data_5W5T
# 
_entry.id   5W5T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.341 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5W5T         
WWPDB D_1000228491 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5W6J unspecified 
PDB . 5W5R unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5W5T 
_pdbx_database_status.recvd_initial_deposition_date   2017-06-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Mascarenhas, R.N.' 1 ? 
'Hill, B.L.'        2 ? 
'Ballicora, M.A.'   3 ? 
'Liu, D.'           4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Biol. Chem.' 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            294 
_citation.language                  ? 
_citation.page_first                1338 
_citation.page_last                 1348 
_citation.title                     
'Structural analysis reveals a pyruvate-binding activator site in theAgrobacterium tumefaciensADP-glucose pyrophosphorylase.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA118.004246 
_citation.pdbx_database_id_PubMed   30401744 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hill, B.L.'          1 ?                   
primary 'Mascarenhas, R.'     2 ?                   
primary 'Patel, H.P.'         3 ?                   
primary 'Asencion Diez, M.D.' 4 ?                   
primary 'Wu, R.'              5 ?                   
primary 'Iglesias, A.A.'      6 ?                   
primary 'Liu, D.'             7 0000-0002-7587-703X 
primary 'Ballicora, M.A.'     8 ?                   
# 
_cell.entry_id           5W5T 
_cell.length_a           93.781 
_cell.length_b           140.145 
_cell.length_c           228.855 
_cell.angle_alpha        107.81 
_cell.angle_beta         101.84 
_cell.angle_gamma        90.06 
_cell.Z_PDB              20 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5W5T 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucose-1-phosphate adenylyltransferase' 46467.398 20    2.7.7.27 ? ? ? 
2 non-polymer syn 'SULFATE ION'                             96.063    75    ?        ? ? ? 
3 non-polymer syn GLYCEROL                                  92.094    46    ?        ? ? ? 
4 non-polymer syn 'ethyl 2-oxopropanoate'                   116.115   10    ?        ? ? ? 
5 water       nat water                                     18.015    11257 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ADP-glucose pyrophosphorylase,ADPGlc PPase,ADP-glucose synthase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRGWDFFR
PERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKMDYEYMLQQHVDSGADVTIGCLEVPR
MEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEALRRDAADPTSSRDFGKDIIPYIVEHG
KAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIWTYAEITPPAKFVHDDEDRRGSAVSS
VVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHGVVIPEGLIVGEDPELDAKRFRRTES
GICLITQSMIDKLDL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRGWDFFR
PERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKMDYEYMLQQHVDSGADVTIGCLEVPR
MEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEALRRDAADPTSSRDFGKDIIPYIVEHG
KAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIWTYAEITPPAKFVHDDEDRRGSAVSS
VVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHGVVIPEGLIVGEDPELDAKRFRRTES
GICLITQSMIDKLDL
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,Z,T 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   GLN n 
1 3   PRO n 
1 4   LEU n 
1 5   ALA n 
1 6   ARG n 
1 7   ASP n 
1 8   ALA n 
1 9   MET n 
1 10  ALA n 
1 11  TYR n 
1 12  VAL n 
1 13  LEU n 
1 14  ALA n 
1 15  GLY n 
1 16  GLY n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  ARG n 
1 21  LEU n 
1 22  LYS n 
1 23  GLU n 
1 24  LEU n 
1 25  THR n 
1 26  ASP n 
1 27  ARG n 
1 28  ARG n 
1 29  ALA n 
1 30  LYS n 
1 31  PRO n 
1 32  ALA n 
1 33  VAL n 
1 34  TYR n 
1 35  PHE n 
1 36  GLY n 
1 37  GLY n 
1 38  LYS n 
1 39  ALA n 
1 40  ARG n 
1 41  ILE n 
1 42  ILE n 
1 43  ASP n 
1 44  PHE n 
1 45  ALA n 
1 46  LEU n 
1 47  SER n 
1 48  ASN n 
1 49  ALA n 
1 50  LEU n 
1 51  ASN n 
1 52  SER n 
1 53  GLY n 
1 54  ILE n 
1 55  ARG n 
1 56  ARG n 
1 57  ILE n 
1 58  GLY n 
1 59  VAL n 
1 60  ALA n 
1 61  THR n 
1 62  GLN n 
1 63  TYR n 
1 64  LYS n 
1 65  ALA n 
1 66  HIS n 
1 67  SER n 
1 68  LEU n 
1 69  ILE n 
1 70  ARG n 
1 71  HIS n 
1 72  LEU n 
1 73  GLN n 
1 74  ARG n 
1 75  GLY n 
1 76  TRP n 
1 77  ASP n 
1 78  PHE n 
1 79  PHE n 
1 80  ARG n 
1 81  PRO n 
1 82  GLU n 
1 83  ARG n 
1 84  ASN n 
1 85  GLU n 
1 86  SER n 
1 87  PHE n 
1 88  ASP n 
1 89  ILE n 
1 90  LEU n 
1 91  PRO n 
1 92  ALA n 
1 93  SER n 
1 94  GLN n 
1 95  ARG n 
1 96  VAL n 
1 97  SER n 
1 98  GLU n 
1 99  THR n 
1 100 GLN n 
1 101 TRP n 
1 102 TYR n 
1 103 GLU n 
1 104 GLY n 
1 105 THR n 
1 106 ALA n 
1 107 ASP n 
1 108 ALA n 
1 109 VAL n 
1 110 TYR n 
1 111 GLN n 
1 112 ASN n 
1 113 ILE n 
1 114 ASP n 
1 115 ILE n 
1 116 ILE n 
1 117 GLU n 
1 118 PRO n 
1 119 TYR n 
1 120 ALA n 
1 121 PRO n 
1 122 GLU n 
1 123 TYR n 
1 124 MET n 
1 125 VAL n 
1 126 ILE n 
1 127 LEU n 
1 128 ALA n 
1 129 GLY n 
1 130 ASP n 
1 131 HIS n 
1 132 ILE n 
1 133 TYR n 
1 134 LYS n 
1 135 MET n 
1 136 ASP n 
1 137 TYR n 
1 138 GLU n 
1 139 TYR n 
1 140 MET n 
1 141 LEU n 
1 142 GLN n 
1 143 GLN n 
1 144 HIS n 
1 145 VAL n 
1 146 ASP n 
1 147 SER n 
1 148 GLY n 
1 149 ALA n 
1 150 ASP n 
1 151 VAL n 
1 152 THR n 
1 153 ILE n 
1 154 GLY n 
1 155 CYS n 
1 156 LEU n 
1 157 GLU n 
1 158 VAL n 
1 159 PRO n 
1 160 ARG n 
1 161 MET n 
1 162 GLU n 
1 163 ALA n 
1 164 THR n 
1 165 GLY n 
1 166 PHE n 
1 167 GLY n 
1 168 VAL n 
1 169 MET n 
1 170 HIS n 
1 171 VAL n 
1 172 ASN n 
1 173 GLU n 
1 174 LYS n 
1 175 ASP n 
1 176 GLU n 
1 177 ILE n 
1 178 ILE n 
1 179 ASP n 
1 180 PHE n 
1 181 ILE n 
1 182 GLU n 
1 183 LYS n 
1 184 PRO n 
1 185 ALA n 
1 186 ASP n 
1 187 PRO n 
1 188 PRO n 
1 189 GLY n 
1 190 ILE n 
1 191 PRO n 
1 192 GLY n 
1 193 ASN n 
1 194 GLU n 
1 195 GLY n 
1 196 PHE n 
1 197 ALA n 
1 198 LEU n 
1 199 ALA n 
1 200 SER n 
1 201 MET n 
1 202 GLY n 
1 203 ILE n 
1 204 TYR n 
1 205 VAL n 
1 206 PHE n 
1 207 HIS n 
1 208 THR n 
1 209 LYS n 
1 210 PHE n 
1 211 LEU n 
1 212 MET n 
1 213 GLU n 
1 214 ALA n 
1 215 LEU n 
1 216 ARG n 
1 217 ARG n 
1 218 ASP n 
1 219 ALA n 
1 220 ALA n 
1 221 ASP n 
1 222 PRO n 
1 223 THR n 
1 224 SER n 
1 225 SER n 
1 226 ARG n 
1 227 ASP n 
1 228 PHE n 
1 229 GLY n 
1 230 LYS n 
1 231 ASP n 
1 232 ILE n 
1 233 ILE n 
1 234 PRO n 
1 235 TYR n 
1 236 ILE n 
1 237 VAL n 
1 238 GLU n 
1 239 HIS n 
1 240 GLY n 
1 241 LYS n 
1 242 ALA n 
1 243 VAL n 
1 244 ALA n 
1 245 HIS n 
1 246 ARG n 
1 247 PHE n 
1 248 ALA n 
1 249 ASP n 
1 250 SER n 
1 251 CYS n 
1 252 VAL n 
1 253 ARG n 
1 254 SER n 
1 255 ASP n 
1 256 PHE n 
1 257 GLU n 
1 258 HIS n 
1 259 GLU n 
1 260 PRO n 
1 261 TYR n 
1 262 TRP n 
1 263 ARG n 
1 264 ASP n 
1 265 VAL n 
1 266 GLY n 
1 267 THR n 
1 268 ILE n 
1 269 ASP n 
1 270 ALA n 
1 271 TYR n 
1 272 TRP n 
1 273 GLN n 
1 274 ALA n 
1 275 ASN n 
1 276 ILE n 
1 277 ASP n 
1 278 LEU n 
1 279 THR n 
1 280 ASP n 
1 281 VAL n 
1 282 VAL n 
1 283 PRO n 
1 284 ASP n 
1 285 LEU n 
1 286 ASP n 
1 287 ILE n 
1 288 TYR n 
1 289 ASP n 
1 290 LYS n 
1 291 SER n 
1 292 TRP n 
1 293 PRO n 
1 294 ILE n 
1 295 TRP n 
1 296 THR n 
1 297 TYR n 
1 298 ALA n 
1 299 GLU n 
1 300 ILE n 
1 301 THR n 
1 302 PRO n 
1 303 PRO n 
1 304 ALA n 
1 305 LYS n 
1 306 PHE n 
1 307 VAL n 
1 308 HIS n 
1 309 ASP n 
1 310 ASP n 
1 311 GLU n 
1 312 ASP n 
1 313 ARG n 
1 314 ARG n 
1 315 GLY n 
1 316 SER n 
1 317 ALA n 
1 318 VAL n 
1 319 SER n 
1 320 SER n 
1 321 VAL n 
1 322 VAL n 
1 323 SER n 
1 324 GLY n 
1 325 ASP n 
1 326 CYS n 
1 327 ILE n 
1 328 ILE n 
1 329 SER n 
1 330 GLY n 
1 331 ALA n 
1 332 ALA n 
1 333 LEU n 
1 334 ASN n 
1 335 ARG n 
1 336 SER n 
1 337 LEU n 
1 338 LEU n 
1 339 PHE n 
1 340 THR n 
1 341 GLY n 
1 342 VAL n 
1 343 ARG n 
1 344 ALA n 
1 345 ASN n 
1 346 SER n 
1 347 TYR n 
1 348 SER n 
1 349 ARG n 
1 350 LEU n 
1 351 GLU n 
1 352 ASN n 
1 353 ALA n 
1 354 VAL n 
1 355 VAL n 
1 356 LEU n 
1 357 PRO n 
1 358 SER n 
1 359 VAL n 
1 360 LYS n 
1 361 ILE n 
1 362 GLY n 
1 363 ARG n 
1 364 HIS n 
1 365 ALA n 
1 366 GLN n 
1 367 LEU n 
1 368 SER n 
1 369 ASN n 
1 370 VAL n 
1 371 VAL n 
1 372 ILE n 
1 373 ASP n 
1 374 HIS n 
1 375 GLY n 
1 376 VAL n 
1 377 VAL n 
1 378 ILE n 
1 379 PRO n 
1 380 GLU n 
1 381 GLY n 
1 382 LEU n 
1 383 ILE n 
1 384 VAL n 
1 385 GLY n 
1 386 GLU n 
1 387 ASP n 
1 388 PRO n 
1 389 GLU n 
1 390 LEU n 
1 391 ASP n 
1 392 ALA n 
1 393 LYS n 
1 394 ARG n 
1 395 PHE n 
1 396 ARG n 
1 397 ARG n 
1 398 THR n 
1 399 GLU n 
1 400 SER n 
1 401 GLY n 
1 402 ILE n 
1 403 CYS n 
1 404 LEU n 
1 405 ILE n 
1 406 THR n 
1 407 GLN n 
1 408 SER n 
1 409 MET n 
1 410 ILE n 
1 411 ASP n 
1 412 LYS n 
1 413 LEU n 
1 414 ASP n 
1 415 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   415 
_entity_src_gen.gene_src_common_name               'Agrobacterium tumefaciens' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 glgC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rhizobium radiobacter' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     358 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli K-12' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     83333 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GLGC_RHIRD 
_struct_ref.pdbx_db_accession          P39669 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRGWDFFR
PERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKMDYEYMLQQHVDSGADVTIGCLEVPR
MEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEAVRRDAADPTSSRDFGKDIIPYIVEHG
KAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIWTYAEITPPAKFVHDDEDRRGSAVSS
VVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHGVVIPEGLIVGEDPELDAKRFRRTES
GICLITQSMIDKLDL
;
_struct_ref.pdbx_align_begin           6 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5W5T A 1 ? 415 ? P39669 6 ? 420 ? 7 421 
2  1 5W5T B 1 ? 415 ? P39669 6 ? 420 ? 7 421 
3  1 5W5T C 1 ? 415 ? P39669 6 ? 420 ? 7 421 
4  1 5W5T D 1 ? 415 ? P39669 6 ? 420 ? 7 421 
5  1 5W5T E 1 ? 415 ? P39669 6 ? 420 ? 7 421 
6  1 5W5T F 1 ? 415 ? P39669 6 ? 420 ? 7 421 
7  1 5W5T G 1 ? 415 ? P39669 6 ? 420 ? 7 421 
8  1 5W5T H 1 ? 415 ? P39669 6 ? 420 ? 7 421 
9  1 5W5T I 1 ? 415 ? P39669 6 ? 420 ? 7 421 
10 1 5W5T J 1 ? 415 ? P39669 6 ? 420 ? 7 421 
11 1 5W5T K 1 ? 415 ? P39669 6 ? 420 ? 7 421 
12 1 5W5T L 1 ? 415 ? P39669 6 ? 420 ? 7 421 
13 1 5W5T M 1 ? 415 ? P39669 6 ? 420 ? 7 421 
14 1 5W5T N 1 ? 415 ? P39669 6 ? 420 ? 7 421 
15 1 5W5T O 1 ? 415 ? P39669 6 ? 420 ? 7 421 
16 1 5W5T P 1 ? 415 ? P39669 6 ? 420 ? 7 421 
17 1 5W5T Q 1 ? 415 ? P39669 6 ? 420 ? 7 421 
18 1 5W5T R 1 ? 415 ? P39669 6 ? 420 ? 7 421 
19 1 5W5T Z 1 ? 415 ? P39669 6 ? 420 ? 7 421 
20 1 5W5T T 1 ? 415 ? P39669 6 ? 420 ? 7 421 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  5W5T LEU A 215 ? UNP P39669 VAL 220 conflict 221 1  
2  5W5T LEU B 215 ? UNP P39669 VAL 220 conflict 221 2  
3  5W5T LEU C 215 ? UNP P39669 VAL 220 conflict 221 3  
4  5W5T LEU D 215 ? UNP P39669 VAL 220 conflict 221 4  
5  5W5T LEU E 215 ? UNP P39669 VAL 220 conflict 221 5  
6  5W5T LEU F 215 ? UNP P39669 VAL 220 conflict 221 6  
7  5W5T LEU G 215 ? UNP P39669 VAL 220 conflict 221 7  
8  5W5T LEU H 215 ? UNP P39669 VAL 220 conflict 221 8  
9  5W5T LEU I 215 ? UNP P39669 VAL 220 conflict 221 9  
10 5W5T LEU J 215 ? UNP P39669 VAL 220 conflict 221 10 
11 5W5T LEU K 215 ? UNP P39669 VAL 220 conflict 221 11 
12 5W5T LEU L 215 ? UNP P39669 VAL 220 conflict 221 12 
13 5W5T LEU M 215 ? UNP P39669 VAL 220 conflict 221 13 
14 5W5T LEU N 215 ? UNP P39669 VAL 220 conflict 221 14 
15 5W5T LEU O 215 ? UNP P39669 VAL 220 conflict 221 15 
16 5W5T LEU P 215 ? UNP P39669 VAL 220 conflict 221 16 
17 5W5T LEU Q 215 ? UNP P39669 VAL 220 conflict 221 17 
18 5W5T LEU R 215 ? UNP P39669 VAL 220 conflict 221 18 
19 5W5T LEU Z 215 ? UNP P39669 VAL 220 conflict 221 19 
20 5W5T LEU T 215 ? UNP P39669 VAL 220 conflict 221 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
9X7 non-polymer         . 'ethyl 2-oxopropanoate' ?                               'C5 H8 O3'       116.115 
ALA 'L-peptide linking' y ALANINE                 ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE               ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE               ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                 ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE              ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE           ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                 ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'           ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE               ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5W5T 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.01 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.12 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '50mM HEPES pH7.5, 1.5M LiSO4' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           80 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         MARRESEARCH 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-04-15 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.entry_id                     5W5T 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.760 
_reflns.number_obs                   1035315 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.100 
_reflns.pdbx_Rmerge_I_obs            0.050 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.700 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.100 
_reflns.pdbx_Rrim_I_all              0.068 
_reflns.pdbx_Rpim_I_all              0.046 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_netI_over_av_sigmaI     ? 
_reflns.pdbx_number_measured_all     2210333 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_chi_squared             0.926 
_reflns.Rmerge_F_all                 ? 
_reflns.Rmerge_F_obs                 ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.observed_criterion_I_max     ? 
_reflns.observed_criterion_I_min     ? 
_reflns.pdbx_d_res_high_opt          ? 
_reflns.pdbx_d_res_low_opt           ? 
_reflns.details                      ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1  1.760 1.790  ? ? ? ? 0.618 ? ? 0.899 1.900 ? ? ? 48723 ? ? ? ? 91.500 0.833 0.556 0.736 
1 2  1.790 1.820  ? ? ? ? 0.509 ? ? 0.900 1.900 ? ? ? 50796 ? ? ? ? 95.300 0.686 0.458 0.795 
1 3  1.820 1.860  ? ? ? ? 0.440 ? ? 0.912 2.100 ? ? ? 51254 ? ? ? ? 96.000 0.593 0.394 0.831 
1 4  1.860 1.900  ? ? ? ? 0.355 ? ? 0.930 2.200 ? ? ? 51358 ? ? ? ? 96.400 0.478 0.318 0.881 
1 5  1.900 1.940  ? ? ? ? 0.280 ? ? 0.943 2.200 ? ? ? 51643 ? ? ? ? 96.600 0.377 0.250 0.917 
1 6  1.940 1.980  ? ? ? ? 0.232 ? ? 0.964 2.200 ? ? ? 51566 ? ? ? ? 96.700 0.313 0.208 0.940 
1 7  1.980 2.030  ? ? ? ? 0.182 ? ? 0.969 2.200 ? ? ? 51651 ? ? ? ? 96.900 0.246 0.164 0.962 
1 8  2.030 2.090  ? ? ? ? 0.149 ? ? 0.984 2.200 ? ? ? 51694 ? ? ? ? 97.000 0.201 0.134 0.974 
1 9  2.090 2.150  ? ? ? ? 0.128 ? ? 0.974 2.200 ? ? ? 51747 ? ? ? ? 97.200 0.172 0.115 0.981 
1 10 2.150 2.220  ? ? ? ? 0.105 ? ? 0.981 2.200 ? ? ? 52075 ? ? ? ? 97.300 0.141 0.094 0.987 
1 11 2.220 2.300  ? ? ? ? 0.087 ? ? 0.964 2.200 ? ? ? 51824 ? ? ? ? 97.400 0.118 0.078 0.990 
1 12 2.300 2.390  ? ? ? ? 0.074 ? ? 0.956 2.200 ? ? ? 52021 ? ? ? ? 97.600 0.100 0.067 0.993 
1 13 2.390 2.500  ? ? ? ? 0.065 ? ? 0.936 2.200 ? ? ? 52175 ? ? ? ? 97.800 0.088 0.059 0.994 
1 14 2.500 2.630  ? ? ? ? 0.054 ? ? 0.920 2.200 ? ? ? 52284 ? ? ? ? 98.000 0.074 0.049 0.995 
1 15 2.630 2.790  ? ? ? ? 0.046 ? ? 0.906 2.200 ? ? ? 52345 ? ? ? ? 98.200 0.062 0.042 0.997 
1 16 2.790 3.010  ? ? ? ? 0.037 ? ? 0.898 2.200 ? ? ? 52518 ? ? ? ? 98.400 0.050 0.034 0.997 
1 17 3.010 3.310  ? ? ? ? 0.034 ? ? 0.955 2.200 ? ? ? 52510 ? ? ? ? 98.500 0.046 0.031 0.996 
1 18 3.310 3.790  ? ? ? ? 0.031 ? ? 1.052 2.100 ? ? ? 52548 ? ? ? ? 98.600 0.042 0.029 0.996 
1 19 3.790 4.780  ? ? ? ? 0.026 ? ? 0.867 2.100 ? ? ? 52620 ? ? ? ? 98.700 0.035 0.024 0.997 
1 20 4.780 50.000 ? ? ? ? 0.023 ? ? 0.594 2.100 ? ? ? 51963 ? ? ? ? 97.400 0.031 0.021 0.998 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5W5T 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     974344 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.960 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             41.26 
_refine.ls_d_res_high                            1.76 
_refine.ls_percent_reflns_obs                    91.1 
_refine.ls_R_factor_obs                          0.166 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.163 
_refine.ls_R_factor_R_free                       0.207 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.200 
_refine.ls_number_reflns_R_free                  50673 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               25.64 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       TWIN_LSQ_F 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 23.890 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        64362 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         731 
_refine_hist.number_atoms_solvent             11257 
_refine_hist.number_atoms_total               76350 
_refine_hist.d_res_high                       1.76 
_refine_hist.d_res_low                        41.26 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 66593 'X-RAY DIFFRACTION' ? 
f_angle_d          1.106  ? ? 90425 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.604 ? ? 24222 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.043  ? ? 9789  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 11798 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.7629 1.7933  20078 0.2617 38.00 0.2896 . . 956  . . 
