLU B CA   1 
ATOM   6407  C  C    . GLU B  1 189 ? -15.396 -25.202 7.232   1.00 18.33  ?  189 GLU B C    1 
ATOM   6408  O  O    . GLU B  1 189 ? -16.514 -24.720 7.396   1.00 18.37  ?  189 GLU B O    1 
ATOM   6409  C  CB   . GLU B  1 189 ? -13.619 -24.618 8.885   1.00 18.56  ?  189 GLU B CB   1 
ATOM   6410  C  CG   . GLU B  1 189 ? -13.027 -24.945 10.239  1.00 21.20  ?  189 GLU B CG   1 
ATOM   6411  C  CD   . GLU B  1 189 ? -11.709 -24.266 10.536  1.00 19.48  ?  189 GLU B CD   1 
ATOM   6412  O  OE1  . GLU B  1 189 ? -11.503 -23.107 10.166  1.00 20.28  ?  189 GLU B OE1  1 
ATOM   6413  O  OE2  . GLU B  1 189 ? -10.838 -24.907 11.186  1.00 21.52  -1 189 GLU B OE2  1 
ATOM   6414  H  H    . GLU B  1 189 ? -13.019 -26.842 8.076   1.00 25.24  ?  189 GLU B H    1 
ATOM   6415  H  HA   . GLU B  1 189 ? -15.207 -25.867 9.155   1.00 22.50  ?  189 GLU B HA   1 
ATOM   6416  H  HB2  . GLU B  1 189 ? -12.894 -24.548 8.245   1.00 22.27  ?  189 GLU B HB2  1 
ATOM   6417  H  HB3  . GLU B  1 189 ? -14.089 -23.772 8.954   1.00 22.27  ?  189 GLU B HB3  1 
ATOM   6418  H  HG2  . GLU B  1 189 ? -13.658 -24.675 10.925  1.00 25.44  ?  189 GLU B HG2  1 
ATOM   6419  H  HG3  . GLU B  1 189 ? -12.881 -25.903 10.289  1.00 25.44  ?  189 GLU B HG3  1 
ATOM   6420  N  N    . VAL B  1 190 ? -14.842 -25.316 6.030   1.00 19.74  ?  190 VAL B N    1 
ATOM   6421  C  CA   . VAL B  1 190 ? -15.591 -24.935 4.833   1.00 18.73  ?  190 VAL B CA   1 
ATOM   6422  C  C    . VAL B  1 190 ? -16.865 -25.753 4.722   1.00 21.07  ?  190 VAL B C    1 
ATOM   6423  O  O    . VAL B  1 190 ? -17.915 -25.237 4.330   1.00 19.74  ?  190 VAL B O    1 
ATOM   6424  C  CB   . VAL B  1 190 ? -14.720 -25.083 3.573   1.00 19.29  ?  190 VAL B CB   1 
ATOM   6425  C  CG1  . VAL B  1 190 ? -15.554 -24.912 2.298   1.00 25.22  ?  190 VAL B CG1  1 
ATOM   6426  C  CG2  . VAL B  1 190 ? -13.550 -24.089 3.592   1.00 21.47  ?  190 VAL B CG2  1 
ATOM   6427  H  H    . VAL B  1 190 ? -14.047 -25.606 5.879   1.00 23.68  ?  190 VAL B H    1 
ATOM   6428  H  HA   . VAL B  1 190 ? -15.844 -24.002 4.908   1.00 22.47  ?  190 VAL B HA   1 
ATOM   6429  H  HB   . VAL B  1 190 ? -14.344 -25.978 3.560   1.00 23.15  ?  190 VAL B HB   1 
ATOM   6430  H  HG11 . VAL B  1 190 ? -14.975 -25.011 1.526   1.00 30.26  ?  190 VAL B HG11 1 
ATOM   6431  H  HG12 . VAL B  1 190 ? -16.247 -25.590 2.281   1.00 30.26  ?  190 VAL B HG12 1 
ATOM   6432  H  HG13 . VAL B  1 190 ? -15.955 -24.028 2.299   1.00 30.26  ?  190 VAL B HG13 1 
ATOM   6433  H  HG21 . VAL B  1 190 ? -13.022 -24.208 2.786   1.00 25.77  ?  190 VAL B HG21 1 
ATOM   6434  H  HG22 . VAL B  1 190 ? -13.903 -23.186 3.625   1.00 25.77  ?  190 VAL B HG22 1 
ATOM   6435  H  HG23 . VAL B  1 190 ? -13.003 -24.260 4.374   1.00 25.77  ?  190 VAL B HG23 1 
ATOM   6436  N  N    . GLU B  1 191 ? -16.794 -27.045 5.052   1.00 22.30  ?  191 GLU B N    1 
ATOM   6437  C  CA   . GLU B  1 191 ? -17.988 -27.877 4.982   1.00 23.35  ?  191 GLU B CA   1 
ATOM   6438  C  C    . GLU B  1 191 ? -19.072 -27.389 5.939   1.00 21.85  ?  191 GLU B C    1 
ATOM   6439  O  O    . GLU B  1 191 ? -20.260 -27.387 5.595   1.00 20.21  ?  191 GLU B O    1 
ATOM   6440  C  CB   . GLU B  1 191 ? -17.630 -29.339 5.257   1.00 26.55  ?  191 GLU B CB   1 
ATOM   6441  C  CG   . GLU B  1 191 ? -18.816 -30.273 5.018   1.00 32.45  ?  191 GLU B CG   1 
ATOM   6442  C  CD   . GLU B  1 191 ? -18.521 -31.706 5.444   1.00 42.90  ?  191 GLU B CD   1 
ATOM   6443  O  OE1  . GLU B  1 191 ? -17.741 -31.913 6.405   1.00 45.52  ?  191 GLU B OE1  1 
ATOM   6444  O  OE2  . GLU B  1 191 ? -19.086 -32.620 4.819   1.00 41.07  -1 191 GLU B OE2  1 
ATOM   6445  H  H    . GLU B  1 191 ? -16.082 -27.452 5.312   1.00 26.77  ?  191 GLU B H    1 
ATOM   6446  H  HA   . GLU B  1 191 ? -18.348 -27.828 4.082   1.00 28.02  ?  191 GLU B HA   1 
ATOM   6447  H  HB2  . GLU B  1 191 ? -16.910 -29.607 4.666   1.00 31.86  ?  191 GLU B HB2  1 
ATOM   6448  H  HB3  . GLU B  1 191 ? -17.355 -29.430 6.183   1.00 31.86  ?  191 GLU B HB3  1 
ATOM   6449  H  HG2  . GLU B  1 191 ? -19.577 -29.957 5.530   1.00 38.95  ?  191 GLU B HG2  1 
ATOM   6450  H  HG3  . GLU B  1 191 ? -19.029 -30.278 4.072   1.00 38.95  ?  191 GLU B HG3  1 
ATOM   6451  N  N    . VAL B  1 192 ? -18.694 -26.923 7.130   1.00 19.11  ?  192 VAL B N    1 
ATOM   6452  C  CA   . VAL B  1 192 ? -19.691 -26.409 8.057   1.00 19.21  ?  192 VAL B CA   1 
ATOM   6453  C  C    . VAL B  1 192 ? -20.338 -25.134 7.513   1.00 17.37  ?  192 VAL B C    1 
ATOM   6454  O  O    . VAL B  1 192 ? -21.559 -24.941 7.607   1.00 17.94  ?  192 VAL B O    1 
ATOM   6455  C  CB   . VAL B  1 192 ? -19.071 -26.154 9.445   1.00 22.70  ?  192 VAL B CB   1 
ATOM   6456  C  CG1  . VAL B  1 192 ? -20.085 -25.546 10.394  1.00 21.15  ?  192 VAL B CG1  1 
ATOM   6457  C  CG2  . VAL B  1 192 ? -18.502 -27.453 10.034  1.00 22.72  ?  192 VAL B CG2  1 
ATOM   6458  H  H    . VAL B  1 192 ? -17.884 -26.894 7.417   1.00 22.93  ?  192 VAL B H    1 
ATOM   6459  H  HA   . VAL B  1 192 ? -20.390 -27.074 8.163   1.00 23.05  ?  192 VAL B HA   1 
ATOM   6460  H  HB   . VAL B  1 192 ? -18.339 -25.525 9.349   1.00 27.24  ?  192 VAL B HB   1 
ATOM   6461  H  HG11 . VAL B  1 192 ? -19.662 -25.399 11.255  1.00 25.38  ?  192 VAL B HG11 1 
ATOM   6462  H  HG12 . VAL B  1 192 ? -20.394 -24.702 10.028  1.00 25.38  ?  192 VAL B HG12 1 
ATOM   6463  H  HG13 . VAL B  1 192 ? -20.832 -26.158 10.492  1.00 25.38  ?  192 VAL B HG13 1 
ATOM   6464  H  HG21 . VAL B  1 192 ? -18.119 -27.263 10.904  1.00 27.26  ?  192 VAL B HG21 1 
ATOM   6465  H  HG22 . VAL B  1 192 ? -19.220 -28.100 10.121  1.00 27.26  ?  192 VAL B HG22 1 
ATOM   6466  H  HG23 . VAL B  1 192 ? -17.818 -27.796 9.438   1.00 27.26  ?  192 VAL B HG23 1 
ATOM   6467  N  N    . ILE B  1 193 ? -19.526 -24.232 6.955   1.00 16.95  ?  193 ILE B N    1 
ATOM   6468  C  CA   . ILE B  1 193 ? -20.035 -22.992 6.394   1.00 17.47  ?  193 ILE B CA   1 
ATOM   6469  C  C    . ILE B  1 193 ? -20.974 -23.310 5.235   1.00 17.04  ?  193 ILE B C    1 
ATOM   6470  O  O    . ILE B  1 193 ? -22.064 -22.766 5.146   1.00 17.66  ?  193 ILE B O    1 
ATOM   6471  C  CB   . ILE B  1 193 ? -18.880 -22.078 5.937   1.00 18.35  ?  193 ILE B CB   1 
ATOM   6472  C  CG1  . ILE B  1 193 ? -18.006 -21.675 7.136   1.00 17.10  ?  193 ILE B CG1  1 
ATOM   6473  C  CG2  . ILE B  1 193 ? -19.399 -20.844 5.135   1.00 18.80  ?  193 ILE B CG2  1 
ATOM   6474  C  CD1  . ILE B  1 193 ? -16.715 -20.930 6.739   1.00 21.14  ?  193 ILE B CD1  1 
ATOM   6475  H  H    . ILE B  1 193 ? -18.673 -24.321 6.893   1.00 20.33  ?  193 ILE B H    1 
ATOM   6476  H  HA   . ILE B  1 193 ? -20.543 -22.521 7.073   1.00 20.96  ?  193 ILE B HA   1 
ATOM   6477  H  HB   . ILE B  1 193 ? -18.323 -22.597 5.337   1.00 22.02  ?  193 ILE B HB   1 
ATOM   6478  H  HG12 . ILE B  1 193 ? -18.520 -21.091 7.716   1.00 20.52  ?  193 ILE B HG12 1 
ATOM   6479  H  HG13 . ILE B  1 193 ? -17.750 -22.476 7.619   1.00 20.52  ?  193 ILE B HG13 1 
ATOM   6480  H  HG21 . ILE B  1 193 ? -18.642 -20.299 4.869   1.00 22.56  ?  193 ILE B HG21 1 
ATOM   6481  H  HG22 . ILE B  1 193 ? -19.875 -21.156 4.349   1.00 22.56  ?  193 ILE B HG22 1 
ATOM   6482  H  HG23 . ILE B  1 193 ? -19.996 -20.328 5.699   1.00 22.56  ?  193 ILE B HG23 1 
ATOM   6483  H  HD11 . ILE B  1 193 ? -16.218 -20.710 7.543   1.00 25.37  ?  193 ILE B HD11 1 
ATOM   6484  H  HD12 . ILE B  1 193 ? -16.182 -21.505 6.167   1.00 25.37  ?  193 ILE B HD12 1 
ATOM   6485  H  HD13 . ILE B  1 193 ? -16.953 -20.118 6.264   1.00 25.37  ?  193 ILE B HD13 1 
ATOM   6486  N  N    . ARG B  1 194 ? -20.555 -24.212 4.354   1.00 18.39  ?  194 ARG B N    1 
ATOM   6487  C  CA   A ARG B  1 194 ? -21.414 -24.648 3.253   0.50 20.59  ?  194 ARG B CA   1 
ATOM   6488  C  CA   B ARG B  1 194 ? -21.422 -24.632 3.254   0.50 20.45  ?  194 ARG B CA   1 
ATOM   6489  C  C    . ARG B  1 194 ? -22.746 -25.171 3.775   1.00 19.63  ?  194 ARG B C    1 
ATOM   6490  O  O    . ARG B  1 194 ? -23.826 -24.784 3.300   1.00 19.65  ?  194 ARG B O    1 
ATOM   6491  C  CB   A ARG B  1 194 ? -20.692 -25.735 2.449   0.50 20.34  ?  194 ARG B CB   1 
ATOM   6492  C  CB   B ARG B  1 194 ? -20.728 -25.700 2.415   0.50 20.43  ?  194 ARG B CB   1 
ATOM   6493  C  CG   A ARG B  1 194 ? -21.482 -26.308 1.256   0.50 21.09  ?  194 ARG B CG   1 
ATOM   6494  C  CG   B ARG B  1 194 ? -21.555 -26.154 1.202   0.50 20.52  ?  194 ARG B CG   1 
ATOM   6495  C  CD   A ARG B  1 194 ? -20.743 -27.467 0.562   0.50 27.37  ?  194 ARG B CD   1 
ATOM   6496  C  CD   B ARG B  1 194 ? -21.143 -27.527 0.716   0.50 27.44  ?  194 ARG B CD   1 
ATOM   6497  N  NE   A ARG B  1 194 ? -19.493 -27.056 -0.079  0.50 33.41  ?  194 ARG B NE   1 
ATOM   6498  N  NE   B ARG B  1 194 ? -21.451 -28.572 1.692   0.50 24.33  ?  194 ARG B NE   1 
ATOM   6499  C  CZ   A ARG B  1 194 ? -18.264 -27.386 0.334   0.50 36.09  ?  194 ARG B CZ   1 
ATOM   6500  C  CZ   B ARG B  1 194 ? -21.310 -29.870 1.455   0.50 28.83  ?  194 ARG B CZ   1 
ATOM   6501  N  NH1  A ARG B  1 194 ? -18.066 -28.162 1.400   0.50 27.78  1  194 ARG B NH1  1 
ATOM   6502  N  NH1  B ARG B  1 194 ? -20.858 -30.275 0.277   0.50 27.18  1  194 ARG B NH1  1 
ATOM   6503  N  NH2  A ARG B  1 194 ? -17.212 -26.942 -0.341  0.50 31.32  ?  194 ARG B NH2  1 
ATOM   6504  N  NH2  B ARG B  1 194 ? -21.616 -30.761 2.388   0.50 29.69  ?  194 ARG B NH2  1 
ATOM   6505  H  H    A ARG B  1 194 ? -19.781 -24.588 4.370   0.50 22.06  ?  194 ARG B H    1 
ATOM   6506  H  H    B ARG B  1 194 ? -19.784 -24.594 4.368   0.50 22.06  ?  194 ARG B H    1 
ATOM   6507  H  HA   A ARG B  1 194 ? -21.589 -23.897 2.664   0.50 24.71  ?  194 ARG B HA   1 
ATOM   6508  H  HA   B ARG B  1 194 ? -21.607 -23.869 2.684   0.50 24.54  ?  194 ARG B HA   1 
ATOM   6509  H  HB2  A ARG B  1 194 ? -19.867 -25.362 2.100   0.50 24.41  ?  194 ARG B HB2  1 
ATOM   6510  H  HB2  B ARG B  1 194 ? -19.887 -25.345 2.086   0.50 24.52  ?  194 ARG B HB2  1 
ATOM   6511  H  HB3  A ARG B  1 194 ? -20.488 -26.473 3.045   0.50 24.41  ?  194 ARG B HB3  1 
ATOM   6512  H  HB3  B ARG B  1 194 ? -20.563 -26.478 2.970   0.50 24.52  ?  194 ARG B HB3  1 
ATOM   6513  H  HG2  A ARG B  1 194 ? -22.336 -26.642 1.573   0.50 25.31  ?  194 ARG B HG2  1 
ATOM   6514  H  HG2  B ARG B  1 194 ? -22.492 -26.190 1.451   0.50 24.62  ?  194 ARG B HG2  1 
ATOM   6515  H  HG3  A ARG B  1 194 ? -21.622 -25.605 0.602   0.50 25.31  ?  194 ARG B HG3  1 
ATOM   6516  H  HG3  B ARG B  1 194 ? -21.427 -25.524 0.475   0.50 24.62  ?  194 ARG B HG3  1 
ATOM   6517  H  HD2  A ARG B  1 194 ? -20.530 -28.144 1.223   0.50 32.84  ?  194 ARG B HD2  1 
ATOM   6518  H  HD2  B ARG B  1 194 ? -21.618 -27.730 -0.105  0.50 32.93  ?  194 ARG B HD2  1 
ATOM   6519  H  HD3  A ARG B  1 194 ? -21.319 -27.842 -0.122  0.50 32.84  ?  194 ARG B HD3  1 
ATOM   6520  H  HD3  B ARG B  1 194 ? -20.186 -27.534 0.558   0.50 32.93  ?  194 ARG B HD3  1 
ATOM   6521  H  HE   A ARG B  1 194 ? -19.554 -26.560 -0.779  0.50 40.09  ?  194 ARG B HE   1 
ATOM   6522  H  HE   B ARG B  1 194 ? -21.823 -28.336 2.431   0.50 29.20  ?  194 ARG B HE   1 
ATOM   6523  H  HH11 A ARG B  1 194 ? -18.738 -28.458 1.847   0.50 33.33  ?  194 ARG B HH11 1 
ATOM   6524  H  HH11 B ARG B  1 194 ? -20.660 -29.698 -0.330  0.50 32.62  ?  194 ARG B HH11 1 
ATOM   6525  H  HH12 A ARG B  1 194 ? -17.265 -28.362 1.643   0.50 33.33  ?  194 ARG B HH12 1 
ATOM   6526  H  HH12 B ARG B  1 194 ? -20.763 -31.115 0.118   0.50 32.62  ?  194 ARG B HH12 1 
ATOM   6527  H  HH21 A ARG B  1 194 ? -17.324 -26.442 -1.032  0.50 37.58  ?  194 ARG B HH21 1 
ATOM   6528  H  HH21 B ARG B  1 194 ? -21.908 -30.499 3.153   0.50 35.63  ?  194 ARG B HH21 1 
ATOM   6529  H  HH22 A ARG B  1 194 ? -16.418 -27.151 -0.086  0.50 37.58  ?  194 ARG B HH22 1 
ATOM   6530  H  HH22 B ARG B  1 194 ? -21.519 -31.601 2.229   0.50 35.63  ?  194 ARG B HH22 1 
ATOM   6531  N  N    . ASP B  1 195 ? -22.688 -26.080 4.743   1.00 21.01  ?  195 ASP B N    1 
ATOM   6532  C  CA   . ASP B  1 195 ? -23.906 -26.668 5.290   1.00 20.96  ?  195 ASP B CA   1 
ATOM   6533  C  C    . ASP B  1 195 ? -24.784 -25.628 5.976   1.00 20.79  ?  195 ASP B C    1 
ATOM   6534  O  O    . ASP B  1 195 ? -26.010 -25.718 5.922   1.00 18.86  ?  195 ASP B O    1 
ATOM   6535  C  CB   . ASP B  1 195 ? -23.539 -27.780 6.260   1.00 20.72  ?  195 ASP B CB   1 
ATOM   6536  C  CG   . ASP B  1 195 ? -23.028 -29.043 5.546   1.00 28.95  ?  195 ASP B CG   1 
ATOM   6537  O  OD1  . ASP B  1 195 ? -23.140 -29.145 4.292   1.00 29.00  ?  195 ASP B OD1  1 
ATOM   6538  O  OD2  . ASP B  1 195 ? -22.487 -29.925 6.249   1.00 30.92  -1 195 ASP B OD2  1 
ATOM   6539  H  H    . ASP B  1 195 ? -21.962 -26.373 5.098   1.00 25.21  ?  195 ASP B H    1 
ATOM   6540  H  HA   . ASP B  1 195 ? -24.419 -27.060 4.566   1.00 25.15  ?  195 ASP B HA   1 
ATOM   6541  H  HB2  . ASP B  1 195 ? -22.839 -27.465 6.852   1.00 24.87  ?  195 ASP B HB2  1 
ATOM   6542  H  HB3  . ASP B  1 195 ? -24.325 -28.023 6.775   1.00 24.87  ?  195 ASP B HB3  1 
ATOM   6543  N  N    . ASN B  1 196 ? -24.189 -24.631 6.647   1.00 17.79  ?  196 ASN B N    1 
ATOM   6544  C  CA   . ASN B  1 196 ? -25.014 -23.579 7.235   1.00 18.67  ?  196 ASN B CA   1 
ATOM   6545  C  C    . ASN B  1 196 ? -25.822 -22.860 6.153   1.00 20.53  ?  196 ASN B C    1 
ATOM   6546  O  O    . ASN B  1 196 ? -27.014 -22.568 6.333   1.00 19.70  ?  196 ASN B O    1 
ATOM   6547  C  CB   . ASN B  1 196 ? -24.161 -22.556 7.998   1.00 16.83  ?  196 ASN B CB   1 
ATOM   6548  C  CG   . ASN B  1 196 ? -23.602 -23.095 9.307   1.00 18.64  ?  196 ASN B CG   1 
ATOM   6549  O  OD1  . ASN B  1 196 ? -24.013 -24.158 9.812   1.00 20.56  ?  196 ASN B OD1  1 
ATOM   6550  N  ND2  . ASN B  1 196 ? -22.673 -22.333 9.887   1.00 19.15  ?  196 ASN B ND2  1 
ATOM   6551  H  H    . ASN B  1 196 ? -23.342 -24.547 6.770   1.00 21.35  ?  196 ASN B H    1 
ATOM   6552  H  HA   . ASN B  1 196 ? -25.637 -23.979 7.862   1.00 22.40  ?  196 ASN B HA   1 
ATOM   6553  H  HB2  . ASN B  1 196 ? -23.412 -22.292 7.440   1.00 20.20  ?  196 ASN B HB2  1 
ATOM   6554  H  HB3  . ASN B  1 196 ? -24.708 -21.782 8.204   1.00 20.20  ?  196 ASN B HB3  1 
ATOM   6555  H  HD21 . ASN B  1 196 ? -22.316 -22.581 10.629  1.00 22.98  ?  196 ASN B HD21 1 
ATOM   6556  H  HD22 . ASN B  1 196 ? -22.430 -21.595 9.518   1.00 22.98  ?  196 ASN B HD22 1 
ATOM   6557  N  N    . PHE B  1 197 ? -25.175 -22.530 5.026   1.00 18.84  ?  197 PHE B N    1 
ATOM   6558  C  CA   . PHE B  1 197 ? -25.881 -21.891 3.931   1.00 17.14  ?  197 PHE B CA   1 
ATOM   6559  C  C    . PHE B  1 197 ? -26.925 -22.815 3.347   1.00 20.49  ?  197 PHE B C    1 
ATOM   6560  O  O    . PHE B  1 197 ? -28.055 -22.387 3.103   1.00 19.53  ?  197 PHE B O    1 
ATOM   6561  C  CB   . PHE B  1 197 ? -24.900 -21.429 2.847   1.00 17.97  ?  197 PHE B CB   1 
ATOM   6562  C  CG   . PHE B  1 197 ? -25.582 -20.921 1.599   1.00 16.75  ?  197 PHE B CG   1 
ATOM   6563  C  CD1  . PHE B  1 197 ? -26.604 -19.970 1.683   1.00 18.36  ?  197 PHE B CD1  1 
ATOM   6564  C  CD2  . PHE B  1 197 ? -25.216 -21.416 0.356   1.00 20.41  ?  197 PHE B CD2  1 
ATOM   6565  C  CE1  . PHE B  1 197 ? -27.267 -19.536 0.539   1.00 19.65  ?  197 PHE B CE1  1 
ATOM   6566  C  CE2  . PHE B  1 197 ? -25.881 -20.965 -0.793  1.00 19.27  ?  197 PHE B CE2  1 
ATOM   6567  C  CZ   . PHE B  1 197 ? -26.893 -20.051 -0.691  1.00 18.19  ?  197 PHE B CZ   1 
ATOM   6568  H  H    . PHE B  1 197 ? -24.338 -22.667 4.881   1.00 22.61  ?  197 PHE B H    1 
ATOM   6569  H  HA   . PHE B  1 197 ? -26.337 -21.105 4.271   1.00 20.56  ?  197 PHE B HA   1 
ATOM   6570  H  HB2  . PHE B  1 197 ? -24.355 -20.710 3.203   1.00 21.56  ?  197 PHE B HB2  1 
ATOM   6571  H  HB3  . PHE B  1 197 ? -24.336 -22.177 2.595   1.00 21.56  ?  197 PHE B HB3  1 
ATOM   6572  H  HD1  . PHE B  1 197 ? -26.863 -19.646 2.516   1.00 22.03  ?  197 PHE B HD1  1 
ATOM   6573  H  HD2  . PHE B  1 197 ? -24.543 -22.054 0.287   1.00 24.50  ?  197 PHE B HD2  1 
ATOM   6574  H  HE1  . PHE B  1 197 ? -27.946 -18.903 0.598   1.00 23.57  ?  197 PHE B HE1  1 
ATOM   6575  H  HE2  . PHE B  1 197 ? -25.639 -21.296 -1.627  1.00 23.13  ?  197 PHE B HE2  1 
ATOM   6576  H  HZ   . PHE B  1 197 ? -27.314 -19.747 -1.462  1.00 21.83  ?  197 PHE B HZ   1 
ATOM   6577  N  N    . LEU B  1 198 ? -26.575 -24.085 3.150   1.00 18.03  ?  198 LEU B N    1 
ATOM   6578  C  CA   . LEU B  1 198 ? -27.538 -25.030 2.579   1.00 20.91  ?  198 LEU B CA   1 
ATOM   6579  C  C    . LEU B  1 198 ? -28.745 -25.241 3.487   1.00 23.53  ?  198 LEU B C    1 
ATOM   6580  O  O    . LEU B  1 198 ? -29.850 -25.504 2.989   1.00 23.56  ?  198 LEU B O    1 
ATOM   6581  C  CB   . LEU B  1 198 ? -26.859 -26.359 2.264   1.00 20.68  ?  198 LEU B CB   1 
ATOM   6582  C  CG   . LEU B  1 198 ? -25.753 -26.314 1.203   1.00 23.01  ?  198 LEU B CG   1 
ATOM   6583  C  CD1  . LEU B  1 198 ? -25.106 -27.696 1.035   1.00 31.46  ?  198 LEU B CD1  1 
ATOM   6584  C  CD2  . LEU B  1 198 ? -26.281 -25.786 -0.133  1.00 35.43  ?  198 LEU B CD2  1 
ATOM   6585  H  H    . LEU B  1 198 ? -25.804 -24.420 3.332   1.00 21.64  ?  198 LEU B H    1 
ATOM   6586  H  HA   . LEU B  1 198 ? -27.865 -24.665 1.742   1.00 25.10  ?  198 LEU B HA   1 
ATOM   6587  H  HB2  . LEU B  1 198 ? -26.462 -26.700 3.081   1.00 24.82  ?  198 LEU B HB2  1 
ATOM   6588  H  HB3  . LEU B  1 198 ? -27.534 -26.980 1.950   1.00 24.82  ?  198 LEU B HB3  1 
ATOM   6589  H  HG   . LEU B  1 198 ? -25.062 -25.704 1.505   1.00 27.61  ?  198 LEU B HG   1 
ATOM   6590  H  HD11 . LEU B  1 198 ? -24.412 -27.639 0.360   1.00 37.75  ?  198 LEU B HD11 1 
ATOM   6591  H  HD12 . LEU B  1 198 ? -24.723 -27.970 1.883   1.00 37.75  ?  198 LEU B HD12 1 
ATOM   6592  H  HD13 . LEU B  1 198 ? -25.786 -28.330 0.759   1.00 37.75  ?  198 LEU B HD13 1 
ATOM   6593  H  HD21 . LEU B  1 198 ? -25.555 -25.773 -0.776  1.00 42.52  ?  198 LEU B HD21 1 
ATOM   6594  H  HD22 . LEU B  1 198 ? -26.989 -26.372 -0.445  1.00 42.52  ?  198 LEU B HD22 1 
ATOM   6595  H  HD23 . LEU B  1 198 ? -26.626 -24.889 -0.003  1.00 42.52  ?  198 LEU B HD23 1 
ATOM   6596  N  N    . ASN B  1 199 ? -28.584 -25.103 4.808   1.00 21.72  ?  199 ASN B N    1 
ATOM   6597  C  CA   A ASN B  1 199 ? -29.745 -25.220 5.688   0.52 21.81  ?  199 ASN B CA   1 
ATOM   6598  C  CA   B ASN B  1 199 ? -29.734 -25.211 5.701   0.48 21.73  ?  199 ASN B CA   1 
ATOM   6599  C  C    . ASN B  1 199 ? -30.772 -24.135 5.403   1.00 24.66  ?  199 ASN B C    1 
ATOM   6600  O  O    . ASN B  1 199 ? -31.979 -24.364 5.564   1.00 28.06  ?  199 ASN B O    1 
ATOM   6601  C  CB   A ASN B  1 199 ? -29.310 -25.166 7.150   0.52 22.96  ?  199 ASN B CB   1 
ATOM   6602  C  CB   B ASN B  1 199 ? -29.261 -25.124 7.153   0.48 22.98  ?  199 ASN B CB   1 
ATOM   6603  C  CG   A ASN B  1 199 ? -28.633 -26.441 7.598   0.52 22.09  ?  199 ASN B CG   1 
ATOM   6604  C  CG   B ASN B  1 199 ? -30.383 -25.303 8.143   0.48 28.41  ?  199 ASN B CG   1 
ATOM   6605  O  OD1  A ASN B  1 199 ? -28.828 -27.511 7.006   0.52 29.77  ?  199 ASN B OD1  1 
ATOM   6606  O  OD1  B ASN B  1 199 ? -30.944 -26.393 8.269   0.48 34.02  ?  199 ASN B OD1  1 
ATOM   6607  N  ND2  A ASN B  1 199 ? -27.818 -26.338 8.643   0.52 25.74  ?  199 ASN B ND2  1 
ATOM   6608  N  ND2  B ASN B  1 199 ? -30.704 -24.245 8.869   0.48 27.63  ?  199 ASN B ND2  1 
ATOM   6609  H  H    A ASN B  1 199 ? -27.838 -24.946 5.206   0.52 26.06  ?  199 ASN B H    1 
ATOM   6610  H  H    B ASN B  1 199 ? -27.835 -24.950 5.201   0.48 26.06  ?  199 ASN B H    1 
ATOM   6611  H  HA   A ASN B  1 199 ? -30.169 -26.079 5.534   0.52 26.17  ?  199 ASN B HA   1 
ATOM   6612  H  HA   B ASN B  1 199 ? -30.154 -26.076 5.574   0.48 26.08  ?  199 ASN B HA   1 
ATOM   6613  H  HB2  A ASN B  1 199 ? -28.684 -24.435 7.268   0.52 27.55  ?  199 ASN B HB2  1 
ATOM   6614  H  HB2  B ASN B  1 199 ? -28.605 -25.821 7.313   0.48 27.57  ?  199 ASN B HB2  1 
ATOM   6615  H  HB3  A ASN B  1 199 ? -30.092 -25.029 7.707   0.52 27.55  ?  199 ASN B HB3  1 
ATOM   6616  H  HB3  B ASN B  1 199 ? -28.863 -24.253 7.304   0.48 27.57  ?  199 ASN B HB3  1 
ATOM   6617  H  HD21 A ASN B  1 199 ? -27.408 -27.033 8.938   0.52 30.88  ?  199 ASN B HD21 1 
ATOM   6618  H  HD21 B ASN B  1 199 ? -31.338 -24.297 9.448   0.48 33.15  ?  199 ASN B HD21 1 
ATOM   6619  H  HD22 A ASN B  1 199 ? -27.702 -25.575 9.024   0.52 30.88  ?  199 ASN B HD22 1 
ATOM   6620  H  HD22 B ASN B  1 199 ? -30.279 -23.505 8.763   0.48 33.15  ?  199 ASN B HD22 1 
ATOM   6621  N  N    . ARG B  1 200 ? -30.335 -22.968 4.956   1.00 19.58  ?  200 ARG B N    1 
ATOM   6622  C  CA   . ARG B  1 200 ? -31.268 -21.945 4.538   1.00 19.48  ?  200 ARG B CA   1 
ATOM   6623  C  C    . ARG B  1 200 ? -31.794 -22.228 3.132   1.00 24.19  ?  200 ARG B C    1 
ATOM   6624  O  O    . ARG B  1 200 ? -33.000 -22.101 2.874   1.00 24.07  ?  200 ARG B O    1 
ATOM   6625  C  CB   . ARG B  1 200 ? -30.613 -20.555 4.583   1.00 21.58  ?  200 ARG B CB   1 
ATOM   6626  C  CG   . ARG B  1 200 ? -30.227 -20.046 5.978   1.00 22.30  ?  200 ARG B CG   1 
ATOM   6627  C  CD   . ARG B  1 200 ? -31.419 -19.726 6.873   1.00 23.87  ?  200 ARG B CD   1 
ATOM   6628  N  NE   . ARG B  1 200 ? -32.440 -18.871 6.250   1.00 25.68  ?  200 ARG B NE   1 
ATOM   6629  C  CZ   . ARG B  1 200 ? -32.481 -17.542 6.283   1.00 30.30  ?  200 ARG B CZ   1 
ATOM   6630  N  NH1  . ARG B  1 200 ? -31.551 -16.840 6.917   1.00 32.10  1  200 ARG B NH1  1 
ATOM   6631  N  NH2  . ARG B  1 200 ? -33.482 -16.906 5.671   1.00 28.75  ?  200 ARG B NH2  1 
ATOM   6632  H  H    . ARG B  1 200 ? -29.507 -22.747 4.885   1.00 23.49  ?  200 ARG B H    1 
ATOM   6633  H  HA   . ARG B  1 200 ? -32.024 -21.940 5.146   1.00 23.37  ?  200 ARG B HA   1 
ATOM   6634  H  HB2  . ARG B  1 200 ? -29.803 -20.581 4.050   1.00 25.90  ?  200 ARG B HB2  1 
ATOM   6635  H  HB3  . ARG B  1 200 ? -31.231 -19.913 4.201   1.00 25.90  ?  200 ARG B HB3  1 
ATOM   6636  H  HG2  . ARG B  1 200 ? -29.697 -20.725 6.423   1.00 26.76  ?  200 ARG B HG2  1 
ATOM   6637  H  HG3  . ARG B  1 200 ? -29.705 -19.234 5.881   1.00 26.76  ?  200 ARG B HG3  1 
ATOM   6638  H  HD2  . ARG B  1 200 ? -31.847 -20.558 7.127   1.00 28.64  ?  200 ARG B HD2  1 
ATOM   6639  H  HD3  . ARG B  1 200 ? -31.097 -19.269 7.666   1.00 28.64  ?  200 ARG B HD3  1 
ATOM   6640  H  HE   . ARG B  1 200 ? -33.072 -19.269 5.824   1.00 30.81  ?  200 ARG B HE   1 
ATOM   6641  H  HH11 . ARG B  1 200 ? -30.904 -17.243 7.315   1.00 38.51  ?  200 ARG B HH11 1 
ATOM   6642  H  HH12 . ARG B  1 200 ? -31.594 -15.981 6.928   1.00 38.51  ?  200 ARG B HH12 1 
ATOM   6643  H  HH21 . ARG B  1 200 ? -34.088 -17.355 5.258   1.00 34.51  ?  200 ARG B HH21 1 
ATOM   6644  H  HH22 . ARG B  1 200 ? -33.518 -16.047 5.685   1.00 34.51  ?  200 ARG B HH22 1 
ATOM   6645  N  N    . LEU B  1 201 ? -30.912 -22.610 2.216   1.00 21.04  ?  201 LEU B N    1 
ATOM   6646  C  CA   . LEU B  1 201 ? -31.284 -22.708 0.811   1.00 20.95  ?  201 LEU B CA   1 
ATOM   6647  C  C    . LEU B  1 201 ? -32.186 -23.914 0.557   1.00 25.18  ?  201 LEU B C    1 
ATOM   6648  O  O    . LEU B  1 201 ? -33.074 -23.840 -0.300  1.00 24.55  ?  201 LEU B O    1 
ATOM   6649  C  CB   . LEU B  1 201 ? -30.022 -22.771 -0.065  1.00 20.83  ?  201 LEU B CB   1 
ATOM   6650  C  CG   . LEU B  1 201 ? -30.154 -22.598 -1.578  1.00 22.42  ?  201 LEU B CG   1 
ATOM   6651  C  CD1  . LEU B  1 201 ? -30.640 -21.169 -1.931  1.00 22.29  ?  201 LEU B CD1  1 
ATOM   6652  C  CD2  . LEU B  1 201 ? -28.843 -22.933 -2.253  1.00 23.39  ?  201 LEU B CD2  1 
ATOM   6653  H  H    . LEU B  1 201 ? -30.094 -22.818 2.382   1.00 25.25  ?  201 LEU B H    1 
ATOM   6654  H  HA   . LEU B  1 201 ? -31.778 -21.911 0.562   1.00 25.15  ?  201 LEU B HA   1 
ATOM   6655  H  HB2  . LEU B  1 201 ? -29.418 -22.077 0.242   1.00 25.00  ?  201 LEU B HB2  1 
ATOM   6656  H  HB3  . LEU B  1 201 ? -29.607 -23.635 0.081   1.00 25.00  ?  201 LEU B HB3  1 
ATOM   6657  H  HG   . LEU B  1 201 ? -30.820 -23.224 -1.904  1.00 26.90  ?  201 LEU B HG   1 
ATOM   6658  H  HD11 . LEU B  1 201 ? -30.714 -21.090 -2.895  1.00 26.75  ?  201 LEU B HD11 1 
ATOM   6659  H  HD12 . LEU B  1 201 ? -31.506 -21.020 -1.519  1.00 26.75  ?  201 LEU B HD12 1 
ATOM   6660  H  HD13 . LEU B  1 201 ? -29.998 -20.525 -1.594  1.00 26.75  ?  201 LEU B HD13 1 
ATOM   6661  H  HD21 . LEU B  1 201 ? -28.943 -22.818 -3.211  1.00 28.07  ?  201 LEU B HD21 1 
ATOM   6662  H  HD22 . LEU B  1 201 ? -28.155 -22.336 -1.918  1.00 28.07  ?  201 LEU B HD22 1 
ATOM   6663  H  HD23 . LEU B  1 201 ? -28.610 -23.852 -2.051  1.00 28.07  ?  201 LEU B HD23 1 
ATOM   6664  N  N    . ASP B  1 202 ? -32.004 -25.000 1.321   1.00 25.88  ?  202 ASP B N    1 
ATOM   6665  C  CA   . ASP B  1 202 ? -32.868 -26.177 1.207   1.00 24.27  ?  202 ASP B CA   1 
ATOM   6666  C  C    . ASP B  1 202 ? -34.339 -25.817 1.324   1.00 28.80  ?  202 ASP B C    1 
ATOM   6667  O  O    . ASP B  1 202 ? -35.183 -26.497 0.727   1.00 31.05  ?  202 ASP B O    1 
ATOM   6668  C  CB   . ASP B  1 202 ? -32.541 -27.206 2.301   1.00 23.86  ?  202 ASP B CB   1 
ATOM   6669  C  CG   . ASP B  1 202 ? -31.352 -28.104 1.957   1.00 30.09  ?  202 ASP B CG   1 
ATOM   6670  O  OD1  . ASP B  1 202 ? -31.042 -28.310 0.758   1.00 33.56  ?  202 ASP B OD1  1 
ATOM   6671  O  OD2  . ASP B  1 202 ? -30.712 -28.642 2.898   1.00 34.15  -1 202 ASP B OD2  1 
ATOM   6672  H  H    . ASP B  1 202 ? -31.385 -25.077 1.914   1.00 31.05  ?  202 ASP B H    1 
ATOM   6673  H  HA   . ASP B  1 202 ? -32.725 -26.596 0.344   1.00 29.13  ?  202 ASP B HA   1 
ATOM   6674  H  HB2  . ASP B  1 202 ? -32.329 -26.734 3.122   1.00 28.64  ?  202 ASP B HB2  1 
ATOM   6675  H  HB3  . ASP B  1 202 ? -33.314 -27.775 2.438   1.00 28.64  ?  202 ASP B HB3  1 
ATOM   6676  N  N    . GLN B  1 203 ? -34.668 -24.806 2.135   1.00 27.75  ?  203 GLN B N    1 
ATOM   6677  C  CA   . GLN B  1 203 ? -36.052 -24.425 2.405   1.00 27.05  ?  203 GLN B CA   1 
ATOM   6678  C  C    . GLN B  1 203 ? -36.655 -23.533 1.331   1.00 37.13  ?  203 GLN B C    1 
ATOM   6679  O  O    . GLN B  1 203 ? -37.873 -23.293 1.359   1.00 35.80  ?  203 GLN B O    1 
ATOM   6680  C  CB   . GLN B  1 203 ? -36.148 -23.726 3.754   1.00 32.87  ?  203 GLN B CB   1 
ATOM   6681  C  CG   . GLN B  1 203 ? -35.650 -24.606 4.889   1.00 29.99  ?  203 GLN B CG   1 
ATOM   6682  C  CD   . GLN B  1 203 ? -36.492 -25.865 5.039   1.00 34.61  ?  203 GLN B CD   1 
ATOM   6683  O  OE1  . GLN B  1 203 ? -37.698 -25.873 4.747   1.00 38.63  ?  203 GLN B OE1  1 
ATOM   6684  N  NE2  . GLN B  1 203 ? -35.857 -26.940 5.480   1.00 41.25  ?  203 GLN B NE2  1 
ATOM   6685  H  H    . GLN B  1 203 ? -34.092 -24.318 2.548   1.00 33.30  ?  203 GLN B H    1 
ATOM   6686  H  HA   . GLN B  1 203 ? -36.590 -25.231 2.453   1.00 32.46  ?  203 GLN B HA   1 
ATOM   6687  H  HB2  . GLN B  1 203 ? -35.607 -22.922 3.735   1.00 39.44  ?  203 GLN B HB2  1 
ATOM   6688  H  HB3  . GLN B  1 203 ? -37.075 -23.502 3.931   1.00 39.44  ?  203 GLN B HB3  1 
ATOM   6689  H  HG2  . GLN B  1 203 ? -34.735 -24.873 4.708   1.00 35.99  ?  203 GLN B HG2  1 
ATOM   6690  H  HG3  . GLN B  1 203 ? -35.695 -24.110 5.722   1.00 35.99  ?  203 GLN B HG3  1 
ATOM   6691  H  HE21 . GLN B  1 203 ? -35.018 -26.899 5.662   1.00 49.50  ?  203 GLN B HE21 1 
ATOM   6692  H  HE22 . GLN B  1 203 ? -36.284 -27.679 5.583   1.00 49.50  ?  203 GLN B HE22 1 
ATOM   6693  N  N    . THR B  1 204 ? -35.858 -23.058 0.391   1.00 25.95  ?  204 THR B N    1 
ATOM   6694  C  CA   . THR B  1 204 ? -36.362 -22.166 -0.652  1.00 28.45  ?  204 THR B CA   1 
ATOM   6695  C  C    . THR B  1 204 ? -36.035 -22.656 -2.057  1.00 30.39  ?  204 THR B C    1 
ATOM   6696  O  O    . THR B  1 204 ? -36.892 -22.560 -2.932  1.00 33.12  ?  204 THR B O    1 
ATOM   6697  C  CB   . THR B  1 204 ? -35.809 -20.729 -0.435  1.00 26.10  ?  204 THR B CB   1 
ATOM   6698  O  OG1  . THR B  1 204 ? -34.383 -20.740 -0.483  1.00 28.27  ?  204 THR B OG1  1 
ATOM   6699  C  CG2  . THR B  1 204 ? -36.250 -20.145 0.943   1.00 26.47  ?  204 THR B CG2  1 
ATOM   6700  H  H    . THR B  1 204 ? -35.019 -23.233 0.330   1.00 31.14  ?  204 THR B H    1 
ATOM   6701  H  HA   . THR B  1 204 ? -37.328 -22.121 -0.577  1.00 34.15  ?  204 THR B HA   1 
ATOM   6702  H  HB   . THR B  1 204 ? -36.147 -20.148 -1.134  1.00 31.32  ?  204 THR B HB   1 
ATOM   6703  H  HG1  . THR B  1 204 ? -34.085 -19.963 -0.366  1.00 33.93  ?  204 THR B HG1  1 
ATOM   6704  H  HG21 . THR B  1 204 ? -35.893 -19.250 1.053   1.00 31.77  ?  204 THR B HG21 1 
ATOM   6705  H  HG22 . THR B  1 204 ? -37.218 -20.106 0.992   1.00 31.77  ?  204 THR B HG22 1 
ATOM   6706  H  HG23 . THR B  1 204 ? -35.920 -20.706 1.662   1.00 31.77  ?  204 THR B HG23 1 
ATOM   6707  N  N    . LYS B  1 205 ? -34.832 -23.209 -2.280  1.00 25.13  ?  205 LYS B N    1 
ATOM   6708  C  CA   . LYS B  1 205 ? -34.365 -23.663 -3.601  1.00 26.66  ?  205 LYS B CA   1 
ATOM   6709  C  C    . LYS B  1 205 ? -33.611 -24.980 -3.470  1.00 28.30  ?  205 LYS B C    1 
ATOM   6710  O  O    . LYS B  1 205 ? -32.384 -25.046 -3.638  1.00 23.98  ?  205 LYS B O    1 
ATOM   6711  C  CB   . LYS B  1 205 ? -33.459 -22.611 -4.256  1.00 24.96  ?  205 LYS B CB   1 
ATOM   6712  C  CG   . LYS B  1 205 ? -34.119 -21.312 -4.632  1.00 24.37  ?  205 LYS B CG   1 
ATOM   6713  C  CD   . LYS B  1 205 ? -35.142 -21.488 -5.757  1.00 26.43  ?  205 LYS B CD   1 
ATOM   6714  C  CE   . LYS B  1 205 ? -35.785 -20.170 -6.125  1.00 34.98  ?  205 LYS B CE   1 
ATOM   6715  N  NZ   . LYS B  1 205 ? -36.960 -20.451 -7.018  1.00 32.48  1  205 LYS B NZ   1 
ATOM   6716  H  H    . LYS B  1 205 ? -34.250 -23.334 -1.659  1.00 30.16  ?  205 LYS B H    1 
ATOM   6717  H  HA   . LYS B  1 205 ? -35.130 -23.807 -4.179  1.00 32.00  ?  205 LYS B HA   1 
ATOM   6718  H  HB2  . LYS B  1 205 ? -32.740 -22.402 -3.640  1.00 29.95  ?  205 LYS B HB2  1 
ATOM   6719  H  HB3  . LYS B  1 205 ? -33.087 -22.991 -5.068  1.00 29.95  ?  205 LYS B HB3  1 
ATOM   6720  H  HG2  . LYS B  1 205 ? -34.581 -20.955 -3.858  1.00 29.24  ?  205 LYS B HG2  1 
ATOM   6721  H  HG3  . LYS B  1 205 ? -33.442 -20.687 -4.935  1.00 29.24  ?  205 LYS B HG3  1 
ATOM   6722  H  HD2  . LYS B  1 205 ? -34.696 -21.840 -6.544  1.00 31.72  ?  205 LYS B HD2  1 
ATOM   6723  H  HD3  . LYS B  1 205 ? -35.838 -22.097 -5.465  1.00 31.72  ?  205 LYS B HD3  1 
ATOM   6724  H  HE2  . LYS B  1 205 ? -36.100 -19.722 -5.324  1.00 41.98  ?  205 LYS B HE2  1 
ATOM   6725  H  HE3  . LYS B  1 205 ? -35.151 -19.616 -6.606  1.00 41.98  ?  205 LYS B HE3  1 
ATOM   6726  H  HZ1  . LYS B  1 205 ? -37.549 -20.966 -6.593  1.00 38.97  ?  205 LYS B HZ1  1 
ATOM   6727  H  HZ2  . LYS B  1 205 ? -37.356 -19.688 -7.248  1.00 38.97  ?  205 LYS B HZ2  1 
ATOM   6728  H  HZ3  . LYS B  1 205 ? -36.689 -20.870 -7.755  1.00 38.97  ?  205 LYS B HZ3  1 
ATOM   6729  N  N    . PRO B  1 206 ? -34.314 -26.068 -3.171  1.00 25.35  ?  206 PRO B N    1 
ATOM   6730  C  CA   . PRO B  1 206 ? -33.602 -27.323 -2.923  1.00 23.16  ?  206 PRO B CA   1 
ATOM   6731  C  C    . PRO B  1 206 ? -32.846 -27.870 -4.128  1.00 20.08  ?  206 PRO B C    1 
ATOM   6732  O  O    . PRO B  1 206 ? -31.855 -28.591 -3.937  1.00 25.31  ?  206 PRO B O    1 
ATOM   6733  C  CB   . PRO B  1 206 ? -34.721 -28.264 -2.455  1.00 30.48  ?  206 PRO B CB   1 
ATOM   6734  C  CG   . PRO B  1 206 ? -35.952 -27.680 -3.024  1.00 28.53  ?  206 PRO B CG   1 
ATOM   6735  C  CD   . PRO B  1 206 ? -35.771 -26.212 -3.010  1.00 32.08  ?  206 PRO B CD   1 
ATOM   6736  H  HA   . PRO B  1 206 ? -32.975 -27.202 -2.193  1.00 27.79  ?  206 PRO B HA   1 
ATOM   6737  H  HB2  . PRO B  1 206 ? -34.568 -29.156 -2.805  1.00 36.58  ?  206 PRO B HB2  1 
ATOM   6738  H  HB3  . PRO B  1 206 ? -34.759 -28.273 -1.486  1.00 36.58  ?  206 PRO B HB3  1 
ATOM   6739  H  HG2  . PRO B  1 206 ? -36.070 -27.997 -3.933  1.00 34.24  ?  206 PRO B HG2  1 
ATOM   6740  H  HG3  . PRO B  1 206 ? -36.712 -27.932 -2.476  1.00 34.24  ?  206 PRO B HG3  1 
ATOM   6741  H  HD2  . PRO B  1 206 ? -36.237 -25.803 -3.756  1.00 38.49  ?  206 PRO B HD2  1 
ATOM   6742  H  HD3  . PRO B  1 206 ? -36.057 -25.841 -2.161  1.00 38.49  ?  206 PRO B HD3  1 
ATOM   6743  N  N    . LYS B  1 207 ? -33.280 -27.584 -5.371  1.00 24.27  ?  207 LYS B N    1 
ATOM   6744  C  CA   . LYS B  1 207 ? -32.511 -28.026 -6.536  1.00 27.34  ?  207 LYS B CA   1 
ATOM   6745  C  C    . LYS B  1 207 ? -31.175 -27.297 -6.642  1.00 23.20  ?  207 LYS B C    1 
ATOM   6746  O  O    . LYS B  1 207 ? -30.180 -27.897 -7.060  1.00 29.10  ?  207 LYS B O    1 
ATOM   6747  C  CB   . LYS B  1 207 ? -33.310 -27.830 -7.828  1.00 26.49  ?  207 LYS B CB   1 
ATOM   6748  C  CG   . LYS B  1 207 ? -34.596 -28.637 -7.869  1.00 33.41  ?  207 LYS B CG   1 
ATOM   6749  C  CD   . LYS B  1 207 ? -34.309 -30.129 -8.017  1.00 54.10  ?  207 LYS B CD   1 
ATOM   6750  C  CE   . LYS B  1 207 ? -35.505 -30.992 -7.606  1.00 72.43  ?  207 LYS B CE   1 
ATOM   6751  N  NZ   . LYS B  1 207 ? -35.820 -30.887 -6.140  1.00 65.55  1  207 LYS B NZ   1 
ATOM   6752  H  H    . LYS B  1 207 ? -33.998 -27.147 -5.557  1.00 29.12  ?  207 LYS B H    1 
ATOM   6753  H  HA   . LYS B  1 207 ? -32.324 -28.974 -6.444  1.00 32.80  ?  207 LYS B HA   1 
ATOM   6754  H  HB2  . LYS B  1 207 ? -33.544 -26.893 -7.913  1.00 31.78  ?  207 LYS B HB2  1 
ATOM   6755  H  HB3  . LYS B  1 207 ? -32.763 -28.104 -8.580  1.00 31.78  ?  207 LYS B HB3  1 
ATOM   6756  H  HG2  . LYS B  1 207 ? -35.087 -28.501 -7.044  1.00 40.09  ?  207 LYS B HG2  1 
ATOM   6757  H  HG3  . LYS B  1 207 ? -35.129 -28.352 -8.628  1.00 40.09  ?  207 LYS B HG3  1 
ATOM   6758  H  HD2  . LYS B  1 207 ? -34.101 -30.322 -8.945  1.00 64.92  ?  207 LYS B HD2  1 
ATOM   6759  H  HD3  . LYS B  1 207 ? -33.558 -30.365 -7.451  1.00 64.92  ?  207 LYS B HD3  1 
ATOM   6760  H  HE2  . LYS B  1 207 ? -36.287 -30.705 -8.103  1.00 86.92  ?  207 LYS B HE2  1 
ATOM   6761  H  HE3  . LYS B  1 207 ? -35.308 -31.921 -7.805  1.00 86.92  ?  207 LYS B HE3  1 
ATOM   6762  H  HZ1  . LYS B  1 207 ? -36.012 -30.044 -5.930  1.00 78.66  ?  207 LYS B HZ1  1 
ATOM   6763  H  HZ2  . LYS B  1 207 ? -36.519 -31.402 -5.942  1.00 78.66  ?  207 LYS B HZ2  1 
ATOM   6764  H  HZ3  . LYS B  1 207 ? -35.120 -31.153 -5.659  1.00 78.66  ?  207 LYS B HZ3  1 
ATOM   6765  N  N    . LEU B  1 208 ? -31.129 -26.020 -6.256  1.00 22.67  ?  208 LEU B N    1 
ATOM   6766  C  CA   . LEU B  1 208 ? -29.856 -25.305 -6.226  1.00 25.41  ?  208 LEU B CA   1 
ATOM   6767  C  C    . LEU B  1 208 ? -28.964 -25.858 -5.135  1.00 24.10  ?  208 LEU B C    1 
ATOM   6768  O  O    . LEU B  1 208 ? -27.748 -26.008 -5.322  1.00 26.02  ?  208 LEU B O    1 
ATOM   6769  C  CB   . LEU B  1 208 ? -30.104 -23.824 -5.985  1.00 28.92  ?  208 LEU B CB   1 
ATOM   6770  C  CG   . LEU B  1 208 ? -29.699 -22.750 -6.984  1.00 45.28  ?  208 LEU B CG   1 
ATOM   6771  C  CD1  . LEU B  1 208 ? -29.898 -23.168 -8.430  1.00 37.27  ?  208 LEU B CD1  1 
ATOM   6772  C  CD2  . LEU B  1 208 ? -30.530 -21.530 -6.661  1.00 26.76  ?  208 LEU B CD2  1 
ATOM   6773  H  H    . LEU B  1 208 ? -31.809 -25.553 -6.012  1.00 27.20  ?  208 LEU B H    1 
ATOM   6774  H  HA   . LEU B  1 208 ? -29.404 -25.409 -7.078  1.00 30.49  ?  208 LEU B HA   1 
ATOM   6775  H  HB2  . LEU B  1 208 ? -31.059 -23.717 -5.855  1.00 34.70  ?  208 LEU B HB2  1 
ATOM   6776  H  HB3  . LEU B  1 208 ? -29.657 -23.596 -5.155  1.00 34.70  ?  208 LEU B HB3  1 
ATOM   6777  H  HG   . LEU B  1 208 ? -28.764 -22.527 -6.856  1.00 54.33  ?  208 LEU B HG   1 
ATOM   6778  H  HD11 . LEU B  1 208 ? -29.621 -22.441 -9.010  1.00 44.72  ?  208 LEU B HD11 1 
ATOM   6779  H  HD12 . LEU B  1 208 ? -29.361 -23.956 -8.608  1.00 44.72  ?  208 LEU B HD12 1 
ATOM   6780  H  HD13 . LEU B  1 208 ? -30.836 -23.367 -8.575  1.00 44.72  ?  208 LEU B HD13 1 
ATOM   6781  H  HD21 . LEU B  1 208 ? -30.300 -20.819 -7.279  1.00 32.11  ?  208 LEU B HD21 1 
ATOM   6782  H  HD22 . LEU B  1 208 ? -31.469 -21.756 -6.751  1.00 32.11  ?  208 LEU B HD22 1 
ATOM   6783  H  HD23 . LEU B  1 208 ? -30.341 -21.252 -5.751  1.00 32.11  ?  208 LEU B HD23 1 
ATOM   6784  N  N    . ALA B  1 209 ? -29.552 -26.169 -3.985  1.00 22.76  ?  209 ALA B N    1 
ATOM   6785  C  CA   . ALA B  1 209 ? -28.772 -26.747 -2.903  1.00 23.91  ?  209 ALA B CA   1 
ATOM   6786  C  C    . ALA B  1 209 ? -28.189 -28.100 -3.303  1.00 25.26  ?  209 ALA B C    1 
ATOM   6787  O  O    . ALA B  1 209 ? -27.035 -28.417 -2.974  1.00 28.72  ?  209 ALA B O    1 
ATOM   6788  C  CB   . ALA B  1 209 ? -29.655 -26.852 -1.658  1.00 25.73  ?  209 ALA B CB   1 
ATOM   6789  H  H    . ALA B  1 209 ? -30.387 -26.058 -3.809  1.00 27.31  ?  209 ALA B H    1 
ATOM   6790  H  HA   . ALA B  1 209 ? -28.034 -26.154 -2.696  1.00 28.69  ?  209 ALA B HA   1 
ATOM   6791  H  HB1  . ALA B  1 209 ? -29.136 -27.238 -0.935  1.00 30.88  ?  209 ALA B HB1  1 
ATOM   6792  H  HB2  . ALA B  1 209 ? -29.959 -25.965 -1.412  1.00 30.88  ?  209 ALA B HB2  1 
ATOM   6793  H  HB3  . ALA B  1 209 ? -30.416 -27.419 -1.859  1.00 30.88  ?  209 ALA B HB3  1 
ATOM   6794  N  N    . ASP B  1 210 ? -28.965 -28.908 -4.045  1.00 25.09  ?  210 ASP B N    1 
ATOM   6795  C  CA   . ASP B  1 210 ? -28.479 -30.215 -4.481  1.00 30.55  ?  210 ASP B CA   1 
ATOM   6796  C  C    . ASP B  1 210 ? -27.318 -30.096 -5.467  1.00 27.72  ?  210 ASP B C    1 
ATOM   6797  O  O    . ASP B  1 210 ? -26.405 -30.926 -5.441  1.00 33.55  ?  210 ASP B O    1 
ATOM   6798  C  CB   . ASP B  1 210 ? -29.630 -31.022 -5.097  1.00 35.06  ?  210 ASP B CB   1 
ATOM   6799  C  CG   . ASP B  1 210 ? -29.272 -32.491 -5.302  1.00 55.00  ?  210 ASP B CG   1 
ATOM   6800  O  OD1  . ASP B  1 210 ? -28.841 -33.145 -4.326  1.00 60.95  ?  210 ASP B OD1  1 
ATOM   6801  O  OD2  . ASP B  1 210 ? -29.427 -32.993 -6.437  1.00 61.30  -1 210 ASP B OD2  1 
ATOM   6802  H  H    . ASP B  1 210 ? -29.764 -28.721 -4.302  1.00 30.11  ?  210 ASP B H    1 
ATOM   6803  H  HA   . ASP B  1 210 ? -28.159 -30.703 -3.706  1.00 36.66  ?  210 ASP B HA   1 
ATOM   6804  H  HB2  . ASP B  1 210 ? -30.398 -30.980 -4.506  1.00 42.07  ?  210 ASP B HB2  1 
ATOM   6805  H  HB3  . ASP B  1 210 ? -29.855 -30.644 -5.962  1.00 42.07  ?  210 ASP B HB3  1 
ATOM   6806  N  N    . ILE B  1 211 ? -27.294 -29.047 -6.295  1.00 26.01  ?  211 ILE B N    1 
ATOM   6807  C  CA   . ILE B  1 211 ? -26.174 -28.857 -7.209  1.00 25.71  ?  211 ILE B CA   1 
ATOM   6808  C  C    . ILE B  1 211 ? -24.925 -28.428 -6.447  1.00 27.19  ?  211 ILE B C    1 
ATOM   6809  O  O    . ILE B  1 211 ? -23.806 -28.838 -6.784  1.00 31.25  ?  211 ILE B O    1 
ATOM   6810  C  CB   . ILE B  1 211 ? -26.541 -27.852 -8.314  1.00 29.88  ?  211 ILE B CB   1 
ATOM   6811  C  CG1  . ILE B  1 211 ? -27.615 -28.465 -9.233  1.00 37.92  ?  211 ILE B CG1  1 
ATOM   6812  C  CG2  . ILE B  1 211 ? -25.323 -27.503 -9.156  1.00 30.82  ?  211 ILE B CG2  1 
ATOM   6813  C  CD1  . ILE B  1 211 ? -28.362 -27.441 -10.055 1.00 41.91  ?  211 ILE B CD1  1 
ATOM   6814  H  H    . ILE B  1 211 ? -27.905 -28.444 -6.345  1.00 31.21  ?  211 ILE B H    1 
ATOM   6815  H  HA   . ILE B  1 211 ? -25.978 -29.704 -7.638  1.00 30.85  ?  211 ILE B HA   1 
ATOM   6816  H  HB   . ILE B  1 211 ? -26.891 -27.043 -7.908  1.00 35.85  ?  211 ILE B HB   1 
ATOM   6817  H  HG12 . ILE B  1 211 ? -27.188 -29.084 -9.845  1.00 45.51  ?  211 ILE B HG12 1 
ATOM   6818  H  HG13 . ILE B  1 211 ? -28.262 -28.937 -8.686  1.00 45.51  ?  211 ILE B HG13 1 
ATOM   6819  H  HG21 . ILE B  1 211 ? -25.585 -26.870 -9.842  1.00 36.99  ?  211 ILE B HG21 1 
ATOM   6820  H  HG22 . ILE B  1 211 ? -24.646 -27.110 -8.583  1.00 36.99  ?  211 ILE B HG22 1 
ATOM   6821  H  HG23 . ILE B  1 211 ? -24.981 -28.313 -9.566  1.00 36.99  ?  211 ILE B HG23 1 
ATOM   6822  H  HD11 . ILE B  1 211 ? -29.018 -27.896 -10.605 1.00 50.29  ?  211 ILE B HD11 1 
ATOM   6823  H  HD12 . ILE B  1 211 ? -28.805 -26.819 -9.457  1.00 50.29  ?  211 ILE B HD12 1 
ATOM   6824  H  HD13 . ILE B  1 211 ? -27.730 -26.966 -10.617 1.00 50.29  ?  211 ILE B HD13 1 
ATOM   6825  N  N    . ILE B  1 212 ? -25.078 -27.578 -5.432  1.00 23.33  ?  212 ILE B N    1 
ATOM   6826  C  CA   . ILE B  1 212 ? -23.933 -27.261 -4.573  1.00 23.06  ?  212 ILE B CA   1 
ATOM   6827  C  C    . ILE B  1 212 ? -23.378 -28.536 -3.947  1.00 28.06  ?  212 ILE B C    1 
ATOM   6828  O  O    . ILE B  1 212 ? -22.156 -28.740 -3.893  1.00 32.69  ?  212 ILE B O    1 
ATOM   6829  C  CB   . ILE B  1 212 ? -24.321 -26.233 -3.497  1.00 22.49  ?  212 ILE B CB   1 
ATOM   6830  C  CG1  . ILE B  1 212 ? -24.490 -24.839 -4.103  1.00 23.76  ?  212 ILE B CG1  1 
ATOM   6831  C  CG2  . ILE B  1 212 ? -23.232 -26.166 -2.401  1.00 27.29  ?  212 ILE B CG2  1 
ATOM   6832  C  CD1  . ILE B  1 212 ? -25.007 -23.788 -3.142  1.00 25.16  ?  212 ILE B CD1  1 
ATOM   6833  H  H    . ILE B  1 212 ? -25.812 -27.181 -5.222  1.00 28.00  ?  212 ILE B H    1 
ATOM   6834  H  HA   . ILE B  1 212 ? -23.233 -26.869 -5.118  1.00 27.67  ?  212 ILE B HA   1 
ATOM   6835  H  HB   . ILE B  1 212 ? -25.159 -26.503 -3.091  1.00 26.99  ?  212 ILE B HB   1 
ATOM   6836  H  HG12 . ILE B  1 212 ? -23.628 -24.538 -4.432  1.00 28.51  ?  212 ILE B HG12 1 
ATOM   6837  H  HG13 . ILE B  1 212 ? -25.117 -24.897 -4.841  1.00 28.51  ?  212 ILE B HG13 1 
ATOM   6838  H  HG21 . ILE B  1 212 ? -23.495 -25.513 -1.734  1.00 32.74  ?  212 ILE B HG21 1 
ATOM   6839  H  HG22 . ILE B  1 212 ? -23.142 -27.041 -1.992  1.00 32.74  ?  212 ILE B HG22 1 
ATOM   6840  H  HG23 . ILE B  1 212 ? -22.391 -25.903 -2.808  1.00 32.74  ?  212 ILE B HG23 1 
ATOM   6841  H  HD11 . ILE B  1 212 ? -25.082 -22.942 -3.611  1.00 30.19  ?  212 ILE B HD11 1 
ATOM   6842  H  HD12 . ILE B  1 212 ? -25.877 -24.062 -2.813  1.00 30.19  ?  212 ILE B HD12 1 
ATOM   6843  H  HD13 . ILE B  1 212 ? -24.385 -23.703 -2.403  1.00 30.19  ?  212 ILE B HD13 1 
ATOM   6844  N  N    . ARG B  1 213 ? -24.260 -29.397 -3.435  1.00 31.31  ?  213 ARG B N    1 
ATOM   6845  C  CA   . ARG B  1 213 ? -23.814 -30.660 -2.841  1.00 41.16  ?  213 ARG B CA   1 
ATOM   6846  C  C    . ARG B  1 213 ? -23.139 -31.555 -3.869  1.00 40.38  ?  213 ARG B C    1 
ATOM   6847  O  O    . ARG B  1 213 ? -22.081 -32.132 -3.596  1.00 47.82  ?  213 ARG B O    1 
ATOM   6848  C  CB   . ARG B  1 213 ? -24.985 -31.407 -2.210  1.00 37.47  ?  213 ARG B CB   1 
ATOM   6849  C  CG   . ARG B  1 213 ? -25.482 -30.781 -0.950  1.00 33.47  ?  213 ARG B CG   1 
ATOM   6850  C  CD   . ARG B  1 213 ? -26.386 -31.713 -0.136  1.00 36.71  ?  213 ARG B CD   1 
ATOM   6851  N  NE   . ARG B  1 213 ? -26.781 -31.062 1.115   1.00 33.73  ?  213 ARG B NE   1 
ATOM   6852  C  CZ   . ARG B  1 213 ? -27.901 -30.361 1.300   1.00 35.43  ?  213 ARG B CZ   1 
ATOM   6853  N  NH1  . ARG B  1 213 ? -28.794 -30.216 0.320   1.00 34.68  1  213 ARG B NH1  1 
ATOM   6854  N  NH2  . ARG B  1 213 ? -28.128 -29.797 2.482   1.00 32.78  ?  213 ARG B NH2  1 
ATOM   6855  H  H    . ARG B  1 213 ? -25.112 -29.276 -3.419  1.00 37.57  ?  213 ARG B H    1 
ATOM   6856  H  HA   . ARG B  1 213 ? -23.169 -30.468 -2.142  1.00 49.39  ?  213 ARG B HA   1 
ATOM   6857  H  HB2  . ARG B  1 213 ? -25.720 -31.429 -2.841  1.00 44.97  ?  213 ARG B HB2  1 
ATOM   6858  H  HB3  . ARG B  1 213 ? -24.703 -32.312 -2.001  1.00 44.97  ?  213 ARG B HB3  1 
ATOM   6859  H  HG2  . ARG B  1 213 ? -24.723 -30.541 -0.397  1.00 40.16  ?  213 ARG B HG2  1 
ATOM   6860  H  HG3  . ARG B  1 213 ? -25.994 -29.988 -1.173  1.00 40.16  ?  213 ARG B HG3  1 
ATOM   6861  H  HD2  . ARG B  1 213 ? -27.186 -31.916 -0.645  1.00 44.05  ?  213 ARG B HD2  1 
ATOM   6862  H  HD3  . ARG B  1 213 ? -25.903 -32.527 0.079   1.00 44.05  ?  213 ARG B HD3  1 
ATOM   6863  H  HE   . ARG B  1 213 ? -26.248 -31.138 1.786   1.00 40.48  ?  213 ARG B HE   1 
ATOM   6864  H  HH11 . ARG B  1 213 ? -28.649 -30.573 -0.449  1.00 41.62  ?  213 ARG B HH11 1 
ATOM   6865  H  HH12 . ARG B  1 213 ? -29.512 -29.764 0.456   1.00 41.62  ?  213 ARG B HH12 1 
ATOM   6866  H  HH21 . ARG B  1 213 ? -27.559 -29.891 3.120   1.00 39.34  ?  213 ARG B HH21 1 
ATOM   6867  H  HH22 . ARG B  1 213 ? -28.852 -29.353 2.614   1.00 39.34  ?  213 ARG B HH22 1 
ATOM   6868  N  N    . ASN B  1 214 ? -23.746 -31.704 -5.049  1.00 51.71  ?  214 ASN B N    1 
ATOM   6869  C  CA   . ASN B  1 214 ? -23.192 -32.574 -6.092  1.00 54.07  ?  214 ASN B CA   1 
ATOM   6870  C  C    . ASN B  1 214 ? -23.809 -32.196 -7.432  1.00 66.65  ?  214 ASN B C    1 
ATOM   6871  O  O    . ASN B  1 214 ? -24.968 -32.536 -7.691  1.00 78.67  ?  214 ASN B O    1 
ATOM   6872  C  CB   . ASN B  1 214 ? -23.456 -34.045 -5.773  1.00 64.12  ?  214 ASN B CB   1 
ATOM   6873  C  CG   . ASN B  1 214 ? -24.585 -34.248 -4.759  1.00 59.13  ?  214 ASN B CG   1 
ATOM   6874  O  OD1  . ASN B  1 214 ? -25.759 -33.996 -5.046  1.00 57.95  ?  214 ASN B OD1  1 
ATOM   6875  N  ND2  . ASN B  1 214 ? -24.228 -34.741 -3.574  1.00 67.34  ?  214 ASN B ND2  1 
ATOM   6876  H  H    . ASN B  1 214 ? -24.479 -31.313 -5.271  1.00 62.05  ?  214 ASN B H    1 
ATOM   6877  H  HA   . ASN B  1 214 ? -22.233 -32.441 -6.147  1.00 64.88  ?  214 ASN B HA   1 
ATOM   6878  H  HB2  . ASN B  1 214 ? -23.703 -34.505 -6.591  1.00 76.94  ?  214 ASN B HB2  1 
ATOM   6879  H  HB3  . ASN B  1 214 ? -22.649 -34.437 -5.405  1.00 76.94  ?  214 ASN B HB3  1 
ATOM   6880  H  HD21 . ASN B  1 214 ? -23.404 -34.926 -3.416  1.00 80.81  ?  214 ASN B HD21 1 
ATOM   6881  H  HD22 . ASN B  1 214 ? -24.823 -34.875 -2.968  1.00 80.81  ?  214 ASN B HD22 1 
ATOM   6882  N  N    . GLY B  1 215 ? -23.040 -31.522 -8.287  1.00 64.49  ?  215 GLY B N    1 
ATOM   6883  C  CA   . GLY B  1 215 ? -23.547 -31.122 -9.595  1.00 60.60  ?  215 GLY B CA   1 
ATOM   6884  C  C    . GLY B  1 215 ? -22.497 -30.600 -10.560 1.00 63.47  ?  215 GLY B C    1 
ATOM   6885  O  O    . GLY B  1 215 ? -22.791 -30.316 -11.729 1.00 69.35  ?  215 GLY B O    1 
ATOM   6886  H  H    . GLY B  1 215 ? -22.227 -31.287 -8.134  1.00 77.38  ?  215 GLY B H    1 
ATOM   6887  H  HA2  . GLY B  1 215 ? -23.981 -31.884 -10.010 1.00 72.72  ?  215 GLY B HA2  1 
ATOM   6888  H  HA3  . GLY B  1 215 ? -24.213 -30.427 -9.474  1.00 72.72  ?  215 GLY B HA3  1 
HETATM 6889  N  N    . MSE C  1 1   ? -38.012 -0.841  40.360  1.00 44.82  ?  1   MSE C N    1 
HETATM 6890  C  CA   . MSE C  1 1   ? -36.949 0.007   39.748  1.00 56.45  ?  1   MSE C CA   1 
HETATM 6891  C  C    . MSE C  1 1   ? -37.416 1.460   39.600  1.00 61.56  ?  1   MSE C C    1 
HETATM 6892  O  O    . MSE C  1 1   ? -38.604 1.723   39.473  1.00 53.92  ?  1   MSE C O    1 
HETATM 6893  C  CB   . MSE C  1 1   ? -36.542 -0.577  38.398  1.00 64.52  ?  1   MSE C CB   1 
HETATM 6894  C  CG   . MSE C  1 1   ? -36.142 -2.051  38.507  1.00 71.19  ?  1   MSE C CG   1 
HETATM 6895  SE SE   . MSE C  1 1   ? -35.508 -2.845  36.842  1.00 81.99  ?  1   MSE C SE   1 
HETATM 6896  C  CE   . MSE C  1 1   ? -37.203 -3.077  35.901  1.00 62.45  ?  1   MSE C CE   1 
HETATM 6897  H  H1   . MSE C  1 1   ? -37.642 -1.415  40.930  1.00 53.78  ?  1   MSE C H1   1 
HETATM 6898  H  H2   . MSE C  1 1   ? -38.591 -0.323  40.794  1.00 53.78  ?  1   MSE C H2   1 
HETATM 6899  H  H3   . MSE C  1 1   ? -38.438 -1.290  39.720  1.00 53.78  ?  1   MSE C H3   1 
HETATM 6900  H  HA   . MSE C  1 1   ? -36.169 -0.010  40.324  1.00 67.74  ?  1   MSE C HA   1 
HETATM 6901  H  HB2  . MSE C  1 1   ? -37.290 -0.512  37.784  1.00 77.42  ?  1   MSE C HB2  1 
HETATM 6902  H  HB3  . MSE C  1 1   ? -35.783 -0.082  38.053  1.00 77.42  ?  1   MSE C HB3  1 
HETATM 6903  H  HG2  . MSE C  1 1   ? -35.429 -2.131  39.160  1.00 85.42  ?  1   MSE C HG2  1 
HETATM 6904  H  HG3  . MSE C  1 1   ? -36.913 -2.561  38.801  1.00 85.42  ?  1   MSE C HG3  1 
HETATM 6905  H  HE1  . MSE C  1 1   ? -37.030 -3.474  35.033  1.00 74.94  ?  1   MSE C HE1  1 
HETATM 6906  H  HE2  . MSE C  1 1   ? -37.777 -3.660  36.424  1.00 74.94  ?  1   MSE C HE2  1 
HETATM 6907  H  HE3  . MSE C  1 1   ? -37.624 -2.210  35.791  1.00 74.94  ?  1   MSE C HE3  1 
ATOM   6908  N  N    . ASP C  1 2   ? -36.482 2.412   39.632  1.00 73.50  ?  2   ASP C N    1 
ATOM   6909  C  CA   . ASP C  1 2   ? -36.832 3.833   39.567  1.00 73.34  ?  2   ASP C CA   1 
ATOM   6910  C  C    . ASP C  1 2   ? -37.161 4.246   38.127  1.00 69.90  ?  2   ASP C C    1 
ATOM   6911  O  O    . ASP C  1 2   ? -36.503 5.088   37.518  1.00 72.60  ?  2   ASP C O    1 
ATOM   6912  C  CB   . ASP C  1 2   ? -35.704 4.681   40.145  1.00 90.85  ?  2   ASP C CB   1 
ATOM   6913  C  CG   . ASP C  1 2   ? -34.359 4.408   39.478  1.00 103.10 ?  2   ASP C CG   1 