'X-RAY DIFFRACTION' . 1.7933 1.8259  27952 0.2472 52.00 0.2814 . . 1439 . . 
'X-RAY DIFFRACTION' . 1.8259 1.8610  39001 0.2355 73.00 0.2529 . . 2035 . . 
'X-RAY DIFFRACTION' . 1.8610 1.8990  46186 0.2223 87.00 0.2562 . . 2393 . . 
'X-RAY DIFFRACTION' . 1.8990 1.9403  48749 0.2081 91.00 0.2557 . . 2510 . . 
'X-RAY DIFFRACTION' . 1.9403 1.9854  48843 0.2014 92.00 0.2375 . . 2682 . . 
'X-RAY DIFFRACTION' . 1.9854 2.0350  49368 0.1939 92.00 0.2368 . . 2506 . . 
'X-RAY DIFFRACTION' . 2.0350 2.0900  49092 0.1894 92.00 0.2185 . . 2673 . . 
'X-RAY DIFFRACTION' . 2.0900 2.1515  49322 0.1874 92.00 0.2251 . . 2527 . . 
'X-RAY DIFFRACTION' . 2.1515 2.2210  49540 0.1836 92.00 0.2215 . . 2632 . . 
'X-RAY DIFFRACTION' . 2.2210 2.3003  49465 0.1754 93.00 0.2167 . . 2519 . . 
'X-RAY DIFFRACTION' . 2.3003 2.3924  49493 0.1727 93.00 0.2286 . . 2634 . . 
'X-RAY DIFFRACTION' . 2.3924 2.5013  49638 0.1735 93.00 0.2173 . . 2653 . . 
'X-RAY DIFFRACTION' . 2.5013 2.6331  49657 0.1692 93.00 0.2159 . . 2727 . . 
'X-RAY DIFFRACTION' . 2.6331 2.7980  49704 0.1645 93.00 0.2083 . . 2805 . . 
'X-RAY DIFFRACTION' . 2.7980 3.0139  49965 0.1528 93.00 0.2032 . . 2650 . . 
'X-RAY DIFFRACTION' . 3.0139 3.3170  50057 0.1456 94.00 0.2001 . . 2528 . . 
'X-RAY DIFFRACTION' . 3.3170 3.7965  50308 0.1247 94.00 0.1735 . . 2371 . . 
'X-RAY DIFFRACTION' . 3.7965 4.7813  50113 0.1094 94.00 0.1547 . . 2524 . . 
'X-RAY DIFFRACTION' . 4.7813 35.1691 49508 0.1837 93.00 0.2102 . . 2513 . . 
# 
_struct.entry_id                     5W5T 
_struct.title                        'Agrobacterium tumefaciens ADP-Glucose Pyrophosphorylase bound to activator ethyl pyruvate' 
_struct.pdbx_descriptor              'Glucose-1-phosphate adenylyltransferase (E.C.2.7.7.27)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5W5T 
_struct_keywords.text            
'Glucose-1-phosphate adenylyltransferase, glycogen biosynthesis, starch biosynthesis, allosterism, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 3 ? 
Z  N N 4 ? 
AA N N 2 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 2 ? 
JA N N 2 ? 
KA N N 3 ? 
LA N N 3 ? 
MA N N 3 ? 
NA N N 3 ? 
OA N N 2 ? 
PA N N 2 ? 
QA N N 2 ? 
RA N N 2 ? 
SA N N 3 ? 
TA N N 3 ? 
UA N N 3 ? 
VA N N 4 ? 
WA N N 2 ? 
XA N N 2 ? 
YA N N 2 ? 
ZA N N 3 ? 
AB N N 2 ? 
BB N N 2 ? 
CB N N 4 ? 
DB N N 2 ? 
EB N N 2 ? 
FB N N 2 ? 
GB N N 3 ? 
HB N N 3 ? 
IB N N 4 ? 
JB N N 2 ? 
KB N N 2 ? 
LB N N 3 ? 
MB N N 2 ? 
NB N N 2 ? 
OB N N 2 ? 
PB N N 2 ? 
QB N N 3 ? 
RB N N 3 ? 
SB N N 3 ? 
TB N N 4 ? 
UB N N 2 ? 
VB N N 2 ? 
WB N N 2 ? 
XB N N 3 ? 
YB N N 3 ? 
ZB N N 3 ? 
AC N N 3 ? 
BC N N 2 ? 
CC N N 2 ? 
DC N N 2 ? 
EC N N 3 ? 
FC N N 3 ? 
GC N N 2 ? 
HC N N 2 ? 
IC N N 2 ? 
JC N N 2 ? 
KC N N 3 ? 
LC N N 3 ? 
MC N N 4 ? 
NC N N 2 ? 
OC N N 2 ? 
PC N N 2 ? 
QC N N 3 ? 
RC N N 3 ? 
SC N N 3 ? 
TC N N 3 ? 
UC N N 4 ? 
VC N N 2 ? 
WC N N 2 ? 
XC N N 2 ? 
YC N N 3 ? 
ZC N N 3 ? 
AD N N 2 ? 
BD N N 2 ? 
CD N N 2 ? 
DD N N 2 ? 
ED N N 2 ? 
FD N N 3 ? 
GD N N 3 ? 
HD N N 4 ? 
ID N N 2 ? 
JD N N 2 ? 
KD N N 2 ? 
LD N N 2 ? 
MD N N 3 ? 
ND N N 3 ? 
OD N N 2 ? 
PD N N 2 ? 
QD N N 2 ? 
RD N N 2 ? 
SD N N 2 ? 
TD N N 2 ? 
UD N N 2 ? 
VD N N 2 ? 
WD N N 3 ? 
XD N N 3 ? 
YD N N 3 ? 
ZD N N 2 ? 
AE N N 2 ? 
BE N N 2 ? 
CE N N 2 ? 
DE N N 2 ? 
EE N N 2 ? 
FE N N 3 ? 
GE N N 3 ? 
HE N N 3 ? 
IE N N 3 ? 
JE N N 4 ? 
KE N N 2 ? 
LE N N 2 ? 
ME N N 2 ? 
NE N N 3 ? 
OE N N 3 ? 
PE N N 4 ? 
QE N N 2 ? 
RE N N 2 ? 
SE N N 2 ? 
TE N N 2 ? 
UE N N 3 ? 
VE N N 5 ? 
WE N N 5 ? 
XE N N 5 ? 
YE N N 5 ? 
ZE N N 5 ? 
AF N N 5 ? 
BF N N 5 ? 
CF N N 5 ? 
DF N N 5 ? 
EF N N 5 ? 
FF N N 5 ? 
GF N N 5 ? 
HF N N 5 ? 
IF N N 5 ? 
JF N N 5 ? 
KF N N 5 ? 
LF N N 5 ? 
MF N N 5 ? 
NF N N 5 ? 
OF N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 PRO A 3   ? ARG A 6   ? PRO A 9   ARG A 12  5 ? 4  
HELX_P HELX_P2   AA2 GLY A 18  ? ASP A 26  ? GLY A 24  ASP A 32  5 ? 9  
HELX_P HELX_P3   AA3 ALA A 29  ? ALA A 32  ? ALA A 35  ALA A 38  5 ? 4  
HELX_P HELX_P4   AA4 ILE A 42  ? SER A 52  ? ILE A 48  SER A 58  1 ? 11 
HELX_P HELX_P5   AA5 ALA A 65  ? TRP A 76  ? ALA A 71  TRP A 82  1 ? 12 
HELX_P HELX_P6   AA6 ARG A 80  ? ASN A 84  ? ARG A 86  ASN A 90  5 ? 5  
HELX_P HELX_P7   AA7 ALA A 106 ? GLN A 111 ? ALA A 112 GLN A 117 1 ? 6  
HELX_P HELX_P8   AA8 ASN A 112 ? ALA A 120 ? ASN A 118 ALA A 126 1 ? 9  
HELX_P HELX_P9   AA9 ASP A 136 ? GLY A 148 ? ASP A 142 GLY A 154 1 ? 13 
HELX_P HELX_P10  AB1 MET A 161 ? GLY A 165 ? MET A 167 GLY A 171 5 ? 5  
HELX_P HELX_P11  AB2 THR A 208 ? ASP A 221 ? THR A 214 ASP A 227 1 ? 14 
HELX_P HELX_P12  AB3 ASP A 231 ? GLY A 240 ? ASP A 237 GLY A 246 1 ? 10 
HELX_P HELX_P13  AB4 PHE A 247 ? CYS A 251 ? PHE A 253 CYS A 257 1 ? 5  
HELX_P HELX_P14  AB5 THR A 267 ? LEU A 278 ? THR A 273 LEU A 284 1 ? 12 
HELX_P HELX_P15  AB6 ASP A 387 ? PHE A 395 ? ASP A 393 PHE A 401 1 ? 9  
HELX_P HELX_P16  AB7 THR A 406 ? LYS A 412 ? THR A 412 LYS A 418 1 ? 7  
HELX_P HELX_P17  AB8 PRO B 3   ? ARG B 6   ? PRO B 9   ARG B 12  5 ? 4  
HELX_P HELX_P18  AB9 GLY B 18  ? ASP B 26  ? GLY B 24  ASP B 32  5 ? 9  
HELX_P HELX_P19  AC1 ALA B 29  ? ALA B 32  ? ALA B 35  ALA B 38  5 ? 4  
HELX_P HELX_P20  AC2 ILE B 42  ? SER B 52  ? ILE B 48  SER B 58  1 ? 11 
HELX_P HELX_P21  AC3 ALA B 65  ? TRP B 76  ? ALA B 71  TRP B 82  1 ? 12 
HELX_P HELX_P22  AC4 ARG B 80  ? ASN B 84  ? ARG B 86  ASN B 90  5 ? 5  
HELX_P HELX_P23  AC5 GLY B 104 ? GLN B 111 ? GLY B 110 GLN B 117 1 ? 8  
HELX_P HELX_P24  AC6 ASN B 112 ? GLU B 117 ? ASN B 118 GLU B 123 1 ? 6  
HELX_P HELX_P25  AC7 PRO B 118 ? ALA B 120 ? PRO B 124 ALA B 126 5 ? 3  
HELX_P HELX_P26  AC8 ASP B 136 ? GLY B 148 ? ASP B 142 GLY B 154 1 ? 13 
HELX_P HELX_P27  AC9 GLU B 162 ? GLY B 165 ? GLU B 168 GLY B 171 5 ? 4  
HELX_P HELX_P28  AD1 THR B 208 ? ALA B 220 ? THR B 214 ALA B 226 1 ? 13 
HELX_P HELX_P29  AD2 ASP B 231 ? GLY B 240 ? ASP B 237 GLY B 246 1 ? 10 
HELX_P HELX_P30  AD3 PHE B 247 ? CYS B 251 ? PHE B 253 CYS B 257 1 ? 5  
HELX_P HELX_P31  AD4 THR B 267 ? ASP B 277 ? THR B 273 ASP B 283 1 ? 11 
HELX_P HELX_P32  AD5 LEU B 278 ? ASP B 280 ? LEU B 284 ASP B 286 5 ? 3  
HELX_P HELX_P33  AD6 ASP B 387 ? PHE B 395 ? ASP B 393 PHE B 401 1 ? 9  
HELX_P HELX_P34  AD7 THR B 406 ? LYS B 412 ? THR B 412 LYS B 418 1 ? 7  
HELX_P HELX_P35  AD8 PRO C 3   ? ARG C 6   ? PRO C 9   ARG C 12  5 ? 4  
HELX_P HELX_P36  AD9 GLY C 18  ? ASP C 26  ? GLY C 24  ASP C 32  5 ? 9  
HELX_P HELX_P37  AE1 ALA C 29  ? ALA C 32  ? ALA C 35  ALA C 38  5 ? 4  
HELX_P HELX_P38  AE2 ILE C 41  ? SER C 52  ? ILE C 47  SER C 58  1 ? 12 
HELX_P HELX_P39  AE3 ALA C 65  ? TRP C 76  ? ALA C 71  TRP C 82  1 ? 12 
HELX_P HELX_P40  AE4 ARG C 80  ? ASN C 84  ? ARG C 86  ASN C 90  5 ? 5  
HELX_P HELX_P41  AE5 GLY C 104 ? GLN C 111 ? GLY C 110 GLN C 117 1 ? 8  
HELX_P HELX_P42  AE6 ASN C 112 ? GLU C 117 ? ASN C 118 GLU C 123 1 ? 6  
HELX_P HELX_P43  AE7 PRO C 118 ? ALA C 120 ? PRO C 124 ALA C 126 5 ? 3  
HELX_P HELX_P44  AE8 ASP C 136 ? GLY C 148 ? ASP C 142 GLY C 154 1 ? 13 
HELX_P HELX_P45  AE9 ARG C 160 ? THR C 164 ? ARG C 166 THR C 170 1 ? 5  
HELX_P HELX_P46  AF1 THR C 208 ? ALA C 220 ? THR C 214 ALA C 226 1 ? 13 
HELX_P HELX_P47  AF2 ASP C 231 ? GLY C 240 ? ASP C 237 GLY C 246 1 ? 10 
HELX_P HELX_P48  AF3 PHE C 247 ? CYS C 251 ? PHE C 253 CYS C 257 1 ? 5  
HELX_P HELX_P49  AF4 THR C 267 ? ASP C 277 ? THR C 273 ASP C 283 1 ? 11 
HELX_P HELX_P50  AF5 LEU C 278 ? ASP C 280 ? LEU C 284 ASP C 286 5 ? 3  
HELX_P HELX_P51  AF6 ASP C 387 ? PHE C 395 ? ASP C 393 PHE C 401 1 ? 9  
HELX_P HELX_P52  AF7 THR C 406 ? LYS C 412 ? THR C 412 LYS C 418 1 ? 7  
HELX_P HELX_P53  AF8 PRO D 3   ? ARG D 6   ? PRO D 9   ARG D 12  5 ? 4  
HELX_P HELX_P54  AF9 GLY D 18  ? ASP D 26  ? GLY D 24  ASP D 32  5 ? 9  
HELX_P HELX_P55  AG1 ALA D 29  ? ALA D 32  ? ALA D 35  ALA D 38  5 ? 4  
HELX_P HELX_P56  AG2 ILE D 41  ? GLY D 53  ? ILE D 47  GLY D 59  1 ? 13 
HELX_P HELX_P57  AG3 ALA D 65  ? TRP D 76  ? ALA D 71  TRP D 82  1 ? 12 
HELX_P HELX_P58  AG4 ARG D 80  ? ASN D 84  ? ARG D 86  ASN D 90  5 ? 5  
HELX_P HELX_P59  AG5 GLY D 104 ? GLN D 111 ? GLY D 110 GLN D 117 1 ? 8  
HELX_P HELX_P60  AG6 ASN D 112 ? GLU D 117 ? ASN D 118 GLU D 123 1 ? 6  
HELX_P HELX_P61  AG7 ASP D 136 ? GLY D 148 ? ASP D 142 GLY D 154 1 ? 13 
HELX_P HELX_P62  AG8 ARG D 160 ? THR D 164 ? ARG D 166 THR D 170 1 ? 5  
HELX_P HELX_P63  AG9 THR D 208 ? ASP D 221 ? THR D 214 ASP D 227 1 ? 14 
HELX_P HELX_P64  AH1 ASP D 231 ? GLY D 240 ? ASP D 237 GLY D 246 1 ? 10 
HELX_P HELX_P65  AH2 ALA D 248 ? SER D 250 ? ALA D 254 SER D 256 5 ? 3  
HELX_P HELX_P66  AH3 THR D 267 ? ASP D 277 ? THR D 273 ASP D 283 1 ? 11 
HELX_P HELX_P67  AH4 LEU D 278 ? ASP D 280 ? LEU D 284 ASP D 286 5 ? 3  
HELX_P HELX_P68  AH5 ASP D 387 ? PHE D 395 ? ASP D 393 PHE D 401 1 ? 9  
HELX_P HELX_P69  AH6 THR D 406 ? LYS D 412 ? THR D 412 LYS D 418 1 ? 7  
HELX_P HELX_P70  AH7 PRO E 3   ? ARG E 6   ? PRO E 9   ARG E 12  5 ? 4  
HELX_P HELX_P71  AH8 GLY E 18  ? ASP E 26  ? GLY E 24  ASP E 32  5 ? 9  
HELX_P HELX_P72  AH9 ALA E 29  ? ALA E 32  ? ALA E 35  ALA E 38  5 ? 4  
HELX_P HELX_P73  AI1 ILE E 41  ? SER E 52  ? ILE E 47  SER E 58  1 ? 12 
HELX_P HELX_P74  AI2 LEU E 68  ? TRP E 76  ? LEU E 74  TRP E 82  1 ? 9  
HELX_P HELX_P75  AI3 ARG E 80  ? ASN E 84  ? ARG E 86  ASN E 90  5 ? 5  
HELX_P HELX_P76  AI4 GLY E 104 ? GLN E 111 ? GLY E 110 GLN E 117 1 ? 8  
HELX_P HELX_P77  AI5 ASN E 112 ? GLU E 117 ? ASN E 118 GLU E 123 1 ? 6  
HELX_P HELX_P78  AI6 PRO E 118 ? ALA E 120 ? PRO E 124 ALA E 126 5 ? 3  
HELX_P HELX_P79  AI7 ASP E 136 ? GLY E 148 ? ASP E 142 GLY E 154 1 ? 13 
HELX_P HELX_P80  AI8 ARG E 160 ? THR E 164 ? ARG E 166 THR E 170 1 ? 5  
HELX_P HELX_P81  AI9 THR E 208 ? ASP E 221 ? THR E 214 ASP E 227 1 ? 14 
HELX_P HELX_P82  AJ1 ASP E 231 ? GLY E 240 ? ASP E 237 GLY E 246 1 ? 10 
HELX_P HELX_P83  AJ2 PHE E 247 ? CYS E 251 ? PHE E 253 CYS E 257 1 ? 5  
HELX_P HELX_P84  AJ3 THR E 267 ? ASP E 277 ? THR E 273 ASP E 283 1 ? 11 
HELX_P HELX_P85  AJ4 LEU E 278 ? ASP E 280 ? LEU E 284 ASP E 286 5 ? 3  
HELX_P HELX_P86  AJ5 ASP E 387 ? PHE E 395 ? ASP E 393 PHE E 401 1 ? 9  
HELX_P HELX_P87  AJ6 THR E 406 ? LYS E 412 ? THR E 412 LYS E 418 1 ? 7  
HELX_P HELX_P88  AJ7 PRO F 3   ? ARG F 6   ? PRO F 9   ARG F 12  5 ? 4  
HELX_P HELX_P89  AJ8 GLY F 18  ? ASP F 26  ? GLY F 24  ASP F 32  5 ? 9  
HELX_P HELX_P90  AJ9 ALA F 29  ? ALA F 32  ? ALA F 35  ALA F 38  5 ? 4  
HELX_P HELX_P91  AK1 ILE F 41  ? SER F 52  ? ILE F 47  SER F 58  1 ? 12 
HELX_P HELX_P92  AK2 ALA F 65  ? TRP F 76  ? ALA F 71  TRP F 82  1 ? 12 
HELX_P HELX_P93  AK3 ARG F 80  ? ASN F 84  ? ARG F 86  ASN F 90  5 ? 5  
HELX_P HELX_P94  AK4 GLY F 104 ? GLN F 111 ? GLY F 110 GLN F 117 1 ? 8  
HELX_P HELX_P95  AK5 ASN F 112 ? GLU F 117 ? ASN F 118 GLU F 123 1 ? 6  
HELX_P HELX_P96  AK6 TYR F 137 ? GLY F 148 ? TYR F 143 GLY F 154 1 ? 12 
HELX_P HELX_P97  AK7 MET F 161 ? GLY F 165 ? MET F 167 GLY F 171 5 ? 5  
HELX_P HELX_P98  AK8 THR F 208 ? ASP F 221 ? THR F 214 ASP F 227 1 ? 14 
HELX_P HELX_P99  AK9 ASP F 231 ? GLY F 240 ? ASP F 237 GLY F 246 1 ? 10 
HELX_P HELX_P100 AL1 PHE F 247 ? CYS F 251 ? PHE F 253 CYS F 257 1 ? 5  
HELX_P HELX_P101 AL2 THR F 267 ? ASP F 277 ? THR F 273 ASP F 283 1 ? 11 
HELX_P HELX_P102 AL3 LEU F 278 ? ASP F 280 ? LEU F 284 ASP F 286 5 ? 3  
HELX_P HELX_P103 AL4 ASP F 387 ? PHE F 395 ? ASP F 393 PHE F 401 1 ? 9  
HELX_P HELX_P104 AL5 THR F 406 ? LYS F 412 ? THR F 412 LYS F 418 1 ? 7  
HELX_P HELX_P105 AL6 PRO G 3   ? ARG G 6   ? PRO G 9   ARG G 12  5 ? 4  
HELX_P HELX_P106 AL7 GLY G 18  ? ASP G 26  ? GLY G 24  ASP G 32  5 ? 9  
HELX_P HELX_P107 AL8 ALA G 29  ? ALA G 32  ? ALA G 35  ALA G 38  5 ? 4  
HELX_P HELX_P108 AL9 ILE G 42  ? SER G 52  ? ILE G 48  SER G 58  1 ? 11 
HELX_P HELX_P109 AM1 ALA G 65  ? TRP G 76  ? ALA G 71  TRP G 82  1 ? 12 
HELX_P HELX_P110 AM2 ARG G 80  ? ASN G 84  ? ARG G 86  ASN G 90  5 ? 5  
HELX_P HELX_P111 AM3 ALA G 106 ? GLN G 111 ? ALA G 112 GLN G 117 1 ? 6  
HELX_P HELX_P112 AM4 ASN G 112 ? GLU G 117 ? ASN G 118 GLU G 123 1 ? 6  
HELX_P HELX_P113 AM5 PRO G 118 ? ALA G 120 ? PRO G 124 ALA G 126 5 ? 3  
HELX_P HELX_P114 AM6 ASP G 136 ? GLY G 148 ? ASP G 142 GLY G 154 1 ? 13 
HELX_P HELX_P115 AM7 MET G 161 ? GLY G 165 ? MET G 167 GLY G 171 5 ? 5  
HELX_P HELX_P116 AM8 THR G 208 ? ASP G 221 ? THR G 214 ASP G 227 1 ? 14 
HELX_P HELX_P117 AM9 ASP G 231 ? GLY G 240 ? ASP G 237 GLY G 246 1 ? 10 
HELX_P HELX_P118 AN1 PHE G 247 ? CYS G 251 ? PHE G 253 CYS G 257 1 ? 5  
HELX_P HELX_P119 AN2 THR G 267 ? ASP G 277 ? THR G 273 ASP G 283 1 ? 11 
HELX_P HELX_P120 AN3 LEU G 278 ? ASP G 280 ? LEU G 284 ASP G 286 5 ? 3  
HELX_P HELX_P121 AN4 ASP G 387 ? PHE G 395 ? ASP G 393 PHE G 401 1 ? 9  
HELX_P HELX_P122 AN5 THR G 406 ? LYS G 412 ? THR G 412 LYS G 418 1 ? 7  
HELX_P HELX_P123 AN6 PRO H 3   ? ARG H 6   ? PRO H 9   ARG H 12  5 ? 4  
HELX_P HELX_P124 AN7 GLY H 18  ? ASP H 26  ? GLY H 24  ASP H 32  5 ? 9  
HELX_P HELX_P125 AN8 ALA H 29  ? ALA H 32  ? ALA H 35  ALA H 38  5 ? 4  
HELX_P HELX_P126 AN9 ILE H 42  ? SER H 52  ? ILE H 48  SER H 58  1 ? 11 
HELX_P HELX_P127 AO1 ALA H 65  ? TRP H 76  ? ALA H 71  TRP H 82  1 ? 12 
HELX_P HELX_P128 AO2 ARG H 80  ? ASN H 84  ? ARG H 86  ASN H 90  5 ? 5  
HELX_P HELX_P129 AO3 ALA H 106 ? GLN H 111 ? ALA H 112 GLN H 117 1 ? 6  
HELX_P HELX_P130 AO4 ASN H 112 ? GLU H 117 ? ASN H 118 GLU H 123 1 ? 6  
HELX_P HELX_P131 AO5 ASP H 136 ? GLY H 148 ? ASP H 142 GLY H 154 1 ? 13 
HELX_P HELX_P132 AO6 MET H 161 ? GLY H 165 ? MET H 167 GLY H 171 5 ? 5  
HELX_P HELX_P133 AO7 THR H 208 ? ALA H 220 ? THR H 214 ALA H 226 1 ? 13 
HELX_P HELX_P134 AO8 ASP H 231 ? GLY H 240 ? ASP H 237 GLY H 246 1 ? 10 
HELX_P HELX_P135 AO9 PHE H 247 ? CYS H 251 ? PHE H 253 CYS H 257 1 ? 5  
HELX_P HELX_P136 AP1 THR H 267 ? LEU H 278 ? THR H 273 LEU H 284 1 ? 12 
HELX_P HELX_P137 AP2 ASP H 387 ? PHE H 395 ? ASP H 393 PHE H 401 1 ? 9  
HELX_P HELX_P138 AP3 THR H 406 ? ASP H 411 ? THR H 412 ASP H 417 1 ? 6  
HELX_P HELX_P139 AP4 PRO I 3   ? ARG I 6   ? PRO I 9   ARG I 12  5 ? 4  
HELX_P HELX_P140 AP5 GLY I 18  ? ASP I 26  ? GLY I 24  ASP I 32  5 ? 9  
HELX_P HELX_P141 AP6 ALA I 29  ? ALA I 32  ? ALA I 35  ALA I 38  5 ? 4  
HELX_P HELX_P142 AP7 ILE I 41  ? GLY I 53  ? ILE I 47  GLY I 59  1 ? 13 
HELX_P HELX_P143 AP8 ALA I 65  ? TRP I 76  ? ALA I 71  TRP I 82  1 ? 12 
HELX_P HELX_P144 AP9 ARG I 80  ? ASN I 84  ? ARG I 86  ASN I 90  5 ? 5  
HELX_P HELX_P145 AQ1 ALA I 106 ? GLN I 111 ? ALA I 112 GLN I 117 1 ? 6  
HELX_P HELX_P146 AQ2 ASN I 112 ? GLU I 117 ? ASN I 118 GLU I 123 1 ? 6  
HELX_P HELX_P147 AQ3 ASP I 136 ? GLY I 148 ? ASP I 142 GLY I 154 1 ? 13 
HELX_P HELX_P148 AQ4 ARG I 160 ? THR I 164 ? ARG I 166 THR I 170 1 ? 5  
HELX_P HELX_P149 AQ5 THR I 208 ? ASP I 221 ? THR I 214 ASP I 227 1 ? 14 
HELX_P HELX_P150 AQ6 ASP I 231 ? GLY I 240 ? ASP I 237 GLY I 246 1 ? 10 
HELX_P HELX_P151 AQ7 PHE I 247 ? CYS I 251 ? PHE I 253 CYS I 257 1 ? 5  
HELX_P HELX_P152 AQ8 THR I 267 ? ASP I 277 ? THR I 273 ASP I 283 1 ? 11 
HELX_P HELX_P153 AQ9 LEU I 278 ? ASP I 280 ? LEU I 284 ASP I 286 5 ? 3  
HELX_P HELX_P154 AR1 ASP I 387 ? PHE I 395 ? ASP I 393 PHE I 401 1 ? 9  
HELX_P HELX_P155 AR2 THR I 406 ? LYS I 412 ? THR I 412 LYS I 418 1 ? 7  
HELX_P HELX_P156 AR3 PRO J 3   ? ARG J 6   ? PRO J 9   ARG J 12  5 ? 4  
HELX_P HELX_P157 AR4 GLY J 18  ? ASP J 26  ? GLY J 24  ASP J 32  5 ? 9  
HELX_P HELX_P158 AR5 ALA J 29  ? ALA J 32  ? ALA J 35  ALA J 38  5 ? 4  
HELX_P HELX_P159 AR6 ILE J 42  ? SER J 52  ? ILE J 48  SER J 58  1 ? 11 
HELX_P HELX_P160 AR7 ALA J 65  ? TRP J 76  ? ALA J 71  TRP J 82  1 ? 12 
HELX_P HELX_P161 AR8 ARG J 80  ? ASN J 84  ? ARG J 86  ASN J 90  5 ? 5  
HELX_P HELX_P162 AR9 GLY J 104 ? GLN J 111 ? GLY J 110 GLN J 117 1 ? 8  
HELX_P HELX_P163 AS1 ASN J 112 ? GLU J 117 ? ASN J 118 GLU J 123 1 ? 6  
HELX_P HELX_P164 AS2 ASP J 136 ? GLY J 148 ? ASP J 142 GLY J 154 1 ? 13 
HELX_P HELX_P165 AS3 ARG J 160 ? THR J 164 ? ARG J 166 THR J 170 1 ? 5  
HELX_P HELX_P166 AS4 THR J 208 ? ALA J 220 ? THR J 214 ALA J 226 1 ? 13 
HELX_P HELX_P167 AS5 ASP J 231 ? GLY J 240 ? ASP J 237 GLY J 246 1 ? 10 
HELX_P HELX_P168 AS6 ALA J 248 ? SER J 250 ? ALA J 254 SER J 256 5 ? 3  
HELX_P HELX_P169 AS7 THR J 267 ? ASP J 277 ? THR J 273 ASP J 283 1 ? 11 
HELX_P HELX_P170 AS8 LEU J 278 ? ASP J 280 ? LEU J 284 ASP J 286 5 ? 3  
HELX_P HELX_P171 AS9 ASP J 387 ? PHE J 395 ? ASP J 393 PHE J 401 1 ? 9  
HELX_P HELX_P172 AT1 THR J 406 ? LYS J 412 ? THR J 412 LYS J 418 1 ? 7  
HELX_P HELX_P173 AT2 PRO K 3   ? ARG K 6   ? PRO K 9   ARG K 12  5 ? 4  
HELX_P HELX_P174 AT3 GLY K 18  ? ASP K 26  ? GLY K 24  ASP K 32  5 ? 9  
HELX_P HELX_P175 AT4 ALA K 29  ? ALA K 32  ? ALA K 35  ALA K 38  5 ? 4  
HELX_P HELX_P176 AT5 ILE K 42  ? SER K 52  ? ILE K 48  SER K 58  1 ? 11 
HELX_P HELX_P177 AT6 ALA K 65  ? TRP K 76  ? ALA K 71  TRP K 82  1 ? 12 
HELX_P HELX_P178 AT7 ARG K 80  ? ASN K 84  ? ARG K 86  ASN K 90  5 ? 5  
HELX_P HELX_P179 AT8 GLY K 104 ? GLN K 111 ? GLY K 110 GLN K 117 1 ? 8  
HELX_P HELX_P180 AT9 ASN K 112 ? GLU K 117 ? ASN K 118 GLU K 123 1 ? 6  
HELX_P HELX_P181 AU1 PRO K 118 ? ALA K 120 ? PRO K 124 ALA K 126 5 ? 3  
HELX_P HELX_P182 AU2 ASP K 136 ? GLY K 148 ? ASP K 142 GLY K 154 1 ? 13 
HELX_P HELX_P183 AU3 MET K 161 ? THR K 164 ? MET K 167 THR K 170 5 ? 4  
HELX_P HELX_P184 AU4 THR K 208 ? ASP K 221 ? THR K 214 ASP K 227 1 ? 14 
HELX_P HELX_P185 AU5 ASP K 231 ? GLY K 240 ? ASP K 237 GLY K 246 1 ? 10 
HELX_P HELX_P186 AU6 PHE K 247 ? CYS K 251 ? PHE K 253 CYS K 257 1 ? 5  
HELX_P HELX_P187 AU7 THR K 267 ? ASP K 277 ? THR K 273 ASP K 283 1 ? 11 
HELX_P HELX_P188 AU8 LEU K 278 ? ASP K 280 ? LEU K 284 ASP K 286 5 ? 3  
HELX_P HELX_P189 AU9 GLU K 389 ? PHE K 395 ? GLU K 395 PHE K 401 1 ? 7  
HELX_P HELX_P190 AV1 THR K 406 ? LYS K 412 ? THR K 412 LYS K 418 1 ? 7  
HELX_P HELX_P191 AV2 PRO L 3   ? ARG L 6   ? PRO L 9   ARG L 12  5 ? 4  
HELX_P HELX_P192 AV3 GLY L 18  ? ASP L 26  ? GLY L 24  ASP L 32  5 ? 9  
HELX_P HELX_P193 AV4 ALA L 29  ? ALA L 32  ? ALA L 35  ALA L 38  5 ? 4  
HELX_P HELX_P194 AV5 ILE L 41  ? SER L 52  ? ILE L 47  SER L 58  1 ? 12 
HELX_P HELX_P195 AV6 ALA L 65  ? TRP L 76  ? ALA L 71  TRP L 82  1 ? 12 
HELX_P HELX_P196 AV7 ARG L 80  ? ASN L 84  ? ARG L 86  ASN L 90  5 ? 5  
HELX_P HELX_P197 AV8 GLY L 104 ? GLN L 111 ? GLY L 110 GLN L 117 1 ? 8  
HELX_P HELX_P198 AV9 ASN L 112 ? GLU L 117 ? ASN L 118 GLU L 123 1 ? 6  
HELX_P HELX_P199 AW1 PRO L 118 ? ALA L 120 ? PRO L 124 ALA L 126 5 ? 3  
HELX_P HELX_P200 AW2 ASP L 136 ? GLY L 148 ? ASP L 142 GLY L 154 1 ? 13 
HELX_P HELX_P201 AW3 MET L 161 ? GLY L 165 ? MET L 167 GLY L 171 5 ? 5  
HELX_P HELX_P202 AW4 THR L 208 ? ASP L 221 ? THR L 214 ASP L 227 1 ? 14 
HELX_P HELX_P203 AW5 ASP L 231 ? GLY L 240 ? ASP L 237 GLY L 246 1 ? 10 
HELX_P HELX_P204 AW6 PHE L 247 ? CYS L 251 ? PHE L 253 CYS L 257 1 ? 5  
HELX_P HELX_P205 AW7 THR L 267 ? ASP L 277 ? THR L 273 ASP L 283 1 ? 11 
HELX_P HELX_P206 AW8 LEU L 278 ? ASP L 280 ? LEU L 284 ASP L 286 5 ? 3  
HELX_P HELX_P207 AW9 ASP L 387 ? PHE L 395 ? ASP L 393 PHE L 401 1 ? 9  
HELX_P HELX_P208 AX1 THR L 406 ? LYS L 412 ? THR L 412 LYS L 418 1 ? 7  
HELX_P HELX_P209 AX2 PRO M 3   ? ARG M 6   ? PRO M 9   ARG M 12  5 ? 4  
HELX_P HELX_P210 AX3 GLY M 18  ? ASP M 26  ? GLY M 24  ASP M 32  5 ? 9  
HELX_P HELX_P211 AX4 ALA M 29  ? ALA M 32  ? ALA M 35  ALA M 38  5 ? 4  
HELX_P HELX_P212 AX5 ILE M 42  ? SER M 52  ? ILE M 48  SER M 58  1 ? 11 
HELX_P HELX_P213 AX6 ALA M 65  ? TRP M 76  ? ALA M 71  TRP M 82  1 ? 12 
HELX_P HELX_P214 AX7 ARG M 80  ? ASN M 84  ? ARG M 86  ASN M 90  5 ? 5  
HELX_P HELX_P215 AX8 GLY M 104 ? GLN M 111 ? GLY M 110 GLN M 117 1 ? 8  
HELX_P HELX_P216 AX9 ASN M 112 ? ALA M 120 ? ASN M 118 ALA M 126 1 ? 9  
HELX_P HELX_P217 AY1 ASP M 136 ? GLY M 148 ? ASP M 142 GLY M 154 1 ? 13 
HELX_P HELX_P218 AY2 ARG M 160 ? THR M 164 ? ARG M 166 THR M 170 1 ? 5  
HELX_P HELX_P219 AY3 THR M 208 ? ASP M 221 ? THR M 214 ASP M 227 1 ? 14 
HELX_P HELX_P220 AY4 ASP M 231 ? GLY M 240 ? ASP M 237 GLY M 246 1 ? 10 
HELX_P HELX_P221 AY5 PHE M 247 ? CYS M 251 ? PHE M 253 CYS M 257 1 ? 5  
HELX_P HELX_P222 AY6 THR M 267 ? ASP M 277 ? THR M 273 ASP M 283 1 ? 11 
HELX_P HELX_P223 AY7 LEU M 278 ? ASP M 280 ? LEU M 284 ASP M 286 5 ? 3  
HELX_P HELX_P224 AY8 ASP M 387 ? PHE M 395 ? ASP M 393 PHE M 401 1 ? 9  
HELX_P HELX_P225 AY9 THR M 406 ? LYS M 412 ? THR M 412 LYS M 418 1 ? 7  
HELX_P HELX_P226 AZ1 PRO N 3   ? ARG N 6   ? PRO N 9   ARG N 12  5 ? 4  
HELX_P HELX_P227 AZ2 GLY N 18  ? ASP N 26  ? GLY N 24  ASP N 32  5 ? 9  
HELX_P HELX_P228 AZ3 ALA N 29  ? ALA N 32  ? ALA N 35  ALA N 38  5 ? 4  
HELX_P HELX_P229 AZ4 ILE N 42  ? GLY N 53  ? ILE N 48  GLY N 59  1 ? 12 
HELX_P HELX_P230 AZ5 ALA N 65  ? TRP N 76  ? ALA N 71  TRP N 82  1 ? 12 
HELX_P HELX_P231 AZ6 ARG N 80  ? ASN N 84  ? ARG N 86  ASN N 90  5 ? 5  
HELX_P HELX_P232 AZ7 GLY N 104 ? GLN N 111 ? GLY N 110 GLN N 117 1 ? 8  
HELX_P HELX_P233 AZ8 ASN N 112 ? ALA N 120 ? ASN N 118 ALA N 126 1 ? 9  
HELX_P HELX_P234 AZ9 ASP N 136 ? GLY N 148 ? ASP N 142 GLY N 154 1 ? 13 
HELX_P HELX_P235 BA1 GLU N 162 ? GLY N 165 ? GLU N 168 GLY N 171 5 ? 4  
HELX_P HELX_P236 BA2 THR N 208 ? ALA N 220 ? THR N 214 ALA N 226 1 ? 13 
HELX_P HELX_P237 BA3 ASP N 231 ? GLY N 240 ? ASP N 237 GLY N 246 1 ? 10 
HELX_P HELX_P238 BA4 PHE N 247 ? CYS N 251 ? PHE N 253 CYS N 257 1 ? 5  
HELX_P HELX_P239 BA5 THR N 267 ? ASP N 277 ? THR N 273 ASP N 283 1 ? 11 
HELX_P HELX_P240 BA6 LEU N 278 ? ASP N 280 ? LEU N 284 ASP N 286 5 ? 3  
HELX_P HELX_P241 BA7 ASP N 387 ? PHE N 395 ? ASP N 393 PHE N 401 1 ? 9  
HELX_P HELX_P242 BA8 THR N 406 ? ASP N 411 ? THR N 412 ASP N 417 1 ? 6  
HELX_P HELX_P243 BA9 PRO O 3   ? ARG O 6   ? PRO O 9   ARG O 12  5 ? 4  
HELX_P HELX_P244 BB1 GLY O 18  ? ASP O 26  ? GLY O 24  ASP O 32  5 ? 9  
HELX_P HELX_P245 BB2 ALA O 29  ? ALA O 32  ? ALA O 35  ALA O 38  5 ? 4  
HELX_P HELX_P246 BB3 ILE O 42  ? GLY O 53  ? ILE O 48  GLY O 59  1 ? 12 
HELX_P HELX_P247 BB4 SER O 67  ? LEU O 68  ? SER O 73  LEU O 74  5 ? 2  
HELX_P HELX_P248 BB5 ARG O 70  ? ARG O 70  ? ARG O 76  ARG O 76  5 ? 1  
HELX_P HELX_P249 BB6 HIS O 71  ? TRP O 76  ? HIS O 77  TRP O 82  1 ? 6  
HELX_P HELX_P250 BB7 ARG O 80  ? ASN O 84  ? ARG O 86  ASN O 90  5 ? 5  
HELX_P HELX_P251 BB8 GLY O 104 ? GLN O 111 ? GLY O 110 GLN O 117 1 ? 8  
HELX_P HELX_P252 BB9 ASN O 112 ? ALA O 120 ? ASN O 118 ALA O 126 1 ? 9  
HELX_P HELX_P253 BC1 ASP O 136 ? GLY O 148 ? ASP O 142 GLY O 154 1 ? 13 
HELX_P HELX_P254 BC2 GLU O 162 ? GLY O 165 ? GLU O 168 GLY O 171 5 ? 4  
HELX_P HELX_P255 BC3 THR O 208 ? ALA O 220 ? THR O 214 ALA O 226 1 ? 13 
HELX_P HELX_P256 BC4 ASP O 231 ? GLY O 240 ? ASP O 237 GLY O 246 1 ? 10 
HELX_P HELX_P257 BC5 PHE O 247 ? CYS O 251 ? PHE O 253 CYS O 257 1 ? 5  
HELX_P HELX_P258 BC6 THR O 267 ? ASP O 277 ? THR O 273 ASP O 283 1 ? 11 
HELX_P HELX_P259 BC7 LEU O 278 ? ASP O 280 ? LEU O 284 ASP O 286 5 ? 3  
HELX_P HELX_P260 BC8 ASP O 387 ? PHE O 395 ? ASP O 393 PHE O 401 1 ? 9  
HELX_P HELX_P261 BC9 THR O 406 ? LYS O 412 ? THR O 412 LYS O 418 1 ? 7  
HELX_P HELX_P262 BD1 PRO P 3   ? ARG P 6   ? PRO P 9   ARG P 12  5 ? 4  
HELX_P HELX_P263 BD2 GLY P 18  ? ASP P 26  ? GLY P 24  ASP P 32  5 ? 9  
HELX_P HELX_P264 BD3 ALA P 29  ? ALA P 32  ? ALA P 35  ALA P 38  5 ? 4  
HELX_P HELX_P265 BD4 ILE P 41  ? GLY P 53  ? ILE P 47  GLY P 59  1 ? 13 
HELX_P HELX_P266 BD5 ALA P 65  ? TRP P 76  ? ALA P 71  TRP P 82  1 ? 12 
HELX_P HELX_P267 BD6 ARG P 80  ? ASN P 84  ? ARG P 86  ASN P 90  5 ? 5  
HELX_P HELX_P268 BD7 GLY P 104 ? GLN P 111 ? GLY P 110 GLN P 117 1 ? 8  
HELX_P HELX_P269 BD8 ASN P 112 ? GLU P 117 ? ASN P 118 GLU P 123 1 ? 6  
HELX_P HELX_P270 BD9 PRO P 118 ? ALA P 120 ? PRO P 124 ALA P 126 5 ? 3  
HELX_P HELX_P271 BE1 ASP P 136 ? GLY P 148 ? ASP P 142 GLY P 154 1 ? 13 
HELX_P HELX_P272 BE2 MET P 161 ? GLY P 165 ? MET P 167 GLY P 171 5 ? 5  
HELX_P HELX_P273 BE3 THR P 208 ? ALA P 220 ? THR P 214 ALA P 226 1 ? 13 
HELX_P HELX_P274 BE4 ASP P 231 ? GLY P 240 ? ASP P 237 GLY P 246 1 ? 10 
HELX_P HELX_P275 BE5 PHE P 247 ? CYS P 251 ? PHE P 253 CYS P 257 1 ? 5  
HELX_P HELX_P276 BE6 THR P 267 ? ILE P 268 ? THR P 273 ILE P 274 5 ? 2  
HELX_P HELX_P277 BE7 ALA P 270 ? ALA P 270 ? ALA P 276 ALA P 276 5 ? 1  
HELX_P HELX_P278 BE8 TYR P 271 ? ASP P 277 ? TYR P 277 ASP P 283 1 ? 7  
HELX_P HELX_P279 BE9 LEU P 278 ? ASP P 280 ? LEU P 284 ASP P 286 5 ? 3  
HELX_P HELX_P280 BF1 ASP P 387 ? PHE P 395 ? ASP P 393 PHE P 401 1 ? 9  
HELX_P HELX_P281 BF2 THR P 406 ? LEU P 413 ? THR P 412 LEU P 419 1 ? 8  
HELX_P HELX_P282 BF3 PRO Q 3   ? ARG Q 6   ? PRO Q 9   ARG Q 12  5 ? 4  