ATOM   6914  O  OD1  . ASP C  1 2   ? -34.133 3.260   39.023  1.00 93.53  ?  2   ASP C OD1  1 
ATOM   6915  O  OD2  . ASP C  1 2   ? -33.529 5.343   39.415  1.00 106.85 -1 2   ASP C OD2  1 
ATOM   6916  H  H    . ASP C  1 2   ? -35.637 2.261   39.690  1.00 88.19  ?  2   ASP C H    1 
ATOM   6917  H  HA   . ASP C  1 2   ? -37.624 3.985   40.107  1.00 88.00  ?  2   ASP C HA   1 
ATOM   6918  H  HB2  . ASP C  1 2   ? -35.917 5.619   40.017  1.00 109.01 ?  2   ASP C HB2  1 
ATOM   6919  H  HB3  . ASP C  1 2   ? -35.616 4.487   41.091  1.00 109.01 ?  2   ASP C HB3  1 
ATOM   6920  N  N    . THR C  1 3   ? -38.217 3.634   37.590  1.00 61.06  ?  3   THR C N    1 
ATOM   6921  C  CA   . THR C  1 3   ? -38.670 3.921   36.236  1.00 52.37  ?  3   THR C CA   1 
ATOM   6922  C  C    . THR C  1 3   ? -40.160 3.631   36.142  1.00 40.17  ?  3   THR C C    1 
ATOM   6923  O  O    . THR C  1 3   ? -40.693 2.799   36.880  1.00 53.14  ?  3   THR C O    1 
ATOM   6924  C  CB   . THR C  1 3   ? -37.923 3.089   35.182  1.00 52.62  ?  3   THR C CB   1 
ATOM   6925  O  OG1  . THR C  1 3   ? -38.385 3.442   33.871  1.00 53.14  ?  3   THR C OG1  1 
ATOM   6926  C  CG2  . THR C  1 3   ? -38.146 1.583   35.405  1.00 57.37  ?  3   THR C CG2  1 
ATOM   6927  H  H    . THR C  1 3   ? -38.690 3.043   37.996  1.00 73.27  ?  3   THR C H    1 
ATOM   6928  H  HA   . THR C  1 3   ? -38.528 4.860   36.041  1.00 62.84  ?  3   THR C HA   1 
ATOM   6929  H  HB   . THR C  1 3   ? -36.972 3.269   35.247  1.00 63.14  ?  3   THR C HB   1 
ATOM   6930  H  HG1  . THR C  1 3   ? -38.245 4.257   33.727  1.00 63.77  ?  3   THR C HG1  1 
ATOM   6931  H  HG21 . THR C  1 3   ? -37.667 1.074   34.731  1.00 68.85  ?  3   THR C HG21 1 
ATOM   6932  H  HG22 . THR C  1 3   ? -37.822 1.326   36.282  1.00 68.85  ?  3   THR C HG22 1 
ATOM   6933  H  HG23 . THR C  1 3   ? -39.091 1.375   35.344  1.00 68.85  ?  3   THR C HG23 1 
ATOM   6934  N  N    . ASN C  1 4   ? -40.823 4.319   35.223  1.00 47.00  ?  4   ASN C N    1 
ATOM   6935  C  CA   . ASN C  1 4   ? -42.230 4.064   34.969  1.00 48.80  ?  4   ASN C CA   1 
ATOM   6936  C  C    . ASN C  1 4   ? -42.445 3.014   33.880  1.00 44.63  ?  4   ASN C C    1 
ATOM   6937  O  O    . ASN C  1 4   ? -43.595 2.668   33.595  1.00 44.66  ?  4   ASN C O    1 
ATOM   6938  C  CB   . ASN C  1 4   ? -42.943 5.376   34.593  1.00 50.46  ?  4   ASN C CB   1 
ATOM   6939  C  CG   . ASN C  1 4   ? -42.530 5.909   33.222  1.00 54.82  ?  4   ASN C CG   1 
ATOM   6940  O  OD1  . ASN C  1 4   ? -41.410 5.684   32.765  1.00 58.30  ?  4   ASN C OD1  1 
ATOM   6941  N  ND2  . ASN C  1 4   ? -43.439 6.624   32.567  1.00 61.67  ?  4   ASN C ND2  1 
ATOM   6942  H  H    . ASN C  1 4   ? -40.481 4.938   34.734  0.79 56.40  ?  4   ASN C H    1 
ATOM   6943  H  HA   . ASN C  1 4   ? -42.636 3.730   35.784  1.00 58.57  ?  4   ASN C HA   1 
ATOM   6944  H  HB2  . ASN C  1 4   ? -43.901 5.221   34.578  1.00 60.56  ?  4   ASN C HB2  1 
ATOM   6945  H  HB3  . ASN C  1 4   ? -42.728 6.053   35.254  1.00 60.56  ?  4   ASN C HB3  1 
ATOM   6946  H  HD21 . ASN C  1 4   ? -43.255 6.947   31.791  1.00 74.00  ?  4   ASN C HD21 1 
ATOM   6947  H  HD22 . ASN C  1 4   ? -44.211 6.765   32.919  1.00 74.00  ?  4   ASN C HD22 1 
ATOM   6948  N  N    . LYS C  1 5   ? -41.379 2.484   33.272  1.00 30.20  ?  5   LYS C N    1 
ATOM   6949  C  CA   . LYS C  1 5   ? -41.519 1.650   32.084  1.00 23.15  ?  5   LYS C CA   1 
ATOM   6950  C  C    . LYS C  1 5   ? -41.780 0.211   32.498  1.00 22.25  ?  5   LYS C C    1 
ATOM   6951  O  O    . LYS C  1 5   ? -41.248 -0.263  33.503  1.00 26.49  ?  5   LYS C O    1 
ATOM   6952  C  CB   . LYS C  1 5   ? -40.250 1.738   31.229  1.00 31.51  ?  5   LYS C CB   1 
ATOM   6953  C  CG   . LYS C  1 5   ? -40.316 1.024   29.895  1.00 39.84  ?  5   LYS C CG   1 
ATOM   6954  C  CD   . LYS C  1 5   ? -39.167 1.468   28.991  1.00 51.84  ?  5   LYS C CD   1 
ATOM   6955  C  CE   . LYS C  1 5   ? -38.567 0.303   28.234  1.00 51.75  ?  5   LYS C CE   1 
ATOM   6956  N  NZ   . LYS C  1 5   ? -37.536 0.756   27.267  1.00 58.83  1  5   LYS C NZ   1 
ATOM   6957  H  H    . LYS C  1 5   ? -40.566 2.594   33.530  1.00 36.24  ?  5   LYS C H    1 
ATOM   6958  H  HA   . LYS C  1 5   ? -42.271 1.961   31.555  1.00 27.78  ?  5   LYS C HA   1 
ATOM   6959  H  HB2  . LYS C  1 5   ? -40.065 2.673   31.049  1.00 37.81  ?  5   LYS C HB2  1 
ATOM   6960  H  HB3  . LYS C  1 5   ? -39.515 1.352   31.730  1.00 37.81  ?  5   LYS C HB3  1 
ATOM   6961  H  HG2  . LYS C  1 5   ? -40.242 0.067   30.038  1.00 47.81  ?  5   LYS C HG2  1 
ATOM   6962  H  HG3  . LYS C  1 5   ? -41.153 1.237   29.455  1.00 47.81  ?  5   LYS C HG3  1 
ATOM   6963  H  HD2  . LYS C  1 5   ? -39.500 2.110   28.344  1.00 62.20  ?  5   LYS C HD2  1 
ATOM   6964  H  HD3  . LYS C  1 5   ? -38.470 1.868   29.533  1.00 62.20  ?  5   LYS C HD3  1 
ATOM   6965  H  HE2  . LYS C  1 5   ? -38.148 -0.305  28.863  1.00 62.10  ?  5   LYS C HE2  1 
ATOM   6966  H  HE3  . LYS C  1 5   ? -39.267 -0.153  27.742  1.00 62.10  ?  5   LYS C HE3  1 
ATOM   6967  H  HZ1  . LYS C  1 5   ? -37.197 0.056   26.834  1.00 70.60  ?  5   LYS C HZ1  1 
ATOM   6968  H  HZ2  . LYS C  1 5   ? -37.898 1.314   26.676  1.00 70.60  ?  5   LYS C HZ2  1 
ATOM   6969  H  HZ3  . LYS C  1 5   ? -36.879 1.176   27.697  1.00 70.60  ?  5   LYS C HZ3  1 
ATOM   6970  N  N    . ARG C  1 6   ? -42.638 -0.479  31.736  1.00 18.89  ?  6   ARG C N    1 
ATOM   6971  C  CA   . ARG C  1 6   ? -42.845 -1.908  31.960  1.00 17.49  ?  6   ARG C CA   1 
ATOM   6972  C  C    . ARG C  1 6   ? -41.639 -2.658  31.411  1.00 20.75  ?  6   ARG C C    1 
ATOM   6973  O  O    . ARG C  1 6   ? -41.349 -2.564  30.214  1.00 23.02  ?  6   ARG C O    1 
ATOM   6974  C  CB   . ARG C  1 6   ? -44.117 -2.388  31.262  1.00 19.25  ?  6   ARG C CB   1 
ATOM   6975  C  CG   . ARG C  1 6   ? -45.417 -1.844  31.875  1.00 18.79  ?  6   ARG C CG   1 
ATOM   6976  C  CD   . ARG C  1 6   ? -46.639 -2.476  31.240  1.00 18.50  ?  6   ARG C CD   1 
ATOM   6977  N  NE   . ARG C  1 6   ? -47.821 -2.138  32.044  1.00 18.25  ?  6   ARG C NE   1 
ATOM   6978  C  CZ   . ARG C  1 6   ? -48.517 -1.005  31.935  1.00 16.50  ?  6   ARG C CZ   1 
ATOM   6979  N  NH1  . ARG C  1 6   ? -48.236 -0.099  31.016  1.00 19.25  1  6   ARG C NH1  1 
ATOM   6980  N  NH2  . ARG C  1 6   ? -49.543 -0.783  32.755  1.00 18.52  ?  6   ARG C NH2  1 
ATOM   6981  H  H    . ARG C  1 6   ? -43.104 -0.146  31.094  1.00 22.67  ?  6   ARG C H    1 
ATOM   6982  H  HA   . ARG C  1 6   ? -42.921 -2.086  32.910  1.00 20.99  ?  6   ARG C HA   1 
ATOM   6983  H  HB2  . ARG C  1 6   ? -44.088 -2.107  30.334  1.00 23.10  ?  6   ARG C HB2  1 
ATOM   6984  H  HB3  . ARG C  1 6   ? -44.152 -3.356  31.310  1.00 23.10  ?  6   ARG C HB3  1 
ATOM   6985  H  HG2  . ARG C  1 6   ? -45.431 -2.042  32.824  1.00 22.55  ?  6   ARG C HG2  1 
ATOM   6986  H  HG3  . ARG C  1 6   ? -45.461 -0.885  31.731  1.00 22.55  ?  6   ARG C HG3  1 
ATOM   6987  H  HD2  . ARG C  1 6   ? -46.762 -2.127  30.343  1.00 22.20  ?  6   ARG C HD2  1 
ATOM   6988  H  HD3  . ARG C  1 6   ? -46.539 -3.441  31.223  1.00 22.20  ?  6   ARG C HD3  1 
ATOM   6989  H  HE   . ARG C  1 6   ? -48.084 -2.713  32.628  1.00 21.90  ?  6   ARG C HE   1 
ATOM   6990  H  HH11 . ARG C  1 6   ? -47.571 -0.217  30.485  1.00 23.11  ?  6   ARG C HH11 1 
ATOM   6991  H  HH12 . ARG C  1 6   ? -48.709 0.618   30.961  1.00 23.11  ?  6   ARG C HH12 1 
ATOM   6992  H  HH21 . ARG C  1 6   ? -49.753 -1.368  33.349  1.00 22.22  ?  6   ARG C HH21 1 
ATOM   6993  H  HH22 . ARG C  1 6   ? -50.013 -0.068  32.671  1.00 22.22  ?  6   ARG C HH22 1 
ATOM   6994  N  N    . GLU C  1 7   ? -40.919 -3.369  32.279  1.00 18.31  ?  7   GLU C N    1 
ATOM   6995  C  CA   . GLU C  1 7   ? -39.703 -4.069  31.892  1.00 17.51  ?  7   GLU C CA   1 
ATOM   6996  C  C    . GLU C  1 7   ? -39.711 -5.505  32.384  1.00 16.33  ?  7   GLU C C    1 
ATOM   6997  O  O    . GLU C  1 7   ? -39.938 -5.757  33.573  1.00 19.15  ?  7   GLU C O    1 
ATOM   6998  C  CB   . GLU C  1 7   ? -38.478 -3.318  32.445  1.00 22.94  ?  7   GLU C CB   1 
ATOM   6999  C  CG   . GLU C  1 7   ? -38.399 -1.886  31.874  1.00 32.19  ?  7   GLU C CG   1 
ATOM   7000  C  CD   . GLU C  1 7   ? -37.300 -1.027  32.498  1.00 54.51  ?  7   GLU C CD   1 
ATOM   7001  O  OE1  . GLU C  1 7   ? -37.192 -0.976  33.747  1.00 63.79  ?  7   GLU C OE1  1 
ATOM   7002  O  OE2  . GLU C  1 7   ? -36.551 -0.397  31.725  1.00 54.75  -1 7   GLU C OE2  1 
ATOM   7003  H  H    . GLU C  1 7   ? -41.120 -3.460  33.110  1.00 21.98  ?  7   GLU C H    1 
ATOM   7004  H  HA   . GLU C  1 7   ? -39.637 -4.082  30.924  1.00 21.01  ?  7   GLU C HA   1 
ATOM   7005  H  HB2  . GLU C  1 7   ? -38.546 -3.258  33.410  1.00 27.53  ?  7   GLU C HB2  1 
ATOM   7006  H  HB3  . GLU C  1 7   ? -37.670 -3.792  32.193  1.00 27.53  ?  7   GLU C HB3  1 
ATOM   7007  H  HG2  . GLU C  1 7   ? -38.227 -1.939  30.921  1.00 38.63  ?  7   GLU C HG2  1 
ATOM   7008  H  HG3  . GLU C  1 7   ? -39.246 -1.441  32.031  1.00 38.63  ?  7   GLU C HG3  1 
ATOM   7009  N  N    . ILE C  1 8   ? -39.394 -6.432  31.476  1.00 16.20  ?  8   ILE C N    1 
ATOM   7010  C  CA   . ILE C  1 8   ? -39.162 -7.828  31.829  1.00 15.40  ?  8   ILE C CA   1 
ATOM   7011  C  C    . ILE C  1 8   ? -37.801 -7.911  32.507  1.00 16.48  ?  8   ILE C C    1 
ATOM   7012  O  O    . ILE C  1 8   ? -36.841 -7.236  32.091  1.00 18.39  ?  8   ILE C O    1 
ATOM   7013  C  CB   . ILE C  1 8   ? -39.222 -8.723  30.585  1.00 16.43  ?  8   ILE C CB   1 
ATOM   7014  C  CG1  . ILE C  1 8   ? -40.655 -8.688  30.021  1.00 16.94  ?  8   ILE C CG1  1 
ATOM   7015  C  CG2  . ILE C  1 8   ? -38.778 -10.157 30.901  1.00 15.31  ?  8   ILE C CG2  1 
ATOM   7016  C  CD1  . ILE C  1 8   ? -40.817 -9.332  28.671  1.00 17.90  ?  8   ILE C CD1  1 
ATOM   7017  H  H    . ILE C  1 8   ? -39.307 -6.270  30.636  1.00 19.44  ?  8   ILE C H    1 
ATOM   7018  H  HA   . ILE C  1 8   ? -39.840 -8.123  32.457  1.00 18.48  ?  8   ILE C HA   1 
ATOM   7019  H  HB   . ILE C  1 8   ? -38.621 -8.358  29.916  1.00 19.71  ?  8   ILE C HB   1 
ATOM   7020  H  HG12 . ILE C  1 8   ? -41.242 -9.152  30.640  1.00 20.33  ?  8   ILE C HG12 1 
ATOM   7021  H  HG13 . ILE C  1 8   ? -40.934 -7.763  29.940  1.00 20.33  ?  8   ILE C HG13 1 
ATOM   7022  H  HG21 . ILE C  1 8   ? -38.830 -10.689 30.092  1.00 18.37  ?  8   ILE C HG21 1 
ATOM   7023  H  HG22 . ILE C  1 8   ? -37.865 -10.140 31.229  1.00 18.37  ?  8   ILE C HG22 1 
ATOM   7024  H  HG23 . ILE C  1 8   ? -39.366 -10.527 31.579  1.00 18.37  ?  8   ILE C HG23 1 
ATOM   7025  H  HD11 . ILE C  1 8   ? -41.745 -9.264  28.398  1.00 21.47  ?  8   ILE C HD11 1 
ATOM   7026  H  HD12 . ILE C  1 8   ? -40.249 -8.873  28.033  1.00 21.47  ?  8   ILE C HD12 1 
ATOM   7027  H  HD13 . ILE C  1 8   ? -40.558 -10.265 28.734  1.00 21.47  ?  8   ILE C HD13 1 
ATOM   7028  N  N    . VAL C  1 9   ? -37.715 -8.732  33.543  1.00 16.35  ?  9   VAL C N    1 
ATOM   7029  C  CA   . VAL C  1 9   ? -36.460 -8.994  34.241  1.00 15.61  ?  9   VAL C CA   1 
ATOM   7030  C  C    . VAL C  1 9   ? -36.284 -10.511 34.351  1.00 18.77  ?  9   VAL C C    1 
ATOM   7031  O  O    . VAL C  1 9   ? -37.206 -11.299 34.134  1.00 18.00  ?  9   VAL C O    1 
ATOM   7032  C  CB   . VAL C  1 9   ? -36.411 -8.323  35.620  1.00 18.31  ?  9   VAL C CB   1 
ATOM   7033  C  CG1  . VAL C  1 9   ? -36.589 -6.813  35.487  1.00 21.63  ?  9   VAL C CG1  1 
ATOM   7034  C  CG2  . VAL C  1 9   ? -37.479 -8.884  36.534  1.00 19.42  ?  9   VAL C CG2  1 
ATOM   7035  H  H    . VAL C  1 9   ? -38.385 -9.161  33.871  1.00 19.62  ?  9   VAL C H    1 
ATOM   7036  H  HA   . VAL C  1 9   ? -35.726 -8.645  33.712  1.00 18.73  ?  9   VAL C HA   1 
ATOM   7037  H  HB   . VAL C  1 9   ? -35.546 -8.492  36.026  1.00 21.97  ?  9   VAL C HB   1 
ATOM   7038  H  HG11 . VAL C  1 9   ? -36.554 -6.412  36.369  1.00 25.96  ?  9   VAL C HG11 1 
ATOM   7039  H  HG12 . VAL C  1 9   ? -35.875 -6.459  34.934  1.00 25.96  ?  9   VAL C HG12 1 
ATOM   7040  H  HG13 . VAL C  1 9   ? -37.448 -6.632  35.074  1.00 25.96  ?  9   VAL C HG13 1 
ATOM   7041  H  HG21 . VAL C  1 9   ? -37.421 -8.441  37.395  1.00 23.30  ?  9   VAL C HG21 1 
ATOM   7042  H  HG22 . VAL C  1 9   ? -38.349 -8.725  36.136  1.00 23.30  ?  9   VAL C HG22 1 
ATOM   7043  H  HG23 . VAL C  1 9   ? -37.333 -9.837  36.641  1.00 23.30  ?  9   VAL C HG23 1 
ATOM   7044  N  N    . GLU C  1 10  ? -35.056 -10.921 34.685  1.00 16.16  ?  10  GLU C N    1 
ATOM   7045  C  CA   . GLU C  1 10  ? -34.731 -12.331 34.756  1.00 16.85  ?  10  GLU C CA   1 
ATOM   7046  C  C    . GLU C  1 10  ? -33.873 -12.582 35.979  1.00 16.45  ?  10  GLU C C    1 
ATOM   7047  O  O    . GLU C  1 10  ? -33.051 -11.738 36.345  1.00 18.45  ?  10  GLU C O    1 
ATOM   7048  C  CB   . GLU C  1 10  ? -34.006 -12.776 33.480  1.00 17.62  ?  10  GLU C CB   1 
ATOM   7049  C  CG   . GLU C  1 10  ? -33.706 -14.246 33.389  1.00 20.96  ?  10  GLU C CG   1 
ATOM   7050  C  CD   . GLU C  1 10  ? -33.299 -14.655 31.962  1.00 27.55  ?  10  GLU C CD   1 
ATOM   7051  O  OE1  . GLU C  1 10  ? -33.993 -14.208 31.017  1.00 32.19  ?  10  GLU C OE1  1 
ATOM   7052  O  OE2  . GLU C  1 10  ? -32.338 -15.437 31.843  1.00 34.79  -1 10  GLU C OE2  1 
ATOM   7053  H  H    . GLU C  1 10  ? -34.400 -10.397 34.874  1.00 19.40  ?  10  GLU C H    1 
ATOM   7054  H  HA   . GLU C  1 10  ? -35.548 -12.847 34.842  1.00 20.22  ?  10  GLU C HA   1 
ATOM   7055  H  HB2  . GLU C  1 10  ? -34.557 -12.543 32.717  1.00 21.14  ?  10  GLU C HB2  1 
ATOM   7056  H  HB3  . GLU C  1 10  ? -33.161 -12.303 33.426  1.00 21.14  ?  10  GLU C HB3  1 
ATOM   7057  H  HG2  . GLU C  1 10  ? -32.973 -14.461 33.987  1.00 25.16  ?  10  GLU C HG2  1 
ATOM   7058  H  HG3  . GLU C  1 10  ? -34.498 -14.750 33.634  1.00 25.16  ?  10  GLU C HG3  1 
ATOM   7059  N  N    . PHE C  1 11  ? -34.088 -13.748 36.605  1.00 16.05  ?  11  PHE C N    1 
ATOM   7060  C  CA   . PHE C  1 11  ? -33.258 -14.239 37.703  1.00 16.00  ?  11  PHE C CA   1 
ATOM   7061  C  C    . PHE C  1 11  ? -32.948 -15.703 37.422  1.00 17.76  ?  11  PHE C C    1 
ATOM   7062  O  O    . PHE C  1 11  ? -33.839 -16.546 37.498  1.00 19.10  ?  11  PHE C O    1 
ATOM   7063  C  CB   . PHE C  1 11  ? -33.968 -14.108 39.050  1.00 19.98  ?  11  PHE C CB   1 
ATOM   7064  C  CG   . PHE C  1 11  ? -34.348 -12.705 39.413  1.00 19.63  ?  11  PHE C CG   1 
ATOM   7065  C  CD1  . PHE C  1 11  ? -35.592 -12.217 39.091  1.00 21.99  ?  11  PHE C CD1  1 
ATOM   7066  C  CD2  . PHE C  1 11  ? -33.451 -11.872 40.062  1.00 26.04  ?  11  PHE C CD2  1 
ATOM   7067  C  CE1  . PHE C  1 11  ? -35.956 -10.907 39.422  1.00 25.20  ?  11  PHE C CE1  1 
ATOM   7068  C  CE2  . PHE C  1 11  ? -33.834 -10.557 40.408  1.00 26.75  ?  11  PHE C CE2  1 
ATOM   7069  C  CZ   . PHE C  1 11  ? -35.095 -10.102 40.065  1.00 26.28  ?  11  PHE C CZ   1 
ATOM   7070  H  H    . PHE C  1 11  ? -34.729 -14.283 36.401  1.00 19.26  ?  11  PHE C H    1 
ATOM   7071  H  HA   . PHE C  1 11  ? -32.425 -13.742 37.736  1.00 19.20  ?  11  PHE C HA   1 
ATOM   7072  H  HB2  . PHE C  1 11  ? -34.780 -14.636 39.026  1.00 23.98  ?  11  PHE C HB2  1 
ATOM   7073  H  HB3  . PHE C  1 11  ? -33.380 -14.443 39.745  1.00 23.98  ?  11  PHE C HB3  1 
ATOM   7074  H  HD1  . PHE C  1 11  ? -36.200 -12.765 38.649  1.00 26.38  ?  11  PHE C HD1  1 
ATOM   7075  H  HD2  . PHE C  1 11  ? -32.607 -12.186 40.293  1.00 31.25  ?  11  PHE C HD2  1 
ATOM   7076  H  HE1  . PHE C  1 11  ? -36.804 -10.594 39.201  1.00 30.25  ?  11  PHE C HE1  1 
ATOM   7077  H  HE2  . PHE C  1 11  ? -33.235 -9.995  40.845  1.00 32.10  ?  11  PHE C HE2  1 
ATOM   7078  H  HZ   . PHE C  1 11  ? -35.347 -9.234  40.281  1.00 31.54  ?  11  PHE C HZ   1 
ATOM   7079  N  N    . LEU C  1 12  ? -31.696 -16.007 37.088  1.00 19.45  ?  12  LEU C N    1 
ATOM   7080  C  CA   . LEU C  1 12  ? -31.233 -17.410 36.951  1.00 20.28  ?  12  LEU C CA   1 
ATOM   7081  C  C    . LEU C  1 12  ? -32.274 -18.361 36.312  1.00 26.22  ?  12  LEU C C    1 
ATOM   7082  O  O    . LEU C  1 12  ? -32.738 -19.338 36.915  1.00 29.17  ?  12  LEU C O    1 
ATOM   7083  C  CB   . LEU C  1 12  ? -30.839 -17.973 38.296  1.00 18.95  ?  12  LEU C CB   1 
ATOM   7084  C  CG   . LEU C  1 12  ? -30.099 -19.299 38.113  1.00 27.57  ?  12  LEU C CG   1 
ATOM   7085  C  CD1  . LEU C  1 12  ? -28.755 -19.089 37.446  1.00 26.83  ?  12  LEU C CD1  1 
ATOM   7086  C  CD2  . LEU C  1 12  ? -29.942 -19.973 39.450  1.00 37.45  ?  12  LEU C CD2  1 
ATOM   7087  H  H    . LEU C  1 12  ? -31.084 -15.423 36.932  1.00 23.34  ?  12  LEU C H    1 
ATOM   7088  H  HA   . LEU C  1 12  ? -30.444 -17.420 36.387  1.00 24.33  ?  12  LEU C HA   1 
ATOM   7089  H  HB2  . LEU C  1 12  ? -30.249 -17.350 38.749  1.00 22.74  ?  12  LEU C HB2  1 
ATOM   7090  H  HB3  . LEU C  1 12  ? -31.635 -18.134 38.826  1.00 22.74  ?  12  LEU C HB3  1 
ATOM   7091  H  HG   . LEU C  1 12  ? -30.628 -19.880 37.544  1.00 33.08  ?  12  LEU C HG   1 
ATOM   7092  H  HD11 . LEU C  1 12  ? -28.315 -19.947 37.346  1.00 32.20  ?  12  LEU C HD11 1 
ATOM   7093  H  HD12 . LEU C  1 12  ? -28.894 -18.684 36.575  1.00 32.20  ?  12  LEU C HD12 1 
ATOM   7094  H  HD13 . LEU C  1 12  ? -28.216 -18.503 38.000  1.00 32.20  ?  12  LEU C HD13 1 
ATOM   7095  H  HD21 . LEU C  1 12  ? -29.472 -20.813 39.326  1.00 44.94  ?  12  LEU C HD21 1 
ATOM   7096  H  HD22 . LEU C  1 12  ? -29.434 -19.393 40.038  1.00 44.94  ?  12  LEU C HD22 1 
ATOM   7097  H  HD23 . LEU C  1 12  ? -30.821 -20.138 39.825  1.00 44.94  ?  12  LEU C HD23 1 
ATOM   7098  N  N    . GLY C  1 13  ? -32.600 -18.075 35.082  1.00 23.04  ?  13  GLY C N    1 
ATOM   7099  C  CA   . GLY C  1 13  ? -33.505 -18.908 34.310  1.00 26.51  ?  13  GLY C CA   1 
ATOM   7100  C  C    . GLY C  1 13  ? -34.979 -18.586 34.442  1.00 26.38  ?  13  GLY C C    1 
ATOM   7101  O  O    . GLY C  1 13  ? -35.798 -19.227 33.767  1.00 26.77  ?  13  GLY C O    1 
ATOM   7102  H  H    . GLY C  1 13  ? -32.308 -17.389 34.652  1.00 27.65  ?  13  GLY C H    1 
ATOM   7103  H  HA2  . GLY C  1 13  ? -33.271 -18.835 33.372  1.00 31.81  ?  13  GLY C HA2  1 
ATOM   7104  H  HA3  . GLY C  1 13  ? -33.380 -19.832 34.577  1.00 31.81  ?  13  GLY C HA3  1 
ATOM   7105  N  N    . ILE C  1 14  ? -35.357 -17.647 35.293  1.00 19.21  ?  14  ILE C N    1 
ATOM   7106  C  CA   . ILE C  1 14  ? -36.759 -17.313 35.507  1.00 19.36  ?  14  ILE C CA   1 
ATOM   7107  C  C    . ILE C  1 14  ? -36.959 -15.906 34.933  1.00 16.99  ?  14  ILE C C    1 
ATOM   7108  O  O    . ILE C  1 14  ? -36.548 -14.913 35.530  1.00 17.54  ?  14  ILE C O    1 
ATOM   7109  C  CB   . ILE C  1 14  ? -37.190 -17.390 36.976  1.00 19.32  ?  14  ILE C CB   1 
ATOM   7110  C  CG1  . ILE C  1 14  ? -36.842 -18.765 37.600  1.00 19.92  ?  14  ILE C CG1  1 
ATOM   7111  C  CG2  . ILE C  1 14  ? -38.705 -17.130 37.028  1.00 21.32  ?  14  ILE C CG2  1 
ATOM   7112  C  CD1  . ILE C  1 14  ? -37.362 -18.962 39.043  1.00 23.38  ?  14  ILE C CD1  1 
ATOM   7113  H  H    . ILE C  1 14  ? -34.813 -17.179 35.768  1.00 23.05  ?  14  ILE C H    1 
ATOM   7114  H  HA   . ILE C  1 14  ? -37.312 -17.927 35.000  1.00 23.23  ?  14  ILE C HA   1 
ATOM   7115  H  HB   . ILE C  1 14  ? -36.734 -16.694 37.474  1.00 23.19  ?  14  ILE C HB   1 
ATOM   7116  H  HG12 . ILE C  1 14  ? -37.230 -19.463 37.049  1.00 23.90  ?  14  ILE C HG12 1 
ATOM   7117  H  HG13 . ILE C  1 14  ? -35.877 -18.862 37.619  1.00 23.90  ?  14  ILE C HG13 1 
ATOM   7118  H  HG21 . ILE C  1 14  ? -39.001 -17.174 37.951  1.00 25.58  ?  14  ILE C HG21 1 
ATOM   7119  H  HG22 . ILE C  1 14  ? -38.887 -16.249 36.664  1.00 25.58  ?  14  ILE C HG22 1 
ATOM   7120  H  HG23 . ILE C  1 14  ? -39.160 -17.806 36.502  1.00 25.58  ?  14  ILE C HG23 1 
ATOM   7121  H  HD11 . ILE C  1 14  ? -37.102 -19.843 39.355  1.00 28.05  ?  14  ILE C HD11 1 
ATOM   7122  H  HD12 . ILE C  1 14  ? -36.974 -18.281 39.614  1.00 28.05  ?  14  ILE C HD12 1 
ATOM   7123  H  HD13 . ILE C  1 14  ? -38.329 -18.883 39.043  1.00 28.05  ?  14  ILE C HD13 1 
ATOM   7124  N  N    . ARG C  1 15  ? -37.604 -15.832 33.767  1.00 16.28  ?  15  ARG C N    1 
ATOM   7125  C  CA   . ARG C  1 15  ? -37.944 -14.587 33.096  1.00 15.68  ?  15  ARG C CA   1 
ATOM   7126  C  C    . ARG C  1 15  ? -39.375 -14.185 33.464  1.00 14.74  ?  15  ARG C C    1 
ATOM   7127  O  O    . ARG C  1 15  ? -40.305 -15.002 33.375  1.00 16.35  ?  15  ARG C O    1 
ATOM   7128  C  CB   . ARG C  1 15  ? -37.804 -14.804 31.591  1.00 18.42  ?  15  ARG C CB   1 
ATOM   7129  C  CG   . ARG C  1 15  ? -38.233 -13.685 30.718  1.00 17.81  ?  15  ARG C CG   1 
ATOM   7130  C  CD   . ARG C  1 15  ? -37.852 -14.073 29.242  1.00 19.37  ?  15  ARG C CD   1 
ATOM   7131  N  NE   . ARG C  1 15  ? -38.522 -13.241 28.282  1.00 18.44  ?  15  ARG C NE   1 
ATOM   7132  C  CZ   . ARG C  1 15  ? -38.070 -12.110 27.770  1.00 16.67  ?  15  ARG C CZ   1 
ATOM   7133  N  NH1  . ARG C  1 15  ? -36.885 -11.603 28.122  1.00 18.37  1  15  ARG C NH1  1 
ATOM   7134  N  NH2  . ARG C  1 15  ? -38.815 -11.497 26.891  1.00 17.64  ?  15  ARG C NH2  1 
ATOM   7135  H  H    . ARG C  1 15  ? -37.864 -16.525 33.330  1.00 19.53  ?  15  ARG C H    1 
ATOM   7136  H  HA   . ARG C  1 15  ? -37.336 -13.883 33.372  1.00 18.82  ?  15  ARG C HA   1 
ATOM   7137  H  HB2  . ARG C  1 15  ? -36.871 -14.979 31.396  1.00 22.10  ?  15  ARG C HB2  1 
ATOM   7138  H  HB3  . ARG C  1 15  ? -38.334 -15.579 31.346  1.00 22.10  ?  15  ARG C HB3  1 
ATOM   7139  H  HG2  . ARG C  1 15  ? -39.194 -13.565 30.777  1.00 21.37  ?  15  ARG C HG2  1 
ATOM   7140  H  HG3  . ARG C  1 15  ? -37.763 -12.872 30.963  1.00 21.37  ?  15  ARG C HG3  1 
ATOM   7141  H  HD2  . ARG C  1 15  ? -36.896 -13.967 29.120  1.00 23.24  ?  15  ARG C HD2  1 
ATOM   7142  H  HD3  . ARG C  1 15  ? -38.111 -14.994 29.077  1.00 23.24  ?  15  ARG C HD3  1 
ATOM   7143  H  HE   . ARG C  1 15  ? -39.295 -13.505 28.013  1.00 22.13  ?  15  ARG C HE   1 
ATOM   7144  H  HH11 . ARG C  1 15  ? -36.396 -12.014 28.698  1.00 22.04  ?  15  ARG C HH11 1 
ATOM   7145  H  HH12 . ARG C  1 15  ? -36.613 -10.865 27.776  1.00 22.04  ?  15  ARG C HH12 1 
ATOM   7146  H  HH21 . ARG C  1 15  ? -39.578 -11.827 26.669  1.00 21.16  ?  15  ARG C HH21 1 
ATOM   7147  H  HH22 . ARG C  1 15  ? -38.551 -10.756 26.544  1.00 21.16  ?  15  ARG C HH22 1 
ATOM   7148  N  N    . THR C  1 16  ? -39.541 -12.944 33.930  1.00 13.63  ?  16  THR C N    1 
ATOM   7149  C  CA   . THR C  1 16  ? -40.805 -12.517 34.529  1.00 16.18  ?  16  THR C CA   1 
ATOM   7150  C  C    . THR C  1 16  ? -41.036 -11.021 34.341  1.00 15.44  ?  16  THR C C    1 
ATOM   7151  O  O    . THR C  1 16  ? -40.108 -10.223 34.348  1.00 15.85  ?  16  THR C O    1 
ATOM   7152  C  CB   . THR C  1 16  ? -40.845 -12.904 36.024  1.00 14.53  ?  16  THR C CB   1 
ATOM   7153  O  OG1  . THR C  1 16  ? -42.117 -12.533 36.583  1.00 16.43  ?  16  THR C OG1  1 
ATOM   7154  C  CG2  . THR C  1 16  ? -39.764 -12.258 36.829  1.00 15.54  ?  16  THR C CG2  1 
ATOM   7155  H  H    . THR C  1 16  ? -38.937 -12.333 33.910  1.00 16.36  ?  16  THR C H    1 
ATOM   7156  H  HA   . THR C  1 16  ? -41.531 -12.983 34.085  1.00 19.42  ?  16  THR C HA   1 
ATOM   7157  H  HB   . THR C  1 16  ? -40.738 -13.865 36.101  1.00 17.44  ?  16  THR C HB   1 
ATOM   7158  H  HG1  . THR C  1 16  ? -42.736 -12.932 36.178  1.00 19.72  ?  16  THR C HG1  1 
ATOM   7159  H  HG21 . THR C  1 16  ? -39.832 -12.533 37.757  1.00 18.65  ?  16  THR C HG21 1 
ATOM   7160  H  HG22 . THR C  1 16  ? -38.895 -12.520 36.486  1.00 18.65  ?  16  THR C HG22 1 
ATOM   7161  H  HG23 . THR C  1 16  ? -39.845 -11.293 36.779  1.00 18.65  ?  16  THR C HG23 1 
ATOM   7162  N  N    . TYR C  1 17  ? -42.306 -10.648 34.117  1.00 15.15  ?  17  TYR C N    1 
ATOM   7163  C  CA   . TYR C  1 17  ? -42.753 -9.262  34.260  1.00 14.65  ?  17  TYR C CA   1 
ATOM   7164  C  C    . TYR C  1 17  ? -43.522 -9.082  35.568  1.00 14.39  ?  17  TYR C C    1 
ATOM   7165  O  O    . TYR C  1 17  ? -43.213 -8.186  36.365  1.00 15.41  ?  17  TYR C O    1 
ATOM   7166  C  CB   . TYR C  1 17  ? -43.634 -8.808  33.064  1.00 15.11  ?  17  TYR C CB   1 
ATOM   7167  C  CG   . TYR C  1 17  ? -44.186 -7.464  33.365  1.00 14.49  ?  17  TYR C CG   1 
ATOM   7168  C  CD1  . TYR C  1 17  ? -43.358 -6.341  33.387  1.00 16.62  ?  17  TYR C CD1  1 
ATOM   7169  C  CD2  . TYR C  1 17  ? -45.512 -7.316  33.755  1.00 15.85  ?  17  TYR C CD2  1 
ATOM   7170  C  CE1  . TYR C  1 17  ? -43.817 -5.115  33.797  1.00 18.30  ?  17  TYR C CE1  1 
ATOM   7171  C  CE2  . TYR C  1 17  ? -45.991 -6.093  34.148  1.00 18.44  ?  17  TYR C CE2  1 
ATOM   7172  C  CZ   . TYR C  1 17  ? -45.141 -4.994  34.166  1.00 18.68  ?  17  TYR C CZ   1 
ATOM   7173  O  OH   . TYR C  1 17  ? -45.583 -3.762  34.553  1.00 20.39  ?  17  TYR C OH   1 
ATOM   7174  H  H    . TYR C  1 17  ? -42.930 -11.189 33.879  1.00 18.18  ?  17  TYR C H    1 
ATOM   7175  H  HA   . TYR C  1 17  ? -41.975 -8.685  34.292  1.00 17.57  ?  17  TYR C HA   1 
ATOM   7176  H  HB2  . TYR C  1 17  ? -43.093 -8.751  32.260  1.00 18.13  ?  17  TYR C HB2  1 
ATOM   7177  H  HB3  . TYR C  1 17  ? -44.369 -9.428  32.942  1.00 18.13  ?  17  TYR C HB3  1 
ATOM   7178  H  HD1  . TYR C  1 17  ? -42.459 -6.438  33.168  1.00 19.94  ?  17  TYR C HD1  1 
ATOM   7179  H  HD2  . TYR C  1 17  ? -46.072 -8.058  33.772  1.00 19.02  ?  17  TYR C HD2  1 
ATOM   7180  H  HE1  . TYR C  1 17  ? -43.254 -4.374  33.798  1.00 21.95  ?  17  TYR C HE1  1 
ATOM   7181  H  HE2  . TYR C  1 17  ? -46.880 -6.000  34.402  1.00 22.12  ?  17  TYR C HE2  1 
ATOM   7182  H  HH   . TYR C  1 17  ? -46.398 -3.799  34.755  1.00 24.47  ?  17  TYR C HH   1 
ATOM   7183  N  N    . PHE C  1 18  ? -44.506 -9.952  35.815  1.00 15.63  ?  18  PHE C N    1 
ATOM   7184  C  CA   . PHE C  1 18  ? -45.491 -9.725  36.877  1.00 15.80  ?  18  PHE C CA   1 
ATOM   7185  C  C    . PHE C  1 18  ? -45.011 -10.170 38.258  1.00 19.15  ?  18  PHE C C    1 
ATOM   7186  O  O    . PHE C  1 18  ? -45.573 -9.730  39.263  1.00 17.00  ?  18  PHE C O    1 
ATOM   7187  C  CB   . PHE C  1 18  ? -46.793 -10.468 36.550  1.00 14.80  ?  18  PHE C CB   1 
ATOM   7188  C  CG   . PHE C  1 18  ? -47.586 -9.864  35.418  1.00 16.70  ?  18  PHE C CG   1 
ATOM   7189  C  CD1  . PHE C  1 18  ? -47.485 -10.368 34.126  1.00 16.25  ?  18  PHE C CD1  1 
ATOM   7190  C  CD2  . PHE C  1 18  ? -48.451 -8.789  35.652  1.00 18.59  ?  18  PHE C CD2  1 
ATOM   7191  C  CE1  . PHE C  1 18  ? -48.215 -9.809  33.093  1.00 15.73  ?  18  PHE C CE1  1 
ATOM   7192  C  CE2  . PHE C  1 18  ? -49.188 -8.239  34.619  1.00 19.90  ?  18  PHE C CE2  1 
ATOM   7193  C  CZ   . PHE C  1 18  ? -49.059 -8.732  33.337  1.00 18.46  ?  18  PHE C CZ   1 
ATOM   7194  H  H    . PHE C  1 18  ? -44.625 -10.684 35.379  1.00 18.76  ?  18  PHE C H    1 
ATOM   7195  H  HA   . PHE C  1 18  ? -45.691 -8.777  36.923  1.00 18.96  ?  18  PHE C HA   1 
ATOM   7196  H  HB2  . PHE C  1 18  ? -46.577 -11.381 36.303  1.00 17.76  ?  18  PHE C HB2  1 
ATOM   7197  H  HB3  . PHE C  1 18  ? -47.358 -10.468 37.338  1.00 17.76  ?  18  PHE C HB3  1 
ATOM   7198  H  HD1  . PHE C  1 18  ? -46.913 -11.081 33.953  1.00 19.49  ?  18  PHE C HD1  1 
ATOM   7199  H  HD2  . PHE C  1 18  ? -48.534 -8.444  36.511  1.00 22.30  ?  18  PHE C HD2  1 
ATOM   7200  H  HE1  . PHE C  1 18  ? -48.135 -10.150 32.231  1.00 18.88  ?  18  PHE C HE1  1 
ATOM   7201  H  HE2  . PHE C  1 18  ? -49.753 -7.519  34.785  1.00 23.89  ?  18  PHE C HE2  1 
ATOM   7202  H  HZ   . PHE C  1 18  ? -49.557 -8.364  32.643  1.00 22.15  ?  18  PHE C HZ   1 
ATOM   7203  N  N    . PHE C  1 19  ? -43.993 -11.038 38.340  1.00 15.69  ?  19  PHE C N    1 
ATOM   7204  C  CA   . PHE C  1 19  ? -43.609 -11.686 39.603  1.00 16.51  ?  19  PHE C CA   1 
ATOM   7205  C  C    . PHE C  1 19  ? -42.095 -11.658 39.873  1.00 17.32  ?  19  PHE C C    1 
ATOM   7206  O  O    . PHE C  1 19  ? -41.506 -12.672 40.252  1.00 17.33  ?  19  PHE C O    1 
ATOM   7207  C  CB   . PHE C  1 19  ? -44.111 -13.129 39.601  1.00 18.33  ?  19  PHE C CB   1 
ATOM   7208  C  CG   . PHE C  1 19  ? -45.618 -13.252 39.481  1.00 19.12  ?  19  PHE C CG   1 
ATOM   7209  C  CD1  . PHE C  1 19  ? -46.420 -12.922 40.541  1.00 18.95  ?  19  PHE C CD1  1 
ATOM   7210  C  CD2  . PHE C  1 19  ? -46.205 -13.663 38.283  1.00 19.91  ?  19  PHE C CD2  1 
ATOM   7211  C  CE1  . PHE C  1 19  ? -47.825 -13.026 40.439  1.00 19.56  ?  19  PHE C CE1  1 
ATOM   7212  C  CE2  . PHE C  1 19  ? -47.588 -13.763 38.172  1.00 19.29  ?  19  PHE C CE2  1 
ATOM   7213  C  CZ   . PHE C  1 19  ? -48.386 -13.435 39.265  1.00 19.27  ?  19  PHE C CZ   1 
ATOM   7214  H  H    . PHE C  1 19  ? -43.504 -11.270 37.671  1.00 18.83  ?  19  PHE C H    1 
ATOM   7215  H  HA   . PHE C  1 19  ? -44.047 -11.223 40.334  1.00 19.81  ?  19  PHE C HA   1 
ATOM   7216  H  HB2  . PHE C  1 19  ? -43.714 -13.598 38.850  1.00 22.00  ?  19  PHE C HB2  1 
ATOM   7217  H  HB3  . PHE C  1 19  ? -43.844 -13.554 40.432  1.00 22.00  ?  19  PHE C HB3  1 
ATOM   7218  H  HD1  . PHE C  1 19  ? -46.035 -12.644 41.341  1.00 22.75  ?  19  PHE C HD1  1 
ATOM   7219  H  HD2  . PHE C  1 19  ? -45.667 -13.882 37.557  1.00 23.89  ?  19  PHE C HD2  1 
ATOM   7220  H  HE1  . PHE C  1 19  ? -48.364 -12.806 41.165  1.00 23.47  ?  19  PHE C HE1  1 
ATOM   7221  H  HE2  . PHE C  1 19  ? -47.976 -14.044 37.375  1.00 23.15  ?  19  PHE C HE2  1 
ATOM   7222  H  HZ   . PHE C  1 19  ? -49.311 -13.502 39.196  1.00 23.13  ?  19  PHE C HZ   1 
ATOM   7223  N  N    . PRO C  1 20  ? -41.442 -10.512 39.735  1.00 15.73  ?  20  PRO C N    1 
ATOM   7224  C  CA   . PRO C  1 20  ? -39.976 -10.520 39.977  1.00 16.94  ?  20  PRO C CA   1 
ATOM   7225  C  C    . PRO C  1 20  ? -39.547 -10.921 41.384  1.00 18.92  ?  20  PRO C C    1 
ATOM   7226  O  O    . PRO C  1 20  ? -38.546 -11.642 41.517  1.00 18.75  ?  20  PRO C O    1 
ATOM   7227  C  CB   . PRO C  1 20  ? -39.566 -9.078  39.665  1.00 17.88  ?  20  PRO C CB   1 
ATOM   7228  C  CG   . PRO C  1 20  ? -40.804 -8.275  39.789  1.00 21.60  ?  20  PRO C CG   1 
ATOM   7229  C  CD   . PRO C  1 20  ? -41.901 -9.164  39.334  1.00 16.19  ?  20  PRO C CD   1 
ATOM   7230  H  HA   . PRO C  1 20  ? -39.543 -11.111 39.341  1.00 20.32  ?  20  PRO C HA   1 
ATOM   7231  H  HB2  . PRO C  1 20  ? -38.902 -8.782  40.306  1.00 21.46  ?  20  PRO C HB2  1 
ATOM   7232  H  HB3  . PRO C  1 20  ? -39.216 -9.028  38.762  1.00 21.46  ?  20  PRO C HB3  1 
ATOM   7233  H  HG2  . PRO C  1 20  ? -40.934 -8.019  40.715  1.00 25.92  ?  20  PRO C HG2  1 
ATOM   7234  H  HG3  . PRO C  1 20  ? -40.742 -7.491  39.222  1.00 25.92  ?  20  PRO C HG3  1 
ATOM   7235  H  HD2  . PRO C  1 20  ? -42.728 -8.940  39.788  1.00 19.43  ?  20  PRO C HD2  1 
ATOM   7236  H  HD3  . PRO C  1 20  ? -41.999 -9.113  38.370  1.00 19.43  ?  20  PRO C HD3  1 
ATOM   7237  N  N    . ASN C  1 21  ? -40.249 -10.489 42.444  1.00 18.33  ?  21  ASN C N    1 
ATOM   7238  C  CA   . ASN C  1 21  ? -39.791 -10.873 43.779  1.00 18.37  ?  21  ASN C CA   1 
ATOM   7239  C  C    . ASN C  1 21  ? -40.066 -12.350 44.050  1.00 21.18  ?  21  ASN C C    1 
ATOM   7240  O  O    . ASN C  1 21  ? -39.324 -12.978 44.816  1.00 18.80  ?  21  ASN C O    1 
ATOM   7241  C  CB   . ASN C  1 21  ? -40.448 -9.978  44.838  1.00 19.97  ?  21  ASN C CB   1 
ATOM   7242  C  CG   . ASN C  1 21  ? -39.772 -10.079 46.190  1.00 22.85  ?  21  ASN C CG   1 
ATOM   7243  O  OD1  . ASN C  1 21  ? -38.536 -10.134 46.282  1.00 26.95  ?  21  ASN C OD1  1 
ATOM   7244  N  ND2  . ASN C  1 21  ? -40.574 -10.056 47.254  1.00 26.19  ?  21  ASN C ND2  1 
ATOM   7245  H  H    . ASN C  1 21  ? -40.955 -10.000 42.418  1.00 22.00  ?  21  ASN C H    1 
ATOM   7246  H  HA   . ASN C  1 21  ? -38.832 -10.737 43.830  1.00 22.04  ?  21  ASN C HA   1 
ATOM   7247  H  HB2  . ASN C  1 21  ? -40.398 -9.055  44.546  1.00 23.96  ?  21  ASN C HB2  1 
ATOM   7248  H  HB3  . ASN C  1 21  ? -41.374 -10.243 44.945  1.00 23.96  ?  21  ASN C HB3  1 
ATOM   7249  H  HD21 . ASN C  1 21  ? -40.242 -10.111 48.045  1.00 31.43  ?  21  ASN C HD21 1 
ATOM   7250  H  HD22 . ASN C  1 21  ? -41.425 -9.987  47.149  1.00 31.43  ?  21  ASN C HD22 1 
ATOM   7251  N  N    . LEU C  1 22  ? -41.095 -12.932 43.421  1.00 18.95  ?  22  LEU C N    1 
ATOM   7252  C  CA   . LEU C  1 22  ? -41.326 -14.371 43.559  1.00 17.29  ?  22  LEU C CA   1 
ATOM   7253  C  C    . LEU C  1 22  ? -40.203 -15.155 42.897  1.00 18.39  ?  22  LEU C C    1 
ATOM   7254  O  O    . LEU C  1 22  ? -39.723 -16.161 43.440  1.00 18.06  ?  22  LEU C O    1 
ATOM   7255  C  CB   . LEU C  1 22  ? -42.679 -14.749 42.952  1.00 18.23  ?  22  LEU C CB   1 
ATOM   7256  C  CG   . LEU C  1 22  ? -43.051 -16.235 42.937  1.00 21.85  ?  22  LEU C CG   1 
ATOM   7257  C  CD1  . LEU C  1 22  ? -43.221 -16.746 44.350  1.00 26.81  ?  22  LEU C CD1  1 
ATOM   7258  C  CD2  . LEU C  1 22  ? -44.340 -16.466 42.161  1.00 22.13  ?  22  LEU C CD2  1 
ATOM   7259  H  H    . LEU C  1 22  ? -41.662 -12.524 42.919  1.00 22.74  ?  22  LEU C H    1 
ATOM   7260  H  HA   . LEU C  1 22  ? -41.342 -14.602 44.501  1.00 20.74  ?  22  LEU C HA   1 
ATOM   7261  H  HB2  . LEU C  1 22  ? -43.372 -14.287 43.450  1.00 21.88  ?  22  LEU C HB2  1 
ATOM   7262  H  HB3  . LEU C  1 22  ? -42.692 -14.443 42.031  1.00 21.88  ?  22  LEU C HB3  1 
ATOM   7263  H  HG   . LEU C  1 22  ? -42.342 -16.741 42.511  1.00 26.22  ?  22  LEU C HG   1 
ATOM   7264  H  HD11 . LEU C  1 22  ? -43.456 -17.687 44.320  1.00 32.17  ?  22  LEU C HD11 1 
ATOM   7265  H  HD12 . LEU C  1 22  ? -42.387 -16.628 44.831  1.00 32.17  ?  22  LEU C HD12 1 
ATOM   7266  H  HD13 . LEU C  1 22  ? -43.927 -16.243 44.785  1.00 32.17  ?  22  LEU C HD13 1 
ATOM   7267  H  HD21 . LEU C  1 22  ? -44.548 -17.413 42.170  1.00 26.56  ?  22  LEU C HD21 1 
ATOM   7268  H  HD22 . LEU C  1 22  ? -45.056 -15.965 42.584  1.00 26.56  ?  22  LEU C HD22 1 
ATOM   7269  H  HD23 . LEU C  1 22  ? -44.218 -16.162 41.249  1.00 26.56  ?  22  LEU C HD23 1 
ATOM   7270  N  N    . ALA C  1 23  ? -39.805 -14.732 41.697  1.00 19.23  ?  23  ALA C N    1 
ATOM   7271  C  CA   . ALA C  1 23  ? -38.694 -15.378 41.013  1.00 17.07  ?  23  ALA C CA   1 
ATOM   7272  C  C    . ALA C  1 23  ? -37.420 -15.310 41.853  1.00 18.39  ?  23  ALA C C    1 
ATOM   7273  O  O    . ALA C  1 23  ? -36.716 -16.306 42.012  1.00 18.26  ?  23  ALA C O    1 
ATOM   7274  C  CB   . ALA C  1 23  ? -38.491 -14.714 39.656  1.00 17.87  ?  23  ALA C CB   1 
ATOM   7275  H  H    . ALA C  1 23  ? -40.160 -14.079 41.264  1.00 23.07  ?  23  ALA C H    1 
ATOM   7276  H  HA   . ALA C  1 23  ? -38.910 -16.312 40.865  1.00 20.49  ?  23  ALA C HA   1 
ATOM   7277  H  HB1  . ALA C  1 23  ? -37.751 -15.145 39.201  1.00 21.44  ?  23  ALA C HB1  1 
ATOM   7278  H  HB2  . ALA C  1 23  ? -39.303 -14.810 39.133  1.00 21.44  ?  23  ALA C HB2  1 
ATOM   7279  H  HB3  . ALA C  1 23  ? -38.294 -13.773 39.791  1.00 21.44  ?  23  ALA C HB3  1 
ATOM   7280  N  N    . LEU C  1 24  ? -37.096 -14.128 42.358  1.00 15.88  ?  24  LEU C N    1 
ATOM   7281  C  CA   . LEU C  1 24  ? -35.902 -13.965 43.162  1.00 18.01  ?  24  LEU C CA   1 
ATOM   7282  C  C    . LEU C  1 24  ? -35.978 -14.827 44.414  1.00 19.70  ?  24  LEU C C    1 
ATOM   7283  O  O    . LEU C  1 24  ? -34.991 -15.476 44.787  1.00 20.56  ?  24  LEU C O    1 
ATOM   7284  C  CB   . LEU C  1 24  ? -35.736 -12.494 43.548  1.00 20.35  ?  24  LEU C CB   1 
ATOM   7285  C  CG   . LEU C  1 24  ? -34.540 -12.210 44.476  1.00 23.85  ?  24  LEU C CG   1 
ATOM   7286  C  CD1  . LEU C  1 24  ? -33.206 -12.657 43.841  1.00 22.43  ?  24  LEU C CD1  1 
ATOM   7287  C  CD2  . LEU C  1 24  ? -34.486 -10.734 44.809  1.00 28.53  ?  24  LEU C CD2  1 
ATOM   7288  H  H    . LEU C  1 24  ? -37.552 -13.407 42.248  1.00 19.06  ?  24  LEU C H    1 
ATOM   7289  H  HA   . LEU C  1 24  ? -35.125 -14.237 42.648  1.00 21.61  ?  24  LEU C HA   1 
ATOM   7290  H  HB2  . LEU C  1 24  ? -35.611 -11.973 42.740  1.00 24.43  ?  24  LEU C HB2  1 
ATOM   7291  H  HB3  . LEU C  1 24  ? -36.540 -12.201 44.005  1.00 24.43  ?  24  LEU C HB3  1 
ATOM   7292  H  HG   . LEU C  1 24  ? -34.658 -12.701 45.305  1.00 28.62  ?  24  LEU C HG   1 
ATOM   7293  H  HD11 . LEU C  1 24  ? -32.482 -12.460 44.456  1.00 26.91  ?  24  LEU C HD11 1 
ATOM   7294  H  HD12 . LEU C  1 24  ? -33.243 -13.610 43.667  1.00 26.91  ?  24  LEU C HD12 1 
ATOM   7295  H  HD13 . LEU C  1 24  ? -33.075 -12.173 43.010  1.00 26.91  ?  24  LEU C HD13 1 
ATOM   7296  H  HD21 . LEU C  1 24  ? -33.729 -10.570 45.394  1.00 34.24  ?  24  LEU C HD21 1 
ATOM   7297  H  HD22 . LEU C  1 24  ? -34.385 -10.229 43.987  1.00 34.24  ?  24  LEU C HD22 1 
ATOM   7298  H  HD23 . LEU C  1 24  ? -35.309 -10.480 45.255  1.00 34.24  ?  24  LEU C HD23 1 
ATOM   7299  N  N    . TYR C  1 25  ? -37.138 -14.837 45.078  1.00 17.82  ?  25  TYR C N    1 
ATOM   7300  C  CA   . TYR C  1 25  ? -37.311 -15.681 46.253  1.00 20.20  ?  25  TYR C CA   1 
ATOM   7301  C  C    . TYR C  1 25  ? -36.976 -17.135 45.933  1.00 20.14  ?  25  TYR C C    1 
ATOM   7302  O  O    . TYR C  1 25  ? -36.244 -17.797 46.678  1.00 20.11  ?  25  TYR C O    1 
ATOM   7303  C  CB   . TYR C  1 25  ? -38.744 -15.564 46.810  1.00 18.54  ?  25  TYR C CB   1 
ATOM   7304  C  CG   . TYR C  1 25  ? -38.893 -16.395 48.065  1.00 21.21  ?  25  TYR C CG   1 
ATOM   7305  C  CD1  . TYR C  1 25  ? -38.646 -15.838 49.300  1.00 25.50  ?  25  TYR C CD1  1 
ATOM   7306  C  CD2  . TYR C  1 25  ? -39.193 -17.747 47.999  1.00 20.81  ?  25  TYR C CD2  1 
ATOM   7307  C  CE1  . TYR C  1 25  ? -38.732 -16.606 50.455  1.00 25.47  ?  25  TYR C CE1  1 
ATOM   7308  C  CE2  . TYR C  1 25  ? -39.265 -18.519 49.135  1.00 23.75  ?  25  TYR C CE2  1 
ATOM   7309  C  CZ   . TYR C  1 25  ? -39.032 -17.937 50.359  1.00 28.24  ?  25  TYR C CZ   1 
ATOM   7310  O  OH   . TYR C  1 25  ? -39.100 -18.729 51.482  1.00 28.26  ?  25  TYR C OH   1 
ATOM   7311  H  H    . TYR C  1 25  ? -37.829 -14.370 44.868  1.00 21.38  ?  25  TYR C H    1 
ATOM   7312  H  HA   . TYR C  1 25  ? -36.700 -15.381 46.944  1.00 24.24  ?  25  TYR C HA   1 
ATOM   7313  H  HB2  . TYR C  1 25  ? -38.931 -14.638 47.031  1.00 22.24  ?  25  TYR C HB2  1 
ATOM   7314  H  HB3  . TYR C  1 25  ? -39.375 -15.889 46.149  1.00 22.24  ?  25  TYR C HB3  1 
ATOM   7315  H  HD1  . TYR C  1 25  ? -38.432 -14.936 49.362  1.00 30.60  ?  25  TYR C HD1  1 
ATOM   7316  H  HD2  . TYR C  1 25  ? -39.339 -18.142 47.169  1.00 24.97  ?  25  TYR C HD2  1 
ATOM   7317  H  HE1  . TYR C  1 25  ? -38.567 -16.222 51.286  1.00 30.57  ?  25  TYR C HE1  1 
ATOM   7318  H  HE2  . TYR C  1 25  ? -39.474 -19.423 49.076  1.00 28.51  ?  25  TYR C HE2  1 
ATOM   7319  H  HH   . TYR C  1 25  ? -38.937 -18.271 52.167  1.00 33.91  ?  25  TYR C HH   1 
ATOM   7320  N  N    . ALA C  1 26  ? -37.505 -17.648 44.824  1.00 19.60  ?  26  ALA C N    1 
ATOM   7321  C  CA   . ALA C  1 26  ? -37.335 -19.060 44.503  1.00 19.94  ?  26  ALA C CA   1 
ATOM   7322  C  C    . ALA C  1 26  ? -35.884 -19.390 44.195  1.00 21.90  ?  26  ALA C C    1 
ATOM   7323  O  O    . ALA C  1 26  ? -35.385 -20.462 44.577  1.00 21.79  ?  26  ALA C O    1 
ATOM   7324  C  CB   . ALA C  1 26  ? -38.229 -19.430 43.317  1.00 20.45  ?  26  ALA C CB   1 
ATOM   7325  H  H    . ALA C  1 26  ? -37.962 -17.203 44.247  1.00 23.52  ?  26  ALA C H    1 
ATOM   7326  H  HA   . ALA C  1 26  ? -37.610 -19.594 45.265  1.00 23.93  ?  26  ALA C HA   1 
ATOM   7327  H  HB1  . ALA C  1 26  ? -38.108 -20.371 43.112  1.00 24.54  ?  26  ALA C HB1  1 
ATOM   7328  H  HB2  . ALA C  1 26  ? -39.154 -19.259 43.554  1.00 24.54  ?  26  ALA C HB2  1 
ATOM   7329  H  HB3  . ALA C  1 26  ? -37.977 -18.890 42.552  1.00 24.54  ?  26  ALA C HB3  1 
ATOM   7330  N  N    . VAL C  1 27  ? -35.191 -18.486 43.493  1.00 19.87  ?  27  VAL C N    1 
ATOM   7331  C  CA   . VAL C  1 27  ? -33.783 -18.686 43.161  1.00 22.75  ?  27  VAL C CA   1 
ATOM   7332  C  C    . VAL C  1 27  ? -32.915 -18.710 44.419  1.00 23.29  ?  27  VAL C C    1 
ATOM   7333  O  O    . VAL C  1 27  ? -31.927 -19.464 44.495  1.00 24.74  ?  27  VAL C O    1 
ATOM   7334  C  CB   . VAL C  1 27  ? -33.330 -17.599 42.166  1.00 23.53  ?  27  VAL C CB   1 
ATOM   7335  C  CG1  . VAL C  1 27  ? -31.791 -17.498 42.117  1.00 31.67  ?  27  VAL C CG1  1 
ATOM   7336  C  CG2  . VAL C  1 27  ? -33.939 -17.889 40.760  1.00 25.70  ?  27  VAL C CG2  1 
ATOM   7337  H  H    . VAL C  1 27  ? -35.518 -17.747 43.200  1.00 23.84  ?  27  VAL C H    1 
ATOM   7338  H  HA   . VAL C  1 27  ? -33.687 -19.545 42.721  1.00 27.30  ?  27  VAL C HA   1 
ATOM   7339  H  HB   . VAL C  1 27  ? -33.672 -16.742 42.465  1.00 28.24  ?  27  VAL C HB   1 
ATOM   7340  H  HG11 . VAL C  1 27  ? -31.540 -16.807 41.484  1.00 38.00  ?  27  VAL C HG11 1 
ATOM   7341  H  HG12 . VAL C  1 27  ? -31.461 -17.272 43.001  1.00 38.00  ?  27  VAL C HG12 1 
ATOM   7342  H  HG13 . VAL C  1 27  ? -31.427 -18.352 41.837  1.00 38.00  ?  27  VAL C HG13 1 
ATOM   7343  H  HG21 . VAL C  1 27  ? -33.649 -17.200 40.142  1.00 30.84  ?  27  VAL C HG21 1 
ATOM   7344  H  HG22 . VAL C  1 27  ? -33.633 -18.757 40.456  1.00 30.84  ?  27  VAL C HG22 1 
ATOM   7345  H  HG23 . VAL C  1 27  ? -34.907 -17.885 40.829  1.00 30.84  ?  27  VAL C HG23 1 
ATOM   7346  N  N    . ASN C  1 28  ? -33.230 -17.856 45.399  1.00 20.67  ?  28  ASN C N    1 
ATOM   7347  C  CA   . ASN C  1 28  ? -32.469 -17.792 46.641  1.00 23.75  ?  28  ASN C CA   1 
ATOM   7348  C  C    . ASN C  1 28  ? -32.795 -18.943 47.590  1.00 32.12  ?  28  ASN C C    1 
ATOM   7349  O  O    . ASN C  1 28  ? -31.908 -19.411 48.305  1.00 29.88  ?  28  ASN C O    1 
ATOM   7350  C  CB   . ASN C  1 28  ? -32.725 -16.462 47.356  1.00 19.78  ?  28  ASN C CB   1 
ATOM   7351  C  CG   . ASN C  1 28  ? -31.886 -15.328 46.797  1.00 23.60  ?  28  ASN C CG   1 
ATOM   7352  O  OD1  . ASN C  1 28  ? -30.760 -15.550 46.321  1.00 24.39  ?  28  ASN C OD1  1 
ATOM   7353  N  ND2  . ASN C  1 28  ? -32.391 -14.100 46.896  1.00 23.14  ?  28  ASN C ND2  1 
ATOM   7354  H  H    . ASN C  1 28  ? -33.887 -17.302 45.364  1.00 24.81  ?  28  ASN C H    1 
ATOM   7355  H  HA   . ASN C  1 28  ? -31.524 -17.840 46.431  1.00 28.49  ?  28  ASN C HA   1 
ATOM   7356  H  HB2  . ASN C  1 28  ? -33.660 -16.222 47.255  1.00 23.73  ?  28  ASN C HB2  1 
ATOM   7357  H  HB3  . ASN C  1 28  ? -32.508 -16.561 48.296  1.00 23.73  ?  28  ASN C HB3  1 
ATOM   7358  H  HD21 . ASN C  1 28  ? -31.949 -13.428 46.592  1.00 27.77  ?  28  ASN C HD21 1 
ATOM   7359  H  HD22 . ASN C  1 28  ? -33.159 -13.980 47.264  1.00 27.77  ?  28  ASN C HD22 1 
ATOM   7360  N  N    . ASN C  1 29  ? -34.029 -19.434 47.590  1.00 21.33  ?  29  ASN C N    1 
ATOM   7361  C  CA   . ASN C  1 29  ? -34.511 -20.316 48.648  1.00 25.64  ?  29  ASN C CA   1 
ATOM   7362  C  C    . ASN C  1 29  ? -34.896 -21.702 48.154  1.00 23.87  ?  29  ASN C C    1 
ATOM   7363  O  O    . ASN C  1 29  ? -35.742 -22.351 48.788  1.00 22.77  ?  29  ASN C O    1 
ATOM   7364  C  CB   . ASN C  1 29  ? -35.701 -19.662 49.341  1.00 23.32  ?  29  ASN C CB   1 
ATOM   7365  C  CG   . ASN C  1 29  ? -35.287 -18.428 50.123  1.00 28.36  ?  29  ASN C CG   1 
ATOM   7366  O  OD1  . ASN C  1 29  ? -34.725 -18.532 51.223  1.00 32.41  ?  29  ASN C OD1  1 
ATOM   7367  N  ND2  . ASN C  1 29  ? -35.521 -17.263 49.558  1.00 24.04  ?  29  ASN C ND2  1 
ATOM   7368  H  H    . ASN C  1 29  ? -34.614 -19.270 46.981  1.00 25.59  ?  29  ASN C H    1 
ATOM   7369  H  HA   . ASN C  1 29  ? -33.807 -20.424 49.307  1.00 30.76  ?  29  ASN C HA   1 
ATOM   7370  H  HB2  . ASN C  1 29  ? -36.352 -19.395 48.674  1.00 27.98  ?  29  ASN C HB2  1 
ATOM   7371  H  HB3  . ASN C  1 29  ? -36.096 -20.295 49.961  1.00 27.98  ?  29  ASN C HB3  1 
ATOM   7372  H  HD21 . ASN C  1 29  ? -35.304 -16.536 49.964  1.00 28.85  ?  29  ASN C HD21 1 
ATOM   7373  H  HD22 . ASN C  1 29  ? -35.892 -17.227 48.783  1.00 28.85  ?  29  ASN C HD22 1 
ATOM   7374  N  N    . ASP C  1 30  ? -34.322 -22.165 47.034  1.00 21.83  ?  30  ASP C N    1 
ATOM   7375  C  CA   . ASP C  1 30  ? -34.771 -23.437 46.475  1.00 22.79  ?  30  ASP C CA   1 
ATOM   7376  C  C    . ASP C  1 30  ? -34.523 -24.601 47.435  1.00 20.18  ?  30  ASP C C    1 
ATOM   7377  O  O    . ASP C  1 30  ? -35.345 -25.509 47.521  1.00 21.90  ?  30  ASP C O    1 
ATOM   7378  C  CB   . ASP C  1 30  ? -34.146 -23.703 45.077  1.00 19.17  ?  30  ASP C CB   1 
ATOM   7379  C  CG   . ASP C  1 30  ? -32.641 -23.802 45.064  1.00 29.34  ?  30  ASP C CG   1 
ATOM   7380  O  OD1  . ASP C  1 30  ? -31.956 -23.109 45.821  1.00 29.73  ?  30  ASP C OD1  1 
ATOM   7381  O  OD2  . ASP C  1 30  ? -32.130 -24.561 44.205  1.00 30.69  -1 30  ASP C OD2  1 
ATOM   7382  H  H    . ASP C  1 30  ? -33.694 -21.774 46.596  1.00 26.20  ?  30  ASP C H    1 
ATOM   7383  H  HA   . ASP C  1 30  ? -35.730 -23.381 46.346  1.00 27.35  ?  30  ASP C HA   1 
ATOM   7384  H  HB2  . ASP C  1 30  ? -34.498 -24.540 44.736  1.00 23.00  ?  30  ASP C HB2  1 
ATOM   7385  H  HB3  . ASP C  1 30  ? -34.398 -22.978 44.483  1.00 23.00  ?  30  ASP C HB3  1 
ATOM   7386  N  N    . GLU C  1 31  ? -33.411 -24.594 48.187  1.00 21.07  ?  31  GLU C N    1 
ATOM   7387  C  CA   . GLU C  1 31  ? -33.180 -25.727 49.083  1.00 25.47  ?  31  GLU C CA   1 
ATOM   7388  C  C    . GLU C  1 31  ? -34.173 -25.718 50.235  1.00 25.56  ?  31  GLU C C    1 
ATOM   7389  O  O    . GLU C  1 31  ? -34.649 -26.777 50.662  1.00 26.39  ?  31  GLU C O    1 
ATOM   7390  C  CB   . GLU C  1 31  ? -31.734 -25.725 49.596  1.00 22.83  ?  31  GLU C CB   1 
ATOM   7391  C  CG   . GLU C  1 31  ? -31.414 -26.842 50.581  1.00 27.38  ?  31  GLU C CG   1 
ATOM   7392  C  CD   . GLU C  1 31  ? -31.634 -28.251 50.031  1.00 39.12  ?  31  GLU C CD   1 
ATOM   7393  O  OE1  . GLU C  1 31  ? -31.631 -28.453 48.793  1.00 31.56  ?  31  GLU C OE1  1 
ATOM   7394  O  OE2  . GLU C  1 31  ? -31.814 -29.170 50.860  1.00 34.29  -1 31  GLU C OE2  1 
ATOM   7395  H  H    . GLU C  1 31  ? -32.810 -23.980 48.197  1.00 25.28  ?  31  GLU C H    1 
ATOM   7396  H  HA   . GLU C  1 31  ? -33.314 -26.549 48.585  1.00 30.56  ?  31  GLU C HA   1 
ATOM   7397  H  HB2  . GLU C  1 31  ? -31.135 -25.820 48.838  1.00 27.40  ?  31  GLU C HB2  1 
ATOM   7398  H  HB3  . GLU C  1 31  ? -31.564 -24.881 50.043  1.00 27.40  ?  31  GLU C HB3  1 
ATOM   7399  H  HG2  . GLU C  1 31  ? -30.483 -26.769 50.841  1.00 32.86  ?  31  GLU C HG2  1 
ATOM   7400  H  HG3  . GLU C  1 31  ? -31.981 -26.738 51.361  1.00 32.86  ?  31  GLU C HG3  1 
ATOM   7401  N  N    . LEU C  1 32  ? -34.534 -24.528 50.727  1.00 21.86  ?  32  LEU C N    1 
ATOM   7402  C  CA   . LEU C  1 32  ? -35.555 -24.448 51.765  1.00 24.06  ?  32  LEU C CA   1 
ATOM   7403  C  C    . LEU C  1 32  ? -36.911 -24.921 51.252  1.00 25.21  ?  32  LEU C C    1 
ATOM   7404  O  O    . LEU C  1 32  ? -37.660 -25.575 51.980  1.00 25.39  ?  32  LEU C O    1 
ATOM   7405  C  CB   . LEU C  1 32  ? -35.642 -23.016 52.299  1.00 28.33  ?  32  LEU C CB   1 
ATOM   7406  C  CG   . LEU C  1 32  ? -36.635 -22.807 53.431  1.00 27.43  ?  32  LEU C CG   1 
ATOM   7407  C  CD1  . LEU C  1 32  ? -36.201 -23.591 54.702  1.00 28.90  ?  32  LEU C CD1  1 
ATOM   7408  C  CD2  . LEU C  1 32  ? -36.788 -21.304 53.698  1.00 27.93  ?  32  LEU C CD2  1 
ATOM   7409  H  H    . LEU C  1 32  ? -34.208 -23.771 50.481  1.00 26.23  ?  32  LEU C H    1 
ATOM   7410  H  HA   . LEU C  1 32  ? -35.299 -25.025 52.501  1.00 28.88  ?  32  LEU C HA   1 
ATOM   7411  H  HB2  . LEU C  1 32  ? -34.767 -22.756 52.627  1.00 34.00  ?  32  LEU C HB2  1 
ATOM   7412  H  HB3  . LEU C  1 32  ? -35.903 -22.431 51.571  1.00 34.00  ?  32  LEU C HB3  1 
ATOM   7413  H  HG   . LEU C  1 32  ? -37.500 -23.148 53.155  1.00 32.92  ?  32  LEU C HG   1 
ATOM   7414  H  HD11 . LEU C  1 32  ? -36.852 -23.438 55.404  1.00 34.69  ?  32  LEU C HD11 1 
ATOM   7415  H  HD12 . LEU C  1 32  ? -36.159 -24.537 54.490  1.00 34.69  ?  32  LEU C HD12 1 
ATOM   7416  H  HD13 . LEU C  1 32  ? -35.328 -23.275 54.984  1.00 34.69  ?  32  LEU C HD13 1 
ATOM   7417  H  HD21 . LEU C  1 32  ? -37.422 -21.175 54.421  1.00 33.52  ?  32  LEU C HD21 1 
ATOM   7418  H  HD22 . LEU C  1 32  ? -35.924 -20.938 53.945  1.00 33.52  ?  32  LEU C HD22 1 
ATOM   7419  H  HD23 . LEU C  1 32  ? -37.112 -20.872 52.892  1.00 33.52  ?  32  LEU C HD23 1 
ATOM   7420  N  N    . LEU C  1 33  ? -37.241 -24.620 49.989  1.00 22.45  ?  33  LEU C N    1 
ATOM   7421  C  CA   . LEU C  1 33  ? -38.501 -25.087 49.422  1.00 21.70  ?  33  LEU C CA   1 
ATOM   7422  C  C    . LEU C  1 33  ? -38.525 -26.613 49.298  1.00 25.70  ?  33  LEU C C    1 
ATOM   7423  O  O    . LEU C  1 33  ? -39.580 -27.239 49.465  1.00 28.55  ?  33  LEU C O    1 
ATOM   7424  C  CB   . LEU C  1 33  ? -38.716 -24.426 48.050  1.00 22.29  ?  33  LEU C CB   1 
ATOM   7425  C  CG   . LEU C  1 33  ? -39.149 -22.953 48.085  1.00 22.81  ?  33  LEU C CG   1 
ATOM   7426  C  CD1  . LEU C  1 33  ? -38.921 -22.288 46.748  1.00 25.64  ?  33  LEU C CD1  1 
ATOM   7427  C  CD2  . LEU C  1 33  ? -40.609 -22.826 48.489  1.00 24.96  ?  33  LEU C CD2  1 
ATOM   7428  H  H    . LEU C  1 33  ? -36.757 -24.154 49.452  1.00 26.94  ?  33  LEU C H    1 
ATOM   7429  H  HA   . LEU C  1 33  ? -39.230 -24.820 50.004  1.00 26.04  ?  33  LEU C HA   1 
ATOM   7430  H  HB2  . LEU C  1 33  ? -37.883 -24.472 47.554  1.00 26.75  ?  33  LEU C HB2  1 
ATOM   7431  H  HB3  . LEU C  1 33  ? -39.403 -24.920 47.576  1.00 26.75  ?  33  LEU C HB3  1 
ATOM   7432  H  HG   . LEU C  1 33  ? -38.615 -22.484 48.746  1.00 27.38  ?  33  LEU C HG   1 
ATOM   7433  H  HD11 . LEU C  1 33  ? -39.204 -21.361 46.804  1.00 30.77  ?  33  LEU C HD11 1 
ATOM   7434  H  HD12 . LEU C  1 33  ? -37.976 -22.333 46.531  1.00 30.77  ?  33  LEU C HD12 1 
ATOM   7435  H  HD13 . LEU C  1 33  ? -39.439 -22.752 46.072  1.00 30.77  ?  33  LEU C HD13 1 
ATOM   7436  H  HD21 . LEU C  1 33  ? -40.853 -21.887 48.502  1.00 29.95  ?  33  LEU C HD21 1 
ATOM   7437  H  HD22 . LEU C  1 33  ? -41.157 -23.302 47.844  1.00 29.95  ?  33  LEU C HD22 1 
ATOM   7438  H  HD23 . LEU C  1 33  ? -40.727 -23.211 49.371  1.00 29.95  ?  33  LEU C HD23 1 
ATOM   7439  N  N    . VAL C  1 34  ? -37.366 -27.227 49.021  1.00 26.73  ?  34  VAL C N    1 
ATOM   7440  C  CA   . VAL C  1 34  ? -37.242 -28.688 49.032  1.00 32.19  ?  34  VAL C CA   1 
ATOM   7441  C  C    . VAL C  1 34  ? -37.394 -29.240 50.449  1.00 34.79  ?  34  VAL C C    1 
ATOM   7442  O  O    . VAL C  1 34  ? -38.155 -30.185 50.685  1.00 36.13  ?  34  VAL C O    1 
ATOM   7443  C  CB   . VAL C  1 34  ? -35.885 -29.108 48.421  1.00 37.91  ?  34  VAL C CB   1 
ATOM   7444  C  CG1  . VAL C  1 34  ? -35.610 -30.597 48.625  1.00 43.00  ?  34  VAL C CG1  1 
ATOM   7445  C  CG2  . VAL C  1 34  ? -35.833 -28.774 46.964  1.00 40.42  ?  34  VAL C CG2  1 
ATOM   7446  H  H    . VAL C  1 34  ? -36.636 -26.816 48.822  1.00 32.08  ?  34  VAL C H    1 
ATOM   7447  H  HA   . VAL C  1 34  ? -37.947 -29.068 48.486  1.00 38.63  ?  34  VAL C HA   1 
ATOM   7448  H  HB   . VAL C  1 34  ? -35.178 -28.613 48.864  1.00 45.50  ?  34  VAL C HB   1 
ATOM   7449  H  HG11 . VAL C  1 34  ? -34.753 -30.817 48.228  1.00 51.60  ?  34  VAL C HG11 1 
ATOM   7450  H  HG12 . VAL C  1 34  ? -35.594 -30.788 49.576  1.00 51.60  ?  34  VAL C HG12 1 
ATOM   7451  H  HG13 . VAL C  1 34  ? -36.314 -31.109 48.197  1.00 51.60  ?  34  VAL C HG13 1 
ATOM   7452  H  HG21 . VAL C  1 34  ? -34.973 -29.048 46.608  1.00 48.51  ?  34  VAL C HG21 1 
ATOM   7453  H  HG22 . VAL C  1 34  ? -36.546 -29.246 46.506  1.00 48.51  ?  34  VAL C HG22 1 
ATOM   7454  H  HG23 . VAL C  1 34  ? -35.947 -27.816 46.855  1.00 48.51  ?  34  VAL C HG23 1 
ATOM   7455  N  N    . SER C  1 35  ? -36.659 -28.681 51.409  1.00 28.68  ?  35  SER C N    1 
ATOM   7456  C  CA   . SER C  1 35  ? -36.396 -29.383 52.666  1.00 29.97  ?  35  SER C CA   1 
ATOM   7457  C  C    . SER C  1 35  ? -37.340 -29.018 53.799  1.00 39.58  ?  35  SER C C    1 
ATOM   7458  O  O    . SER C  1 35  ? -37.539 -29.834 54.705  1.00 38.28  ?  35  SER C O    1 
ATOM   7459  C  CB   . SER C  1 35  ? -34.958 -29.114 53.110  1.00 33.40  ?  35  SER C CB   1 
ATOM   7460  O  OG   . SER C  1 35  ? -34.068 -29.578 52.110  1.00 44.10  ?  35  SER C OG   1 
ATOM   7461  H  H    . SER C  1 35  ? -36.302 -27.900 51.359  1.00 34.41  ?  35  SER C H    1 
ATOM   7462  H  HA   . SER C  1 35  ? -36.482 -30.336 52.509  1.00 35.96  ?  35  SER C HA   1 
ATOM   7463  H  HB2  . SER C  1 35  ? -34.833 -28.161 53.234  1.00 40.08  ?  35  SER C HB2  1 
ATOM   7464  H  HB3  . SER C  1 35  ? -34.784 -29.587 53.939  1.00 40.08  ?  35  SER C HB3  1 
ATOM   7465  H  HG   . SER C  1 35  ? -33.274 -29.436 52.344  1.00 52.92  ?  35  SER C HG   1 
ATOM   7466  N  N    . ASP C  1 36  ? -37.894 -27.813 53.808  1.00 32.33  ?  36  ASP C N    1 
ATOM   7467  C  CA   . ASP C  1 36  ? -38.803 -27.378 54.876  1.00 29.60  ?  36  ASP C CA   1 
ATOM   7468  C  C    . ASP C  1 36  ? -39.782 -26.396 54.270  1.00 24.68  ?  36  ASP C C    1 
ATOM   7469  O  O    . ASP C  1 36  ? -39.799 -25.199 54.604  1.00 25.07  ?  36  ASP C O    1 
ATOM   7470  C  CB   . ASP C  1 36  ? -38.026 -26.761 56.034  1.00 32.92  ?  36  ASP C CB   1 
ATOM   7471  C  CG   . ASP C  1 36  ? -38.822 -26.737 57.328  1.00 46.86  ?  36  ASP C CG   1 
ATOM   7472  O  OD1  . ASP C  1 36  ? -40.031 -27.063 57.301  1.00 37.36  ?  36  ASP C OD1  1 
ATOM   7473  O  OD2  . ASP C  1 36  ? -38.219 -26.394 58.369  1.00 46.13  -1 36  ASP C OD2  1 
ATOM   7474  H  H    . ASP C  1 36  ? -37.762 -27.217 53.202  1.00 38.80  ?  36  ASP C H    1 
ATOM   7475  H  HA   . ASP C  1 36  ? -39.299 -28.142 55.210  1.00 35.52  ?  36  ASP C HA   1 
ATOM   7476  H  HB2  . ASP C  1 36  ? -37.220 -27.279 56.187  1.00 39.51  ?  36  ASP C HB2  1 
ATOM   7477  H  HB3  . ASP C  1 36  ? -37.794 -25.846 55.808  1.00 39.51  ?  36  ASP C HB3  1 
ATOM   7478  N  N    . PRO C  1 37  ? -40.615 -26.858 53.339  1.00 28.95  ?  37  PRO C N    1 
ATOM   7479  C  CA   . PRO C  1 37  ? -41.492 -25.929 52.632  1.00 27.58  ?  37  PRO C CA   1 
ATOM   7480  C  C    . PRO C  1 37  ? -42.507 -25.231 53.537  1.00 26.72  ?  37  PRO C C    1 
ATOM   7481  O  O    . PRO C  1 37  ? -42.931 -24.118 53.215  1.00 27.16  ?  37  PRO C O    1 
ATOM   7482  C  CB   . PRO C  1 37  ? -42.169 -26.816 51.571  1.00 33.22  ?  37  PRO C CB   1 
ATOM   7483  C  CG   . PRO C  1 37  ? -42.037 -28.192 52.068  1.00 30.27  ?  37  PRO C CG   1 
ATOM   7484  C  CD   . PRO C  1 37  ? -40.768 -28.245 52.876  1.00 34.37  ?  37  PRO C CD   1 
ATOM   7485  H  HA   . PRO C  1 37  ? -40.960 -25.254 52.181  1.00 33.09  ?  37  PRO C HA   1 
ATOM   7486  H  HB2  . PRO C  1 37  ? -43.104 -26.570 51.490  1.00 39.87  ?  37  PRO C HB2  1 
ATOM   7487  H  HB3  . PRO C  1 37  ? -41.713 -26.714 50.722  1.00 39.87  ?  37  PRO C HB3  1 
ATOM   7488  H  HG2  . PRO C  1 37  ? -42.801 -28.408 52.625  1.00 36.32  ?  37  PRO C HG2  1 
ATOM   7489  H  HG3  . PRO C  1 37  ? -41.985 -28.802 51.316  1.00 36.32  ?  37  PRO C HG3  1 
ATOM   7490  H  HD2  . PRO C  1 37  ? -40.871 -28.846 53.630  1.00 41.24  ?  37  PRO C HD2  1 
ATOM   7491  H  HD3  . PRO C  1 37  ? -40.019 -28.501 52.314  1.00 41.24  ?  37  PRO C HD3  1 
ATOM   7492  N  N    . ASN C  1 38  ? -42.911 -25.830 54.664  1.00 31.33  ?  38  ASN C N    1 
ATOM   7493  C  CA   . ASN C  1 38  ? -43.836 -25.132 55.552  1.00 33.85  ?  38  ASN C CA   1 
ATOM   7494  C  C    . ASN C  1 38  ? -43.205 -23.926 56.236  1.00 26.78  ?  38  ASN C C    1 
ATOM   7495  O  O    . ASN C  1 38  ? -43.932 -23.030 56.672  1.00 29.05  ?  38  ASN C O    1 
ATOM   7496  C  CB   . ASN C  1 38  ? -44.389 -26.093 56.599  1.00 27.68  ?  38  ASN C CB   1 
ATOM   7497  C  CG   . ASN C  1 38  ? -45.251 -27.147 55.975  1.00 38.95  ?  38  ASN C CG   1 
ATOM   7498  O  OD1  . ASN C  1 38  ? -45.961 -26.883 55.005  1.00 44.95  ?  38  ASN C OD1  1 
ATOM   7499  N  ND2  . ASN C  1 38  ? -45.155 -28.357 56.480  1.00 41.60  ?  38  ASN C ND2  1 
ATOM   7500  H  H    . ASN C  1 38  ? -42.671 -26.613 54.927  1.00 37.59  ?  38  ASN C H    1 
ATOM   7501  H  HA   . ASN C  1 38  ? -44.585 -24.810 55.026  1.00 40.62  ?  38  ASN C HA   1 
ATOM   7502  H  HB2  . ASN C  1 38  ? -43.652 -26.531 57.052  1.00 33.22  ?  38  ASN C HB2  1 
ATOM   7503  H  HB3  . ASN C  1 38  ? -44.928 -25.598 57.236  1.00 33.22  ?  38  ASN C HB3  1 
ATOM   7504  H  HD21 . ASN C  1 38  ? -45.629 -28.997 56.156  1.00 49.92  ?  38  ASN C HD21 1 
ATOM   7505  H  HD22 . ASN C  1 38  ? -44.618 -28.509 57.135  1.00 49.92  ?  38  ASN C HD22 1 
ATOM   7506  N  N    . LYS C  1 39  ? -41.884 -23.846 56.290  1.00 26.00  ?  39  LYS C N    1 
ATOM   7507  C  CA   . LYS C  1 39  ? -41.257 -22.651 56.831  1.00 31.92  ?  39  LYS C CA   1 
ATOM   7508  C  C    . LYS C  1 39  ? -40.885 -21.666 55.746  1.00 32.34  ?  39  LYS C C    1 
ATOM   7509  O  O    . LYS C  1 39  ? -40.456 -20.550 56.062  1.00 32.36  ?  39  LYS C O    1 
ATOM   7510  C  CB   . LYS C  1 39  ? -40.006 -23.012 57.644  1.00 32.60  ?  39  LYS C CB   1 
ATOM   7511  C  CG   . LYS C  1 39  ? -40.257 -22.990 59.155  1.00 53.00  ?  39  LYS C CG   1 
ATOM   7512  C  CD   . LYS C  1 39  ? -39.579 -24.129 59.858  1.00 58.85  ?  39  LYS C CD   1 
ATOM   7513  C  CE   . LYS C  1 39  ? -39.238 -23.750 61.282  1.00 56.81  ?  39  LYS C CE   1 
ATOM   7514  N  NZ   . LYS C  1 39  ? -40.456 -23.391 62.060  1.00 64.59  1  39  LYS C NZ   1 
ATOM   7515  H  H    . LYS C  1 39  ? -41.338 -24.455 56.026  1.00 31.20  ?  39  LYS C H    1 
ATOM   7516  H  HA   . LYS C  1 39  ? -41.883 -22.212 57.428  1.00 38.30  ?  39  LYS C HA   1 
ATOM   7517  H  HB2  . LYS C  1 39  ? -39.718 -23.906 57.401  1.00 39.12  ?  39  LYS C HB2  1 
ATOM   7518  H  HB3  . LYS C  1 39  ? -39.304 -22.372 57.447  1.00 39.12  ?  39  LYS C HB3  1 
ATOM   7519  H  HG2  . LYS C  1 39  ? -39.912 -22.161 59.522  1.00 63.59  ?  39  LYS C HG2  1 
ATOM   7520  H  HG3  . LYS C  1 39  ? -41.210 -23.057 59.320  1.00 63.59  ?  39  LYS C HG3  1 
ATOM   7521  H  HD2  . LYS C  1 39  ? -40.174 -24.895 59.880  1.00 70.63  ?  39  LYS C HD2  1 
ATOM   7522  H  HD3  . LYS C  1 39  ? -38.757 -24.352 59.395  1.00 70.63  ?  39  LYS C HD3  1 
ATOM   7523  H  HE2  . LYS C  1 39  ? -38.809 -24.501 61.720  1.00 68.17  ?  39  LYS C HE2  1 
ATOM   7524  H  HE3  . LYS C  1 39  ? -38.645 -22.982 61.275  1.00 68.17  ?  39  LYS C HE3  1 
ATOM   7525  H  HZ1  . LYS C  1 39  ? -40.231 -23.171 62.893  1.00 77.50  ?  39  LYS C HZ1  1 
ATOM   7526  H  HZ2  . LYS C  1 39  ? -40.867 -22.699 61.679  1.00 77.50  ?  39  LYS C HZ2  1 
ATOM   7527  H  HZ3  . LYS C  1 39  ? -41.016 -24.082 62.084  1.00 77.50  ?  39  LYS C HZ3  1 
ATOM   7528  N  N    . ALA C  1 40  ? -41.024 -22.066 54.487  1.00 28.41  ?  40  ALA C N    1 
ATOM   7529  C  CA   . ALA C  1 40  ? -40.790 -21.172 53.374  1.00 27.43  ?  40  ALA C CA   1 
ATOM   7530  C  C    . ALA C  1 40  ? -42.026 -20.322 53.111  1.00 29.01  ?  40  ALA C C    1 
ATOM   7531  O  O    . ALA C  1 40  ? -43.111 -20.540 53.651  1.00 28.67  ?  40  ALA C O    1 
ATOM   7532  C  CB   . ALA C  1 40  ? -40.435 -21.958 52.107  1.00 26.67  ?  40  ALA C CB   1 
ATOM   7533  H  H    . ALA C  1 40  ? -41.256 -22.861 54.255  1.00 34.09  ?  40  ALA C H    1 
ATOM   7534  H  HA   . ALA C  1 40  ? -40.051 -20.580 53.586  1.00 32.92  ?  40  ALA C HA   1 
ATOM   7535  H  HB1  . ALA C  1 40  ? -40.285 -21.333 51.380  1.00 32.01  ?  40  ALA C HB1  1 
ATOM   7536  H  HB2  . ALA C  1 40  ? -39.631 -22.475 52.271  1.00 32.01  ?  40  ALA C HB2  1 
ATOM   7537  H  HB3  . ALA C  1 40  ? -41.171 -22.550 51.887  1.00 32.01  ?  40  ALA C HB3  1 
ATOM   7538  N  N    . ASN C  1 41  ? -41.850 -19.332 52.259  1.00 26.53  ?  41  ASN C N    1 
ATOM   7539  C  CA   . ASN C  1 41  ? -42.960 -18.478 51.889  1.00 25.09  ?  41  ASN C CA   1 
ATOM   7540  C  C    . ASN C  1 41  ? -44.076 -19.289 51.225  1.00 26.23  ?  41  ASN C C    1 
ATOM   7541  O  O    . ASN C  1 41  ? -43.824 -20.105 50.328  1.00 25.00  ?  41  ASN C O    1 
ATOM   7542  C  CB   . ASN C  1 41  ? -42.472 -17.387 50.942  1.00 28.72  ?  41  ASN C CB   1 
ATOM   7543  C  CG   . ASN C  1 41  ? -43.603 -16.512 50.464  1.00 35.17  ?  41  ASN C CG   1 
ATOM   7544  O  OD1  . ASN C  1 41  ? -44.251 -16.829 49.480  1.00 29.10  ?  41  ASN C OD1  1 
ATOM   7545  N  ND2  . ASN C  1 41  ? -43.864 -15.416 51.175  1.00 34.25  ?  41  ASN C ND2  1 
ATOM   7546  H  H    . ASN C  1 41  ? -41.103 -19.134 51.881  1.00 31.83  ?  41  ASN C H    1 
ATOM   7547  H  HA   . ASN C  1 41  ? -43.320 -18.055 52.684  1.00 30.11  ?  41  ASN C HA   1 
ATOM   7548  H  HB2  . ASN C  1 41  ? -41.830 -16.827 51.405  1.00 34.46  ?  41  ASN C HB2  1 
ATOM   7549  H  HB3  . ASN C  1 41  ? -42.059 -17.799 50.167  1.00 34.46  ?  41  ASN C HB3  1 
ATOM   7550  H  HD21 . ASN C  1 41  ? -44.501 -14.890 50.935  1.00 41.10  ?  41  ASN C HD21 1 
ATOM   7551  H  HD22 . ASN C  1 41  ? -43.396 -15.234 51.873  1.00 41.10  ?  41  ASN C HD22 1 
ATOM   7552  N  N    . SER C  1 42  ? -45.311 -19.064 51.671  1.00 25.91  ?  42  SER C N    1 
ATOM   7553  C  CA   . SER C  1 42  ? -46.418 -19.920 51.258  1.00 22.73  ?  42  SER C CA   1 
ATOM   7554  C  C    . SER C  1 42  ? -46.815 -19.711 49.801  1.00 26.28  ?  42  SER C C    1 
ATOM   7555  O  O    . SER C  1 42  ? -47.297 -20.643 49.163  1.00 25.26  ?  42  SER C O    1 
ATOM   7556  C  CB   . SER C  1 42  ? -47.637 -19.683 52.146  1.00 32.63  ?  42  SER C CB   1 
ATOM   7557  O  OG   . SER C  1 42  ? -48.207 -18.412 51.875  1.00 41.86  ?  42  SER C OG   1 
ATOM   7558  H  H    . SER C  1 42  ? -45.532 -18.429 52.207  1.00 31.09  ?  42  SER C H    1 
ATOM   7559  H  HA   . SER C  1 42  ? -46.151 -20.847 51.362  1.00 27.28  ?  42  SER C HA   1 
ATOM   7560  H  HB2  . SER C  1 42  ? -48.297 -20.371 51.968  1.00 39.16  ?  42  SER C HB2  1 
ATOM   7561  H  HB3  . SER C  1 42  ? -47.363 -19.717 53.076  1.00 39.16  ?  42  SER C HB3  1 
ATOM   7562  H  HG   . SER C  1 42  ? -48.877 -18.287 52.366  1.00 50.24  ?  42  SER C HG   1 
ATOM   7563  N  N    . PHE C  1 43  ? -46.666 -18.498 49.274  1.00 22.64  ?  43  PHE C N    1 
ATOM   7564  C  CA   . PHE C  1 43  ? -46.944 -18.246 47.856  1.00 26.81  ?  43  PHE C CA   1 
ATOM   7565  C  C    . PHE C  1 43  ? -45.956 -19.014 46.979  1.00 23.25  ?  43  PHE C C    1 
ATOM   7566  O  O    . PHE C  1 43  ? -46.360 -19.763 46.075  1.00 21.87  ?  43  PHE C O    1 
ATOM   7567  C  CB   . PHE C  1 43  ? -46.904 -16.721 47.637  1.00 27.27  ?  43  PHE C CB   1 
ATOM   7568  C  CG   . PHE C  1 43  ? -47.195 -16.228 46.228  1.00 23.98  ?  43  PHE C CG   1 
ATOM   7569  C  CD1  . PHE C  1 43  ? -47.800 -17.006 45.243  1.00 26.26  ?  43  PHE C CD1  1 
ATOM   7570  C  CD2  . PHE C  1 43  ? -46.871 -14.912 45.918  1.00 26.73  ?  43  PHE C CD2  1 
ATOM   7571  C  CE1  . PHE C  1 43  ? -48.027 -16.480 43.961  1.00 24.94  ?  43  PHE C CE1  1 
ATOM   7572  C  CE2  . PHE C  1 43  ? -47.105 -14.393 44.662  1.00 28.05  ?  43  PHE C CE2  1 
ATOM   7573  C  CZ   . PHE C  1 43  ? -47.691 -15.168 43.691  1.00 23.37  ?  43  PHE C CZ   1 
ATOM   7574  H  H    . PHE C  1 43  ? -46.406 -17.805 49.712  1.00 27.17  ?  43  PHE C H    1 
ATOM   7575  H  HA   . PHE C  1 43  ? -47.839 -18.558 47.647  1.00 32.17  ?  43  PHE C HA   1 
ATOM   7576  H  HB2  . PHE C  1 43  ? -47.559 -16.313 48.225  1.00 32.72  ?  43  PHE C HB2  1 
ATOM   7577  H  HB3  . PHE C  1 43  ? -46.018 -16.404 47.875  1.00 32.72  ?  43  PHE C HB3  1 
ATOM   7578  H  HD1  . PHE C  1 43  ? -48.024 -17.890 45.426  1.00 31.52  ?  43  PHE C HD1  1 
ATOM   7579  H  HD2  . PHE C  1 43  ? -46.473 -14.376 46.565  1.00 32.08  ?  43  PHE C HD2  1 
ATOM   7580  H  HE1  . PHE C  1 43  ? -48.428 -17.003 43.305  1.00 29.93  ?  43  PHE C HE1  1 
ATOM   7581  H  HE2  . PHE C  1 43  ? -46.875 -13.512 44.475  1.00 33.66  ?  43  PHE C HE2  1 
ATOM   7582  H  HZ   . PHE C  1 43  ? -47.846 -14.814 42.845  1.00 28.05  ?  43  PHE C HZ   1 
ATOM   7583  N  N    . ALA C  1 44  ? -44.658 -18.909 47.287  1.00 21.84  ?  44  ALA C N    1 
ATOM   7584  C  CA   . ALA C  1 44  ? -43.650 -19.672 46.561  1.00 20.05  ?  44  ALA C CA   1 
ATOM   7585  C  C    . ALA C  1 44  ? -43.857 -21.171 46.717  1.00 24.77  ?  44  ALA C C    1 
ATOM   7586  O  O    . ALA C  1 44  ? -43.737 -21.929 45.742  1.00 21.70  ?  44  ALA C O    1 
ATOM   7587  C  CB   . ALA C  1 44  ? -42.251 -19.276 47.015  1.00 21.53  ?  44  ALA C CB   1 
ATOM   7588  H  H    . ALA C  1 44  ? -44.341 -18.405 47.908  1.00 26.20  ?  44  ALA C H    1 
ATOM   7589  H  HA   . ALA C  1 44  ? -43.723 -19.462 45.617  1.00 24.06  ?  44  ALA C HA   1 
ATOM   7590  H  HB1  . ALA C  1 44  ? -41.599 -19.795 46.519  1.00 25.84  ?  44  ALA C HB1  1 
ATOM   7591  H  HB2  . ALA C  1 44  ? -42.120 -18.330 46.844  1.00 25.84  ?  44  ALA C HB2  1 
ATOM   7592  H  HB3  . ALA C  1 44  ? -42.165 -19.455 47.964  1.00 25.84  ?  44  ALA C HB3  1 
ATOM   7593  N  N    . ALA C  1 45  ? -44.166 -21.633 47.930  1.00 21.93  ?  45  ALA C N    1 
ATOM   7594  C  CA   . ALA C  1 45  ? -44.307 -23.068 48.125  1.00 21.46  ?  45  ALA C CA   1 
ATOM   7595  C  C    . ALA C  1 45  ? -45.439 -23.632 47.286  1.00 23.25  ?  45  ALA C C    1 
ATOM   7596  O  O    . ALA C  1 45  ? -45.321 -24.730 46.729  1.00 23.62  ?  45  ALA C O    1 
ATOM   7597  C  CB   . ALA C  1 45  ? -44.528 -23.378 49.609  1.00 22.79  ?  45  ALA C CB   1 
ATOM   7598  H  H    . ALA C  1 45  ? -44.293 -21.152 48.631  1.00 26.32  ?  45  ALA C H    1 
ATOM   7599  H  HA   . ALA C  1 45  ? -43.486 -23.505 47.848  1.00 25.76  ?  45  ALA C HA   1 
ATOM   7600  H  HB1  . ALA C  1 45  ? -44.620 -24.337 49.721  1.00 27.35  ?  45  ALA C HB1  1 
ATOM   7601  H  HB2  . ALA C  1 45  ? -43.765 -23.057 50.115  1.00 27.35  ?  45  ALA C HB2  1 
ATOM   7602  H  HB3  . ALA C  1 45  ? -45.335 -22.931 49.908  1.00 27.35  ?  45  ALA C HB3  1 
ATOM   7603  N  N    . TYR C  1 46  ? -46.555 -22.909 47.203  1.00 23.38  ?  46  TYR C N    1 
ATOM   7604  C  CA   . TYR C  1 46  ? -47.681 -23.370 46.409  1.00 23.11  ?  46  TYR C CA   1 
ATOM   7605  C  C    . TYR C  1 46  ? -47.362 -23.351 44.920  1.00 22.30  ?  46  TYR C C    1 
ATOM   7606  O  O    . TYR C  1 46  ? -47.641 -24.315 44.201  1.00 23.07  ?  46  TYR C O    1 
ATOM   7607  C  CB   . TYR C  1 46  ? -48.891 -22.502 46.700  1.00 22.30  ?  46  TYR C CB   1 
ATOM   7608  C  CG   . TYR C  1 46  ? -50.141 -22.941 46.006  1.00 22.18  ?  46  TYR C CG   1 
ATOM   7609  C  CD1  . TYR C  1 46  ? -50.813 -24.063 46.445  1.00 27.85  ?  46  TYR C CD1  1 
ATOM   7610  C  CD2  . TYR C  1 46  ? -50.669 -22.226 44.941  1.00 27.09  ?  46  TYR C CD2  1 
ATOM   7611  C  CE1  . TYR C  1 46  ? -51.979 -24.476 45.848  1.00 35.40  ?  46  TYR C CE1  1 
ATOM   7612  C  CE2  . TYR C  1 46  ? -51.835 -22.634 44.320  1.00 31.93  ?  46  TYR C CE2  1 
ATOM   7613  C  CZ   . TYR C  1 46  ? -52.492 -23.765 44.785  1.00 44.64  ?  46  TYR C CZ   1 
ATOM   7614  O  OH   . TYR C  1 46  ? -53.668 -24.210 44.207  1.00 35.81  ?  46  TYR C OH   1 
ATOM   7615  H  H    . TYR C  1 46  ? -46.681 -22.154 47.595  1.00 28.06  ?  46  TYR C H    1 
ATOM   7616  H  HA   . TYR C  1 46  ? -47.896 -24.282 46.661  1.00 27.73  ?  46  TYR C HA   1 
ATOM   7617  H  HB2  . TYR C  1 46  ? -49.063 -22.517 47.655  1.00 26.77  ?  46  TYR C HB2  1 
ATOM   7618  H  HB3  . TYR C  1 46  ? -48.699 -21.594 46.416  1.00 26.77  ?  46  TYR C HB3  1 
ATOM   7619  H  HD1  . TYR C  1 46  ? -50.475 -24.544 47.166  1.00 33.42  ?  46  TYR C HD1  1 
ATOM   7620  H  HD2  . TYR C  1 46  ? -50.228 -21.466 44.635  1.00 32.51  ?  46  TYR C HD2  1 
ATOM   7621  H  HE1  . TYR C  1 46  ? -52.417 -25.237 46.156  1.00 42.49  ?  46  TYR C HE1  1 
ATOM   7622  H  HE2  . TYR C  1 46  ? -52.182 -22.149 43.606  1.00 38.32  ?  46  TYR C HE2  1 
ATOM   7623  H  HH   . TYR C  1 46  ? -53.886 -23.704 43.572  1.00 42.98  ?  46  TYR C HH   1 
ATOM   7624  N  N    . VAL C  1 47  ? -46.807 -22.240 44.425  1.00 22.84  ?  47  VAL C N    1 
ATOM   7625  C  CA   . VAL C  1 47  ? -46.514 -22.122 42.993  1.00 25.01  ?  47  VAL C CA   1 
ATOM   7626  C  C    . VAL C  1 47  ? -45.592 -23.241 42.503  1.00 22.62  ?  47  VAL C C    1 
ATOM   7627  O  O    . VAL C  1 47  ? -45.783 -23.788 41.397  1.00 24.61  ?  47  VAL C O    1 
ATOM   7628  C  CB   . VAL C  1 47  ? -45.901 -20.741 42.704  1.00 24.20  ?  47  VAL C CB   1 
ATOM   7629  C  CG1  . VAL C  1 47  ? -45.230 -20.731 41.338  1.00 25.82  ?  47  VAL C CG1  1 
ATOM   7630  C  CG2  . VAL C  1 47  ? -46.982 -19.673 42.777  1.00 28.51  ?  47  VAL C CG2  1 
ATOM   7631  H  H    . VAL C  1 47  ? -46.592 -21.550 44.891  1.00 27.41  ?  47  VAL C H    1 
ATOM   7632  H  HA   . VAL C  1 47  ? -47.346 -22.186 42.498  1.00 30.02  ?  47  VAL C HA   1 
ATOM   7633  H  HB   . VAL C  1 47  ? -45.229 -20.541 43.375  1.00 29.04  ?  47  VAL C HB   1 
ATOM   7634  H  HG11 . VAL C  1 47  ? -44.852 -19.852 41.178  1.00 30.98  ?  47  VAL C HG11 1 
ATOM   7635  H  HG12 . VAL C  1 47  ? -44.529 -21.401 41.326  1.00 30.98  ?  47  VAL C HG12 1 
ATOM   7636  H  HG13 . VAL C  1 47  ? -45.893 -20.934 40.659  1.00 30.98  ?  47  VAL C HG13 1 
ATOM   7637  H  HG21 . VAL C  1 47  ? -46.584 -18.808 42.593  1.00 34.21  ?  47  VAL C HG21 1 
ATOM   7638  H  HG22 . VAL C  1 47  ? -47.665 -19.870 42.117  1.00 34.21  ?  47  VAL C HG22 1 
ATOM   7639  H  HG23 . VAL C  1 47  ? -47.370 -19.677 43.666  1.00 34.21  ?  47  VAL C HG23 1 
ATOM   7640  N  N    . PHE C  1 48  ? -44.566 -23.571 43.286  1.00 21.62  ?  48  PHE C N    1 
ATOM   7641  C  CA   . PHE C  1 48  ? -43.522 -24.508 42.889  1.00 20.08  ?  48  PHE C CA   1 
ATOM   7642  C  C    . PHE C  1 48  ? -43.850 -25.943 43.276  1.00 24.00  ?  48  PHE C C    1 
ATOM   7643  O  O    . PHE C  1 48  ? -43.001 -26.828 43.109  1.00 28.12  ?  48  PHE C O    1 
ATOM   7644  C  CB   . PHE C  1 48  ? -42.170 -24.051 43.463  1.00 23.62  ?  48  PHE C CB   1 
ATOM   7645  C  CG   . PHE C  1 48  ? -41.577 -22.922 42.678  1.00 22.18  ?  48  PHE C CG   1 
ATOM   7646  C  CD1  . PHE C  1 48  ? -41.878 -21.597 42.972  1.00 22.80  ?  48  PHE C CD1  1 
ATOM   7647  C  CD2  . PHE C  1 48  ? -40.771 -23.186 41.586  1.00 21.08  ?  48  PHE C CD2  1 
ATOM   7648  C  CE1  . PHE C  1 48  ? -41.370 -20.569 42.178  1.00 21.71  ?  48  PHE C CE1  1 
ATOM   7649  C  CE2  . PHE C  1 48  ? -40.291 -22.163 40.786  1.00 19.83  ?  48  PHE C CE2  1 
ATOM   7650  C  CZ   . PHE C  1 48  ? -40.562 -20.861 41.096  1.00 20.03  ?  48  PHE C CZ   1 
ATOM   7651  H  H    . PHE C  1 48  ? -44.452 -23.252 44.076  1.00 25.94  ?  48  PHE C H    1 
ATOM   7652  H  HA   . PHE C  1 48  ? -43.446 -24.484 41.923  1.00 24.10  ?  48  PHE C HA   1 
ATOM   7653  H  HB2  . PHE C  1 48  ? -42.298 -23.749 44.376  1.00 28.35  ?  48  PHE C HB2  1 
ATOM   7654  H  HB3  . PHE C  1 48  ? -41.548 -24.794 43.440  1.00 28.35  ?  48  PHE C HB3  1 
ATOM   7655  H  HD1  . PHE C  1 48  ? -42.429 -21.396 43.694  1.00 27.36  ?  48  PHE C HD1  1 
ATOM   7656  H  HD2  . PHE C  1 48  ? -40.587 -24.068 41.358  1.00 25.30  ?  48  PHE C HD2  1 
ATOM   7657  H  HE1  . PHE C  1 48  ? -41.562 -19.684 42.388  1.00 26.05  ?  48  PHE C HE1  1 
ATOM   7658  H  HE2  . PHE C  1 48  ? -39.734 -22.361 40.068  1.00 23.80  ?  48  PHE C HE2  1 
ATOM   7659  H  HZ   . PHE C  1 48  ? -40.212 -20.174 40.575  1.00 24.04  ?  48  PHE C HZ   1 
ATOM   7660  N  N    . GLY C  1 49  ? -45.046 -26.181 43.808  1.00 23.66  ?  49  GLY C N    1 
ATOM   7661  C  CA   . GLY C  1 49  ? -45.506 -27.532 44.069  1.00 25.38  ?  49  GLY C CA   1 
ATOM   7662  C  C    . GLY C  1 49  ? -44.970 -28.149 45.332  1.00 27.62  ?  49  GLY C C    1 
ATOM   7663  O  O    . GLY C  1 49  ? -45.078 -29.373 45.498  1.00 29.74  ?  49  GLY C O    1 
ATOM   7664  H  H    . GLY C  1 49  ? -45.610 -25.570 44.027  1.00 28.40  ?  49  GLY C H    1 
ATOM   7665  H  HA2  . GLY C  1 49  ? -46.474 -27.529 44.125  1.00 30.46  ?  49  GLY C HA2  1 
ATOM   7666  H  HA3  . GLY C  1 49  ? -45.250 -28.101 43.326  1.00 30.46  ?  49  GLY C HA3  1 
ATOM   7667  N  N    . ALA C  1 50  ? -44.393 -27.344 46.231  1.00 24.10  ?  50  ALA C N    1 
ATOM   7668  C  CA   . ALA C  1 50  ? -43.851 -27.840 47.493  1.00 25.40  ?  50  ALA C CA   1 
ATOM   7669  C  C    . ALA C  1 50  ? -44.907 -28.001 48.563  1.00 36.48  ?  50  ALA C C    1 
ATOM   7670  O  O    . ALA C  1 50  ? -44.669 -28.708 49.548  1.00 31.18  ?  50  ALA C O    1 
ATOM   7671  C  CB   . ALA C  1 50  ? -42.774 -26.886 48.025  1.00 27.94  ?  50  ALA C CB   1 
ATOM   7672  H  H    . ALA C  1 50  ? -44.305 -26.495 46.127  1.00 28.92  ?  50  ALA C H    1 
ATOM   7673  H  HA   . ALA C  1 50  ? -43.440 -28.706 47.343  1.00 30.49  ?  50  ALA C HA   1 
ATOM   7674  H  HB1  . ALA C  1 50  ? -42.429 -27.235 48.862  1.00 33.53  ?  50  ALA C HB1  1 
ATOM   7675  H  HB2  . ALA C  1 50  ? -42.059 -26.823 47.373  1.00 33.53  ?  50  ALA C HB2  1 
ATOM   7676  H  HB3  . ALA C  1 50  ? -43.169 -26.012 48.169  1.00 33.53  ?  50  ALA C HB3  1 
ATOM   7677  N  N    . SER C  1 51  ? -46.044 -27.338 48.394  1.00 27.25  ?  51  SER C N    1 
ATOM   7678  C  CA   . SER C  1 51  ? -47.162 -27.381 49.316  1.00 30.50  ?  51  SER C CA   1 
ATOM   7679  C  C    . SER C  1 51  ? -48.443 -27.258 48.505  1.00 36.21  ?  51  SER C C    1 
ATOM   7680  O  O    . SER C  1 51  ? -48.474 -26.592 47.469  1.00 30.71  ?  51  SER C O    1 
ATOM   7681  C  CB   . SER C  1 51  ? -47.092 -26.257 50.347  1.00 33.27  ?  51  SER C CB   1 
ATOM   7682  O  OG   . SER C  1 51  ? -48.238 -26.300 51.191  1.00 35.09  ?  51  SER C OG   1 
ATOM   7683  H  H    . SER C  1 51  ? -46.193 -26.830 47.716  1.00 32.70  ?  51  SER C H    1 
ATOM   7684  H  HA   . SER C  1 51  ? -47.169 -28.232 49.782  1.00 36.60  ?  51  SER C HA   1 
ATOM   7685  H  HB2  . SER C  1 51  ? -46.294 -26.369 50.888  1.00 39.92  ?  51  SER C HB2  1 
ATOM   7686  H  HB3  . SER C  1 51  ? -47.066 -25.403 49.887  1.00 39.92  ?  51  SER C HB3  1 
ATOM   7687  H  HG   . SER C  1 51  ? -48.200 -25.682 51.758  1.00 42.10  ?  51  SER C HG   1 
ATOM   7688  N  N    . ASP C  1 52  ? -49.498 -27.913 48.976  1.00 34.88  ?  52  ASP C N    1 
ATOM   7689  C  CA   . ASP C  1 52  ? -50.816 -27.738 48.385  1.00 34.84  ?  52  ASP C CA   1 
ATOM   7690  C  C    . ASP C  1 52  ? -51.653 -26.725 49.151  1.00 33.02  ?  52  ASP C C    1 
ATOM   7691  O  O    . ASP C  1 52  ? -52.820 -26.510 48.808  1.00 36.26  ?  52  ASP C O    1 
ATOM   7692  C  CB   . ASP C  1 52  ? -51.538 -29.087 48.297  1.00 48.02  ?  52  ASP C CB   1 
ATOM   7693  C  CG   . ASP C  1 52  ? -50.987 -29.958 47.185  1.00 66.08  ?  52  ASP C CG   1 
ATOM   7694  O  OD1  . ASP C  1 52  ? -50.555 -29.394 46.153  1.00 66.36  ?  52  ASP C OD1  1 
ATOM   7695  O  OD2  . ASP C  1 52  ? -50.971 -31.200 47.343  1.00 79.00  -1 52  ASP C OD2  1 
ATOM   7696  H  H    . ASP C  1 52  ? -49.477 -28.464 49.637  1.00 41.85  ?  52  ASP C H    1 
ATOM   7697  H  HA   . ASP C  1 52  ? -50.707 -27.405 47.481  1.00 41.81  ?  52  ASP C HA   1 
ATOM   7698  H  HB2  . ASP C  1 52  ? -51.428 -29.562 49.136  1.00 57.63  ?  52  ASP C HB2  1 
ATOM   7699  H  HB3  . ASP C  1 52  ? -52.479 -28.933 48.121  1.00 57.63  ?  52  ASP C HB3  1 
ATOM   7700  N  N    . LYS C  1 53  ? -51.080 -26.090 50.174  1.00 31.76  ?  53  LYS C N    1 
ATOM   7701  C  CA   . LYS C  1 53  ? -51.767 -25.021 50.888  1.00 34.75  ?  53  LYS C CA   1 
ATOM   7702  C  C    . LYS C  1 53  ? -51.775 -23.759 50.031  1.00 37.45  ?  53  LYS C C    1 
ATOM   7703  O  O    . LYS C  1 53  ? -50.715 -23.245 49.668  1.00 34.25  ?  53  LYS C O    1 
ATOM   7704  C  CB   . LYS C  1 53  ? -51.077 -24.764 52.228  1.00 40.35  ?  53  LYS C CB   1 
ATOM   7705  C  CG   . LYS C  1 53  ? -51.621 -23.576 53.030  1.00 46.38  ?  53  LYS C CG   1 
ATOM   7706  C  CD   . LYS C  1 53  ? -50.628 -23.124 54.114  1.00 64.32  ?  53  LYS C CD   1 
ATOM   7707  C  CE   . LYS C  1 53  ? -50.527 -21.586 54.209  1.00 59.50  ?  53  LYS C CE   1 
ATOM   7708  N  NZ   . LYS C  1 53  ? -49.281 -21.115 54.920  1.00 46.95  1  53  LYS C NZ   1 
ATOM   7709  H  H    . LYS C  1 53  ? -50.292 -26.262 50.472  1.00 38.11  ?  53  LYS C H    1 
ATOM   7710  H  HA   . LYS C  1 53  ? -52.685 -25.283 51.059  1.00 41.70  ?  53  LYS C HA   1 
ATOM   7711  H  HB2  . LYS C  1 53  ? -51.174 -25.556 52.780  1.00 48.42  ?  53  LYS C HB2  1 
ATOM   7712  H  HB3  . LYS C  1 53  ? -50.136 -24.598 52.063  1.00 48.42  ?  53  LYS C HB3  1 
ATOM   7713  H  HG2  . LYS C  1 53  ? -51.776 -22.829 52.430  1.00 55.66  ?  53  LYS C HG2  1 
ATOM   7714  H  HG3  . LYS C  1 53  ? -52.449 -23.835 53.465  1.00 55.66  ?  53  LYS C HG3  1 
ATOM   7715  H  HD2  . LYS C  1 53  ? -50.922 -23.461 54.975  1.00 77.18  ?  53  LYS C HD2  1 
ATOM   7716  H  HD3  . LYS C  1 53  ? -49.748 -23.472 53.903  1.00 77.18  ?  53  LYS C HD3  1 
ATOM   7717  H  HE2  . LYS C  1 53  ? -50.517 -21.216 53.313  1.00 71.40  ?  53  LYS C HE2  1 
ATOM   7718  H  HE3  . LYS C  1 53  ? -51.294 -21.250 54.698  1.00 71.40  ?  53  LYS C HE3  1 
ATOM   7719  H  HZ1  . LYS C  1 53  ? -48.558 -21.401 54.488  1.00 56.34  ?  53  LYS C HZ1  1 
ATOM   7720  H  HZ2  . LYS C  1 53  ? -49.267 -20.225 54.950  1.00 56.34  ?  53  LYS C HZ2  1 
ATOM   7721  H  HZ3  . LYS C  1 53  ? -49.267 -21.432 55.751  1.00 56.34  ?  53  LYS C HZ3  1 
ATOM   7722  N  N    . LYS C  1 54  ? -52.969 -23.265 49.698  1.00 38.59  ?  54  LYS C N    1 
ATOM   7723  C  CA   . LYS C  1 54  ? -53.076 -22.054 48.897  1.00 37.88  ?  54  LYS C CA   1 
ATOM   7724  C  C    . LYS C  1 54  ? -52.641 -20.844 49.724  1.00 39.07  ?  54  LYS C C    1 
ATOM   7725  O  O    . LYS C  1 54  ? -53.016 -20.716 50.894  1.00 38.22  ?  54  LYS C O    1 
ATOM   7726  C  CB   . LYS C  1 54  ? -54.509 -21.842 48.399  1.00 47.17  ?  54  LYS C CB   1 
ATOM   7727  C  CG   . LYS C  1 54  ? -55.083 -22.999 47.596  1.00 53.90  ?  54  LYS C CG   1 
ATOM   7728  C  CD   . LYS C  1 54  ? -56.587 -22.816 47.381  1.00 68.27  ?  54  LYS C CD   1 
ATOM   7729  C  CE   . LYS C  1 54  ? -57.202 -23.954 46.561  1.00 67.85  ?  54  LYS C CE   1 
ATOM   7730  N  NZ   . LYS C  1 54  ? -58.589 -23.629 46.093  1.00 68.37  1  54  LYS C NZ   1 
ATOM   7731  H  H    . LYS C  1 54  ? -53.723 -23.612 49.922  1.00 46.31  ?  54  LYS C H    1 
ATOM   7732  H  HA   . LYS C  1 54  ? -52.492 -22.125 48.126  1.00 45.45  ?  54  LYS C HA   1 
ATOM   7733  H  HB2  . LYS C  1 54  ? -55.086 -21.704 49.167  1.00 56.60  ?  54  LYS C HB2  1 
ATOM   7734  H  HB3  . LYS C  1 54  ? -54.526 -21.055 47.833  1.00 56.60  ?  54  LYS C HB3  1 
ATOM   7735  H  HG2  . LYS C  1 54  ? -54.652 -23.034 46.727  1.00 64.68  ?  54  LYS C HG2  1 
ATOM   7736  H  HG3  . LYS C  1 54  ? -54.941 -23.829 48.077  1.00 64.68  ?  54  LYS C HG3  1 
ATOM   7737  H  HD2  . LYS C  1 54  ? -57.030 -22.793 48.244  1.00 81.92  ?  54  LYS C HD2  1 
ATOM   7738  H  HD3  . LYS C  1 54  ? -56.741 -21.985 46.905  1.00 81.92  ?  54  LYS C HD3  1 
ATOM   7739  H  HE2  . LYS C  1 54  ? -56.651 -24.118 45.781  1.00 81.42  ?  54  LYS C HE2  1 
ATOM   7740  H  HE3  . LYS C  1 54  ? -57.248 -24.753 47.111  1.00 81.42  ?  54  LYS C HE3  1 
ATOM   7741  H  HZ1  . LYS C  1 54  ? -58.918 -24.309 45.621  1.00 82.04  ?  54  LYS C HZ1  1 
ATOM   7742  H  HZ2  . LYS C  1 54  ? -59.119 -23.480 46.793  1.00 82.04  ?  54  LYS C HZ2  1 
ATOM   7743  H  HZ3  . LYS C  1 54  ? -58.575 -22.902 45.581  1.00 82.04  ?  54  LYS C HZ3  1 
ATOM   7744  N  N    . PRO C  1 55  ? -51.853 -19.942 49.156  1.00 32.79  ?  55  PRO C N    1 
ATOM   7745  C  CA   . PRO C  1 55  ? -51.504 -18.716 49.886  1.00 28.12  ?  55  PRO C CA   1 
ATOM   7746  C  C    . PRO C  1 55  ? -52.731 -17.840 50.092  1.00 34.18  ?  55  PRO C C    1 
ATOM   7747  O  O    . PRO C  1 55  ? -53.700 -17.890 49.333  1.00 32.09  ?  55  PRO C O    1 
ATOM   7748  C  CB   . PRO C  1 55  ? -50.483 -18.029 48.975  1.00 30.09  ?  55  PRO C CB   1 
ATOM   7749  C  CG   . PRO C  1 55  ? -50.774 -18.600 47.610  1.00 28.36  ?  55  PRO C CG   1 
ATOM   7750  C  CD   . PRO C  1 55  ? -51.228 -19.990 47.822  1.00 31.08  ?  55  PRO C CD   1 
ATOM   7751  H  HA   . PRO C  1 55  ? -51.097 -18.925 50.741  1.00 33.74  ?  55  PRO C HA   1 
ATOM   7752  H  HB2  . PRO C  1 55  ? -50.622 -17.069 48.987  1.00 36.11  ?  55  PRO C HB2  1 
ATOM   7753  H  HB3  . PRO C  1 55  ? -49.583 -18.253 49.260  1.00 36.11  ?  55  PRO C HB3  1 
ATOM   7754  H  HG2  . PRO C  1 55  ? -51.470 -18.077 47.184  1.00 34.04  ?  55  PRO C HG2  1 
ATOM   7755  H  HG3  . PRO C  1 55  ? -49.964 -18.586 47.076  1.00 34.04  ?  55  PRO C HG3  1 
ATOM   7756  H  HD2  . PRO C  1 55  ? -51.883 -20.238 47.151  1.00 37.29  ?  55  PRO C HD2  1 
ATOM   7757  H  HD3  . PRO C  1 55  ? -50.472 -20.597 47.824  1.00 37.29  ?  55  PRO C HD3  1 
ATOM   7758  N  N    . SER C  1 56  ? -52.664 -17.012 51.130  1.00 35.24  ?  56  SER C N    1 
ATOM   7759  C  CA   . SER C  1 56  ? -53.676 -15.993 51.357  1.00 39.97  ?  56  SER C CA   1 
ATOM   7760  C  C    . SER C  1 56  ? -53.431 -14.784 50.457  1.00 37.63  ?  56  SER C C    1 
ATOM   7761  O  O    . SER C  1 56  ? -52.369 -14.635 49.851  1.00 31.43  ?  56  SER C O    1 
ATOM   7762  C  CB   . SER C  1 56  ? -53.665 -15.549 52.816  1.00 40.44  ?  56  SER C CB   1 
ATOM   7763  O  OG   . SER C  1 56  ? -52.440 -14.899 53.118  1.00 33.96  ?  56  SER C OG   1 
ATOM   7764  H  H    . SER C  1 56  ? -52.037 -17.022 51.719  1.00 42.29  ?  56  SER C H    1 
ATOM   7765  H  HA   . SER C  1 56  ? -54.552 -16.356 51.153  1.00 47.96  ?  56  SER C HA   1 
ATOM   7766  H  HB2  . SER C  1 56  ? -54.398 -14.931 52.966  1.00 48.53  ?  56  SER C HB2  1 
ATOM   7767  H  HB3  . SER C  1 56  ? -53.761 -16.327 53.386  1.00 48.53  ?  56  SER C HB3  1 
ATOM   7768  H  HG   . SER C  1 56  ? -52.435 -14.655 53.922  1.00 40.75  ?  56  SER C HG   1 
ATOM   7769  N  N    . VAL C  1 57  ? -54.447 -13.919 50.362  1.00 37.01  ?  57  VAL C N    1 
ATOM   7770  C  CA   . VAL C  1 57  ? -54.272 -12.616 49.722  1.00 33.94  ?  57  VAL C CA   1 
ATOM   7771  C  C    . VAL C  1 57  ? -53.088 -11.889 50.347  1.00 39.61  ?  57  VAL C C    1 
ATOM   7772  O  O    . VAL C  1 57  ? -52.218 -11.361 49.647  1.00 30.44  ?  57  VAL C O    1 
ATOM   7773  C  CB   . VAL C  1 57  ? -55.572 -11.788 49.816  1.00 33.95  ?  57  VAL C CB   1 
ATOM   7774  C  CG1  . VAL C  1 57  ? -55.333 -10.333 49.477  1.00 42.19  ?  57  VAL C CG1  1 
ATOM   7775  C  CG2  . VAL C  1 57  ? -56.610 -12.317 48.872  1.00 39.62  ?  57  VAL C CG2  1 
ATOM   7776  H  H    . VAL C  1 57  ? -55.241 -14.064 50.659  1.00 44.41  ?  57  VAL C H    1 
ATOM   7777  H  HA   . VAL C  1 57  ? -54.074 -12.752 48.782  1.00 40.73  ?  57  VAL C HA   1 
ATOM   7778  H  HB   . VAL C  1 57  ? -55.924 -11.839 50.719  1.00 40.75  ?  57  VAL C HB   1 
ATOM   7779  H  HG11 . VAL C  1 57  ? -56.172 -9.851  49.548  1.00 50.62  ?  57  VAL C HG11 1 
ATOM   7780  H  HG12 . VAL C  1 57  ? -54.686 -9.966  50.100  1.00 50.62  ?  57  VAL C HG12 1 
ATOM   7781  H  HG13 . VAL C  1 57  ? -54.992 -10.272 48.571  1.00 50.62  ?  57  VAL C HG13 1 
ATOM   7782  H  HG21 . VAL C  1 57  ? -57.413 -11.779 48.952  1.00 47.55  ?  57  VAL C HG21 1 
ATOM   7783  H  HG22 . VAL C  1 57  ? -56.267 -12.266 47.966  1.00 47.55  ?  57  VAL C HG22 1 
ATOM   7784  H  HG23 . VAL C  1 57  ? -56.804 -13.239 49.101  1.00 47.55  ?  57  VAL C HG23 1 
ATOM   7785  N  N    . ASP C  1 58  ? -53.024 -11.868 51.679  1.00 37.70  ?  58  ASP C N    1 
ATOM   7786  C  CA   . ASP C  1 58  ? -51.925 -11.178 52.348  1.00 44.57  ?  58  ASP C CA   1 
ATOM   7787  C  C    . ASP C  1 58  ? -50.572 -11.768 51.954  1.00 41.57  ?  58  ASP C C    1 
ATOM   7788  O  O    . ASP C  1 58  ? -49.618 -11.024 51.683  1.00 37.23  ?  58  ASP C O    1 
ATOM   7789  C  CB   . ASP C  1 58  ? -52.110 -11.230 53.869  1.00 49.25  ?  58  ASP C CB   1 
ATOM   7790  C  CG   . ASP C  1 58  ? -50.860 -10.773 54.627  1.00 58.53  ?  58  ASP C CG   1 
ATOM   7791  O  OD1  . ASP C  1 58  ? -50.582 -9.555  54.643  1.00 60.05  ?  58  ASP C OD1  1 
ATOM   7792  O  OD2  . ASP C  1 58  ? -50.147 -11.633 55.194  1.00 66.94  -1 58  ASP C OD2  1 
ATOM   7793  H  H    . ASP C  1 58  ? -53.593 -12.238 52.207  1.00 45.24  ?  58  ASP C H    1 
ATOM   7794  H  HA   . ASP C  1 58  ? -51.932 -10.246 52.080  1.00 53.49  ?  58  ASP C HA   1 
ATOM   7795  H  HB2  . ASP C  1 58  ? -52.843 -10.647 54.120  1.00 59.10  ?  58  ASP C HB2  1 
ATOM   7796  H  HB3  . ASP C  1 58  ? -52.305 -12.143 54.134  1.00 59.10  ?  58  ASP C HB3  1 
ATOM   7797  N  N    . ASP C  1 59  ? -50.463 -13.107 51.924  1.00 35.87  ?  59  ASP C N    1 
ATOM   7798  C  CA   . ASP C  1 59  ? -49.215 -13.755 51.517  1.00 31.04  ?  59  ASP C CA   1 
ATOM   7799  C  C    . ASP C  1 59  ? -48.756 -13.257 50.152  1.00 25.50  ?  59  ASP C C    1 
ATOM   7800  O  O    . ASP C  1 59  ? -47.567 -13.023 49.928  1.00 27.94  ?  59  ASP C O    1 
ATOM   7801  C  CB   . ASP C  1 59  ? -49.383 -15.276 51.431  1.00 31.96  ?  59  ASP C CB   1 
ATOM   7802  C  CG   . ASP C  1 59  ? -49.617 -15.942 52.787  1.00 44.97  ?  59  ASP C CG   1 
ATOM   7803  O  OD1  . ASP C  1 59  ? -49.147 -15.408 53.814  1.00 40.20  ?  59  ASP C OD1  1 
ATOM   7804  O  OD2  . ASP C  1 59  ? -50.244 -17.026 52.794  1.00 36.04  -1 59  ASP C OD2  1 
ATOM   7805  H  H    . ASP C  1 59  ? -51.094 -13.653 52.133  1.00 43.05  ?  59  ASP C H    1 
ATOM   7806  H  HA   . ASP C  1 59  ? -48.522 -13.558 52.166  1.00 37.25  ?  59  ASP C HA   1 
ATOM   7807  H  HB2  . ASP C  1 59  ? -50.145 -15.476 50.866  1.00 38.35  ?  59  ASP C HB2  1 
ATOM   7808  H  HB3  . ASP C  1 59  ? -48.579 -15.659 51.047  1.00 38.35  ?  59  ASP C HB3  1 
ATOM   7809  N  N    . ILE C  1 60  ? -49.695 -13.142 49.224  1.00 27.54  ?  60  ILE C N    1 
ATOM   7810  C  CA   . ILE C  1 60  ? -49.387 -12.701 47.874  1.00 27.27  ?  60  ILE C CA   1 
ATOM   7811  C  C    . ILE C  1 60  ? -48.994 -11.228 47.869  1.00 27.40  ?  60  ILE C C    1 
ATOM   7812  O  O    . ILE C  1 60  ? -47.986 -10.837 47.267  1.00 24.91  ?  60  ILE C O    1 
ATOM   7813  C  CB   . ILE C  1 60  ? -50.604 -12.974 46.977  1.00 29.51  ?  60  ILE C CB   1 
ATOM   7814  C  CG1  . ILE C  1 60  ? -50.800 -14.481 46.820  1.00 28.92  ?  60  ILE C CG1  1 
ATOM   7815  C  CG2  . ILE C  1 60  ? -50.438 -12.298 45.628  1.00 25.41  ?  60  ILE C CG2  1 
ATOM   7816  C  CD1  . ILE C  1 60  ? -52.138 -14.841 46.120  1.00 29.53  ?  60  ILE C CD1  1 
ATOM   7817  H  H    . ILE C  1 60  ? -50.527 -13.316 49.354  1.00 33.05  ?  60  ILE C H    1 
ATOM   7818  H  HA   . ILE C  1 60  ? -48.638 -13.215 47.534  1.00 32.72  ?  60  ILE C HA   1 
ATOM   7819  H  HB   . ILE C  1 60  ? -51.391 -12.606 47.409  1.00 35.41  ?  60  ILE C HB   1 
ATOM   7820  H  HG12 . ILE C  1 60  ? -50.076 -14.840 46.285  1.00 34.70  ?  60  ILE C HG12 1 
ATOM   7821  H  HG13 . ILE C  1 60  ? -50.801 -14.893 47.698  1.00 34.70  ?  60  ILE C HG13 1 
ATOM   7822  H  HG21 . ILE C  1 60  ? -51.218 -12.486 45.083  1.00 30.49  ?  60  ILE C HG21 1 
ATOM   7823  H  HG22 . ILE C  1 60  ? -50.351 -11.341 45.763  1.00 30.49  ?  60  ILE C HG22 1 
ATOM   7824  H  HG23 . ILE C  1 60  ? -49.642 -12.645 45.197  1.00 30.49  ?  60  ILE C HG23 1 
ATOM   7825  H  HD11 . ILE C  1 60  ? -52.207 -15.806 46.049  1.00 35.43  ?  60  ILE C HD11 1 
ATOM   7826  H  HD12 . ILE C  1 60  ? -52.874 -14.495 46.649  1.00 35.43  ?  60  ILE C HD12 1 
ATOM   7827  H  HD13 . ILE C  1 60  ? -52.149 -14.442 45.236  1.00 35.43  ?  60  ILE C HD13 1 
ATOM   7828  N  N    . VAL C  1 61  ? -49.777 -10.387 48.557  1.00 31.29  ?  61  VAL C N    1 
ATOM   7829  C  CA   . VAL C  1 61  ? -49.485 -8.955  48.581  1.00 28.15  ?  61  VAL C CA   1 
ATOM   7830  C  C    . VAL C  1 61  ? -48.101 -8.707  49.173  1.00 25.25  ?  61  VAL C C    1 
ATOM   7831  O  O    . VAL C  1 61  ? -47.370 -7.811  48.727  1.00 27.34  ?  61  VAL C O    1 
ATOM   7832  C  CB   . VAL C  1 61  ? -50.592 -8.202  49.351  1.00 31.96  ?  61  VAL C CB   1 
ATOM   7833  C  CG1  . VAL C  1 61  ? -50.252 -6.702  49.505  1.00 35.90  ?  61  VAL C CG1  1 
ATOM   7834  C  CG2  . VAL C  1 61  ? -51.929 -8.357  48.638  1.00 37.09  ?  61  VAL C CG2  1 
ATOM   7835  H  H    . VAL C  1 61  ? -50.470 -10.619 49.010  1.00 37.55  ?  61  VAL C H    1 
ATOM   7836  H  HA   . VAL C  1 61  ? -49.481 -8.623  47.669  1.00 33.79  ?  61  VAL C HA   1 
ATOM   7837  H  HB   . VAL C  1 61  ? -50.677 -8.585  50.239  1.00 38.35  ?  61  VAL C HB   1 
ATOM   7838  H  HG11 . VAL C  1 61  ? -50.968 -6.265  49.993  1.00 43.08  ?  61  VAL C HG11 1 
ATOM   7839  H  HG12 . VAL C  1 61  ? -49.418 -6.616  49.994  1.00 43.08  ?  61  VAL C HG12 1 
ATOM   7840  H  HG13 . VAL C  1 61  ? -50.162 -6.307  48.624  1.00 43.08  ?  61  VAL C HG13 1 
ATOM   7841  H  HG21 . VAL C  1 61  ? -52.610 -7.878  49.136  1.00 44.51  ?  61  VAL C HG21 1 
ATOM   7842  H  HG22 . VAL C  1 61  ? -51.854 -7.990  47.743  1.00 44.51  ?  61  VAL C HG22 1 
ATOM   7843  H  HG23 . VAL C  1 61  ? -52.155 -9.300  48.591  1.00 44.51  ?  61  VAL C HG23 1 
ATOM   7844  N  N    . GLN C  1 62  ? -47.710 -9.502  50.182  1.00 27.53  ?  62  GLN C N    1 
ATOM   7845  C  CA   . GLN C  1 62  ? -46.417 -9.313  50.831  1.00 31.48  ?  62  GLN C CA   1 
ATOM   7846  C  C    . GLN C  1 62  ? -45.260 -9.567  49.880  1.00 28.57  ?  62  GLN C C    1 
ATOM   7847  O  O    . GLN C  1 62  ? -44.226 -8.883  49.951  1.00 31.25  ?  62  GLN C O    1 
ATOM   7848  C  CB   . GLN C  1 62  ? -46.297 -10.229 52.053  1.00 41.13  ?  62  GLN C CB   1 
ATOM   7849  C  CG   . GLN C  1 62  ? -47.126 -9.787  53.244  1.00 53.63  ?  62  GLN C CG   1 
ATOM   7850  C  CD   . GLN C  1 62  ? -46.732 -8.413  53.728  1.00 52.31  ?  62  GLN C CD   1 
ATOM   7851  O  OE1  . GLN C  1 62  ? -45.543 -8.103  53.848  1.00 57.77  ?  62  GLN C OE1  1 
ATOM   7852  N  NE2  . GLN C  1 62  ? -47.725 -7.565  53.972  1.00 56.81  ?  62  GLN C NE2  1 
ATOM   7853  H  H    . GLN C  1 62  ? -48.175 -10.150 50.501  1.00 33.04  ?  62  GLN C H    1 
ATOM   7854  H  HA   . GLN C  1 62  ? -46.353 -8.395  51.139  1.00 37.78  ?  62  GLN C HA   1 
ATOM   7855  H  HB2  . GLN C  1 62  ? -46.589 -11.120 51.804  1.00 49.35  ?  62  GLN C HB2  1 
ATOM   7856  H  HB3  . GLN C  1 62  ? -45.368 -10.254 52.333  1.00 49.35  ?  62  GLN C HB3  1 
ATOM   7857  H  HG2  . GLN C  1 62  ? -48.061 -9.761  52.989  1.00 64.36  ?  62  GLN C HG2  1 
ATOM   7858  H  HG3  . GLN C  1 62  ? -46.995 -10.413 53.973  1.00 64.36  ?  62  GLN C HG3  1 
ATOM   7859  H  HE21 . GLN C  1 62  ? -48.540 -7.811  53.852  1.00 68.18  ?  62  GLN C HE21 1 
ATOM   7860  H  HE22 . GLN C  1 62  ? -47.552 -6.769  54.250  1.00 68.18  ?  62  GLN C HE22 1 
ATOM   7861  N  N    . ILE C  1 63  ? -45.389 -10.583 49.014  1.00 24.49  ?  63  ILE C N    1 
ATOM   7862  C  CA   . ILE C  1 63  ? -44.361 -10.856 48.022  1.00 28.27  ?  63  ILE C CA   1 
ATOM   7863  C  C    . ILE C  1 63  ? -44.353 -9.770  46.950  1.00 27.25  ?  63  ILE C C    1 
ATOM   7864  O  O    . ILE C  1 63  ? -43.290 -9.378  46.454  1.00 26.80  ?  63  ILE C O    1 
ATOM   7865  C  CB   . ILE C  1 63  ? -44.582 -12.259 47.416  1.00 27.41  ?  63  ILE C CB   1 
ATOM   7866  C  CG1  . ILE C  1 63  ? -44.061 -13.349 48.363  1.00 35.12  ?  63  ILE C CG1  1 
ATOM   7867  C  CG2  . ILE C  1 63  ? -43.918 -12.402 46.027  1.00 29.09  ?  63  ILE C CG2  1 
ATOM   7868  C  CD1  . ILE C  1 63  ? -42.524 -13.391 48.534  1.00 31.43  ?  63  ILE C CD1  1 
ATOM   7869  H  H    . ILE C  1 63  ? -46.059 -11.121 48.987  1.00 29.39  ?  63  ILE C H    1 
ATOM   7870  H  HA   . ILE C  1 63  ? -43.495 -10.852 48.458  1.00 33.92  ?  63  ILE C HA   1 
ATOM   7871  H  HB   . ILE C  1 63  ? -45.536 -12.390 47.305  1.00 32.89  ?  63  ILE C HB   1 
ATOM   7872  H  HG12 . ILE C  1 63  ? -44.449 -13.206 49.240  1.00 42.14  ?  63  ILE C HG12 1 
ATOM   7873  H  HG13 . ILE C  1 63  ? -44.341 -14.213 48.022  1.00 42.14  ?  63  ILE C HG13 1 
ATOM   7874  H  HG21 . ILE C  1 63  ? -44.083 -13.296 45.689  1.00 34.91  ?  63  ILE C HG21 1 
ATOM   7875  H  HG22 . ILE C  1 63  ? -44.300 -11.745 45.426  1.00 34.91  ?  63  ILE C HG22 1 
ATOM   7876  H  HG23 . ILE C  1 63  ? -42.963 -12.253 46.117  1.00 34.91  ?  63  ILE C HG23 1 
ATOM   7877  H  HD11 . ILE C  1 63  ? -42.294 -14.108 49.147  1.00 37.71  ?  63  ILE C HD11 1 
ATOM   7878  H  HD12 . ILE C  1 63  ? -42.114 -13.551 47.669  1.00 37.71  ?  63  ILE C HD12 1 
ATOM   7879  H  HD13 . ILE C  1 63  ? -42.223 -12.541 48.891  1.00 37.71  ?  63  ILE C HD13 1 
ATOM   7880  N  N    . LEU C  1 64  ? -45.534 -9.285  46.560  1.00 23.96  ?  64  LEU C N    1 
ATOM   7881  C  CA   A LEU C  1 64  ? -45.615 -8.273  45.510  0.01 24.25  ?  64  LEU C CA   1 
ATOM   7882  C  CA   B LEU C  1 64  ? -45.631 -8.265  45.514  0.99 21.50  ?  64  LEU C CA   1 
ATOM   7883  C  C    . LEU C  1 64  ? -45.117 -6.912  45.986  1.00 26.01  ?  64  LEU C C    1 
ATOM   7884  O  O    . LEU C  1 64  ? -44.539 -6.149  45.197  1.00 25.11  ?  64  LEU C O    1 
ATOM   7885  C  CB   A LEU C  1 64  ? -47.056 -8.153  45.011  0.01 24.36  ?  64  LEU C CB   1 
ATOM   7886  C  CB   B LEU C  1 64  ? -47.082 -8.134  45.055  0.99 22.20  ?  64  LEU C CB   1 
ATOM   7887  C  CG   A LEU C  1 64  ? -47.473 -9.063  43.852  0.01 24.85  ?  64  LEU C CG   1 
ATOM   7888  C  CG   B LEU C  1 64  ? -47.654 -9.298  44.243  0.99 21.54  ?  64  LEU C CG   1 
ATOM   7889  C  CD1  A LEU C  1 64  ? -47.127 -10.519 44.125  0.01 25.84  ?  64  LEU C CD1  1 
ATOM   7890  C  CD1  B LEU C  1 64  ? -49.057 -8.955  43.849  0.99 22.64  ?  64  LEU C CD1  1 
ATOM   7891  C  CD2  A LEU C  1 64  ? -48.964 -8.913  43.584  0.01 24.58  ?  64  LEU C CD2  1 
ATOM   7892  C  CD2  B LEU C  1 64  ? -46.790 -9.613  43.000  0.99 29.07  ?  64  LEU C CD2  1 
ATOM   7893  H  H    A LEU C  1 64  ? -46.294 -9.524  46.885  0.01 28.75  ?  64  LEU C H    1 
ATOM   7894  H  H    B LEU C  1 64  ? -46.292 -9.530  46.885  0.99 28.75  ?  64  LEU C H    1 
ATOM   7895  H  HA   A LEU C  1 64  ? -45.061 -8.549  44.763  0.01 29.10  ?  64  LEU C HA   1 
ATOM   7896  H  HA   B LEU C  1 64  ? -45.098 -8.540  44.752  0.99 25.80  ?  64  LEU C HA   1 
ATOM   7897  H  HB2  A LEU C  1 64  ? -47.649 -8.347  45.753  0.01 29.23  ?  64  LEU C HB2  1 
ATOM   7898  H  HB2  B LEU C  1 64  ? -47.640 -8.033  45.842  0.99 26.64  ?  64  LEU C HB2  1 
ATOM   7899  H  HB3  A LEU C  1 64  ? -47.198 -7.238  44.720  0.01 29.23  ?  64  LEU C HB3  1 
ATOM   7900  H  HB3  B LEU C  1 64  ? -47.155 -7.338  44.506  0.99 26.64  ?  64  LEU C HB3  1 
ATOM   7901  H  HG   A LEU C  1 64  ? -46.998 -8.789  43.052  0.01 29.82  ?  64  LEU C HG   1 
ATOM   7902  H  HG   B LEU C  1 64  ? -47.682 -10.091 44.800  0.99 25.85  ?  64  LEU C HG   1 
ATOM   7903  H  HD11 A LEU C  1 64  ? -47.408 -11.057 43.368  0.01 31.01  ?  64  LEU C HD11 1 
ATOM   7904  H  HD11 B LEU C  1 64  ? -49.428 -9.689  43.333  0.99 27.17  ?  64  LEU C HD11 1 
ATOM   7905  H  HD12 A LEU C  1 64  ? -46.168 -10.597 44.249  0.01 31.01  ?  64  LEU C HD12 1 
ATOM   7906  H  HD12 B LEU C  1 64  ? -49.584 -8.815  44.652  0.99 27.17  ?  64  LEU C HD12 1 
ATOM   7907  H  HD13 A LEU C  1 64  ? -47.590 -10.808 44.927  0.01 31.01  ?  64  LEU C HD13 1 
ATOM   7908  H  HD13 B LEU C  1 64  ? -49.046 -8.146  43.315  0.99 27.17  ?  64  LEU C HD13 1 
ATOM   7909  H  HD21 A LEU C  1 64  ? -49.212 -9.494  42.848  0.01 29.49  ?  64  LEU C HD21 1 
ATOM   7910  H  HD21 B LEU C  1 64  ? -47.189 -10.354 42.518  0.99 34.88  ?  64  LEU C HD21 1 
ATOM   7911  H  HD22 A LEU C  1 64  ? -49.455 -9.161  44.383  0.01 29.49  ?  64  LEU C HD22 1 
ATOM   7912  H  HD22 B LEU C  1 64  ? -46.757 -8.828  42.432  0.99 34.88  ?  64  LEU C HD22 1 
ATOM   7913  H  HD23 A LEU C  1 64  ? -49.151 -7.989  43.354  0.01 29.49  ?  64  LEU C HD23 1 
ATOM   7914  H  HD23 B LEU C  1 64  ? -45.895 -9.851  43.290  0.99 34.88  ?  64  LEU C HD23 1 
ATOM   7915  N  N    . PHE C  1 65  ? -45.330 -6.580  47.254  1.00 23.59  ?  65  PHE C N    1 
ATOM   7916  C  CA   . PHE C  1 65  ? -44.986 -5.261  47.782  1.00 25.98  ?  65  PHE C CA   1 
ATOM   7917  C  C    . PHE C  1 65  ? -44.107 -5.393  49.023  1.00 30.00  ?  65  PHE C C    1 
ATOM   7918  O  O    . PHE C  1 65  ? -44.535 -5.064  50.136  1.00 32.79  ?  65  PHE C O    1 
ATOM   7919  C  CB   . PHE C  1 65  ? -46.254 -4.469  48.107  1.00 23.91  ?  65  PHE C CB   1 
ATOM   7920  C  CG   . PHE C  1 65  ? -47.158 -4.229  46.918  1.00 23.71  ?  65  PHE C CG   1 
ATOM   7921  C  CD1  . PHE C  1 65  ? -46.988 -3.116  46.105  1.00 25.89  ?  65  PHE C CD1  1 
ATOM   7922  C  CD2  . PHE C  1 65  ? -48.195 -5.106  46.619  1.00 21.31  ?  65  PHE C CD2  1 
ATOM   7923  C  CE1  . PHE C  1 65  ? -47.820 -2.891  45.024  1.00 27.02  ?  65  PHE C CE1  1 
ATOM   7924  C  CE2  . PHE C  1 65  ? -49.033 -4.884  45.547  1.00 23.46  ?  65  PHE C CE2  1 
ATOM   7925  C  CZ   . PHE C  1 65  ? -48.848 -3.767  44.740  1.00 22.54  ?  65  PHE C CZ   1 
ATOM   7926  H  H    . PHE C  1 65  ? -45.678 -7.107  47.838  1.00 28.31  ?  65  PHE C H    1 
ATOM   7927  H  HA   . PHE C  1 65  ? -44.487 -4.770  47.110  1.00 31.17  ?  65  PHE C HA   1 
ATOM   7928  H  HB2  . PHE C  1 65  ? -46.764 -4.958  48.771  1.00 28.69  ?  65  PHE C HB2  1 
ATOM   7929  H  HB3  . PHE C  1 65  ? -45.998 -3.604  48.462  1.00 28.69  ?  65  PHE C HB3  1 