HELX_P HELX_P283 BF4 GLY Q 18  ? ASP Q 26  ? GLY Q 24  ASP Q 32  5 ? 9  
HELX_P HELX_P284 BF5 ALA Q 29  ? ALA Q 32  ? ALA Q 35  ALA Q 38  5 ? 4  
HELX_P HELX_P285 BF6 ILE Q 42  ? SER Q 52  ? ILE Q 48  SER Q 58  1 ? 11 
HELX_P HELX_P286 BF7 ALA Q 65  ? TRP Q 76  ? ALA Q 71  TRP Q 82  1 ? 12 
HELX_P HELX_P287 BF8 ARG Q 80  ? ASN Q 84  ? ARG Q 86  ASN Q 90  5 ? 5  
HELX_P HELX_P288 BF9 GLY Q 104 ? GLN Q 111 ? GLY Q 110 GLN Q 117 1 ? 8  
HELX_P HELX_P289 BG1 ASN Q 112 ? GLU Q 117 ? ASN Q 118 GLU Q 123 1 ? 6  
HELX_P HELX_P290 BG2 PRO Q 118 ? ALA Q 120 ? PRO Q 124 ALA Q 126 5 ? 3  
HELX_P HELX_P291 BG3 ASP Q 136 ? GLY Q 148 ? ASP Q 142 GLY Q 154 1 ? 13 
HELX_P HELX_P292 BG4 MET Q 161 ? GLY Q 165 ? MET Q 167 GLY Q 171 5 ? 5  
HELX_P HELX_P293 BG5 THR Q 208 ? ASP Q 221 ? THR Q 214 ASP Q 227 1 ? 14 
HELX_P HELX_P294 BG6 ASP Q 231 ? GLY Q 240 ? ASP Q 237 GLY Q 246 1 ? 10 
HELX_P HELX_P295 BG7 ALA Q 248 ? SER Q 250 ? ALA Q 254 SER Q 256 5 ? 3  
HELX_P HELX_P296 BG8 THR Q 267 ? ASP Q 277 ? THR Q 273 ASP Q 283 1 ? 11 
HELX_P HELX_P297 BG9 LEU Q 278 ? ASP Q 280 ? LEU Q 284 ASP Q 286 5 ? 3  
HELX_P HELX_P298 BH1 ASP Q 387 ? PHE Q 395 ? ASP Q 393 PHE Q 401 1 ? 9  
HELX_P HELX_P299 BH2 THR Q 406 ? ASP Q 411 ? THR Q 412 ASP Q 417 1 ? 6  
HELX_P HELX_P300 BH3 PRO R 3   ? ARG R 6   ? PRO R 9   ARG R 12  5 ? 4  
HELX_P HELX_P301 BH4 GLY R 18  ? ASP R 26  ? GLY R 24  ASP R 32  5 ? 9  
HELX_P HELX_P302 BH5 ALA R 29  ? ALA R 32  ? ALA R 35  ALA R 38  5 ? 4  
HELX_P HELX_P303 BH6 ILE R 42  ? SER R 52  ? ILE R 48  SER R 58  1 ? 11 
HELX_P HELX_P304 BH7 ALA R 65  ? TRP R 76  ? ALA R 71  TRP R 82  1 ? 12 
HELX_P HELX_P305 BH8 ARG R 80  ? ASN R 84  ? ARG R 86  ASN R 90  5 ? 5  
HELX_P HELX_P306 BH9 ALA R 106 ? GLN R 111 ? ALA R 112 GLN R 117 1 ? 6  
HELX_P HELX_P307 BI1 ASN R 112 ? ALA R 120 ? ASN R 118 ALA R 126 1 ? 9  
HELX_P HELX_P308 BI2 ASP R 136 ? GLY R 148 ? ASP R 142 GLY R 154 1 ? 13 
HELX_P HELX_P309 BI3 GLU R 162 ? GLY R 165 ? GLU R 168 GLY R 171 5 ? 4  
HELX_P HELX_P310 BI4 THR R 208 ? ASP R 221 ? THR R 214 ASP R 227 1 ? 14 
HELX_P HELX_P311 BI5 ASP R 231 ? GLY R 240 ? ASP R 237 GLY R 246 1 ? 10 
HELX_P HELX_P312 BI6 PHE R 247 ? CYS R 251 ? PHE R 253 CYS R 257 1 ? 5  
HELX_P HELX_P313 BI7 THR R 267 ? ASP R 277 ? THR R 273 ASP R 283 1 ? 11 
HELX_P HELX_P314 BI8 LEU R 278 ? ASP R 280 ? LEU R 284 ASP R 286 5 ? 3  
HELX_P HELX_P315 BI9 ASP R 387 ? PHE R 395 ? ASP R 393 PHE R 401 1 ? 9  
HELX_P HELX_P316 BJ1 THR R 406 ? LYS R 412 ? THR R 412 LYS R 418 1 ? 7  
HELX_P HELX_P317 BJ2 PRO S 3   ? ARG S 6   ? PRO Z 9   ARG Z 12  5 ? 4  
HELX_P HELX_P318 BJ3 GLY S 18  ? ASP S 26  ? GLY Z 24  ASP Z 32  5 ? 9  
HELX_P HELX_P319 BJ4 ALA S 29  ? ALA S 32  ? ALA Z 35  ALA Z 38  5 ? 4  
HELX_P HELX_P320 BJ5 ILE S 42  ? SER S 52  ? ILE Z 48  SER Z 58  1 ? 11 
HELX_P HELX_P321 BJ6 ALA S 65  ? TRP S 76  ? ALA Z 71  TRP Z 82  1 ? 12 
HELX_P HELX_P322 BJ7 ARG S 80  ? ASN S 84  ? ARG Z 86  ASN Z 90  5 ? 5  
HELX_P HELX_P323 BJ8 GLY S 104 ? GLN S 111 ? GLY Z 110 GLN Z 117 1 ? 8  
HELX_P HELX_P324 BJ9 ASN S 112 ? GLU S 117 ? ASN Z 118 GLU Z 123 1 ? 6  
HELX_P HELX_P325 BK1 PRO S 118 ? ALA S 120 ? PRO Z 124 ALA Z 126 5 ? 3  
HELX_P HELX_P326 BK2 ASP S 136 ? GLY S 148 ? ASP Z 142 GLY Z 154 1 ? 13 
HELX_P HELX_P327 BK3 MET S 161 ? GLY S 165 ? MET Z 167 GLY Z 171 5 ? 5  
HELX_P HELX_P328 BK4 THR S 208 ? ASP S 221 ? THR Z 214 ASP Z 227 1 ? 14 
HELX_P HELX_P329 BK5 ASP S 231 ? GLY S 240 ? ASP Z 237 GLY Z 246 1 ? 10 
HELX_P HELX_P330 BK6 PHE S 247 ? CYS S 251 ? PHE Z 253 CYS Z 257 1 ? 5  
HELX_P HELX_P331 BK7 THR S 267 ? ASP S 277 ? THR Z 273 ASP Z 283 1 ? 11 
HELX_P HELX_P332 BK8 LEU S 278 ? ASP S 280 ? LEU Z 284 ASP Z 286 5 ? 3  
HELX_P HELX_P333 BK9 ASP S 387 ? PHE S 395 ? ASP Z 393 PHE Z 401 1 ? 9  
HELX_P HELX_P334 BL1 THR S 406 ? LYS S 412 ? THR Z 412 LYS Z 418 1 ? 7  
HELX_P HELX_P335 BL2 PRO T 3   ? ARG T 6   ? PRO T 9   ARG T 12  5 ? 4  
HELX_P HELX_P336 BL3 GLY T 18  ? ASP T 26  ? GLY T 24  ASP T 32  5 ? 9  
HELX_P HELX_P337 BL4 ALA T 29  ? ALA T 32  ? ALA T 35  ALA T 38  5 ? 4  
HELX_P HELX_P338 BL5 ILE T 41  ? GLY T 53  ? ILE T 47  GLY T 59  1 ? 13 
HELX_P HELX_P339 BL6 ALA T 65  ? TRP T 76  ? ALA T 71  TRP T 82  1 ? 12 
HELX_P HELX_P340 BL7 ARG T 80  ? ASN T 84  ? ARG T 86  ASN T 90  5 ? 5  
HELX_P HELX_P341 BL8 GLY T 104 ? GLN T 111 ? GLY T 110 GLN T 117 1 ? 8  
HELX_P HELX_P342 BL9 ASN T 112 ? GLU T 117 ? ASN T 118 GLU T 123 1 ? 6  
HELX_P HELX_P343 BM1 PRO T 118 ? ALA T 120 ? PRO T 124 ALA T 126 5 ? 3  
HELX_P HELX_P344 BM2 ASP T 136 ? GLY T 148 ? ASP T 142 GLY T 154 1 ? 13 
HELX_P HELX_P345 BM3 MET T 161 ? GLY T 165 ? MET T 167 GLY T 171 5 ? 5  
HELX_P HELX_P346 BM4 THR T 208 ? ASP T 221 ? THR T 214 ASP T 227 1 ? 14 
HELX_P HELX_P347 BM5 ASP T 231 ? GLY T 240 ? ASP T 237 GLY T 246 1 ? 10 
HELX_P HELX_P348 BM6 PHE T 247 ? CYS T 251 ? PHE T 253 CYS T 257 1 ? 5  
HELX_P HELX_P349 BM7 THR T 267 ? LEU T 278 ? THR T 273 LEU T 284 1 ? 12 
HELX_P HELX_P350 BM8 ASP T 387 ? PHE T 395 ? ASP T 393 PHE T 401 1 ? 9  
HELX_P HELX_P351 BM9 THR T 406 ? LYS T 412 ? THR T 412 LYS T 418 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7  ? 
AA2 ? 7  ? 
AA3 ? 2  ? 
AA4 ? 2  ? 
AA5 ? 10 ? 
AA6 ? 6  ? 
AA7 ? 6  ? 
AA8 ? 10 ? 
AA9 ? 7  ? 
AB1 ? 7  ? 
AB2 ? 2  ? 
AB3 ? 2  ? 
AB4 ? 7  ? 
AB5 ? 2  ? 
AB6 ? 2  ? 
AB7 ? 2  ? 
AB8 ? 10 ? 
AB9 ? 6  ? 
AC1 ? 6  ? 
AC2 ? 10 ? 
AC3 ? 7  ? 
AC4 ? 7  ? 
AC5 ? 2  ? 
AC6 ? 2  ? 
AC7 ? 7  ? 
AC8 ? 7  ? 
AC9 ? 2  ? 
AD1 ? 2  ? 
AD2 ? 10 ? 
AD3 ? 6  ? 
AD4 ? 6  ? 
AD5 ? 10 ? 
AD6 ? 7  ? 
AD7 ? 7  ? 
AD8 ? 2  ? 
AD9 ? 2  ? 
AE1 ? 7  ? 
AE2 ? 7  ? 
AE3 ? 2  ? 
AE4 ? 2  ? 
AE5 ? 10 ? 
AE6 ? 6  ? 
AE7 ? 6  ? 
AE8 ? 10 ? 
AE9 ? 7  ? 
AF1 ? 7  ? 
AF2 ? 2  ? 
AF3 ? 2  ? 
AF4 ? 7  ? 
AF5 ? 7  ? 
AF6 ? 2  ? 
AF7 ? 2  ? 
AF8 ? 10 ? 
AF9 ? 6  ? 
AG1 ? 6  ? 
AG2 ? 10 ? 
AG3 ? 7  ? 
AG4 ? 7  ? 
AG5 ? 2  ? 
AG6 ? 2  ? 
AG7 ? 7  ? 
AG8 ? 7  ? 
AG9 ? 2  ? 
AH1 ? 2  ? 
AH2 ? 10 ? 
AH3 ? 6  ? 
AH4 ? 6  ? 
AH5 ? 10 ? 
AH6 ? 7  ? 
AH7 ? 7  ? 
AH8 ? 2  ? 
AH9 ? 2  ? 
AI1 ? 7  ? 
AI2 ? 7  ? 
AI3 ? 2  ? 
AI4 ? 2  ? 
AI5 ? 10 ? 
AI6 ? 6  ? 
AI7 ? 6  ? 
AI8 ? 10 ? 
AI9 ? 10 ? 
AJ1 ? 2  ? 
AJ2 ? 2  ? 
AJ3 ? 7  ? 
AJ4 ? 7  ? 
AJ5 ? 2  ? 
AJ6 ? 2  ? 
AJ7 ? 10 ? 
AJ8 ? 6  ? 
AJ9 ? 6  ? 
AK1 ? 10 ? 
AK2 ? 7  ? 
AK3 ? 7  ? 
AK4 ? 2  ? 
AK5 ? 2  ? 
AK6 ? 7  ? 
AK7 ? 7  ? 
AK8 ? 2  ? 
AK9 ? 2  ? 
AL1 ? 10 ? 
AL2 ? 6  ? 
AL3 ? 6  ? 
AL4 ? 10 ? 
AL5 ? 7  ? 
AL6 ? 7  ? 
AL7 ? 2  ? 
AL8 ? 2  ? 
AL9 ? 7  ? 
AM1 ? 7  ? 
AM2 ? 2  ? 
AM3 ? 2  ? 
AM4 ? 10 ? 
AM5 ? 6  ? 
AM6 ? 6  ? 
AM7 ? 10 ? 
AM8 ? 10 ? 
AM9 ? 2  ? 
AN1 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? parallel      
AA1 2 3  ? parallel      
AA1 3 4  ? parallel      
AA1 4 5  ? anti-parallel 
AA1 5 6  ? anti-parallel 
AA1 6 7  ? anti-parallel 
AA2 1 2  ? parallel      
AA2 2 3  ? parallel      
AA2 3 4  ? parallel      
AA2 4 5  ? anti-parallel 
AA2 5 6  ? anti-parallel 
AA2 6 7  ? parallel      
AA3 1 2  ? anti-parallel 
AA4 1 2  ? anti-parallel 
AA5 1 2  ? parallel      
AA5 2 3  ? parallel      
AA5 3 4  ? parallel      
AA5 4 5  ? parallel      
AA5 5 6  ? anti-parallel 
AA5 6 7  ? parallel      
AA5 7 8  ? parallel      
AA5 8 9  ? parallel      
AA5 9 10 ? parallel      
AA6 1 2  ? parallel      
AA6 2 3  ? parallel      
AA6 3 4  ? parallel      
AA6 4 5  ? parallel      
AA6 5 6  ? anti-parallel 
AA7 1 2  ? parallel      
AA7 2 3  ? parallel      
AA7 3 4  ? parallel      
AA7 4 5  ? parallel      
AA7 5 6  ? anti-parallel 
AA8 1 2  ? parallel      
AA8 2 3  ? parallel      
AA8 3 4  ? parallel      
AA8 4 5  ? parallel      
AA8 5 6  ? anti-parallel 
AA8 6 7  ? parallel      
AA8 7 8  ? parallel      
AA8 8 9  ? parallel      
AA8 9 10 ? parallel      
AA9 1 2  ? parallel      
AA9 2 3  ? parallel      
AA9 3 4  ? parallel      
AA9 4 5  ? anti-parallel 
AA9 5 6  ? anti-parallel 
AA9 6 7  ? anti-parallel 
AB1 1 2  ? parallel      
AB1 2 3  ? parallel      
AB1 3 4  ? parallel      
AB1 4 5  ? anti-parallel 
AB1 5 6  ? anti-parallel 
AB1 6 7  ? parallel      
AB2 1 2  ? anti-parallel 
AB3 1 2  ? anti-parallel 
AB4 1 2  ? parallel      
AB4 2 3  ? parallel      
AB4 3 4  ? parallel      
AB4 4 5  ? anti-parallel 
AB4 5 6  ? anti-parallel 
AB4 6 7  ? parallel      
AB5 1 2  ? anti-parallel 
AB6 1 2  ? anti-parallel 
AB7 1 2  ? anti-parallel 
AB8 1 2  ? parallel      
AB8 2 3  ? parallel      
AB8 3 4  ? parallel      
AB8 4 5  ? parallel      
AB8 5 6  ? anti-parallel 
AB8 6 7  ? parallel      
AB8 7 8  ? parallel      
AB8 8 9  ? parallel      
AB8 9 10 ? parallel      
AB9 1 2  ? parallel      
AB9 2 3  ? parallel      
AB9 3 4  ? parallel      
AB9 4 5  ? parallel      
AB9 5 6  ? anti-parallel 
AC1 1 2  ? parallel      
AC1 2 3  ? parallel      
AC1 3 4  ? parallel      
AC1 4 5  ? parallel      
AC1 5 6  ? anti-parallel 
AC2 1 2  ? parallel      
AC2 2 3  ? parallel      
AC2 3 4  ? parallel      
AC2 4 5  ? parallel      
AC2 5 6  ? anti-parallel 
AC2 6 7  ? parallel      
AC2 7 8  ? parallel      
AC2 8 9  ? parallel      
AC2 9 10 ? parallel      
AC3 1 2  ? parallel      
AC3 2 3  ? parallel      
AC3 3 4  ? parallel      
AC3 4 5  ? anti-parallel 
AC3 5 6  ? anti-parallel 
AC3 6 7  ? anti-parallel 
AC4 1 2  ? parallel      
AC4 2 3  ? parallel      
AC4 3 4  ? parallel      
AC4 4 5  ? anti-parallel 
AC4 5 6  ? anti-parallel 
AC4 6 7  ? parallel      
AC5 1 2  ? anti-parallel 
AC6 1 2  ? anti-parallel 
AC7 1 2  ? parallel      
AC7 2 3  ? parallel      
AC7 3 4  ? parallel      
AC7 4 5  ? anti-parallel 
AC7 5 6  ? anti-parallel 
AC7 6 7  ? anti-parallel 
AC8 1 2  ? parallel      
AC8 2 3  ? parallel      
AC8 3 4  ? parallel      
AC8 4 5  ? anti-parallel 
AC8 5 6  ? anti-parallel 
AC8 6 7  ? parallel      
AC9 1 2  ? anti-parallel 
AD1 1 2  ? anti-parallel 
AD2 1 2  ? parallel      
AD2 2 3  ? parallel      
AD2 3 4  ? parallel      
AD2 4 5  ? parallel      
AD2 5 6  ? anti-parallel 
AD2 6 7  ? parallel      
AD2 7 8  ? parallel      
AD2 8 9  ? parallel      
AD2 9 10 ? parallel      
AD3 1 2  ? parallel      
AD3 2 3  ? parallel      
AD3 3 4  ? parallel      
AD3 4 5  ? parallel      
AD3 5 6  ? anti-parallel 
AD4 1 2  ? parallel      
AD4 2 3  ? parallel      
AD4 3 4  ? parallel      
AD4 4 5  ? parallel      
AD4 5 6  ? anti-parallel 
AD5 1 2  ? parallel      
AD5 2 3  ? parallel      
AD5 3 4  ? parallel      
AD5 4 5  ? parallel      
AD5 5 6  ? anti-parallel 
AD5 6 7  ? parallel      
AD5 7 8  ? parallel      
AD5 8 9  ? parallel      
AD5 9 10 ? parallel      
AD6 1 2  ? parallel      
AD6 2 3  ? parallel      
AD6 3 4  ? parallel      
AD6 4 5  ? anti-parallel 
AD6 5 6  ? anti-parallel 
AD6 6 7  ? anti-parallel 
AD7 1 2  ? parallel      
AD7 2 3  ? parallel      
AD7 3 4  ? parallel      
AD7 4 5  ? anti-parallel 
AD7 5 6  ? anti-parallel 
AD7 6 7  ? parallel      
AD8 1 2  ? anti-parallel 
AD9 1 2  ? anti-parallel 
AE1 1 2  ? parallel      
AE1 2 3  ? parallel      
AE1 3 4  ? parallel      
AE1 4 5  ? anti-parallel 
AE1 5 6  ? anti-parallel 
AE1 6 7  ? anti-parallel 
AE2 1 2  ? parallel      
AE2 2 3  ? parallel      
AE2 3 4  ? parallel      
AE2 4 5  ? anti-parallel 
AE2 5 6  ? anti-parallel 
AE2 6 7  ? parallel      
AE3 1 2  ? anti-parallel 
AE4 1 2  ? anti-parallel 
AE5 1 2  ? parallel      
AE5 2 3  ? parallel      
AE5 3 4  ? parallel      
AE5 4 5  ? parallel      
AE5 5 6  ? anti-parallel 
AE5 6 7  ? parallel      
AE5 7 8  ? parallel      
AE5 8 9  ? parallel      
AE5 9 10 ? parallel      
AE6 1 2  ? parallel      
AE6 2 3  ? parallel      
AE6 3 4  ? parallel      
AE6 4 5  ? parallel      
AE6 5 6  ? anti-parallel 
AE7 1 2  ? parallel      
AE7 2 3  ? parallel      
AE7 3 4  ? parallel      
AE7 4 5  ? parallel      
AE7 5 6  ? anti-parallel 
AE8 1 2  ? parallel      
AE8 2 3  ? parallel      
AE8 3 4  ? parallel      
AE8 4 5  ? parallel      
AE8 5 6  ? anti-parallel 
AE8 6 7  ? parallel      
AE8 7 8  ? parallel      
AE8 8 9  ? parallel      
AE8 9 10 ? parallel      
AE9 1 2  ? parallel      
AE9 2 3  ? parallel      
AE9 3 4  ? parallel      
AE9 4 5  ? anti-parallel 
AE9 5 6  ? anti-parallel 
AE9 6 7  ? anti-parallel 
AF1 1 2  ? parallel      
AF1 2 3  ? parallel      
AF1 3 4  ? parallel      
AF1 4 5  ? anti-parallel 
AF1 5 6  ? anti-parallel 
AF1 6 7  ? parallel      
AF2 1 2  ? anti-parallel 