ATOM   7930  H  HD1  . PHE C  1 65  ? -46.302 -2.515  46.287  1.00 31.06  ?  65  PHE C HD1  1 
ATOM   7931  H  HD2  . PHE C  1 65  ? -48.329 -5.853  47.156  1.00 25.57  ?  65  PHE C HD2  1 
ATOM   7932  H  HE1  . PHE C  1 65  ? -47.690 -2.141  44.489  1.00 32.42  ?  65  PHE C HE1  1 
ATOM   7933  H  HE2  . PHE C  1 65  ? -49.720 -5.484  45.361  1.00 28.16  ?  65  PHE C HE2  1 
ATOM   7934  H  HZ   . PHE C  1 65  ? -49.406 -3.617  44.011  1.00 27.04  ?  65  PHE C HZ   1 
ATOM   7935  N  N    . PRO C  1 66  ? -42.865 -5.842  48.862  1.00 28.90  ?  66  PRO C N    1 
ATOM   7936  C  CA   . PRO C  1 66  ? -41.959 -5.925  50.018  1.00 34.68  ?  66  PRO C CA   1 
ATOM   7937  C  C    . PRO C  1 66  ? -41.580 -4.545  50.541  1.00 41.64  ?  66  PRO C C    1 
ATOM   7938  O  O    . PRO C  1 66  ? -41.719 -3.527  49.862  1.00 34.32  ?  66  PRO C O    1 
ATOM   7939  C  CB   . PRO C  1 66  ? -40.744 -6.665  49.457  1.00 36.98  ?  66  PRO C CB   1 
ATOM   7940  C  CG   . PRO C  1 66  ? -40.762 -6.392  48.000  1.00 39.41  ?  66  PRO C CG   1 
ATOM   7941  C  CD   . PRO C  1 66  ? -42.210 -6.297  47.622  1.00 30.10  ?  66  PRO C CD   1 
ATOM   7942  H  HA   . PRO C  1 66  ? -42.359 -6.447  50.731  1.00 41.62  ?  66  PRO C HA   1 
ATOM   7943  H  HB2  . PRO C  1 66  ? -39.934 -6.316  49.861  1.00 44.38  ?  66  PRO C HB2  1 
ATOM   7944  H  HB3  . PRO C  1 66  ? -40.832 -7.616  49.629  1.00 44.38  ?  66  PRO C HB3  1 
ATOM   7945  H  HG2  . PRO C  1 66  ? -40.307 -5.555  47.821  1.00 47.29  ?  66  PRO C HG2  1 
ATOM   7946  H  HG3  . PRO C  1 66  ? -40.333 -7.123  47.527  1.00 47.29  ?  66  PRO C HG3  1 
ATOM   7947  H  HD2  . PRO C  1 66  ? -42.332 -5.643  46.916  1.00 36.12  ?  66  PRO C HD2  1 
ATOM   7948  H  HD3  . PRO C  1 66  ? -42.549 -7.168  47.361  1.00 36.12  ?  66  PRO C HD3  1 
ATOM   7949  N  N    . SER C  1 67  ? -41.102 -4.512  51.784  1.00 49.30  ?  67  SER C N    1 
ATOM   7950  C  CA   . SER C  1 67  ? -40.685 -3.238  52.359  1.00 49.02  ?  67  SER C CA   1 
ATOM   7951  C  C    . SER C  1 67  ? -39.589 -2.616  51.510  1.00 37.67  ?  67  SER C C    1 
ATOM   7952  O  O    . SER C  1 67  ? -38.699 -3.309  51.000  1.00 41.89  ?  67  SER C O    1 
ATOM   7953  C  CB   . SER C  1 67  ? -40.188 -3.421  53.793  1.00 60.73  ?  67  SER C CB   1 
ATOM   7954  O  OG   . SER C  1 67  ? -39.683 -2.193  54.302  1.00 64.48  ?  67  SER C OG   1 
ATOM   7955  H  H    . SER C  1 67  ? -41.011 -5.193  52.301  1.00 59.16  ?  67  SER C H    1 
ATOM   7956  H  HA   . SER C  1 67  ? -41.441 -2.630  52.374  1.00 58.82  ?  67  SER C HA   1 
ATOM   7957  H  HB2  . SER C  1 67  ? -40.926 -3.716  54.350  1.00 72.88  ?  67  SER C HB2  1 
ATOM   7958  H  HB3  . SER C  1 67  ? -39.479 -4.083  53.802  1.00 72.88  ?  67  SER C HB3  1 
ATOM   7959  H  HG   . SER C  1 67  ? -39.411 -2.299  55.090  1.00 77.37  ?  67  SER C HG   1 
ATOM   7960  N  N    . GLY C  1 68  ? -39.675 -1.296  51.337  1.00 41.36  ?  68  GLY C N    1 
ATOM   7961  C  CA   . GLY C  1 68  ? -38.714 -0.571  50.538  1.00 47.07  ?  68  GLY C CA   1 
ATOM   7962  C  C    . GLY C  1 68  ? -38.963 -0.625  49.051  1.00 45.42  ?  68  GLY C C    1 
ATOM   7963  O  O    . GLY C  1 68  ? -38.103 -0.195  48.276  1.00 41.32  ?  68  GLY C O    1 
ATOM   7964  H  H    . GLY C  1 68  ? -40.290 -0.802  51.680  1.00 49.63  ?  68  GLY C H    1 
ATOM   7965  H  HA2  . GLY C  1 68  ? -38.719 0.361   50.808  1.00 56.49  ?  68  GLY C HA2  1 
ATOM   7966  H  HA3  . GLY C  1 68  ? -37.829 -0.929  50.706  1.00 56.49  ?  68  GLY C HA3  1 
ATOM   7967  N  N    . SER C  1 69  ? -40.100 -1.166  48.626  1.00 40.93  ?  69  SER C N    1 
ATOM   7968  C  CA   . SER C  1 69  ? -40.434 -1.169  47.211  1.00 37.29  ?  69  SER C CA   1 
ATOM   7969  C  C    . SER C  1 69  ? -40.383 0.247   46.666  1.00 28.69  ?  69  SER C C    1 
ATOM   7970  O  O    . SER C  1 69  ? -40.939 1.171   47.265  1.00 33.88  ?  69  SER C O    1 
ATOM   7971  C  CB   . SER C  1 69  ? -41.829 -1.760  47.008  1.00 30.08  ?  69  SER C CB   1 
ATOM   7972  O  OG   . SER C  1 69  ? -41.825 -3.155  47.274  1.00 32.06  ?  69  SER C OG   1 
ATOM   7973  H  H    . SER C  1 69  ? -40.689 -1.534  49.133  1.00 49.11  ?  69  SER C H    1 
ATOM   7974  H  HA   . SER C  1 69  ? -39.794 -1.712  46.725  1.00 44.75  ?  69  SER C HA   1 
ATOM   7975  H  HB2  . SER C  1 69  ? -42.449 -1.324  47.613  1.00 36.10  ?  69  SER C HB2  1 
ATOM   7976  H  HB3  . SER C  1 69  ? -42.104 -1.614  46.089  1.00 36.10  ?  69  SER C HB3  1 
ATOM   7977  H  HG   . SER C  1 69  ? -41.587 -3.295  48.067  1.00 38.47  ?  69  SER C HG   1 
ATOM   7978  N  N    . ASP C  1 70  ? -39.718 0.414   45.532  1.00 27.40  ?  70  ASP C N    1 
ATOM   7979  C  CA   . ASP C  1 70  ? -39.706 1.713   44.882  1.00 28.20  ?  70  ASP C CA   1 
ATOM   7980  C  C    . ASP C  1 70  ? -40.891 1.834   43.924  1.00 34.04  ?  70  ASP C C    1 
ATOM   7981  O  O    . ASP C  1 70  ? -41.742 0.943   43.813  1.00 26.41  ?  70  ASP C O    1 
ATOM   7982  C  CB   . ASP C  1 70  ? -38.364 1.980   44.183  1.00 31.48  ?  70  ASP C CB   1 
ATOM   7983  C  CG   . ASP C  1 70  ? -38.074 1.050   43.011  1.00 44.33  ?  70  ASP C CG   1 
ATOM   7984  O  OD1  . ASP C  1 70  ? -38.982 0.387   42.475  1.00 32.75  ?  70  ASP C OD1  1 
ATOM   7985  O  OD2  . ASP C  1 70  ? -36.894 0.993   42.595  1.00 41.50  -1 70  ASP C OD2  1 
ATOM   7986  H  H    . ASP C  1 70  ? -39.274 -0.198  45.123  1.00 32.88  ?  70  ASP C H    1 
ATOM   7987  H  HA   . ASP C  1 70  ? -39.816 2.395   45.564  1.00 33.84  ?  70  ASP C HA   1 
ATOM   7988  H  HB2  . ASP C  1 70  ? -38.365 2.890   43.846  1.00 37.77  ?  70  ASP C HB2  1 
ATOM   7989  H  HB3  . ASP C  1 70  ? -37.650 1.871   44.830  1.00 37.77  ?  70  ASP C HB3  1 
ATOM   7990  N  N    . SER C  1 71  ? -40.945 2.968   43.225  1.00 28.57  ?  71  SER C N    1 
ATOM   7991  C  CA   . SER C  1 71  ? -42.131 3.307   42.449  1.00 27.87  ?  71  SER C CA   1 
ATOM   7992  C  C    . SER C  1 71  ? -42.355 2.329   41.307  1.00 28.06  ?  71  SER C C    1 
ATOM   7993  O  O    . SER C  1 71  ? -43.496 1.914   41.053  1.00 23.27  ?  71  SER C O    1 
ATOM   7994  C  CB   . SER C  1 71  ? -42.010 4.736   41.926  1.00 31.94  ?  71  SER C CB   1 
ATOM   7995  O  OG   . SER C  1 71  ? -40.981 4.853   40.970  1.00 38.02  ?  71  SER C OG   1 
ATOM   7996  H  H    . SER C  1 71  ? -40.313 3.551   43.186  1.00 34.28  ?  71  SER C H    1 
ATOM   7997  H  HA   . SER C  1 71  ? -42.907 3.268   43.030  1.00 33.44  ?  71  SER C HA   1 
ATOM   7998  H  HB2  . SER C  1 71  ? -42.850 4.992   41.515  1.00 38.33  ?  71  SER C HB2  1 
ATOM   7999  H  HB3  . SER C  1 71  ? -41.815 5.327   42.671  1.00 38.33  ?  71  SER C HB3  1 
ATOM   8000  H  HG   . SER C  1 71  ? -40.931 5.646   40.697  1.00 45.62  ?  71  SER C HG   1 
ATOM   8001  N  N    . GLY C  1 72  ? -41.287 1.944   40.601  1.00 26.21  ?  72  GLY C N    1 
ATOM   8002  C  CA   . GLY C  1 72  ? -41.428 0.957   39.552  1.00 25.43  ?  72  GLY C CA   1 
ATOM   8003  C  C    . GLY C  1 72  ? -41.886 -0.396  40.063  1.00 21.78  ?  72  GLY C C    1 
ATOM   8004  O  O    . GLY C  1 72  ? -42.686 -1.070  39.413  1.00 21.76  ?  72  GLY C O    1 
ATOM   8005  H  H    . GLY C  1 72  ? -40.487 2.239   40.714  1.00 31.45  ?  72  GLY C H    1 
ATOM   8006  H  HA2  . GLY C  1 72  ? -42.074 1.272   38.900  1.00 30.51  ?  72  GLY C HA2  1 
ATOM   8007  H  HA3  . GLY C  1 72  ? -40.575 0.841   39.104  1.00 30.51  ?  72  GLY C HA3  1 
ATOM   8008  N  N    . THR C  1 73  ? -41.370 -0.822  41.219  1.00 25.65  ?  73  THR C N    1 
ATOM   8009  C  CA   . THR C  1 73  ? -41.840 -2.074  41.813  1.00 23.43  ?  73  THR C CA   1 
ATOM   8010  C  C    . THR C  1 73  ? -43.322 -1.998  42.144  1.00 21.44  ?  73  THR C C    1 
ATOM   8011  O  O    . THR C  1 73  ? -44.080 -2.933  41.868  1.00 22.58  ?  73  THR C O    1 
ATOM   8012  C  CB   . THR C  1 73  ? -41.040 -2.397  43.075  1.00 29.00  ?  73  THR C CB   1 
ATOM   8013  O  OG1  . THR C  1 73  ? -39.708 -2.755  42.695  1.00 30.65  ?  73  THR C OG1  1 
ATOM   8014  C  CG2  . THR C  1 73  ? -41.685 -3.534  43.862  1.00 29.07  ?  73  THR C CG2  1 
ATOM   8015  H  H    . THR C  1 73  ? -40.761 -0.415  41.670  1.00 30.78  ?  73  THR C H    1 
ATOM   8016  H  HA   . THR C  1 73  ? -41.709 -2.796  41.178  1.00 28.11  ?  73  THR C HA   1 
ATOM   8017  H  HB   . THR C  1 73  ? -41.010 -1.612  43.644  1.00 34.80  ?  73  THR C HB   1 
ATOM   8018  H  HG1  . THR C  1 73  ? -39.253 -2.936  43.378  1.00 36.78  ?  73  THR C HG1  1 
ATOM   8019  H  HG21 . THR C  1 73  ? -41.164 -3.724  44.658  1.00 34.88  ?  73  THR C HG21 1 
ATOM   8020  H  HG22 . THR C  1 73  ? -42.585 -3.286  44.126  1.00 34.88  ?  73  THR C HG22 1 
ATOM   8021  H  HG23 . THR C  1 73  ? -41.726 -4.334  43.314  1.00 34.88  ?  73  THR C HG23 1 
ATOM   8022  N  N    . ILE C  1 74  ? -43.747 -0.883  42.727  1.00 22.01  ?  74  ILE C N    1 
ATOM   8023  C  CA   . ILE C  1 74  ? -45.149 -0.717  43.097  1.00 23.21  ?  74  ILE C CA   1 
ATOM   8024  C  C    . ILE C  1 74  ? -46.027 -0.746  41.845  1.00 21.78  ?  74  ILE C C    1 
ATOM   8025  O  O    . ILE C  1 74  ? -47.058 -1.425  41.810  1.00 19.62  ?  74  ILE C O    1 
ATOM   8026  C  CB   . ILE C  1 74  ? -45.335 0.580   43.913  1.00 22.11  ?  74  ILE C CB   1 
ATOM   8027  C  CG1  . ILE C  1 74  ? -44.655 0.444   45.285  1.00 25.57  ?  74  ILE C CG1  1 
ATOM   8028  C  CG2  . ILE C  1 74  ? -46.823 0.949   44.106  1.00 23.19  ?  74  ILE C CG2  1 
ATOM   8029  C  CD1  . ILE C  1 74  ? -44.411 1.800   45.990  1.00 29.77  ?  74  ILE C CD1  1 
ATOM   8030  H  H    . ILE C  1 74  ? -43.247 -0.210  42.918  1.00 26.41  ?  74  ILE C H    1 
ATOM   8031  H  HA   . ILE C  1 74  ? -45.413 -1.461  43.660  1.00 27.85  ?  74  ILE C HA   1 
ATOM   8032  H  HB   . ILE C  1 74  ? -44.904 1.304   43.433  1.00 26.53  ?  74  ILE C HB   1 
ATOM   8033  H  HG12 . ILE C  1 74  ? -45.218 -0.094  45.862  1.00 30.69  ?  74  ILE C HG12 1 
ATOM   8034  H  HG13 . ILE C  1 74  ? -43.795 0.012   45.166  1.00 30.69  ?  74  ILE C HG13 1 
ATOM   8035  H  HG21 . ILE C  1 74  ? -46.880 1.768   44.624  1.00 27.83  ?  74  ILE C HG21 1 
ATOM   8036  H  HG22 . ILE C  1 74  ? -47.231 1.079   43.236  1.00 27.83  ?  74  ILE C HG22 1 
ATOM   8037  H  HG23 . ILE C  1 74  ? -47.268 0.228   44.577  1.00 27.83  ?  74  ILE C HG23 1 
ATOM   8038  H  HD11 . ILE C  1 74  ? -43.982 1.638   46.844  1.00 35.72  ?  74  ILE C HD11 1 
ATOM   8039  H  HD12 . ILE C  1 74  ? -43.839 2.348   45.430  1.00 35.72  ?  74  ILE C HD12 1 
ATOM   8040  H  HD13 . ILE C  1 74  ? -45.264 2.242   46.126  1.00 35.72  ?  74  ILE C HD13 1 
ATOM   8041  N  N    . LEU C  1 75  ? -45.648 0.000   40.805  1.00 20.37  ?  75  LEU C N    1 
ATOM   8042  C  CA   . LEU C  1 75  ? -46.491 0.064   39.606  1.00 24.31  ?  75  LEU C CA   1 
ATOM   8043  C  C    . LEU C  1 75  ? -46.581 -1.292  38.904  1.00 19.28  ?  75  LEU C C    1 
ATOM   8044  O  O    . LEU C  1 75  ? -47.649 -1.686  38.429  1.00 19.47  ?  75  LEU C O    1 
ATOM   8045  C  CB   . LEU C  1 75  ? -45.963 1.131   38.646  1.00 19.20  ?  75  LEU C CB   1 
ATOM   8046  C  CG   . LEU C  1 75  ? -46.208 2.581   39.095  1.00 23.29  ?  75  LEU C CG   1 
ATOM   8047  C  CD1  . LEU C  1 75  ? -45.374 3.525   38.253  1.00 23.45  ?  75  LEU C CD1  1 
ATOM   8048  C  CD2  . LEU C  1 75  ? -47.695 2.968   38.986  1.00 22.88  ?  75  LEU C CD2  1 
ATOM   8049  H  H    . LEU C  1 75  ? -44.926 0.467   40.766  1.00 24.45  ?  75  LEU C H    1 
ATOM   8050  H  HA   . LEU C  1 75  ? -47.389 0.320   39.869  1.00 29.17  ?  75  LEU C HA   1 
ATOM   8051  H  HB2  . LEU C  1 75  ? -45.005 1.012   38.550  1.00 23.04  ?  75  LEU C HB2  1 
ATOM   8052  H  HB3  . LEU C  1 75  ? -46.394 1.014   37.786  1.00 23.04  ?  75  LEU C HB3  1 
ATOM   8053  H  HG   . LEU C  1 75  ? -45.936 2.680   40.021  1.00 27.95  ?  75  LEU C HG   1 
ATOM   8054  H  HD11 . LEU C  1 75  ? -45.537 4.435   38.545  1.00 28.14  ?  75  LEU C HD11 1 
ATOM   8055  H  HD12 . LEU C  1 75  ? -44.436 3.303   38.366  1.00 28.14  ?  75  LEU C HD12 1 
ATOM   8056  H  HD13 . LEU C  1 75  ? -45.628 3.425   37.322  1.00 28.14  ?  75  LEU C HD13 1 
ATOM   8057  H  HD21 . LEU C  1 75  ? -47.804 3.887   39.278  1.00 27.46  ?  75  LEU C HD21 1 
ATOM   8058  H  HD22 . LEU C  1 75  ? -47.977 2.878   38.063  1.00 27.46  ?  75  LEU C HD22 1 
ATOM   8059  H  HD23 . LEU C  1 75  ? -48.216 2.377   39.551  1.00 27.46  ?  75  LEU C HD23 1 
ATOM   8060  N  N    . THR C  1 76  ? -45.461 -2.015  38.840  1.00 19.53  ?  76  THR C N    1 
ATOM   8061  C  CA   . THR C  1 76  ? -45.452 -3.345  38.251  1.00 19.18  ?  76  THR C CA   1 
ATOM   8062  C  C    . THR C  1 76  ? -46.355 -4.284  39.036  1.00 20.21  ?  76  THR C C    1 
ATOM   8063  O  O    . THR C  1 76  ? -47.196 -4.990  38.462  1.00 18.39  ?  76  THR C O    1 
ATOM   8064  C  CB   . THR C  1 76  ? -44.002 -3.830  38.211  1.00 21.49  ?  76  THR C CB   1 
ATOM   8065  O  OG1  . THR C  1 76  ? -43.272 -3.004  37.292  1.00 25.10  ?  76  THR C OG1  1 
ATOM   8066  C  CG2  . THR C  1 76  ? -43.907 -5.298  37.776  1.00 20.55  ?  76  THR C CG2  1 
ATOM   8067  H  H    . THR C  1 76  ? -44.696 -1.754  39.134  1.00 23.44  ?  76  THR C H    1 
ATOM   8068  H  HA   . THR C  1 76  ? -45.782 -3.295  37.340  1.00 23.02  ?  76  THR C HA   1 
ATOM   8069  H  HB   . THR C  1 76  ? -43.612 -3.748  39.095  1.00 25.79  ?  76  THR C HB   1 
ATOM   8070  H  HG1  . THR C  1 76  ? -43.296 -2.203  37.544  1.00 30.12  ?  76  THR C HG1  1 
ATOM   8071  H  HG21 . THR C  1 76  ? -42.979 -5.579  37.759  1.00 24.66  ?  76  THR C HG21 1 
ATOM   8072  H  HG22 . THR C  1 76  ? -44.396 -5.860  38.398  1.00 24.66  ?  76  THR C HG22 1 
ATOM   8073  H  HG23 . THR C  1 76  ? -44.286 -5.406  36.889  1.00 24.66  ?  76  THR C HG23 1 
ATOM   8074  N  N    . SER C  1 77  ? -46.248 -4.249  40.362  1.00 19.21  ?  77  SER C N    1 
ATOM   8075  C  CA   . SER C  1 77  ? -47.079 -5.120  41.179  1.00 17.24  ?  77  SER C CA   1 
ATOM   8076  C  C    . SER C  1 77  ? -48.541 -4.706  41.144  1.00 18.91  ?  77  SER C C    1 
ATOM   8077  O  O    . SER C  1 77  ? -49.415 -5.556  41.294  1.00 18.82  ?  77  SER C O    1 
ATOM   8078  C  CB   . SER C  1 77  ? -46.536 -5.143  42.601  1.00 19.39  ?  77  SER C CB   1 
ATOM   8079  O  OG   . SER C  1 77  ? -45.387 -5.972  42.642  1.00 20.56  ?  77  SER C OG   1 
ATOM   8080  H  H    . SER C  1 77  ? -45.713 -3.741  40.803  1.00 23.05  ?  77  SER C H    1 
ATOM   8081  H  HA   . SER C  1 77  ? -47.022 -6.023  40.827  1.00 20.69  ?  77  SER C HA   1 
ATOM   8082  H  HB2  . SER C  1 77  ? -46.293 -4.242  42.867  1.00 23.27  ?  77  SER C HB2  1 
ATOM   8083  H  HB3  . SER C  1 77  ? -47.212 -5.500  43.198  1.00 23.27  ?  77  SER C HB3  1 
ATOM   8084  H  HG   . SER C  1 77  ? -45.076 -5.994  43.422  1.00 24.67  ?  77  SER C HG   1 
HETATM 8085  N  N    . MSE C  1 78  ? -48.831 -3.438  40.892  1.00 18.16  ?  78  MSE C N    1 
HETATM 8086  C  CA   . MSE C  1 78  ? -50.218 -3.016  40.672  1.00 21.59  ?  78  MSE C CA   1 
HETATM 8087  C  C    . MSE C  1 78  ? -50.810 -3.609  39.385  1.00 18.35  ?  78  MSE C C    1 
HETATM 8088  O  O    . MSE C  1 78  ? -52.007 -3.926  39.336  1.00 18.93  ?  78  MSE C O    1 
HETATM 8089  C  CB   . MSE C  1 78  ? -50.306 -1.511  40.640  1.00 18.60  ?  78  MSE C CB   1 
HETATM 8090  C  CG   . MSE C  1 78  ? -50.143 -0.946  42.047  1.00 20.65  ?  78  MSE C CG   1 
HETATM 8091  SE SE   . MSE C  1 78  ? -50.006 0.984   42.083  1.00 21.77  ?  78  MSE C SE   1 
HETATM 8092  C  CE   . MSE C  1 78  ? -51.844 1.388   41.612  1.00 22.41  ?  78  MSE C CE   1 
HETATM 8093  H  H    . MSE C  1 78  ? -48.253 -2.803  40.842  1.00 21.79  ?  78  MSE C H    1 
HETATM 8094  H  HA   . MSE C  1 78  ? -50.753 -3.321  41.422  1.00 25.91  ?  78  MSE C HA   1 
HETATM 8095  H  HB2  . MSE C  1 78  ? -49.596 -1.157  40.082  1.00 22.32  ?  78  MSE C HB2  1 
HETATM 8096  H  HB3  . MSE C  1 78  ? -51.173 -1.244  40.299  1.00 22.32  ?  78  MSE C HB3  1 
HETATM 8097  H  HG2  . MSE C  1 78  ? -50.913 -1.200  42.579  1.00 24.78  ?  78  MSE C HG2  1 
HETATM 8098  H  HG3  . MSE C  1 78  ? -49.335 -1.310  42.440  1.00 24.78  ?  78  MSE C HG3  1 
HETATM 8099  H  HE1  . MSE C  1 78  ? -51.958 2.350   41.583  1.00 26.90  ?  78  MSE C HE1  1 
HETATM 8100  H  HE2  . MSE C  1 78  ? -52.037 1.005   40.742  1.00 26.90  ?  78  MSE C HE2  1 
HETATM 8101  H  HE3  . MSE C  1 78  ? -52.432 1.004   42.281  1.00 26.90  ?  78  MSE C HE3  1 
ATOM   8102  N  N    . ASP C  1 79  ? -50.000 -3.730  38.323  1.00 18.23  ?  79  ASP C N    1 
ATOM   8103  C  CA   . ASP C  1 79  ? -50.413 -4.508  37.156  1.00 17.17  ?  79  ASP C CA   1 
ATOM   8104  C  C    . ASP C  1 79  ? -50.821 -5.911  37.581  1.00 17.68  ?  79  ASP C C    1 
ATOM   8105  O  O    . ASP C  1 79  ? -51.856 -6.424  37.154  1.00 17.90  ?  79  ASP C O    1 
ATOM   8106  C  CB   . ASP C  1 79  ? -49.299 -4.631  36.107  1.00 17.67  ?  79  ASP C CB   1 
ATOM   8107  C  CG   . ASP C  1 79  ? -49.124 -3.419  35.217  1.00 20.49  ?  79  ASP C CG   1 
ATOM   8108  O  OD1  . ASP C  1 79  ? -49.910 -2.445  35.239  1.00 19.66  ?  79  ASP C OD1  1 
ATOM   8109  O  OD2  . ASP C  1 79  ? -48.161 -3.451  34.417  1.00 21.54  -1 79  ASP C OD2  1 
ATOM   8110  H  H    . ASP C  1 79  ? -49.219 -3.376  38.257  1.00 21.87  ?  79  ASP C H    1 
ATOM   8111  H  HA   . ASP C  1 79  ? -51.178 -4.081  36.739  1.00 20.60  ?  79  ASP C HA   1 
ATOM   8112  H  HB2  . ASP C  1 79  ? -48.458 -4.781  36.566  1.00 21.20  ?  79  ASP C HB2  1 
ATOM   8113  H  HB3  . ASP C  1 79  ? -49.497 -5.389  35.534  1.00 21.20  ?  79  ASP C HB3  1 
ATOM   8114  N  N    . THR C  1 80  ? -50.003 -6.551  38.410  1.00 17.21  ?  80  THR C N    1 
ATOM   8115  C  CA   . THR C  1 80  ? -50.315 -7.905  38.871  1.00 20.98  ?  80  THR C CA   1 
ATOM   8116  C  C    . THR C  1 80  ? -51.631 -7.924  39.644  1.00 21.29  ?  80  THR C C    1 
ATOM   8117  O  O    . THR C  1 80  ? -52.452 -8.816  39.439  1.00 19.61  ?  80  THR C O    1 
ATOM   8118  C  CB   . THR C  1 80  ? -49.163 -8.445  39.713  1.00 17.16  ?  80  THR C CB   1 
ATOM   8119  O  OG1  . THR C  1 80  ? -47.966 -8.218  38.946  1.00 18.83  ?  80  THR C OG1  1 
ATOM   8120  C  CG2  . THR C  1 80  ? -49.337 -9.943  40.003  1.00 18.19  ?  80  THR C CG2  1 
ATOM   8121  H  H    . THR C  1 80  ? -49.267 -6.230  38.719  1.00 20.65  ?  80  THR C H    1 
ATOM   8122  H  HA   . THR C  1 80  ? -50.416 -8.483  38.099  1.00 25.18  ?  80  THR C HA   1 
ATOM   8123  H  HB   . THR C  1 80  ? -49.113 -7.964  40.554  1.00 20.59  ?  80  THR C HB   1 
ATOM   8124  H  HG1  . THR C  1 80  ? -47.297 -8.500  39.369  1.00 22.60  ?  80  THR C HG1  1 
ATOM   8125  H  HG21 . THR C  1 80  ? -48.596 -10.266 40.538  1.00 21.83  ?  80  THR C HG21 1 
ATOM   8126  H  HG22 . THR C  1 80  ? -50.164 -10.093 40.487  1.00 21.83  ?  80  THR C HG22 1 
ATOM   8127  H  HG23 . THR C  1 80  ? -49.365 -10.441 39.170  1.00 21.83  ?  80  THR C HG23 1 
ATOM   8128  N  N    . LEU C  1 81  ? -51.863 -6.929  40.501  1.00 19.41  ?  81  LEU C N    1 
ATOM   8129  C  CA   . LEU C  1 81  ? -53.126 -6.864  41.233  1.00 19.87  ?  81  LEU C CA   1 
ATOM   8130  C  C    . LEU C  1 81  ? -54.321 -6.796  40.273  1.00 22.79  ?  81  LEU C C    1 
ATOM   8131  O  O    . LEU C  1 81  ? -55.336 -7.488  40.460  1.00 22.27  ?  81  LEU C O    1 
ATOM   8132  C  CB   . LEU C  1 81  ? -53.135 -5.663  42.168  1.00 20.67  ?  81  LEU C CB   1 
ATOM   8133  C  CG   . LEU C  1 81  ? -52.163 -5.630  43.344  1.00 21.96  ?  81  LEU C CG   1 
ATOM   8134  C  CD1  . LEU C  1 81  ? -52.365 -4.314  44.090  1.00 26.88  ?  81  LEU C CD1  1 
ATOM   8135  C  CD2  . LEU C  1 81  ? -52.336 -6.801  44.288  1.00 23.00  ?  81  LEU C CD2  1 
ATOM   8136  H  H    . LEU C  1 81  ? -51.315 -6.289  40.674  1.00 23.29  ?  81  LEU C H    1 
ATOM   8137  H  HA   . LEU C  1 81  ? -53.220 -7.665  41.772  1.00 23.85  ?  81  LEU C HA   1 
ATOM   8138  H  HB2  . LEU C  1 81  ? -52.952 -4.873  41.635  1.00 24.81  ?  81  LEU C HB2  1 
ATOM   8139  H  HB3  . LEU C  1 81  ? -54.026 -5.588  42.542  1.00 24.81  ?  81  LEU C HB3  1 
ATOM   8140  H  HG   . LEU C  1 81  ? -51.254 -5.648  43.006  1.00 26.35  ?  81  LEU C HG   1 
ATOM   8141  H  HD11 . LEU C  1 81  ? -51.752 -4.280  44.841  1.00 32.26  ?  81  LEU C HD11 1 
ATOM   8142  H  HD12 . LEU C  1 81  ? -52.187 -3.578  43.484  1.00 32.26  ?  81  LEU C HD12 1 
ATOM   8143  H  HD13 . LEU C  1 81  ? -53.280 -4.269  44.407  1.00 32.26  ?  81  LEU C HD13 1 
ATOM   8144  H  HD21 . LEU C  1 81  ? -51.693 -6.722  45.010  1.00 27.60  ?  81  LEU C HD21 1 
ATOM   8145  H  HD22 . LEU C  1 81  ? -53.238 -6.787  44.645  1.00 27.60  ?  81  LEU C HD22 1 
ATOM   8146  H  HD23 . LEU C  1 81  ? -52.186 -7.625  43.799  1.00 27.60  ?  81  LEU C HD23 1 
ATOM   8147  N  N    . LEU C  1 82  ? -54.231 -5.975  39.229  1.00 18.84  ?  82  LEU C N    1 
ATOM   8148  C  CA   . LEU C  1 82  ? -55.332 -5.900  38.272  1.00 23.10  ?  82  LEU C CA   1 
ATOM   8149  C  C    . LEU C  1 82  ? -55.571 -7.237  37.589  1.00 29.15  ?  82  LEU C C    1 
ATOM   8150  O  O    . LEU C  1 82  ? -56.719 -7.635  37.369  1.00 24.60  ?  82  LEU C O    1 
ATOM   8151  C  CB   . LEU C  1 82  ? -55.063 -4.842  37.216  1.00 23.24  ?  82  LEU C CB   1 
ATOM   8152  C  CG   . LEU C  1 82  ? -55.061 -3.402  37.712  1.00 20.93  ?  82  LEU C CG   1 
ATOM   8153  C  CD1  . LEU C  1 82  ? -54.787 -2.470  36.556  1.00 23.66  ?  82  LEU C CD1  1 
ATOM   8154  C  CD2  . LEU C  1 82  ? -56.424 -3.078  38.350  1.00 24.76  ?  82  LEU C CD2  1 
ATOM   8155  H  H    . LEU C  1 82  ? -53.562 -5.464  39.054  1.00 22.61  ?  82  LEU C H    1 
ATOM   8156  H  HA   . LEU C  1 82  ? -56.143 -5.654  38.743  1.00 27.72  ?  82  LEU C HA   1 
ATOM   8157  H  HB2  . LEU C  1 82  ? -54.192 -5.015  36.824  1.00 27.89  ?  82  LEU C HB2  1 
ATOM   8158  H  HB3  . LEU C  1 82  ? -55.746 -4.912  36.531  1.00 27.89  ?  82  LEU C HB3  1 
ATOM   8159  H  HG   . LEU C  1 82  ? -54.367 -3.285  38.380  1.00 25.12  ?  82  LEU C HG   1 
ATOM   8160  H  HD11 . LEU C  1 82  ? -54.787 -1.556  36.881  1.00 28.39  ?  82  LEU C HD11 1 
ATOM   8161  H  HD12 . LEU C  1 82  ? -53.921 -2.685  36.176  1.00 28.39  ?  82  LEU C HD12 1 
ATOM   8162  H  HD13 . LEU C  1 82  ? -55.480 -2.584  35.887  1.00 28.39  ?  82  LEU C HD13 1 
ATOM   8163  H  HD21 . LEU C  1 82  ? -56.416 -2.160  38.663  1.00 29.71  ?  82  LEU C HD21 1 
ATOM   8164  H  HD22 . LEU C  1 82  ? -57.120 -3.195  37.683  1.00 29.71  ?  82  LEU C HD22 1 
ATOM   8165  H  HD23 . LEU C  1 82  ? -56.575 -3.681  39.095  1.00 29.71  ?  82  LEU C HD23 1 
ATOM   8166  N  N    . ALA C  1 83  ? -54.503 -7.923  37.207  1.00 20.86  ?  83  ALA C N    1 
ATOM   8167  C  CA   . ALA C  1 83  ? -54.649 -9.202  36.524  1.00 23.85  ?  83  ALA C CA   1 
ATOM   8168  C  C    . ALA C  1 83  ? -55.232 -10.257 37.452  1.00 25.04  ?  83  ALA C C    1 
ATOM   8169  O  O    . ALA C  1 83  ? -55.863 -11.204 36.984  1.00 26.82  ?  83  ALA C O    1 
ATOM   8170  C  CB   . ALA C  1 83  ? -53.294 -9.655  35.983  1.00 21.18  ?  83  ALA C CB   1 
ATOM   8171  H  H    . ALA C  1 83  ? -53.689 -7.674  37.330  1.00 25.03  ?  83  ALA C H    1 
ATOM   8172  H  HA   . ALA C  1 83  ? -55.253 -9.094  35.772  1.00 28.62  ?  83  ALA C HA   1 
ATOM   8173  H  HB1  . ALA C  1 83  ? -53.403 -10.506 35.531  1.00 25.42  ?  83  ALA C HB1  1 
ATOM   8174  H  HB2  . ALA C  1 83  ? -52.964 -8.988  35.360  1.00 25.42  ?  83  ALA C HB2  1 
ATOM   8175  H  HB3  . ALA C  1 83  ? -52.675 -9.750  36.724  1.00 25.42  ?  83  ALA C HB3  1 
ATOM   8176  N  N    . LEU C  1 84  ? -55.016 -10.121 38.757  1.00 22.80  ?  84  LEU C N    1 
ATOM   8177  C  CA   . LEU C  1 84  ? -55.488 -11.083 39.746  1.00 24.92  ?  84  LEU C CA   1 
ATOM   8178  C  C    . LEU C  1 84  ? -56.959 -10.918 40.101  1.00 32.16  ?  84  LEU C C    1 
ATOM   8179  O  O    . LEU C  1 84  ? -57.501 -11.778 40.799  1.00 35.77  ?  84  LEU C O    1 
ATOM   8180  C  CB   . LEU C  1 84  ? -54.651 -10.981 41.030  1.00 24.18  ?  84  LEU C CB   1 
ATOM   8181  C  CG   . LEU C  1 84  ? -53.233 -11.557 40.940  1.00 23.74  ?  84  LEU C CG   1 
ATOM   8182  C  CD1  . LEU C  1 84  ? -52.411 -11.222 42.196  1.00 24.36  ?  84  LEU C CD1  1 
ATOM   8183  C  CD2  . LEU C  1 84  ? -53.237 -13.064 40.700  1.00 26.49  ?  84  LEU C CD2  1 
ATOM   8184  H  H    . LEU C  1 84  ? -54.587 -9.461  39.103  1.00 27.36  ?  84  LEU C H    1 
ATOM   8185  H  HA   . LEU C  1 84  ? -55.371 -11.977 39.388  1.00 29.90  ?  84  LEU C HA   1 
ATOM   8186  H  HB2  . LEU C  1 84  ? -54.570 -10.045 41.270  1.00 29.01  ?  84  LEU C HB2  1 
ATOM   8187  H  HB3  . LEU C  1 84  ? -55.114 -11.458 41.736  1.00 29.01  ?  84  LEU C HB3  1 
ATOM   8188  H  HG   . LEU C  1 84  ? -52.785 -11.146 40.184  1.00 28.48  ?  84  LEU C HG   1 
ATOM   8189  H  HD11 . LEU C  1 84  ? -51.523 -11.602 42.102  1.00 29.23  ?  84  LEU C HD11 1 
ATOM   8190  H  HD12 . LEU C  1 84  ? -52.351 -10.258 42.286  1.00 29.23  ?  84  LEU C HD12 1 
ATOM   8191  H  HD13 . LEU C  1 84  ? -52.852 -11.601 42.972  1.00 29.23  ?  84  LEU C HD13 1 
ATOM   8192  H  HD21 . LEU C  1 84  ? -52.320 -13.378 40.652  1.00 31.79  ?  84  LEU C HD21 1 
ATOM   8193  H  HD22 . LEU C  1 84  ? -53.697 -13.499 41.435  1.00 31.79  ?  84  LEU C HD22 1 
ATOM   8194  H  HD23 . LEU C  1 84  ? -53.695 -13.250 39.866  1.00 31.79  ?  84  LEU C HD23 1 
ATOM   8195  N  N    . GLY C  1 85  ? -57.594 -9.823  39.701  1.00 24.53  ?  85  GLY C N    1 
ATOM   8196  C  CA   . GLY C  1 85  ? -59.044 -9.735  39.740  1.00 30.47  ?  85  GLY C CA   1 
ATOM   8197  C  C    . GLY C  1 85  ? -59.623 -9.089  40.990  1.00 35.87  ?  85  GLY C C    1 
ATOM   8198  O  O    . GLY C  1 85  ? -58.939 -8.389  41.737  1.00 27.66  ?  85  GLY C O    1 
ATOM   8199  H  H    . GLY C  1 85  ? -57.206 -9.116  39.402  1.00 29.44  ?  85  GLY C H    1 
ATOM   8200  H  HA2  . GLY C  1 85  ? -59.347 -9.223  38.973  1.00 36.57  ?  85  GLY C HA2  1 
ATOM   8201  H  HA3  . GLY C  1 85  ? -59.414 -10.629 39.668  1.00 36.57  ?  85  GLY C HA3  1 
ATOM   8202  N  N    . PRO C  1 86  ? -60.915 -9.335  41.256  1.00 35.50  ?  86  PRO C N    1 
ATOM   8203  C  CA   . PRO C  1 86  ? -61.629 -8.500  42.237  1.00 31.29  ?  86  PRO C CA   1 
ATOM   8204  C  C    . PRO C  1 86  ? -61.121 -8.602  43.669  1.00 26.30  ?  86  PRO C C    1 
ATOM   8205  O  O    . PRO C  1 86  ? -61.253 -7.631  44.418  1.00 36.95  ?  86  PRO C O    1 
ATOM   8206  C  CB   . PRO C  1 86  ? -63.077 -9.002  42.124  1.00 42.86  ?  86  PRO C CB   1 
ATOM   8207  C  CG   . PRO C  1 86  ? -62.959 -10.385 41.581  1.00 47.88  ?  86  PRO C CG   1 
ATOM   8208  C  CD   . PRO C  1 86  ? -61.790 -10.352 40.652  1.00 47.40  ?  86  PRO C CD   1 
ATOM   8209  H  HA   . PRO C  1 86  ? -61.599 -7.571  41.960  1.00 37.55  ?  86  PRO C HA   1 
ATOM   8210  H  HB2  . PRO C  1 86  ? -63.491 -9.012  43.001  1.00 51.43  ?  86  PRO C HB2  1 
ATOM   8211  H  HB3  . PRO C  1 86  ? -63.575 -8.435  41.515  1.00 51.43  ?  86  PRO C HB3  1 
ATOM   8212  H  HG2  . PRO C  1 86  ? -62.801 -11.008 42.307  1.00 57.45  ?  86  PRO C HG2  1 
ATOM   8213  H  HG3  . PRO C  1 86  ? -63.770 -10.617 41.102  1.00 57.45  ?  86  PRO C HG3  1 
ATOM   8214  H  HD2  . PRO C  1 86  ? -61.346 -11.214 40.635  1.00 56.88  ?  86  PRO C HD2  1 
ATOM   8215  H  HD3  . PRO C  1 86  ? -62.069 -10.076 39.765  1.00 56.88  ?  86  PRO C HD3  1 
ATOM   8216  N  N    . ASP C  1 87  ? -60.547 -9.734  44.085  1.00 36.51  ?  87  ASP C N    1 
ATOM   8217  C  CA   . ASP C  1 87  ? -60.040 -9.838  45.453  1.00 37.88  ?  87  ASP C CA   1 
ATOM   8218  C  C    . ASP C  1 87  ? -58.835 -8.939  45.713  1.00 38.45  ?  87  ASP C C    1 
ATOM   8219  O  O    . ASP C  1 87  ? -58.389 -8.847  46.861  1.00 35.73  ?  87  ASP C O    1 
ATOM   8220  C  CB   . ASP C  1 87  ? -59.648 -11.282 45.783  1.00 43.18  ?  87  ASP C CB   1 
ATOM   8221  C  CG   . ASP C  1 87  ? -60.849 -12.196 45.919  1.00 54.35  ?  87  ASP C CG   1 
ATOM   8222  O  OD1  . ASP C  1 87  ? -61.964 -11.681 46.129  1.00 48.40  ?  87  ASP C OD1  1 
ATOM   8223  O  OD2  . ASP C  1 87  ? -60.667 -13.425 45.825  1.00 52.28  -1 87  ASP C OD2  1 
ATOM   8224  H  H    . ASP C  1 87  ? -60.442 -10.441 43.607  1.00 43.81  ?  87  ASP C H    1 
ATOM   8225  H  HA   . ASP C  1 87  ? -60.744 -9.574  46.067  1.00 45.46  ?  87  ASP C HA   1 
ATOM   8226  H  HB2  . ASP C  1 87  ? -59.087 -11.628 45.072  1.00 51.82  ?  87  ASP C HB2  1 
ATOM   8227  H  HB3  . ASP C  1 87  ? -59.165 -11.295 46.624  1.00 51.82  ?  87  ASP C HB3  1 
ATOM   8228  N  N    . PHE C  1 88  ? -58.290 -8.302  44.676  1.00 34.59  ?  88  PHE C N    1 
ATOM   8229  C  CA   . PHE C  1 88  ? -57.109 -7.470  44.808  1.00 34.45  ?  88  PHE C CA   1 
ATOM   8230  C  C    . PHE C  1 88  ? -57.356 -6.022  44.407  1.00 41.61  ?  88  PHE C C    1 
ATOM   8231  O  O    . PHE C  1 88  ? -56.431 -5.205  44.488  1.00 32.24  ?  88  PHE C O    1 
ATOM   8232  C  CB   . PHE C  1 88  ? -55.965 -8.083  43.983  1.00 27.25  ?  88  PHE C CB   1 
ATOM   8233  C  CG   . PHE C  1 88  ? -55.564 -9.459  44.467  1.00 29.57  ?  88  PHE C CG   1 
ATOM   8234  C  CD1  . PHE C  1 88  ? -56.234 -10.589 44.018  1.00 30.30  ?  88  PHE C CD1  1 
ATOM   8235  C  CD2  . PHE C  1 88  ? -54.539 -9.618  45.383  1.00 30.94  ?  88  PHE C CD2  1 
ATOM   8236  C  CE1  . PHE C  1 88  ? -55.884 -11.844 44.463  1.00 36.31  ?  88  PHE C CE1  1 
ATOM   8237  C  CE2  . PHE C  1 88  ? -54.176 -10.876 45.833  1.00 36.31  ?  88  PHE C CE2  1 
ATOM   8238  C  CZ   . PHE C  1 88  ? -54.856 -11.998 45.373  1.00 33.69  ?  88  PHE C CZ   1 
ATOM   8239  H  H    . PHE C  1 88  ? -58.597 -8.340  43.873  1.00 41.50  ?  88  PHE C H    1 
ATOM   8240  H  HA   . PHE C  1 88  ? -56.833 -7.473  45.737  1.00 41.34  ?  88  PHE C HA   1 
ATOM   8241  H  HB2  . PHE C  1 88  ? -56.249 -8.161  43.059  1.00 32.69  ?  88  PHE C HB2  1 
ATOM   8242  H  HB3  . PHE C  1 88  ? -55.188 -7.505  44.044  1.00 32.69  ?  88  PHE C HB3  1 
ATOM   8243  H  HD1  . PHE C  1 88  ? -56.929 -10.497 43.407  1.00 36.36  ?  88  PHE C HD1  1 
ATOM   8244  H  HD2  . PHE C  1 88  ? -54.083 -8.870  45.695  1.00 37.13  ?  88  PHE C HD2  1 
ATOM   8245  H  HE1  . PHE C  1 88  ? -56.341 -12.591 44.150  1.00 43.58  ?  88  PHE C HE1  1 
ATOM   8246  H  HE2  . PHE C  1 88  ? -53.483 -10.971 46.447  1.00 43.57  ?  88  PHE C HE2  1 
ATOM   8247  H  HZ   . PHE C  1 88  ? -54.618 -12.846 45.671  1.00 40.43  ?  88  PHE C HZ   1 
ATOM   8248  N  N    . LEU C  1 89  ? -58.586 -5.667  44.039  1.00 30.37  ?  89  LEU C N    1 
ATOM   8249  C  CA   . LEU C  1 89  ? -58.855 -4.328  43.522  1.00 34.63  ?  89  LEU C CA   1 
ATOM   8250  C  C    . LEU C  1 89  ? -58.875 -3.275  44.618  1.00 34.10  ?  89  LEU C C    1 
ATOM   8251  O  O    . LEU C  1 89  ? -58.534 -2.110  44.367  1.00 34.50  ?  89  LEU C O    1 
ATOM   8252  C  CB   . LEU C  1 89  ? -60.179 -4.325  42.762  1.00 44.38  ?  89  LEU C CB   1 
ATOM   8253  C  CG   . LEU C  1 89  ? -60.562 -3.044  42.028  1.00 39.33  ?  89  LEU C CG   1 
ATOM   8254  C  CD1  . LEU C  1 89  ? -59.591 -2.687  40.898  1.00 36.79  ?  89  LEU C CD1  1 
ATOM   8255  C  CD2  . LEU C  1 89  ? -61.965 -3.209  41.460  1.00 58.55  ?  89  LEU C CD2  1 
ATOM   8256  H  H    . LEU C  1 89  ? -59.277 -6.178  44.079  1.00 36.44  ?  89  LEU C H    1 
ATOM   8257  H  HA   . LEU C  1 89  ? -58.154 -4.090  42.895  1.00 41.56  ?  89  LEU C HA   1 
ATOM   8258  H  HB2  . LEU C  1 89  ? -60.147 -5.033  42.101  1.00 53.25  ?  89  LEU C HB2  1 
ATOM   8259  H  HB3  . LEU C  1 89  ? -60.889 -4.512  43.396  1.00 53.25  ?  89  LEU C HB3  1 
ATOM   8260  H  HG   . LEU C  1 89  ? -60.576 -2.307  42.659  1.00 47.20  ?  89  LEU C HG   1 
ATOM   8261  H  HD11 . LEU C  1 89  ? -59.889 -1.868  40.473  1.00 44.15  ?  89  LEU C HD11 1 
ATOM   8262  H  HD12 . LEU C  1 89  ? -58.705 -2.564  41.272  1.00 44.15  ?  89  LEU C HD12 1 
ATOM   8263  H  HD13 . LEU C  1 89  ? -59.581 -3.410  40.252  1.00 44.15  ?  89  LEU C HD13 1 
ATOM   8264  H  HD21 . LEU C  1 89  ? -62.213 -2.397  40.992  1.00 70.26  ?  89  LEU C HD21 1 
ATOM   8265  H  HD22 . LEU C  1 89  ? -61.970 -3.960  40.847  1.00 70.26  ?  89  LEU C HD22 1 
ATOM   8266  H  HD23 . LEU C  1 89  ? -62.583 -3.373  42.190  1.00 70.26  ?  89  LEU C HD23 1 
ATOM   8267  N  N    . THR C  1 90  ? -59.276 -3.641  45.833  1.00 37.81  ?  90  THR C N    1 
ATOM   8268  C  CA   . THR C  1 90  ? -59.190 -2.685  46.925  1.00 38.58  ?  90  THR C CA   1 
ATOM   8269  C  C    . THR C  1 90  ? -57.736 -2.372  47.245  1.00 41.24  ?  90  THR C C    1 
ATOM   8270  O  O    . THR C  1 90  ? -57.384 -1.204  47.462  1.00 36.09  ?  90  THR C O    1 
ATOM   8271  C  CB   . THR C  1 90  ? -59.931 -3.221  48.147  1.00 47.73  ?  90  THR C CB   1 
ATOM   8272  O  OG1  . THR C  1 90  ? -61.319 -3.348  47.815  1.00 44.12  ?  90  THR C OG1  1 
ATOM   8273  C  CG2  . THR C  1 90  ? -59.782 -2.281  49.324  1.00 50.57  ?  90  THR C CG2  1 
ATOM   8274  H  H    . THR C  1 90  ? -59.593 -4.412  46.044  1.00 45.37  ?  90  THR C H    1 
ATOM   8275  H  HA   . THR C  1 90  ? -59.620 -1.859  46.654  1.00 46.30  ?  90  THR C HA   1 
ATOM   8276  H  HB   . THR C  1 90  ? -59.573 -4.088  48.393  1.00 57.27  ?  90  THR C HB   1 
ATOM   8277  H  HG1  . THR C  1 90  ? -61.746 -3.642  48.476  1.00 52.94  ?  90  THR C HG1  1 
ATOM   8278  H  HG21 . THR C  1 90  ? -60.258 -2.634  50.092  1.00 60.69  ?  90  THR C HG21 1 
ATOM   8279  H  HG22 . THR C  1 90  ? -58.845 -2.182  49.553  1.00 60.69  ?  90  THR C HG22 1 
ATOM   8280  H  HG23 . THR C  1 90  ? -60.146 -1.410  49.101  1.00 60.69  ?  90  THR C HG23 1 
ATOM   8281  N  N    . GLU C  1 91  ? -56.867 -3.395  47.227  1.00 37.19  ?  91  GLU C N    1 
ATOM   8282  C  CA   . GLU C  1 91  ? -55.442 -3.155  47.429  1.00 32.71  ?  91  GLU C CA   1 
ATOM   8283  C  C    . GLU C  1 91  ? -54.879 -2.275  46.319  1.00 26.72  ?  91  GLU C C    1 
ATOM   8284  O  O    . GLU C  1 91  ? -54.068 -1.384  46.587  1.00 29.74  ?  91  GLU C O    1 
ATOM   8285  C  CB   . GLU C  1 91  ? -54.674 -4.482  47.507  1.00 35.15  ?  91  GLU C CB   1 
ATOM   8286  C  CG   . GLU C  1 91  ? -53.183 -4.341  47.811  1.00 32.42  ?  91  GLU C CG   1 
ATOM   8287  C  CD   . GLU C  1 91  ? -52.883 -3.978  49.261  1.00 41.09  ?  91  GLU C CD   1 
ATOM   8288  O  OE1  . GLU C  1 91  ? -53.654 -4.382  50.156  1.00 44.51  ?  91  GLU C OE1  1 
ATOM   8289  O  OE2  . GLU C  1 91  ? -51.857 -3.317  49.507  1.00 36.91  -1 91  GLU C OE2  1 
ATOM   8290  H  H    . GLU C  1 91  ? -57.078 -4.219  47.102  1.00 44.62  ?  91  GLU C H    1 
ATOM   8291  H  HA   . GLU C  1 91  ? -55.318 -2.689  48.271  1.00 39.26  ?  91  GLU C HA   1 
ATOM   8292  H  HB2  . GLU C  1 91  ? -55.067 -5.026  48.208  1.00 42.18  ?  91  GLU C HB2  1 
ATOM   8293  H  HB3  . GLU C  1 91  ? -54.758 -4.938  46.655  1.00 42.18  ?  91  GLU C HB3  1 
ATOM   8294  H  HG2  . GLU C  1 91  ? -52.743 -5.184  47.620  1.00 38.90  ?  91  GLU C HG2  1 
ATOM   8295  H  HG3  . GLU C  1 91  ? -52.813 -3.643  47.248  1.00 38.90  ?  91  GLU C HG3  1 
ATOM   8296  N  N    . PHE C  1 92  ? -55.322 -2.485  45.077  1.00 27.52  ?  92  PHE C N    1 
ATOM   8297  C  CA   . PHE C  1 92  ? -54.885 -1.617  43.991  1.00 25.08  ?  92  PHE C CA   1 
ATOM   8298  C  C    . PHE C  1 92  ? -55.243 -0.164  44.273  1.00 32.87  ?  92  PHE C C    1 
ATOM   8299  O  O    . PHE C  1 92  ? -54.421 0.739   44.098  1.00 28.31  ?  92  PHE C O    1 
ATOM   8300  C  CB   . PHE C  1 92  ? -55.504 -2.074  42.683  1.00 26.02  ?  92  PHE C CB   1 
ATOM   8301  C  CG   . PHE C  1 92  ? -55.222 -1.169  41.521  1.00 27.76  ?  92  PHE C CG   1 
ATOM   8302  C  CD1  . PHE C  1 92  ? -55.965 -0.025  41.311  1.00 27.34  ?  92  PHE C CD1  1 
ATOM   8303  C  CD2  . PHE C  1 92  ? -54.211 -1.476  40.621  1.00 23.55  ?  92  PHE C CD2  1 
ATOM   8304  C  CE1  . PHE C  1 92  ? -55.717 0.786   40.230  1.00 27.56  ?  92  PHE C CE1  1 
ATOM   8305  C  CE2  . PHE C  1 92  ? -53.956 -0.675  39.540  1.00 22.24  ?  92  PHE C CE2  1 
ATOM   8306  C  CZ   . PHE C  1 92  ? -54.691 0.467   39.344  1.00 25.60  ?  92  PHE C CZ   1 
ATOM   8307  H  H    . PHE C  1 92  ? -55.864 -3.111  44.844  1.00 33.03  ?  92  PHE C H    1 
ATOM   8308  H  HA   . PHE C  1 92  ? -53.921 -1.678  43.905  1.00 30.10  ?  92  PHE C HA   1 
ATOM   8309  H  HB2  . PHE C  1 92  ? -55.157 -2.953  42.464  1.00 31.23  ?  92  PHE C HB2  1 
ATOM   8310  H  HB3  . PHE C  1 92  ? -56.467 -2.121  42.794  1.00 31.23  ?  92  PHE C HB3  1 
ATOM   8311  H  HD1  . PHE C  1 92  ? -56.650 0.193   41.902  1.00 32.80  ?  92  PHE C HD1  1 
ATOM   8312  H  HD2  . PHE C  1 92  ? -53.706 -2.247  40.747  1.00 28.26  ?  92  PHE C HD2  1 
ATOM   8313  H  HE1  . PHE C  1 92  ? -56.219 1.558   40.102  1.00 33.07  ?  92  PHE C HE1  1 
ATOM   8314  H  HE2  . PHE C  1 92  ? -53.270 -0.893  38.950  1.00 26.69  ?  92  PHE C HE2  1 
ATOM   8315  H  HZ   . PHE C  1 92  ? -54.517 1.016   38.613  1.00 30.72  ?  92  PHE C HZ   1 
ATOM   8316  N  N    . LYS C  1 93  ? -56.483 0.084   44.690  1.00 31.04  ?  93  LYS C N    1 
ATOM   8317  C  CA   . LYS C  1 93  ? -56.904 1.459   44.931  1.00 34.93  ?  93  LYS C CA   1 
ATOM   8318  C  C    . LYS C  1 93  ? -56.119 2.088   46.075  1.00 30.82  ?  93  LYS C C    1 
ATOM   8319  O  O    . LYS C  1 93  ? -55.770 3.273   46.018  1.00 30.89  ?  93  LYS C O    1 
ATOM   8320  C  CB   . LYS C  1 93  ? -58.405 1.481   45.205  1.00 31.54  ?  93  LYS C CB   1 
ATOM   8321  C  CG   . LYS C  1 93  ? -59.226 1.207   43.955  1.00 34.40  ?  93  LYS C CG   1 
ATOM   8322  C  CD   . LYS C  1 93  ? -60.706 1.351   44.250  1.00 56.46  ?  93  LYS C CD   1 
ATOM   8323  C  CE   . LYS C  1 93  ? -61.469 1.862   43.043  1.00 63.13  ?  93  LYS C CE   1 
ATOM   8324  N  NZ   . LYS C  1 93  ? -62.870 2.257   43.392  1.00 66.67  1  93  LYS C NZ   1 
ATOM   8325  H  H    . LYS C  1 93  ? -57.086 -0.511  44.837  1.00 37.25  ?  93  LYS C H    1 
ATOM   8326  H  HA   . LYS C  1 93  ? -56.739 1.984   44.132  1.00 41.92  ?  93  LYS C HA   1 
ATOM   8327  H  HB2  . LYS C  1 93  ? -58.617 0.798   45.861  1.00 37.84  ?  93  LYS C HB2  1 
ATOM   8328  H  HB3  . LYS C  1 93  ? -58.653 2.356   45.543  1.00 37.84  ?  93  LYS C HB3  1 
ATOM   8329  H  HG2  . LYS C  1 93  ? -58.986 1.845   43.265  1.00 41.28  ?  93  LYS C HG2  1 
ATOM   8330  H  HG3  . LYS C  1 93  ? -59.060 0.301   43.651  1.00 41.28  ?  93  LYS C HG3  1 
ATOM   8331  H  HD2  . LYS C  1 93  ? -61.069 0.485   44.494  1.00 67.76  ?  93  LYS C HD2  1 
ATOM   8332  H  HD3  . LYS C  1 93  ? -60.827 1.983   44.976  1.00 67.76  ?  93  LYS C HD3  1 
ATOM   8333  H  HE2  . LYS C  1 93  ? -61.015 2.642   42.686  1.00 75.76  ?  93  LYS C HE2  1 
ATOM   8334  H  HE3  . LYS C  1 93  ? -61.509 1.163   42.372  1.00 75.76  ?  93  LYS C HE3  1 
ATOM   8335  H  HZ1  . LYS C  1 93  ? -63.292 2.552   42.667  1.00 80.00  ?  93  LYS C HZ1  1 
ATOM   8336  H  HZ2  . LYS C  1 93  ? -63.310 1.555   43.718  1.00 80.00  ?  93  LYS C HZ2  1 
ATOM   8337  H  HZ3  . LYS C  1 93  ? -62.860 2.902   44.004  1.00 80.00  ?  93  LYS C HZ3  1 
ATOM   8338  N  N    . LYS C  1 94  ? -55.829 1.311   47.124  1.00 32.84  ?  94  LYS C N    1 
ATOM   8339  C  CA   . LYS C  1 94  ? -55.000 1.805   48.222  1.00 39.57  ?  94  LYS C CA   1 
ATOM   8340  C  C    . LYS C  1 94  ? -53.622 2.218   47.727  1.00 45.03  ?  94  LYS C C    1 
ATOM   8341  O  O    . LYS C  1 94  ? -53.123 3.291   48.086  1.00 33.96  ?  94  LYS C O    1 
ATOM   8342  C  CB   . LYS C  1 94  ? -54.869 0.743   49.323  1.00 45.01  ?  94  LYS C CB   1 
ATOM   8343  C  CG   . LYS C  1 94  ? -53.758 1.019   50.376  1.00 53.33  ?  94  LYS C CG   1 
ATOM   8344  C  CD   . LYS C  1 94  ? -53.374 -0.225  51.198  1.00 67.16  ?  94  LYS C CD   1 
ATOM   8345  C  CE   . LYS C  1 94  ? -54.493 -0.661  52.140  1.00 65.32  ?  94  LYS C CE   1 
ATOM   8346  N  NZ   . LYS C  1 94  ? -53.996 -1.567  53.220  1.00 61.99  1  94  LYS C NZ   1 
ATOM   8347  H  H    . LYS C  1 94  ? -56.099 0.501   47.222  1.00 39.41  ?  94  LYS C H    1 
ATOM   8348  H  HA   . LYS C  1 94  ? -55.424 2.587   48.609  1.00 47.49  ?  94  LYS C HA   1 
ATOM   8349  H  HB2  . LYS C  1 94  ? -55.713 0.685   49.797  1.00 54.02  ?  94  LYS C HB2  1 
ATOM   8350  H  HB3  . LYS C  1 94  ? -54.671 -0.111  48.906  1.00 54.02  ?  94  LYS C HB3  1 
ATOM   8351  H  HG2  . LYS C  1 94  ? -52.962 1.331   49.918  1.00 63.99  ?  94  LYS C HG2  1 
ATOM   8352  H  HG3  . LYS C  1 94  ? -54.072 1.699   50.993  1.00 63.99  ?  94  LYS C HG3  1 
ATOM   8353  H  HD2  . LYS C  1 94  ? -53.185 -0.960  50.593  1.00 80.60  ?  94  LYS C HD2  1 
ATOM   8354  H  HD3  . LYS C  1 94  ? -52.590 -0.023  51.733  1.00 80.60  ?  94  LYS C HD3  1 
ATOM   8355  H  HE2  . LYS C  1 94  ? -54.880 0.124   52.558  1.00 78.39  ?  94  LYS C HE2  1 
ATOM   8356  H  HE3  . LYS C  1 94  ? -55.168 -1.137  51.633  1.00 78.39  ?  94  LYS C HE3  1 
ATOM   8357  H  HZ1  . LYS C  1 94  ? -54.669 -1.803  53.752  1.00 74.39  ?  94  LYS C HZ1  1 
ATOM   8358  H  HZ2  . LYS C  1 94  ? -53.639 -2.299  52.862  1.00 74.39  ?  94  LYS C HZ2  1 
ATOM   8359  H  HZ3  . LYS C  1 94  ? -53.376 -1.151  53.705  1.00 74.39  ?  94  LYS C HZ3  1 
ATOM   8360  N  N    . ARG C  1 95  ? -52.963 1.350   46.944  1.00 31.78  ?  95  ARG C N    1 
ATOM   8361  C  CA   . ARG C  1 95  ? -51.628 1.674   46.453  1.00 32.22  ?  95  ARG C CA   1 
ATOM   8362  C  C    . ARG C  1 95  ? -51.670 2.900   45.546  1.00 26.50  ?  95  ARG C C    1 
ATOM   8363  O  O    . ARG C  1 95  ? -50.754 3.729   45.570  1.00 28.38  ?  95  ARG C O    1 
ATOM   8364  C  CB   . ARG C  1 95  ? -51.030 0.477   45.700  1.00 25.74  ?  95  ARG C CB   1 
ATOM   8365  C  CG   . ARG C  1 95  ? -50.842 -0.762  46.563  1.00 26.73  ?  95  ARG C CG   1 
ATOM   8366  C  CD   . ARG C  1 95  ? -49.726 -0.604  47.559  1.00 29.28  ?  95  ARG C CD   1 
ATOM   8367  N  NE   . ARG C  1 95  ? -49.745 -1.737  48.484  1.00 33.34  ?  95  ARG C NE   1 
ATOM   8368  C  CZ   . ARG C  1 95  ? -48.751 -2.077  49.290  1.00 28.75  ?  95  ARG C CZ   1 
ATOM   8369  N  NH1  . ARG C  1 95  ? -47.624 -1.385  49.315  1.00 30.69  1  95  ARG C NH1  1 
ATOM   8370  N  NH2  . ARG C  1 95  ? -48.887 -3.139  50.074  1.00 32.34  ?  95  ARG C NH2  1 
ATOM   8371  H  H    . ARG C  1 95  ? -53.265 0.585   46.690  1.00 38.14  ?  95  ARG C H    1 
ATOM   8372  H  HA   . ARG C  1 95  ? -51.052 1.876   47.207  1.00 38.67  ?  95  ARG C HA   1 
ATOM   8373  H  HB2  . ARG C  1 95  ? -51.622 0.241   44.969  1.00 30.89  ?  95  ARG C HB2  1 
ATOM   8374  H  HB3  . ARG C  1 95  ? -50.161 0.729   45.352  1.00 30.89  ?  95  ARG C HB3  1 
ATOM   8375  H  HG2  . ARG C  1 95  ? -51.661 -0.934  47.054  1.00 32.07  ?  95  ARG C HG2  1 
ATOM   8376  H  HG3  . ARG C  1 95  ? -50.632 -1.517  45.992  1.00 32.07  ?  95  ARG C HG3  1 
ATOM   8377  H  HD2  . ARG C  1 95  ? -48.873 -0.594  47.097  1.00 35.14  ?  95  ARG C HD2  1 
ATOM   8378  H  HD3  . ARG C  1 95  ? -49.851 0.213   48.066  1.00 35.14  ?  95  ARG C HD3  1 
ATOM   8379  H  HE   . ARG C  1 95  ? -50.457 -2.220  48.506  1.00 40.01  ?  95  ARG C HE   1 
ATOM   8380  H  HH11 . ARG C  1 95  ? -47.530 -0.699  48.805  1.00 36.82  ?  95  ARG C HH11 1 
ATOM   8381  H  HH12 . ARG C  1 95  ? -46.988 -1.619  49.844  1.00 36.82  ?  95  ARG C HH12 1 
ATOM   8382  H  HH21 . ARG C  1 95  ? -49.618 -3.592  50.062  1.00 38.80  ?  95  ARG C HH21 1 
ATOM   8383  H  HH22 . ARG C  1 95  ? -48.249 -3.367  50.604  1.00 38.80  ?  95  ARG C HH22 1 
ATOM   8384  N  N    . ASN C  1 96  ? -52.724 3.022   44.738  1.00 27.11  ?  96  ASN C N    1 
ATOM   8385  C  CA   . ASN C  1 96  ? -52.834 4.165   43.841  1.00 23.55  ?  96  ASN C CA   1 
ATOM   8386  C  C    . ASN C  1 96  ? -53.019 5.456   44.630  1.00 32.34  ?  96  ASN C C    1 
ATOM   8387  O  O    . ASN C  1 96  ? -52.419 6.482   44.301  1.00 26.90  ?  96  ASN C O    1 
ATOM   8388  C  CB   . ASN C  1 96  ? -53.969 3.946   42.856  1.00 27.62  ?  96  ASN C CB   1 
ATOM   8389  C  CG   . ASN C  1 96  ? -53.694 4.585   41.508  1.00 27.47  ?  96  ASN C CG   1 
ATOM   8390  O  OD1  . ASN C  1 96  ? -52.542 4.644   41.061  1.00 24.53  ?  96  ASN C OD1  1 
ATOM   8391  N  ND2  . ASN C  1 96  ? -54.737 5.041   40.846  1.00 35.40  ?  96  ASN C ND2  1 
ATOM   8392  H  H    . ASN C  1 96  ? -53.378 2.466   44.693  1.00 32.54  ?  96  ASN C H    1 
ATOM   8393  H  HA   . ASN C  1 96  ? -52.011 4.244   43.333  1.00 28.26  ?  96  ASN C HA   1 
ATOM   8394  H  HB2  . ASN C  1 96  ? -54.091 2.993   42.719  1.00 33.14  ?  96  ASN C HB2  1 
ATOM   8395  H  HB3  . ASN C  1 96  ? -54.781 4.337   43.215  1.00 33.14  ?  96  ASN C HB3  1 
ATOM   8396  H  HD21 . ASN C  1 96  ? -54.629 5.412   40.078  1.00 42.48  ?  96  ASN C HD21 1 
ATOM   8397  H  HD22 . ASN C  1 96  ? -55.525 4.969   41.183  1.00 42.48  ?  96  ASN C HD22 1 
ATOM   8398  N  N    . GLN C  1 97  ? -53.830 5.421   45.688  1.00 31.65  ?  97  GLN C N    1 
ATOM   8399  C  CA   . GLN C  1 97  ? -53.989 6.612   46.525  1.00 38.81  ?  97  GLN C CA   1 
ATOM   8400  C  C    . GLN C  1 97  ? -52.652 7.052   47.119  1.00 28.95  ?  97  GLN C C    1 
ATOM   8401  O  O    . GLN C  1 97  ? -52.334 8.251   47.135  1.00 37.54  ?  97  GLN C O    1 
ATOM   8402  C  CB   . GLN C  1 97  ? -55.013 6.339   47.630  1.00 41.81  ?  97  GLN C CB   1 
ATOM   8403  C  CG   . GLN C  1 97  ? -55.107 7.444   48.685  1.00 55.98  ?  97  GLN C CG   1 
ATOM   8404  C  CD   . GLN C  1 97  ? -56.029 7.068   49.820  1.00 74.60  ?  97  GLN C CD   1 
ATOM   8405  O  OE1  . GLN C  1 97  ? -56.949 6.267   49.648  1.00 79.55  ?  97  GLN C OE1  1 
ATOM   8406  N  NE2  . GLN C  1 97  ? -55.779 7.630   50.995  1.00 88.00  ?  97  GLN C NE2  1 
ATOM   8407  H  H    . GLN C  1 97  ? -54.290 4.739   45.938  1.00 37.98  ?  97  GLN C H    1 
ATOM   8408  H  HA   . GLN C  1 97  ? -54.326 7.339   45.978  1.00 46.57  ?  97  GLN C HA   1 
ATOM   8409  H  HB2  . GLN C  1 97  ? -55.889 6.242   47.225  1.00 50.17  ?  97  GLN C HB2  1 
ATOM   8410  H  HB3  . GLN C  1 97  ? -54.769 5.517   48.084  1.00 50.17  ?  97  GLN C HB3  1 
ATOM   8411  H  HG2  . GLN C  1 97  ? -54.225 7.608   49.054  1.00 67.17  ?  97  GLN C HG2  1 
ATOM   8412  H  HG3  . GLN C  1 97  ? -55.452 8.251   48.271  1.00 67.17  ?  97  GLN C HG3  1 
ATOM   8413  H  HE21 . GLN C  1 97  ? -55.120 8.177   51.079  1.00 105.60 ?  97  GLN C HE21 1 
ATOM   8414  H  HE22 . GLN C  1 97  ? -56.276 7.449   51.673  1.00 105.60 ?  97  GLN C HE22 1 
ATOM   8415  N  N    . ASP C  1 98  ? -51.851 6.091   47.600  1.00 32.20  ?  98  ASP C N    1 
ATOM   8416  C  CA   . ASP C  1 98  ? -50.528 6.368   48.162  1.00 39.47  ?  98  ASP C CA   1 
ATOM   8417  C  C    . ASP C  1 98  ? -49.615 7.072   47.166  1.00 47.26  ?  98  ASP C C    1 
ATOM   8418  O  O    . ASP C  1 98  ? -48.753 7.870   47.554  1.00 39.97  ?  98  ASP C O    1 
ATOM   8419  C  CB   . ASP C  1 98  ? -49.862 5.055   48.582  1.00 48.00  ?  98  ASP C CB   1 
ATOM   8420  C  CG   . ASP C  1 98  ? -49.725 4.894   50.074  1.00 64.06  ?  98  ASP C CG   1 
ATOM   8421  O  OD1  . ASP C  1 98  ? -50.145 5.790   50.837  1.00 61.70  ?  98  ASP C OD1  1 
ATOM   8422  O  OD2  . ASP C  1 98  ? -49.178 3.840   50.468  1.00 61.65  -1 98  ASP C OD2  1 
ATOM   8423  H  H    . ASP C  1 98  ? -52.059 5.256   47.610  1.00 38.64  ?  98  ASP C H    1 
ATOM   8424  H  HA   . ASP C  1 98  ? -50.621 6.931   48.946  1.00 47.37  ?  98  ASP C HA   1 
ATOM   8425  H  HB2  . ASP C  1 98  ? -50.394 4.314   48.251  1.00 57.60  ?  98  ASP C HB2  1 
ATOM   8426  H  HB3  . ASP C  1 98  ? -48.972 5.018   48.197  1.00 57.60  ?  98  ASP C HB3  1 
ATOM   8427  N  N    . LEU C  1 99  ? -49.719 6.721   45.884  1.00 30.84  ?  99  LEU C N    1 
ATOM   8428  C  CA   . LEU C  1 99  ? -48.805 7.275   44.897  1.00 28.12  ?  99  LEU C CA   1 
ATOM   8429  C  C    . LEU C  1 99  ? -49.101 8.743   44.605  1.00 23.50  ?  99  LEU C C    1 
ATOM   8430  O  O    . LEU C  1 99  ? -48.196 9.470   44.171  1.00 26.66  ?  99  LEU C O    1 
ATOM   8431  C  CB   . LEU C  1 99  ? -48.874 6.462   43.599  1.00 23.25  ?  99  LEU C CB   1 
ATOM   8432  C  CG   . LEU C  1 99  ? -48.308 5.044   43.574  1.00 26.03  ?  99  LEU C CG   1 
ATOM   8433  C  CD1  . LEU C  1 99  ? -48.620 4.436   42.236  1.00 27.50  ?  99  LEU C CD1  1 
ATOM   8434  C  CD2  . LEU C  1 99  ? -46.800 5.035   43.800  1.00 29.71  ?  99  LEU C CD2  1 
ATOM   8435  H  H    . LEU C  1 99  ? -50.302 6.173   45.568  1.00 37.00  ?  99  LEU C H    1 
ATOM   8436  H  HA   . LEU C  1 99  ? -47.899 7.215   45.239  1.00 33.74  ?  99  LEU C HA   1 
ATOM   8437  H  HB2  . LEU C  1 99  ? -49.808 6.392   43.346  1.00 27.90  ?  99  LEU C HB2  1 
ATOM   8438  H  HB3  . LEU C  1 99  ? -48.402 6.962   42.914  1.00 27.90  ?  99  LEU C HB3  1 
ATOM   8439  H  HG   . LEU C  1 99  ? -48.730 4.511   44.265  1.00 31.23  ?  99  LEU C HG   1 
ATOM   8440  H  HD11 . LEU C  1 99  ? -48.264 3.534   42.209  1.00 33.00  ?  99  LEU C HD11 1 
ATOM   8441  H  HD12 . LEU C  1 99  ? -49.582 4.417   42.116  1.00 33.00  ?  99  LEU C HD12 1 
ATOM   8442  H  HD13 . LEU C  1 99  ? -48.210 4.975   41.542  1.00 33.00  ?  99  LEU C HD13 1 
ATOM   8443  H  HD21 . LEU C  1 99  ? -46.484 4.118   43.777  1.00 35.65  ?  99  LEU C HD21 1 
ATOM   8444  H  HD22 . LEU C  1 99  ? -46.373 5.550   43.099  1.00 35.65  ?  99  LEU C HD22 1 
ATOM   8445  H  HD23 . LEU C  1 99  ? -46.608 5.429   44.665  1.00 35.65  ?  99  LEU C HD23 1 
ATOM   8446  N  N    . ALA C  1 100 ? -50.331 9.178   44.829  1.00 29.63  ?  100 ALA C N    1 
ATOM   8447  C  CA   . ALA C  1 100 ? -50.747 10.494  44.361  1.00 30.52  ?  100 ALA C CA   1 
ATOM   8448  C  C    . ALA C  1 100 ? -49.944 11.606  45.025  1.00 27.15  ?  100 ALA C C    1 
ATOM   8449  O  O    . ALA C  1 100 ? -49.725 12.657  44.414  1.00 24.14  ?  100 ALA C O    1 
ATOM   8450  C  CB   . ALA C  1 100 ? -52.234 10.695  44.628  1.00 34.97  ?  100 ALA C CB   1 
ATOM   8451  H  H    . ALA C  1 100 ? -50.941 8.738   45.245  1.00 35.55  ?  100 ALA C H    1 
ATOM   8452  H  HA   . ALA C  1 100 ? -50.603 10.550  43.403  1.00 36.63  ?  100 ALA C HA   1 
ATOM   8453  H  HB1  . ALA C  1 100 ? -52.495 11.573  44.312  1.00 41.96  ?  100 ALA C HB1  1 
ATOM   8454  H  HB2  . ALA C  1 100 ? -52.734 10.010  44.156  1.00 41.96  ?  100 ALA C HB2  1 
ATOM   8455  H  HB3  . ALA C  1 100 ? -52.395 10.624  45.582  1.00 41.96  ?  100 ALA C HB3  1 
ATOM   8456  N  N    . ARG C  1 101 ? -49.548 11.410  46.288  1.00 29.18  ?  101 ARG C N    1 
ATOM   8457  C  CA   . ARG C  1 101 ? -48.783 12.423  47.010  1.00 37.00  ?  101 ARG C CA   1 
ATOM   8458  C  C    . ARG C  1 101 ? -47.459 12.709  46.321  1.00 30.08  ?  101 ARG C C    1 
ATOM   8459  O  O    . ARG C  1 101 ? -46.879 13.797  46.490  1.00 29.18  ?  101 ARG C O    1 
ATOM   8460  C  CB   . ARG C  1 101 ? -48.519 11.951  48.447  1.00 44.00  ?  101 ARG C CB   1 
ATOM   8461  C  CG   . ARG C  1 101 ? -49.729 11.367  49.157  1.00 62.58  ?  101 ARG C CG   1 
ATOM   8462  C  CD   . ARG C  1 101 ? -49.418 10.986  50.607  1.00 67.97  ?  101 ARG C CD   1 
ATOM   8463  N  NE   . ARG C  1 101 ? -48.724 9.700   50.721  1.00 72.86  ?  101 ARG C NE   1 
ATOM   8464  C  CZ   . ARG C  1 101 ? -47.451 9.544   51.082  1.00 69.55  ?  101 ARG C CZ   1 
ATOM   8465  N  NH1  . ARG C  1 101 ? -46.685 10.588  51.378  1.00 63.01  1  101 ARG C NH1  1 
ATOM   8466  N  NH2  . ARG C  1 101 ? -46.938 8.325   51.156  1.00 72.65  ?  101 ARG C NH2  1 
ATOM   8467  H  H    . ARG C  1 101 ? -49.711 10.700  46.745  1.00 35.02  ?  101 ARG C H    1 
ATOM   8468  H  HA   . ARG C  1 101 ? -49.293 13.247  47.047  1.00 44.41  ?  101 ARG C HA   1 
ATOM   8469  H  HB2  . ARG C  1 101 ? -47.832 11.267  48.427  1.00 52.80  ?  101 ARG C HB2  1 
ATOM   8470  H  HB3  . ARG C  1 101 ? -48.210 12.708  48.969  1.00 52.80  ?  101 ARG C HB3  1 
ATOM   8471  H  HG2  . ARG C  1 101 ? -50.442 12.024  49.164  1.00 75.10  ?  101 ARG C HG2  1 
ATOM   8472  H  HG3  . ARG C  1 101 ? -50.017 10.567  48.689  1.00 75.10  ?  101 ARG C HG3  1 
ATOM   8473  H  HD2  . ARG C  1 101 ? -48.850 11.668  50.998  1.00 81.57  ?  101 ARG C HD2  1 
ATOM   8474  H  HD3  . ARG C  1 101 ? -50.249 10.922  51.102  1.00 81.57  ?  101 ARG C HD3  1 
ATOM   8475  H  HE   . ARG C  1 101 ? -49.174 8.989   50.541  1.00 87.44  ?  101 ARG C HE   1 
ATOM   8476  H  HH11 . ARG C  1 101 ? -47.008 11.384  51.336  1.00 75.61  ?  101 ARG C HH11 1 
ATOM   8477  H  HH12 . ARG C  1 101 ? -45.866 10.469  51.609  1.00 75.61  ?  101 ARG C HH12 1 
ATOM   8478  H  HH21 . ARG C  1 101 ? -47.424 7.642   50.967  1.00 87.18  ?  101 ARG C HH21 1 
ATOM   8479  H  HH22 . ARG C  1 101 ? -46.116 8.218   51.387  1.00 87.18  ?  101 ARG C HH22 1 
ATOM   8480  N  N    . PHE C  1 102 ? -46.953 11.734  45.579  1.00 26.32  ?  102 PHE C N    1 
ATOM   8481  C  CA   . PHE C  1 102 ? -45.703 11.823  44.849  1.00 27.73  ?  102 PHE C CA   1 
ATOM   8482  C  C    . PHE C  1 102 ? -45.910 12.210  43.396  1.00 25.29  ?  102 PHE C C    1 
ATOM   8483  O  O    . PHE C  1 102 ? -44.968 12.112  42.608  1.00 25.59  ?  102 PHE C O    1 
ATOM   8484  C  CB   . PHE C  1 102 ? -44.973 10.478  44.922  1.00 31.35  ?  102 PHE C CB   1 
ATOM   8485  C  CG   . PHE C  1 102 ? -44.731 10.013  46.329  1.00 40.96  ?  102 PHE C CG   1 
ATOM   8486  C  CD1  . PHE C  1 102 ? -43.666 10.512  47.059  1.00 44.23  ?  102 PHE C CD1  1 
ATOM   8487  C  CD2  . PHE C  1 102 ? -45.579 9.096   46.928  1.00 39.60  ?  102 PHE C CD2  1 
ATOM   8488  C  CE1  . PHE C  1 102 ? -43.447 10.095  48.364  1.00 49.07  ?  102 PHE C CE1  1 
ATOM   8489  C  CE2  . PHE C  1 102 ? -45.370 8.679   48.232  1.00 50.59  ?  102 PHE C CE2  1 
ATOM   8490  C  CZ   . PHE C  1 102 ? -44.300 9.180   48.947  1.00 44.65  ?  102 PHE C CZ   1 
ATOM   8491  H  H    . PHE C  1 102 ? -47.340 10.973  45.481  1.00 31.58  ?  102 PHE C H    1 
ATOM   8492  H  HA   . PHE C  1 102 ? -45.140 12.495  45.264  1.00 33.27  ?  102 PHE C HA   1 
ATOM   8493  H  HB2  . PHE C  1 102 ? -45.507 9.805   44.473  1.00 37.62  ?  102 PHE C HB2  1 
ATOM   8494  H  HB3  . PHE C  1 102 ? -44.112 10.564  44.484  1.00 37.62  ?  102 PHE C HB3  1 
ATOM   8495  H  HD1  . PHE C  1 102 ? -43.091 11.130  46.670  1.00 53.07  ?  102 PHE C HD1  1 
ATOM   8496  H  HD2  . PHE C  1 102 ? -46.302 8.760   46.449  1.00 47.52  ?  102 PHE C HD2  1 
ATOM   8497  H  HE1  . PHE C  1 102 ? -42.727 10.433  48.846  1.00 58.88  ?  102 PHE C HE1  1 
ATOM   8498  H  HE2  . PHE C  1 102 ? -45.943 8.060   48.622  1.00 60.71  ?  102 PHE C HE2  1 
ATOM   8499  H  HZ   . PHE C  1 102 ? -44.152 8.899   49.821  1.00 53.58  ?  102 PHE C HZ   1 
ATOM   8500  N  N    . ASN C  1 103 ? -47.130 12.611  43.029  1.00 25.41  ?  103 ASN C N    1 
ATOM   8501  C  CA   . ASN C  1 103 ? -47.495 12.916  41.640  1.00 22.42  ?  103 ASN C CA   1 
ATOM   8502  C  C    . ASN C  1 103 ? -47.369 11.708  40.723  1.00 22.94  ?  103 ASN C C    1 
ATOM   8503  O  O    . ASN C  1 103 ? -47.150 11.836  39.513  1.00 21.46  ?  103 ASN C O    1 
ATOM   8504  C  CB   . ASN C  1 103 ? -46.671 14.097  41.096  1.00 23.25  ?  103 ASN C CB   1 
ATOM   8505  C  CG   . ASN C  1 103 ? -46.979 15.376  41.806  1.00 30.12  ?  103 ASN C CG   1 
ATOM   8506  O  OD1  . ASN C  1 103 ? -46.116 15.933  42.513  1.00 29.25  ?  103 ASN C OD1  1 
ATOM   8507  N  ND2  . ASN C  1 103 ? -48.222 15.868  41.666  1.00 27.12  ?  103 ASN C ND2  1 
ATOM   8508  H  H    . ASN C  1 103 ? -47.781 12.717  43.581  1.00 30.50  ?  103 ASN C H    1 
ATOM   8509  H  HA   . ASN C  1 103 ? -48.426 13.188  41.626  1.00 26.90  ?  103 ASN C HA   1 
ATOM   8510  H  HB2  . ASN C  1 103 ? -45.727 13.907  41.214  1.00 27.89  ?  103 ASN C HB2  1 
ATOM   8511  H  HB3  . ASN C  1 103 ? -46.872 14.218  40.155  1.00 27.89  ?  103 ASN C HB3  1 
ATOM   8512  H  HD21 . ASN C  1 103 ? -48.442 16.601  42.057  1.00 32.55  ?  103 ASN C HD21 1 
ATOM   8513  H  HD22 . ASN C  1 103 ? -48.798 15.449  41.184  1.00 32.55  ?  103 ASN C HD22 1 
ATOM   8514  N  N    . LEU C  1 104 ? -47.530 10.502  41.269  1.00 22.25  ?  104 LEU C N    1 
ATOM   8515  C  CA   . LEU C  1 104 ? -47.491 9.273   40.496  1.00 21.89  ?  104 LEU C CA   1 
ATOM   8516  C  C    . LEU C  1 104 ? -48.869 8.622   40.488  1.00 20.58  ?  104 LEU C C    1 
ATOM   8517  O  O    . LEU C  1 104 ? -49.659 8.788   41.419  1.00 23.27  ?  104 LEU C O    1 
ATOM   8518  C  CB   . LEU C  1 104 ? -46.463 8.275   41.066  1.00 24.38  ?  104 LEU C CB   1 
ATOM   8519  C  CG   . LEU C  1 104 ? -45.011 8.746   41.051  1.00 30.04  ?  104 LEU C CG   1 
ATOM   8520  C  CD1  . LEU C  1 104 ? -44.159 7.749   41.822  1.00 32.22  ?  104 LEU C CD1  1 
ATOM   8521  C  CD2  . LEU C  1 104 ? -44.519 8.878   39.635  1.00 34.64  ?  104 LEU C CD2  1 
ATOM   8522  H  H    . LEU C  1 104 ? -47.667 10.373  42.108  1.00 26.70  ?  104 LEU C H    1 
ATOM   8523  H  HA   . LEU C  1 104 ? -47.243 9.477   39.581  1.00 26.27  ?  104 LEU C HA   1 
ATOM   8524  H  HB2  . LEU C  1 104 ? -46.698 8.086   41.987  1.00 29.25  ?  104 LEU C HB2  1 
ATOM   8525  H  HB3  . LEU C  1 104 ? -46.509 7.458   40.546  1.00 29.25  ?  104 LEU C HB3  1 
ATOM   8526  H  HG   . LEU C  1 104 ? -44.944 9.611   41.484  1.00 36.05  ?  104 LEU C HG   1 
ATOM   8527  H  HD11 . LEU C  1 104 ? -43.237 8.048   41.812  1.00 38.66  ?  104 LEU C HD11 1 
ATOM   8528  H  HD12 . LEU C  1 104 ? -44.482 7.699   42.735  1.00 38.66  ?  104 LEU C HD12 1 
ATOM   8529  H  HD13 . LEU C  1 104 ? -44.230 6.879   41.397  1.00 38.66  ?  104 LEU C HD13 1 
ATOM   8530  H  HD21 . LEU C  1 104 ? -43.597 9.177   39.648  1.00 41.57  ?  104 LEU C HD21 1 
ATOM   8531  H  HD22 . LEU C  1 104 ? -44.581 8.015   39.197  1.00 41.57  ?  104 LEU C HD22 1 
ATOM   8532  H  HD23 . LEU C  1 104 ? -45.071 9.526   39.169  1.00 41.57  ?  104 LEU C HD23 1 
ATOM   8533  N  N    . THR C  1 105 ? -49.147 7.870   39.430  1.00 22.61  ?  105 THR C N    1 
ATOM   8534  C  CA   . THR C  1 105 ? -50.389 7.115   39.358  1.00 21.27  ?  105 THR C CA   1 
ATOM   8535  C  C    . THR C  1 105 ? -50.229 5.954   38.385  1.00 21.54  ?  105 THR C C    1 
ATOM   8536  O  O    . THR C  1 105 ? -49.341 5.935   37.529  1.00 21.84  ?  105 THR C O    1 
ATOM   8537  C  CB   . THR C  1 105 ? -51.569 8.014   38.944  1.00 25.62  ?  105 THR C CB   1 
ATOM   8538  O  OG1  . THR C  1 105 ? -52.800 7.396   39.337  1.00 25.63  ?  105 THR C OG1  1 
ATOM   8539  C  CG2  . THR C  1 105 ? -51.564 8.281   37.447  1.00 24.33  ?  105 THR C CG2  1 
ATOM   8540  H  H    . THR C  1 105 ? -48.636 7.780   38.744  1.00 27.13  ?  105 THR C H    1 
ATOM   8541  H  HA   . THR C  1 105 ? -50.586 6.747   40.234  1.00 25.52  ?  105 THR C HA   1 
ATOM   8542  H  HB   . THR C  1 105 ? -51.488 8.867   39.398  1.00 30.75  ?  105 THR C HB   1 
ATOM   8543  H  HG1  . THR C  1 105 ? -52.878 6.647   38.963  1.00 30.76  ?  105 THR C HG1  1 
ATOM   8544  H  HG21 . THR C  1 105 ? -52.313 8.848   37.209  1.00 29.19  ?  105 THR C HG21 1 
ATOM   8545  H  HG22 . THR C  1 105 ? -50.739 8.724   37.193  1.00 29.19  ?  105 THR C HG22 1 
ATOM   8546  H  HG23 . THR C  1 105 ? -51.634 7.444   36.962  1.00 29.19  ?  105 THR C HG23 1 
ATOM   8547  N  N    . HIS C  1 106 ? -51.113 4.980   38.532  1.00 20.81  ?  106 HIS C N    1 
ATOM   8548  C  CA   . HIS C  1 106 ? -51.151 3.884   37.580  1.00 20.68  ?  106 HIS C CA   1 
ATOM   8549  C  C    . HIS C  1 106 ? -51.782 4.352   36.272  1.00 19.68  ?  106 HIS C C    1 
ATOM   8550  O  O    . HIS C  1 106 ? -52.778 5.097   36.280  1.00 21.84  ?  106 HIS C O    1 
ATOM   8551  C  CB   . HIS C  1 106 ? -51.921 2.718   38.179  1.00 19.97  ?  106 HIS C CB   1 
ATOM   8552  C  CG   . HIS C  1 106 ? -51.734 1.452   37.416  1.00 19.48  ?  106 HIS C CG   1 
ATOM   8553  N  ND1  . HIS C  1 106 ? -52.486 1.136   36.306  1.00 21.43  ?  106 HIS C ND1  1 
ATOM   8554  C  CD2  . HIS C  1 106 ? -50.859 0.433   37.590  1.00 21.21  ?  106 HIS C CD2  1 
ATOM   8555  C  CE1  . HIS C  1 106 ? -52.071 -0.020  35.820  1.00 21.66  ?  106 HIS C CE1  1 
ATOM   8556  N  NE2  . HIS C  1 106 ? -51.095 -0.472  36.590  1.00 21.61  ?  106 HIS C NE2  1 
ATOM   8557  H  H    . HIS C  1 106 ? -51.694 4.930   39.164  1.00 24.97  ?  106 HIS C H    1 
ATOM   8558  H  HA   . HIS C  1 106 ? -50.246 3.588   37.394  1.00 24.82  ?  106 HIS C HA   1 
ATOM   8559  H  HB2  . HIS C  1 106 ? -51.614 2.570   39.087  1.00 23.96  ?  106 HIS C HB2  1 
ATOM   8560  H  HB3  . HIS C  1 106 ? -52.867 2.931   38.180  1.00 23.96  ?  106 HIS C HB3  1 
ATOM   8561  H  HD2  . HIS C  1 106 ? -50.218 0.362   38.261  1.00 25.46  ?  106 HIS C HD2  1 
ATOM   8562  H  HE1  . HIS C  1 106 ? -52.426 -0.457  35.080  1.00 25.99  ?  106 HIS C HE1  1 
ATOM   8563  H  HE2  . HIS C  1 106 ? -50.674 -1.214  36.479  1.00 25.93  ?  106 HIS C HE2  1 
ATOM   8564  N  N    . ASP C  1 107 ? -51.199 3.923   35.147  1.00 19.93  ?  107 ASP C N    1 
ATOM   8565  C  CA   . ASP C  1 107 ? -51.633 4.413   33.839  1.00 17.88  ?  107 ASP C CA   1 
ATOM   8566  C  C    . ASP C  1 107 ? -53.020 3.907   33.435  1.00 24.49  ?  107 ASP C C    1 
ATOM   8567  O  O    . ASP C  1 107 ? -53.615 4.465   32.506  1.00 25.96  ?  107 ASP C O    1 
ATOM   8568  C  CB   . ASP C  1 107 ? -50.618 4.077   32.723  1.00 19.05  ?  107 ASP C CB   1 
ATOM   8569  C  CG   . ASP C  1 107 ? -50.268 2.591   32.636  1.00 25.58  ?  107 ASP C CG   1 
ATOM   8570  O  OD1  . ASP C  1 107 ? -50.213 1.910   33.664  1.00 39.71  ?  107 ASP C OD1  1 
ATOM   8571  O  OD2  . ASP C  1 107 ? -50.021 2.141   31.523  1.00 29.40  -1 107 ASP C OD2  1 
ATOM   8572  H  H    . ASP C  1 107 ? -50.556 3.353   35.117  1.00 23.91  ?  107 ASP C H    1 
ATOM   8573  H  HA   . ASP C  1 107 ? -51.688 5.381   33.887  1.00 21.45  ?  107 ASP C HA   1 
ATOM   8574  H  HB2  . ASP C  1 107 ? -50.992 4.343   31.869  1.00 22.86  ?  107 ASP C HB2  1 
ATOM   8575  H  HB3  . ASP C  1 107 ? -49.797 4.566   32.890  1.00 22.86  ?  107 ASP C HB3  1 
ATOM   8576  N  N    . LEU C  1 108 ? -53.541 2.877   34.095  1.00 20.34  ?  108 LEU C N    1 
ATOM   8577  C  CA   . LEU C  1 108 ? -54.887 2.386   33.814  1.00 24.24  ?  108 LEU C CA   1 
ATOM   8578  C  C    . LEU C  1 108 ? -55.888 2.832   34.873  1.00 31.03  ?  108 LEU C C    1 
ATOM   8579  O  O    . LEU C  1 108 ? -56.924 2.187   35.046  1.00 31.98  ?  108 LEU C O    1 
ATOM   8580  C  CB   . LEU C  1 108 ? -54.893 0.864   33.682  1.00 21.45  ?  108 LEU C CB   1 
ATOM   8581  C  CG   . LEU C  1 108 ? -53.986 0.263   32.600  1.00 23.19  ?  108 LEU C CG   1 
ATOM   8582  C  CD1  . LEU C  1 108 ? -54.112 -1.277  32.502  1.00 26.20  ?  108 LEU C CD1  1 
ATOM   8583  C  CD2  . LEU C  1 108 ? -54.206 0.931   31.263  1.00 24.88  ?  108 LEU C CD2  1 
ATOM   8584  H  H    . LEU C  1 108 ? -53.133 2.442   34.715  1.00 24.41  ?  108 LEU C H    1 
ATOM   8585  H  HA   . LEU C  1 108 ? -55.178 2.754   32.964  1.00 29.08  ?  108 LEU C HA   1 
ATOM   8586  H  HB2  . LEU C  1 108 ? -54.617 0.486   34.531  1.00 25.74  ?  108 LEU C HB2  1 
ATOM   8587  H  HB3  . LEU C  1 108 ? -55.800 0.581   33.485  1.00 25.74  ?  108 LEU C HB3  1 
ATOM   8588  H  HG   . LEU C  1 108 ? -53.068 0.448   32.854  1.00 27.83  ?  108 LEU C HG   1 
ATOM   8589  H  HD11 . LEU C  1 108 ? -53.518 -1.598  31.805  1.00 31.44  ?  108 LEU C HD11 1 
ATOM   8590  H  HD12 . LEU C  1 108 ? -53.865 -1.669  33.354  1.00 31.44  ?  108 LEU C HD12 1 
ATOM   8591  H  HD13 . LEU C  1 108 ? -55.029 -1.506  32.286  1.00 31.44  ?  108 LEU C HD13 1 
ATOM   8592  H  HD21 . LEU C  1 108 ? -53.618 0.526   30.607  1.00 29.86  ?  108 LEU C HD21 1 
ATOM   8593  H  HD22 . LEU C  1 108 ? -55.132 0.809   30.999  1.00 29.86  ?  108 LEU C HD22 1 
ATOM   8594  H  HD23 . LEU C  1 108 ? -54.008 1.877   31.347  1.00 29.86  ?  108 LEU C HD23 1 
ATOM   8595  N  N    . SER C  1 109 ? -55.592 3.930   35.562  1.00 24.81  ?  109 SER C N    1 
ATOM   8596  C  CA   . SER C  1 109 ? -56.457 4.471   36.602  1.00 28.71  ?  109 SER C CA   1 
ATOM   8597  C  C    . SER C  1 109 ? -57.872 4.780   36.129  1.00 45.81  ?  109 SER C C    1 
ATOM   8598  O  O    . SER C  1 109 ? -58.738 4.995   36.976  1.00 39.79  ?  109 SER C O    1 
ATOM   8599  C  CB   . SER C  1 109 ? -55.829 5.750   37.172  1.00 37.56  ?  109 SER C CB   1 
ATOM   8600  O  OG   . SER C  1 109 ? -54.775 5.448   38.074  1.00 27.54  ?  109 SER C OG   1 
ATOM   8601  H  H    . SER C  1 109 ? -54.875 4.390   35.441  1.00 29.78  ?  109 SER C H    1 
ATOM   8602  H  HA   . SER C  1 109 ? -56.521 3.825   37.322  1.00 34.45  ?  109 SER C HA   1 
ATOM   8603  H  HB2  . SER C  1 109 ? -55.476 6.280   36.441  1.00 45.07  ?  109 SER C HB2  1 
ATOM   8604  H  HB3  . SER C  1 109 ? -56.512 6.252   37.644  1.00 45.07  ?  109 SER C HB3  1 
ATOM   8605  H  HG   . SER C  1 109 ? -54.174 5.014   37.678  1.00 33.05  ?  109 SER C HG   1 
ATOM   8606  N  N    . ILE C  1 110 ? -58.141 4.822   34.818  1.00 37.57  ?  110 ILE C N    1 
ATOM   8607  C  CA   . ILE C  1 110 ? -59.519 5.059   34.379  1.00 39.42  ?  110 ILE C CA   1 
ATOM   8608  C  C    . ILE C  1 110 ? -60.433 3.913   34.796  1.00 48.14  ?  110 ILE C C    1 
ATOM   8609  O  O    . ILE C  1 110 ? -61.632 4.121   35.021  1.00 54.59  ?  110 ILE C O    1 
ATOM   8610  C  CB   . ILE C  1 110 ? -59.607 5.297   32.859  1.00 39.60  ?  110 ILE C CB   1 
ATOM   8611  C  CG1  . ILE C  1 110 ? -59.133 4.077   32.065  1.00 35.77  ?  110 ILE C CG1  1 
ATOM   8612  C  CG2  . ILE C  1 110 ? -58.872 6.568   32.483  1.00 50.25  ?  110 ILE C CG2  1 
ATOM   8613  C  CD1  . ILE C  1 110 ? -59.474 4.176   30.592  1.00 52.15  ?  110 ILE C CD1  1 
ATOM   8614  H  H    . ILE C  1 110 ? -57.566 4.720   34.187  1.00 45.09  ?  110 ILE C H    1 
ATOM   8615  H  HA   . ILE C  1 110 ? -59.844 5.862   34.815  1.00 47.31  ?  110 ILE C HA   1 
ATOM   8616  H  HB   . ILE C  1 110 ? -60.543 5.433   32.644  1.00 47.52  ?  110 ILE C HB   1 
ATOM   8617  H  HG12 . ILE C  1 110 ? -58.170 4.001   32.147  1.00 42.93  ?  110 ILE C HG12 1 
ATOM   8618  H  HG13 . ILE C  1 110 ? -59.561 3.282   32.420  1.00 42.93  ?  110 ILE C HG13 1 
ATOM   8619  H  HG21 . ILE C  1 110 ? -57.941 6.482   32.741  1.00 60.30  ?  110 ILE C HG21 1 
ATOM   8620  H  HG22 . ILE C  1 110 ? -58.939 6.699   31.525  1.00 60.30  ?  110 ILE C HG22 1 
ATOM   8621  H  HG23 . ILE C  1 110 ? -59.277 7.316   32.949  1.00 60.30  ?  110 ILE C HG23 1 
ATOM   8622  H  HD11 . ILE C  1 110 ? -59.152 3.381   30.140  1.00 62.58  ?  110 ILE C HD11 1 
ATOM   8623  H  HD12 . ILE C  1 110 ? -60.437 4.245   30.495  1.00 62.58  ?  110 ILE C HD12 1 
ATOM   8624  H  HD13 . ILE C  1 110 ? -59.046 4.964   30.221  1.00 62.58  ?  110 ILE C HD13 1 
ATOM   8625  N  N    . LEU C  1 111 ? -59.901 2.691   34.891  1.00 47.86  ?  111 LEU C N    1 
ATOM   8626  C  CA   . LEU C  1 111 ? -60.669 1.570   35.425  1.00 52.21  ?  111 LEU C CA   1 
ATOM   8627  C  C    . LEU C  1 111 ? -61.252 1.903   36.792  1.00 66.19  ?  111 LEU C C    1 
ATOM   8628  O  O    . LEU C  1 111 ? -62.473 1.909   36.982  1.00 70.37  ?  111 LEU C O    1 
ATOM   8629  C  CB   . LEU C  1 111 ? -59.785 0.329   35.537  1.00 50.83  ?  111 LEU C CB   1 
ATOM   8630  C  CG   . LEU C  1 111 ? -59.543 -0.479  34.273  1.00 48.86  ?  111 LEU C CG   1 
ATOM   8631  C  CD1  . LEU C  1 111 ? -58.506 -1.558  34.573  1.00 43.22  ?  111 LEU C CD1  1 
ATOM   8632  C  CD2  . LEU C  1 111 ? -60.840 -1.103  33.760  1.00 46.80  ?  111 LEU C CD2  1 
ATOM   8633  H  H    . LEU C  1 111 ? -59.100 2.488   34.652  1.00 57.43  ?  111 LEU C H    1 
ATOM   8634  H  HA   . LEU C  1 111 ? -61.402 1.368   34.823  1.00 62.65  ?  111 LEU C HA   1 
ATOM   8635  H  HB2  . LEU C  1 111 ? -58.916 0.609   35.865  1.00 61.00  ?  111 LEU C HB2  1 
ATOM   8636  H  HB3  . LEU C  1 111 ? -60.190 -0.271  36.183  1.00 61.00  ?  111 LEU C HB3  1 
ATOM   8637  H  HG   . LEU C  1 111 ? -59.188 0.102   33.582  1.00 58.64  ?  111 LEU C HG   1 
ATOM   8638  H  HD11 . LEU C  1 111 ? -58.349 -2.076  33.768  1.00 51.86  ?  111 LEU C HD11 1 
ATOM   8639  H  HD12 . LEU C  1 111 ? -57.683 -1.133  34.860  1.00 51.86  ?  111 LEU C HD12 1 
ATOM   8640  H  HD13 . LEU C  1 111 ? -58.844 -2.134  35.277  1.00 51.86  ?  111 LEU C HD13 1 
ATOM   8641  H  HD21 . LEU C  1 111 ? -60.649 -1.610  32.955  1.00 56.16  ?  111 LEU C HD21 1 
ATOM   8642  H  HD22 . LEU C  1 111 ? -61.200 -1.690  34.443  1.00 56.16  ?  111 LEU C HD22 1 
ATOM   8643  H  HD23 . LEU C  1 111 ? -61.474 -0.396  33.563  1.00 56.16  ?  111 LEU C HD23 1 
ATOM   8644  N  N    . ALA C  1 112 ? -60.372 2.150   37.766  1.00 76.55  ?  112 ALA C N    1 
ATOM   8645  C  CA   . ALA C  1 112 ? -60.751 2.545   39.118  1.00 82.57  ?  112 ALA C CA   1 
ATOM   8646  C  C    . ALA C  1 112 ? -61.440 3.908   39.177  1.00 78.62  ?  112 ALA C C    1 
ATOM   8647  O  O    . ALA C  1 112 ? -61.832 4.323   40.273  1.00 87.65  ?  112 ALA C O    1 
ATOM   8648  C  CB   . ALA C  1 112 ? -59.505 2.558   40.009  1.00 69.67  ?  112 ALA C CB   1 
ATOM   8649  H  H    . ALA C  1 112 ? -59.521 2.092   37.660  1.00 91.86  ?  112 ALA C H    1 
ATOM   8650  H  HA   . ALA C  1 112 ? -61.366 1.886   39.475  1.00 99.08  ?  112 ALA C HA   1 
ATOM   8651  H  HB1  . ALA C  1 112 ? -59.762 2.821   40.907  1.00 83.60  ?  112 ALA C HB1  1 
ATOM   8652  H  HB2  . ALA C  1 112 ? -59.118 1.668   40.023  1.00 83.60  ?  112 ALA C HB2  1 
ATOM   8653  H  HB3  . ALA C  1 112 ? -58.865 3.192   39.648  1.00 83.60  ?  112 ALA C HB3  1 
ATOM   8654  N  N    . GLN C  1 113 ? -61.594 4.604   38.051  1.00 78.88  ?  113 GLN C N    1 
ATOM   8655  C  CA   . GLN C  1 113 ? -62.168 5.947   38.031  1.00 67.68  ?  113 GLN C CA   1 
ATOM   8656  C  C    . GLN C  1 113 ? -63.117 6.112   36.850  1.00 79.68  ?  113 GLN C C    1 
ATOM   8657  O  O    . GLN C  1 113 ? -63.398 7.230   36.423  1.00 88.65  ?  113 GLN C O    1 
ATOM   8658  C  CB   . GLN C  1 113 ? -61.057 7.001   37.967  1.00 82.84  ?  113 GLN C CB   1 
ATOM   8659  C  CG   . GLN C  1 113 ? -60.067 6.936   39.135  1.00 84.20  ?  113 GLN C CG   1 
ATOM   8660  C  CD   . GLN C  1 113 ? -58.808 7.766   38.900  1.00 78.27  ?  113 GLN C CD   1 
ATOM   8661  O  OE1  . GLN C  1 113 ? -58.753 8.589   37.981  1.00 80.72  ?  113 GLN C OE1  1 
ATOM   8662  N  NE2  . GLN C  1 113 ? -57.787 7.544   39.731  1.00 65.85  ?  113 GLN C NE2  1 
ATOM   8663  H  H    . GLN C  1 113 ? -61.370 4.314   37.273  1.00 94.65  ?  113 GLN C H    1 
ATOM   8664  H  HA   . GLN C  1 113 ? -62.673 6.090   38.847  1.00 81.21  ?  113 GLN C HA   1 
ATOM   8665  H  HB2  . GLN C  1 113 ? -60.555 6.876   37.147  1.00 99.41  ?  113 GLN C HB2  1 
ATOM   8666  H  HB3  . GLN C  1 113 ? -61.462 7.882   37.972  1.00 99.41  ?  113 GLN C HB3  1 
ATOM   8667  H  HG2  . GLN C  1 113 ? -60.501 7.272   39.935  1.00 101.03 ?  113 GLN C HG2  1 
ATOM   8668  H  HG3  . GLN C  1 113 ? -59.796 6.014   39.267  1.00 101.03 ?  113 GLN C HG3  1 
ATOM   8669  H  HE21 . GLN C  1 113 ? -57.861 6.958   40.356  1.00 79.02  ?  113 GLN C HE21 1 
ATOM   8670  H  HE22 . GLN C  1 113 ? -57.054 7.986   39.640  1.00 79.02  ?  113 GLN C HE22 1 
ATOM   8671  N  N    . ASP C  1 115 ? -68.039 4.111   35.722  1.00 68.69  ?  115 ASP C N    1 
ATOM   8672  C  CA   . ASP C  1 115 ? -68.356 3.773   34.335  1.00 61.47  ?  115 ASP C CA   1 
ATOM   8673  C  C    . ASP C  1 115 ? -67.334 2.777   33.775  1.00 67.04  ?  115 ASP C C    1 
ATOM   8674  O  O    . ASP C  1 115 ? -66.619 3.092   32.819  1.00 64.67  ?  115 ASP C O    1 
ATOM   8675  C  CB   . ASP C  1 115 ? -68.384 5.042   33.466  1.00 64.60  ?  115 ASP C CB   1 
ATOM   8676  C  CG   . ASP C  1 115 ? -69.002 4.811   32.080  1.00 66.68  ?  115 ASP C CG   1 
ATOM   8677  O  OD1  . ASP C  1 115 ? -69.563 3.715   31.832  1.00 73.29  ?  115 ASP C OD1  1 
ATOM   8678  O  OD2  . ASP C  1 115 ? -68.917 5.733   31.230  1.00 74.27  ?  115 ASP C OD2  1 
ATOM   8679  H  HA   . ASP C  1 115 ? -69.233 3.360   34.298  1.00 73.76  ?  115 ASP C HA   1 
ATOM   8680  H  HB2  . ASP C  1 115 ? -68.908 5.721   33.917  1.00 77.52  ?  115 ASP C HB2  1 
ATOM   8681  H  HB3  . ASP C  1 115 ? -67.475 5.356   33.339  1.00 77.52  ?  115 ASP C HB3  1 
ATOM   8682  N  N    . GLU C  1 116 ? -67.273 1.574   34.362  1.00 78.59  ?  116 GLU C N    1 
ATOM   8683  C  CA   . GLU C  1 116 ? -66.227 0.621   33.993  1.00 75.40  ?  116 GLU C CA   1 
ATOM   8684  C  C    . GLU C  1 116 ? -66.440 0.046   32.596  1.00 79.03  ?  116 GLU C C    1 
ATOM   8685  O  O    . GLU C  1 116 ? -65.461 -0.227  31.892  1.00 81.23  ?  116 GLU C O    1 
ATOM   8686  C  CB   . GLU C  1 116 ? -66.147 -0.499  35.033  1.00 73.80  ?  116 GLU C CB   1 
ATOM   8687  C  CG   . GLU C  1 116 ? -64.943 -1.437  34.885  1.00 72.98  ?  116 GLU C CG   1 
ATOM   8688  C  CD   . GLU C  1 116 ? -65.059 -2.682  35.752  1.00 78.58  ?  116 GLU C CD   1 
ATOM   8689  O  OE1  . GLU C  1 116 ? -66.025 -3.456  35.563  1.00 83.23  ?  116 GLU C OE1  1 
ATOM   8690  O  OE2  . GLU C  1 116 ? -64.179 -2.885  36.617  1.00 82.21  ?  116 GLU C OE2  1 
ATOM   8691  H  H    . GLU C  1 116 ? -67.817 1.293   34.965  1.00 94.31  ?  116 GLU C H    1 
ATOM   8692  H  HA   . GLU C  1 116 ? -65.374 1.083   33.992  1.00 90.48  ?  116 GLU C HA   1 
ATOM   8693  H  HB2  . GLU C  1 116 ? -66.098 -0.098  35.915  1.00 88.56  ?  116 GLU C HB2  1 
ATOM   8694  H  HB3  . GLU C  1 116 ? -66.949 -1.041  34.966  1.00 88.56  ?  116 GLU C HB3  1 
ATOM   8695  H  HG2  . GLU C  1 116 ? -64.875 -1.721  33.960  1.00 87.58  ?  116 GLU C HG2  1 
ATOM   8696  H  HG3  . GLU C  1 116 ? -64.139 -0.963  35.148  1.00 87.58  ?  116 GLU C HG3  1 
ATOM   8697  N  N    . ASP C  1 117 ? -67.694 -0.134  32.168  1.00 61.39  ?  117 ASP C N    1 
ATOM   8698  C  CA   . ASP C  1 117 ? -67.951 -0.581  30.801  1.00 64.90  ?  117 ASP C CA   1 
ATOM   8699  C  C    . ASP C  1 117 ? -67.279 0.339   29.782  1.00 62.27  ?  117 ASP C C    1 
ATOM   8700  O  O    . ASP C  1 117 ? -66.566 -0.129  28.887  1.00 61.33  ?  117 ASP C O    1 
ATOM   8701  C  CB   . ASP C  1 117 ? -69.461 -0.661  30.549  1.00 67.76  ?  117 ASP C CB   1 
ATOM   8702  C  CG   . ASP C  1 117 ? -69.804 -1.214  29.166  1.00 68.89  ?  117 ASP C CG   1 
ATOM   8703  O  OD1  . ASP C  1 117 ? -70.357 -0.464  28.329  1.00 72.09  ?  117 ASP C OD1  1 
ATOM   8704  O  OD2  . ASP C  1 117 ? -69.505 -2.402  28.912  1.00 71.96  -1 117 ASP C OD2  1 
ATOM   8705  H  H    . ASP C  1 117 ? -68.400 -0.005  32.643  1.00 73.66  ?  117 ASP C H    1 
ATOM   8706  H  HA   . ASP C  1 117 ? -67.582 -1.471  30.687  1.00 77.87  ?  117 ASP C HA   1 
ATOM   8707  H  HB2  . ASP C  1 117 ? -69.861 -1.244  31.213  1.00 81.31  ?  117 ASP C HB2  1 
ATOM   8708  H  HB3  . ASP C  1 117 ? -69.840 0.229   30.619  1.00 81.31  ?  117 ASP C HB3  1 
ATOM   8709  N  N    . ALA C  1 118 ? -67.483 1.656   29.911  1.00 59.71  ?  118 ALA C N    1 
ATOM   8710  C  CA   . ALA C  1 118 ? -66.931 2.607   28.941  1.00 59.53  ?  118 ALA C CA   1 
ATOM   8711  C  C    . ALA C  1 118 ? -65.405 2.666   29.011  1.00 47.64  ?  118 ALA C C    1 
ATOM   8712  O  O    . ALA C  1 118 ? -64.729 2.764   27.975  1.00 37.29  ?  118 ALA C O    1 
ATOM   8713  C  CB   . ALA C  1 118 ? -67.532 3.996   29.174  1.00 61.51  ?  118 ALA C CB   1 
ATOM   8714  H  H    . ALA C  1 118 ? -67.933 2.021   30.547  1.00 71.66  ?  118 ALA C H    1 
ATOM   8715  H  HA   . ALA C  1 118 ? -67.178 2.321   28.048  1.00 71.44  ?  118 ALA C HA   1 
ATOM   8716  H  HB1  . ALA C  1 118 ? -67.159 4.614   28.526  1.00 73.81  ?  118 ALA C HB1  1 
ATOM   8717  H  HB2  . ALA C  1 118 ? -68.495 3.946   29.066  1.00 73.81  ?  118 ALA C HB2  1 
ATOM   8718  H  HB3  . ALA C  1 118 ? -67.314 4.288   30.073  1.00 73.81  ?  118 ALA C HB3  1 
ATOM   8719  N  N    . ALA C  1 119 ? -64.841 2.620   30.219  1.00 49.66  ?  119 ALA C N    1 
ATOM   8720  C  CA   . ALA C  1 119 ? -63.391 2.514   30.346  1.00 45.07  ?  119 ALA C CA   1 
ATOM   8721  C  C    . ALA C  1 119 ? -62.881 1.254   29.662  1.00 47.33  ?  119 ALA C C    1 
ATOM   8722  O  O    . ALA C  1 119 ? -61.870 1.289   28.947  1.00 39.45  ?  119 ALA C O    1 
ATOM   8723  C  CB   . ALA C  1 119 ? -62.986 2.512   31.820  1.00 42.26  ?  119 ALA C CB   1 
ATOM   8724  H  H    . ALA C  1 119 ? -65.267 2.649   30.965  1.00 59.59  ?  119 ALA C H    1 
ATOM   8725  H  HA   . ALA C  1 119 ? -62.976 3.279   29.919  1.00 54.09  ?  119 ALA C HA   1 
ATOM   8726  H  HB1  . ALA C  1 119 ? -62.021 2.440   31.882  1.00 50.71  ?  119 ALA C HB1  1 
ATOM   8727  H  HB2  . ALA C  1 119 ? -63.284 3.339   32.230  1.00 50.71  ?  119 ALA C HB2  1 
ATOM   8728  H  HB3  . ALA C  1 119 ? -63.403 1.755   32.261  1.00 50.71  ?  119 ALA C HB3  1 
ATOM   8729  N  N    . LYS C  1 120 ? -63.567 0.126   29.870  1.00 47.26  ?  120 LYS C N    1 
ATOM   8730  C  CA   . LYS C  1 120 ? -63.101 -1.129  29.294  1.00 47.68  ?  120 LYS C CA   1 
ATOM   8731  C  C    . LYS C  1 120 ? -63.189 -1.125  27.767  1.00 49.56  ?  120 LYS C C    1 
ATOM   8732  O  O    . LYS C  1 120 ? -62.346 -1.738  27.107  1.00 32.80  ?  120 LYS C O    1 
ATOM   8733  C  CB   . LYS C  1 120 ? -63.885 -2.299  29.895  1.00 45.16  ?  120 LYS C CB   1 
ATOM   8734  C  CG   . LYS C  1 120 ? -63.494 -2.612  31.354  1.00 48.98  ?  120 LYS C CG   1 
ATOM   8735  C  CD   . LYS C  1 120 ? -64.074 -3.944  31.830  1.00 56.35  ?  120 LYS C CD   1 
ATOM   8736  C  CE   . LYS C  1 120 ? -63.490 -4.359  33.168  1.00 65.43  ?  120 LYS C CE   1 
ATOM   8737  N  NZ   . LYS C  1 120 ? -64.192 -5.552  33.726  1.00 70.32  1  120 LYS C NZ   1 
ATOM   8738  H  H    . LYS C  1 120 ? -64.290 0.065   30.332  1.00 56.72  ?  120 LYS C H    1 
ATOM   8739  H  HA   . LYS C  1 120 ? -62.168 -1.250  29.532  1.00 57.22  ?  120 LYS C HA   1 
ATOM   8740  H  HB2  . LYS C  1 120 ? -64.831 -2.085  29.880  1.00 54.19  ?  120 LYS C HB2  1 
ATOM   8741  H  HB3  . LYS C  1 120 ? -63.718 -3.094  29.365  1.00 54.19  ?  120 LYS C HB3  1 
ATOM   8742  H  HG2  . LYS C  1 120 ? -62.528 -2.662  31.421  1.00 58.77  ?  120 LYS C HG2  1 
ATOM   8743  H  HG3  . LYS C  1 120 ? -63.833 -1.911  31.932  1.00 58.77  ?  120 LYS C HG3  1 
ATOM   8744  H  HD2  . LYS C  1 120 ? -65.035 -3.856  31.931  1.00 67.62  ?  120 LYS C HD2  1 
ATOM   8745  H  HD3  . LYS C  1 120 ? -63.867 -4.633  31.180  1.00 67.62  ?  120 LYS C HD3  1 
ATOM   8746  H  HE2  . LYS C  1 120 ? -62.554 -4.583  33.052  1.00 78.51  ?  120 LYS C HE2  1 
ATOM   8747  H  HE3  . LYS C  1 120 ? -63.585 -3.628  33.799  1.00 78.51  ?  120 LYS C HE3  1 
ATOM   8748  H  HZ1  . LYS C  1 120 ? -63.833 -5.777  34.509  1.00 84.38  ?  120 LYS C HZ1  1 
ATOM   8749  H  HZ2  . LYS C  1 120 ? -65.055 -5.369  33.844  1.00 84.38  ?  120 LYS C HZ2  1 
ATOM   8750  H  HZ3  . LYS C  1 120 ? -64.116 -6.239  33.165  1.00 84.38  ?  120 LYS C HZ3  1 
ATOM   8751  N  N    . LYS C  1 121 ? -64.170 -0.433  27.178  1.00 40.87  ?  121 LYS C N    1 
ATOM   8752  C  CA   . LYS C  1 121 ? -64.207 -0.341  25.717  1.00 37.89  ?  121 LYS C CA   1 
ATOM   8753  C  C    . LYS C  1 121 ? -63.095 0.565   25.192  1.00 38.35  ?  121 LYS C C    1 
ATOM   8754  O  O    . LYS C  1 121 ? -62.463 0.255   24.171  1.00 31.43  ?  121 LYS C O    1 
ATOM   8755  C  CB   . LYS C  1 121 ? -65.571 0.164   25.240  1.00 48.33  ?  121 LYS C CB   1 
ATOM   8756  C  CG   . LYS C  1 121 ? -66.789 -0.480  25.908  1.00 58.16  ?  121 LYS C CG   1 
ATOM   8757  C  CD   . LYS C  1 121 ? -66.682 -1.999  26.122  1.00 61.50  ?  121 LYS C CD   1 
ATOM   8758  C  CE   . LYS C  1 121 ? -66.993 -2.781  24.851  1.00 65.38  ?  121 LYS C CE   1 
ATOM   8759  N  NZ   . LYS C  1 121 ? -67.022 -4.256  25.086  1.00 81.88  1  121 LYS C NZ   1 
ATOM   8760  H  H    . LYS C  1 121 ? -64.804 -0.021  27.587  1.00 49.05  ?  121 LYS C H    1 
ATOM   8761  H  HA   . LYS C  1 121 ? -64.071 -1.226  25.344  1.00 45.47  ?  121 LYS C HA   1 
ATOM   8762  H  HB2  . LYS C  1 121 ? -65.619 1.119   25.408  1.00 58.00  ?  121 LYS C HB2  1 
ATOM   8763  H  HB3  . LYS C  1 121 ? -65.642 -0.001  24.287  1.00 58.00  ?  121 LYS C HB3  1 
ATOM   8764  H  HG2  . LYS C  1 121 ? -66.917 -0.070  26.778  1.00 69.79  ?  121 LYS C HG2  1 
ATOM   8765  H  HG3  . LYS C  1 121 ? -67.568 -0.316  25.354  1.00 69.79  ?  121 LYS C HG3  1 
ATOM   8766  H  HD2  . LYS C  1 121 ? -65.779 -2.219  26.398  1.00 73.80  ?  121 LYS C HD2  1 
ATOM   8767  H  HD3  . LYS C  1 121 ? -67.316 -2.270  26.805  1.00 73.80  ?  121 LYS C HD3  1 
ATOM   8768  H  HE2  . LYS C  1 121 ? -67.863 -2.511  24.517  1.00 78.45  ?  121 LYS C HE2  1 
ATOM   8769  H  HE3  . LYS C  1 121 ? -66.309 -2.594  24.188  1.00 78.45  ?  121 LYS C HE3  1 
ATOM   8770  H  HZ1  . LYS C  1 121 ? -67.205 -4.681  24.326  1.00 98.26  ?  121 LYS C HZ1  1 
ATOM   8771  H  HZ2  . LYS C  1 121 ? -66.231 -4.531  25.388  1.00 98.26  ?  121 LYS C HZ2  1 
ATOM   8772  H  HZ3  . LYS C  1 121 ? -67.647 -4.456  25.687  1.00 98.26  ?  121 LYS C HZ3  1 
ATOM   8773  N  N    . LYS C  1 122 ? -62.851 1.698   25.862  1.00 33.41  ?  122 LYS C N    1 
ATOM   8774  C  CA   . LYS C  1 122 ? -61.722 2.545   25.486  1.00 33.86  ?  122 LYS C CA   1 
ATOM   8775  C  C    . LYS C  1 122 ? -60.418 1.790   25.655  1.00 30.21  ?  122 LYS C C    1 
ATOM   8776  O  O    . LYS C  1 122 ? -59.519 1.872   24.802  1.00 29.84  ?  122 LYS C O    1 
ATOM   8777  C  CB   . LYS C  1 122 ? -61.684 3.824   26.334  1.00 39.23  ?  122 LYS C CB   1 
ATOM   8778  C  CG   . LYS C  1 122 ? -62.687 4.877   25.917  1.00 59.12  ?  122 LYS C CG   1 
ATOM   8779  C  CD   . LYS C  1 122 ? -62.544 6.142   26.759  1.00 64.90  ?  122 LYS C CD   1 
ATOM   8780  C  CE   . LYS C  1 122 ? -63.787 7.024   26.649  1.00 68.35  ?  122 LYS C CE   1 
ATOM   8781  N  NZ   . LYS C  1 122 ? -64.998 6.354   27.209  1.00 71.01  1  122 LYS C NZ   1 
ATOM   8782  H  H    . LYS C  1 122 ? -63.315 1.989   26.524  1.00 40.09  ?  122 LYS C H    1 
ATOM   8783  H  HA   . LYS C  1 122 ? -61.808 2.800   24.554  1.00 40.63  ?  122 LYS C HA   1 
ATOM   8784  H  HB2  . LYS C  1 122 ? -61.869 3.591   27.258  1.00 47.08  ?  122 LYS C HB2  1 
ATOM   8785  H  HB3  . LYS C  1 122 ? -60.799 4.217   26.267  1.00 47.08  ?  122 LYS C HB3  1 
ATOM   8786  H  HG2  . LYS C  1 122 ? -62.538 5.111   24.988  1.00 70.95  ?  122 LYS C HG2  1 
ATOM   8787  H  HG3  . LYS C  1 122 ? -63.584 4.530   26.037  1.00 70.95  ?  122 LYS C HG3  1 
ATOM   8788  H  HD2  . LYS C  1 122 ? -62.427 5.896   27.690  1.00 77.88  ?  122 LYS C HD2  1 
ATOM   8789  H  HD3  . LYS C  1 122 ? -61.780 6.651   26.446  1.00 77.88  ?  122 LYS C HD3  1 
ATOM   8790  H  HE2  . LYS C  1 122 ? -63.640 7.846   27.144  1.00 82.03  ?  122 LYS C HE2  1 
ATOM   8791  H  HE3  . LYS C  1 122 ? -63.956 7.222   25.714  1.00 82.03  ?  122 LYS C HE3  1 
ATOM   8792  H  HZ1  . LYS C  1 122 ? -64.870 6.165   28.069  1.00 85.21  ?  122 LYS C HZ1  1 
ATOM   8793  H  HZ2  . LYS C  1 122 ? -65.705 6.889   27.132  1.00 85.21  ?  122 LYS C HZ2  1 
ATOM   8794  H  HZ3  . LYS C  1 122 ? -65.158 5.598   26.767  1.00 85.21  ?  122 LYS C HZ3  1 
ATOM   8795  N  N    . LEU C  1 123 ? -60.295 1.039   26.751  1.00 30.08  ?  123 LEU C N    1 
ATOM   8796  C  CA   . LEU C  1 123 ? -59.076 0.269   26.957  1.00 28.19  ?  123 LEU C CA   1 
ATOM   8797  C  C    . LEU C  1 123 ? -58.944 -0.827  25.914  1.00 24.16  ?  123 LEU C C    1 
ATOM   8798  O  O    . LEU C  1 123 ? -57.834 -1.105  25.458  1.00 23.56  ?  123 LEU C O    1 
ATOM   8799  C  CB   . LEU C  1 123 ? -59.031 -0.340  28.366  1.00 35.76  ?  123 LEU C CB   1 
ATOM   8800  C  CG   . LEU C  1 123 ? -58.646 0.626   29.494  1.00 43.29  ?  123 LEU C CG   1 
ATOM   8801  C  CD1  . LEU C  1 123 ? -58.541 -0.110  30.799  1.00 41.63  ?  123 LEU C CD1  1 
ATOM   8802  C  CD2  . LEU C  1 123 ? -57.345 1.357   29.210  1.00 46.29  ?  123 LEU C CD2  1 
ATOM   8803  H  H    . LEU C  1 123 ? -60.885 0.962   27.372  1.00 36.09  ?  123 LEU C H    1 
ATOM   8804  H  HA   . LEU C  1 123 ? -58.313 0.860   26.865  1.00 33.83  ?  123 LEU C HA   1 
ATOM   8805  H  HB2  . LEU C  1 123 ? -59.909 -0.696  28.575  1.00 42.92  ?  123 LEU C HB2  1 
ATOM   8806  H  HB3  . LEU C  1 123 ? -58.381 -1.061  28.367  1.00 42.92  ?  123 LEU C HB3  1 
ATOM   8807  H  HG   . LEU C  1 123 ? -59.345 1.292   29.585  1.00 51.95  ?  123 LEU C HG   1 
ATOM   8808  H  HD11 . LEU C  1 123 ? -58.298 0.519   31.497  1.00 49.95  ?  123 LEU C HD11 1 
ATOM   8809  H  HD12 . LEU C  1 123 ? -59.398 -0.515  31.003  1.00 49.95  ?  123 LEU C HD12 1 
ATOM   8810  H  HD13 . LEU C  1 123 ? -57.861 -0.796  30.720  1.00 49.95  ?  123 LEU C HD13 1 
ATOM   8811  H  HD21 . LEU C  1 123 ? -57.149 1.952   29.951  1.00 55.55  ?  123 LEU C HD21 1 
ATOM   8812  H  HD22 . LEU C  1 123 ? -56.633 0.706   29.111  1.00 55.55  ?  123 LEU C HD22 1 
ATOM   8813  H  HD23 . LEU C  1 123 ? -57.442 1.868   28.391  1.00 55.55  ?  123 LEU C HD23 1 
ATOM   8814  N  N    . ASN C  1 124 ? -60.057 -1.482  25.541  1.00 24.52  ?  124 ASN C N    1 
ATOM   8815  C  CA   . ASN C  1 124 ? -59.982 -2.521  24.519  1.00 22.73  ?  124 ASN C CA   1 
ATOM   8816  C  C    . ASN C  1 124 ? -59.317 -1.972  23.258  1.00 21.13  ?  124 ASN C C    1 
ATOM   8817  O  O    . ASN C  1 124 ? -58.412 -2.605  22.700  1.00 22.00  ?  124 ASN C O    1 
ATOM   8818  C  CB   . ASN C  1 124 ? -61.384 -3.071  24.216  1.00 24.91  ?  124 ASN C CB   1 
ATOM   8819  C  CG   . ASN C  1 124 ? -61.424 -3.951  22.972  1.00 26.45  ?  124 ASN C CG   1 
ATOM   8820  O  OD1  . ASN C  1 124 ? -62.119 -3.634  21.981  1.00 31.60  ?  124 ASN C OD1  1 
ATOM   8821  N  ND2  . ASN C  1 124 ? -60.724 -5.062  23.021  1.00 25.83  ?  124 ASN C ND2  1 
ATOM   8822  H  H    . ASN C  1 124 ? -60.844 -1.343  25.859  1.00 29.43  ?  124 ASN C H    1 
ATOM   8823  H  HA   . ASN C  1 124 ? -59.438 -3.252  24.851  1.00 27.28  ?  124 ASN C HA   1 
ATOM   8824  H  HB2  . ASN C  1 124 ? -61.682 -3.605  24.970  1.00 29.89  ?  124 ASN C HB2  1 
ATOM   8825  H  HB3  . ASN C  1 124 ? -61.991 -2.328  24.077  1.00 29.89  ?  124 ASN C HB3  1 
ATOM   8826  H  HD21 . ASN C  1 124 ? -60.713 -5.594  22.345  1.00 31.00  ?  124 ASN C HD21 1 
ATOM   8827  H  HD22 . ASN C  1 124 ? -60.277 -5.258  23.729  1.00 31.00  ?  124 ASN C HD22 1 
ATOM   8828  N  N    . LEU C  1 125 ? -59.741 -0.786  22.798  1.00 21.31  ?  125 LEU C N    1 
ATOM   8829  C  CA   . LEU C  1 125 ? -59.144 -0.218  21.592  1.00 22.20  ?  125 LEU C CA   1 
ATOM   8830  C  C    . LEU C  1 125 ? -57.675 0.139   21.825  1.00 24.62  ?  125 LEU C C    1 
ATOM   8831  O  O    . LEU C  1 125 ? -56.815 -0.068  20.950  1.00 23.47  ?  125 LEU C O    1 
ATOM   8832  C  CB   . LEU C  1 125 ? -59.935 1.011   21.114  1.00 26.48  ?  125 LEU C CB   1 
ATOM   8833  C  CG   . LEU C  1 125 ? -61.365 0.727   20.634  1.00 32.71  ?  125 LEU C CG   1 
ATOM   8834  C  CD1  . LEU C  1 125 ? -62.009 2.033   20.167  1.00 36.97  ?  125 LEU C CD1  1 
ATOM   8835  C  CD2  . LEU C  1 125 ? -61.437 -0.335  19.528  1.00 32.71  ?  125 LEU C CD2  1 
ATOM   8836  H  H    . LEU C  1 125 ? -60.357 -0.305  23.158  1.00 25.57  ?  125 LEU C H    1 
ATOM   8837  H  HA   . LEU C  1 125 ? -59.177 -0.883  20.886  1.00 26.64  ?  125 LEU C HA   1 
ATOM   8838  H  HB2  . LEU C  1 125 ? -59.994 1.643   21.847  1.00 31.78  ?  125 LEU C HB2  1 
ATOM   8839  H  HB3  . LEU C  1 125 ? -59.456 1.417   20.374  1.00 31.78  ?  125 LEU C HB3  1 
ATOM   8840  H  HG   . LEU C  1 125 ? -61.883 0.400   21.387  1.00 39.25  ?  125 LEU C HG   1 
ATOM   8841  H  HD11 . LEU C  1 125 ? -62.912 1.849   19.865  1.00 44.36  ?  125 LEU C HD11 1 
ATOM   8842  H  HD12 . LEU C  1 125 ? -62.028 2.658   20.908  1.00 44.36  ?  125 LEU C HD12 1 
ATOM   8843  H  HD13 . LEU C  1 125 ? -61.484 2.399   19.438  1.00 44.36  ?  125 LEU C HD13 1 
ATOM   8844  H  HD21 . LEU C  1 125 ? -62.364 -0.464  19.274  1.00 39.25  ?  125 LEU C HD21 1 
ATOM   8845  H  HD22 . LEU C  1 125 ? -60.924 -0.030  18.764  1.00 39.25  ?  125 LEU C HD22 1 
ATOM   8846  H  HD23 . LEU C  1 125 ? -61.067 -1.166  19.864  1.00 39.25  ?  125 LEU C HD23 1 
HETATM 8847  N  N    . MSE C  1 126 ? -57.355 0.633   23.016  1.00 23.53  ?  126 MSE C N    1 
HETATM 8848  C  CA   . MSE C  1 126 ? -55.993 0.980   23.338  1.00 24.50  ?  126 MSE C CA   1 
HETATM 8849  C  C    . MSE C  1 126 ? -55.110 -0.272  23.287  1.00 22.59  ?  126 MSE C C    1 
HETATM 8850  O  O    . MSE C  1 126 ? -53.978 -0.209  22.777  1.00 23.40  ?  126 MSE C O    1 
HETATM 8851  C  CB   . MSE C  1 126 ? -55.904 1.634   24.733  1.00 28.70  ?  126 MSE C CB   1 
HETATM 8852  C  CG   . MSE C  1 126 ? -54.451 1.757   25.300  1.00 34.68  ?  126 MSE C CG   1 
HETATM 8853  SE SE   . MSE C  1 126 ? -54.495 2.400   27.164  1.00 57.82  ?  126 MSE C SE   1 
HETATM 8854  C  CE   . MSE C  1 126 ? -55.825 3.826   26.924  1.00 51.26  ?  126 MSE C CE   1 
HETATM 8855  H  H    . MSE C  1 126 ? -57.915 0.775   23.652  1.00 28.23  ?  126 MSE C H    1 
HETATM 8856  H  HA   . MSE C  1 126 ? -55.669 1.621   22.686  1.00 29.41  ?  126 MSE C HA   1 
HETATM 8857  H  HB2  . MSE C  1 126 ? -56.276 2.529   24.681  1.00 34.44  ?  126 MSE C HB2  1 
HETATM 8858  H  HB3  . MSE C  1 126 ? -56.420 1.102   25.359  1.00 34.44  ?  126 MSE C HB3  1 
HETATM 8859  H  HG2  . MSE C  1 126 ? -54.023 0.887   25.284  1.00 41.62  ?  126 MSE C HG2  1 
HETATM 8860  H  HG3  . MSE C  1 126 ? -53.948 2.392   24.767  1.00 41.62  ?  126 MSE C HG3  1 
HETATM 8861  H  HE1  . MSE C  1 126 ? -55.974 4.265   27.776  1.00 61.51  ?  126 MSE C HE1  1 
HETATM 8862  H  HE2  . MSE C  1 126 ? -55.489 4.464   26.276  1.00 61.51  ?  126 MSE C HE2  1 
HETATM 8863  H  HE3  . MSE C  1 126 ? -56.652 3.434   26.604  1.00 61.51  ?  126 MSE C HE3  1 
ATOM   8864  N  N    . GLY C  1 127 ? -55.614 -1.376  23.851  1.00 21.45  ?  127 GLY C N    1 
ATOM   8865  C  CA   . GLY C  1 127 ? -54.819 -2.594  23.912  1.00 20.55  ?  127 GLY C CA   1 
ATOM   8866  C  C    . GLY C  1 127 ? -54.578 -3.176  22.539  1.00 20.79  ?  127 GLY C C    1 
ATOM   8867  O  O    . GLY C  1 127 ? -53.501 -3.716  22.267  1.00 19.47  ?  127 GLY C O    1 
ATOM   8868  H  H    . GLY C  1 127 ? -56.398 -1.440  24.197  1.00 25.73  ?  127 GLY C H    1 
ATOM   8869  H  HA2  . GLY C  1 127 ? -53.961 -2.402  24.322  1.00 24.66  ?  127 GLY C HA2  1 
ATOM   8870  H  HA3  . GLY C  1 127 ? -55.279 -3.255  24.452  1.00 24.66  ?  127 GLY C HA3  1 
ATOM   8871  N  N    . ARG C  1 128 ? -55.569 -3.071  21.654  1.00 19.24  ?  128 ARG C N    1 
ATOM   8872  C  CA   . ARG C  1 128 ? -55.407 -3.602  20.303  1.00 19.41  ?  128 ARG C CA   1 
ATOM   8873  C  C    . ARG C  1 128 ? -54.324 -2.839  19.545  1.00 19.51  ?  128 ARG C C    1 
ATOM   8874  O  O    . ARG C  1 128 ? -53.500 -3.441  18.839  1.00 19.33  ?  128 ARG C O    1 
ATOM   8875  C  CB   . ARG C  1 128 ? -56.744 -3.548  19.546  1.00 19.34  ?  128 ARG C CB   1 
ATOM   8876  C  CG   . ARG C  1 128 ? -57.837 -4.485  20.103  1.00 19.94  ?  128 ARG C CG   1 
ATOM   8877  C  CD   . ARG C  1 128 ? -59.156 -4.298  19.380  1.00 21.46  ?  128 ARG C CD   1 
ATOM   8878  N  NE   . ARG C  1 128 ? -59.078 -4.659  17.972  1.00 20.15  ?  128 ARG C NE   1 
ATOM   8879  C  CZ   . ARG C  1 128 ? -59.414 -5.840  17.469  1.00 19.23  ?  128 ARG C CZ   1 
ATOM   8880  N  NH1  . ARG C  1 128 ? -59.889 -6.810  18.246  1.00 20.90  1  128 ARG C NH1  1 
ATOM   8881  N  NH2  . ARG C  1 128 ? -59.292 -6.042  16.167  1.00 22.96  ?  128 ARG C NH2  1 
ATOM   8882  H  H    . ARG C  1 128 ? -56.331 -2.703  21.808  1.00 23.09  ?  128 ARG C H    1 
ATOM   8883  H  HA   . ARG C  1 128 ? -55.133 -4.531  20.360  1.00 23.29  ?  128 ARG C HA   1 
ATOM   8884  H  HB2  . ARG C  1 128 ? -57.086 -2.641  19.585  1.00 23.21  ?  128 ARG C HB2  1 
ATOM   8885  H  HB3  . ARG C  1 128 ? -56.587 -3.798  18.622  1.00 23.21  ?  128 ARG C HB3  1 
ATOM   8886  H  HG2  . ARG C  1 128 ? -57.557 -5.407  19.989  1.00 23.93  ?  128 ARG C HG2  1 
ATOM   8887  H  HG3  . ARG C  1 128 ? -57.976 -4.290  21.043  1.00 23.93  ?  128 ARG C HG3  1 
ATOM   8888  H  HD2  . ARG C  1 128 ? -59.829 -4.859  19.798  1.00 25.75  ?  128 ARG C HD2  1 
ATOM   8889  H  HD3  . ARG C  1 128 ? -59.419 -3.366  19.437  1.00 25.75  ?  128 ARG C HD3  1 
ATOM   8890  H  HE   . ARG C  1 128 ? -58.792 -4.061  17.424  1.00 24.18  ?  128 ARG C HE   1 
ATOM   8891  H  HH11 . ARG C  1 128 ? -59.970 -6.682  19.092  1.00 25.08  ?  128 ARG C HH11 1 
ATOM   8892  H  HH12 . ARG C  1 128 ? -60.106 -7.568  17.903  1.00 25.08  ?  128 ARG C HH12 1 
ATOM   8893  H  HH21 . ARG C  1 128 ? -58.990 -5.416  15.662  1.00 27.55  ?  128 ARG C HH21 1 
ATOM   8894  H  HH22 . ARG C  1 128 ? -59.512 -6.801  15.828  1.00 27.55  ?  128 ARG C HH22 1 
ATOM   8895  N  N    . LYS C  1 129 ? -54.269 -1.515  19.709  1.00 19.32  ?  129 LYS C N    1 
ATOM   8896  C  CA   . LYS C  1 129 ? -53.220 -0.735  19.076  1.00 19.43  ?  129 LYS C CA   1 
ATOM   8897  C  C    . LYS C  1 129 ? -51.870 -0.996  19.731  1.00 18.85  ?  129 LYS C C    1 
ATOM   8898  O  O    . LYS C  1 129 ? -50.842 -1.073  19.037  1.00 18.94  ?  129 LYS C O    1 
ATOM   8899  C  CB   . LYS C  1 129 ? -53.586 0.754   19.111  1.00 21.91  ?  129 LYS C CB   1 
ATOM   8900  C  CG   . LYS C  1 129 ? -54.716 1.075   18.153  1.00 27.40  ?  129 LYS C CG   1 
ATOM   8901  C  CD   . LYS C  1 129 ? -55.105 2.558   18.181  1.00 44.20  ?  129 LYS C CD   1 
ATOM   8902  C  CE   . LYS C  1 129 ? -54.055 3.427   17.494  1.00 57.59  ?  129 LYS C CE   1 
ATOM   8903  N  NZ   . LYS C  1 129 ? -54.562 4.812   17.215  1.00 66.45  1  129 LYS C NZ   1 
ATOM   8904  H  H    . LYS C  1 129 ? -54.824 -1.055  20.177  1.00 23.18  ?  129 LYS C H    1 
ATOM   8905  H  HA   . LYS C  1 129 ? -53.152 -1.001  18.146  1.00 23.32  ?  129 LYS C HA   1 
ATOM   8906  H  HB2  . LYS C  1 129 ? -53.872 0.993   20.007  1.00 26.29  ?  129 LYS C HB2  1 
ATOM   8907  H  HB3  . LYS C  1 129 ? -52.812 1.280   18.854  1.00 26.29  ?  129 LYS C HB3  1 
ATOM   8908  H  HG2  . LYS C  1 129 ? -54.438 0.854   17.250  1.00 32.88  ?  129 LYS C HG2  1 
ATOM   8909  H  HG3  . LYS C  1 129 ? -55.497 0.554   18.397  1.00 32.88  ?  129 LYS C HG3  1 
ATOM   8910  H  HD2  . LYS C  1 129 ? -55.949 2.676   17.717  1.00 53.04  ?  129 LYS C HD2  1 
ATOM   8911  H  HD3  . LYS C  1 129 ? -55.186 2.850   19.103  1.00 53.04  ?  129 LYS C HD3  1 
ATOM   8912  H  HE2  . LYS C  1 129 ? -53.277 3.501   18.069  1.00 69.11  ?  129 LYS C HE2  1 
ATOM   8913  H  HE3  . LYS C  1 129 ? -53.808 3.020   16.649  1.00 69.11  ?  129 LYS C HE3  1 
ATOM   8914  H  HZ1  . LYS C  1 129 ? -54.791 5.211   17.976  1.00 79.74  ?  129 LYS C HZ1  1 
ATOM   8915  H  HZ2  . LYS C  1 129 ? -53.929 5.293   16.815  1.00 79.74  ?  129 LYS C HZ2  1 
ATOM   8916  H  HZ3  . LYS C  1 129 ? -55.275 4.773   16.683  1.00 79.74  ?  129 LYS C HZ3  1 
ATOM   8917  N  N    . ALA C  1 130 ? -51.851 -1.171  21.064  1.00 20.00  ?  130 ALA C N    1 
ATOM   8918  C  CA   . ALA C  1 130 ? -50.592 -1.434  21.768  1.00 19.50  ?  130 ALA C CA   1 
ATOM   8919  C  C    . ALA C  1 130 ? -49.938 -2.717  21.282  1.00 17.80  ?  130 ALA C C    1 
ATOM   8920  O  O    . ALA C  1 130 ? -48.713 -2.775  21.117  1.00 16.65  ?  130 ALA C O    1 
ATOM   8921  C  CB   . ALA C  1 130 ? -50.809 -1.521  23.286  1.00 20.86  ?  130 ALA C CB   1 
ATOM   8922  H  H    . ALA C  1 130 ? -52.544 -1.143  21.572  1.00 24.00  ?  130 ALA C H    1 
ATOM   8923  H  HA   . ALA C  1 130 ? -49.978 -0.703  21.596  1.00 23.40  ?  130 ALA C HA   1 
ATOM   8924  H  HB1  . ALA C  1 130 ? -49.957 -1.695  23.717  1.00 25.03  ?  130 ALA C HB1  1 
ATOM   8925  H  HB2  . ALA C  1 130 ? -51.174 -0.679  23.601  1.00 25.03  ?  130 ALA C HB2  1 
ATOM   8926  H  HB3  . ALA C  1 130 ? -51.429 -2.242  23.474  1.00 25.03  ?  130 ALA C HB3  1 
ATOM   8927  N  N    . LYS C  1 131 ? -50.735 -3.759  21.068  1.00 17.19  ?  131 LYS C N    1 
ATOM   8928  C  CA   . LYS C  1 131 ? -50.172 -5.039  20.668  1.00 16.47  ?  131 LYS C CA   1 
ATOM   8929  C  C    . LYS C  1 131 ? -49.440 -4.941  19.338  1.00 16.06  ?  131 LYS C C    1 
ATOM   8930  O  O    . LYS C  1 131 ? -48.489 -5.684  19.106  1.00 17.63  ?  131 LYS C O    1 
ATOM   8931  C  CB   . LYS C  1 131 ? -51.256 -6.100  20.617  1.00 16.35  ?  131 LYS C CB   1 
ATOM   8932  C  CG   . LYS C  1 131 ? -50.713 -7.497  20.481  1.00 22.78  ?  131 LYS C CG   1 
ATOM   8933  C  CD   . LYS C  1 131 ? -51.781 -8.534  20.702  1.00 28.35  ?  131 LYS C CD   1 
ATOM   8934  C  CE   . LYS C  1 131 ? -51.123 -9.896  20.765  1.00 35.80  ?  131 LYS C CE   1 
ATOM   8935  N  NZ   . LYS C  1 131 ? -52.101 -10.956 21.021  1.00 35.74  1  131 LYS C NZ   1 
ATOM   8936  H  H    . LYS C  1 131 ? -51.591 -3.751  21.146  1.00 20.63  ?  131 LYS C H    1 
ATOM   8937  H  HA   . LYS C  1 131 ? -49.526 -5.314  21.337  1.00 19.77  ?  131 LYS C HA   1 
ATOM   8938  H  HB2  . LYS C  1 131 ? -51.774 -6.060  21.435  1.00 19.62  ?  131 LYS C HB2  1 
ATOM   8939  H  HB3  . LYS C  1 131 ? -51.829 -5.928  19.853  1.00 19.62  ?  131 LYS C HB3  1 
ATOM   8940  H  HG2  . LYS C  1 131 ? -50.356 -7.615  19.588  1.00 27.33  ?  131 LYS C HG2  1 
ATOM   8941  H  HG3  . LYS C  1 131 ? -50.016 -7.634  21.142  1.00 27.33  ?  131 LYS C HG3  1 
ATOM   8942  H  HD2  . LYS C  1 131 ? -52.235 -8.366  21.543  1.00 34.02  ?  131 LYS C HD2  1 
ATOM   8943  H  HD3  . LYS C  1 131 ? -52.408 -8.524  19.962  1.00 34.02  ?  131 LYS C HD3  1 
ATOM   8944  H  HE2  . LYS C  1 131 ? -50.688 -10.081 19.918  1.00 42.96  ?  131 LYS C HE2  1 