AF3 1 2  ? anti-parallel 
AF4 1 2  ? parallel      
AF4 2 3  ? parallel      
AF4 3 4  ? parallel      
AF4 4 5  ? anti-parallel 
AF4 5 6  ? anti-parallel 
AF4 6 7  ? anti-parallel 
AF5 1 2  ? parallel      
AF5 2 3  ? parallel      
AF5 3 4  ? parallel      
AF5 4 5  ? anti-parallel 
AF5 5 6  ? anti-parallel 
AF5 6 7  ? parallel      
AF6 1 2  ? anti-parallel 
AF7 1 2  ? anti-parallel 
AF8 1 2  ? parallel      
AF8 2 3  ? parallel      
AF8 3 4  ? parallel      
AF8 4 5  ? parallel      
AF8 5 6  ? anti-parallel 
AF8 6 7  ? parallel      
AF8 7 8  ? parallel      
AF8 8 9  ? parallel      
AF8 9 10 ? parallel      
AF9 1 2  ? parallel      
AF9 2 3  ? parallel      
AF9 3 4  ? parallel      
AF9 4 5  ? parallel      
AF9 5 6  ? anti-parallel 
AG1 1 2  ? parallel      
AG1 2 3  ? parallel      
AG1 3 4  ? parallel      
AG1 4 5  ? parallel      
AG1 5 6  ? anti-parallel 
AG2 1 2  ? parallel      
AG2 2 3  ? parallel      
AG2 3 4  ? parallel      
AG2 4 5  ? parallel      
AG2 5 6  ? anti-parallel 
AG2 6 7  ? parallel      
AG2 7 8  ? parallel      
AG2 8 9  ? parallel      
AG2 9 10 ? parallel      
AG3 1 2  ? parallel      
AG3 2 3  ? parallel      
AG3 3 4  ? parallel      
AG3 4 5  ? anti-parallel 
AG3 5 6  ? anti-parallel 
AG3 6 7  ? anti-parallel 
AG4 1 2  ? parallel      
AG4 2 3  ? parallel      
AG4 3 4  ? parallel      
AG4 4 5  ? anti-parallel 
AG4 5 6  ? anti-parallel 
AG4 6 7  ? parallel      
AG5 1 2  ? anti-parallel 
AG6 1 2  ? anti-parallel 
AG7 1 2  ? parallel      
AG7 2 3  ? parallel      
AG7 3 4  ? parallel      
AG7 4 5  ? anti-parallel 
AG7 5 6  ? anti-parallel 
AG7 6 7  ? anti-parallel 
AG8 1 2  ? parallel      
AG8 2 3  ? parallel      
AG8 3 4  ? parallel      
AG8 4 5  ? anti-parallel 
AG8 5 6  ? anti-parallel 
AG8 6 7  ? parallel      
AG9 1 2  ? anti-parallel 
AH1 1 2  ? anti-parallel 
AH2 1 2  ? parallel      
AH2 2 3  ? parallel      
AH2 3 4  ? parallel      
AH2 4 5  ? parallel      
AH2 5 6  ? anti-parallel 
AH2 6 7  ? parallel      
AH2 7 8  ? parallel      
AH2 8 9  ? parallel      
AH2 9 10 ? parallel      
AH3 1 2  ? parallel      
AH3 2 3  ? parallel      
AH3 3 4  ? parallel      
AH3 4 5  ? parallel      
AH3 5 6  ? anti-parallel 
AH4 1 2  ? parallel      
AH4 2 3  ? parallel      
AH4 3 4  ? parallel      
AH4 4 5  ? parallel      
AH4 5 6  ? anti-parallel 
AH5 1 2  ? parallel      
AH5 2 3  ? parallel      
AH5 3 4  ? parallel      
AH5 4 5  ? parallel      
AH5 5 6  ? anti-parallel 
AH5 6 7  ? parallel      
AH5 7 8  ? parallel      
AH5 8 9  ? parallel      
AH5 9 10 ? parallel      
AH6 1 2  ? parallel      
AH6 2 3  ? parallel      
AH6 3 4  ? parallel      
AH6 4 5  ? anti-parallel 
AH6 5 6  ? anti-parallel 
AH6 6 7  ? anti-parallel 
AH7 1 2  ? parallel      
AH7 2 3  ? parallel      
AH7 3 4  ? parallel      
AH7 4 5  ? anti-parallel 
AH7 5 6  ? anti-parallel 
AH7 6 7  ? parallel      
AH8 1 2  ? anti-parallel 
AH9 1 2  ? anti-parallel 
AI1 1 2  ? parallel      
AI1 2 3  ? parallel      
AI1 3 4  ? parallel      
AI1 4 5  ? anti-parallel 
AI1 5 6  ? anti-parallel 
AI1 6 7  ? anti-parallel 
AI2 1 2  ? parallel      
AI2 2 3  ? parallel      
AI2 3 4  ? parallel      
AI2 4 5  ? anti-parallel 
AI2 5 6  ? anti-parallel 
AI2 6 7  ? parallel      
AI3 1 2  ? anti-parallel 
AI4 1 2  ? anti-parallel 
AI5 1 2  ? parallel      
AI5 2 3  ? parallel      
AI5 3 4  ? parallel      
AI5 4 5  ? parallel      
AI5 5 6  ? anti-parallel 
AI5 6 7  ? parallel      
AI5 7 8  ? parallel      
AI5 8 9  ? parallel      
AI5 9 10 ? parallel      
AI6 1 2  ? parallel      
AI6 2 3  ? parallel      
AI6 3 4  ? parallel      
AI6 4 5  ? parallel      
AI6 5 6  ? anti-parallel 
AI7 1 2  ? parallel      
AI7 2 3  ? parallel      
AI7 3 4  ? parallel      
AI7 4 5  ? parallel      
AI7 5 6  ? anti-parallel 
AI8 1 2  ? parallel      
AI8 2 3  ? parallel      
AI8 3 4  ? parallel      
AI8 4 5  ? parallel      
AI8 5 6  ? anti-parallel 
AI8 6 7  ? parallel      
AI8 7 8  ? parallel      
AI8 8 9  ? parallel      
AI8 9 10 ? parallel      
AI9 1 2  ? parallel      
AI9 2 3  ? parallel      
AI9 3 4  ? parallel      
AI9 4 5  ? anti-parallel 
AI9 5 6  ? anti-parallel 
AI9 6 7  ? anti-parallel 
AI9 7 8  ? anti-parallel 
AI9 8 9  ? parallel      
AI9 9 10 ? anti-parallel 
AJ1 1 2  ? anti-parallel 
AJ2 1 2  ? anti-parallel 
AJ3 1 2  ? parallel      
AJ3 2 3  ? parallel      
AJ3 3 4  ? parallel      
AJ3 4 5  ? anti-parallel 
AJ3 5 6  ? anti-parallel 
AJ3 6 7  ? anti-parallel 
AJ4 1 2  ? parallel      
AJ4 2 3  ? parallel      
AJ4 3 4  ? parallel      
AJ4 4 5  ? anti-parallel 
AJ4 5 6  ? anti-parallel 
AJ4 6 7  ? parallel      
AJ5 1 2  ? anti-parallel 
AJ6 1 2  ? anti-parallel 
AJ7 1 2  ? parallel      
AJ7 2 3  ? parallel      
AJ7 3 4  ? parallel      
AJ7 4 5  ? parallel      
AJ7 5 6  ? anti-parallel 
AJ7 6 7  ? parallel      
AJ7 7 8  ? parallel      
AJ7 8 9  ? parallel      
AJ7 9 10 ? parallel      
AJ8 1 2  ? parallel      
AJ8 2 3  ? parallel      
AJ8 3 4  ? parallel      
AJ8 4 5  ? parallel      
AJ8 5 6  ? anti-parallel 
AJ9 1 2  ? parallel      
AJ9 2 3  ? parallel      
AJ9 3 4  ? parallel      
AJ9 4 5  ? parallel      
AJ9 5 6  ? anti-parallel 
AK1 1 2  ? parallel      
AK1 2 3  ? parallel      
AK1 3 4  ? parallel      
AK1 4 5  ? parallel      
AK1 5 6  ? anti-parallel 
AK1 6 7  ? parallel      
AK1 7 8  ? parallel      
AK1 8 9  ? parallel      
AK1 9 10 ? parallel      
AK2 1 2  ? parallel      
AK2 2 3  ? parallel      
AK2 3 4  ? parallel      
AK2 4 5  ? anti-parallel 
AK2 5 6  ? anti-parallel 
AK2 6 7  ? anti-parallel 
AK3 1 2  ? parallel      
AK3 2 3  ? parallel      
AK3 3 4  ? parallel      
AK3 4 5  ? anti-parallel 
AK3 5 6  ? anti-parallel 
AK3 6 7  ? parallel      
AK4 1 2  ? anti-parallel 
AK5 1 2  ? anti-parallel 
AK6 1 2  ? parallel      
AK6 2 3  ? parallel      
AK6 3 4  ? parallel      
AK6 4 5  ? anti-parallel 
AK6 5 6  ? anti-parallel 
AK6 6 7  ? anti-parallel 
AK7 1 2  ? parallel      
AK7 2 3  ? parallel      
AK7 3 4  ? parallel      
AK7 4 5  ? anti-parallel 
AK7 5 6  ? anti-parallel 
AK7 6 7  ? parallel      
AK8 1 2  ? anti-parallel 
AK9 1 2  ? anti-parallel 
AL1 1 2  ? parallel      
AL1 2 3  ? parallel      
AL1 3 4  ? parallel      
AL1 4 5  ? parallel      
AL1 5 6  ? anti-parallel 
AL1 6 7  ? parallel      
AL1 7 8  ? parallel      
AL1 8 9  ? parallel      
AL1 9 10 ? parallel      
AL2 1 2  ? parallel      
AL2 2 3  ? parallel      
AL2 3 4  ? parallel      
AL2 4 5  ? parallel      
AL2 5 6  ? anti-parallel 
AL3 1 2  ? parallel      
AL3 2 3  ? parallel      
AL3 3 4  ? parallel      
AL3 4 5  ? parallel      
AL3 5 6  ? anti-parallel 
AL4 1 2  ? parallel      
AL4 2 3  ? parallel      
AL4 3 4  ? parallel      
AL4 4 5  ? parallel      
AL4 5 6  ? anti-parallel 
AL4 6 7  ? parallel      
AL4 7 8  ? parallel      
AL4 8 9  ? parallel      
AL4 9 10 ? parallel      
AL5 1 2  ? parallel      
AL5 2 3  ? parallel      
AL5 3 4  ? parallel      
AL5 4 5  ? anti-parallel 
AL5 5 6  ? anti-parallel 
AL5 6 7  ? anti-parallel 
AL6 1 2  ? parallel      
AL6 2 3  ? parallel      
AL6 3 4  ? parallel      
AL6 4 5  ? anti-parallel 
AL6 5 6  ? anti-parallel 
AL6 6 7  ? parallel      
AL7 1 2  ? anti-parallel 
AL8 1 2  ? anti-parallel 
AL9 1 2  ? parallel      
AL9 2 3  ? parallel      
AL9 3 4  ? parallel      
AL9 4 5  ? anti-parallel 
AL9 5 6  ? anti-parallel 
AL9 6 7  ? anti-parallel 
AM1 1 2  ? parallel      
AM1 2 3  ? parallel      
AM1 3 4  ? parallel      
AM1 4 5  ? anti-parallel 
AM1 5 6  ? anti-parallel 
AM1 6 7  ? parallel      
AM2 1 2  ? anti-parallel 
AM3 1 2  ? anti-parallel 
AM4 1 2  ? parallel      
AM4 2 3  ? parallel      
AM4 3 4  ? parallel      
AM4 4 5  ? parallel      
AM4 5 6  ? anti-parallel 
AM4 6 7  ? parallel      
AM4 7 8  ? parallel      
AM4 8 9  ? parallel      
AM4 9 10 ? parallel      
AM5 1 2  ? parallel      
AM5 2 3  ? parallel      
AM5 3 4  ? parallel      
AM5 4 5  ? parallel      
AM5 5 6  ? anti-parallel 
AM6 1 2  ? parallel      
AM6 2 3  ? parallel      
AM6 3 4  ? parallel      
AM6 4 5  ? parallel      
AM6 5 6  ? anti-parallel 
AM7 1 2  ? parallel      
AM7 2 3  ? parallel      
AM7 3 4  ? parallel      
AM7 4 5  ? parallel      
AM7 5 6  ? anti-parallel 
AM7 6 7  ? parallel      
AM7 7 8  ? parallel      
AM7 8 9  ? parallel      
AM7 9 10 ? parallel      
AM8 1 2  ? parallel      
AM8 2 3  ? parallel      
AM8 3 4  ? parallel      
AM8 4 5  ? anti-parallel 
AM8 5 6  ? anti-parallel 
AM8 6 7  ? anti-parallel 
AM8 7 8  ? anti-parallel 
AM8 8 9  ? parallel      
AM8 9 10 ? anti-parallel 
AM9 1 2  ? anti-parallel 
AN1 1 2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  SER A 86  ? PRO A 91  ? SER A 92  PRO A 97  
AA1 2  ARG A 56  ? THR A 61  ? ARG A 62  THR A 67  
AA1 3  ALA A 8   ? LEU A 13  ? ALA A 14  LEU A 19  
AA1 4  TYR A 123 ? ALA A 128 ? TYR A 129 ALA A 134 
AA1 5  PHE A 196 ? HIS A 207 ? PHE A 202 HIS A 213 
AA1 6  GLY A 167 ? VAL A 171 ? GLY A 173 VAL A 177 
AA1 7  ILE A 177 ? GLU A 182 ? ILE A 183 GLU A 188 
AA2 1  SER A 86  ? PRO A 91  ? SER A 92  PRO A 97  
AA2 2  ARG A 56  ? THR A 61  ? ARG A 62  THR A 67  
AA2 3  ALA A 8   ? LEU A 13  ? ALA A 14  LEU A 19  
AA2 4  TYR A 123 ? ALA A 128 ? TYR A 129 ALA A 134 
AA2 5  PHE A 196 ? HIS A 207 ? PHE A 202 HIS A 213 
AA2 6  VAL A 151 ? PRO A 159 ? VAL A 157 PRO A 165 
AA2 7  ALA A 242 ? ARG A 246 ? ALA A 248 ARG A 252 
AA3 1  TYR A 34  ? PHE A 35  ? TYR A 40  PHE A 41  
AA3 2  ALA A 39  ? ARG A 40  ? ALA A 45  ARG A 46  
AA4 1  ILE A 132 ? TYR A 133 ? ILE A 138 TYR A 139 
AA4 2  TRP A 262 ? ARG A 263 ? TRP A 268 ARG A 269 
AA5 1  VAL A 377 ? ILE A 378 ? VAL A 383 ILE A 384 
AA5 2  LYS A 360 ? ILE A 361 ? LYS A 366 ILE A 367 
AA5 3  ARG A 343 ? ALA A 344 ? ARG A 349 ALA A 350 
AA5 4  ILE A 327 ? SER A 329 ? ILE A 333 SER A 335 
AA5 5  ALA A 304 ? VAL A 307 ? ALA A 310 VAL A 313 
AA5 6  SER B 320 ? VAL B 322 ? SER B 326 VAL B 328 
AA5 7  LEU B 337 ? LEU B 338 ? LEU B 343 LEU B 344 
AA5 8  ARG B 349 ? VAL B 355 ? ARG B 355 VAL B 361 
AA5 9  GLN B 366 ? ILE B 372 ? GLN B 372 ILE B 378 
AA5 10 ILE B 383 ? VAL B 384 ? ILE B 389 VAL B 390 
AA6 1  SER B 316 ? VAL B 318 ? SER B 322 VAL B 324 
AA6 2  ALA B 332 ? ASN B 334 ? ALA B 338 ASN B 340 
AA6 3  ARG B 349 ? VAL B 355 ? ARG B 355 VAL B 361 
AA6 4  GLN B 366 ? ILE B 372 ? GLN B 372 ILE B 378 
AA6 5  CYS B 403 ? ILE B 405 ? CYS B 409 ILE B 411 
AA6 6  ARG B 396 ? ARG B 397 ? ARG B 402 ARG B 403 
AA7 1  SER A 316 ? VAL A 318 ? SER A 322 VAL A 324 
AA7 2  ALA A 332 ? ASN A 334 ? ALA A 338 ASN A 340 
AA7 3  ARG A 349 ? VAL A 355 ? ARG A 355 VAL A 361 
AA7 4  GLN A 366 ? ILE A 372 ? GLN A 372 ILE A 378 
AA7 5  CYS A 403 ? ILE A 405 ? CYS A 409 ILE A 411 
AA7 6  ARG A 396 ? ARG A 397 ? ARG A 402 ARG A 403 
AA8 1  ILE A 383 ? VAL A 384 ? ILE A 389 VAL A 390 
AA8 2  GLN A 366 ? ILE A 372 ? GLN A 372 ILE A 378 
AA8 3  ARG A 349 ? VAL A 355 ? ARG A 355 VAL A 361 
AA8 4  LEU A 337 ? LEU A 338 ? LEU A 343 LEU A 344 
AA8 5  SER A 320 ? VAL A 322 ? SER A 326 VAL A 328 
AA8 6  ALA B 304 ? VAL B 307 ? ALA B 310 VAL B 313 
AA8 7  ILE B 327 ? SER B 329 ? ILE B 333 SER B 335 
AA8 8  ARG B 343 ? ALA B 344 ? ARG B 349 ALA B 350 
AA8 9  LYS B 360 ? ILE B 361 ? LYS B 366 ILE B 367 
AA8 10 VAL B 377 ? ILE B 378 ? VAL B 383 ILE B 384 
AA9 1  SER B 86  ? PRO B 91  ? SER B 92  PRO B 97  
AA9 2  ARG B 56  ? THR B 61  ? ARG B 62  THR B 67  
AA9 3  ALA B 8   ? ALA B 14  ? ALA B 14  ALA B 20  
AA9 4  TYR B 123 ? ALA B 128 ? TYR B 129 ALA B 134 
AA9 5  PHE B 196 ? HIS B 207 ? PHE B 202 HIS B 213 
AA9 6  GLY B 167 ? VAL B 171 ? GLY B 173 VAL B 177 
AA9 7  ILE B 177 ? GLU B 182 ? ILE B 183 GLU B 188 
AB1 1  SER B 86  ? PRO B 91  ? SER B 92  PRO B 97  
AB1 2  ARG B 56  ? THR B 61  ? ARG B 62  THR B 67  
AB1 3  ALA B 8   ? ALA B 14  ? ALA B 14  ALA B 20  
AB1 4  TYR B 123 ? ALA B 128 ? TYR B 129 ALA B 134 
AB1 5  PHE B 196 ? HIS B 207 ? PHE B 202 HIS B 213 
AB1 6  VAL B 151 ? PRO B 159 ? VAL B 157 PRO B 165 
AB1 7  ALA B 242 ? ARG B 246 ? ALA B 248 ARG B 252 
AB2 1  TYR B 34  ? PHE B 35  ? TYR B 40  PHE B 41  
AB2 2  ALA B 39  ? ARG B 40  ? ALA B 45  ARG B 46  
AB3 1  ILE B 132 ? TYR B 133 ? ILE B 138 TYR B 139 
AB3 2  TRP B 262 ? ARG B 263 ? TRP B 268 ARG B 269 