ATOM   8945  H  HE3  . LYS C  1 131 ? -50.472 -9.904  21.485  1.00 42.96  ?  131 LYS C HE3  1 
ATOM   8946  H  HZ1  . LYS C  1 131 ? -52.709 -10.972 20.371  1.00 42.89  ?  131 LYS C HZ1  1 
ATOM   8947  H  HZ2  . LYS C  1 131 ? -51.692 -11.746 21.054  1.00 42.89  ?  131 LYS C HZ2  1 
ATOM   8948  H  HZ3  . LYS C  1 131 ? -52.512 -10.811 21.797  1.00 42.89  ?  131 LYS C HZ3  1 
ATOM   8949  N  N    . LEU C  1 132 ? -49.873 -4.037  18.456  1.00 16.21  ?  132 LEU C N    1 
ATOM   8950  C  CA   . LEU C  1 132 ? -49.246 -3.826  17.156  1.00 17.05  ?  132 LEU C CA   1 
ATOM   8951  C  C    . LEU C  1 132 ? -47.947 -3.047  17.232  1.00 19.12  ?  132 LEU C C    1 
ATOM   8952  O  O    . LEU C  1 132 ? -47.262 -2.941  16.213  1.00 19.67  ?  132 LEU C O    1 
ATOM   8953  C  CB   . LEU C  1 132 ? -50.215 -3.079  16.229  1.00 17.27  ?  132 LEU C CB   1 
ATOM   8954  C  CG   . LEU C  1 132 ? -51.523 -3.811  15.936  1.00 18.32  ?  132 LEU C CG   1 
ATOM   8955  C  CD1  . LEU C  1 132 ? -52.485 -2.901  15.174  1.00 20.94  ?  132 LEU C CD1  1 
ATOM   8956  C  CD2  . LEU C  1 132 ? -51.329 -5.077  15.137  1.00 18.10  ?  132 LEU C CD2  1 
ATOM   8957  H  H    . LEU C  1 132 ? -50.548 -3.522  18.595  1.00 19.45  ?  132 LEU C H    1 
ATOM   8958  H  HA   . LEU C  1 132 ? -49.053 -4.688  16.756  1.00 20.45  ?  132 LEU C HA   1 
ATOM   8959  H  HB2  . LEU C  1 132 ? -50.442 -2.230  16.639  1.00 20.73  ?  132 LEU C HB2  1 
ATOM   8960  H  HB3  . LEU C  1 132 ? -49.772 -2.922  15.380  1.00 20.73  ?  132 LEU C HB3  1 
ATOM   8961  H  HG   . LEU C  1 132 ? -51.943 -4.051  16.776  1.00 21.99  ?  132 LEU C HG   1 
ATOM   8962  H  HD11 . LEU C  1 132 ? -53.306 -3.386  15.000  1.00 25.13  ?  132 LEU C HD11 1 
ATOM   8963  H  HD12 . LEU C  1 132 ? -52.671 -2.117  15.715  1.00 25.13  ?  132 LEU C HD12 1 
ATOM   8964  H  HD13 . LEU C  1 132 ? -52.072 -2.636  14.337  1.00 25.13  ?  132 LEU C HD13 1 
ATOM   8965  H  HD21 . LEU C  1 132 ? -52.193 -5.491  14.987  1.00 21.72  ?  132 LEU C HD21 1 
ATOM   8966  H  HD22 . LEU C  1 132 ? -50.916 -4.854  14.288  1.00 21.72  ?  132 LEU C HD22 1 
ATOM   8967  H  HD23 . LEU C  1 132 ? -50.756 -5.680  15.637  1.00 21.72  ?  132 LEU C HD23 1 
ATOM   8968  N  N    . GLN C  1 133 ? -47.598 -2.485  18.386  1.00 17.21  ?  133 GLN C N    1 
ATOM   8969  C  CA   . GLN C  1 133 ? -46.305 -1.857  18.535  1.00 16.89  ?  133 GLN C CA   1 
ATOM   8970  C  C    . GLN C  1 133 ? -45.241 -2.933  18.680  1.00 17.84  ?  133 GLN C C    1 
ATOM   8971  O  O    . GLN C  1 133 ? -45.530 -4.098  18.978  1.00 19.95  ?  133 GLN C O    1 
ATOM   8972  C  CB   . GLN C  1 133 ? -46.285 -0.916  19.740  1.00 18.24  ?  133 GLN C CB   1 
ATOM   8973  C  CG   . GLN C  1 133 ? -47.259 0.217   19.658  1.00 22.70  ?  133 GLN C CG   1 
ATOM   8974  C  CD   . GLN C  1 133 ? -47.185 1.130   20.864  1.00 35.20  ?  133 GLN C CD   1 
ATOM   8975  O  OE1  . GLN C  1 133 ? -46.097 1.436   21.363  1.00 45.01  ?  133 GLN C OE1  1 
ATOM   8976  N  NE2  . GLN C  1 133 ? -48.337 1.579   21.331  1.00 51.58  ?  133 GLN C NE2  1 
ATOM   8977  H  H    . GLN C  1 133 ? -48.093 -2.457  19.089  1.00 20.65  ?  133 GLN C H    1 
ATOM   8978  H  HA   . GLN C  1 133 ? -46.107 -1.338  17.740  1.00 20.26  ?  133 GLN C HA   1 
ATOM   8979  H  HB2  . GLN C  1 133 ? -46.496 -1.428  20.537  1.00 21.89  ?  133 GLN C HB2  1 
ATOM   8980  H  HB3  . GLN C  1 133 ? -45.397 -0.535  19.822  1.00 21.89  ?  133 GLN C HB3  1 
ATOM   8981  H  HG2  . GLN C  1 133 ? -47.064 0.745   18.868  1.00 27.24  ?  133 GLN C HG2  1 
ATOM   8982  H  HG3  . GLN C  1 133 ? -48.158 -0.142  19.607  1.00 27.24  ?  133 GLN C HG3  1 
ATOM   8983  H  HE21 . GLN C  1 133 ? -49.073 1.350   20.951  1.00 61.89  ?  133 GLN C HE21 1 
ATOM   8984  H  HE22 . GLN C  1 133 ? -48.349 2.101   22.014  1.00 61.89  ?  133 GLN C HE22 1 
ATOM   8985  N  N    . LYS C  1 134 ? -43.998 -2.551  18.389  1.00 17.02  ?  134 LYS C N    1 
ATOM   8986  C  CA   . LYS C  1 134 ? -42.906 -3.515  18.333  1.00 16.80  ?  134 LYS C CA   1 
ATOM   8987  C  C    . LYS C  1 134 ? -42.113 -3.662  19.639  1.00 21.77  ?  134 LYS C C    1 
ATOM   8988  O  O    . LYS C  1 134 ? -41.057 -4.312  19.624  1.00 30.55  ?  134 LYS C O    1 
ATOM   8989  C  CB   . LYS C  1 134 ? -41.947 -3.143  17.196  1.00 19.89  ?  134 LYS C CB   1 
ATOM   8990  C  CG   . LYS C  1 134 ? -42.626 -3.014  15.866  1.00 24.33  ?  134 LYS C CG   1 
ATOM   8991  C  CD   . LYS C  1 134 ? -43.067 -4.357  15.406  1.00 21.17  ?  134 LYS C CD   1 
ATOM   8992  C  CE   . LYS C  1 134 ? -43.482 -4.410  13.896  1.00 20.70  ?  134 LYS C CE   1 
ATOM   8993  N  NZ   . LYS C  1 134 ? -44.099 -5.728  13.621  1.00 17.72  1  134 LYS C NZ   1 
ATOM   8994  H  H    . LYS C  1 134 ? -43.763 -1.741  18.220  1.00 20.42  ?  134 LYS C H    1 
ATOM   8995  H  HA   . LYS C  1 134 ? -43.280 -4.385  18.123  1.00 20.16  ?  134 LYS C HA   1 
ATOM   8996  H  HB2  . LYS C  1 134 ? -41.530 -2.291  17.402  1.00 23.86  ?  134 LYS C HB2  1 
ATOM   8997  H  HB3  . LYS C  1 134 ? -41.269 -3.832  17.119  1.00 23.86  ?  134 LYS C HB3  1 
ATOM   8998  H  HG2  . LYS C  1 134 ? -43.406 -2.443  15.951  1.00 29.19  ?  134 LYS C HG2  1 
ATOM   8999  H  HG3  . LYS C  1 134 ? -42.005 -2.651  15.215  1.00 29.19  ?  134 LYS C HG3  1 
ATOM   9000  H  HD2  . LYS C  1 134 ? -42.339 -4.985  15.535  1.00 25.41  ?  134 LYS C HD2  1 
ATOM   9001  H  HD3  . LYS C  1 134 ? -43.834 -4.631  15.933  1.00 25.41  ?  134 LYS C HD3  1 
ATOM   9002  H  HE2  . LYS C  1 134 ? -44.132 -3.715  13.708  1.00 24.84  ?  134 LYS C HE2  1 
ATOM   9003  H  HE3  . LYS C  1 134 ? -42.697 -4.309  13.335  1.00 24.84  ?  134 LYS C HE3  1 
ATOM   9004  H  HZ1  . LYS C  1 134 ? -43.516 -6.378  13.795  1.00 21.26  ?  134 LYS C HZ1  1 
ATOM   9005  H  HZ2  . LYS C  1 134 ? -44.818 -5.839  14.133  1.00 21.26  ?  134 LYS C HZ2  1 
ATOM   9006  H  HZ3  . LYS C  1 134 ? -44.342 -5.777  12.767  1.00 21.26  ?  134 LYS C HZ3  1 
ATOM   9007  N  N    . THR C  1 135 ? -42.623 -3.182  20.764  1.00 18.47  ?  135 THR C N    1 
ATOM   9008  C  CA   . THR C  1 135 ? -41.903 -3.239  22.023  1.00 15.73  ?  135 THR C CA   1 
ATOM   9009  C  C    . THR C  1 135 ? -42.536 -4.234  22.986  1.00 17.63  ?  135 THR C C    1 
ATOM   9010  O  O    . THR C  1 135 ? -43.753 -4.453  22.974  1.00 17.15  ?  135 THR C O    1 
ATOM   9011  C  CB   . THR C  1 135 ? -41.883 -1.864  22.690  1.00 19.99  ?  135 THR C CB   1 
ATOM   9012  O  OG1  . THR C  1 135 ? -43.219 -1.487  23.049  1.00 20.20  ?  135 THR C OG1  1 
ATOM   9013  C  CG2  . THR C  1 135 ? -41.292 -0.821  21.769  1.00 22.72  ?  135 THR C CG2  1 
ATOM   9014  H  H    . THR C  1 135 ? -43.397 -2.813  20.824  1.00 22.16  ?  135 THR C H    1 
ATOM   9015  H  HA   . THR C  1 135 ? -40.987 -3.513  21.858  1.00 18.88  ?  135 THR C HA   1 
ATOM   9016  H  HB   . THR C  1 135 ? -41.337 -1.905  23.491  1.00 23.99  ?  135 THR C HB   1 
ATOM   9017  H  HG1  . THR C  1 135 ? -43.215 -0.732  23.417  1.00 24.24  ?  135 THR C HG1  1 
ATOM   9018  H  HG21 . THR C  1 135 ? -41.287 0.044   22.208  1.00 27.26  ?  135 THR C HG21 1 
ATOM   9019  H  HG22 . THR C  1 135 ? -40.381 -1.062  21.537  1.00 27.26  ?  135 THR C HG22 1 
ATOM   9020  H  HG23 . THR C  1 135 ? -41.818 -0.759  20.957  1.00 27.26  ?  135 THR C HG23 1 
ATOM   9021  N  N    . GLU C  1 136 ? -41.702 -4.779  23.873  1.00 17.06  ?  136 GLU C N    1 
ATOM   9022  C  CA   . GLU C  1 136 ? -42.215 -5.645  24.936  1.00 15.02  ?  136 GLU C CA   1 
ATOM   9023  C  C    . GLU C  1 136 ? -43.163 -4.874  25.841  1.00 16.98  ?  136 GLU C C    1 
ATOM   9024  O  O    . GLU C  1 136 ? -44.186 -5.425  26.278  1.00 17.99  ?  136 GLU C O    1 
ATOM   9025  C  CB   . GLU C  1 136 ? -41.054 -6.233  25.748  1.00 17.10  ?  136 GLU C CB   1 
ATOM   9026  C  CG   . GLU C  1 136 ? -40.308 -7.291  24.959  1.00 16.50  ?  136 GLU C CG   1 
ATOM   9027  C  CD   . GLU C  1 136 ? -39.162 -7.957  25.693  1.00 19.18  ?  136 GLU C CD   1 
ATOM   9028  O  OE1  . GLU C  1 136 ? -38.582 -7.368  26.625  1.00 19.99  ?  136 GLU C OE1  1 
ATOM   9029  O  OE2  . GLU C  1 136 ? -38.839 -9.109  25.287  1.00 21.58  -1 136 GLU C OE2  1 
ATOM   9030  H  H    . GLU C  1 136 ? -40.849 -4.666  23.883  1.00 20.47  ?  136 GLU C H    1 
ATOM   9031  H  HA   . GLU C  1 136 ? -42.708 -6.380  24.538  1.00 18.02  ?  136 GLU C HA   1 
ATOM   9032  H  HB2  . GLU C  1 136 ? -40.430 -5.526  25.975  1.00 20.52  ?  136 GLU C HB2  1 
ATOM   9033  H  HB3  . GLU C  1 136 ? -41.402 -6.645  26.555  1.00 20.52  ?  136 GLU C HB3  1 
ATOM   9034  H  HG2  . GLU C  1 136 ? -40.935 -7.986  24.707  1.00 19.81  ?  136 GLU C HG2  1 
ATOM   9035  H  HG3  . GLU C  1 136 ? -39.942 -6.879  24.161  1.00 19.81  ?  136 GLU C HG3  1 
ATOM   9036  N  N    . ALA C  1 137 ? -42.823 -3.620  26.171  1.00 16.34  ?  137 ALA C N    1 
ATOM   9037  C  CA   . ALA C  1 137 ? -43.637 -2.836  27.092  1.00 16.15  ?  137 ALA C CA   1 
ATOM   9038  C  C    . ALA C  1 137 ? -45.060 -2.674  26.561  1.00 18.42  ?  137 ALA C C    1 
ATOM   9039  O  O    . ALA C  1 137 ? -46.030 -2.808  27.314  1.00 17.49  ?  137 ALA C O    1 
ATOM   9040  C  CB   . ALA C  1 137 ? -43.022 -1.456  27.346  1.00 18.85  ?  137 ALA C CB   1 
ATOM   9041  H  H    . ALA C  1 137 ? -42.129 -3.209  25.874  1.00 19.61  ?  137 ALA C H    1 
ATOM   9042  H  HA   . ALA C  1 137 ? -43.687 -3.301  27.942  1.00 19.38  ?  137 ALA C HA   1 
ATOM   9043  H  HB1  . ALA C  1 137 ? -43.590 -0.966  27.961  1.00 22.62  ?  137 ALA C HB1  1 
ATOM   9044  H  HB2  . ALA C  1 137 ? -42.139 -1.570  27.730  1.00 22.62  ?  137 ALA C HB2  1 
ATOM   9045  H  HB3  . ALA C  1 137 ? -42.957 -0.980  26.504  1.00 22.62  ?  137 ALA C HB3  1 
ATOM   9046  N  N    . ALA C  1 138 ? -45.213 -2.444  25.261  1.00 15.60  ?  138 ALA C N    1 
ATOM   9047  C  CA   . ALA C  1 138 ? -46.555 -2.261  24.702  1.00 17.83  ?  138 ALA C CA   1 
ATOM   9048  C  C    . ALA C  1 138 ? -47.312 -3.573  24.655  1.00 16.21  ?  138 ALA C C    1 
ATOM   9049  O  O    . ALA C  1 138 ? -48.523 -3.607  24.889  1.00 17.08  ?  138 ALA C O    1 
ATOM   9050  C  CB   . ALA C  1 138 ? -46.477 -1.679  23.296  1.00 19.11  ?  138 ALA C CB   1 
ATOM   9051  H  H    . ALA C  1 138 ? -44.573 -2.390  24.689  1.00 18.72  ?  138 ALA C H    1 
ATOM   9052  H  HA   . ALA C  1 138 ? -47.053 -1.643  25.259  1.00 21.40  ?  138 ALA C HA   1 
ATOM   9053  H  HB1  . ALA C  1 138 ? -47.376 -1.569  22.950  1.00 22.93  ?  138 ALA C HB1  1 
ATOM   9054  H  HB2  . ALA C  1 138 ? -46.029 -0.820  23.335  1.00 22.93  ?  138 ALA C HB2  1 
ATOM   9055  H  HB3  . ALA C  1 138 ? -45.977 -2.288  22.730  1.00 22.93  ?  138 ALA C HB3  1 
ATOM   9056  N  N    . LYS C  1 139 ? -46.612 -4.656  24.324  1.00 17.34  ?  139 LYS C N    1 
ATOM   9057  C  CA   . LYS C  1 139 ? -47.245 -5.961  24.253  1.00 15.40  ?  139 LYS C CA   1 
ATOM   9058  C  C    . LYS C  1 139 ? -47.689 -6.441  25.633  1.00 16.57  ?  139 LYS C C    1 
ATOM   9059  O  O    . LYS C  1 139 ? -48.750 -7.052  25.761  1.00 16.89  ?  139 LYS C O    1 
ATOM   9060  C  CB   . LYS C  1 139 ? -46.294 -6.951  23.579  1.00 15.14  ?  139 LYS C CB   1 
ATOM   9061  C  CG   . LYS C  1 139 ? -46.067 -6.645  22.102  1.00 17.52  ?  139 LYS C CG   1 
ATOM   9062  C  CD   . LYS C  1 139 ? -44.892 -7.442  21.543  1.00 16.20  ?  139 LYS C CD   1 
ATOM   9063  C  CE   . LYS C  1 139 ? -44.524 -6.973  20.128  1.00 16.37  ?  139 LYS C CE   1 
ATOM   9064  N  NZ   . LYS C  1 139 ? -45.669 -6.993  19.195  1.00 17.31  1  139 LYS C NZ   1 
ATOM   9065  H  H    . LYS C  1 139 ? -45.772 -4.658  24.137  1.00 20.80  ?  139 LYS C H    1 
ATOM   9066  H  HA   . LYS C  1 139 ? -48.038 -5.891  23.698  1.00 18.48  ?  139 LYS C HA   1 
ATOM   9067  H  HB2  . LYS C  1 139 ? -45.434 -6.918  24.027  1.00 18.17  ?  139 LYS C HB2  1 
ATOM   9068  H  HB3  . LYS C  1 139 ? -46.668 -7.844  23.646  1.00 18.17  ?  139 LYS C HB3  1 
ATOM   9069  H  HG2  . LYS C  1 139 ? -46.862 -6.883  21.599  1.00 21.02  ?  139 LYS C HG2  1 
ATOM   9070  H  HG3  . LYS C  1 139 ? -45.873 -5.701  21.996  1.00 21.02  ?  139 LYS C HG3  1 
ATOM   9071  H  HD2  . LYS C  1 139 ? -44.119 -7.318  22.117  1.00 19.44  ?  139 LYS C HD2  1 
ATOM   9072  H  HD3  . LYS C  1 139 ? -45.132 -8.381  21.500  1.00 19.44  ?  139 LYS C HD3  1 
ATOM   9073  H  HE2  . LYS C  1 139 ? -44.192 -6.062  20.174  1.00 19.64  ?  139 LYS C HE2  1 
ATOM   9074  H  HE3  . LYS C  1 139 ? -43.837 -7.557  19.771  1.00 19.64  ?  139 LYS C HE3  1 
ATOM   9075  H  HZ1  . LYS C  1 139 ? -46.314 -6.457  19.493  1.00 20.77  ?  139 LYS C HZ1  1 
ATOM   9076  H  HZ2  . LYS C  1 139 ? -45.410 -6.715  18.390  1.00 20.77  ?  139 LYS C HZ2  1 
ATOM   9077  H  HZ3  . LYS C  1 139 ? -45.989 -7.821  19.125  1.00 20.77  ?  139 LYS C HZ3  1 
ATOM   9078  N  N    . ILE C  1 140 ? -46.920 -6.141  26.679  1.00 15.87  ?  140 ILE C N    1 
ATOM   9079  C  CA   . ILE C  1 140 ? -47.362 -6.487  28.035  1.00 16.51  ?  140 ILE C CA   1 
ATOM   9080  C  C    . ILE C  1 140 ? -48.639 -5.729  28.391  1.00 17.75  ?  140 ILE C C    1 
ATOM   9081  O  O    . ILE C  1 140 ? -49.581 -6.301  28.952  1.00 18.25  ?  140 ILE C O    1 
ATOM   9082  C  CB   . ILE C  1 140 ? -46.241 -6.221  29.048  1.00 16.18  ?  140 ILE C CB   1 
ATOM   9083  C  CG1  . ILE C  1 140 ? -45.062 -7.170  28.815  1.00 16.70  ?  140 ILE C CG1  1 
ATOM   9084  C  CG2  . ILE C  1 140 ? -46.777 -6.327  30.506  1.00 16.92  ?  140 ILE C CG2  1 
ATOM   9085  C  CD1  . ILE C  1 140 ? -43.805 -6.719  29.501  1.00 19.92  ?  140 ILE C CD1  1 
ATOM   9086  H  H    . ILE C  1 140 ? -46.157 -5.747  26.636  1.00 19.05  ?  140 ILE C H    1 
ATOM   9087  H  HA   . ILE C  1 140 ? -47.566 -7.435  28.063  1.00 19.81  ?  140 ILE C HA   1 
ATOM   9088  H  HB   . ILE C  1 140 ? -45.925 -5.314  28.912  1.00 19.42  ?  140 ILE C HB   1 
ATOM   9089  H  HG12 . ILE C  1 140 ? -45.291 -8.048  29.157  1.00 20.04  ?  140 ILE C HG12 1 
ATOM   9090  H  HG13 . ILE C  1 140 ? -44.882 -7.221  27.863  1.00 20.04  ?  140 ILE C HG13 1 
ATOM   9091  H  HG21 . ILE C  1 140 ? -46.049 -6.155  31.123  1.00 20.30  ?  140 ILE C HG21 1 
ATOM   9092  H  HG22 . ILE C  1 140 ? -47.480 -5.671  30.631  1.00 20.30  ?  140 ILE C HG22 1 
ATOM   9093  H  HG23 . ILE C  1 140 ? -47.128 -7.220  30.648  1.00 20.30  ?  140 ILE C HG23 1 
ATOM   9094  H  HD11 . ILE C  1 140 ? -43.099 -7.358  29.317  1.00 23.90  ?  140 ILE C HD11 1 
ATOM   9095  H  HD12 . ILE C  1 140 ? -43.558 -5.845  29.163  1.00 23.90  ?  140 ILE C HD12 1 
ATOM   9096  H  HD13 . ILE C  1 140 ? -43.967 -6.672  30.456  1.00 23.90  ?  140 ILE C HD13 1 
ATOM   9097  N  N    . LEU C  1 141 ? -48.679 -4.431  28.089  1.00 16.97  ?  141 LEU C N    1 
ATOM   9098  C  CA   . LEU C  1 141 ? -49.882 -3.631  28.320  1.00 16.55  ?  141 LEU C CA   1 
ATOM   9099  C  C    . LEU C  1 141 ? -51.102 -4.228  27.611  1.00 17.28  ?  141 LEU C C    1 
ATOM   9100  O  O    . LEU C  1 141 ? -52.185 -4.342  28.206  1.00 17.67  ?  141 LEU C O    1 
ATOM   9101  C  CB   . LEU C  1 141 ? -49.632 -2.194  27.847  1.00 16.87  ?  141 LEU C CB   1 
ATOM   9102  C  CG   . LEU C  1 141 ? -50.845 -1.269  27.820  1.00 18.35  ?  141 LEU C CG   1 
ATOM   9103  C  CD1  . LEU C  1 141 ? -51.495 -1.140  29.189  1.00 20.26  ?  141 LEU C CD1  1 
ATOM   9104  C  CD2  . LEU C  1 141 ? -50.386 0.063   27.322  1.00 25.00  ?  141 LEU C CD2  1 
ATOM   9105  H  H    . LEU C  1 141 ? -48.023 -3.990  27.750  1.00 20.37  ?  141 LEU C H    1 
ATOM   9106  H  HA   . LEU C  1 141 ? -50.070 -3.607  29.271  1.00 19.87  ?  141 LEU C HA   1 
ATOM   9107  H  HB2  . LEU C  1 141 ? -48.975 -1.790  28.436  1.00 20.24  ?  141 LEU C HB2  1 
ATOM   9108  H  HB3  . LEU C  1 141 ? -49.276 -2.228  26.945  1.00 20.24  ?  141 LEU C HB3  1 
ATOM   9109  H  HG   . LEU C  1 141 ? -51.504 -1.618  27.200  1.00 22.02  ?  141 LEU C HG   1 
ATOM   9110  H  HD11 . LEU C  1 141 ? -52.258 -0.545  29.121  1.00 24.31  ?  141 LEU C HD11 1 
ATOM   9111  H  HD12 . LEU C  1 141 ? -51.784 -2.017  29.485  1.00 24.31  ?  141 LEU C HD12 1 
ATOM   9112  H  HD13 . LEU C  1 141 ? -50.847 -0.777  29.813  1.00 24.31  ?  141 LEU C HD13 1 
ATOM   9113  H  HD21 . LEU C  1 141 ? -51.144 0.668   27.297  1.00 30.00  ?  141 LEU C HD21 1 
ATOM   9114  H  HD22 . LEU C  1 141 ? -49.707 0.407   27.923  1.00 30.00  ?  141 LEU C HD22 1 
ATOM   9115  H  HD23 . LEU C  1 141 ? -50.018 -0.044  26.431  1.00 30.00  ?  141 LEU C HD23 1 
ATOM   9116  N  N    . ALA C  1 142 ? -50.937 -4.617  26.348  1.00 16.63  ?  142 ALA C N    1 
ATOM   9117  C  CA   . ALA C  1 142 ? -52.040 -5.212  25.594  1.00 15.70  ?  142 ALA C CA   1 
ATOM   9118  C  C    . ALA C  1 142 ? -52.547 -6.479  26.264  1.00 18.05  ?  142 ALA C C    1 
ATOM   9119  O  O    . ALA C  1 142 ? -53.759 -6.668  26.400  1.00 18.12  ?  142 ALA C O    1 
ATOM   9120  C  CB   . ALA C  1 142 ? -51.584 -5.494  24.165  1.00 17.83  ?  142 ALA C CB   1 
ATOM   9121  H  H    . ALA C  1 142 ? -50.202 -4.548  25.907  1.00 19.96  ?  142 ALA C H    1 
ATOM   9122  H  HA   . ALA C  1 142 ? -52.774 -4.579  25.555  1.00 18.84  ?  142 ALA C HA   1 
ATOM   9123  H  HB1  . ALA C  1 142 ? -52.320 -5.888  23.671  1.00 21.40  ?  142 ALA C HB1  1 
ATOM   9124  H  HB2  . ALA C  1 142 ? -51.316 -4.659  23.750  1.00 21.40  ?  142 ALA C HB2  1 
ATOM   9125  H  HB3  . ALA C  1 142 ? -50.834 -6.108  24.189  1.00 21.40  ?  142 ALA C HB3  1 
ATOM   9126  N  N    . ILE C  1 143 ? -51.638 -7.360  26.692  1.00 15.90  ?  143 ILE C N    1 
ATOM   9127  C  CA   . ILE C  1 143 ? -52.053 -8.603  27.341  1.00 17.64  ?  143 ILE C CA   1 
ATOM   9128  C  C    . ILE C  1 143 ? -52.758 -8.301  28.661  1.00 19.83  ?  143 ILE C C    1 
ATOM   9129  O  O    . ILE C  1 143 ? -53.767 -8.937  29.003  1.00 18.78  ?  143 ILE C O    1 
ATOM   9130  C  CB   . ILE C  1 143 ? -50.848 -9.542  27.526  1.00 19.67  ?  143 ILE C CB   1 
ATOM   9131  C  CG1  . ILE C  1 143 ? -50.392 -10.049 26.174  1.00 24.93  ?  143 ILE C CG1  1 
ATOM   9132  C  CG2  . ILE C  1 143 ? -51.206 -10.738 28.457  1.00 23.36  ?  143 ILE C CG2  1 
ATOM   9133  C  CD1  . ILE C  1 143 ? -48.975 -10.632 26.221  1.00 22.72  ?  143 ILE C CD1  1 
ATOM   9134  H  H    . ILE C  1 143 ? -50.787 -7.262  26.619  1.00 19.08  ?  143 ILE C H    1 
ATOM   9135  H  HA   . ILE C  1 143 ? -52.690 -9.054  26.766  1.00 21.17  ?  143 ILE C HA   1 
ATOM   9136  H  HB   . ILE C  1 143 ? -50.122 -9.040  27.930  1.00 23.61  ?  143 ILE C HB   1 
ATOM   9137  H  HG12 . ILE C  1 143 ? -50.996 -10.748 25.876  1.00 29.92  ?  143 ILE C HG12 1 
ATOM   9138  H  HG13 . ILE C  1 143 ? -50.394 -9.314  25.541  1.00 29.92  ?  143 ILE C HG13 1 
ATOM   9139  H  HG21 . ILE C  1 143 ? -50.427 -11.308 28.552  1.00 28.03  ?  143 ILE C HG21 1 
ATOM   9140  H  HG22 . ILE C  1 143 ? -51.472 -10.393 29.324  1.00 28.03  ?  143 ILE C HG22 1 
ATOM   9141  H  HG23 . ILE C  1 143 ? -51.937 -11.238 28.061  1.00 28.03  ?  143 ILE C HG23 1 
ATOM   9142  H  HD11 . ILE C  1 143 ? -48.731 -10.942 25.335  1.00 27.26  ?  143 ILE C HD11 1 
ATOM   9143  H  HD12 . ILE C  1 143 ? -48.359 -9.941  26.511  1.00 27.26  ?  143 ILE C HD12 1 
ATOM   9144  H  HD13 . ILE C  1 143 ? -48.960 -11.374 26.846  1.00 27.26  ?  143 ILE C HD13 1 
ATOM   9145  N  N    . LEU C  1 144 ? -52.235 -7.347  29.437  1.00 17.43  ?  144 LEU C N    1 
ATOM   9146  C  CA   . LEU C  1 144 ? -52.885 -6.954  30.688  1.00 17.76  ?  144 LEU C CA   1 
ATOM   9147  C  C    . LEU C  1 144 ? -54.318 -6.478  30.451  1.00 19.26  ?  144 LEU C C    1 
ATOM   9148  O  O    . LEU C  1 144 ? -55.256 -6.926  31.141  1.00 17.92  ?  144 LEU C O    1 
ATOM   9149  C  CB   . LEU C  1 144 ? -52.061 -5.868  31.378  1.00 19.09  ?  144 LEU C CB   1 
ATOM   9150  C  CG   . LEU C  1 144 ? -52.624 -5.340  32.679  1.00 18.81  ?  144 LEU C CG   1 
ATOM   9151  C  CD1  . LEU C  1 144 ? -52.792 -6.421  33.749  1.00 19.47  ?  144 LEU C CD1  1 
ATOM   9152  C  CD2  . LEU C  1 144 ? -51.721 -4.206  33.182  1.00 24.21  ?  144 LEU C CD2  1 
ATOM   9153  H  H    . LEU C  1 144 ? -51.511 -6.917  29.262  1.00 20.91  ?  144 LEU C H    1 
ATOM   9154  H  HA   . LEU C  1 144 ? -52.920 -7.723  31.279  1.00 21.32  ?  144 LEU C HA   1 
ATOM   9155  H  HB2  . LEU C  1 144 ? -51.181 -6.227  31.568  1.00 22.91  ?  144 LEU C HB2  1 
ATOM   9156  H  HB3  . LEU C  1 144 ? -51.979 -5.116  30.771  1.00 22.91  ?  144 LEU C HB3  1 
ATOM   9157  H  HG   . LEU C  1 144 ? -53.500 -4.961  32.505  1.00 22.58  ?  144 LEU C HG   1 
ATOM   9158  H  HD11 . LEU C  1 144 ? -53.156 -6.016  34.552  1.00 23.36  ?  144 LEU C HD11 1 
ATOM   9159  H  HD12 . LEU C  1 144 ? -53.400 -7.101  33.418  1.00 23.36  ?  144 LEU C HD12 1 
ATOM   9160  H  HD13 . LEU C  1 144 ? -51.926 -6.814  33.939  1.00 23.36  ?  144 LEU C HD13 1 
ATOM   9161  H  HD21 . LEU C  1 144 ? -52.078 -3.864  34.016  1.00 29.05  ?  144 LEU C HD21 1 
ATOM   9162  H  HD22 . LEU C  1 144 ? -50.826 -4.554  33.323  1.00 29.05  ?  144 LEU C HD22 1 
ATOM   9163  H  HD23 . LEU C  1 144 ? -51.700 -3.500  32.517  1.00 29.05  ?  144 LEU C HD23 1 
ATOM   9164  N  N    . ILE C  1 145 ? -54.503 -5.588  29.471  1.00 18.17  ?  145 ILE C N    1 
ATOM   9165  C  CA   . ILE C  1 145 ? -55.838 -5.084  29.139  1.00 19.14  ?  145 ILE C CA   1 
ATOM   9166  C  C    . ILE C  1 145 ? -56.763 -6.233  28.732  1.00 18.92  ?  145 ILE C C    1 
ATOM   9167  O  O    . ILE C  1 145 ? -57.922 -6.318  29.185  1.00 19.40  ?  145 ILE C O    1 
ATOM   9168  C  CB   . ILE C  1 145 ? -55.747 -3.997  28.047  1.00 19.55  ?  145 ILE C CB   1 
ATOM   9169  C  CG1  . ILE C  1 145 ? -55.207 -2.702  28.643  1.00 19.43  ?  145 ILE C CG1  1 
ATOM   9170  C  CG2  . ILE C  1 145 ? -57.132 -3.708  27.452  1.00 20.13  ?  145 ILE C CG2  1 
ATOM   9171  C  CD1  . ILE C  1 145 ? -54.780 -1.690  27.626  1.00 18.46  ?  145 ILE C CD1  1 
ATOM   9172  H  H    . ILE C  1 145 ? -53.873 -5.263  28.984  1.00 21.80  ?  145 ILE C H    1 
ATOM   9173  H  HA   . ILE C  1 145 ? -56.217 -4.670  29.931  1.00 22.97  ?  145 ILE C HA   1 
ATOM   9174  H  HB   . ILE C  1 145 ? -55.151 -4.299  27.343  1.00 23.47  ?  145 ILE C HB   1 
ATOM   9175  H  HG12 . ILE C  1 145 ? -55.901 -2.298  29.188  1.00 23.32  ?  145 ILE C HG12 1 
ATOM   9176  H  HG13 . ILE C  1 145 ? -54.437 -2.910  29.195  1.00 23.32  ?  145 ILE C HG13 1 
ATOM   9177  H  HG21 . ILE C  1 145 ? -57.046 -3.024  26.770  1.00 24.15  ?  145 ILE C HG21 1 
ATOM   9178  H  HG22 . ILE C  1 145 ? -57.484 -4.523  27.061  1.00 24.15  ?  145 ILE C HG22 1 
ATOM   9179  H  HG23 . ILE C  1 145 ? -57.720 -3.399  28.159  1.00 24.15  ?  145 ILE C HG23 1 
ATOM   9180  H  HD11 . ILE C  1 145 ? -54.451 -0.901  28.084  1.00 22.16  ?  145 ILE C HD11 1 
ATOM   9181  H  HD12 . ILE C  1 145 ? -54.076 -2.072  27.078  1.00 22.16  ?  145 ILE C HD12 1 
ATOM   9182  H  HD13 . ILE C  1 145 ? -55.541 -1.459  27.072  1.00 22.16  ?  145 ILE C HD13 1 
ATOM   9183  N  N    . LYS C  1 146 ? -56.280 -7.140  27.879  1.00 18.40  ?  146 LYS C N    1 
ATOM   9184  C  CA   . LYS C  1 146 ? -57.127 -8.228  27.411  1.00 17.69  ?  146 LYS C CA   1 
ATOM   9185  C  C    . LYS C  1 146 ? -57.502 -9.151  28.557  1.00 22.28  ?  146 LYS C C    1 
ATOM   9186  O  O    . LYS C  1 146 ? -58.625 -9.666  28.597  1.00 20.65  ?  146 LYS C O    1 
ATOM   9187  C  CB   . LYS C  1 146 ? -56.412 -8.978  26.286  1.00 19.17  ?  146 LYS C CB   1 
ATOM   9188  C  CG   . LYS C  1 146 ? -56.293 -8.133  25.024  1.00 19.23  ?  146 LYS C CG   1 
ATOM   9189  C  CD   . LYS C  1 146 ? -55.414 -8.749  23.972  1.00 23.96  ?  146 LYS C CD   1 
ATOM   9190  C  CE   . LYS C  1 146 ? -55.222 -7.824  22.719  1.00 25.70  ?  146 LYS C CE   1 
ATOM   9191  N  NZ   . LYS C  1 146 ? -56.549 -7.506  22.088  1.00 28.27  1  146 LYS C NZ   1 
ATOM   9192  H  H    . LYS C  1 146 ? -55.480 -7.144  27.564  1.00 22.08  ?  146 LYS C H    1 
ATOM   9193  H  HA   . LYS C  1 146 ? -57.946 -7.856  27.048  1.00 21.23  ?  146 LYS C HA   1 
ATOM   9194  H  HB2  . LYS C  1 146 ? -55.517 -9.212  26.579  1.00 23.00  ?  146 LYS C HB2  1 
ATOM   9195  H  HB3  . LYS C  1 146 ? -56.913 -9.779  26.068  1.00 23.00  ?  146 LYS C HB3  1 
ATOM   9196  H  HG2  . LYS C  1 146 ? -57.176 -8.014  24.642  1.00 23.07  ?  146 LYS C HG2  1 
ATOM   9197  H  HG3  . LYS C  1 146 ? -55.916 -7.270  25.258  1.00 23.07  ?  146 LYS C HG3  1 
ATOM   9198  H  HD2  . LYS C  1 146 ? -54.539 -8.922  24.353  1.00 28.75  ?  146 LYS C HD2  1 
ATOM   9199  H  HD3  . LYS C  1 146 ? -55.815 -9.580  23.672  1.00 28.75  ?  146 LYS C HD3  1 
ATOM   9200  H  HE2  . LYS C  1 146 ? -54.806 -6.991  22.993  1.00 30.84  ?  146 LYS C HE2  1 
ATOM   9201  H  HE3  . LYS C  1 146 ? -54.671 -8.278  22.063  1.00 30.84  ?  146 LYS C HE3  1 
ATOM   9202  H  HZ1  . LYS C  1 146 ? -56.430 -6.981  21.379  1.00 33.93  ?  146 LYS C HZ1  1 
ATOM   9203  H  HZ2  . LYS C  1 146 ? -56.950 -8.257  21.828  1.00 33.93  ?  146 LYS C HZ2  1 
ATOM   9204  H  HZ3  . LYS C  1 146 ? -57.072 -7.087  22.673  1.00 33.93  ?  146 LYS C HZ3  1 
ATOM   9205  N  N    . THR C  1 147 ? -56.587 -9.342  29.511  1.00 18.99  ?  147 THR C N    1 
ATOM   9206  C  CA   . THR C  1 147 ? -56.862 -10.143 30.699  1.00 21.50  ?  147 THR C CA   1 
ATOM   9207  C  C    . THR C  1 147 ? -57.921 -9.483  31.590  1.00 21.21  ?  147 THR C C    1 
ATOM   9208  O  O    . THR C  1 147 ? -58.892 -10.135 32.007  1.00 21.92  ?  147 THR C O    1 
ATOM   9209  C  CB   . THR C  1 147 ? -55.542 -10.347 31.451  1.00 17.71  ?  147 THR C CB   1 
ATOM   9210  O  OG1  . THR C  1 147 ? -54.664 -11.135 30.645  1.00 21.36  ?  147 THR C OG1  1 
ATOM   9211  C  CG2  . THR C  1 147 ? -55.783 -11.097 32.772  1.00 22.97  ?  147 THR C CG2  1 
ATOM   9212  H  H    . THR C  1 147 ? -55.793 -9.012  29.491  1.00 22.79  ?  147 THR C H    1 
ATOM   9213  H  HA   . THR C  1 147 ? -57.194 -11.013 30.428  1.00 25.80  ?  147 THR C HA   1 
ATOM   9214  H  HB   . THR C  1 147 ? -55.134 -9.489  31.645  1.00 21.25  ?  147 THR C HB   1 
ATOM   9215  H  HG1  . THR C  1 147 ? -54.514 -10.743 29.917  1.00 25.64  ?  147 THR C HG1  1 
ATOM   9216  H  HG21 . THR C  1 147 ? -54.943 -11.221 33.240  1.00 27.57  ?  147 THR C HG21 1 
ATOM   9217  H  HG22 . THR C  1 147 ? -56.387 -10.588 33.336  1.00 27.57  ?  147 THR C HG22 1 
ATOM   9218  H  HG23 . THR C  1 147 ? -56.176 -11.965 32.593  1.00 27.57  ?  147 THR C HG23 1 
ATOM   9219  N  N    . ILE C  1 148 ? -57.767 -8.176  31.853  1.00 19.92  ?  148 ILE C N    1 
ATOM   9220  C  CA   . ILE C  1 148 ? -58.711 -7.401  32.663  1.00 21.10  ?  148 ILE C CA   1 
ATOM   9221  C  C    . ILE C  1 148 ? -60.113 -7.450  32.055  1.00 25.19  ?  148 ILE C C    1 
ATOM   9222  O  O    . ILE C  1 148 ? -61.124 -7.554  32.775  1.00 23.95  ?  148 ILE C O    1 
ATOM   9223  C  CB   . ILE C  1 148 ? -58.208 -5.946  32.795  1.00 24.52  ?  148 ILE C CB   1 
ATOM   9224  C  CG1  . ILE C  1 148 ? -56.941 -5.897  33.664  1.00 27.34  ?  148 ILE C CG1  1 
ATOM   9225  C  CG2  . ILE C  1 148 ? -59.310 -5.038  33.351  1.00 34.57  ?  148 ILE C CG2  1 
ATOM   9226  C  CD1  . ILE C  1 148 ? -56.161 -4.592  33.463  1.00 32.49  ?  148 ILE C CD1  1 
ATOM   9227  H  H    . ILE C  1 148 ? -57.105 -7.709  31.565  1.00 23.90  ?  148 ILE C H    1 
ATOM   9228  H  HA   . ILE C  1 148 ? -58.756 -7.786  33.552  1.00 25.31  ?  148 ILE C HA   1 
ATOM   9229  H  HB   . ILE C  1 148 ? -57.976 -5.628  31.909  1.00 29.42  ?  148 ILE C HB   1 
ATOM   9230  H  HG12 . ILE C  1 148 ? -57.193 -5.959  34.599  1.00 32.81  ?  148 ILE C HG12 1 
ATOM   9231  H  HG13 . ILE C  1 148 ? -56.361 -6.637  33.425  1.00 32.81  ?  148 ILE C HG13 1 
ATOM   9232  H  HG21 . ILE C  1 148 ? -58.967 -4.133  33.423  1.00 41.48  ?  148 ILE C HG21 1 
ATOM   9233  H  HG22 . ILE C  1 148 ? -60.069 -5.057  32.746  1.00 41.48  ?  148 ILE C HG22 1 
ATOM   9234  H  HG23 . ILE C  1 148 ? -59.575 -5.362  34.226  1.00 41.48  ?  148 ILE C HG23 1 
ATOM   9235  H  HD11 . ILE C  1 148 ? -55.373 -4.606  34.029  1.00 38.99  ?  148 ILE C HD11 1 
ATOM   9236  H  HD12 . ILE C  1 148 ? -55.899 -4.522  32.532  1.00 38.99  ?  148 ILE C HD12 1 
ATOM   9237  H  HD13 . ILE C  1 148 ? -56.729 -3.844  33.705  1.00 38.99  ?  148 ILE C HD13 1 
ATOM   9238  N  N    . ASN C  1 149 ? -60.199 -7.383  30.728  1.00 21.69  ?  149 ASN C N    1 
ATOM   9239  C  CA   . ASN C  1 149 ? -61.484 -7.332  30.033  1.00 22.50  ?  149 ASN C CA   1 
ATOM   9240  C  C    . ASN C  1 149 ? -62.111 -8.704  29.843  1.00 28.51  ?  149 ASN C C    1 
ATOM   9241  O  O    . ASN C  1 149 ? -63.250 -8.780  29.355  1.00 26.93  ?  149 ASN C O    1 
ATOM   9242  C  CB   . ASN C  1 149 ? -61.301 -6.646  28.685  1.00 25.40  ?  149 ASN C CB   1 
ATOM   9243  C  CG   . ASN C  1 149 ? -61.284 -5.132  28.801  1.00 26.19  ?  149 ASN C CG   1 
ATOM   9244  O  OD1  . ASN C  1 149 ? -61.681 -4.565  29.819  1.00 29.63  ?  149 ASN C OD1  1 
ATOM   9245  N  ND2  . ASN C  1 149 ? -60.834 -4.468  27.745  1.00 25.01  ?  149 ASN C ND2  1 
ATOM   9246  H  H    . ASN C  1 149 ? -59.519 -7.366  30.202  1.00 26.02  ?  149 ASN C H    1 
ATOM   9247  H  HA   . ASN C  1 149 ? -62.100 -6.797  30.556  1.00 27.00  ?  149 ASN C HA   1 
ATOM   9248  H  HB2  . ASN C  1 149 ? -60.458 -6.927  28.298  1.00 30.48  ?  149 ASN C HB2  1 
ATOM   9249  H  HB3  . ASN C  1 149 ? -62.035 -6.894  28.101  1.00 30.48  ?  149 ASN C HB3  1 
ATOM   9250  H  HD21 . ASN C  1 149 ? -60.803 -3.608  27.758  1.00 30.02  ?  149 ASN C HD21 1 
ATOM   9251  H  HD22 . ASN C  1 149 ? -60.573 -4.897  27.046  1.00 30.02  ?  149 ASN C HD22 1 
ATOM   9252  N  N    . SER C  1 150 ? -61.408 -9.774  30.209  1.00 22.11  ?  150 SER C N    1 
ATOM   9253  C  CA   . SER C  1 150 ? -61.950 -11.123 30.095  1.00 22.79  ?  150 SER C CA   1 
ATOM   9254  C  C    . SER C  1 150 ? -63.027 -11.332 31.150  1.00 29.46  ?  150 SER C C    1 
ATOM   9255  O  O    . SER C  1 150 ? -62.901 -10.882 32.289  1.00 30.12  ?  150 SER C O    1 
ATOM   9256  C  CB   . SER C  1 150 ? -60.851 -12.165 30.279  1.00 23.42  ?  150 SER C CB   1 
ATOM   9257  O  OG   . SER C  1 150 ? -59.944 -12.105 29.207  1.00 24.48  ?  150 SER C OG   1 
ATOM   9258  H  H    . SER C  1 150 ? -60.610 -9.743  30.528  1.00 26.53  ?  150 SER C H    1 
ATOM   9259  H  HA   . SER C  1 150 ? -62.347 -11.243 29.219  1.00 27.34  ?  150 SER C HA   1 
ATOM   9260  H  HB2  . SER C  1 150 ? -60.378 -11.985 31.106  1.00 28.10  ?  150 SER C HB2  1 
ATOM   9261  H  HB3  . SER C  1 150 ? -61.251 -13.048 30.308  1.00 28.10  ?  150 SER C HB3  1 
ATOM   9262  H  HG   . SER C  1 150 ? -59.593 -11.343 29.170  1.00 29.37  ?  150 SER C HG   1 
ATOM   9263  N  N    . GLU C  1 151 ? -64.091 -12.024 30.780  1.00 24.64  ?  151 GLU C N    1 
ATOM   9264  C  CA   . GLU C  1 151 ? -65.182 -12.195 31.734  1.00 27.34  ?  151 GLU C CA   1 
ATOM   9265  C  C    . GLU C  1 151 ? -65.168 -13.537 32.459  1.00 40.65  ?  151 GLU C C    1 
ATOM   9266  O  O    . GLU C  1 151 ? -65.486 -13.587 33.650  1.00 62.34  ?  151 GLU C O    1 
ATOM   9267  C  CB   . GLU C  1 151 ? -66.532 -11.979 31.037  1.00 31.62  ?  151 GLU C CB   1 
ATOM   9268  C  CG   . GLU C  1 151 ? -66.874 -10.487 30.833  1.00 38.41  ?  151 GLU C CG   1 
ATOM   9269  C  CD   . GLU C  1 151 ? -67.066 -9.722  32.151  1.00 38.84  ?  151 GLU C CD   1 
ATOM   9270  O  OE1  . GLU C  1 151 ? -67.388 -10.362 33.183  1.00 43.45  ?  151 GLU C OE1  1 
ATOM   9271  O  OE2  . GLU C  1 151 ? -66.875 -8.484  32.155  1.00 54.74  -1 151 GLU C OE2  1 
ATOM   9272  H  H    . GLU C  1 151 ? -64.209 -12.393 30.012  1.00 29.56  ?  151 GLU C H    1 
ATOM   9273  H  HA   . GLU C  1 151 ? -65.098 -11.506 32.411  1.00 32.81  ?  151 GLU C HA   1 
ATOM   9274  H  HB2  . GLU C  1 151 ? -66.508 -12.403 30.165  1.00 37.94  ?  151 GLU C HB2  1 
ATOM   9275  H  HB3  . GLU C  1 151 ? -67.233 -12.375 31.579  1.00 37.94  ?  151 GLU C HB3  1 
ATOM   9276  H  HG2  . GLU C  1 151 ? -66.151 -10.063 30.344  1.00 46.10  ?  151 GLU C HG2  1 
ATOM   9277  H  HG3  . GLU C  1 151 ? -67.699 -10.421 30.327  1.00 46.10  ?  151 GLU C HG3  1 
ATOM   9278  N  N    . GLU C  1 152 ? -64.799 -14.617 31.794  1.00 26.42  ?  152 GLU C N    1 
ATOM   9279  C  CA   . GLU C  1 152 ? -64.830 -15.959 32.350  1.00 29.36  ?  152 GLU C CA   1 
ATOM   9280  C  C    . GLU C  1 152 ? -63.413 -16.523 32.357  1.00 25.96  ?  152 GLU C C    1 
ATOM   9281  O  O    . GLU C  1 152 ? -62.534 -16.037 31.637  1.00 24.08  ?  152 GLU C O    1 
ATOM   9282  C  CB   . GLU C  1 152 ? -65.768 -16.885 31.547  1.00 30.34  ?  152 GLU C CB   1 
ATOM   9283  C  CG   . GLU C  1 152 ? -67.223 -16.419 31.504  1.00 43.83  ?  152 GLU C CG   1 
ATOM   9284  C  CD   . GLU C  1 152 ? -67.812 -16.185 32.891  1.00 53.57  ?  152 GLU C CD   1 
ATOM   9285  O  OE1  . GLU C  1 152 ? -67.375 -16.851 33.862  1.00 60.65  ?  152 GLU C OE1  1 
ATOM   9286  O  OE2  . GLU C  1 152 ? -68.711 -15.321 33.013  1.00 62.70  -1 152 GLU C OE2  1 
ATOM   9287  H  H    . GLU C  1 152 ? -64.514 -14.596 30.982  1.00 31.70  ?  152 GLU C H    1 
ATOM   9288  H  HA   . GLU C  1 152 ? -65.148 -15.921 33.266  1.00 35.23  ?  152 GLU C HA   1 
ATOM   9289  H  HB2  . GLU C  1 152 ? -65.448 -16.936 30.633  1.00 36.41  ?  152 GLU C HB2  1 
ATOM   9290  H  HB3  . GLU C  1 152 ? -65.753 -17.768 31.948  1.00 36.41  ?  152 GLU C HB3  1 
ATOM   9291  H  HG2  . GLU C  1 152 ? -67.273 -15.584 31.013  1.00 52.60  ?  152 GLU C HG2  1 
ATOM   9292  H  HG3  . GLU C  1 152 ? -67.759 -17.096 31.061  1.00 52.60  ?  152 GLU C HG3  1 
ATOM   9293  N  N    . ASN C  1 153 ? -63.201 -17.579 33.155  1.00 24.42  ?  153 ASN C N    1 
ATOM   9294  C  CA   . ASN C  1 153 ? -61.848 -18.127 33.309  1.00 25.37  ?  153 ASN C CA   1 
ATOM   9295  C  C    . ASN C  1 153 ? -61.238 -18.584 31.986  1.00 23.07  ?  153 ASN C C    1 
ATOM   9296  O  O    . ASN C  1 153 ? -60.034 -18.432 31.778  1.00 20.56  ?  153 ASN C O    1 
ATOM   9297  C  CB   . ASN C  1 153 ? -61.849 -19.301 34.286  1.00 27.76  ?  153 ASN C CB   1 
ATOM   9298  C  CG   . ASN C  1 153 ? -61.832 -18.868 35.723  1.00 27.38  ?  153 ASN C CG   1 
ATOM   9299  O  OD1  . ASN C  1 153 ? -61.800 -17.682 36.040  1.00 33.75  ?  153 ASN C OD1  1 
ATOM   9300  N  ND2  . ASN C  1 153 ? -61.823 -19.846 36.613  1.00 40.89  ?  153 ASN C ND2  1 
ATOM   9301  H  H    . ASN C  1 153 ? -63.809 -17.986 33.608  1.00 29.31  ?  153 ASN C H    1 
ATOM   9302  H  HA   . ASN C  1 153 ? -61.273 -17.437 33.677  1.00 30.45  ?  153 ASN C HA   1 
ATOM   9303  H  HB2  . ASN C  1 153 ? -62.649 -19.830 34.142  1.00 33.31  ?  153 ASN C HB2  1 
ATOM   9304  H  HB3  . ASN C  1 153 ? -61.061 -19.844 34.127  1.00 33.31  ?  153 ASN C HB3  1 
ATOM   9305  H  HD21 . ASN C  1 153 ? -61.813 -19.663 37.454  1.00 49.07  ?  153 ASN C HD21 1 
ATOM   9306  H  HD22 . ASN C  1 153 ? -61.827 -20.666 36.352  1.00 49.07  ?  153 ASN C HD22 1 
ATOM   9307  N  N    . TYR C  1 154 ? -62.016 -19.212 31.101  1.00 22.43  ?  154 TYR C N    1 
ATOM   9308  C  CA   . TYR C  1 154 ? -61.405 -19.770 29.898  1.00 19.73  ?  154 TYR C CA   1 
ATOM   9309  C  C    . TYR C  1 154 ? -60.852 -18.662 29.007  1.00 22.20  ?  154 TYR C C    1 
ATOM   9310  O  O    . TYR C  1 154 ? -59.739 -18.775 28.477  1.00 19.44  ?  154 TYR C O    1 
ATOM   9311  C  CB   . TYR C  1 154 ? -62.417 -20.640 29.145  1.00 21.11  ?  154 TYR C CB   1 
ATOM   9312  C  CG   . TYR C  1 154 ? -61.845 -21.351 27.958  1.00 20.22  ?  154 TYR C CG   1 
ATOM   9313  C  CD1  . TYR C  1 154 ? -61.968 -20.805 26.684  1.00 22.42  ?  154 TYR C CD1  1 
ATOM   9314  C  CD2  . TYR C  1 154 ? -61.169 -22.556 28.095  1.00 21.29  ?  154 TYR C CD2  1 
ATOM   9315  C  CE1  . TYR C  1 154 ? -61.429 -21.441 25.581  1.00 22.27  ?  154 TYR C CE1  1 
ATOM   9316  C  CE2  . TYR C  1 154 ? -60.639 -23.202 26.984  1.00 21.80  ?  154 TYR C CE2  1 
ATOM   9317  C  CZ   . TYR C  1 154 ? -60.769 -22.639 25.741  1.00 20.48  ?  154 TYR C CZ   1 
ATOM   9318  O  OH   . TYR C  1 154 ? -60.272 -23.280 24.634  1.00 22.61  ?  154 TYR C OH   1 
ATOM   9319  H  H    . TYR C  1 154 ? -62.866 -19.324 31.170  1.00 26.92  ?  154 TYR C H    1 
ATOM   9320  H  HA   . TYR C  1 154 ? -60.663 -20.338 30.159  1.00 23.67  ?  154 TYR C HA   1 
ATOM   9321  H  HB2  . TYR C  1 154 ? -62.764 -21.311 29.753  1.00 25.33  ?  154 TYR C HB2  1 
ATOM   9322  H  HB3  . TYR C  1 154 ? -63.141 -20.075 28.832  1.00 25.33  ?  154 TYR C HB3  1 
ATOM   9323  H  HD1  . TYR C  1 154 ? -62.410 -19.994 26.574  1.00 26.90  ?  154 TYR C HD1  1 
ATOM   9324  H  HD2  . TYR C  1 154 ? -61.076 -22.938 28.937  1.00 25.55  ?  154 TYR C HD2  1 
ATOM   9325  H  HE1  . TYR C  1 154 ? -61.527 -21.071 24.734  1.00 26.73  ?  154 TYR C HE1  1 
ATOM   9326  H  HE2  . TYR C  1 154 ? -60.194 -24.013 27.084  1.00 26.16  ?  154 TYR C HE2  1 
ATOM   9327  H  HH   . TYR C  1 154 ? -59.894 -23.995 24.862  1.00 27.13  ?  154 TYR C HH   1 
ATOM   9328  N  N    . GLU C  1 155 ? -61.602 -17.564 28.879  1.00 19.97  ?  155 GLU C N    1 
ATOM   9329  C  CA   . GLU C  1 155 ? -61.136 -16.410 28.130  1.00 21.58  ?  155 GLU C CA   1 
ATOM   9330  C  C    . GLU C  1 155 ? -59.911 -15.805 28.801  1.00 22.91  ?  155 GLU C C    1 
ATOM   9331  O  O    . GLU C  1 155 ? -58.928 -15.458 28.135  1.00 18.47  ?  155 GLU C O    1 
ATOM   9332  C  CB   . GLU C  1 155 ? -62.265 -15.373 28.021  1.00 26.35  ?  155 GLU C CB   1 
ATOM   9333  C  CG   . GLU C  1 155 ? -61.862 -14.156 27.232  1.00 27.42  ?  155 GLU C CG   1 
ATOM   9334  C  CD   . GLU C  1 155 ? -62.892 -13.026 27.194  1.00 30.76  ?  155 GLU C CD   1 
ATOM   9335  O  OE1  . GLU C  1 155 ? -63.903 -13.054 27.937  1.00 29.09  ?  155 GLU C OE1  1 
ATOM   9336  O  OE2  . GLU C  1 155 ? -62.650 -12.078 26.421  1.00 31.27  -1 155 GLU C OE2  1 
ATOM   9337  H  H    . GLU C  1 155 ? -62.386 -17.469 29.219  1.00 23.97  ?  155 GLU C H    1 
ATOM   9338  H  HA   . GLU C  1 155 ? -60.888 -16.686 27.234  1.00 25.89  ?  155 GLU C HA   1 
ATOM   9339  H  HB2  . GLU C  1 155 ? -63.026 -15.780 27.578  1.00 31.62  ?  155 GLU C HB2  1 
ATOM   9340  H  HB3  . GLU C  1 155 ? -62.515 -15.084 28.912  1.00 31.62  ?  155 GLU C HB3  1 
ATOM   9341  H  HG2  . GLU C  1 155 ? -61.048 -13.795 27.618  1.00 32.91  ?  155 GLU C HG2  1 
ATOM   9342  H  HG3  . GLU C  1 155 ? -61.693 -14.427 26.316  1.00 32.91  ?  155 GLU C HG3  1 
ATOM   9343  N  N    . LYS C  1 156 ? -59.956 -15.680 30.127  1.00 20.02  ?  156 LYS C N    1 
ATOM   9344  C  CA   . LYS C  1 156 ? -58.826 -15.116 30.844  1.00 20.01  ?  156 LYS C CA   1 
ATOM   9345  C  C    . LYS C  1 156 ? -57.581 -15.967 30.632  1.00 19.61  ?  156 LYS C C    1 
ATOM   9346  O  O    . LYS C  1 156 ? -56.493 -15.431 30.386  1.00 17.91  ?  156 LYS C O    1 
ATOM   9347  C  CB   . LYS C  1 156 ? -59.177 -14.983 32.329  1.00 21.24  ?  156 LYS C CB   1 
ATOM   9348  C  CG   . LYS C  1 156 ? -58.310 -14.038 33.074  1.00 24.30  ?  156 LYS C CG   1 
ATOM   9349  C  CD   . LYS C  1 156 ? -58.767 -13.822 34.542  1.00 33.38  ?  156 LYS C CD   1 
ATOM   9350  C  CE   . LYS C  1 156 ? -57.958 -12.675 35.207  1.00 38.28  ?  156 LYS C CE   1 
ATOM   9351  N  NZ   . LYS C  1 156 ? -58.279 -12.349 36.673  1.00 30.77  1  156 LYS C NZ   1 
ATOM   9352  H  H    . LYS C  1 156 ? -60.620 -15.911 30.623  1.00 24.03  ?  156 LYS C H    1 
ATOM   9353  H  HA   . LYS C  1 156 ? -58.644 -14.228 30.499  1.00 24.02  ?  156 LYS C HA   1 
ATOM   9354  H  HB2  . LYS C  1 156 ? -60.092 -14.668 32.405  1.00 25.49  ?  156 LYS C HB2  1 
ATOM   9355  H  HB3  . LYS C  1 156 ? -59.095 -15.854 32.748  1.00 25.49  ?  156 LYS C HB3  1 
ATOM   9356  H  HG2  . LYS C  1 156 ? -57.406 -14.388 33.091  1.00 29.16  ?  156 LYS C HG2  1 
ATOM   9357  H  HG3  . LYS C  1 156 ? -58.324 -13.178 32.627  1.00 29.16  ?  156 LYS C HG3  1 
ATOM   9358  H  HD2  . LYS C  1 156 ? -59.706 -13.581 34.555  1.00 40.05  ?  156 LYS C HD2  1 
ATOM   9359  H  HD3  . LYS C  1 156 ? -58.619 -14.635 35.049  1.00 40.05  ?  156 LYS C HD3  1 
ATOM   9360  H  HE2  . LYS C  1 156 ? -57.017 -12.908 35.166  1.00 45.94  ?  156 LYS C HE2  1 
ATOM   9361  H  HE3  . LYS C  1 156 ? -58.108 -11.865 34.695  1.00 45.94  ?  156 LYS C HE3  1 
ATOM   9362  H  HZ1  . LYS C  1 156 ? -59.132 -12.108 36.751  1.00 36.93  ?  156 LYS C HZ1  1 
ATOM   9363  H  HZ2  . LYS C  1 156 ? -58.132 -13.064 37.183  1.00 36.93  ?  156 LYS C HZ2  1 
ATOM   9364  H  HZ3  . LYS C  1 156 ? -57.762 -11.682 36.956  1.00 36.93  ?  156 LYS C HZ3  1 
ATOM   9365  N  N    . PHE C  1 157 ? -57.723 -17.296 30.710  1.00 20.01  ?  157 PHE C N    1 
ATOM   9366  C  CA   . PHE C  1 157 ? -56.604 -18.194 30.416  1.00 17.63  ?  157 PHE C CA   1 
ATOM   9367  C  C    . PHE C  1 157 ? -56.091 -18.009 28.987  1.00 19.29  ?  157 PHE C C    1 
ATOM   9368  O  O    . PHE C  1 157 ? -54.875 -17.946 28.754  1.00 17.30  ?  157 PHE C O    1 
ATOM   9369  C  CB   . PHE C  1 157 ? -57.014 -19.650 30.647  1.00 19.14  ?  157 PHE C CB   1 
ATOM   9370  C  CG   . PHE C  1 157 ? -55.944 -20.611 30.274  1.00 18.45  ?  157 PHE C CG   1 
ATOM   9371  C  CD1  . PHE C  1 157 ? -54.815 -20.732 31.071  1.00 20.35  ?  157 PHE C CD1  1 
ATOM   9372  C  CD2  . PHE C  1 157 ? -56.021 -21.366 29.117  1.00 18.40  ?  157 PHE C CD2  1 
ATOM   9373  C  CE1  . PHE C  1 157 ? -53.809 -21.588 30.729  1.00 19.19  ?  157 PHE C CE1  1 
ATOM   9374  C  CE2  . PHE C  1 157 ? -55.014 -22.243 28.788  1.00 17.99  ?  157 PHE C CE2  1 
ATOM   9375  C  CZ   . PHE C  1 157 ? -53.903 -22.341 29.596  1.00 19.96  ?  157 PHE C CZ   1 
ATOM   9376  H  H    . PHE C  1 157 ? -58.451 -17.698 30.930  1.00 24.01  ?  157 PHE C H    1 
ATOM   9377  H  HA   . PHE C  1 157 ? -55.874 -17.991 31.022  1.00 21.16  ?  157 PHE C HA   1 
ATOM   9378  H  HB2  . PHE C  1 157 ? -57.217 -19.776 31.588  1.00 22.97  ?  157 PHE C HB2  1 
ATOM   9379  H  HB3  . PHE C  1 157 ? -57.797 -19.848 30.109  1.00 22.97  ?  157 PHE C HB3  1 
ATOM   9380  H  HD1  . PHE C  1 157 ? -54.740 -20.220 31.845  1.00 24.42  ?  157 PHE C HD1  1 
ATOM   9381  H  HD2  . PHE C  1 157 ? -56.770 -21.298 28.571  1.00 22.08  ?  157 PHE C HD2  1 
ATOM   9382  H  HE1  . PHE C  1 157 ? -53.061 -21.667 31.276  1.00 23.03  ?  157 PHE C HE1  1 
ATOM   9383  H  HE2  . PHE C  1 157 ? -55.073 -22.751 28.011  1.00 21.58  ?  157 PHE C HE2  1 
ATOM   9384  H  HZ   . PHE C  1 157 ? -53.218 -22.930 29.372  1.00 23.95  ?  157 PHE C HZ   1 
ATOM   9385  N  N    . THR C  1 158 ? -57.001 -17.891 28.023  1.00 18.79  ?  158 THR C N    1 
ATOM   9386  C  CA   . THR C  1 158 ? -56.601 -17.697 26.634  1.00 16.28  ?  158 THR C CA   1 
ATOM   9387  C  C    . THR C  1 158 ? -55.778 -16.425 26.469  1.00 16.96  ?  158 THR C C    1 
ATOM   9388  O  O    . THR C  1 158 ? -54.749 -16.426 25.770  1.00 17.45  ?  158 THR C O    1 
ATOM   9389  C  CB   . THR C  1 158 ? -57.857 -17.650 25.746  1.00 19.19  ?  158 THR C CB   1 
ATOM   9390  O  OG1  . THR C  1 158 ? -58.553 -18.900 25.855  1.00 19.99  ?  158 THR C OG1  1 
ATOM   9391  C  CG2  . THR C  1 158 ? -57.516 -17.400 24.305  1.00 21.77  ?  158 THR C CG2  1 
ATOM   9392  H  H    . THR C  1 158 ? -57.851 -17.921 28.147  1.00 22.54  ?  158 THR C H    1 
ATOM   9393  H  HA   . THR C  1 158 ? -56.057 -18.449 26.350  1.00 19.53  ?  158 THR C HA   1 
ATOM   9394  H  HB   . THR C  1 158 ? -58.437 -16.934 26.049  1.00 23.03  ?  158 THR C HB   1 
ATOM   9395  H  HG1  . THR C  1 158 ? -58.779 -19.034 26.653  1.00 23.98  ?  158 THR C HG1  1 
ATOM   9396  H  HG21 . THR C  1 158 ? -58.327 -17.376 23.772  1.00 26.13  ?  158 THR C HG21 1 
ATOM   9397  H  HG22 . THR C  1 158 ? -57.055 -16.552 24.216  1.00 26.13  ?  158 THR C HG22 1 
ATOM   9398  H  HG23 . THR C  1 158 ? -56.942 -18.108 23.973  1.00 26.13  ?  158 THR C HG23 1 
ATOM   9399  N  N    . GLU C  1 159 ? -56.203 -15.340 27.100  1.00 16.27  ?  159 GLU C N    1 
ATOM   9400  C  CA   . GLU C  1 159 ? -55.482 -14.074 26.948  1.00 16.90  ?  159 GLU C CA   1 
ATOM   9401  C  C    . GLU C  1 159 ? -54.153 -14.091 27.718  1.00 18.31  ?  159 GLU C C    1 
ATOM   9402  O  O    . GLU C  1 159 ? -53.124 -13.647 27.195  1.00 18.51  ?  159 GLU C O    1 
ATOM   9403  C  CB   . GLU C  1 159 ? -56.355 -12.893 27.385  1.00 18.49  ?  159 GLU C CB   1 
ATOM   9404  C  CG   . GLU C  1 159 ? -57.614 -12.722 26.523  1.00 18.15  ?  159 GLU C CG   1 
ATOM   9405  C  CD   . GLU C  1 159 ? -57.341 -12.419 25.034  1.00 24.37  ?  159 GLU C CD   1 
ATOM   9406  O  OE1  . GLU C  1 159 ? -56.204 -12.128 24.629  1.00 22.38  ?  159 GLU C OE1  1 
ATOM   9407  O  OE2  . GLU C  1 159 ? -58.327 -12.461 24.253  1.00 30.95  -1 159 GLU C OE2  1 
ATOM   9408  H  H    . GLU C  1 159 ? -56.891 -15.304 27.614  1.00 19.52  ?  159 GLU C H    1 
ATOM   9409  H  HA   . GLU C  1 159 ? -55.273 -13.951 26.009  1.00 20.28  ?  159 GLU C HA   1 
ATOM   9410  H  HB2  . GLU C  1 159 ? -56.637 -13.033 28.303  1.00 22.19  ?  159 GLU C HB2  1 
ATOM   9411  H  HB3  . GLU C  1 159 ? -55.835 -12.077 27.320  1.00 22.19  ?  159 GLU C HB3  1 
ATOM   9412  H  HG2  . GLU C  1 159 ? -58.132 -13.541 26.566  1.00 21.78  ?  159 GLU C HG2  1 
ATOM   9413  H  HG3  . GLU C  1 159 ? -58.136 -11.987 26.881  1.00 21.78  ?  159 GLU C HG3  1 
ATOM   9414  N  N    . LEU C  1 160 ? -54.143 -14.628 28.938  1.00 17.33  ?  160 LEU C N    1 
ATOM   9415  C  CA   . LEU C  1 160 ? -52.883 -14.751 29.681  1.00 17.10  ?  160 LEU C CA   1 
ATOM   9416  C  C    . LEU C  1 160 ? -51.883 -15.652 28.960  1.00 16.10  ?  160 LEU C C    1 
ATOM   9417  O  O    . LEU C  1 160 ? -50.660 -15.493 29.104  1.00 17.07  ?  160 LEU C O    1 
ATOM   9418  C  CB   . LEU C  1 160 ? -53.165 -15.298 31.075  1.00 16.93  ?  160 LEU C CB   1 
ATOM   9419  C  CG   . LEU C  1 160 ? -53.782 -14.327 32.060  1.00 18.75  ?  160 LEU C CG   1 
ATOM   9420  C  CD1  . LEU C  1 160 ? -54.361 -15.033 33.273  1.00 21.39  ?  160 LEU C CD1  1 
ATOM   9421  C  CD2  . LEU C  1 160 ? -52.740 -13.289 32.485  1.00 20.25  ?  160 LEU C CD2  1 
ATOM   9422  H  H    . LEU C  1 160 ? -54.835 -14.924 29.353  1.00 20.80  ?  160 LEU C H    1 
ATOM   9423  H  HA   . LEU C  1 160 ? -52.484 -13.872 29.776  1.00 20.52  ?  160 LEU C HA   1 
ATOM   9424  H  HB2  . LEU C  1 160 ? -53.773 -16.049 30.991  1.00 20.31  ?  160 LEU C HB2  1 
ATOM   9425  H  HB3  . LEU C  1 160 ? -52.327 -15.603 31.457  1.00 20.31  ?  160 LEU C HB3  1 
ATOM   9426  H  HG   . LEU C  1 160 ? -54.506 -13.855 31.620  1.00 22.50  ?  160 LEU C HG   1 
ATOM   9427  H  HD11 . LEU C  1 160 ? -54.742 -14.371 33.870  1.00 25.67  ?  160 LEU C HD11 1 
ATOM   9428  H  HD12 . LEU C  1 160 ? -55.049 -15.650 32.979  1.00 25.67  ?  160 LEU C HD12 1 
ATOM   9429  H  HD13 . LEU C  1 160 ? -53.652 -15.517 33.724  1.00 25.67  ?  160 LEU C HD13 1 
ATOM   9430  H  HD21 . LEU C  1 160 ? -53.147 -12.674 33.115  1.00 24.30  ?  160 LEU C HD21 1 
ATOM   9431  H  HD22 . LEU C  1 160 ? -51.993 -13.745 32.903  1.00 24.30  ?  160 LEU C HD22 1 
ATOM   9432  H  HD23 . LEU C  1 160 ? -52.437 -12.807 31.700  1.00 24.30  ?  160 LEU C HD23 1 
ATOM   9433  N  N    . SER C  1 161 ? -52.371 -16.643 28.217  1.00 15.29  ?  161 SER C N    1 
ATOM   9434  C  CA   . SER C  1 161 ? -51.489 -17.530 27.472  1.00 15.51  ?  161 SER C CA   1 
ATOM   9435  C  C    . SER C  1 161 ? -50.620 -16.754 26.489  1.00 16.37  ?  161 SER C C    1 
ATOM   9436  O  O    . SER C  1 161 ? -49.530 -17.217 26.142  1.00 16.01  ?  161 SER C O    1 
ATOM   9437  C  CB   . SER C  1 161 ? -52.301 -18.583 26.711  1.00 17.54  ?  161 SER C CB   1 
ATOM   9438  O  OG   . SER C  1 161 ? -52.844 -19.580 27.589  1.00 18.48  ?  161 SER C OG   1 
ATOM   9439  H  H    . SER C  1 161 ? -53.208 -16.821 28.129  1.00 18.34  ?  161 SER C H    1 
ATOM   9440  H  HA   . SER C  1 161 ? -50.904 -17.991 28.093  1.00 18.62  ?  161 SER C HA   1 
ATOM   9441  H  HB2  . SER C  1 161 ? -53.031 -18.141 26.251  1.00 21.05  ?  161 SER C HB2  1 
ATOM   9442  H  HB3  . SER C  1 161 ? -51.721 -19.018 26.066  1.00 21.05  ?  161 SER C HB3  1 
ATOM   9443  H  HG   . SER C  1 161 ? -53.352 -19.220 28.153  1.00 22.18  ?  161 SER C HG   1 
ATOM   9444  N  N    . GLU C  1 162 ? -51.071 -15.566 26.061  1.00 15.52  ?  162 GLU C N    1 
ATOM   9445  C  CA   . GLU C  1 162 ? -50.265 -14.756 25.149  1.00 17.26  ?  162 GLU C CA   1 
ATOM   9446  C  C    . GLU C  1 162 ? -48.945 -14.340 25.791  1.00 16.89  ?  162 GLU C C    1 
ATOM   9447  O  O    . GLU C  1 162 ? -47.997 -13.998 25.070  1.00 16.34  ?  162 GLU C O    1 
ATOM   9448  C  CB   . GLU C  1 162 ? -51.049 -13.504 24.702  1.00 17.73  ?  162 GLU C CB   1 
ATOM   9449  C  CG   . GLU C  1 162 ? -52.251 -13.811 23.810  1.00 23.24  ?  162 GLU C CG   1 
ATOM   9450  C  CD   . GLU C  1 162 ? -51.855 -14.369 22.468  1.00 28.21  ?  162 GLU C CD   1 
ATOM   9451  O  OE1  . GLU C  1 162 ? -50.874 -13.863 21.856  1.00 28.62  ?  162 GLU C OE1  1 