AB4 1  SER C 86  ? PRO C 91  ? SER C 92  PRO C 97  
AB4 2  ARG C 56  ? THR C 61  ? ARG C 62  THR C 67  
AB4 3  ALA C 8   ? ALA C 14  ? ALA C 14  ALA C 20  
AB4 4  TYR C 123 ? ALA C 128 ? TYR C 129 ALA C 134 
AB4 5  PHE C 196 ? HIS C 207 ? PHE C 202 HIS C 213 
AB4 6  VAL C 151 ? PRO C 159 ? VAL C 157 PRO C 165 
AB4 7  ALA C 242 ? ARG C 246 ? ALA C 248 ARG C 252 
AB5 1  TYR C 34  ? PHE C 35  ? TYR C 40  PHE C 41  
AB5 2  ALA C 39  ? ARG C 40  ? ALA C 45  ARG C 46  
AB6 1  ILE C 132 ? TYR C 133 ? ILE C 138 TYR C 139 
AB6 2  TRP C 262 ? ARG C 263 ? TRP C 268 ARG C 269 
AB7 1  GLY C 167 ? VAL C 171 ? GLY C 173 VAL C 177 
AB7 2  ILE C 177 ? GLU C 182 ? ILE C 183 GLU C 188 
AB8 1  VAL C 377 ? ILE C 378 ? VAL C 383 ILE C 384 
AB8 2  LYS C 360 ? ILE C 361 ? LYS C 366 ILE C 367 
AB8 3  ARG C 343 ? ALA C 344 ? ARG C 349 ALA C 350 
AB8 4  ILE C 327 ? SER C 329 ? ILE C 333 SER C 335 
AB8 5  ALA C 304 ? VAL C 307 ? ALA C 310 VAL C 313 
AB8 6  SER D 320 ? VAL D 322 ? SER D 326 VAL D 328 
AB8 7  LEU D 337 ? LEU D 338 ? LEU D 343 LEU D 344 
AB8 8  ARG D 349 ? VAL D 355 ? ARG D 355 VAL D 361 
AB8 9  GLN D 366 ? ILE D 372 ? GLN D 372 ILE D 378 
AB8 10 ILE D 383 ? VAL D 384 ? ILE D 389 VAL D 390 
AB9 1  SER D 316 ? VAL D 318 ? SER D 322 VAL D 324 
AB9 2  ALA D 332 ? ASN D 334 ? ALA D 338 ASN D 340 
AB9 3  ARG D 349 ? VAL D 355 ? ARG D 355 VAL D 361 
AB9 4  GLN D 366 ? ILE D 372 ? GLN D 372 ILE D 378 
AB9 5  CYS D 403 ? ILE D 405 ? CYS D 409 ILE D 411 
AB9 6  ARG D 396 ? ARG D 397 ? ARG D 402 ARG D 403 
AC1 1  SER C 316 ? VAL C 318 ? SER C 322 VAL C 324 
AC1 2  ALA C 332 ? ASN C 334 ? ALA C 338 ASN C 340 
AC1 3  ARG C 349 ? VAL C 355 ? ARG C 355 VAL C 361 
AC1 4  GLN C 366 ? ILE C 372 ? GLN C 372 ILE C 378 
AC1 5  CYS C 403 ? ILE C 405 ? CYS C 409 ILE C 411 
AC1 6  ARG C 396 ? ARG C 397 ? ARG C 402 ARG C 403 
AC2 1  ILE C 383 ? VAL C 384 ? ILE C 389 VAL C 390 
AC2 2  GLN C 366 ? ILE C 372 ? GLN C 372 ILE C 378 
AC2 3  ARG C 349 ? VAL C 355 ? ARG C 355 VAL C 361 
AC2 4  LEU C 337 ? LEU C 338 ? LEU C 343 LEU C 344 
AC2 5  SER C 320 ? VAL C 322 ? SER C 326 VAL C 328 
AC2 6  ALA D 304 ? VAL D 307 ? ALA D 310 VAL D 313 
AC2 7  ILE D 327 ? SER D 329 ? ILE D 333 SER D 335 
AC2 8  ARG D 343 ? ALA D 344 ? ARG D 349 ALA D 350 
AC2 9  LYS D 360 ? ILE D 361 ? LYS D 366 ILE D 367 
AC2 10 VAL D 377 ? ILE D 378 ? VAL D 383 ILE D 384 
AC3 1  SER D 86  ? PRO D 91  ? SER D 92  PRO D 97  
AC3 2  ARG D 56  ? THR D 61  ? ARG D 62  THR D 67  
AC3 3  ALA D 8   ? ALA D 14  ? ALA D 14  ALA D 20  
AC3 4  TYR D 123 ? ALA D 128 ? TYR D 129 ALA D 134 
AC3 5  PHE D 196 ? HIS D 207 ? PHE D 202 HIS D 213 
AC3 6  GLY D 167 ? VAL D 171 ? GLY D 173 VAL D 177 
AC3 7  ILE D 177 ? GLU D 182 ? ILE D 183 GLU D 188 
AC4 1  SER D 86  ? PRO D 91  ? SER D 92  PRO D 97  
AC4 2  ARG D 56  ? THR D 61  ? ARG D 62  THR D 67  
AC4 3  ALA D 8   ? ALA D 14  ? ALA D 14  ALA D 20  
AC4 4  TYR D 123 ? ALA D 128 ? TYR D 129 ALA D 134 
AC4 5  PHE D 196 ? HIS D 207 ? PHE D 202 HIS D 213 
AC4 6  VAL D 151 ? PRO D 159 ? VAL D 157 PRO D 165 
AC4 7  ALA D 242 ? ARG D 246 ? ALA D 248 ARG D 252 
AC5 1  TYR D 34  ? PHE D 35  ? TYR D 40  PHE D 41  
AC5 2  ALA D 39  ? ARG D 40  ? ALA D 45  ARG D 46  
AC6 1  ILE D 132 ? TYR D 133 ? ILE D 138 TYR D 139 
AC6 2  TRP D 262 ? ARG D 263 ? TRP D 268 ARG D 269 
AC7 1  SER E 86  ? PRO E 91  ? SER E 92  PRO E 97  
AC7 2  ARG E 56  ? THR E 61  ? ARG E 62  THR E 67  
AC7 3  ALA E 8   ? ALA E 14  ? ALA E 14  ALA E 20  
AC7 4  TYR E 123 ? ALA E 128 ? TYR E 129 ALA E 134 
AC7 5  PHE E 196 ? HIS E 207 ? PHE E 202 HIS E 213 
AC7 6  GLY E 167 ? VAL E 171 ? GLY E 173 VAL E 177 
AC7 7  ILE E 177 ? GLU E 182 ? ILE E 183 GLU E 188 
AC8 1  SER E 86  ? PRO E 91  ? SER E 92  PRO E 97  
AC8 2  ARG E 56  ? THR E 61  ? ARG E 62  THR E 67  
AC8 3  ALA E 8   ? ALA E 14  ? ALA E 14  ALA E 20  
AC8 4  TYR E 123 ? ALA E 128 ? TYR E 129 ALA E 134 
AC8 5  PHE E 196 ? HIS E 207 ? PHE E 202 HIS E 213 
AC8 6  VAL E 151 ? PRO E 159 ? VAL E 157 PRO E 165 
AC8 7  ALA E 242 ? VAL E 243 ? ALA E 248 VAL E 249 
AC9 1  TYR E 34  ? PHE E 35  ? TYR E 40  PHE E 41  
AC9 2  ALA E 39  ? ARG E 40  ? ALA E 45  ARG E 46  
AD1 1  ILE E 132 ? TYR E 133 ? ILE E 138 TYR E 139 
AD1 2  TRP E 262 ? ARG E 263 ? TRP E 268 ARG E 269 
AD2 1  VAL E 377 ? ILE E 378 ? VAL E 383 ILE E 384 
AD2 2  LYS E 360 ? ILE E 361 ? LYS E 366 ILE E 367 
AD2 3  ARG E 343 ? ALA E 344 ? ARG E 349 ALA E 350 
AD2 4  ILE E 327 ? SER E 329 ? ILE E 333 SER E 335 
AD2 5  ALA E 304 ? VAL E 307 ? ALA E 310 VAL E 313 
AD2 6  SER F 320 ? VAL F 322 ? SER F 326 VAL F 328 
AD2 7  LEU F 337 ? LEU F 338 ? LEU F 343 LEU F 344 
AD2 8  ARG F 349 ? VAL F 355 ? ARG F 355 VAL F 361 
AD2 9  GLN F 366 ? ILE F 372 ? GLN F 372 ILE F 378 
AD2 10 ILE F 383 ? VAL F 384 ? ILE F 389 VAL F 390 
AD3 1  SER F 316 ? VAL F 318 ? SER F 322 VAL F 324 
AD3 2  ALA F 332 ? ASN F 334 ? ALA F 338 ASN F 340 
AD3 3  ARG F 349 ? VAL F 355 ? ARG F 355 VAL F 361 
AD3 4  GLN F 366 ? ILE F 372 ? GLN F 372 ILE F 378 
AD3 5  CYS F 403 ? ILE F 405 ? CYS F 409 ILE F 411 
AD3 6  ARG F 396 ? ARG F 397 ? ARG F 402 ARG F 403 
AD4 1  SER E 316 ? VAL E 318 ? SER E 322 VAL E 324 
AD4 2  ALA E 332 ? ASN E 334 ? ALA E 338 ASN E 340 
AD4 3  ARG E 349 ? VAL E 355 ? ARG E 355 VAL E 361 
AD4 4  GLN E 366 ? ILE E 372 ? GLN E 372 ILE E 378 
AD4 5  CYS E 403 ? ILE E 405 ? CYS E 409 ILE E 411 
AD4 6  ARG E 396 ? ARG E 397 ? ARG E 402 ARG E 403 
AD5 1  ILE E 383 ? VAL E 384 ? ILE E 389 VAL E 390 
AD5 2  GLN E 366 ? ILE E 372 ? GLN E 372 ILE E 378 
AD5 3  ARG E 349 ? VAL E 355 ? ARG E 355 VAL E 361 
AD5 4  LEU E 337 ? LEU E 338 ? LEU E 343 LEU E 344 
AD5 5  SER E 320 ? VAL E 322 ? SER E 326 VAL E 328 
AD5 6  ALA F 304 ? VAL F 307 ? ALA F 310 VAL F 313 
AD5 7  ILE F 327 ? SER F 329 ? ILE F 333 SER F 335 
AD5 8  ARG F 343 ? ALA F 344 ? ARG F 349 ALA F 350 
AD5 9  LYS F 360 ? ILE F 361 ? LYS F 366 ILE F 367 
AD5 10 VAL F 377 ? ILE F 378 ? VAL F 383 ILE F 384 
AD6 1  SER F 86  ? LEU F 90  ? SER F 92  LEU F 96  
AD6 2  ARG F 56  ? ALA F 60  ? ARG F 62  ALA F 66  
AD6 3  ALA F 8   ? LEU F 13  ? ALA F 14  LEU F 19  
AD6 4  TYR F 123 ? ALA F 128 ? TYR F 129 ALA F 134 
AD6 5  PHE F 196 ? HIS F 207 ? PHE F 202 HIS F 213 
AD6 6  GLY F 167 ? VAL F 171 ? GLY F 173 VAL F 177 
AD6 7  ILE F 177 ? GLU F 182 ? ILE F 183 GLU F 188 
AD7 1  SER F 86  ? LEU F 90  ? SER F 92  LEU F 96  
AD7 2  ARG F 56  ? ALA F 60  ? ARG F 62  ALA F 66  
AD7 3  ALA F 8   ? LEU F 13  ? ALA F 14  LEU F 19  
AD7 4  TYR F 123 ? ALA F 128 ? TYR F 129 ALA F 134 
AD7 5  PHE F 196 ? HIS F 207 ? PHE F 202 HIS F 213 
AD7 6  VAL F 151 ? PRO F 159 ? VAL F 157 PRO F 165 
AD7 7  ALA F 242 ? ARG F 246 ? ALA F 248 ARG F 252 
AD8 1  TYR F 34  ? PHE F 35  ? TYR F 40  PHE F 41  
AD8 2  ALA F 39  ? ARG F 40  ? ALA F 45  ARG F 46  
AD9 1  ILE F 132 ? TYR F 133 ? ILE F 138 TYR F 139 
AD9 2  TRP F 262 ? ARG F 263 ? TRP F 268 ARG F 269 
AE1 1  SER G 86  ? LEU G 90  ? SER G 92  LEU G 96  
AE1 2  ARG G 56  ? THR G 61  ? ARG G 62  THR G 67  
AE1 3  ALA G 8   ? ALA G 14  ? ALA G 14  ALA G 20  
AE1 4  TYR G 123 ? ALA G 128 ? TYR G 129 ALA G 134 
AE1 5  PHE G 196 ? HIS G 207 ? PHE G 202 HIS G 213 
AE1 6  GLY G 167 ? VAL G 171 ? GLY G 173 VAL G 177 
AE1 7  ILE G 177 ? GLU G 182 ? ILE G 183 GLU G 188 
AE2 1  SER G 86  ? LEU G 90  ? SER G 92  LEU G 96  
AE2 2  ARG G 56  ? THR G 61  ? ARG G 62  THR G 67  
AE2 3  ALA G 8   ? ALA G 14  ? ALA G 14  ALA G 20  
AE2 4  TYR G 123 ? ALA G 128 ? TYR G 129 ALA G 134 
AE2 5  PHE G 196 ? HIS G 207 ? PHE G 202 HIS G 213 
AE2 6  VAL G 151 ? PRO G 159 ? VAL G 157 PRO G 165 
AE2 7  ALA G 242 ? ARG G 246 ? ALA G 248 ARG G 252 
AE3 1  TYR G 34  ? PHE G 35  ? TYR G 40  PHE G 41  
AE3 2  ALA G 39  ? ARG G 40  ? ALA G 45  ARG G 46  
AE4 1  ILE G 132 ? TYR G 133 ? ILE G 138 TYR G 139 
AE4 2  TRP G 262 ? ARG G 263 ? TRP G 268 ARG G 269 
AE5 1  VAL G 377 ? ILE G 378 ? VAL G 383 ILE G 384 
AE5 2  LYS G 360 ? ILE G 361 ? LYS G 366 ILE G 367 
AE5 3  ARG G 343 ? ALA G 344 ? ARG G 349 ALA G 350 
AE5 4  ILE G 327 ? SER G 329 ? ILE G 333 SER G 335 
AE5 5  ALA G 304 ? VAL G 307 ? ALA G 310 VAL G 313 
AE5 6  SER H 320 ? VAL H 322 ? SER H 326 VAL H 328 
AE5 7  LEU H 337 ? LEU H 338 ? LEU H 343 LEU H 344 
AE5 8  ARG H 349 ? VAL H 355 ? ARG H 355 VAL H 361 
AE5 9  GLN H 366 ? ILE H 372 ? GLN H 372 ILE H 378 
AE5 10 ILE H 383 ? VAL H 384 ? ILE H 389 VAL H 390 
AE6 1  SER H 316 ? VAL H 318 ? SER H 322 VAL H 324 
AE6 2  ALA H 332 ? ASN H 334 ? ALA H 338 ASN H 340 
AE6 3  ARG H 349 ? VAL H 355 ? ARG H 355 VAL H 361 
AE6 4  GLN H 366 ? ILE H 372 ? GLN H 372 ILE H 378 
AE6 5  CYS H 403 ? ILE H 405 ? CYS H 409 ILE H 411 
AE6 6  ARG H 396 ? ARG H 397 ? ARG H 402 ARG H 403 
AE7 1  SER G 316 ? VAL G 318 ? SER G 322 VAL G 324 
AE7 2  ALA G 332 ? ASN G 334 ? ALA G 338 ASN G 340 
AE7 3  ARG G 349 ? VAL G 355 ? ARG G 355 VAL G 361 
AE7 4  GLN G 366 ? ILE G 372 ? GLN G 372 ILE G 378 
AE7 5  CYS G 403 ? ILE G 405 ? CYS G 409 ILE G 411 
AE7 6  ARG G 396 ? ARG G 397 ? ARG G 402 ARG G 403 
AE8 1  ILE G 383 ? VAL G 384 ? ILE G 389 VAL G 390 
AE8 2  GLN G 366 ? ILE G 372 ? GLN G 372 ILE G 378 
AE8 3  ARG G 349 ? VAL G 355 ? ARG G 355 VAL G 361 
AE8 4  LEU G 337 ? LEU G 338 ? LEU G 343 LEU G 344 
AE8 5  SER G 320 ? VAL G 322 ? SER G 326 VAL G 328 
AE8 6  ALA H 304 ? VAL H 307 ? ALA H 310 VAL H 313 
AE8 7  ILE H 327 ? SER H 329 ? ILE H 333 SER H 335 
AE8 8  ARG H 343 ? ALA H 344 ? ARG H 349 ALA H 350 
AE8 9  LYS H 360 ? ILE H 361 ? LYS H 366 ILE H 367 
AE8 10 VAL H 377 ? ILE H 378 ? VAL H 383 ILE H 384 
AE9 1  SER H 86  ? LEU H 90  ? SER H 92  LEU H 96  
AE9 2  ARG H 56  ? ALA H 60  ? ARG H 62  ALA H 66  
AE9 3  ALA H 8   ? LEU H 13  ? ALA H 14  LEU H 19  
AE9 4  TYR H 123 ? ALA H 128 ? TYR H 129 ALA H 134 
AE9 5  PHE H 196 ? HIS H 207 ? PHE H 202 HIS H 213 
AE9 6  GLY H 167 ? VAL H 171 ? GLY H 173 VAL H 177 
AE9 7  ILE H 177 ? GLU H 182 ? ILE H 183 GLU H 188 
AF1 1  SER H 86  ? LEU H 90  ? SER H 92  LEU H 96  
AF1 2  ARG H 56  ? ALA H 60  ? ARG H 62  ALA H 66  
AF1 3  ALA H 8   ? LEU H 13  ? ALA H 14  LEU H 19  
AF1 4  TYR H 123 ? ALA H 128 ? TYR H 129 ALA H 134 
AF1 5  PHE H 196 ? HIS H 207 ? PHE H 202 HIS H 213 
AF1 6  VAL H 151 ? PRO H 159 ? VAL H 157 PRO H 165 
AF1 7  ALA H 242 ? ARG H 246 ? ALA H 248 ARG H 252 
AF2 1  TYR H 34  ? PHE H 35  ? TYR H 40  PHE H 41  
AF2 2  ALA H 39  ? ARG H 40  ? ALA H 45  ARG H 46  
AF3 1  ILE H 132 ? TYR H 133 ? ILE H 138 TYR H 139 
AF3 2  TRP H 262 ? ARG H 263 ? TRP H 268 ARG H 269 
AF4 1  SER I 86  ? LEU I 90  ? SER I 92  LEU I 96  
AF4 2  ARG I 56  ? THR I 61  ? ARG I 62  THR I 67  
AF4 3  ALA I 8   ? ALA I 14  ? ALA I 14  ALA I 20  
AF4 4  TYR I 123 ? ALA I 128 ? TYR I 129 ALA I 134 
AF4 5  PHE I 196 ? HIS I 207 ? PHE I 202 HIS I 213 
AF4 6  GLY I 167 ? VAL I 171 ? GLY I 173 VAL I 177 
AF4 7  ILE I 177 ? GLU I 182 ? ILE I 183 GLU I 188 
AF5 1  SER I 86  ? LEU I 90  ? SER I 92  LEU I 96  
AF5 2  ARG I 56  ? THR I 61  ? ARG I 62  THR I 67  
AF5 3  ALA I 8   ? ALA I 14  ? ALA I 14  ALA I 20  
AF5 4  TYR I 123 ? ALA I 128 ? TYR I 129 ALA I 134 
AF5 5  PHE I 196 ? HIS I 207 ? PHE I 202 HIS I 213 
AF5 6  VAL I 151 ? PRO I 159 ? VAL I 157 PRO I 165 
AF5 7  ALA I 242 ? ARG I 246 ? ALA I 248 ARG I 252 
AF6 1  TYR I 34  ? PHE I 35  ? TYR I 40  PHE I 41  
AF6 2  ALA I 39  ? ARG I 40  ? ALA I 45  ARG I 46  
AF7 1  ILE I 132 ? TYR I 133 ? ILE I 138 TYR I 139 
AF7 2  TRP I 262 ? ARG I 263 ? TRP I 268 ARG I 269 
AF8 1  VAL I 377 ? ILE I 378 ? VAL I 383 ILE I 384 
AF8 2  LYS I 360 ? ILE I 361 ? LYS I 366 ILE I 367 
AF8 3  ARG I 343 ? ALA I 344 ? ARG I 349 ALA I 350 
AF8 4  ILE I 327 ? SER I 329 ? ILE I 333 SER I 335 
AF8 5  ALA I 304 ? VAL I 307 ? ALA I 310 VAL I 313 
AF8 6  SER J 320 ? VAL J 322 ? SER J 326 VAL J 328 
AF8 7  LEU J 337 ? LEU J 338 ? LEU J 343 LEU J 344 
AF8 8  ARG J 349 ? VAL J 355 ? ARG J 355 VAL J 361 
AF8 9  GLN J 366 ? ILE J 372 ? GLN J 372 ILE J 378 
AF8 10 ILE J 383 ? VAL J 384 ? ILE J 389 VAL J 390 
AF9 1  SER J 316 ? VAL J 318 ? SER J 322 VAL J 324 
AF9 2  ALA J 332 ? ASN J 334 ? ALA J 338 ASN J 340 
AF9 3  ARG J 349 ? VAL J 355 ? ARG J 355 VAL J 361 
AF9 4  GLN J 366 ? ILE J 372 ? GLN J 372 ILE J 378 
AF9 5  CYS J 403 ? ILE J 405 ? CYS J 409 ILE J 411 
AF9 6  ARG J 396 ? ARG J 397 ? ARG J 402 ARG J 403 
AG1 1  SER I 316 ? VAL I 318 ? SER I 322 VAL I 324 
AG1 2  ALA I 332 ? ASN I 334 ? ALA I 338 ASN I 340 
AG1 3  ARG I 349 ? VAL I 355 ? ARG I 355 VAL I 361 
AG1 4  GLN I 366 ? ILE I 372 ? GLN I 372 ILE I 378 
AG1 5  CYS I 403 ? ILE I 405 ? CYS I 409 ILE I 411 
AG1 6  ARG I 396 ? ARG I 397 ? ARG I 402 ARG I 403 
AG2 1  ILE I 383 ? VAL I 384 ? ILE I 389 VAL I 390 
AG2 2  GLN I 366 ? ILE I 372 ? GLN I 372 ILE I 378 
AG2 3  ARG I 349 ? VAL I 355 ? ARG I 355 VAL I 361 
AG2 4  LEU I 337 ? LEU I 338 ? LEU I 343 LEU I 344 
AG2 5  SER I 320 ? VAL I 322 ? SER I 326 VAL I 328 
AG2 6  ALA J 304 ? VAL J 307 ? ALA J 310 VAL J 313 
AG2 7  ILE J 327 ? SER J 329 ? ILE J 333 SER J 335 
AG2 8  ARG J 343 ? ALA J 344 ? ARG J 349 ALA J 350 
AG2 9  LYS J 360 ? ILE J 361 ? LYS J 366 ILE J 367 
AG2 10 VAL J 377 ? ILE J 378 ? VAL J 383 ILE J 384 
AG3 1  SER J 86  ? PRO J 91  ? SER J 92  PRO J 97  
AG3 2  ARG J 56  ? THR J 61  ? ARG J 62  THR J 67  
AG3 3  ALA J 8   ? ALA J 14  ? ALA J 14  ALA J 20  
AG3 4  TYR J 123 ? ALA J 128 ? TYR J 129 ALA J 134 
AG3 5  PHE J 196 ? HIS J 207 ? PHE J 202 HIS J 213 
AG3 6  GLY J 167 ? VAL J 171 ? GLY J 173 VAL J 177 
AG3 7  ILE J 177 ? GLU J 182 ? ILE J 183 GLU J 188 
AG4 1  SER J 86  ? PRO J 91  ? SER J 92  PRO J 97  
AG4 2  ARG J 56  ? THR J 61  ? ARG J 62  THR J 67  
AG4 3  ALA J 8   ? ALA J 14  ? ALA J 14  ALA J 20  
AG4 4  TYR J 123 ? ALA J 128 ? TYR J 129 ALA J 134 
AG4 5  PHE J 196 ? HIS J 207 ? PHE J 202 HIS J 213 
AG4 6  VAL J 151 ? PRO J 159 ? VAL J 157 PRO J 165 
AG4 7  ALA J 242 ? ARG J 246 ? ALA J 248 ARG J 252 
AG5 1  TYR J 34  ? PHE J 35  ? TYR J 40  PHE J 41  
AG5 2  ALA J 39  ? ARG J 40  ? ALA J 45  ARG J 46  
AG6 1  ILE J 132 ? TYR J 133 ? ILE J 138 TYR J 139 
AG6 2  TRP J 262 ? ARG J 263 ? TRP J 268 ARG J 269 
AG7 1  SER K 86  ? LEU K 90  ? SER K 92  LEU K 96  
AG7 2  ARG K 56  ? THR K 61  ? ARG K 62  THR K 67  
AG7 3  ALA K 8   ? ALA K 14  ? ALA K 14  ALA K 20  
AG7 4  TYR K 123 ? ALA K 128 ? TYR K 129 ALA K 134 
AG7 5  PHE K 196 ? HIS K 207 ? PHE K 202 HIS K 213 
AG7 6  GLY K 167 ? VAL K 171 ? GLY K 173 VAL K 177 
AG7 7  ILE K 177 ? GLU K 182 ? ILE K 183 GLU K 188 
AG8 1  SER K 86  ? LEU K 90  ? SER K 92  LEU K 96  
AG8 2  ARG K 56  ? THR K 61  ? ARG K 62  THR K 67  
AG8 3  ALA K 8   ? ALA K 14  ? ALA K 14  ALA K 20  
AG8 4  TYR K 123 ? ALA K 128 ? TYR K 129 ALA K 134 
AG8 5  PHE K 196 ? HIS K 207 ? PHE K 202 HIS K 213 
AG8 6  VAL K 151 ? PRO K 159 ? VAL K 157 PRO K 165 
AG8 7  ALA K 242 ? ARG K 246 ? ALA K 248 ARG K 252 
AG9 1  TYR K 34  ? PHE K 35  ? TYR K 40  PHE K 41  
AG9 2  ALA K 39  ? ARG K 40  ? ALA K 45  ARG K 46  
AH1 1  ILE K 132 ? TYR K 133 ? ILE K 138 TYR K 139 
AH1 2  TRP K 262 ? ARG K 263 ? TRP K 268 ARG K 269 
AH2 1  VAL K 377 ? ILE K 378 ? VAL K 383 ILE K 384 
AH2 2  LYS K 360 ? ILE K 361 ? LYS K 366 ILE K 367 
AH2 3  ARG K 343 ? ALA K 344 ? ARG K 349 ALA K 350 
AH2 4  ILE K 327 ? SER K 329 ? ILE K 333 SER K 335 
AH2 5  ALA K 304 ? VAL K 307 ? ALA K 310 VAL K 313 
AH2 6  SER L 320 ? VAL L 322 ? SER L 326 VAL L 328 
AH2 7  LEU L 337 ? LEU L 338 ? LEU L 343 LEU L 344 
AH2 8  ARG L 349 ? VAL L 355 ? ARG L 355 VAL L 361 
AH2 9  GLN L 366 ? ILE L 372 ? GLN L 372 ILE L 378 
AH2 10 ILE L 383 ? VAL L 384 ? ILE L 389 VAL L 390 
AH3 1  SER L 316 ? VAL L 318 ? SER L 322 VAL L 324 
AH3 2  ALA L 332 ? ASN L 334 ? ALA L 338 ASN L 340 
AH3 3  ARG L 349 ? VAL L 355 ? ARG L 355 VAL L 361 
AH3 4  GLN L 366 ? ILE L 372 ? GLN L 372 ILE L 378 
AH3 5  CYS L 403 ? ILE L 405 ? CYS L 409 ILE L 411 
AH3 6  ARG L 396 ? ARG L 397 ? ARG L 402 ARG L 403 
AH4 1  SER K 316 ? VAL K 318 ? SER K 322 VAL K 324 
AH4 2  ALA K 332 ? LEU K 338 ? ALA K 338 LEU K 344 
AH4 3  ARG K 349 ? VAL K 355 ? ARG K 355 VAL K 361 
AH4 4  GLN K 366 ? ILE K 372 ? GLN K 372 ILE K 378 
AH4 5  CYS K 403 ? ILE K 405 ? CYS K 409 ILE K 411 
AH4 6  ARG K 396 ? ARG K 397 ? ARG K 402 ARG K 403 
AH5 1  ILE K 383 ? VAL K 384 ? ILE K 389 VAL K 390 
AH5 2  GLN K 366 ? ILE K 372 ? GLN K 372 ILE K 378 
AH5 3  ARG K 349 ? VAL K 355 ? ARG K 355 VAL K 361 
AH5 4  ALA K 332 ? LEU K 338 ? ALA K 338 LEU K 344 
AH5 5  SER K 320 ? VAL K 322 ? SER K 326 VAL K 328 
AH5 6  ALA L 304 ? VAL L 307 ? ALA L 310 VAL L 313 
AH5 7  ILE L 327 ? SER L 329 ? ILE L 333 SER L 335 
AH5 8  ARG L 343 ? ALA L 344 ? ARG L 349 ALA L 350 
AH5 9  LYS L 360 ? ILE L 361 ? LYS L 366 ILE L 367 
AH5 10 VAL L 377 ? ILE L 378 ? VAL L 383 ILE L 384 
AH6 1  SER L 86  ? LEU L 90  ? SER L 92  LEU L 96  
AH6 2  ARG L 56  ? THR L 61  ? ARG L 62  THR L 67  
AH6 3  ALA L 8   ? ALA L 14  ? ALA L 14  ALA L 20  
AH6 4  TYR L 123 ? ALA L 128 ? TYR L 129 ALA L 134 
AH6 5  PHE L 196 ? HIS L 207 ? PHE L 202 HIS L 213 
AH6 6  GLY L 167 ? VAL L 171 ? GLY L 173 VAL L 177 
AH6 7  ILE L 177 ? GLU L 182 ? ILE L 183 GLU L 188 
AH7 1  SER L 86  ? LEU L 90  ? SER L 92  LEU L 96  
AH7 2  ARG L 56  ? THR L 61  ? ARG L 62  THR L 67  
AH7 3  ALA L 8   ? ALA L 14  ? ALA L 14  ALA L 20  
AH7 4  TYR L 123 ? ALA L 128 ? TYR L 129 ALA L 134 
AH7 5  PHE L 196 ? HIS L 207 ? PHE L 202 HIS L 213 
AH7 6  VAL L 151 ? PRO L 159 ? VAL L 157 PRO L 165 
AH7 7  ALA L 242 ? ARG L 246 ? ALA L 248 ARG L 252 
AH8 1  TYR L 34  ? PHE L 35  ? TYR L 40  PHE L 41  
AH8 2  ALA L 39  ? ARG L 40  ? ALA L 45  ARG L 46  
AH9 1  ILE L 132 ? TYR L 133 ? ILE L 138 TYR L 139 
AH9 2  TRP L 262 ? ARG L 263 ? TRP L 268 ARG L 269 
AI1 1  SER M 86  ? PRO M 91  ? SER M 92  PRO M 97  
AI1 2  ARG M 56  ? THR M 61  ? ARG M 62  THR M 67  
AI1 3  ALA M 8   ? ALA M 14  ? ALA M 14  ALA M 20  
AI1 4  TYR M 123 ? ALA M 128 ? TYR M 129 ALA M 134 
AI1 5  PHE M 196 ? HIS M 207 ? PHE M 202 HIS M 213 
AI1 6  GLY M 167 ? VAL M 171 ? GLY M 173 VAL M 177 
AI1 7  ILE M 177 ? GLU M 182 ? ILE M 183 GLU M 188 
AI2 1  SER M 86  ? PRO M 91  ? SER M 92  PRO M 97  
AI2 2  ARG M 56  ? THR M 61  ? ARG M 62  THR M 67  
AI2 3  ALA M 8   ? ALA M 14  ? ALA M 14  ALA M 20  
AI2 4  TYR M 123 ? ALA M 128 ? TYR M 129 ALA M 134 
AI2 5  PHE M 196 ? HIS M 207 ? PHE M 202 HIS M 213 
AI2 6  VAL M 151 ? PRO M 159 ? VAL M 157 PRO M 165 
AI2 7  ALA M 242 ? ARG M 246 ? ALA M 248 ARG M 252 
AI3 1  TYR M 34  ? PHE M 35  ? TYR M 40  PHE M 41  
AI3 2  ALA M 39  ? ARG M 40  ? ALA M 45  ARG M 46  
AI4 1  ILE M 132 ? TYR M 133 ? ILE M 138 TYR M 139 
AI4 2  TRP M 262 ? ARG M 263 ? TRP M 268 ARG M 269 
AI5 1  VAL M 377 ? ILE M 378 ? VAL M 383 ILE M 384 
AI5 2  LYS M 360 ? ILE M 361 ? LYS M 366 ILE M 367 
AI5 3  ARG M 343 ? ALA M 344 ? ARG M 349 ALA M 350 
AI5 4  ILE M 327 ? SER M 329 ? ILE M 333 SER M 335 
AI5 5  ALA M 304 ? VAL M 307 ? ALA M 310 VAL M 313 
AI5 6  SER N 320 ? VAL N 322 ? SER N 326 VAL N 328 
AI5 7  LEU N 337 ? LEU N 338 ? LEU N 343 LEU N 344 
AI5 8  ARG N 349 ? VAL N 355 ? ARG N 355 VAL N 361 
AI5 9  GLN N 366 ? ILE N 372 ? GLN N 372 ILE N 378 
AI5 10 ILE N 383 ? VAL N 384 ? ILE N 389 VAL N 390 
AI6 1  SER N 316 ? VAL N 318 ? SER N 322 VAL N 324 
AI6 2  ALA N 332 ? ASN N 334 ? ALA N 338 ASN N 340 
AI6 3  ARG N 349 ? VAL N 355 ? ARG N 355 VAL N 361 
AI6 4  GLN N 366 ? ILE N 372 ? GLN N 372 ILE N 378 
AI6 5  CYS N 403 ? ILE N 405 ? CYS N 409 ILE N 411 
AI6 6  ARG N 396 ? ARG N 397 ? ARG N 402 ARG N 403 
AI7 1  SER M 316 ? VAL M 318 ? SER M 322 VAL M 324 
AI7 2  ALA M 332 ? ASN M 334 ? ALA M 338 ASN M 340 
AI7 3  ARG M 349 ? VAL M 355 ? ARG M 355 VAL M 361 
AI7 4  GLN M 366 ? ILE M 372 ? GLN M 372 ILE M 378 
AI7 5  CYS M 403 ? ILE M 405 ? CYS M 409 ILE M 411 
AI7 6  ARG M 396 ? ARG M 397 ? ARG M 402 ARG M 403 
AI8 1  ILE M 383 ? VAL M 384 ? ILE M 389 VAL M 390 
AI8 2  GLN M 366 ? ILE M 372 ? GLN M 372 ILE M 378 
AI8 3  ARG M 349 ? VAL M 355 ? ARG M 355 VAL M 361 
AI8 4  LEU M 337 ? LEU M 338 ? LEU M 343 LEU M 344 
AI8 5  SER M 320 ? VAL M 322 ? SER M 326 VAL M 328 
AI8 6  ALA N 304 ? VAL N 307 ? ALA N 310 VAL N 313 
AI8 7  ILE N 327 ? SER N 329 ? ILE N 333 SER N 335 
AI8 8  ARG N 343 ? ALA N 344 ? ARG N 349 ALA N 350 
AI8 9  LYS N 360 ? ILE N 361 ? LYS N 366 ILE N 367 
AI8 10 VAL N 377 ? ILE N 378 ? VAL N 383 ILE N 384 
AI9 1  SER N 86  ? PRO N 91  ? SER N 92  PRO N 97  
AI9 2  ARG N 56  ? THR N 61  ? ARG N 62  THR N 67  
AI9 3  ALA N 8   ? LEU N 13  ? ALA N 14  LEU N 19  
AI9 4  TYR N 123 ? ALA N 128 ? TYR N 129 ALA N 134 
AI9 5  PHE N 196 ? HIS N 207 ? PHE N 202 HIS N 213 
AI9 6  GLY N 167 ? VAL N 171 ? GLY N 173 VAL N 177 
AI9 7  GLU N 176 ? GLU N 182 ? GLU N 182 GLU N 188 
AI9 8  ALA N 242 ? ARG N 246 ? ALA N 248 ARG N 252 
AI9 9  VAL N 151 ? PRO N 159 ? VAL N 157 PRO N 165 
AI9 10 PHE N 196 ? HIS N 207 ? PHE N 202 HIS N 213 
AJ1 1  TYR N 34  ? PHE N 35  ? TYR N 40  PHE N 41  
AJ1 2  ALA N 39  ? ARG N 40  ? ALA N 45  ARG N 46  
AJ2 1  ILE N 132 ? TYR N 133 ? ILE N 138 TYR N 139 
AJ2 2  TRP N 262 ? ARG N 263 ? TRP N 268 ARG N 269 
AJ3 1  SER O 86  ? LEU O 90  ? SER O 92  LEU O 96  
AJ3 2  ARG O 56  ? THR O 61  ? ARG O 62  THR O 67  
AJ3 3  ALA O 8   ? ALA O 14  ? ALA O 14  ALA O 20  
AJ3 4  TYR O 123 ? ALA O 128 ? TYR O 129 ALA O 134 
AJ3 5  PHE O 196 ? HIS O 207 ? PHE O 202 HIS O 213 
AJ3 6  GLY O 167 ? VAL O 171 ? GLY O 173 VAL O 177 
AJ3 7  ILE O 177 ? GLU O 182 ? ILE O 183 GLU O 188 
AJ4 1  SER O 86  ? LEU O 90  ? SER O 92  LEU O 96  
AJ4 2  ARG O 56  ? THR O 61  ? ARG O 62  THR O 67  
AJ4 3  ALA O 8   ? ALA O 14  ? ALA O 14  ALA O 20  
AJ4 4  TYR O 123 ? ALA O 128 ? TYR O 129 ALA O 134 
AJ4 5  PHE O 196 ? HIS O 207 ? PHE O 202 HIS O 213 
AJ4 6  VAL O 151 ? PRO O 159 ? VAL O 157 PRO O 165 
AJ4 7  ALA O 242 ? ARG O 246 ? ALA O 248 ARG O 252 
AJ5 1  TYR O 34  ? PHE O 35  ? TYR O 40  PHE O 41  
AJ5 2  ALA O 39  ? ARG O 40  ? ALA O 45  ARG O 46  
AJ6 1  ILE O 132 ? TYR O 133 ? ILE O 138 TYR O 139 
AJ6 2  TRP O 262 ? ARG O 263 ? TRP O 268 ARG O 269 
AJ7 1  VAL O 377 ? ILE O 378 ? VAL O 383 ILE O 384 
AJ7 2  LYS O 360 ? ILE O 361 ? LYS O 366 ILE O 367 
AJ7 3  ARG O 343 ? ALA O 344 ? ARG O 349 ALA O 350 
AJ7 4  ILE O 327 ? SER O 329 ? ILE O 333 SER O 335 
AJ7 5  ALA O 304 ? VAL O 307 ? ALA O 310 VAL O 313 
AJ7 6  VAL P 321 ? VAL P 322 ? VAL P 327 VAL P 328 
AJ7 7  LEU P 337 ? LEU P 338 ? LEU P 343 LEU P 344 
AJ7 8  ARG P 349 ? VAL P 355 ? ARG P 355 VAL P 361 
AJ7 9  GLN P 366 ? ILE P 372 ? GLN P 372 ILE P 378 
AJ7 10 ILE P 383 ? VAL P 384 ? ILE P 389 VAL P 390 
AJ8 1  SER P 316 ? VAL P 318 ? SER P 322 VAL P 324 
AJ8 2  ALA P 332 ? ASN P 334 ? ALA P 338 ASN P 340 
AJ8 3  ARG P 349 ? VAL P 355 ? ARG P 355 VAL P 361 
AJ8 4  GLN P 366 ? ILE P 372 ? GLN P 372 ILE P 378 
AJ8 5  CYS P 403 ? ILE P 405 ? CYS P 409 ILE P 411 
AJ8 6  ARG P 396 ? ARG P 397 ? ARG P 402 ARG P 403 
AJ9 1  SER O 316 ? VAL O 318 ? SER O 322 VAL O 324 
AJ9 2  ALA O 332 ? ASN O 334 ? ALA O 338 ASN O 340 
AJ9 3  ARG O 349 ? VAL O 355 ? ARG O 355 VAL O 361 
AJ9 4  GLN O 366 ? ILE O 372 ? GLN O 372 ILE O 378 
AJ9 5  CYS O 403 ? ILE O 405 ? CYS O 409 ILE O 411 
AJ9 6  ARG O 396 ? ARG O 397 ? ARG O 402 ARG O 403 
AK1 1  ILE O 383 ? VAL O 384 ? ILE O 389 VAL O 390 
AK1 2  GLN O 366 ? ILE O 372 ? GLN O 372 ILE O 378 
AK1 3  ARG O 349 ? VAL O 355 ? ARG O 355 VAL O 361 
AK1 4  LEU O 337 ? LEU O 338 ? LEU O 343 LEU O 344 
AK1 5  SER O 320 ? VAL O 322 ? SER O 326 VAL O 328 
AK1 6  ALA P 304 ? VAL P 307 ? ALA P 310 VAL P 313 
AK1 7  ILE P 327 ? SER P 329 ? ILE P 333 SER P 335 
AK1 8  ARG P 343 ? ALA P 344 ? ARG P 349 ALA P 350 
AK1 9  LYS P 360 ? ILE P 361 ? LYS P 366 ILE P 367 
AK1 10 VAL P 377 ? ILE P 378 ? VAL P 383 ILE P 384 
AK2 1  SER P 86  ? PRO P 91  ? SER P 92  PRO P 97  
AK2 2  ARG P 56  ? THR P 61  ? ARG P 62  THR P 67  
AK2 3  ALA P 8   ? LEU P 13  ? ALA P 14  LEU P 19  
AK2 4  TYR P 123 ? ALA P 128 ? TYR P 129 ALA P 134 
AK2 5  PHE P 196 ? HIS P 207 ? PHE P 202 HIS P 213 
AK2 6  GLY P 167 ? VAL P 171 ? GLY P 173 VAL P 177 
AK2 7  ILE P 177 ? GLU P 182 ? ILE P 183 GLU P 188 
AK3 1  SER P 86  ? PRO P 91  ? SER P 92  PRO P 97  
AK3 2  ARG P 56  ? THR P 61  ? ARG P 62  THR P 67  
AK3 3  ALA P 8   ? LEU P 13  ? ALA P 14  LEU P 19  
AK3 4  TYR P 123 ? ALA P 128 ? TYR P 129 ALA P 134 
AK3 5  PHE P 196 ? HIS P 207 ? PHE P 202 HIS P 213 
AK3 6  VAL P 151 ? PRO P 159 ? VAL P 157 PRO P 165 
AK3 7  ALA P 242 ? ARG P 246 ? ALA P 248 ARG P 252 
AK4 1  TYR P 34  ? PHE P 35  ? TYR P 40  PHE P 41  
AK4 2  ALA P 39  ? ARG P 40  ? ALA P 45  ARG P 46  
AK5 1  ILE P 132 ? TYR P 133 ? ILE P 138 TYR P 139 
AK5 2  TRP P 262 ? ARG P 263 ? TRP P 268 ARG P 269 
AK6 1  SER Q 86  ? PRO Q 91  ? SER Q 92  PRO Q 97  