ATOM   9452  O  OE2  . GLU C  1 162 ? -52.477 -15.375 22.066  1.00 35.55  -1 162 GLU C OE2  1 
ATOM   9453  H  H    . GLU C  1 162 ? -51.825 -15.216 26.281  1.00 18.62  ?  162 GLU C H    1 
ATOM   9454  H  HA   . GLU C  1 162 ? -50.061 -15.280 24.359  1.00 20.72  ?  162 GLU C HA   1 
ATOM   9455  H  HB2  . GLU C  1 162 ? -51.375 -13.042 25.490  1.00 21.28  ?  162 GLU C HB2  1 
ATOM   9456  H  HB3  . GLU C  1 162 ? -50.452 -12.923 24.204  1.00 21.28  ?  162 GLU C HB3  1 
ATOM   9457  H  HG2  . GLU C  1 162 ? -52.814 -14.465 24.252  1.00 27.89  ?  162 GLU C HG2  1 
ATOM   9458  H  HG3  . GLU C  1 162 ? -52.749 -12.992 23.659  1.00 27.89  ?  162 GLU C HG3  1 
ATOM   9459  N  N    . LEU C  1 163 ? -48.840 -14.409 27.131  1.00 17.00  ?  163 LEU C N    1 
ATOM   9460  C  CA   . LEU C  1 163 ? -47.548 -14.134 27.779  1.00 17.38  ?  163 LEU C CA   1 
ATOM   9461  C  C    . LEU C  1 163 ? -46.454 -15.068 27.277  1.00 16.47  ?  163 LEU C C    1 
ATOM   9462  O  O    . LEU C  1 163 ? -45.279 -14.689 27.246  1.00 16.95  ?  163 LEU C O    1 
ATOM   9463  C  CB   . LEU C  1 163 ? -47.691 -14.250 29.305  1.00 15.83  ?  163 LEU C CB   1 
ATOM   9464  C  CG   . LEU C  1 163 ? -48.521 -13.143 29.909  1.00 17.28  ?  163 LEU C CG   1 
ATOM   9465  C  CD1  . LEU C  1 163 ? -48.905 -13.511 31.353  1.00 18.53  ?  163 LEU C CD1  1 
ATOM   9466  C  CD2  . LEU C  1 163 ? -47.789 -11.774 29.877  1.00 23.46  ?  163 LEU C CD2  1 
ATOM   9467  H  H    . LEU C  1 163 ? -49.481 -14.607 27.669  1.00 20.40  ?  163 LEU C H    1 
ATOM   9468  H  HA   . LEU C  1 163 ? -47.281 -13.225 27.572  1.00 20.86  ?  163 LEU C HA   1 
ATOM   9469  H  HB2  . LEU C  1 163 ? -48.118 -15.094 29.517  1.00 18.99  ?  163 LEU C HB2  1 
ATOM   9470  H  HB3  . LEU C  1 163 ? -46.809 -14.216 29.706  1.00 18.99  ?  163 LEU C HB3  1 
ATOM   9471  H  HG   . LEU C  1 163 ? -49.340 -13.053 29.398  1.00 20.74  ?  163 LEU C HG   1 
ATOM   9472  H  HD11 . LEU C  1 163 ? -49.437 -12.793 31.730  1.00 22.24  ?  163 LEU C HD11 1 
ATOM   9473  H  HD12 . LEU C  1 163 ? -49.418 -14.334 31.342  1.00 22.24  ?  163 LEU C HD12 1 
ATOM   9474  H  HD13 . LEU C  1 163 ? -48.095 -13.632 31.873  1.00 22.24  ?  163 LEU C HD13 1 
ATOM   9475  H  HD21 . LEU C  1 163 ? -48.362 -11.101 30.275  1.00 28.16  ?  163 LEU C HD21 1 
ATOM   9476  H  HD22 . LEU C  1 163 ? -46.963 -11.847 30.380  1.00 28.16  ?  163 LEU C HD22 1 
ATOM   9477  H  HD23 . LEU C  1 163 ? -47.595 -11.542 28.955  1.00 28.16  ?  163 LEU C HD23 1 
ATOM   9478  N  N    . CYS C  1 164 ? -46.812 -16.301 26.887  1.00 15.78  ?  164 CYS C N    1 
ATOM   9479  C  CA   . CYS C  1 164 ? -45.838 -17.256 26.389  1.00 16.89  ?  164 CYS C CA   1 
ATOM   9480  C  C    . CYS C  1 164 ? -45.186 -16.767 25.103  1.00 17.56  ?  164 CYS C C    1 
ATOM   9481  O  O    . CYS C  1 164 ? -44.056 -17.152 24.827  1.00 16.02  ?  164 CYS C O    1 
ATOM   9482  C  CB   . CYS C  1 164 ? -46.491 -18.614 26.176  1.00 16.80  ?  164 CYS C CB   1 
ATOM   9483  S  SG   . CYS C  1 164 ? -47.200 -19.299 27.715  1.00 18.56  ?  164 CYS C SG   1 
ATOM   9484  H  H    . CYS C  1 164 ? -47.618 -16.600 26.905  1.00 18.93  ?  164 CYS C H    1 
ATOM   9485  H  HA   . CYS C  1 164 ? -45.139 -17.364 27.052  1.00 20.27  ?  164 CYS C HA   1 
ATOM   9486  H  HB2  . CYS C  1 164 ? -47.207 -18.523 25.529  1.00 20.16  ?  164 CYS C HB2  1 
ATOM   9487  H  HB3  . CYS C  1 164 ? -45.824 -19.238 25.848  1.00 20.16  ?  164 CYS C HB3  1 
ATOM   9488  H  HG   . CYS C  1 164 ? -46.325 -19.427 28.526  1.00 22.27  ?  164 CYS C HG   1 
ATOM   9489  N  N    . GLY C  1 165 ? -45.845 -15.863 24.361  1.00 16.16  ?  165 GLY C N    1 
ATOM   9490  C  CA   . GLY C  1 165 ? -45.250 -15.288 23.168  1.00 16.92  ?  165 GLY C CA   1 
ATOM   9491  C  C    . GLY C  1 165 ? -44.144 -14.301 23.444  1.00 18.05  ?  165 GLY C C    1 
ATOM   9492  O  O    . GLY C  1 165 ? -43.424 -13.930 22.508  1.00 19.60  ?  165 GLY C O    1 
ATOM   9493  H  H    . GLY C  1 165 ? -46.636 -15.573 24.535  1.00 19.40  ?  165 GLY C H    1 
ATOM   9494  H  HA2  . GLY C  1 165 ? -44.886 -16.001 22.620  1.00 20.30  ?  165 GLY C HA2  1 
ATOM   9495  H  HA3  . GLY C  1 165 ? -45.938 -14.835 22.657  1.00 20.30  ?  165 GLY C HA3  1 
ATOM   9496  N  N    . LEU C  1 166 ? -44.044 -13.813 24.688  1.00 16.10  ?  166 LEU C N    1 
ATOM   9497  C  CA   . LEU C  1 166 ? -42.928 -13.006 25.178  1.00 16.34  ?  166 LEU C CA   1 
ATOM   9498  C  C    . LEU C  1 166 ? -41.964 -13.817 26.046  1.00 15.24  ?  166 LEU C C    1 
ATOM   9499  O  O    . LEU C  1 166 ? -41.126 -13.245 26.760  1.00 15.83  ?  166 LEU C O    1 
ATOM   9500  C  CB   . LEU C  1 166 ? -43.473 -11.812 25.963  1.00 16.84  ?  166 LEU C CB   1 
ATOM   9501  C  CG   . LEU C  1 166 ? -44.431 -10.879 25.223  1.00 19.50  ?  166 LEU C CG   1 
ATOM   9502  C  CD1  . LEU C  1 166 ? -45.100 -9.894  26.171  1.00 20.55  ?  166 LEU C CD1  1 
ATOM   9503  C  CD2  . LEU C  1 166 ? -43.635 -10.143 24.164  1.00 31.77  ?  166 LEU C CD2  1 
ATOM   9504  H  H    . LEU C  1 166 ? -44.642 -13.947 25.291  1.00 19.32  ?  166 LEU C H    1 
ATOM   9505  H  HA   . LEU C  1 166 ? -42.430 -12.663 24.419  1.00 19.61  ?  166 LEU C HA   1 
ATOM   9506  H  HB2  . LEU C  1 166 ? -43.946 -12.152 26.739  1.00 20.21  ?  166 LEU C HB2  1 
ATOM   9507  H  HB3  . LEU C  1 166 ? -42.720 -11.275 26.258  1.00 20.21  ?  166 LEU C HB3  1 
ATOM   9508  H  HG   . LEU C  1 166 ? -45.120 -11.402 24.783  1.00 23.40  ?  166 LEU C HG   1 
ATOM   9509  H  HD11 . LEU C  1 166 ? -45.697 -9.323  25.663  1.00 24.66  ?  166 LEU C HD11 1 
ATOM   9510  H  HD12 . LEU C  1 166 ? -45.602 -10.389 26.837  1.00 24.66  ?  166 LEU C HD12 1 
ATOM   9511  H  HD13 . LEU C  1 166 ? -44.416 -9.358  26.602  1.00 24.66  ?  166 LEU C HD13 1 
ATOM   9512  H  HD21 . LEU C  1 166 ? -44.228 -9.545  23.683  1.00 38.13  ?  166 LEU C HD21 1 
ATOM   9513  H  HD22 . LEU C  1 166 ? -42.930 -9.634  24.596  1.00 38.13  ?  166 LEU C HD22 1 
ATOM   9514  H  HD23 . LEU C  1 166 ? -43.249 -10.790 23.553  1.00 38.13  ?  166 LEU C HD23 1 
ATOM   9515  N  N    . ASP C  1 167 ? -42.052 -15.145 25.976  1.00 13.76  ?  167 ASP C N    1 
ATOM   9516  C  CA   . ASP C  1 167 ? -41.294 -16.047 26.828  1.00 13.85  ?  167 ASP C CA   1 
ATOM   9517  C  C    . ASP C  1 167 ? -41.512 -15.714 28.301  1.00 15.90  ?  167 ASP C C    1 
ATOM   9518  O  O    . ASP C  1 167 ? -40.612 -15.857 29.135  1.00 16.61  ?  167 ASP C O    1 
ATOM   9519  C  CB   . ASP C  1 167 ? -39.811 -16.050 26.450  1.00 14.93  ?  167 ASP C CB   1 
ATOM   9520  C  CG   . ASP C  1 167 ? -39.546 -16.756 25.118  1.00 22.94  ?  167 ASP C CG   1 
ATOM   9521  O  OD1  . ASP C  1 167 ? -40.473 -17.372 24.544  1.00 19.36  ?  167 ASP C OD1  1 
ATOM   9522  O  OD2  . ASP C  1 167 ? -38.385 -16.698 24.643  1.00 25.81  -1 167 ASP C OD2  1 
ATOM   9523  H  H    . ASP C  1 167 ? -42.564 -15.557 25.421  1.00 16.51  ?  167 ASP C H    1 
ATOM   9524  H  HA   . ASP C  1 167 ? -41.626 -16.947 26.687  1.00 16.62  ?  167 ASP C HA   1 
ATOM   9525  H  HB2  . ASP C  1 167 ? -39.502 -15.134 26.371  1.00 17.92  ?  167 ASP C HB2  1 
ATOM   9526  H  HB3  . ASP C  1 167 ? -39.309 -16.512 27.140  1.00 17.92  ?  167 ASP C HB3  1 
ATOM   9527  N  N    . LEU C  1 168 ? -42.751 -15.325 28.631  1.00 16.15  ?  168 LEU C N    1 
ATOM   9528  C  CA   . LEU C  1 168 ? -43.212 -15.127 30.004  1.00 15.37  ?  168 LEU C CA   1 
ATOM   9529  C  C    . LEU C  1 168 ? -44.065 -16.307 30.468  1.00 14.29  ?  168 LEU C C    1 
ATOM   9530  O  O    . LEU C  1 168 ? -45.014 -16.151 31.249  1.00 15.63  ?  168 LEU C O    1 
ATOM   9531  C  CB   . LEU C  1 168 ? -43.960 -13.792 30.116  1.00 15.40  ?  168 LEU C CB   1 
ATOM   9532  C  CG   . LEU C  1 168 ? -43.076 -12.554 29.933  1.00 15.33  ?  168 LEU C CG   1 
ATOM   9533  C  CD1  . LEU C  1 168 ? -43.913 -11.301 29.900  1.00 17.48  ?  168 LEU C CD1  1 
ATOM   9534  C  CD2  . LEU C  1 168 ? -41.988 -12.482 31.022  1.00 17.92  ?  168 LEU C CD2  1 
ATOM   9535  H  H    . LEU C  1 168 ? -43.363 -15.166 28.048  1.00 19.38  ?  168 LEU C H    1 
ATOM   9536  H  HA   . LEU C  1 168 ? -42.437 -15.078 30.586  1.00 18.44  ?  168 LEU C HA   1 
ATOM   9537  H  HB2  . LEU C  1 168 ? -44.649 -13.765 29.434  1.00 18.48  ?  168 LEU C HB2  1 
ATOM   9538  H  HB3  . LEU C  1 168 ? -44.366 -13.737 30.995  1.00 18.48  ?  168 LEU C HB3  1 
ATOM   9539  H  HG   . LEU C  1 168 ? -42.625 -12.624 29.077  1.00 18.39  ?  168 LEU C HG   1 
ATOM   9540  H  HD11 . LEU C  1 168 ? -43.329 -10.535 29.784  1.00 20.97  ?  168 LEU C HD11 1 
ATOM   9541  H  HD12 . LEU C  1 168 ? -44.536 -11.357 29.159  1.00 20.97  ?  168 LEU C HD12 1 
ATOM   9542  H  HD13 . LEU C  1 168 ? -44.398 -11.223 30.736  1.00 20.97  ?  168 LEU C HD13 1 
ATOM   9543  H  HD21 . LEU C  1 168 ? -41.449 -11.689 30.876  1.00 21.50  ?  168 LEU C HD21 1 
ATOM   9544  H  HD22 . LEU C  1 168 ? -42.414 -12.438 31.892  1.00 21.50  ?  168 LEU C HD22 1 
ATOM   9545  H  HD23 . LEU C  1 168 ? -41.432 -13.275 30.965  1.00 21.50  ?  168 LEU C HD23 1 
ATOM   9546  N  N    . ASP C  1 169 ? -43.671 -17.515 30.049  1.00 16.28  ?  169 ASP C N    1 
ATOM   9547  C  CA   . ASP C  1 169 ? -44.319 -18.743 30.503  1.00 16.61  ?  169 ASP C CA   1 
ATOM   9548  C  C    . ASP C  1 169 ? -44.403 -18.841 32.021  1.00 16.77  ?  169 ASP C C    1 
ATOM   9549  O  O    . ASP C  1 169 ? -45.407 -19.336 32.543  1.00 16.16  ?  169 ASP C O    1 
ATOM   9550  C  CB   . ASP C  1 169 ? -43.583 -19.953 29.911  1.00 17.54  ?  169 ASP C CB   1 
ATOM   9551  C  CG   . ASP C  1 169 ? -43.380 -19.807 28.418  1.00 19.90  ?  169 ASP C CG   1 
ATOM   9552  O  OD1  . ASP C  1 169 ? -42.495 -18.998 28.020  1.00 18.96  ?  169 ASP C OD1  1 
ATOM   9553  O  OD2  . ASP C  1 169 ? -44.149 -20.458 27.669  1.00 18.72  -1 169 ASP C OD2  1 
ATOM   9554  H  H    . ASP C  1 169 ? -43.025 -17.647 29.497  1.00 19.53  ?  169 ASP C H    1 
ATOM   9555  H  HA   . ASP C  1 169 ? -45.227 -18.757 30.159  1.00 19.93  ?  169 ASP C HA   1 
ATOM   9556  H  HB2  . ASP C  1 169 ? -42.712 -20.032 30.330  1.00 21.05  ?  169 ASP C HB2  1 
ATOM   9557  H  HB3  . ASP C  1 169 ? -44.106 -20.754 30.070  1.00 21.05  ?  169 ASP C HB3  1 
ATOM   9558  N  N    . PHE C  1 170 ? -43.373 -18.387 32.751  1.00 16.68  ?  170 PHE C N    1 
ATOM   9559  C  CA   . PHE C  1 170 ? -43.453 -18.399 34.205  1.00 17.26  ?  170 PHE C CA   1 
ATOM   9560  C  C    . PHE C  1 170 ? -44.673 -17.629 34.704  1.00 16.82  ?  170 PHE C C    1 
ATOM   9561  O  O    . PHE C  1 170 ? -45.396 -18.091 35.594  1.00 15.74  ?  170 PHE C O    1 
ATOM   9562  C  CB   . PHE C  1 170 ? -42.168 -17.804 34.799  1.00 14.93  ?  170 PHE C CB   1 
ATOM   9563  C  CG   . PHE C  1 170 ? -42.196 -17.626 36.279  1.00 16.46  ?  170 PHE C CG   1 
ATOM   9564  C  CD1  . PHE C  1 170 ? -42.265 -18.750 37.112  1.00 19.01  ?  170 PHE C CD1  1 
ATOM   9565  C  CD2  . PHE C  1 170 ? -42.151 -16.366 36.861  1.00 18.31  ?  170 PHE C CD2  1 
ATOM   9566  C  CE1  . PHE C  1 170 ? -42.234 -18.606 38.486  1.00 19.14  ?  170 PHE C CE1  1 
ATOM   9567  C  CE2  . PHE C  1 170 ? -42.115 -16.229 38.256  1.00 19.61  ?  170 PHE C CE2  1 
ATOM   9568  C  CZ   . PHE C  1 170 ? -42.173 -17.352 39.048  1.00 17.71  ?  170 PHE C CZ   1 
ATOM   9569  H  H    . PHE C  1 170 ? -42.638 -18.076 32.431  1.00 20.01  ?  170 PHE C H    1 
ATOM   9570  H  HA   . PHE C  1 170 ? -43.529 -19.317 34.511  1.00 20.71  ?  170 PHE C HA   1 
ATOM   9571  H  HB2  . PHE C  1 170 ? -41.427 -18.393 34.588  1.00 17.91  ?  170 PHE C HB2  1 
ATOM   9572  H  HB3  . PHE C  1 170 ? -42.017 -16.933 34.401  1.00 17.91  ?  170 PHE C HB3  1 
ATOM   9573  H  HD1  . PHE C  1 170 ? -42.286 -19.602 36.738  1.00 22.81  ?  170 PHE C HD1  1 
ATOM   9574  H  HD2  . PHE C  1 170 ? -42.091 -15.611 36.322  1.00 21.97  ?  170 PHE C HD2  1 
ATOM   9575  H  HE1  . PHE C  1 170 ? -42.280 -19.357 39.032  1.00 22.97  ?  170 PHE C HE1  1 
ATOM   9576  H  HE2  . PHE C  1 170 ? -42.085 -15.384 38.643  1.00 23.53  ?  170 PHE C HE2  1 
ATOM   9577  H  HZ   . PHE C  1 170 ? -42.178 -17.262 39.974  1.00 21.25  ?  170 PHE C HZ   1 
ATOM   9578  N  N    . ASP C  1 171 ? -44.902 -16.439 34.167  1.00 16.49  ?  171 ASP C N    1 
ATOM   9579  C  CA   . ASP C  1 171 ? -46.009 -15.624 34.647  1.00 16.25  ?  171 ASP C CA   1 
ATOM   9580  C  C    . ASP C  1 171 ? -47.335 -16.294 34.312  1.00 15.63  ?  171 ASP C C    1 
ATOM   9581  O  O    . ASP C  1 171 ? -48.262 -16.290 35.146  1.00 16.68  ?  171 ASP C O    1 
ATOM   9582  C  CB   . ASP C  1 171 ? -45.950 -14.229 34.030  1.00 15.26  ?  171 ASP C CB   1 
ATOM   9583  C  CG   . ASP C  1 171 ? -44.813 -13.380 34.546  1.00 17.17  ?  171 ASP C CG   1 
ATOM   9584  O  OD1  . ASP C  1 171 ? -44.123 -13.825 35.499  1.00 18.05  ?  171 ASP C OD1  1 
ATOM   9585  O  OD2  . ASP C  1 171 ? -44.614 -12.264 33.988  1.00 16.10  -1 171 ASP C OD2  1 
ATOM   9586  H  H    . ASP C  1 171 ? -44.440 -16.084 33.534  1.00 19.79  ?  171 ASP C H    1 
ATOM   9587  H  HA   . ASP C  1 171 ? -45.947 -15.534 35.610  1.00 19.50  ?  171 ASP C HA   1 
ATOM   9588  H  HB2  . ASP C  1 171 ? -45.843 -14.316 33.070  1.00 18.31  ?  171 ASP C HB2  1 
ATOM   9589  H  HB3  . ASP C  1 171 ? -46.779 -13.766 34.228  1.00 18.31  ?  171 ASP C HB3  1 
ATOM   9590  N  N    . ALA C  1 172 ? -47.456 -16.839 33.094  1.00 17.91  ?  172 ALA C N    1 
ATOM   9591  C  CA   . ALA C  1 172 ? -48.684 -17.536 32.727  1.00 15.67  ?  172 ALA C CA   1 
ATOM   9592  C  C    . ALA C  1 172 ? -48.936 -18.700 33.663  1.00 18.20  ?  172 ALA C C    1 
ATOM   9593  O  O    . ALA C  1 172 ? -50.077 -18.924 34.095  1.00 17.79  ?  172 ALA C O    1 
ATOM   9594  C  CB   . ALA C  1 172 ? -48.616 -18.007 31.270  1.00 17.18  ?  172 ALA C CB   1 
ATOM   9595  H  H    . ALA C  1 172 ? -46.854 -16.817 32.480  1.00 21.49  ?  172 ALA C H    1 
ATOM   9596  H  HA   . ALA C  1 172 ? -49.430 -16.922 32.808  1.00 18.80  ?  172 ALA C HA   1 
ATOM   9597  H  HB1  . ALA C  1 172 ? -49.441 -18.467 31.049  1.00 20.62  ?  172 ALA C HB1  1 
ATOM   9598  H  HB2  . ALA C  1 172 ? -48.503 -17.235 30.694  1.00 20.62  ?  172 ALA C HB2  1 
ATOM   9599  H  HB3  . ALA C  1 172 ? -47.864 -18.610 31.169  1.00 20.62  ?  172 ALA C HB3  1 
ATOM   9600  N  N    . TYR C  1 173 ? -47.871 -19.418 34.030  1.00 16.58  ?  173 TYR C N    1 
ATOM   9601  C  CA   . TYR C  1 173 ? -47.981 -20.553 34.950  1.00 18.11  ?  173 TYR C CA   1 
ATOM   9602  C  C    . TYR C  1 173 ? -48.413 -20.106 36.341  1.00 17.38  ?  173 TYR C C    1 
ATOM   9603  O  O    . TYR C  1 173 ? -49.297 -20.723 36.949  1.00 18.47  ?  173 TYR C O    1 
ATOM   9604  C  CB   . TYR C  1 173 ? -46.649 -21.307 35.010  1.00 16.42  ?  173 TYR C CB   1 
ATOM   9605  C  CG   . TYR C  1 173 ? -46.754 -22.582 35.812  1.00 20.27  ?  173 TYR C CG   1 
ATOM   9606  C  CD1  . TYR C  1 173 ? -47.476 -23.660 35.304  1.00 26.70  ?  173 TYR C CD1  1 
ATOM   9607  C  CD2  . TYR C  1 173 ? -46.205 -22.689 37.065  1.00 23.79  ?  173 TYR C CD2  1 
ATOM   9608  C  CE1  . TYR C  1 173 ? -47.625 -24.819 36.011  1.00 30.53  ?  173 TYR C CE1  1 
ATOM   9609  C  CE2  . TYR C  1 173 ? -46.325 -23.906 37.796  1.00 25.21  ?  173 TYR C CE2  1 
ATOM   9610  C  CZ   . TYR C  1 173 ? -47.047 -24.938 37.247  1.00 26.96  ?  173 TYR C CZ   1 
ATOM   9611  O  OH   . TYR C  1 173 ? -47.250 -26.142 37.908  1.00 29.40  ?  173 TYR C OH   1 
ATOM   9612  H  H    . TYR C  1 173 ? -47.070 -19.266 33.759  1.00 19.90  ?  173 TYR C H    1 
ATOM   9613  H  HA   . TYR C  1 173 ? -48.654 -21.165 34.613  1.00 21.73  ?  173 TYR C HA   1 
ATOM   9614  H  HB2  . TYR C  1 173 ? -46.373 -21.539 34.109  1.00 19.71  ?  173 TYR C HB2  1 
ATOM   9615  H  HB3  . TYR C  1 173 ? -45.981 -20.742 35.428  1.00 19.71  ?  173 TYR C HB3  1 
ATOM   9616  H  HD1  . TYR C  1 173 ? -47.869 -23.587 34.464  1.00 32.05  ?  173 TYR C HD1  1 
ATOM   9617  H  HD2  . TYR C  1 173 ? -45.715 -21.981 37.419  1.00 28.55  ?  173 TYR C HD2  1 
ATOM   9618  H  HE1  . TYR C  1 173 ? -48.104 -25.529 35.649  1.00 36.64  ?  173 TYR C HE1  1 
ATOM   9619  H  HE2  . TYR C  1 173 ? -45.953 -23.987 38.644  1.00 30.25  ?  173 TYR C HE2  1 
ATOM   9620  H  HH   . TYR C  1 173 ? -46.863 -26.130 38.654  1.00 35.29  ?  173 TYR C HH   1 
ATOM   9621  N  N    . VAL C  1 174 ? -47.786 -19.052 36.872  1.00 17.34  ?  174 VAL C N    1 
ATOM   9622  C  CA   . VAL C  1 174 ? -48.168 -18.538 38.189  1.00 18.61  ?  174 VAL C CA   1 
ATOM   9623  C  C    . VAL C  1 174 ? -49.628 -18.115 38.195  1.00 19.40  ?  174 VAL C C    1 
ATOM   9624  O  O    . VAL C  1 174 ? -50.386 -18.484 39.099  1.00 18.24  ?  174 VAL C O    1 
ATOM   9625  C  CB   . VAL C  1 174 ? -47.263 -17.372 38.613  1.00 16.36  ?  174 VAL C CB   1 
ATOM   9626  C  CG1  . VAL C  1 174 ? -47.731 -16.774 39.937  1.00 19.03  ?  174 VAL C CG1  1 
ATOM   9627  C  CG2  . VAL C  1 174 ? -45.782 -17.807 38.751  1.00 19.10  ?  174 VAL C CG2  1 
ATOM   9628  H  H    . VAL C  1 174 ? -47.144 -18.622 36.495  1.00 20.81  ?  174 VAL C H    1 
ATOM   9629  H  HA   . VAL C  1 174 ? -48.062 -19.247 38.842  1.00 22.33  ?  174 VAL C HA   1 
ATOM   9630  H  HB   . VAL C  1 174 ? -47.308 -16.677 37.938  1.00 19.63  ?  174 VAL C HB   1 
ATOM   9631  H  HG11 . VAL C  1 174 ? -47.142 -16.042 40.178  1.00 22.83  ?  174 VAL C HG11 1 
ATOM   9632  H  HG12 . VAL C  1 174 ? -48.639 -16.448 39.832  1.00 22.83  ?  174 VAL C HG12 1 
ATOM   9633  H  HG13 . VAL C  1 174 ? -47.703 -17.461 40.621  1.00 22.83  ?  174 VAL C HG13 1 
ATOM   9634  H  HG21 . VAL C  1 174 ? -45.252 -17.040 39.019  1.00 22.93  ?  174 VAL C HG21 1 
ATOM   9635  H  HG22 . VAL C  1 174 ? -45.719 -18.505 39.422  1.00 22.93  ?  174 VAL C HG22 1 
ATOM   9636  H  HG23 . VAL C  1 174 ? -45.470 -18.142 37.895  1.00 22.93  ?  174 VAL C HG23 1 
ATOM   9637  N  N    . PHE C  1 175 ? -50.055 -17.324 37.199  1.00 18.23  ?  175 PHE C N    1 
ATOM   9638  C  CA   . PHE C  1 175 ? -51.472 -16.925 37.147  1.00 17.66  ?  175 PHE C CA   1 
ATOM   9639  C  C    . PHE C  1 175 ? -52.388 -18.141 37.076  1.00 18.49  ?  175 PHE C C    1 
ATOM   9640  O  O    . PHE C  1 175 ? -53.441 -18.169 37.721  1.00 19.06  ?  175 PHE C O    1 
ATOM   9641  C  CB   . PHE C  1 175 ? -51.755 -16.002 35.951  1.00 18.54  ?  175 PHE C CB   1 
ATOM   9642  C  CG   . PHE C  1 175 ? -51.288 -14.564 36.135  1.00 18.31  ?  175 PHE C CG   1 
ATOM   9643  C  CD1  . PHE C  1 175 ? -51.806 -13.770 37.163  1.00 18.23  ?  175 PHE C CD1  1 
ATOM   9644  C  CD2  . PHE C  1 175 ? -50.366 -13.978 35.248  1.00 18.39  ?  175 PHE C CD2  1 
ATOM   9645  C  CE1  . PHE C  1 175 ? -51.406 -12.434 37.335  1.00 19.82  ?  175 PHE C CE1  1 
ATOM   9646  C  CE2  . PHE C  1 175 ? -49.981 -12.633 35.411  1.00 17.97  ?  175 PHE C CE2  1 
ATOM   9647  C  CZ   . PHE C  1 175 ? -50.483 -11.874 36.459  1.00 18.22  ?  175 PHE C CZ   1 
ATOM   9648  H  H    . PHE C  1 175 ? -49.566 -17.014 36.563  1.00 21.87  ?  175 PHE C H    1 
ATOM   9649  H  HA   . PHE C  1 175 ? -51.690 -16.436 37.957  1.00 21.19  ?  175 PHE C HA   1 
ATOM   9650  H  HB2  . PHE C  1 175 ? -51.303 -16.360 35.171  1.00 22.25  ?  175 PHE C HB2  1 
ATOM   9651  H  HB3  . PHE C  1 175 ? -52.712 -15.982 35.794  1.00 22.25  ?  175 PHE C HB3  1 
ATOM   9652  H  HD1  . PHE C  1 175 ? -52.419 -14.140 37.756  1.00 21.88  ?  175 PHE C HD1  1 
ATOM   9653  H  HD2  . PHE C  1 175 ? -50.018 -14.477 34.545  1.00 22.07  ?  175 PHE C HD2  1 
ATOM   9654  H  HE1  . PHE C  1 175 ? -51.754 -11.928 38.033  1.00 23.78  ?  175 PHE C HE1  1 
ATOM   9655  H  HE2  . PHE C  1 175 ? -49.359 -12.259 34.830  1.00 21.56  ?  175 PHE C HE2  1 
ATOM   9656  H  HZ   . PHE C  1 175 ? -50.217 -10.989 36.564  1.00 21.86  ?  175 PHE C HZ   1 
ATOM   9657  N  N    . THR C  1 176 ? -52.029 -19.141 36.274  1.00 18.79  ?  176 THR C N    1 
ATOM   9658  C  CA   . THR C  1 176 ? -52.851 -20.338 36.177  1.00 19.44  ?  176 THR C CA   1 
ATOM   9659  C  C    . THR C  1 176 ? -53.001 -21.003 37.538  1.00 19.75  ?  176 THR C C    1 
ATOM   9660  O  O    . THR C  1 176 ? -54.112 -21.394 37.929  1.00 22.86  ?  176 THR C O    1 
ATOM   9661  C  CB   . THR C  1 176 ? -52.241 -21.298 35.157  1.00 21.44  ?  176 THR C CB   1 
ATOM   9662  O  OG1  . THR C  1 176 ? -52.370 -20.736 33.837  1.00 21.69  ?  176 THR C OG1  1 
ATOM   9663  C  CG2  . THR C  1 176 ? -52.914 -22.651 35.180  1.00 21.99  ?  176 THR C CG2  1 
ATOM   9664  H  H    . THR C  1 176 ? -51.322 -19.149 35.784  1.00 22.54  ?  176 THR C H    1 
ATOM   9665  H  HA   . THR C  1 176 ? -53.736 -20.090 35.865  1.00 23.33  ?  176 THR C HA   1 
ATOM   9666  H  HB   . THR C  1 176 ? -51.301 -21.424 35.360  1.00 25.73  ?  176 THR C HB   1 
ATOM   9667  H  HG1  . THR C  1 176 ? -51.969 -19.998 33.798  1.00 26.03  ?  176 THR C HG1  1 
ATOM   9668  H  HG21 . THR C  1 176 ? -52.505 -23.236 34.524  1.00 26.39  ?  176 THR C HG21 1 
ATOM   9669  H  HG22 . THR C  1 176 ? -52.824 -23.051 36.059  1.00 26.39  ?  176 THR C HG22 1 
ATOM   9670  H  HG23 . THR C  1 176 ? -53.857 -22.555 34.973  1.00 26.39  ?  176 THR C HG23 1 
ATOM   9671  N  N    . LYS C  1 177 ? -51.901 -21.121 38.284  1.00 19.58  ?  177 LYS C N    1 
ATOM   9672  C  CA   . LYS C  1 177 ? -51.940 -21.750 39.605  1.00 23.85  ?  177 LYS C CA   1 
ATOM   9673  C  C    . LYS C  1 177 ? -52.797 -20.941 40.574  1.00 24.38  ?  177 LYS C C    1 
ATOM   9674  O  O    . LYS C  1 177 ? -53.663 -21.502 41.269  1.00 25.13  ?  177 LYS C O    1 
ATOM   9675  C  CB   . LYS C  1 177 ? -50.511 -21.905 40.159  1.00 23.22  ?  177 LYS C CB   1 
ATOM   9676  C  CG   . LYS C  1 177 ? -49.632 -22.953 39.470  1.00 28.74  ?  177 LYS C CG   1 
ATOM   9677  C  CD   . LYS C  1 177 ? -50.003 -24.381 39.859  1.00 40.73  ?  177 LYS C CD   1 
ATOM   9678  C  CE   . LYS C  1 177 ? -49.731 -24.642 41.332  1.00 40.76  ?  177 LYS C CE   1 
ATOM   9679  N  NZ   . LYS C  1 177 ? -49.916 -26.074 41.693  1.00 44.98  1  177 LYS C NZ   1 
ATOM   9680  H  H    . LYS C  1 177 ? -51.121 -20.845 38.048  1.00 23.50  ?  177 LYS C H    1 
ATOM   9681  H  HA   . LYS C  1 177 ? -52.330 -22.635 39.524  1.00 28.62  ?  177 LYS C HA   1 
ATOM   9682  H  HB2  . LYS C  1 177 ? -50.059 -21.050 40.079  1.00 27.86  ?  177 LYS C HB2  1 
ATOM   9683  H  HB3  . LYS C  1 177 ? -50.572 -22.150 41.096  1.00 27.86  ?  177 LYS C HB3  1 
ATOM   9684  H  HG2  . LYS C  1 177 ? -49.733 -22.867 38.509  1.00 34.49  ?  177 LYS C HG2  1 
ATOM   9685  H  HG3  . LYS C  1 177 ? -48.707 -22.804 39.721  1.00 34.49  ?  177 LYS C HG3  1 
ATOM   9686  H  HD2  . LYS C  1 177 ? -50.948 -24.524 39.694  1.00 48.88  ?  177 LYS C HD2  1 
ATOM   9687  H  HD3  . LYS C  1 177 ? -49.473 -25.004 39.337  1.00 48.88  ?  177 LYS C HD3  1 
ATOM   9688  H  HE2  . LYS C  1 177 ? -48.814 -24.395 41.534  1.00 48.91  ?  177 LYS C HE2  1 
ATOM   9689  H  HE3  . LYS C  1 177 ? -50.344 -24.114 41.867  1.00 48.91  ?  177 LYS C HE3  1 
ATOM   9690  H  HZ1  . LYS C  1 177 ? -50.752 -26.324 41.522  1.00 53.98  ?  177 LYS C HZ1  1 
ATOM   9691  H  HZ2  . LYS C  1 177 ? -49.359 -26.581 41.219  1.00 53.98  ?  177 LYS C HZ2  1 
ATOM   9692  H  HZ3  . LYS C  1 177 ? -49.750 -26.193 42.559  1.00 53.98  ?  177 LYS C HZ3  1 
ATOM   9693  N  N    . ILE C  1 178 ? -52.577 -19.612 40.645  1.00 20.89  ?  178 ILE C N    1 
ATOM   9694  C  CA   . ILE C  1 178 ? -53.224 -18.795 41.673  1.00 22.89  ?  178 ILE C CA   1 
ATOM   9695  C  C    . ILE C  1 178 ? -54.696 -18.567 41.371  1.00 24.19  ?  178 ILE C C    1 
ATOM   9696  O  O    . ILE C  1 178 ? -55.521 -18.508 42.293  1.00 26.23  ?  178 ILE C O    1 
ATOM   9697  C  CB   . ILE C  1 178 ? -52.471 -17.461 41.833  1.00 22.90  ?  178 ILE C CB   1 
ATOM   9698  C  CG1  . ILE C  1 178 ? -51.063 -17.736 42.355  1.00 28.86  ?  178 ILE C CG1  1 
ATOM   9699  C  CG2  . ILE C  1 178 ? -53.248 -16.484 42.723  1.00 28.41  ?  178 ILE C CG2  1 
ATOM   9700  C  CD1  . ILE C  1 178 ? -51.024 -18.286 43.772  1.00 32.91  ?  178 ILE C CD1  1 
ATOM   9701  H  H    . ILE C  1 178 ? -52.063 -19.172 40.113  1.00 25.06  ?  178 ILE C H    1 
ATOM   9702  H  HA   . ILE C  1 178 ? -53.169 -19.265 42.520  1.00 27.47  ?  178 ILE C HA   1 
ATOM   9703  H  HB   . ILE C  1 178 ? -52.388 -17.060 40.954  1.00 27.48  ?  178 ILE C HB   1 
ATOM   9704  H  HG12 . ILE C  1 178 ? -50.636 -18.385 41.774  1.00 34.63  ?  178 ILE C HG12 1 
ATOM   9705  H  HG13 . ILE C  1 178 ? -50.560 -16.907 42.346  1.00 34.63  ?  178 ILE C HG13 1 
ATOM   9706  H  HG21 . ILE C  1 178 ? -52.744 -15.659 42.800  1.00 34.09  ?  178 ILE C HG21 1 
ATOM   9707  H  HG22 . ILE C  1 178 ? -54.112 -16.309 42.318  1.00 34.09  ?  178 ILE C HG22 1 
ATOM   9708  H  HG23 . ILE C  1 178 ? -53.367 -16.883 43.599  1.00 34.09  ?  178 ILE C HG23 1 
ATOM   9709  H  HD11 . ILE C  1 178 ? -50.100 -18.433 44.028  1.00 39.50  ?  178 ILE C HD11 1 
ATOM   9710  H  HD12 . ILE C  1 178 ? -51.435 -17.644 44.371  1.00 39.50  ?  178 ILE C HD12 1 
ATOM   9711  H  HD13 . ILE C  1 178 ? -51.512 -19.124 43.799  1.00 39.50  ?  178 ILE C HD13 1 
ATOM   9712  N  N    . LEU C  1 179 ? -55.057 -18.429 40.099  1.00 20.52  ?  179 LEU C N    1 
ATOM   9713  C  CA   . LEU C  1 179 ? -56.433 -18.172 39.711  1.00 19.87  ?  179 LEU C CA   1 
ATOM   9714  C  C    . LEU C  1 179 ? -57.219 -19.435 39.429  1.00 23.58  ?  179 LEU C C    1 
ATOM   9715  O  O    . LEU C  1 179 ? -58.388 -19.330 39.050  1.00 26.60  ?  179 LEU C O    1 
ATOM   9716  C  CB   . LEU C  1 179 ? -56.465 -17.270 38.483  1.00 22.30  ?  179 LEU C CB   1 
ATOM   9717  C  CG   . LEU C  1 179 ? -55.836 -15.895 38.730  1.00 19.97  ?  179 LEU C CG   1 
ATOM   9718  C  CD1  . LEU C  1 179 ? -55.833 -15.127 37.429  1.00 23.70  ?  179 LEU C CD1  1 
ATOM   9719  C  CD2  . LEU C  1 179 ? -56.536 -15.133 39.846  1.00 24.01  ?  179 LEU C CD2  1 
ATOM   9720  H  H    . LEU C  1 179 ? -54.512 -18.481 39.435  1.00 24.62  ?  179 LEU C H    1 
ATOM   9721  H  HA   . LEU C  1 179 ? -56.877 -17.703 40.434  1.00 23.85  ?  179 LEU C HA   1 
ATOM   9722  H  HB2  . LEU C  1 179 ? -55.974 -17.698 37.765  1.00 26.76  ?  179 LEU C HB2  1 
ATOM   9723  H  HB3  . LEU C  1 179 ? -57.388 -17.133 38.218  1.00 26.76  ?  179 LEU C HB3  1 
ATOM   9724  H  HG   . LEU C  1 179 ? -54.913 -16.021 38.997  1.00 23.96  ?  179 LEU C HG   1 
ATOM   9725  H  HD11 . LEU C  1 179 ? -55.436 -14.255 37.578  1.00 28.44  ?  179 LEU C HD11 1 
ATOM   9726  H  HD12 . LEU C  1 179 ? -55.314 -15.620 36.774  1.00 28.44  ?  179 LEU C HD12 1 
ATOM   9727  H  HD13 . LEU C  1 179 ? -56.747 -15.026 37.119  1.00 28.44  ?  179 LEU C HD13 1 
ATOM   9728  H  HD21 . LEU C  1 179 ? -56.102 -14.274 39.961  1.00 28.81  ?  179 LEU C HD21 1 
ATOM   9729  H  HD22 . LEU C  1 179 ? -57.467 -15.005 39.604  1.00 28.81  ?  179 LEU C HD22 1 
ATOM   9730  H  HD23 . LEU C  1 179 ? -56.475 -15.648 40.665  1.00 28.81  ?  179 LEU C HD23 1 
ATOM   9731  N  N    . GLY C  1 180 ? -56.598 -20.602 39.536  1.00 22.85  ?  180 GLY C N    1 
ATOM   9732  C  CA   . GLY C  1 180 ? -57.321 -21.849 39.328  1.00 24.75  ?  180 GLY C CA   1 
ATOM   9733  C  C    . GLY C  1 180 ? -57.796 -22.029 37.904  1.00 26.91  ?  180 GLY C C    1 
ATOM   9734  O  O    . GLY C  1 180 ? -58.927 -22.474 37.678  1.00 24.66  ?  180 GLY C O    1 
ATOM   9735  H  H    . GLY C  1 180 ? -55.765 -20.699 39.726  1.00 27.42  ?  180 GLY C H    1 
ATOM   9736  H  HA2  . GLY C  1 180 ? -56.744 -22.595 39.554  1.00 29.69  ?  180 GLY C HA2  1 
ATOM   9737  H  HA3  . GLY C  1 180 ? -58.094 -21.873 39.913  1.00 29.69  ?  180 GLY C HA3  1 
ATOM   9738  N  N    . LEU C  1 181 ? -56.963 -21.690 36.927  1.00 22.63  ?  181 LEU C N    1 
ATOM   9739  C  CA   . LEU C  1 181 ? -57.394 -21.750 35.541  1.00 19.91  ?  181 LEU C CA   1 
ATOM   9740  C  C    . LEU C  1 181 ? -57.204 -23.117 34.897  1.00 21.23  ?  181 LEU C C    1 
ATOM   9741  O  O    . LEU C  1 181 ? -57.626 -23.295 33.747  1.00 23.62  ?  181 LEU C O    1 
ATOM   9742  C  CB   . LEU C  1 181 ? -56.650 -20.689 34.703  1.00 23.28  ?  181 LEU C CB   1 
ATOM   9743  C  CG   . LEU C  1 181 ? -56.768 -19.274 35.285  1.00 21.69  ?  181 LEU C CG   1 
ATOM   9744  C  CD1  . LEU C  1 181 ? -55.963 -18.294 34.456  1.00 21.96  ?  181 LEU C CD1  1 
ATOM   9745  C  CD2  . LEU C  1 181 ? -58.207 -18.823 35.387  1.00 24.75  ?  181 LEU C CD2  1 
ATOM   9746  H  H    . LEU C  1 181 ? -56.153 -21.425 37.040  1.00 27.16  ?  181 LEU C H    1 
ATOM   9747  H  HA   . LEU C  1 181 ? -58.341 -21.540 35.504  1.00 23.89  ?  181 LEU C HA   1 
ATOM   9748  H  HB2  . LEU C  1 181 ? -55.709 -20.919 34.666  1.00 27.93  ?  181 LEU C HB2  1 
ATOM   9749  H  HB3  . LEU C  1 181 ? -57.023 -20.676 33.807  1.00 27.93  ?  181 LEU C HB3  1 
ATOM   9750  H  HG   . LEU C  1 181 ? -56.397 -19.276 36.181  1.00 26.03  ?  181 LEU C HG   1 
ATOM   9751  H  HD11 . LEU C  1 181 ? -56.051 -17.408 34.840  1.00 26.36  ?  181 LEU C HD11 1 
ATOM   9752  H  HD12 . LEU C  1 181 ? -55.032 -18.566 34.462  1.00 26.36  ?  181 LEU C HD12 1 
ATOM   9753  H  HD13 . LEU C  1 181 ? -56.302 -18.296 33.547  1.00 26.36  ?  181 LEU C HD13 1 
ATOM   9754  H  HD21 . LEU C  1 181 ? -58.231 -17.927 35.758  1.00 29.70  ?  181 LEU C HD21 1 
ATOM   9755  H  HD22 . LEU C  1 181 ? -58.602 -18.825 34.500  1.00 29.70  ?  181 LEU C HD22 1 
ATOM   9756  H  HD23 . LEU C  1 181 ? -58.689 -19.434 35.965  1.00 29.70  ?  181 LEU C HD23 1 
ATOM   9757  N  N    . GLU C  1 182 ? -56.549 -24.067 35.568  1.00 23.80  ?  182 GLU C N    1 
ATOM   9758  C  CA   . GLU C  1 182 ? -56.390 -25.406 35.008  1.00 21.91  ?  182 GLU C CA   1 
ATOM   9759  C  C    . GLU C  1 182 ? -57.663 -26.216 35.256  1.00 29.00  ?  182 GLU C C    1 
ATOM   9760  O  O    . GLU C  1 182 ? -58.072 -26.410 36.405  1.00 30.07  ?  182 GLU C O    1 
ATOM   9761  C  CB   . GLU C  1 182 ? -55.159 -26.095 35.606  1.00 25.18  ?  182 GLU C CB   1 
ATOM   9762  C  CG   . GLU C  1 182 ? -54.881 -27.437 34.931  1.00 29.20  ?  182 GLU C CG   1 
ATOM   9763  C  CD   . GLU C  1 182 ? -53.657 -28.160 35.486  1.00 35.07  ?  182 GLU C CD   1 
ATOM   9764  O  OE1  . GLU C  1 182 ? -52.973 -27.611 36.373  1.00 39.61  ?  182 GLU C OE1  1 
ATOM   9765  O  OE2  . GLU C  1 182 ? -53.392 -29.282 35.008  1.00 49.15  -1 182 GLU C OE2  1 
ATOM   9766  H  H    . GLU C  1 182 ? -56.192 -23.962 36.343  1.00 28.57  ?  182 GLU C H    1 
ATOM   9767  H  HA   . GLU C  1 182 ? -56.260 -25.335 34.050  1.00 26.30  ?  182 GLU C HA   1 
ATOM   9768  H  HB2  . GLU C  1 182 ? -54.383 -25.526 35.482  1.00 30.22  ?  182 GLU C HB2  1 
ATOM   9769  H  HB3  . GLU C  1 182 ? -55.310 -26.255 36.550  1.00 30.22  ?  182 GLU C HB3  1 
ATOM   9770  H  HG2  . GLU C  1 182 ? -55.650 -28.016 35.057  1.00 35.04  ?  182 GLU C HG2  1 
ATOM   9771  H  HG3  . GLU C  1 182 ? -54.734 -27.287 33.984  1.00 35.04  ?  182 GLU C HG3  1 
ATOM   9772  N  N    . ASP C  1 183 ? -58.296 -26.676 34.184  1.00 23.23  ?  183 ASP C N    1 
ATOM   9773  C  CA   . ASP C  1 183 ? -59.476 -27.533 34.295  1.00 27.23  ?  183 ASP C CA   1 
ATOM   9774  C  C    . ASP C  1 183 ? -59.426 -28.516 33.129  1.00 27.76  ?  183 ASP C C    1 
ATOM   9775  O  O    . ASP C  1 183 ? -58.437 -28.573 32.397  1.00 25.29  ?  183 ASP C O    1 
ATOM   9776  C  CB   . ASP C  1 183 ? -60.759 -26.690 34.351  1.00 28.66  ?  183 ASP C CB   1 
ATOM   9777  C  CG   . ASP C  1 183 ? -61.088 -25.979 33.027  1.00 36.92  ?  183 ASP C CG   1 
ATOM   9778  O  OD1  . ASP C  1 183 ? -60.531 -26.307 31.958  1.00 29.73  ?  183 ASP C OD1  1 
ATOM   9779  O  OD2  . ASP C  1 183 ? -61.941 -25.071 33.059  1.00 42.81  -1 183 ASP C OD2  1 
ATOM   9780  H  H    . ASP C  1 183 ? -58.063 -26.507 33.374  1.00 27.88  ?  183 ASP C H    1 
ATOM   9781  H  HA   . ASP C  1 183 ? -59.419 -28.043 35.118  1.00 32.68  ?  183 ASP C HA   1 
ATOM   9782  H  HB2  . ASP C  1 183 ? -61.505 -27.270 34.571  1.00 34.39  ?  183 ASP C HB2  1 
ATOM   9783  H  HB3  . ASP C  1 183 ? -60.658 -26.011 35.036  1.00 34.39  ?  183 ASP C HB3  1 
ATOM   9784  N  N    . GLU C  1 184 ? -60.486 -29.315 32.956  1.00 30.04  ?  184 GLU C N    1 
ATOM   9785  C  CA   . GLU C  1 184 ? -60.441 -30.338 31.916  1.00 28.85  ?  184 GLU C CA   1 
ATOM   9786  C  C    . GLU C  1 184 ? -60.257 -29.738 30.515  1.00 26.08  ?  184 GLU C C    1 
ATOM   9787  O  O    . GLU C  1 184 ? -59.631 -30.368 29.654  1.00 32.34  ?  184 GLU C O    1 
ATOM   9788  C  CB   . GLU C  1 184 ? -61.712 -31.205 31.978  1.00 38.59  ?  184 GLU C CB   1 
ATOM   9789  C  CG   . GLU C  1 184 ? -62.994 -30.453 31.658  1.00 51.49  ?  184 GLU C CG   1 
ATOM   9790  C  CD   . GLU C  1 184 ? -64.255 -31.295 31.851  1.00 70.00  ?  184 GLU C CD   1 
ATOM   9791  O  OE1  . GLU C  1 184 ? -64.150 -32.442 32.348  1.00 65.30  ?  184 GLU C OE1  1 
ATOM   9792  O  OE2  . GLU C  1 184 ? -65.352 -30.799 31.502  1.00 74.04  -1 184 GLU C OE2  1 
ATOM   9793  H  H    . GLU C  1 184 ? -61.216 -29.286 33.411  1.00 36.04  ?  184 GLU C H    1 
ATOM   9794  H  HA   . GLU C  1 184 ? -59.682 -30.918 32.087  1.00 34.62  ?  184 GLU C HA   1 
ATOM   9795  H  HB2  . GLU C  1 184 ? -61.627 -31.929 31.339  1.00 46.31  ?  184 GLU C HB2  1 
ATOM   9796  H  HB3  . GLU C  1 184 ? -61.799 -31.567 32.874  1.00 46.31  ?  184 GLU C HB3  1 
ATOM   9797  H  HG2  . GLU C  1 184 ? -63.060 -29.680 32.241  1.00 61.78  ?  184 GLU C HG2  1 
ATOM   9798  H  HG3  . GLU C  1 184 ? -62.967 -30.166 30.732  1.00 61.78  ?  184 GLU C HG3  1 
ATOM   9799  N  N    . ASP C  1 185 ? -60.763 -28.525 30.276  1.00 29.49  ?  185 ASP C N    1 
ATOM   9800  C  CA   . ASP C  1 185 ? -60.642 -27.889 28.962  1.00 26.92  ?  185 ASP C CA   1 
ATOM   9801  C  C    . ASP C  1 185 ? -59.246 -27.302 28.724  1.00 25.12  ?  185 ASP C C    1 
ATOM   9802  O  O    . ASP C  1 185 ? -58.781 -27.282 27.586  1.00 27.81  ?  185 ASP C O    1 
ATOM   9803  C  CB   . ASP C  1 185 ? -61.697 -26.787 28.819  1.00 29.23  ?  185 ASP C CB   1 
ATOM   9804  C  CG   . ASP C  1 185 ? -63.121 -27.331 28.935  1.00 36.80  ?  185 ASP C CG   1 
ATOM   9805  O  OD1  . ASP C  1 185 ? -63.348 -28.415 28.372  1.00 38.54  ?  185 ASP C OD1  1 
ATOM   9806  O  OD2  . ASP C  1 185 ? -63.957 -26.696 29.608  1.00 46.97  -1 185 ASP C OD2  1 
ATOM   9807  H  H    . ASP C  1 185 ? -61.182 -28.049 30.858  1.00 35.39  ?  185 ASP C H    1 
ATOM   9808  H  HA   . ASP C  1 185 ? -60.808 -28.553 28.274  1.00 32.30  ?  185 ASP C HA   1 
ATOM   9809  H  HB2  . ASP C  1 185 ? -61.567 -26.130 29.521  1.00 35.08  ?  185 ASP C HB2  1 
ATOM   9810  H  HB3  . ASP C  1 185 ? -61.604 -26.368 27.949  1.00 35.08  ?  185 ASP C HB3  1 
ATOM   9811  N  N    . THR C  1 186 ? -58.564 -26.843 29.769  1.00 24.03  ?  186 THR C N    1 
ATOM   9812  C  CA   . THR C  1 186 ? -57.293 -26.141 29.583  1.00 20.43  ?  186 THR C CA   1 
ATOM   9813  C  C    . THR C  1 186 ? -56.092 -27.005 29.928  1.00 20.76  ?  186 THR C C    1 
ATOM   9814  O  O    . THR C  1 186 ? -54.958 -26.570 29.724  1.00 20.22  ?  186 THR C O    1 
ATOM   9815  C  CB   . THR C  1 186 ? -57.251 -24.883 30.453  1.00 21.10  ?  186 THR C CB   1 
ATOM   9816  O  OG1  . THR C  1 186 ? -57.316 -25.286 31.828  1.00 21.83  ?  186 THR C OG1  1 
ATOM   9817  C  CG2  . THR C  1 186 ? -58.398 -23.901 30.125  1.00 21.28  ?  186 THR C CG2  1 
ATOM   9818  H  H    . THR C  1 186 ? -58.810 -26.923 30.589  1.00 28.83  ?  186 THR C H    1 
ATOM   9819  H  HA   . THR C  1 186 ? -57.213 -25.870 28.655  1.00 24.52  ?  186 THR C HA   1 
ATOM   9820  H  HB   . THR C  1 186 ? -56.411 -24.423 30.300  1.00 25.31  ?  186 THR C HB   1 
ATOM   9821  H  HG1  . THR C  1 186 ? -57.295 -24.610 32.327  1.00 26.20  ?  186 THR C HG1  1 
ATOM   9822  H  HG21 . THR C  1 186 ? -58.337 -23.118 30.695  1.00 25.54  ?  186 THR C HG21 1 
ATOM   9823  H  HG22 . THR C  1 186 ? -58.339 -23.621 29.198  1.00 25.54  ?  186 THR C HG22 1 
ATOM   9824  H  HG23 . THR C  1 186 ? -59.254 -24.332 30.270  1.00 25.54  ?  186 THR C HG23 1 
ATOM   9825  N  N    . ALA C  1 187 ? -56.309 -28.219 30.448  1.00 21.95  ?  187 ALA C N    1 
ATOM   9826  C  CA   . ALA C  1 187 ? -55.210 -28.993 31.033  1.00 22.98  ?  187 ALA C CA   1 
ATOM   9827  C  C    . ALA C  1 187 ? -54.066 -29.259 30.055  1.00 19.61  ?  187 ALA C C    1 
ATOM   9828  O  O    . ALA C  1 187 ? -52.881 -29.154 30.423  1.00 22.46  ?  187 ALA C O    1 
ATOM   9829  C  CB   . ALA C  1 187 ? -55.757 -30.310 31.581  1.00 31.03  ?  187 ALA C CB   1 
ATOM   9830  H  H    . ALA C  1 187 ? -57.074 -28.612 30.474  1.00 26.34  ?  187 ALA C H    1 
ATOM   9831  H  HA   . ALA C  1 187 ? -54.845 -28.494 31.780  1.00 27.57  ?  187 ALA C HA   1 
ATOM   9832  H  HB1  . ALA C  1 187 ? -55.026 -30.818 31.967  1.00 37.23  ?  187 ALA C HB1  1 
ATOM   9833  H  HB2  . ALA C  1 187 ? -56.421 -30.117 32.261  1.00 37.23  ?  187 ALA C HB2  1 
ATOM   9834  H  HB3  . ALA C  1 187 ? -56.161 -30.810 30.855  1.00 37.23  ?  187 ALA C HB3  1 
ATOM   9835  N  N    . ASP C  1 188 ? -54.372 -29.626 28.810  1.00 22.38  ?  188 ASP C N    1 
ATOM   9836  C  CA   . ASP C  1 188 ? -53.297 -29.932 27.875  1.00 20.37  ?  188 ASP C CA   1 
ATOM   9837  C  C    . ASP C  1 188 ? -52.457 -28.687 27.571  1.00 22.01  ?  188 ASP C C    1 
ATOM   9838  O  O    . ASP C  1 188 ? -51.233 -28.778 27.422  1.00 23.31  ?  188 ASP C O    1 
ATOM   9839  C  CB   . ASP C  1 188 ? -53.880 -30.534 26.594  1.00 23.43  ?  188 ASP C CB   1 
ATOM   9840  C  CG   . ASP C  1 188 ? -54.389 -31.962 26.801  1.00 33.42  ?  188 ASP C CG   1 
ATOM   9841  O  OD1  . ASP C  1 188 ? -54.248 -32.493 27.924  1.00 42.94  ?  188 ASP C OD1  1 
ATOM   9842  O  OD2  . ASP C  1 188 ? -54.935 -32.531 25.843  1.00 46.12  -1 188 ASP C OD2  1 
ATOM   9843  H  H    . ASP C  1 188 ? -55.168 -29.704 28.493  1.00 26.85  ?  188 ASP C H    1 
ATOM   9844  H  HA   . ASP C  1 188 ? -52.712 -30.594 28.276  1.00 24.44  ?  188 ASP C HA   1 
ATOM   9845  H  HB2  . ASP C  1 188 ? -54.625 -29.988 26.297  1.00 28.12  ?  188 ASP C HB2  1 
ATOM   9846  H  HB3  . ASP C  1 188 ? -53.191 -30.556 25.912  1.00 28.12  ?  188 ASP C HB3  1 
ATOM   9847  N  N    . GLU C  1 189 ? -53.095 -27.523 27.488  1.00 20.51  ?  189 GLU C N    1 
ATOM   9848  C  CA   . GLU C  1 189 ? -52.351 -26.297 27.248  1.00 18.31  ?  189 GLU C CA   1 
ATOM   9849  C  C    . GLU C  1 189 ? -51.534 -25.890 28.470  1.00 17.55  ?  189 GLU C C    1 
ATOM   9850  O  O    . GLU C  1 189 ? -50.403 -25.414 28.327  1.00 18.76  ?  189 GLU C O    1 
ATOM   9851  C  CB   . GLU C  1 189 ? -53.309 -25.178 26.849  1.00 17.29  ?  189 GLU C CB   1 
ATOM   9852  C  CG   . GLU C  1 189 ? -53.929 -25.420 25.467  1.00 19.42  ?  189 GLU C CG   1 
ATOM   9853  C  CD   . GLU C  1 189 ? -55.216 -24.669 25.219  1.00 18.54  ?  189 GLU C CD   1 
ATOM   9854  O  OE1  . GLU C  1 189 ? -55.392 -23.535 25.720  1.00 20.89  ?  189 GLU C OE1  1 
ATOM   9855  O  OE2  . GLU C  1 189 ? -56.106 -25.235 24.506  1.00 19.84  -1 189 GLU C OE2  1 
ATOM   9856  H  H    . GLU C  1 189 ? -53.945 -27.419 27.567  1.00 24.61  ?  189 GLU C H    1 
ATOM   9857  H  HA   . GLU C  1 189 ? -51.736 -26.441 26.512  1.00 21.97  ?  189 GLU C HA   1 
ATOM   9858  H  HB2  . GLU C  1 189 ? -54.028 -25.127 27.498  1.00 20.75  ?  189 GLU C HB2  1 
ATOM   9859  H  HB3  . GLU C  1 189 ? -52.824 -24.339 26.821  1.00 20.75  ?  189 GLU C HB3  1 
ATOM   9860  H  HG2  . GLU C  1 189 ? -53.292 -25.144 24.789  1.00 23.31  ?  189 GLU C HG2  1 
ATOM   9861  H  HG3  . GLU C  1 189 ? -54.117 -26.367 25.372  1.00 23.31  ?  189 GLU C HG3  1 
ATOM   9862  N  N    . VAL C  1 190 ? -52.104 -26.055 29.671  1.00 18.54  ?  190 VAL C N    1 
ATOM   9863  C  CA   . VAL C  1 190 ? -51.351 -25.775 30.894  1.00 18.25  ?  190 VAL C CA   1 
ATOM   9864  C  C    . VAL C  1 190 ? -50.097 -26.634 30.942  1.00 20.32  ?  190 VAL C C    1 
ATOM   9865  O  O    . VAL C  1 190 ? -49.013 -26.160 31.302  1.00 19.38  ?  190 VAL C O    1 
ATOM   9866  C  CB   . VAL C  1 190 ? -52.224 -25.994 32.133  1.00 20.29  ?  190 VAL C CB   1 
ATOM   9867  C  CG1  . VAL C  1 190 ? -51.393 -25.853 33.442  1.00 22.03  ?  190 VAL C CG1  1 
ATOM   9868  C  CG2  . VAL C  1 190 ? -53.396 -25.018 32.154  1.00 22.79  ?  190 VAL C CG2  1 
ATOM   9869  H  H    . VAL C  1 190 ? -52.911 -26.323 29.800  1.00 22.25  ?  190 VAL C H    1 
ATOM   9870  H  HA   . VAL C  1 190 ? -51.074 -24.846 30.886  1.00 21.90  ?  190 VAL C HA   1 
ATOM   9871  H  HB   . VAL C  1 190 ? -52.587 -26.893 32.106  1.00 24.35  ?  190 VAL C HB   1 
ATOM   9872  H  HG11 . VAL C  1 190 ? -51.976 -25.998 34.203  1.00 26.44  ?  190 VAL C HG11 1 
ATOM   9873  H  HG12 . VAL C  1 190 ? -50.684 -26.515 33.438  1.00 26.44  ?  190 VAL C HG12 1 
ATOM   9874  H  HG13 . VAL C  1 190 ? -51.013 -24.962 33.480  1.00 26.44  ?  190 VAL C HG13 1 
ATOM   9875  H  HG21 . VAL C  1 190 ? -53.928 -25.181 32.948  1.00 27.35  ?  190 VAL C HG21 1 
ATOM   9876  H  HG22 . VAL C  1 190 ? -53.051 -24.111 32.167  1.00 27.35  ?  190 VAL C HG22 1 
ATOM   9877  H  HG23 . VAL C  1 190 ? -53.935 -25.156 31.360  1.00 27.35  ?  190 VAL C HG23 1 
ATOM   9878  N  N    . GLU C  1 191 ? -50.210 -27.899 30.510  1.00 21.74  ?  191 GLU C N    1 
ATOM   9879  C  CA   . GLU C  1 191 ? -49.034 -28.767 30.494  1.00 22.41  ?  191 GLU C CA   1 
ATOM   9880  C  C    . GLU C  1 191 ? -47.939 -28.238 29.570  1.00 20.67  ?  191 GLU C C    1 
ATOM   9881  O  O    . GLU C  1 191 ? -46.757 -28.296 29.912  1.00 20.43  ?  191 GLU C O    1 
ATOM   9882  C  CB   . GLU C  1 191 ? -49.431 -30.200 30.120  1.00 26.60  ?  191 GLU C CB   1 
ATOM   9883  C  CG   . GLU C  1 191 ? -48.247 -31.129 30.164  1.00 29.02  ?  191 GLU C CG   1 
ATOM   9884  C  CD   . GLU C  1 191 ? -48.582 -32.560 29.787  1.00 44.23  ?  191 GLU C CD   1 
ATOM   9885  O  OE1  . GLU C  1 191 ? -49.445 -32.774 28.904  1.00 49.09  ?  191 GLU C OE1  1 
ATOM   9886  O  OE2  . GLU C  1 191 ? -47.959 -33.467 30.377  1.00 46.98  -1 191 GLU C OE2  1 
ATOM   9887  H  H    . GLU C  1 191 ? -50.936 -28.265 30.230  1.00 26.09  ?  191 GLU C H    1 
ATOM   9888  H  HA   . GLU C  1 191 ? -48.665 -28.795 31.390  1.00 26.89  ?  191 GLU C HA   1 
ATOM   9889  H  HB2  . GLU C  1 191 ? -50.094 -30.524 30.751  1.00 31.92  ?  191 GLU C HB2  1 
ATOM   9890  H  HB3  . GLU C  1 191 ? -49.791 -30.209 29.220  1.00 31.92  ?  191 GLU C HB3  1 
ATOM   9891  H  HG2  . GLU C  1 191 ? -47.574 -30.808 29.543  1.00 34.83  ?  191 GLU C HG2  1 
ATOM   9892  H  HG3  . GLU C  1 191 ? -47.887 -31.135 31.065  1.00 34.83  ?  191 GLU C HG3  1 
ATOM   9893  N  N    . VAL C  1 192 ? -48.301 -27.697 28.396  1.00 19.30  ?  192 VAL C N    1 
ATOM   9894  C  CA   . VAL C  1 192 ? -47.308 -27.110 27.512  1.00 18.79  ?  192 VAL C CA   1 
ATOM   9895  C  C    . VAL C  1 192 ? -46.633 -25.893 28.172  1.00 18.06  ?  192 VAL C C    1 
ATOM   9896  O  O    . VAL C  1 192 ? -45.406 -25.722 28.099  1.00 19.28  ?  192 VAL C O    1 
ATOM   9897  C  CB   . VAL C  1 192 ? -47.941 -26.738 26.154  1.00 19.61  ?  192 VAL C CB   1 
ATOM   9898  C  CG1  . VAL C  1 192 ? -46.918 -26.011 25.287  1.00 22.12  ?  192 VAL C CG1  1 
ATOM   9899  C  CG2  . VAL C  1 192 ? -48.497 -27.979 25.464  1.00 22.19  ?  192 VAL C CG2  1 
ATOM   9900  H  H    . VAL C  1 192 ? -49.107 -27.663 28.099  1.00 23.16  ?  192 VAL C H    1 
ATOM   9901  H  HA   . VAL C  1 192 ? -46.618 -27.770 27.342  1.00 22.55  ?  192 VAL C HA   1 
ATOM   9902  H  HB   . VAL C  1 192 ? -48.681 -26.131 26.311  1.00 23.53  ?  192 VAL C HB   1 
ATOM   9903  H  HG11 . VAL C  1 192 ? -47.329 -25.784 24.438  1.00 26.55  ?  192 VAL C HG11 1 
ATOM   9904  H  HG12 . VAL C  1 192 ? -46.635 -25.204 25.744  1.00 26.55  ?  192 VAL C HG12 1 
ATOM   9905  H  HG13 . VAL C  1 192 ? -46.157 -26.594 25.141  1.00 26.55  ?  192 VAL C HG13 1 
ATOM   9906  H  HG21 . VAL C  1 192 ? -48.888 -27.719 24.615  1.00 26.62  ?  192 VAL C HG21 1 
ATOM   9907  H  HG22 . VAL C  1 192 ? -47.775 -28.609 25.317  1.00 26.62  ?  192 VAL C HG22 1 
ATOM   9908  H  HG23 . VAL C  1 192 ? -49.174 -28.379 26.032  1.00 26.62  ?  192 VAL C HG23 1 
ATOM   9909  N  N    . ILE C  1 193 ? -47.423 -25.012 28.797  1.00 17.09  ?  193 ILE C N    1 
ATOM   9910  C  CA   . ILE C  1 193 ? -46.881 -23.841 29.476  1.00 15.64  ?  193 ILE C CA   1 
ATOM   9911  C  C    . ILE C  1 193 ? -45.924 -24.271 30.580  1.00 16.56  ?  193 ILE C C    1 
ATOM   9912  O  O    . ILE C  1 193 ? -44.821 -23.728 30.707  1.00 17.03  ?  193 ILE C O    1 
ATOM   9913  C  CB   . ILE C  1 193 ? -48.009 -22.963 30.042  1.00 19.45  ?  193 ILE C CB   1 
ATOM   9914  C  CG1  . ILE C  1 193 ? -48.854 -22.404 28.900  1.00 17.34  ?  193 ILE C CG1  1 
ATOM   9915  C  CG2  . ILE C  1 193 ? -47.445 -21.805 30.880  1.00 19.69  ?  193 ILE C CG2  1 
ATOM   9916  C  CD1  . ILE C  1 193 ? -50.072 -21.616 29.338  1.00 20.13  ?  193 ILE C CD1  1 
ATOM   9917  H  H    . ILE C  1 193 ? -48.280 -25.075 28.839  1.00 20.50  ?  193 ILE C H    1 
ATOM   9918  H  HA   . ILE C  1 193 ? -46.381 -23.309 28.837  1.00 18.77  ?  193 ILE C HA   1 
ATOM   9919  H  HB   . ILE C  1 193 ? -48.575 -23.511 30.609  1.00 23.34  ?  193 ILE C HB   1 
ATOM   9920  H  HG12 . ILE C  1 193 ? -48.300 -21.814 28.366  1.00 20.80  ?  193 ILE C HG12 1 
ATOM   9921  H  HG13 . ILE C  1 193 ? -49.164 -23.144 28.354  1.00 20.80  ?  193 ILE C HG13 1 
ATOM   9922  H  HG21 . ILE C  1 193 ? -48.182 -21.273 31.220  1.00 23.63  ?  193 ILE C HG21 1 
ATOM   9923  H  HG22 . ILE C  1 193 ? -46.931 -22.170 31.618  1.00 23.63  ?  193 ILE C HG22 1 
ATOM   9924  H  HG23 . ILE C  1 193 ? -46.874 -21.258 30.318  1.00 23.63  ?  193 ILE C HG23 1 
ATOM   9925  H  HD11 . ILE C  1 193 ? -50.544 -21.302 28.552  1.00 24.15  ?  193 ILE C HD11 1 
ATOM   9926  H  HD12 . ILE C  1 193 ? -50.649 -22.193 29.863  1.00 24.15  ?  193 ILE C HD12 1 
ATOM   9927  H  HD13 . ILE C  1 193 ? -49.783 -20.861 29.874  1.00 24.15  ?  193 ILE C HD13 1 
ATOM   9928  N  N    . ARG C  1 194 ? -46.362 -25.221 31.394  1.00 17.59  ?  194 ARG C N    1 
ATOM   9929  C  CA   . ARG C  1 194 ? -45.509 -25.766 32.454  1.00 20.64  ?  194 ARG C CA   1 
ATOM   9930  C  C    . ARG C  1 194 ? -44.211 -26.305 31.878  1.00 21.52  ?  194 ARG C C    1 
ATOM   9931  O  O    . ARG C  1 194 ? -43.119 -26.020 32.388  1.00 20.65  ?  194 ARG C O    1 
ATOM   9932  C  CB   . ARG C  1 194 ? -46.250 -26.851 33.203  1.00 19.59  ?  194 ARG C CB   1 
ATOM   9933  C  CG   . ARG C  1 194 ? -45.474 -27.460 34.387  1.00 23.82  ?  194 ARG C CG   1 
ATOM   9934  C  CD   . ARG C  1 194 ? -46.262 -28.605 35.020  1.00 29.94  ?  194 ARG C CD   1 
ATOM   9935  N  NE   . ARG C  1 194 ? -47.493 -28.178 35.696  1.00 42.75  ?  194 ARG C NE   1 
ATOM   9936  C  CZ   . ARG C  1 194 ? -48.749 -28.456 35.306  1.00 50.91  ?  194 ARG C CZ   1 
ATOM   9937  N  NH1  . ARG C  1 194 ? -49.007 -29.186 34.219  1.00 36.71  1  194 ARG C NH1  1 
ATOM   9938  N  NH2  . ARG C  1 194 ? -49.773 -27.997 36.023  1.00 43.34  ?  194 ARG C NH2  1 
ATOM   9939  H  H    . ARG C  1 194 ? -47.147 -25.570 31.359  1.00 21.11  ?  194 ARG C H    1 
ATOM   9940  H  HA   . ARG C  1 194 ? -45.290 -25.059 33.082  1.00 24.77  ?  194 ARG C HA   1 
ATOM   9941  H  HB2  . ARG C  1 194 ? -47.074 -26.479 33.553  1.00 23.50  ?  194 ARG C HB2  1 
ATOM   9942  H  HB3  . ARG C  1 194 ? -46.454 -27.571 32.585  1.00 23.50  ?  194 ARG C HB3  1 
ATOM   9943  H  HG2  . ARG C  1 194 ? -44.626 -27.810 34.071  1.00 28.59  ?  194 ARG C HG2  1 
ATOM   9944  H  HG3  . ARG C  1 194 ? -45.328 -26.779 35.062  1.00 28.59  ?  194 ARG C HG3  1 
ATOM   9945  H  HD2  . ARG C  1 194 ? -46.509 -29.236 34.326  1.00 35.92  ?  194 ARG C HD2  1 
ATOM   9946  H  HD3  . ARG C  1 194 ? -45.700 -29.044 35.678  1.00 35.92  ?  194 ARG C HD3  1 
ATOM   9947  H  HE   . ARG C  1 194 ? -47.402 -27.705 36.408  1.00 51.30  ?  194 ARG C HE   1 
ATOM   9948  H  HH11 . ARG C  1 194 ? -48.360 -29.492 33.743  1.00 44.06  ?  194 ARG C HH11 1 
ATOM   9949  H  HH12 . ARG C  1 194 ? -49.821 -29.349 33.995  1.00 44.06  ?  194 ARG C HH12 1 
ATOM   9950  H  HH21 . ARG C  1 194 ? -49.628 -27.525 36.728  1.00 52.01  ?  194 ARG C HH21 1 
ATOM   9951  H  HH22 . ARG C  1 194 ? -50.580 -28.171 35.782  1.00 52.01  ?  194 ARG C HH22 1 
ATOM   9952  N  N    . ASP C  1 195 ? -44.306 -27.090 30.807  1.00 21.43  ?  195 ASP C N    1 
ATOM   9953  C  CA   . ASP C  1 195 ? -43.108 -27.671 30.213  1.00 19.09  ?  195 ASP C CA   1 
ATOM   9954  C  C    . ASP C  1 195 ? -42.183 -26.616 29.622  1.00 20.68  ?  195 ASP C C    1 
ATOM   9955  O  O    . ASP C  1 195 ? -40.961 -26.758 29.717  1.00 20.73  ?  195 ASP C O    1 
ATOM   9956  C  CB   . ASP C  1 195 ? -43.491 -28.719 29.172  1.00 22.00  ?  195 ASP C CB   1 
ATOM   9957  C  CG   . ASP C  1 195 ? -43.972 -30.019 29.807  1.00 32.36  ?  195 ASP C CG   1 
ATOM   9958  O  OD1  . ASP C  1 195 ? -43.760 -30.218 31.028  1.00 35.43  ?  195 ASP C OD1  1 
ATOM   9959  O  OD2  . ASP C  1 195 ? -44.587 -30.849 29.095  1.00 32.94  -1 195 ASP C OD2  1 
ATOM   9960  H  H    . ASP C  1 195 ? -45.041 -27.299 30.412  1.00 25.72  ?  195 ASP C H    1 
ATOM   9961  H  HA   . ASP C  1 195 ? -42.613 -28.127 30.912  1.00 22.91  ?  195 ASP C HA   1 
ATOM   9962  H  HB2  . ASP C  1 195 ? -44.208 -28.371 28.619  1.00 26.40  ?  195 ASP C HB2  1 
ATOM   9963  H  HB3  . ASP C  1 195 ? -42.716 -28.920 28.624  1.00 26.40  ?  195 ASP C HB3  1 
ATOM   9964  N  N    . ASN C  1 196 ? -42.729 -25.536 29.026  1.00 19.00  ?  196 ASN C N    1 
ATOM   9965  C  CA   . ASN C  1 196 ? -41.897 -24.422 28.569  1.00 18.30  ?  196 ASN C CA   1 
ATOM   9966  C  C    . ASN C  1 196 ? -41.098 -23.815 29.724  1.00 18.19  ?  196 ASN C C    1 
ATOM   9967  O  O    . ASN C  1 196 ? -39.904 -23.537 29.594  1.00 19.98  ?  196 ASN C O    1 
ATOM   9968  C  CB   . ASN C  1 196 ? -42.745 -23.326 27.928  1.00 17.37  ?  196 ASN C CB   1 
ATOM   9969  C  CG   . ASN C  1 196 ? -43.301 -23.729 26.582  1.00 18.70  ?  196 ASN C CG   1 
ATOM   9970  O  OD1  . ASN C  1 196 ? -42.944 -24.773 25.992  1.00 21.28  ?  196 ASN C OD1  1 
ATOM   9971  N  ND2  . ASN C  1 196 ? -44.206 -22.886 26.078  1.00 18.20  ?  196 ASN C ND2  1 
ATOM   9972  H  H    . ASN C  1 196 ? -43.570 -25.433 28.879  1.00 22.79  ?  196 ASN C H    1 
ATOM   9973  H  HA   . ASN C  1 196 ? -41.269 -24.746 27.904  1.00 21.96  ?  196 ASN C HA   1 
ATOM   9974  H  HB2  . ASN C  1 196 ? -43.492 -23.122 28.513  1.00 20.85  ?  196 ASN C HB2  1 
ATOM   9975  H  HB3  . ASN C  1 196 ? -42.197 -22.536 27.802  1.00 20.85  ?  196 ASN C HB3  1 
ATOM   9976  H  HD21 . ASN C  1 196 ? -44.567 -23.049 25.315  1.00 21.84  ?  196 ASN C HD21 1 
ATOM   9977  H  HD22 . ASN C  1 196 ? -44.427 -22.180 26.516  1.00 21.84  ?  196 ASN C HD22 1 
ATOM   9978  N  N    . PHE C  1 197 ? -41.758 -23.599 30.858  1.00 20.48  ?  197 PHE C N    1 
ATOM   9979  C  CA   . PHE C  1 197 ? -41.064 -23.071 32.030  1.00 19.37  ?  197 PHE C CA   1 
ATOM   9980  C  C    . PHE C  1 197 ? -40.032 -24.070 32.555  1.00 20.69  ?  197 PHE C C    1 
ATOM   9981  O  O    . PHE C  1 197 ? -38.871 -23.691 32.805  1.00 22.46  ?  197 PHE C O    1 
ATOM   9982  C  CB   . PHE C  1 197 ? -42.078 -22.713 33.117  1.00 18.49  ?  197 PHE C CB   1 
ATOM   9983  C  CG   . PHE C  1 197 ? -41.441 -22.242 34.389  1.00 16.99  ?  197 PHE C CG   1 
ATOM   9984  C  CD1  . PHE C  1 197 ? -40.420 -21.311 34.354  1.00 19.39  ?  197 PHE C CD1  1 
ATOM   9985  C  CD2  . PHE C  1 197 ? -41.893 -22.689 35.605  1.00 20.58  ?  197 PHE C CD2  1 
ATOM   9986  C  CE1  . PHE C  1 197 ? -39.792 -20.870 35.540  1.00 18.41  ?  197 PHE C CE1  1 
ATOM   9987  C  CE2  . PHE C  1 197 ? -41.284 -22.222 36.795  1.00 21.46  ?  197 PHE C CE2  1 
ATOM   9988  C  CZ   . PHE C  1 197 ? -40.253 -21.313 36.735  1.00 19.39  ?  197 PHE C CZ   1 
ATOM   9989  H  H    . PHE C  1 197 ? -42.597 -23.747 30.976  1.00 24.58  ?  197 PHE C H    1 
ATOM   9990  H  HA   . PHE C  1 197 ? -40.595 -22.260 31.779  1.00 23.25  ?  197 PHE C HA   1 
ATOM   9991  H  HB2  . PHE C  1 197 ? -42.651 -22.002 32.790  1.00 22.19  ?  197 PHE C HB2  1 
ATOM   9992  H  HB3  . PHE C  1 197 ? -42.609 -23.498 33.322  1.00 22.19  ?  197 PHE C HB3  1 
ATOM   9993  H  HD1  . PHE C  1 197 ? -40.105 -21.011 33.532  1.00 23.27  ?  197 PHE C HD1  1 
ATOM   9994  H  HD2  . PHE C  1 197 ? -42.589 -23.304 35.647  1.00 24.69  ?  197 PHE C HD2  1 
ATOM   9995  H  HE1  . PHE C  1 197 ? -39.104 -20.246 35.503  1.00 22.09  ?  197 PHE C HE1  1 
ATOM   9996  H  HE2  . PHE C  1 197 ? -41.582 -22.531 37.620  1.00 25.75  ?  197 PHE C HE2  1 
ATOM   9997  H  HZ   . PHE C  1 197 ? -39.854 -21.017 37.521  1.00 23.26  ?  197 PHE C HZ   1 
ATOM   9998  N  N    . LEU C  1 198 ? -40.429 -25.342 32.704  1.00 20.07  ?  198 LEU C N    1 
ATOM   9999  C  CA   . LEU C  1 198 ? -39.485 -26.376 33.157  1.00 21.13  ?  198 LEU C CA   1 
ATOM   10000 C  C    . LEU C  1 198 ? -38.259 -26.467 32.236  1.00 24.90  ?  198 LEU C C    1 
ATOM   10001 O  O    . LEU C  1 198 ? -37.133 -26.734 32.705  1.00 23.91  ?  198 LEU C O    1 
ATOM   10002 C  CB   . LEU C  1 198 ? -40.197 -27.733 33.266  1.00 20.61  ?  198 LEU C CB   1 
ATOM   10003 C  CG   . LEU C  1 198 ? -41.223 -27.909 34.383  1.00 21.81  ?  198 LEU C CG   1 
ATOM   10004 C  CD1  . LEU C  1 198 ? -42.103 -29.127 34.245  1.00 28.26  ?  198 LEU C CD1  1 
ATOM   10005 C  CD2  . LEU C  1 198 ? -40.467 -27.992 35.744  1.00 33.16  ?  198 LEU C CD2  1 
ATOM   10006 H  H    . LEU C  1 198 ? -41.225 -25.629 32.552  1.00 24.08  ?  198 LEU C H    1 
ATOM   10007 H  HA   . LEU C  1 198 ? -39.168 -26.139 34.042  1.00 25.36  ?  198 LEU C HA   1 
ATOM   10008 H  HB2  . LEU C  1 198 ? -40.659 -27.896 32.429  1.00 24.73  ?  198 LEU C HB2  1 
ATOM   10009 H  HB3  . LEU C  1 198 ? -39.520 -28.416 33.392  1.00 24.73  ?  198 LEU C HB3  1 
ATOM   10010 H  HG   . LEU C  1 198 ? -41.797 -27.128 34.409  1.00 26.18  ?  198 LEU C HG   1 
ATOM   10011 H  HD11 . LEU C  1 198 ? -42.719 -29.158 34.994  1.00 33.91  ?  198 LEU C HD11 1 
ATOM   10012 H  HD12 . LEU C  1 198 ? -42.596 -29.067 33.412  1.00 33.91  ?  198 LEU C HD12 1 
ATOM   10013 H  HD13 . LEU C  1 198 ? -41.545 -29.921 34.243  1.00 33.91  ?  198 LEU C HD13 1 
ATOM   10014 H  HD21 . LEU C  1 198 ? -41.114 -28.105 36.458  1.00 39.79  ?  198 LEU C HD21 1 
ATOM   10015 H  HD22 . LEU C  1 198 ? -39.862 -28.750 35.724  1.00 39.79  ?  198 LEU C HD22 1 
ATOM   10016 H  HD23 . LEU C  1 198 ? -39.966 -27.172 35.877  1.00 39.79  ?  198 LEU C HD23 1 
ATOM   10017 N  N    . ASN C  1 199 ? -38.426 -26.236 30.932  1.00 23.04  ?  199 ASN C N    1 
ATOM   10018 C  CA   A ASN C  1 199 ? -37.280 -26.307 30.033  0.45 26.29  ?  199 ASN C CA   1 
ATOM   10019 C  CA   B ASN C  1 199 ? -37.285 -26.306 30.027  0.55 26.35  ?  199 ASN C CA   1 
ATOM   10020 C  C    . ASN C  1 199 ? -36.225 -25.274 30.391  1.00 34.71  ?  199 ASN C C    1 
ATOM   10021 O  O    . ASN C  1 199 ? -35.024 -25.534 30.249  1.00 33.67  ?  199 ASN C O    1 
ATOM   10022 C  CB   A ASN C  1 199 ? -37.734 -26.131 28.580  0.45 27.22  ?  199 ASN C CB   1 
ATOM   10023 C  CB   B ASN C  1 199 ? -37.754 -26.134 28.576  0.55 27.10  ?  199 ASN C CB   1 
ATOM   10024 C  CG   A ASN C  1 199 ? -38.445 -27.348 28.049  0.45 26.55  ?  199 ASN C CG   1 
ATOM   10025 C  CG   B ASN C  1 199 ? -36.601 -26.074 27.592  0.55 33.31  ?  199 ASN C CG   1 
ATOM   10026 O  OD1  A ASN C  1 199 ? -38.253 -28.456 28.546  0.45 32.29  ?  199 ASN C OD1  1 
ATOM   10027 O  OD1  B ASN C  1 199 ? -35.920 -27.071 27.357  0.55 39.88  ?  199 ASN C OD1  1 
ATOM   10028 N  ND2  A ASN C  1 199 ? -39.276 -27.154 27.025  0.45 34.45  ?  199 ASN C ND2  1 
ATOM   10029 N  ND2  B ASN C  1 199 ? -36.378 -24.905 27.014  0.55 34.54  ?  199 ASN C ND2  1 
ATOM   10030 H  H    A ASN C  1 199 ? -39.174 -26.040 30.554  0.45 27.65  ?  199 ASN C H    1 
ATOM   10031 H  H    B ASN C  1 199 ? -39.175 -26.040 30.556  0.55 27.65  ?  199 ASN C H    1 
ATOM   10032 H  HA   A ASN C  1 199 ? -36.874 -27.185 30.112  0.45 31.55  ?  199 ASN C HA   1 
ATOM   10033 H  HA   B ASN C  1 199 ? -36.881 -27.185 30.104  0.55 31.62  ?  199 ASN C HA   1 
ATOM   10034 H  HB2  A ASN C  1 199 ? -38.344 -25.379 28.527  0.45 32.67  ?  199 ASN C HB2  1 
ATOM   10035 H  HB2  B ASN C  1 199 ? -38.317 -26.885 28.333  0.55 32.53  ?  199 ASN C HB2  1 
ATOM   10036 H  HB3  A ASN C  1 199 ? -36.957 -25.969 28.022  0.45 32.67  ?  199 ASN C HB3  1 
ATOM   10037 H  HB3  B ASN C  1 199 ? -38.255 -25.306 28.501  0.55 32.53  ?  199 ASN C HB3  1 
ATOM   10038 H  HD21 A ASN C  1 199 ? -39.705 -27.818 26.687  0.45 41.34  ?  199 ASN C HD21 1 
ATOM   10039 H  HD21 B ASN C  1 199 ? -35.736 -24.821 26.449  0.55 41.45  ?  199 ASN C HD21 1 
ATOM   10040 H  HD22 A ASN C  1 199 ? -39.383 -26.364 26.702  0.45 41.34  ?  199 ASN C HD22 1 
ATOM   10041 H  HD22 B ASN C  1 199 ? -36.876 -24.230 27.204  0.55 41.45  ?  199 ASN C HD22 1 
ATOM   10042 N  N    . ARG C  1 200 ? -36.639 -24.100 30.861  1.00 22.88  ?  200 ARG C N    1 
ATOM   10043 C  CA   . ARG C  1 200 ? -35.676 -23.129 31.332  1.00 25.31  ?  200 ARG C CA   1 
ATOM   10044 C  C    . ARG C  1 200 ? -35.141 -23.538 32.699  1.00 23.70  ?  200 ARG C C    1 
ATOM   10045 O  O    . ARG C  1 200 ? -33.936 -23.438 32.948  1.00 24.20  ?  200 ARG C O    1 
ATOM   10046 C  CB   . ARG C  1 200 ? -36.292 -21.733 31.411  1.00 22.54  ?  200 ARG C CB   1 
ATOM   10047 C  CG   . ARG C  1 200 ? -36.720 -21.122 30.076  1.00 25.50  ?  200 ARG C CG   1 
ATOM   10048 C  CD   . ARG C  1 200 ? -35.519 -20.693 29.174  1.00 26.39  ?  200 ARG C CD   1 
ATOM   10049 N  NE   . ARG C  1 200 ? -34.461 -19.936 29.858  1.00 32.44  ?  200 ARG C NE   1 
ATOM   10050 C  CZ   . ARG C  1 200 ? -34.423 -18.605 30.009  1.00 35.65  ?  200 ARG C CZ   1 
ATOM   10051 N  NH1  . ARG C  1 200 ? -35.397 -17.808 29.549  1.00 34.75  1  200 ARG C NH1  1 
ATOM   10052 N  NH2  . ARG C  1 200 ? -33.389 -18.055 30.632  1.00 37.24  ?  200 ARG C NH2  1 
ATOM   10053 H  H    . ARG C  1 200 ? -37.460 -23.851 30.916  1.00 27.45  ?  200 ARG C H    1 
ATOM   10054 H  HA   . ARG C  1 200 ? -34.930 -23.096 30.713  1.00 30.38  ?  200 ARG C HA   1 
ATOM   10055 H  HB2  . ARG C  1 200 ? -37.079 -21.777 31.975  1.00 27.05  ?  200 ARG C HB2  1 
ATOM   10056 H  HB3  . ARG C  1 200 ? -35.642 -21.133 31.809  1.00 27.05  ?  200 ARG C HB3  1 
ATOM   10057 H  HG2  . ARG C  1 200 ? -37.242 -21.776 29.585  1.00 30.60  ?  200 ARG C HG2  1 
ATOM   10058 H  HG3  . ARG C  1 200 ? -37.258 -20.334 30.250  1.00 30.60  ?  200 ARG C HG3  1 
ATOM   10059 H  HD2  . ARG C  1 200 ? -35.113 -21.491 28.802  1.00 31.66  ?  200 ARG C HD2  1 
ATOM   10060 H  HD3  . ARG C  1 200 ? -35.858 -20.136 28.455  1.00 31.66  ?  200 ARG C HD3  1 
ATOM   10061 H  HE   . ARG C  1 200 ? -33.809 -20.387 30.190  1.00 38.92  ?  200 ARG C HE   1 
ATOM   10062 H  HH11 . ARG C  1 200 ? -36.072 -18.146 29.138  1.00 41.70  ?  200 ARG C HH11 1 
ATOM   10063 H  HH12 . ARG C  1 200 ? -35.345 -16.957 29.664  1.00 41.70  ?  200 ARG C HH12 1 
ATOM   10064 H  HH21 . ARG C  1 200 ? -32.757 -18.551 30.938  1.00 44.69  ?  200 ARG C HH21 1 
ATOM   10065 H  HH22 . ARG C  1 200 ? -33.358 -17.202 30.743  1.00 44.69  ?  200 ARG C HH22 1 
ATOM   10066 N  N    . LEU C  1 201 ? -36.011 -24.005 33.590  1.00 21.58  ?  201 LEU C N    1 
ATOM   10067 C  CA   . LEU C  1 201 ? -35.571 -24.367 34.938  1.00 21.46  ?  201 LEU C CA   1 
ATOM   10068 C  C    . LEU C  1 201 ? -34.603 -25.525 34.932  1.00 26.54  ?  201 LEU C C    1 
ATOM   10069 O  O    . LEU C  1 201 ? -33.700 -25.594 35.777  1.00 26.10  ?  201 LEU C O    1 
ATOM   10070 C  CB   . LEU C  1 201 ? -36.755 -24.773 35.799  1.00 27.08  ?  201 LEU C CB   1 
ATOM   10071 C  CG   . LEU C  1 201 ? -37.555 -23.732 36.527  1.00 31.72  ?  201 LEU C CG   1 
ATOM   10072 C  CD1  . LEU C  1 201 ? -38.475 -24.501 37.474  1.00 26.83  ?  201 LEU C CD1  1 
ATOM   10073 C  CD2  . LEU C  1 201 ? -36.679 -22.747 37.295  1.00 25.32  ?  201 LEU C CD2  1 
ATOM   10074 H  H    . LEU C  1 201 ? -36.851 -24.120 33.444  1.00 25.89  ?  201 LEU C H    1 
ATOM   10075 H  HA   . LEU C  1 201 ? -35.136 -23.605 35.352  1.00 25.75  ?  201 LEU C HA   1 
ATOM   10076 H  HB2  . LEU C  1 201 ? -37.380 -25.247 35.228  1.00 32.50  ?  201 LEU C HB2  1 
ATOM   10077 H  HB3  . LEU C  1 201 ? -36.426 -25.387 36.474  1.00 32.50  ?  201 LEU C HB3  1 
ATOM   10078 H  HG   . LEU C  1 201 ? -38.101 -23.238 35.896  1.00 38.06  ?  201 LEU C HG   1 
ATOM   10079 H  HD11 . LEU C  1 201 ? -39.016 -23.868 37.971  1.00 32.20  ?  201 LEU C HD11 1 
ATOM   10080 H  HD12 . LEU C  1 201 ? -39.046 -25.087 36.952  1.00 32.20  ?  201 LEU C HD12 1 
ATOM   10081 H  HD13 . LEU C  1 201 ? -37.933 -25.025 38.085  1.00 32.20  ?  201 LEU C HD13 1 
ATOM   10082 H  HD21 . LEU C  1 201 ? -37.248 -22.102 37.743  1.00 30.38  ?  201 LEU C HD21 1 
ATOM   10083 H  HD22 . LEU C  1 201 ? -36.154 -23.235 37.949  1.00 30.38  ?  201 LEU C HD22 1 
ATOM   10084 H  HD23 . LEU C  1 201 ? -36.092 -22.293 36.671  1.00 30.38  ?  201 LEU C HD23 1 
ATOM   10085 N  N    . ASP C  1 202 ? -34.824 -26.497 34.057  1.00 25.26  ?  202 ASP C N    1 
ATOM   10086 C  CA   . ASP C  1 202 ? -33.938 -27.648 34.055  1.00 25.04  ?  202 ASP C CA   1 
ATOM   10087 C  C    . ASP C  1 202 ? -32.474 -27.232 33.908  1.00 35.73  ?  202 ASP C C    1 
ATOM   10088 O  O    . ASP C  1 202 ? -31.591 -27.981 34.336  1.00 35.78  ?  202 ASP C O    1 
ATOM   10089 C  CB   . ASP C  1 202 ? -34.346 -28.614 32.951  1.00 27.64  ?  202 ASP C CB   1 
ATOM   10090 C  CG   . ASP C  1 202 ? -35.581 -29.431 33.307  1.00 29.44  ?  202 ASP C CG   1 
ATOM   10091 O  OD1  . ASP C  1 202 ? -35.867 -29.681 34.506  1.00 29.18  ?  202 ASP C OD1  1 
ATOM   10092 O  OD2  . ASP C  1 202 ? -36.263 -29.862 32.352  1.00 30.42  -1 202 ASP C OD2  1 
ATOM   10093 H  H    . ASP C  1 202 ? -35.457 -26.516 33.474  1.00 30.31  ?  202 ASP C H    1 
ATOM   10094 H  HA   . ASP C  1 202 ? -34.030 -28.112 34.902  1.00 30.05  ?  202 ASP C HA   1 
ATOM   10095 H  HB2  . ASP C  1 202 ? -34.542 -28.110 32.146  1.00 33.17  ?  202 ASP C HB2  1 
ATOM   10096 H  HB3  . ASP C  1 202 ? -33.616 -29.231 32.786  1.00 33.17  ?  202 ASP C HB3  1 
ATOM   10097 N  N    . GLN C  1 203 ? -32.190 -26.047 33.352  1.00 37.59  ?  203 GLN C N    1 
ATOM   10098 C  CA   . GLN C  1 203 ? -30.809 -25.594 33.151  1.00 34.21  ?  203 GLN C CA   1 
ATOM   10099 C  C    . GLN C  1 203 ? -30.236 -24.759 34.292  1.00 45.67  ?  203 GLN C C    1 
ATOM   10100 O  O    . GLN C  1 203 ? -29.015 -24.545 34.323  1.00 46.82  ?  203 GLN C O    1 
ATOM   10101 C  CB   . GLN C  1 203 ? -30.711 -24.787 31.859  1.00 43.97  ?  203 GLN C CB   1 
ATOM   10102 C  CG   . GLN C  1 203 ? -31.091 -25.587 30.647  1.00 36.23  ?  203 GLN C CG   1 
ATOM   10103 C  CD   . GLN C  1 203 ? -30.190 -26.823 30.448  1.00 46.95  ?  203 GLN C CD   1 
ATOM   10104 O  OE1  . GLN C  1 203 ? -28.989 -26.793 30.752  1.00 45.73  ?  203 GLN C OE1  1 
ATOM   10105 N  NE2  . GLN C  1 203 ? -30.774 -27.914 29.943  1.00 48.51  ?  203 GLN C NE2  1 
ATOM   10106 H  H    . GLN C  1 203 ? -32.783 -25.487 33.081  1.00 45.10  ?  203 GLN C H    1 
ATOM   10107 H  HA   . GLN C  1 203 ? -30.242 -26.375 33.050  1.00 41.06  ?  203 GLN C HA   1 
ATOM   10108 H  HB2  . GLN C  1 203 ? -31.309 -24.025 31.916  1.00 52.76  ?  203 GLN C HB2  1 
ATOM   10109 H  HB3  . GLN C  1 203 ? -29.797 -24.483 31.744  1.00 52.76  ?  203 GLN C HB3  1 
ATOM   10110 H  HG2  . GLN C  1 203 ? -32.006 -25.895 30.745  1.00 43.48  ?  203 GLN C HG2  1 
ATOM   10111 H  HG3  . GLN C  1 203 ? -31.011 -25.027 29.859  1.00 43.48  ?  203 GLN C HG3  1 
ATOM   10112 H  HE21 . GLN C  1 203 ? -31.611 -27.901 29.747  1.00 58.21  ?  203 GLN C HE21 1 
ATOM   10113 H  HE22 . GLN C  1 203 ? -30.312 -28.628 29.814  1.00 58.21  ?  203 GLN C HE22 1 
ATOM   10114 N  N    . THR C  1 204 ? -31.038 -24.315 35.230  1.00 34.82  ?  204 THR C N    1 
ATOM   10115 C  CA   . THR C  1 204 ? -30.541 -23.364 36.231  1.00 26.87  ?  204 THR C CA   1 
ATOM   10116 C  C    . THR C  1 204 ? -30.880 -23.752 37.657  1.00 36.68  ?  204 THR C C    1 
ATOM   10117 O  O    . THR C  1 204 ? -30.095 -23.484 38.569  1.00 32.80  ?  204 THR C O    1 
ATOM   10118 C  CB   . THR C  1 204 ? -31.151 -22.006 35.919  1.00 31.48  ?  204 THR C CB   1 
ATOM   10119 O  OG1  . THR C  1 204 ? -32.587 -22.110 35.993  1.00 33.96  ?  204 THR C OG1  1 
ATOM   10120 C  CG2  . THR C  1 204 ? -30.772 -21.558 34.539  1.00 30.79  ?  204 THR C CG2  1 
ATOM   10121 H  H    . THR C  1 204 ? -31.864 -24.535 35.320  1.00 41.78  ?  204 THR C H    1 
ATOM   10122 H  HA   . THR C  1 204 ? -29.576 -23.292 36.155  1.00 32.25  ?  204 THR C HA   1 
ATOM   10123 H  HB   . THR C  1 204 ? -30.835 -21.349 36.559  1.00 37.78  ?  204 THR C HB   1 
ATOM   10124 H  HG1  . THR C  1 204 ? -32.938 -21.367 35.822  1.00 40.76  ?  204 THR C HG1  1 
ATOM   10125 H  HG21 . THR C  1 204 ? -31.167 -20.692 34.352  1.00 36.95  ?  204 THR C HG21 1 
ATOM   10126 H  HG22 . THR C  1 204 ? -29.808 -21.488 34.466  1.00 36.95  ?  204 THR C HG22 1 
ATOM   10127 H  HG23 . THR C  1 204 ? -31.092 -22.198 33.884  1.00 36.95  ?  204 THR C HG23 1 
ATOM   10128 N  N    . LYS C  1 205 ? -32.042 -24.347 37.873  1.00 27.68  ?  205 LYS C N    1 
ATOM   10129 C  CA   . LYS C  1 205 ? -32.546 -24.666 39.205  1.00 33.85  ?  205 LYS C CA   1 
ATOM   10130 C  C    . LYS C  1 205 ? -33.262 -25.995 39.097  1.00 26.25  ?  205 LYS C C    1 
ATOM   10131 O  O    . LYS C  1 205 ? -34.483 -26.097 39.258  1.00 24.47  ?  205 LYS C O    1 
ATOM   10132 C  CB   . LYS C  1 205 ? -33.456 -23.559 39.755  1.00 38.86  ?  205 LYS C CB   1 
ATOM   10133 C  CG   . LYS C  1 205 ? -32.717 -22.363 40.375  1.00 33.75  ?  205 LYS C CG   1 
ATOM   10134 C  CD   . LYS C  1 205 ? -31.635 -22.872 41.342  1.00 44.34  ?  205 LYS C CD   1 
ATOM   10135 C  CE   . LYS C  1 205 ? -31.051 -21.867 42.324  1.00 41.17  ?  205 LYS C CE   1 
ATOM   10136 N  NZ   . LYS C  1 205 ? -29.807 -22.512 42.933  1.00 36.22  1  205 LYS C NZ   1 
ATOM   10137 H  H    . LYS C  1 205 ? -32.577 -24.586 37.244  1.00 33.22  ?  205 LYS C H    1 
ATOM   10138 H  HA   . LYS C  1 205 ? -31.798 -24.772 39.812  1.00 40.62  ?  205 LYS C HA   1 
ATOM   10139 H  HB2  . LYS C  1 205 ? -34.004 -23.220 39.029  1.00 46.63  ?  205 LYS C HB2  1 
ATOM   10140 H  HB3  . LYS C  1 205 ? -34.025 -23.940 40.441  1.00 46.63  ?  205 LYS C HB3  1 
ATOM   10141 H  HG2  . LYS C  1 205 ? -32.289 -21.845 39.676  1.00 40.50  ?  205 LYS C HG2  1 
ATOM   10142 H  HG3  . LYS C  1 205 ? -33.343 -21.814 40.872  1.00 40.50  ?  205 LYS C HG3  1 
ATOM   10143 H  HD2  . LYS C  1 205 ? -32.016 -23.594 41.867  1.00 53.21  ?  205 LYS C HD2  1 
ATOM   10144 H  HD3  . LYS C  1 205 ? -30.897 -23.216 40.815  1.00 53.21  ?  205 LYS C HD3  1 
ATOM   10145 H  HE2  . LYS C  1 205 ? -30.794 -21.056 41.858  1.00 49.40  ?  205 LYS C HE2  1 
ATOM   10146 H  HE3  . LYS C  1 205 ? -31.690 -21.679 43.029  1.00 49.40  ?  205 LYS C HE3  1 
ATOM   10147 H  HZ1  . LYS C  1 205 ? -30.029 -23.265 43.353  1.00 43.46  ?  205 LYS C HZ1  1 
ATOM   10148 H  HZ2  . LYS C  1 205 ? -29.218 -22.701 42.293  1.00 43.46  ?  205 LYS C HZ2  1 
ATOM   10149 H  HZ3  . LYS C  1 205 ? -29.431 -21.956 43.517  1.00 43.46  ?  205 LYS C HZ3  1 
ATOM   10150 N  N    . PRO C  1 206 ? -32.500 -27.072 38.886  1.00 31.02  ?  206 PRO C N    1 
ATOM   10151 C  CA   . PRO C  1 206 ? -33.114 -28.403 38.822  1.00 26.05  ?  206 PRO C CA   1 
ATOM   10152 C  C    . PRO C  1 206 ? -33.941 -28.767 40.034  1.00 27.62  ?  206 PRO C C    1 
ATOM   10153 O  O    . PRO C  1 206 ? -34.902 -29.516 39.868  1.00 26.22  ?  206 PRO C O    1 
ATOM   10154 C  CB   . PRO C  1 206 ? -31.906 -29.347 38.675  1.00 36.54  ?  206 PRO C CB   1 
ATOM   10155 C  CG   . PRO C  1 206 ? -30.781 -28.504 38.266  1.00 42.32  ?  206 PRO C CG   1 
ATOM   10156 C  CD   . PRO C  1 206 ? -31.037 -27.128 38.812  1.00 33.46  ?  206 PRO C CD   1 
ATOM   10157 H  HA   . PRO C  1 206 ? -33.669 -28.474 38.029  1.00 31.26  ?  206 PRO C HA   1 
ATOM   10158 H  HB2  . PRO C  1 206 ? -31.720 -29.772 39.528  1.00 43.84  ?  206 PRO C HB2  1 
ATOM   10159 H  HB3  . PRO C  1 206 ? -32.096 -30.014 37.997  1.00 43.84  ?  206 PRO C HB3  1 
ATOM   10160 H  HG2  . PRO C  1 206 ? -29.959 -28.865 38.633  1.00 50.79  ?  206 PRO C HG2  1 
ATOM   10161 H  HG3  . PRO C  1 206 ? -30.735 -28.479 37.297  1.00 50.79  ?  206 PRO C HG3  1 
ATOM   10162 H  HD2  . PRO C  1 206 ? -30.649 -27.036 39.697  1.00 40.16  ?  206 PRO C HD2  1 
ATOM   10163 H  HD3  . PRO C  1 206 ? -30.702 -26.453 38.203  1.00 40.16  ?  206 PRO C HD3  1 
ATOM   10164 N  N    . LYS C  1 207 ? -33.579 -28.311 41.257  1.00 27.13  ?  207 LYS C N    1 
ATOM   10165 C  CA   . LYS C  1 207 ? -34.390 -28.599 42.440  1.00 36.10  ?  207 LYS C CA   1 
ATOM   10166 C  C    . LYS C  1 207 ? -35.788 -28.048 42.284  1.00 21.83  ?  207 LYS C C    1 
ATOM   10167 O  O    . LYS C  1 207 ? -36.755 -28.674 42.713  1.00 29.39  ?  207 LYS C O    1 
ATOM   10168 C  CB   . LYS C  1 207 ? -33.777 -27.985 43.709  1.00 37.16  ?  207 LYS C CB   1 
ATOM   10169 C  CG   . LYS C  1 207 ? -32.592 -28.669 44.213  1.00 34.11  ?  207 LYS C CG   1 
ATOM   10170 C  CD   . LYS C  1 207 ? -31.957 -27.887 45.366  1.00 30.65  ?  207 LYS C CD   1 
ATOM   10171 C  CE   . LYS C  1 207 ? -30.599 -28.440 45.658  1.00 37.17  ?  207 LYS C CE   1 
ATOM   10172 N  NZ   . LYS C  1 207 ? -29.950 -27.693 46.767  1.00 34.50  1  207 LYS C NZ   1 
ATOM   10173 H  H    . LYS C  1 207 ? -32.877 -27.840 41.414  1.00 32.56  ?  207 LYS C H    1 
ATOM   10174 H  HA   . LYS C  1 207 ? -34.450 -29.559 42.562  1.00 43.31  ?  207 LYS C HA   1 
ATOM   10175 H  HB2  . LYS C  1 207 ? -33.526 -27.067 43.518  1.00 44.59  ?  207 LYS C HB2  1 
ATOM   10176 H  HB3  . LYS C  1 207 ? -34.445 -27.999 44.413  1.00 44.59  ?  207 LYS C HB3  1 
ATOM   10177 H  HG2  . LYS C  1 207 ? -32.842 -29.547 44.541  1.00 40.93  ?  207 LYS C HG2  1 
ATOM   10178 H  HG3  . LYS C  1 207 ? -31.938 -28.748 43.501  1.00 40.93  ?  207 LYS C HG3  1 
ATOM   10179 H  HD2  . LYS C  1 207 ? -31.865 -26.955 45.116  1.00 36.77  ?  207 LYS C HD2  1 
ATOM   10180 H  HD3  . LYS C  1 207 ? -32.505 -27.976 46.161  1.00 36.77  ?  207 LYS C HD3  1 
ATOM   10181 H  HE2  . LYS C  1 207 ? -30.680 -29.370 45.922  1.00 44.60  ?  207 LYS C HE2  1 
ATOM   10182 H  HE3  . LYS C  1 207 ? -30.042 -28.360 44.868  1.00 44.60  ?  207 LYS C HE3  1 
ATOM   10183 H  HZ1  . LYS C  1 207 ? -29.864 -26.835 46.546  1.00 41.40  ?  207 LYS C HZ1  1 
ATOM   10184 H  HZ2  . LYS C  1 207 ? -30.445 -27.753 47.505  1.00 41.40  ?  207 LYS C HZ2  1 
ATOM   10185 H  HZ3  . LYS C  1 207 ? -29.144 -28.032 46.931  1.00 41.40  ?  207 LYS C HZ3  1 
ATOM   10186 N  N    . LEU C  1 208 ? -35.893 -26.832 41.733  1.00 25.43  ?  208 LEU C N    1 
ATOM   10187 C  CA   . LEU C  1 208 ? -37.199 -26.229 41.556  1.00 25.18  ?  208 LEU C CA   1 
ATOM   10188 C  C    . LEU C  1 208 ? -37.991 -27.012 40.523  1.00 22.46  ?  208 LEU C C    1 
ATOM   10189 O  O    . LEU C  1 208 ? -39.186 -27.229 40.694  1.00 23.24  ?  208 LEU C O    1 
ATOM   10190 C  CB   . LEU C  1 208 ? -37.080 -24.766 41.126  1.00 26.05  ?  208 LEU C CB   1 
ATOM   10191 C  CG   . LEU C  1 208 ? -36.439 -23.748 42.087  1.00 23.68  ?  208 LEU C CG   1 
ATOM   10192 C  CD1  . LEU C  1 208 ? -36.338 -22.361 41.424  1.00 28.08  ?  208 LEU C CD1  1 
ATOM   10193 C  CD2  . LEU C  1 208 ? -37.232 -23.675 43.323  1.00 24.48  ?  208 LEU C CD2  1 
ATOM   10194 H  H    . LEU C  1 208 ? -35.233 -26.352 41.461  1.00 30.51  ?  208 LEU C H    1 
ATOM   10195 H  HA   . LEU C  1 208 ? -37.682 -26.260 42.397  1.00 30.22  ?  208 LEU C HA   1 
ATOM   10196 H  HB2  . LEU C  1 208 ? -36.558 -24.742 40.309  1.00 31.26  ?  208 LEU C HB2  1 
ATOM   10197 H  HB3  . LEU C  1 208 ? -37.974 -24.442 40.935  1.00 31.26  ?  208 LEU C HB3  1 
ATOM   10198 H  HG   . LEU C  1 208 ? -35.544 -24.043 42.315  1.00 28.41  ?  208 LEU C HG   1 
ATOM   10199 H  HD11 . LEU C  1 208 ? -35.932 -21.741 42.050  1.00 33.70  ?  208 LEU C HD11 1 
ATOM   10200 H  HD12 . LEU C  1 208 ? -35.791 -22.432 40.626  1.00 33.70  ?  208 LEU C HD12 1 
ATOM   10201 H  HD13 . LEU C  1 208 ? -37.229 -22.058 41.189  1.00 33.70  ?  208 LEU C HD13 1 
ATOM   10202 H  HD21 . LEU C  1 208 ? -36.822 -23.032 43.923  1.00 29.38  ?  208 LEU C HD21 1 
ATOM   10203 H  HD22 . LEU C  1 208 ? -38.134 -23.394 43.103  1.00 29.38  ?  208 LEU C HD22 1 
ATOM   10204 H  HD23 . LEU C  1 208 ? -37.250 -24.551 43.739  1.00 29.38  ?  208 LEU C HD23 1 
ATOM   10205 N  N    . ALA C  1 209 ? -37.337 -27.427 39.436  1.00 22.47  ?  209 ALA C N    1 
ATOM   10206 C  CA   . ALA C  1 209 ? -38.036 -28.232 38.431  1.00 19.56  ?  209 ALA C CA   1 
ATOM   10207 C  C    . ALA C  1 209 ? -38.566 -29.523 39.040  1.00 22.65  ?  209 ALA C C    1 
ATOM   10208 O  O    . ALA C  1 209 ? -39.707 -29.933 38.772  1.00 25.07  ?  209 ALA C O    1 
ATOM   10209 C  CB   . ALA C  1 209 ? -37.089 -28.524 37.256  1.00 21.49  ?  209 ALA C CB   1 
ATOM   10210 H  H    . ALA C  1 209 ? -36.511 -27.262 39.260  1.00 26.96  ?  209 ALA C H    1 
ATOM   10211 H  HA   . ALA C  1 209 ? -38.792 -27.727 38.091  1.00 23.48  ?  209 ALA C HA   1 
ATOM   10212 H  HB1  . ALA C  1 209 ? -37.561 -29.057 36.596  1.00 25.79  ?  209 ALA C HB1  1 
ATOM   10213 H  HB2  . ALA C  1 209 ? -36.806 -27.684 36.862  1.00 25.79  ?  209 ALA C HB2  1 
ATOM   10214 H  HB3  . ALA C  1 209 ? -36.318 -29.012 37.586  1.00 25.79  ?  209 ALA C HB3  1 
ATOM   10215 N  N    . ASP C  1 210 ? -37.753 -30.160 39.892  1.00 24.06  ?  210 ASP C N    1 
ATOM   10216 C  CA   . ASP C  1 210 ? -38.138 -31.430 40.501  1.00 28.70  ?  210 ASP C CA   1 
ATOM   10217 C  C    . ASP C  1 210 ? -39.368 -31.285 41.403  1.00 32.19  ?  210 ASP C C    1 
ATOM   10218 O  O    . ASP C  1 210 ? -40.267 -32.132 41.368  1.00 36.71  ?  210 ASP C O    1 
ATOM   10219 C  CB   . ASP C  1 210 ? -36.947 -31.999 41.267  1.00 29.94  ?  210 ASP C CB   1 
ATOM   10220 C  CG   . ASP C  1 210 ? -37.259 -33.318 41.951  1.00 49.56  ?  210 ASP C CG   1 
ATOM   10221 O  OD1  . ASP C  1 210 ? -37.795 -34.231 41.283  1.00 44.92  ?  210 ASP C OD1  1 
ATOM   10222 O  OD2  . ASP C  1 210 ? -36.949 -33.439 43.155  1.00 54.11  -1 210 ASP C OD2  1 
ATOM   10223 H  H    . ASP C  1 210 ? -36.977 -29.875 40.130  1.00 28.87  ?  210 ASP C H    1 
ATOM   10224 H  HA   . ASP C  1 210 ? -38.363 -32.057 39.797  1.00 34.44  ?  210 ASP C HA   1 
ATOM   10225 H  HB2  . ASP C  1 210 ? -36.216 -32.149 40.647  1.00 35.92  ?  210 ASP C HB2  1 
ATOM   10226 H  HB3  . ASP C  1 210 ? -36.678 -31.364 41.949  1.00 35.92  ?  210 ASP C HB3  1 
ATOM   10227 N  N    . ILE C  1 211 ? -39.460 -30.188 42.163  1.00 30.82  ?  211 ILE C N    1 
ATOM   10228 C  CA   . ILE C  1 211 ? -40.633 -29.971 43.009  1.00 38.87  ?  211 ILE C CA   1 
ATOM   10229 C  C    . ILE C  1 211 ? -41.887 -29.811 42.150  1.00 39.06  ?  211 ILE C C    1 
ATOM   10230 O  O    . ILE C  1 211 ? -42.939 -30.391 42.438  1.00 39.57  ?  211 ILE C O    1 
ATOM   10231 C  CB   . ILE C  1 211 ? -40.422 -28.748 43.933  1.00 36.52  ?  211 ILE C CB   1 
ATOM   10232 C  CG1  . ILE C  1 211 ? -39.130 -28.854 44.744  1.00 50.07  ?  211 ILE C CG1  1 
ATOM   10233 C  CG2  . ILE C  1 211 ? -41.566 -28.653 44.907  1.00 44.16  ?  211 ILE C CG2  1 
ATOM   10234 C  CD1  . ILE C  1 211 ? -38.706 -27.527 45.364  1.00 52.10  ?  211 ILE C CD1  1 
ATOM   10235 H  H    . ILE C  1 211 ? -38.867 -29.566 42.206  1.00 36.98  ?  211 ILE C H    1 
ATOM   10236 H  HA   . ILE C  1 211 ? -40.759 -30.750 43.573  1.00 46.64  ?  211 ILE C HA   1 
ATOM   10237 H  HB   . ILE C  1 211 ? -40.394 -27.943 43.394  1.00 43.82  ?  211 ILE C HB   1 
ATOM   10238 H  HG12 . ILE C  1 211 ? -39.260 -29.492 45.462  1.00 60.08  ?  211 ILE C HG12 1 
ATOM   10239 H  HG13 . ILE C  1 211 ? -38.415 -29.153 44.160  1.00 60.08  ?  211 ILE C HG13 1 
ATOM   10240 H  HG21 . ILE C  1 211 ? -41.427 -27.885 45.483  1.00 52.99  ?  211 ILE C HG21 1 
ATOM   10241 H  HG22 . ILE C  1 211 ? -42.394 -28.550 44.411  1.00 52.99  ?  211 ILE C HG22 1 
ATOM   10242 H  HG23 . ILE C  1 211 ? -41.597 -29.464 45.438  1.00 52.99  ?  211 ILE C HG23 1 
ATOM   10243 H  HD11 . ILE C  1 211 ? -37.884 -27.661 45.863  1.00 62.52  ?  211 ILE C HD11 1 
ATOM   10244 H  HD12 . ILE C  1 211 ? -38.563 -26.880 44.657  1.00 62.52  ?  211 ILE C HD12 1 
ATOM   10245 H  HD13 . ILE C  1 211 ? -39.408 -27.219 45.959  1.00 62.52  ?  211 ILE C HD13 1 
ATOM   10246 N  N    . ILE C  1 212 ? -41.798 -29.029 41.077  1.00 25.90  ?  212 ILE C N    1 
ATOM   10247 C  CA   . ILE C  1 212 ? -42.959 -28.823 40.219  1.00 26.58  ?  212 ILE C CA   1 
ATOM   10248 C  C    . ILE C  1 212 ? -43.415 -30.139 39.596  1.00 37.54  ?  212 ILE C C    1 
ATOM   10249 O  O    . ILE C  1 212 ? -44.618 -30.401 39.477  1.00 36.99  ?  212 ILE C O    1 
ATOM   10250 C  CB   . ILE C  1 212 ? -42.638 -27.780 39.139  1.00 26.32  ?  212 ILE C CB   1 
ATOM   10251 C  CG1  . ILE C  1 212 ? -42.527 -26.384 39.785  1.00 23.77  ?  212 ILE C CG1  1 
ATOM   10252 C  CG2  . ILE C  1 212 ? -43.698 -27.814 38.021  1.00 26.87  ?  212 ILE C CG2  1 
ATOM   10253 C  CD1  . ILE C  1 212 ? -41.978 -25.344 38.872  1.00 27.16  ?  212 ILE C CD1  1 
ATOM   10254 H  H    . ILE C  1 212 ? -41.089 -28.613 40.827  1.00 31.07  ?  212 ILE C H    1 
ATOM   10255 H  HA   . ILE C  1 212 ? -43.690 -28.480 40.756  1.00 31.89  ?  212 ILE C HA   1 
ATOM   10256 H  HB   . ILE C  1 212 ? -41.778 -28.003 38.748  1.00 31.59  ?  212 ILE C HB   1 
ATOM   10257 H  HG12 . ILE C  1 212 ? -43.411 -26.098 40.065  1.00 28.52  ?  212 ILE C HG12 1 
ATOM   10258 H  HG13 . ILE C  1 212 ? -41.941 -26.442 40.556  1.00 28.52  ?  212 ILE C HG13 1 
ATOM   10259 H  HG21 . ILE C  1 212 ? -43.473 -27.148 37.353  1.00 32.24  ?  212 ILE C HG21 1 
ATOM   10260 H  HG22 . ILE C  1 212 ? -43.705 -28.697 37.620  1.00 32.24  ?  212 ILE C HG22 1 
ATOM   10261 H  HG23 . ILE C  1 212 ? -44.567 -27.618 38.405  1.00 32.24  ?  212 ILE C HG23 1 
ATOM   10262 H  HD11 . ILE C  1 212 ? -41.938 -24.498 39.346  1.00 32.59  ?  212 ILE C HD11 1 
ATOM   10263 H  HD12 . ILE C  1 212 ? -41.088 -25.609 38.592  1.00 32.59  ?  212 ILE C HD12 1 
ATOM   10264 H  HD13 . ILE C  1 212 ? -42.559 -25.264 38.100  1.00 32.59  ?  212 ILE C HD13 1 
ATOM   10265 N  N    . ARG C  1 213 ? -42.466 -30.963 39.145  1.00 34.04  ?  213 ARG C N    1 
ATOM   10266 C  CA   . ARG C  1 213 ? -42.824 -32.238 38.522  1.00 39.52  ?  213 ARG C CA   1 
ATOM   10267 C  C    . ARG C  1 213 ? -43.392 -33.214 39.539  1.00 44.87  ?  213 ARG C C    1 
ATOM   10268 O  O    . ARG C  1 213 ? -44.370 -33.915 39.257  1.00 57.23  ?  213 ARG C O    1 
ATOM   10269 C  CB   . ARG C  1 213 ? -41.600 -32.868 37.856  1.00 39.03  ?  213 ARG C CB   1 
ATOM   10270 C  CG   . ARG C  1 213 ? -41.179 -32.196 36.594  1.00 32.07  ?  213 ARG C CG   1 
ATOM   10271 C  CD   . ARG C  1 213 ? -40.272 -33.088 35.760  1.00 33.18  ?  213 ARG C CD   1 
ATOM   10272 N  NE   . ARG C  1 213 ? -40.005 -32.472 34.467  1.00 30.40  ?  213 ARG C NE   1 
ATOM   10273 C  CZ   . ARG C  1 213 ? -38.950 -31.716 34.192  1.00 26.18  ?  213 ARG C CZ   1 
ATOM   10274 N  NH1  . ARG C  1 213 ? -38.017 -31.477 35.119  1.00 25.93  1  213 ARG C NH1  1 
ATOM   10275 N  NH2  . ARG C  1 213 ? -38.826 -31.194 32.984  1.00 32.28  ?  213 ARG C NH2  1 
ATOM   10276 H  H    . ARG C  1 213 ? -41.621 -30.809 39.186  1.00 40.85  ?  213 ARG C H    1 
ATOM   10277 H  HA   . ARG C  1 213 ? -43.496 -32.084 37.840  1.00 47.43  ?  213 ARG C HA   1 
ATOM   10278 H  HB2  . ARG C  1 213 ? -40.854 -32.829 38.474  1.00 46.83  ?  213 ARG C HB2  1 
ATOM   10279 H  HB3  . ARG C  1 213 ? -41.802 -33.793 37.644  1.00 46.83  ?  213 ARG C HB3  1 
ATOM   10280 H  HG2  . ARG C  1 213 ? -41.965 -31.984 36.067  1.00 38.49  ?  213 ARG C HG2  1 
ATOM   10281 H  HG3  . ARG C  1 213 ? -40.691 -31.386 36.811  1.00 38.49  ?  213 ARG C HG3  1 
ATOM   10282 H  HD2  . ARG C  1 213 ? -39.429 -33.214 36.221  1.00 39.82  ?  213 ARG C HD2  1 
ATOM   10283 H  HD3  . ARG C  1 213 ? -40.708 -33.942 35.609  1.00 39.82  ?  213 ARG C HD3  1 
ATOM   10284 H  HE   . ARG C  1 213 ? -40.573 -32.608 33.836  1.00 36.49  ?  213 ARG C HE   1 
ATOM   10285 H  HH11 . ARG C  1 213 ? -38.099 -31.811 35.907  1.00 31.12  ?  213 ARG C HH11 1 
ATOM   10286 H  HH12 . ARG C  1 213 ? -37.337 -30.987 34.928  1.00 31.12  ?  213 ARG C HH12 1 
ATOM   10287 H  HH21 . ARG C  1 213 ? -39.422 -31.350 32.384  1.00 38.73  ?  213 ARG C HH21 1 
ATOM   10288 H  HH22 . ARG C  1 213 ? -38.141 -30.709 32.794  1.00 38.73  ?  213 ARG C HH22 1 
ATOM   10289 N  N    . ASN C  1 214 ? -42.787 -33.270 40.725  1.00 48.15  ?  214 ASN C N    1 
ATOM   10290 C  CA   . ASN C  1 214 ? -42.969 -34.398 41.632  1.00 55.87  ?  214 ASN C CA   1 
ATOM   10291 C  C    . ASN C  1 214 ? -43.575 -33.950 42.955  1.00 66.81  ?  214 ASN C C    1 
ATOM   10292 O  O    . ASN C  1 214 ? -44.766 -34.184 43.179  1.00 72.75  ?  214 ASN C O    1 
ATOM   10293 C  CB   . ASN C  1 214 ? -41.617 -35.101 41.810  1.00 57.50  ?  214 ASN C CB   1 
ATOM   10294 C  CG   . ASN C  1 214 ? -40.964 -35.488 40.464  1.00 54.85  ?  214 ASN C CG   1 
ATOM   10295 O  OD1  . ASN C  1 214 ? -41.633 -35.954 39.540  1.00 57.30  ?  214 ASN C OD1  1 
ATOM   10296 N  ND2  . ASN C  1 214 ? -39.653 -35.287 40.360  1.00 57.00  ?  214 ASN C ND2  1 
ATOM   10297 H  H    . ASN C  1 214 ? -42.262 -32.660 41.028  1.00 57.78  ?  214 ASN C H    1 
ATOM   10298 H  HA   . ASN C  1 214 ? -43.581 -35.032 41.226  1.00 67.05  ?  214 ASN C HA   1 
ATOM   10299 H  HB2  . ASN C  1 214 ? -41.010 -34.506 42.277  1.00 69.00  ?  214 ASN C HB2  1 
ATOM   10300 H  HB3  . ASN C  1 214 ? -41.747 -35.913 42.324  1.00 69.00  ?  214 ASN C HB3  1 
ATOM   10301 H  HD21 . ASN C  1 214 ? -39.244 -35.487 39.630  1.00 68.40  ?  214 ASN C HD21 1 
ATOM   10302 H  HD22 . ASN C  1 214 ? -39.214 -34.958 41.022  1.00 68.40  ?  214 ASN C HD22 1 
ATOM   10303 N  N    . GLY C  1 215 ? -42.811 -33.306 43.842  1.00 66.60  ?  215 GLY C N    1 
ATOM   10304 C  CA   . GLY C  1 215 ? -43.340 -32.867 45.125  1.00 58.89  ?  215 GLY C CA   1 
ATOM   10305 C  C    . GLY C  1 215 ? -42.331 -32.222 46.062  1.00 64.46  ?  215 GLY C C    1 
ATOM   10306 O  O    . GLY C  1 215 ? -41.118 -32.288 45.854  1.00 65.49  ?  215 GLY C O    1 
ATOM   10307 H  H    . GLY C  1 215 ? -41.981 -33.114 43.720  1.00 79.92  ?  215 GLY C H    1 
ATOM   10308 H  HA2  . GLY C  1 215 ? -44.050 -32.225 44.967  1.00 70.67  ?  215 GLY C HA2  1 
ATOM   10309 H  HA3  . GLY C  1 215 ? -43.725 -33.630 45.583  1.00 70.67  ?  215 GLY C HA3  1 
ATOM   10310 N  N    . ASN D  1 4   ? -25.415 -31.492 31.270  1.00 71.38  ?  4   ASN D N    1 
ATOM   10311 C  CA   . ASN D  1 4   ? -25.574 -30.073 31.585  1.00 77.13  ?  4   ASN D CA   1 
ATOM   10312 C  C    . ASN D  1 4   ? -24.863 -29.179 30.570  1.00 72.70  ?  4   ASN D C    1 
ATOM   10313 O  O    . ASN D  1 4   ? -23.630 -29.168 30.487  1.00 80.54  ?  4   ASN D O    1 
ATOM   10314 C  CB   . ASN D  1 4   ? -25.043 -29.770 32.986  1.00 73.60  ?  4   ASN D CB   1 
ATOM   10315 C  CG   . ASN D  1 4   ? -24.729 -28.292 33.181  1.00 72.03  ?  4   ASN D CG   1 
ATOM   10316 O  OD1  . ASN D  1 4   ? -23.637 -27.821 32.838  1.00 77.57  ?  4   ASN D OD1  1 
ATOM   10317 N  ND2  . ASN D  1 4   ? -25.689 -27.551 33.732  1.00 73.48  ?  4   ASN D ND2  1 
ATOM   10318 H  HA   . ASN D  1 4   ? -26.518 -29.851 31.568  1.00 92.55  ?  4   ASN D HA   1 
ATOM   10319 H  HB2  . ASN D  1 4   ? -25.713 -30.024 33.640  1.00 88.32  ?  4   ASN D HB2  1 
ATOM   10320 H  HB3  . ASN D  1 4   ? -24.227 -30.273 33.132  1.00 88.32  ?  4   ASN D HB3  1 
ATOM   10321 H  HD21 . ASN D  1 4   ? -25.562 -26.711 33.864  1.00 88.17  ?  4   ASN D HD21 1 
ATOM   10322 H  HD22 . ASN D  1 4   ? -26.437 -27.913 33.956  1.00 88.17  ?  4   ASN D HD22 1 
ATOM   10323 N  N    . LYS D  1 5   ? -25.646 -28.406 29.826  1.00 39.83  ?  5   LYS D N    1 
ATOM   10324 C  CA   . LYS D  1 5   ? -25.122 -27.595 28.733  1.00 35.98  ?  5   LYS D CA   1 
ATOM   10325 C  C    . LYS D  1 5   ? -24.759 -26.194 29.215  1.00 32.29  ?  5   LYS D C    1 
ATOM   10326 O  O    . LYS D  1 5   ? -25.192 -25.731 30.280  1.00 29.08  ?  5   LYS D O    1 
ATOM   10327 C  CB   . LYS D  1 5   ? -26.122 -27.502 27.583  1.00 47.04  ?  5   LYS D CB   1 
ATOM   10328 C  CG   . LYS D  1 5   ? -27.347 -26.673 27.873  1.00 44.36  ?  5   LYS D CG   1 
ATOM   10329 C  CD   . LYS D  1 5   ? -28.470 -27.006 26.890  1.00 61.83  ?  5   LYS D CD   1 
ATOM   10330 C  CE   . LYS D  1 5   ? -28.315 -26.240 25.584  1.00 63.68  ?  5   LYS D CE   1 
ATOM   10331 N  NZ   . LYS D  1 5   ? -28.730 -24.813 25.737  1.00 67.06  1  5   LYS D NZ   1 
ATOM   10332 H  H    . LYS D  1 5   ? -26.496 -28.332 29.936  1.00 47.80  ?  5   LYS D H    1 
ATOM   10333 H  HA   . LYS D  1 5   ? -24.315 -28.012 28.393  1.00 43.18  ?  5   LYS D HA   1 
ATOM   10334 H  HB2  . LYS D  1 5   ? -25.676 -27.108 26.818  1.00 56.44  ?  5   LYS D HB2  1 
ATOM   10335 H  HB3  . LYS D  1 5   ? -26.421 -28.398 27.361  1.00 56.44  ?  5   LYS D HB3  1 
ATOM   10336 H  HG2  . LYS D  1 5   ? -27.659 -26.862 28.771  1.00 53.23  ?  5   LYS D HG2  1 
ATOM   10337 H  HG3  . LYS D  1 5   ? -27.128 -25.732 27.782  1.00 53.23  ?  5   LYS D HG3  1 
ATOM   10338 H  HD2  . LYS D  1 5   ? -28.450 -27.955 26.690  1.00 74.19  ?  5   LYS D HD2  1 
ATOM   10339 H  HD3  . LYS D  1 5   ? -29.323 -26.764 27.285  1.00 74.19  ?  5   LYS D HD3  1 
ATOM   10340 H  HE2  . LYS D  1 5   ? -27.385 -26.259 25.309  1.00 76.41  ?  5   LYS D HE2  1 
ATOM   10341 H  HE3  . LYS D  1 5   ? -28.875 -26.648 24.904  1.00 76.41  ?  5   LYS D HE3  1 
ATOM   10342 H  HZ1  . LYS D  1 5   ? -29.583 -24.770 25.986  1.00 80.47  ?  5   LYS D HZ1  1 
ATOM   10343 H  HZ2  . LYS D  1 5   ? -28.228 -24.416 26.355  1.00 80.47  ?  5   LYS D HZ2  1 
ATOM   10344 H  HZ3  . LYS D  1 5   ? -28.632 -24.383 24.964  1.00 80.47  ?  5   LYS D HZ3  1 
ATOM   10345 N  N    . ARG D  1 6   ? -23.974 -25.508 28.387  1.00 23.01  ?  6   ARG D N    1 
ATOM   10346 C  CA   . ARG D  1 6   ? -23.512 -24.161 28.708  1.00 19.08  ?  6   ARG D CA   1 
ATOM   10347 C  C    . ARG D  1 6   ? -24.643 -23.188 28.417  1.00 24.30  ?  6   ARG D C    1 
ATOM   10348 O  O    . ARG D  1 6   ? -25.066 -23.057 27.263  1.00 27.82  ?  6   ARG D O    1 
ATOM   10349 C  CB   . ARG D  1 6   ? -22.281 -23.816 27.875  1.00 18.81  ?  6   ARG D CB   1 
ATOM   10350 C  CG   . ARG D  1 6   ? -21.023 -24.612 28.269  1.00 18.83  ?  6   ARG D CG   1 
ATOM   10351 C  CD   . ARG D  1 6   ? -19.785 -24.193 27.502  1.00 18.79  ?  6   ARG D CD   1 
ATOM   10352 N  NE   . ARG D  1 6   ? -18.592 -24.786 28.112  1.00 17.43  ?  6   ARG D NE   1 
ATOM   10353 C  CZ   . ARG D  1 6   ? -18.119 -26.016 27.845  1.00 15.99  ?  6   ARG D CZ   1 
ATOM   10354 N  NH1  . ARG D  1 6   ? -18.678 -26.795 26.926  1.00 17.45  1  6   ARG D NH1  1 
ATOM   10355 N  NH2  . ARG D  1 6   ? -17.063 -26.463 28.501  1.00 17.57  ?  6   ARG D NH2  1 
ATOM   10356 H  H    . ARG D  1 6   ? -23.695 -25.803 27.629  1.00 27.61  ?  6   ARG D H    1 
ATOM   10357 H  HA   . ARG D  1 6   ? -23.282 -24.105 29.648  1.00 22.89  ?  6   ARG D HA   1 
ATOM   10358 H  HB2  . ARG D  1 6   ? -22.472 -24.004 26.942  1.00 22.58  ?  6   ARG D HB2  1 
ATOM   10359 H  HB3  . ARG D  1 6   ? -22.083 -22.873 27.986  1.00 22.58  ?  6   ARG D HB3  1 
ATOM   10360 H  HG2  . ARG D  1 6   ? -20.849 -24.477 29.214  1.00 22.60  ?  6   ARG D HG2  1 
ATOM   10361 H  HG3  . ARG D  1 6   ? -21.179 -25.553 28.093  1.00 22.60  ?  6   ARG D HG3  1 
ATOM   10362 H  HD2  . ARG D  1 6   ? -19.850 -24.503 26.585  1.00 22.54  ?  6   ARG D HD2  1 
ATOM   10363 H  HD3  . ARG D  1 6   ? -19.697 -23.227 27.529  1.00 22.54  ?  6   ARG D HD3  1 
ATOM   10364 H  HE   . ARG D  1 6   ? -18.162 -24.312 28.686  1.00 20.92  ?  6   ARG D HE   1 
ATOM   10365 H  HH11 . ARG D  1 6   ? -19.375 -26.525 26.499  1.00 20.94  ?  6   ARG D HH11 1 
ATOM   10366 H  HH12 . ARG D  1 6   ? -18.352 -27.575 26.766  1.00 20.94  ?  6   ARG D HH12 1 
ATOM   10367 H  HH21 . ARG D  1 6   ? -16.680 -25.965 29.088  1.00 21.09  ?  6   ARG D HH21 1 
ATOM   10368 H  HH22 . ARG D  1 6   ? -16.739 -27.237 28.317  1.00 21.09  ?  6   ARG D HH22 1 
ATOM   10369 N  N    . GLU D  1 7   ? -25.143 -22.519 29.453  1.00 18.34  ?  7   GLU D N    1 
ATOM   10370 C  CA   . GLU D  1 7   ? -26.312 -21.669 29.346  1.00 19.96  ?  7   GLU D CA   1 
ATOM   10371 C  C    . GLU D  1 7   ? -26.007 -20.299 29.931  1.00 16.91  ?  7   GLU D C    1 
ATOM   10372 O  O    . GLU D  1 7   ? -25.535 -20.207 31.063  1.00 20.25  ?  7   GLU D O    1 
ATOM   10373 C  CB   . GLU D  1 7   ? -27.497 -22.299 30.099  1.00 23.98  ?  7   GLU D CB   1 
ATOM   10374 C  CG   . GLU D  1 7   ? -28.812 -21.543 29.949  1.00 36.23  ?  7   GLU D CG   1 
ATOM   10375 C  CD   . GLU D  1 7   ? -29.783 -22.272 29.051  1.00 44.72  ?  7   GLU D CD   1 
ATOM   10376 O  OE1  . GLU D  1 7   ? -29.308 -23.026 28.175  1.00 42.35  ?  7   GLU D OE1  1 
ATOM   10377 O  OE2  . GLU D  1 7   ? -31.007 -22.090 29.224  1.00 44.34  -1 7   GLU D OE2  1 
ATOM   10378 H  H    . GLU D  1 7   ? -24.811 -22.547 30.245  1.00 22.01  ?  7   GLU D H    1 
ATOM   10379 H  HA   . GLU D  1 7   ? -26.556 -21.563 28.413  1.00 23.96  ?  7   GLU D HA   1 
ATOM   10380 H  HB2  . GLU D  1 7   ? -27.635 -23.199 29.764  1.00 28.77  ?  7   GLU D HB2  1 
ATOM   10381 H  HB3  . GLU D  1 7   ? -27.282 -22.331 31.044  1.00 28.77  ?  7   GLU D HB3  1 
ATOM   10382 H  HG2  . GLU D  1 7   ? -29.224 -21.445 30.822  1.00 43.47  ?  7   GLU D HG2  1 
ATOM   10383 H  HG3  . GLU D  1 7   ? -28.637 -20.672 29.562  1.00 43.47  ?  7   GLU D HG3  1 
ATOM   10384 N  N    . ILE D  1 8   ? -26.254 -19.248 29.144  1.00 18.14  ?  8   ILE D N    1 
ATOM   10385 C  CA   . ILE D  1 8   ? -26.200 -17.885 29.660  1.00 15.73  ?  8   ILE D CA   1 
ATOM   10386 C  C    . ILE D  1 8   ? -27.372 -17.655 30.588  1.00 18.30  ?  8   ILE D C    1 
ATOM   10387 O  O    . ILE D  1 8   ? -28.505 -18.077 30.311  1.00 20.91  ?  8   ILE D O    1 
ATOM   10388 C  CB   . ILE D  1 8   ? -26.203 -16.875 28.501  1.00 17.66  ?  8   ILE D CB   1 
ATOM   10389 C  CG1  . ILE D  1 8   ? -24.919 -17.077 27.681  1.00 18.45  ?  8   ILE D CG1  1 
ATOM   10390 C  CG2  . ILE D  1 8   ? -26.401 -15.410 28.976  1.00 16.93  ?  8   ILE D CG2  1 
ATOM   10391 C  CD1  . ILE D  1 8   ? -24.863 -16.363 26.322  1.00 18.41  ?  8   ILE D CD1  1 
ATOM   10392 H  H    . ILE D  1 8   ? -26.455 -19.301 28.310  1.00 21.77  ?  8   ILE D H    1 
ATOM   10393 H  HA   . ILE D  1 8   ? -25.381 -17.765 30.167  1.00 18.88  ?  8   ILE D HA   1 
ATOM   10394 H  HB   . ILE D  1 8   ? -26.952 -17.096 27.926  1.00 21.19  ?  8   ILE D HB   1 
ATOM   10395 H  HG12 . ILE D  1 8   ? -24.169 -16.757 28.206  1.00 22.14  ?  8   ILE D HG12 1 
ATOM   10396 H  HG13 . ILE D  1 8   ? -24.812 -18.026 27.512  1.00 22.14  ?  8   ILE D HG13 1 
ATOM   10397 H  HG21 . ILE D  1 8   ? -26.394 -14.825 28.203  1.00 20.31  ?  8   ILE D HG21 1 
ATOM   10398 H  HG22 . ILE D  1 8   ? -27.252 -15.341 29.436  1.00 20.31  ?  8   ILE D HG22 1 
ATOM   10399 H  HG23 . ILE D  1 8   ? -25.678 -15.173 29.578  1.00 20.31  ?  8   ILE D HG23 1 
ATOM   10400 H  HD11 . ILE D  1 8   ? -24.014 -16.561 25.897  1.00 22.10  ?  8   ILE D HD11 1 
ATOM   10401 H  HD12 . ILE D  1 8   ? -25.593 -16.682 25.769  1.00 22.10  ?  8   ILE D HD12 1 
ATOM   10402 H  HD13 . ILE D  1 8   ? -24.948 -15.408 26.465  1.00 22.10  ?  8   ILE D HD13 1 
ATOM   10403 N  N    . VAL D  1 9   ? -27.115 -16.931 31.665  1.00 17.45  ?  9   VAL D N    1 
ATOM   10404 C  CA   . VAL D  1 9   ? -28.131 -16.562 32.637  1.00 18.07  ?  9   VAL D CA   1 
ATOM   10405 C  C    . VAL D  1 9   ? -28.094 -15.045 32.834  1.00 18.69  ?  9   VAL D C    1 
ATOM   10406 O  O    . VAL D  1 9   ? -27.232 -14.319 32.313  1.00 18.43  ?  9   VAL D O    1 
ATOM   10407 C  CB   . VAL D  1 9   ? -27.955 -17.316 33.970  1.00 18.16  ?  9   VAL D CB   1 
ATOM   10408 C  CG1  . VAL D  1 9   ? -28.119 -18.840 33.751  1.00 25.11  ?  9   VAL D CG1  1 
ATOM   10409 C  CG2  . VAL D  1 9   ? -26.627 -17.062 34.617  1.00 19.47  ?  9   VAL D CG2  1 
ATOM   10410 H  H    . VAL D  1 9   ? -26.333 -16.631 31.861  1.00 20.95  ?  9   VAL D H    1 
ATOM   10411 H  HA   . VAL D  1 9   ? -29.003 -16.793 32.280  1.00 21.69  ?  9   VAL D HA   1 
ATOM   10412 H  HB   . VAL D  1 9   ? -28.646 -17.028 34.587  1.00 21.79  ?  9   VAL D HB   1 
ATOM   10413 H  HG11 . VAL D  1 9   ? -28.005 -19.295 34.599  1.00 30.13  ?  9   VAL D HG11 1 
ATOM   10414 H  HG12 . VAL D  1 9   ? -29.006 -19.013 33.398  1.00 30.13  ?  9   VAL D HG12 1 
ATOM   10415 H  HG13 . VAL D  1 9   ? -27.447 -19.142 33.120  1.00 30.13  ?  9   VAL D HG13 1 
ATOM   10416 H  HG21 . VAL D  1 9   ? -26.580 -17.562 35.447  1.00 23.37  ?  9   VAL D HG21 1 
ATOM   10417 H  HG22 . VAL D  1 9   ? -25.923 -17.350 34.015  1.00 23.37  ?  9   VAL D HG22 1 
ATOM   10418 H  HG23 . VAL D  1 9   ? -26.541 -16.112 34.797  1.00 23.37  ?  9   VAL D HG23 1 
ATOM   10419 N  N    . GLU D  1 10  ? -29.091 -14.554 33.554  1.00 18.83  ?  10  GLU D N    1 
ATOM   10420 C  CA   . GLU D  1 10  ? -29.191 -13.131 33.798  1.00 17.99  ?  10  GLU D CA   1 
ATOM   10421 C  C    . GLU D  1 10  ? -29.787 -12.930 35.177  1.00 17.16  ?  10  GLU D C    1 
ATOM   10422 O  O    . GLU D  1 10  ? -30.626 -13.723 35.628  1.00 16.83  ?  10  GLU D O    1 
ATOM   10423 C  CB   . GLU D  1 10  ? -30.041 -12.442 32.709  1.00 17.99  ?  10  GLU D CB   1 
ATOM   10424 C  CG   . GLU D  1 10  ? -30.191 -10.945 32.878  1.00 18.79  ?  10  GLU D CG   1 
ATOM   10425 C  CD   . GLU D  1 10  ? -30.794 -10.265 31.656  1.00 26.63  ?  10  GLU D CD   1 
ATOM   10426 O  OE1  . GLU D  1 10  ? -30.305 -10.466 30.519  1.00 23.32  ?  10  GLU D OE1  1 
ATOM   10427 O  OE2  . GLU D  1 10  ? -31.793 -9.527  31.824  1.00 29.04  -1 10  GLU D OE2  1 
ATOM   10428 H  H    . GLU D  1 10  ? -29.718 -15.023 33.909  1.00 22.60  ?  10  GLU D H    1 
ATOM   10429 H  HA   . GLU D  1 10  ? -28.304 -12.739 33.787  1.00 21.59  ?  10  GLU D HA   1 
ATOM   10430 H  HB2  . GLU D  1 10  ? -29.627 -12.599 31.846  1.00 21.59  ?  10  GLU D HB2  1 
ATOM   10431 H  HB3  . GLU D  1 10  ? -30.930 -12.829 32.719  1.00 21.59  ?  10  GLU D HB3  1 
ATOM   10432 H  HG2  . GLU D  1 10  ? -30.772 -10.770 33.634  1.00 22.55  ?  10  GLU D HG2  1 
ATOM   10433 H  HG3  . GLU D  1 10  ? -29.316 -10.557 33.035  1.00 22.55  ?  10  GLU D HG3  1 
ATOM   10434 N  N    . PHE D  1 11  ? -29.312 -11.885 35.855  1.00 17.54  ?  11  PHE D N    1 
ATOM   10435 C  CA   . PHE D  1 11  ? -29.807 -11.461 37.166  1.00 20.34  ?  11  PHE D CA   1 
ATOM   10436 C  C    . PHE D  1 11  ? -30.028 -9.958  37.113  1.00 20.84  ?  11  PHE D C    1 
ATOM   10437 O  O    . PHE D  1 11  ? -29.071 -9.193  37.162  1.00 19.67  ?  11  PHE D O    1 
ATOM   10438 C  CB   . PHE D  1 11  ? -28.817 -11.779 38.275  1.00 20.71  ?  11  PHE D CB   1 
ATOM   10439 C  CG   . PHE D  1 11  ? -28.514 -13.206 38.421  1.00 24.03  ?  11  PHE D CG   1 
ATOM   10440 C  CD1  . PHE D  1 11  ? -27.599 -13.805 37.574  1.00 26.42  ?  11  PHE D CD1  1 
ATOM   10441 C  CD2  . PHE D  1 11  ? -29.073 -13.936 39.456  1.00 32.07  ?  11  PHE D CD2  1 
ATOM   10442 C  CE1  . PHE D  1 11  ? -27.286 -15.131 37.724  1.00 26.66  ?  11  PHE D CE1  1 
ATOM   10443 C  CE2  . PHE D  1 11  ? -28.760 -15.273 39.611  1.00 27.80  ?  11  PHE D CE2  1 
ATOM   10444 C  CZ   . PHE D  1 11  ? -27.872 -15.867 38.750  1.00 27.45  ?  11  PHE D CZ   1 
ATOM   10445 H  H    . PHE D  1 11  ? -28.676 -11.385 35.563  1.00 21.05  ?  11  PHE D H    1 
ATOM   10446 H  HA   . PHE D  1 11  ? -30.651 -11.898 37.360  1.00 24.41  ?  11  PHE D HA   1 
ATOM   10447 H  HB2  . PHE D  1 11  ? -27.984 -11.318 38.091  1.00 24.85  ?  11  PHE D HB2  1 
ATOM   10448 H  HB3  . PHE D  1 11  ? -29.184 -11.469 39.118  1.00 24.85  ?  11  PHE D HB3  1 
ATOM   10449 H  HD1  . PHE D  1 11  ? -27.212 -13.312 36.886  1.00 31.71  ?  11  PHE D HD1  1 
ATOM   10450 H  HD2  . PHE D  1 11  ? -29.678 -13.531 40.035  1.00 38.49  ?  11  PHE D HD2  1 
ATOM   10451 H  HE1  . PHE D  1 11  ? -26.684 -15.537 37.143  1.00 31.99  ?  11  PHE D HE1  1 
ATOM   10452 H  HE2  . PHE D  1 11  ? -29.149 -15.768 40.296  1.00 33.36  ?  11  PHE D HE2  1 
ATOM   10453 H  HZ   . PHE D  1 11  ? -27.660 -16.766 38.852  1.00 32.94  ?  11  PHE D HZ   1 
ATOM   10454 N  N    . LEU D  1 12  ? -31.283 -9.539  37.010  1.00 19.77  ?  12  LEU D N    1 
ATOM   10455 C  CA   . LEU D  1 12  ? -31.686 -8.135  37.141  1.00 19.69  ?  12  LEU D CA   1 
ATOM   10456 C  C    . LEU D  1 12  ? -30.719 -7.205  36.424  1.00 23.04  ?  12  LEU D C    1 
ATOM   10457 O  O    . LEU D  1 12  ? -30.080 -6.326  37.015  1.00 23.70  ?  12  LEU D O    1 
ATOM   10458 C  CB   . LEU D  1 12  ? -31.826 -7.763  38.612  1.00 21.43  ?  12  LEU D CB   1 
ATOM   10459 C  CG   . LEU D  1 12  ? -32.589 -6.485  38.938  1.00 29.16  ?  12  LEU D CG   1 
ATOM   10460 C  CD1  . LEU D  1 12  ? -33.941 -6.455  38.276  1.00 25.69  ?  12  LEU D CD1  1 
ATOM   10461 C  CD2  . LEU D  1 12  ? -32.748 -6.453  40.429  1.00 34.17  ?  12  LEU D CD2  1 
ATOM   10462 H  H    . LEU D  1 12  ? -31.945 -10.066 36.858  1.00 23.73  ?  12  LEU D H    1 
ATOM   10463 H  HA   . LEU D  1 12  ? -32.556 -8.025  36.728  1.00 23.63  ?  12  LEU D HA   1 
ATOM   10464 H  HB2  . LEU D  1 12  ? -32.282 -8.490  39.064  1.00 25.72  ?  12  LEU D HB2  1 
ATOM   10465 H  HB3  . LEU D  1 12  ? -30.935 -7.666  38.983  1.00 25.72  ?  12  LEU D HB3  1 
ATOM   10466 H  HG   . LEU D  1 12  ? -32.079 -5.710  38.656  1.00 35.00  ?  12  LEU D HG   1 
ATOM   10467 H  HD11 . LEU D  1 12  ? -34.389 -5