AK6 2  ARG Q 56  ? THR Q 61  ? ARG Q 62  THR Q 67  
AK6 3  ALA Q 8   ? LEU Q 13  ? ALA Q 14  LEU Q 19  
AK6 4  TYR Q 123 ? ALA Q 128 ? TYR Q 129 ALA Q 134 
AK6 5  PHE Q 196 ? HIS Q 207 ? PHE Q 202 HIS Q 213 
AK6 6  GLY Q 167 ? VAL Q 171 ? GLY Q 173 VAL Q 177 
AK6 7  ILE Q 177 ? GLU Q 182 ? ILE Q 183 GLU Q 188 
AK7 1  SER Q 86  ? PRO Q 91  ? SER Q 92  PRO Q 97  
AK7 2  ARG Q 56  ? THR Q 61  ? ARG Q 62  THR Q 67  
AK7 3  ALA Q 8   ? LEU Q 13  ? ALA Q 14  LEU Q 19  
AK7 4  TYR Q 123 ? ALA Q 128 ? TYR Q 129 ALA Q 134 
AK7 5  PHE Q 196 ? HIS Q 207 ? PHE Q 202 HIS Q 213 
AK7 6  VAL Q 151 ? PRO Q 159 ? VAL Q 157 PRO Q 165 
AK7 7  ALA Q 242 ? ARG Q 246 ? ALA Q 248 ARG Q 252 
AK8 1  TYR Q 34  ? PHE Q 35  ? TYR Q 40  PHE Q 41  
AK8 2  ALA Q 39  ? ARG Q 40  ? ALA Q 45  ARG Q 46  
AK9 1  ILE Q 132 ? TYR Q 133 ? ILE Q 138 TYR Q 139 
AK9 2  TRP Q 262 ? ARG Q 263 ? TRP Q 268 ARG Q 269 
AL1 1  VAL Q 377 ? ILE Q 378 ? VAL Q 383 ILE Q 384 
AL1 2  LYS Q 360 ? ILE Q 361 ? LYS Q 366 ILE Q 367 
AL1 3  ARG Q 343 ? ALA Q 344 ? ARG Q 349 ALA Q 350 
AL1 4  ILE Q 327 ? SER Q 329 ? ILE Q 333 SER Q 335 
AL1 5  ALA Q 304 ? VAL Q 307 ? ALA Q 310 VAL Q 313 
AL1 6  VAL R 321 ? VAL R 322 ? VAL R 327 VAL R 328 
AL1 7  ALA R 332 ? LEU R 338 ? ALA R 338 LEU R 344 
AL1 8  ARG R 349 ? VAL R 355 ? ARG R 355 VAL R 361 
AL1 9  GLN R 366 ? ILE R 372 ? GLN R 372 ILE R 378 
AL1 10 ILE R 383 ? VAL R 384 ? ILE R 389 VAL R 390 
AL2 1  SER R 316 ? VAL R 318 ? SER R 322 VAL R 324 
AL2 2  ALA R 332 ? LEU R 338 ? ALA R 338 LEU R 344 
AL2 3  ARG R 349 ? VAL R 355 ? ARG R 355 VAL R 361 
AL2 4  GLN R 366 ? ILE R 372 ? GLN R 372 ILE R 378 
AL2 5  CYS R 403 ? ILE R 405 ? CYS R 409 ILE R 411 
AL2 6  ARG R 396 ? ARG R 397 ? ARG R 402 ARG R 403 
AL3 1  SER Q 316 ? VAL Q 318 ? SER Q 322 VAL Q 324 
AL3 2  ALA Q 332 ? ASN Q 334 ? ALA Q 338 ASN Q 340 
AL3 3  ARG Q 349 ? VAL Q 355 ? ARG Q 355 VAL Q 361 
AL3 4  GLN Q 366 ? ILE Q 372 ? GLN Q 372 ILE Q 378 
AL3 5  CYS Q 403 ? ILE Q 405 ? CYS Q 409 ILE Q 411 
AL3 6  ARG Q 396 ? ARG Q 397 ? ARG Q 402 ARG Q 403 
AL4 1  ILE Q 383 ? VAL Q 384 ? ILE Q 389 VAL Q 390 
AL4 2  GLN Q 366 ? ILE Q 372 ? GLN Q 372 ILE Q 378 
AL4 3  ARG Q 349 ? VAL Q 355 ? ARG Q 355 VAL Q 361 
AL4 4  LEU Q 337 ? LEU Q 338 ? LEU Q 343 LEU Q 344 
AL4 5  SER Q 320 ? VAL Q 322 ? SER Q 326 VAL Q 328 
AL4 6  ALA R 304 ? VAL R 307 ? ALA R 310 VAL R 313 
AL4 7  ILE R 327 ? SER R 329 ? ILE R 333 SER R 335 
AL4 8  ARG R 343 ? ALA R 344 ? ARG R 349 ALA R 350 
AL4 9  LYS R 360 ? ILE R 361 ? LYS R 366 ILE R 367 
AL4 10 VAL R 377 ? ILE R 378 ? VAL R 383 ILE R 384 
AL5 1  SER R 86  ? LEU R 90  ? SER R 92  LEU R 96  
AL5 2  ARG R 56  ? ALA R 60  ? ARG R 62  ALA R 66  
AL5 3  ALA R 8   ? LEU R 13  ? ALA R 14  LEU R 19  
AL5 4  TYR R 123 ? ALA R 128 ? TYR R 129 ALA R 134 
AL5 5  PHE R 196 ? HIS R 207 ? PHE R 202 HIS R 213 
AL5 6  GLY R 167 ? VAL R 171 ? GLY R 173 VAL R 177 
AL5 7  ILE R 177 ? GLU R 182 ? ILE R 183 GLU R 188 
AL6 1  SER R 86  ? LEU R 90  ? SER R 92  LEU R 96  
AL6 2  ARG R 56  ? ALA R 60  ? ARG R 62  ALA R 66  
AL6 3  ALA R 8   ? LEU R 13  ? ALA R 14  LEU R 19  
AL6 4  TYR R 123 ? ALA R 128 ? TYR R 129 ALA R 134 
AL6 5  PHE R 196 ? HIS R 207 ? PHE R 202 HIS R 213 
AL6 6  VAL R 151 ? PRO R 159 ? VAL R 157 PRO R 165 
AL6 7  ALA R 242 ? ARG R 246 ? ALA R 248 ARG R 252 
AL7 1  TYR R 34  ? PHE R 35  ? TYR R 40  PHE R 41  
AL7 2  ALA R 39  ? ARG R 40  ? ALA R 45  ARG R 46  
AL8 1  ILE R 132 ? TYR R 133 ? ILE R 138 TYR R 139 
AL8 2  TRP R 262 ? ARG R 263 ? TRP R 268 ARG R 269 
AL9 1  SER S 86  ? LEU S 90  ? SER Z 92  LEU Z 96  
AL9 2  ARG S 56  ? THR S 61  ? ARG Z 62  THR Z 67  
AL9 3  ALA S 8   ? ALA S 14  ? ALA Z 14  ALA Z 20  
AL9 4  TYR S 123 ? ALA S 128 ? TYR Z 129 ALA Z 134 
AL9 5  PHE S 196 ? HIS S 207 ? PHE Z 202 HIS Z 213 
AL9 6  GLY S 167 ? VAL S 171 ? GLY Z 173 VAL Z 177 
AL9 7  ILE S 177 ? GLU S 182 ? ILE Z 183 GLU Z 188 
AM1 1  SER S 86  ? LEU S 90  ? SER Z 92  LEU Z 96  
AM1 2  ARG S 56  ? THR S 61  ? ARG Z 62  THR Z 67  
AM1 3  ALA S 8   ? ALA S 14  ? ALA Z 14  ALA Z 20  
AM1 4  TYR S 123 ? ALA S 128 ? TYR Z 129 ALA Z 134 
AM1 5  PHE S 196 ? HIS S 207 ? PHE Z 202 HIS Z 213 
AM1 6  VAL S 151 ? PRO S 159 ? VAL Z 157 PRO Z 165 
AM1 7  ALA S 242 ? ARG S 246 ? ALA Z 248 ARG Z 252 
AM2 1  TYR S 34  ? PHE S 35  ? TYR Z 40  PHE Z 41  
AM2 2  ALA S 39  ? ARG S 40  ? ALA Z 45  ARG Z 46  
AM3 1  ILE S 132 ? TYR S 133 ? ILE Z 138 TYR Z 139 
AM3 2  TRP S 262 ? ARG S 263 ? TRP Z 268 ARG Z 269 
AM4 1  VAL S 377 ? ILE S 378 ? VAL Z 383 ILE Z 384 
AM4 2  LYS S 360 ? ILE S 361 ? LYS Z 366 ILE Z 367 
AM4 3  ARG S 343 ? ALA S 344 ? ARG Z 349 ALA Z 350 
AM4 4  ILE S 327 ? SER S 329 ? ILE Z 333 SER Z 335 
AM4 5  ALA S 304 ? VAL S 307 ? ALA Z 310 VAL Z 313 
AM4 6  SER T 320 ? VAL T 322 ? SER T 326 VAL T 328 
AM4 7  LEU T 337 ? LEU T 338 ? LEU T 343 LEU T 344 
AM4 8  ARG T 349 ? VAL T 355 ? ARG T 355 VAL T 361 
AM4 9  GLN T 366 ? ILE T 372 ? GLN T 372 ILE T 378 
AM4 10 ILE T 383 ? VAL T 384 ? ILE T 389 VAL T 390 
AM5 1  SER T 316 ? VAL T 318 ? SER T 322 VAL T 324 
AM5 2  ALA T 332 ? ASN T 334 ? ALA T 338 ASN T 340 
AM5 3  ARG T 349 ? VAL T 355 ? ARG T 355 VAL T 361 
AM5 4  GLN T 366 ? ILE T 372 ? GLN T 372 ILE T 378 
AM5 5  CYS T 403 ? ILE T 405 ? CYS T 409 ILE T 411 
AM5 6  ARG T 396 ? ARG T 397 ? ARG T 402 ARG T 403 
AM6 1  SER S 316 ? VAL S 318 ? SER Z 322 VAL Z 324 
AM6 2  ALA S 332 ? LEU S 338 ? ALA Z 338 LEU Z 344 
AM6 3  ARG S 349 ? VAL S 355 ? ARG Z 355 VAL Z 361 
AM6 4  GLN S 366 ? ILE S 372 ? GLN Z 372 ILE Z 378 
AM6 5  CYS S 403 ? ILE S 405 ? CYS Z 409 ILE Z 411 
AM6 6  ARG S 396 ? ARG S 397 ? ARG Z 402 ARG Z 403 
AM7 1  ILE S 383 ? VAL S 384 ? ILE Z 389 VAL Z 390 
AM7 2  GLN S 366 ? ILE S 372 ? GLN Z 372 ILE Z 378 
AM7 3  ARG S 349 ? VAL S 355 ? ARG Z 355 VAL Z 361 
AM7 4  ALA S 332 ? LEU S 338 ? ALA Z 338 LEU Z 344 
AM7 5  VAL S 321 ? VAL S 322 ? VAL Z 327 VAL Z 328 
AM7 6  ALA T 304 ? VAL T 307 ? ALA T 310 VAL T 313 
AM7 7  ILE T 327 ? SER T 329 ? ILE T 333 SER T 335 
AM7 8  ARG T 343 ? ALA T 344 ? ARG T 349 ALA T 350 
AM7 9  LYS T 360 ? ILE T 361 ? LYS T 366 ILE T 367 
AM7 10 VAL T 377 ? ILE T 378 ? VAL T 383 ILE T 384 
AM8 1  SER T 86  ? PRO T 91  ? SER T 92  PRO T 97  
AM8 2  ARG T 56  ? THR T 61  ? ARG T 62  THR T 67  
AM8 3  ALA T 8   ? LEU T 13  ? ALA T 14  LEU T 19  
AM8 4  TYR T 123 ? ALA T 128 ? TYR T 129 ALA T 134 
AM8 5  PHE T 196 ? HIS T 207 ? PHE T 202 HIS T 213 
AM8 6  GLY T 167 ? VAL T 171 ? GLY T 173 VAL T 177 
AM8 7  GLU T 176 ? GLU T 182 ? GLU T 182 GLU T 188 
AM8 8  ALA T 242 ? ARG T 246 ? ALA T 248 ARG T 252 
AM8 9  VAL T 151 ? PRO T 159 ? VAL T 157 PRO T 165 
AM8 10 PHE T 196 ? HIS T 207 ? PHE T 202 HIS T 213 
AM9 1  TYR T 34  ? PHE T 35  ? TYR T 40  PHE T 41  
AM9 2  ALA T 39  ? ARG T 40  ? ALA T 45  ARG T 46  
AN1 1  ILE T 132 ? TYR T 133 ? ILE T 138 TYR T 139 
AN1 2  TRP T 262 ? ARG T 263 ? TRP T 268 ARG T 269 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  O LEU A 90  ? O LEU A 96  N VAL A 59  ? N VAL A 65  
AA1 2 3  O GLY A 58  ? O GLY A 64  N VAL A 12  ? N VAL A 18  
AA1 3 4  N MET A 9   ? N MET A 15  O VAL A 125 ? O VAL A 131 
AA1 4 5  N ILE A 126 ? N ILE A 132 O TYR A 204 ? O TYR A 210 
AA1 5 6  O SER A 200 ? O SER A 206 N GLY A 167 ? N GLY A 173 
AA1 6 7  N HIS A 170 ? N HIS A 176 O ASP A 179 ? O ASP A 185 
AA2 1 2  O LEU A 90  ? O LEU A 96  N VAL A 59  ? N VAL A 65  
AA2 2 3  O GLY A 58  ? O GLY A 64  N VAL A 12  ? N VAL A 18  
AA2 3 4  N MET A 9   ? N MET A 15  O VAL A 125 ? O VAL A 131 
AA2 4 5  N ILE A 126 ? N ILE A 132 O TYR A 204 ? O TYR A 210 
AA2 5 6  O MET A 201 ? O MET A 207 N GLY A 154 ? N GLY A 160 
AA2 6 7  N ILE A 153 ? N ILE A 159 O HIS A 245 ? O HIS A 251 
AA3 1 2  N PHE A 35  ? N PHE A 41  O ALA A 39  ? O ALA A 45  
AA4 1 2  N ILE A 132 ? N ILE A 138 O ARG A 263 ? O ARG A 269 
AA5 1 2  O ILE A 378 ? O ILE A 384 N LYS A 360 ? N LYS A 366 
AA5 2 3  O ILE A 361 ? O ILE A 367 N ARG A 343 ? N ARG A 349 
AA5 3 4  O ALA A 344 ? O ALA A 350 N SER A 329 ? N SER A 335 
AA5 4 5  O ILE A 328 ? O ILE A 334 N LYS A 305 ? N LYS A 311 
AA5 5 6  N PHE A 306 ? N PHE A 312 O SER B 320 ? O SER B 326 
AA5 6 7  N VAL B 321 ? N VAL B 327 O LEU B 338 ? O LEU B 344 
AA5 7 8  N LEU B 337 ? N LEU B 343 O VAL B 355 ? O VAL B 361 
AA5 8 9  N VAL B 354 ? N VAL B 360 O VAL B 370 ? O VAL B 376 
AA5 9 10 N GLN B 366 ? N GLN B 372 O VAL B 384 ? O VAL B 390 
AA6 1 2  N SER B 316 ? N SER B 322 O LEU B 333 ? O LEU B 339 
AA6 2 3  N ALA B 332 ? N ALA B 338 O LEU B 350 ? O LEU B 356 
AA6 3 4  N VAL B 354 ? N VAL B 360 O VAL B 370 ? O VAL B 376 
AA6 4 5  N VAL B 371 ? N VAL B 377 O ILE B 405 ? O ILE B 411 
AA6 5 6  O LEU B 404 ? O LEU B 410 N ARG B 396 ? N ARG B 402 
AA7 1 2  N SER A 316 ? N SER A 322 O LEU A 333 ? O LEU A 339 
AA7 2 3  N ALA A 332 ? N ALA A 338 O LEU A 350 ? O LEU A 356 
AA7 3 4  N VAL A 354 ? N VAL A 360 O VAL A 370 ? O VAL A 376 
AA7 4 5  N VAL A 371 ? N VAL A 377 O ILE A 405 ? O ILE A 411 
AA7 5 6  O LEU A 404 ? O LEU A 410 N ARG A 396 ? N ARG A 402 
AA8 1 2  O VAL A 384 ? O VAL A 390 N GLN A 366 ? N GLN A 372 
AA8 2 3  O VAL A 370 ? O VAL A 376 N VAL A 354 ? N VAL A 360 
AA8 3 4  O VAL A 355 ? O VAL A 361 N LEU A 337 ? N LEU A 343 
AA8 4 5  O LEU A 338 ? O LEU A 344 N VAL A 321 ? N VAL A 327 
AA8 5 6  N SER A 320 ? N SER A 326 O PHE B 306 ? O PHE B 312 
AA8 6 7  N LYS B 305 ? N LYS B 311 O ILE B 328 ? O ILE B 334 
AA8 7 8  N SER B 329 ? N SER B 335 O ALA B 344 ? O ALA B 350 
AA8 8 9  N ARG B 343 ? N ARG B 349 O ILE B 361 ? O ILE B 367 
AA8 9 10 N LYS B 360 ? N LYS B 366 O ILE B 378 ? O ILE B 384 
AA9 1 2  O LEU B 90  ? O LEU B 96  N VAL B 59  ? N VAL B 65  
AA9 2 3  O GLY B 58  ? O GLY B 64  N VAL B 12  ? N VAL B 18  
AA9 3 4  N LEU B 13  ? N LEU B 19  O LEU B 127 ? O LEU B 133 
AA9 4 5  N ILE B 126 ? N ILE B 132 O TYR B 204 ? O TYR B 210 
AA9 5 6  O SER B 200 ? O SER B 206 N GLY B 167 ? N GLY B 173 
AA9 6 7  N VAL B 168 ? N VAL B 174 O ILE B 181 ? O ILE B 187 
AB1 1 2  O LEU B 90  ? O LEU B 96  N VAL B 59  ? N VAL B 65  
AB1 2 3  O GLY B 58  ? O GLY B 64  N VAL B 12  ? N VAL B 18  
AB1 3 4  N LEU B 13  ? N LEU B 19  O LEU B 127 ? O LEU B 133 
AB1 4 5  N ILE B 126 ? N ILE B 132 O TYR B 204 ? O TYR B 210 
AB1 5 6  O ALA B 199 ? O ALA B 205 N LEU B 156 ? N LEU B 162 
AB1 6 7  N ILE B 153 ? N ILE B 159 O HIS B 245 ? O HIS B 251 
AB2 1 2  N PHE B 35  ? N PHE B 41  O ALA B 39  ? O ALA B 45  
AB3 1 2  N ILE B 132 ? N ILE B 138 O ARG B 263 ? O ARG B 269 
AB4 1 2  O LEU C 90  ? O LEU C 96  N VAL C 59  ? N VAL C 65  
AB4 2 3  O GLY C 58  ? O GLY C 64  N VAL C 12  ? N VAL C 18  
AB4 3 4  N LEU C 13  ? N LEU C 19  O LEU C 127 ? O LEU C 133 
AB4 4 5  N ILE C 126 ? N ILE C 132 O TYR C 204 ? O TYR C 210 
AB4 5 6  O MET C 201 ? O MET C 207 N GLY C 154 ? N GLY C 160 
AB4 6 7  N ILE C 153 ? N ILE C 159 O HIS C 245 ? O HIS C 251 
AB5 1 2  N PHE C 35  ? N PHE C 41  O ALA C 39  ? O ALA C 45  
AB6 1 2  N ILE C 132 ? N ILE C 138 O ARG C 263 ? O ARG C 269 
AB7 1 2  N HIS C 170 ? N HIS C 176 O ASP C 179 ? O ASP C 185 
AB8 1 2  O ILE C 378 ? O ILE C 384 N LYS C 360 ? N LYS C 366 
AB8 2 3  O ILE C 361 ? O ILE C 367 N ARG C 343 ? N ARG C 349 
AB8 3 4  O ALA C 344 ? O ALA C 350 N SER C 329 ? N SER C 335 
AB8 4 5  O ILE C 328 ? O ILE C 334 N LYS C 305 ? N LYS C 311 
AB8 5 6  N ALA C 304 ? N ALA C 310 O VAL D 322 ? O VAL D 328 
AB8 6 7  N VAL D 321 ? N VAL D 327 O LEU D 338 ? O LEU D 344 
AB8 7 8  N LEU D 337 ? N LEU D 343 O VAL D 355 ? O VAL D 361 
AB8 8 9  N ARG D 349 ? N ARG D 355 O LEU D 367 ? O LEU D 373 
AB8 9 10 N GLN D 366 ? N GLN D 372 O VAL D 384 ? O VAL D 390 
AB9 1 2  N SER D 316 ? N SER D 322 O LEU D 333 ? O LEU D 339 
AB9 2 3  N ALA D 332 ? N ALA D 338 O LEU D 350 ? O LEU D 356 
AB9 3 4  N ARG D 349 ? N ARG D 355 O LEU D 367 ? O LEU D 373 
AB9 4 5  N VAL D 371 ? N VAL D 377 O CYS D 403 ? O CYS D 409 
AB9 5 6  O LEU D 404 ? O LEU D 410 N ARG D 396 ? N ARG D 402 
AC1 1 2  N SER C 316 ? N SER C 322 O LEU C 333 ? O LEU C 339 
AC1 2 3  N ALA C 332 ? N ALA C 338 O LEU C 350 ? O LEU C 356 
AC1 3 4  N VAL C 354 ? N VAL C 360 O ILE C 372 ? O ILE C 378 
AC1 4 5  N VAL C 371 ? N VAL C 377 O ILE C 405 ? O ILE C 411 
AC1 5 6  O LEU C 404 ? O LEU C 410 N ARG C 396 ? N ARG C 402 
AC2 1 2  O VAL C 384 ? O VAL C 390 N GLN C 366 ? N GLN C 372 
AC2 2 3  O ILE C 372 ? O ILE C 378 N VAL C 354 ? N VAL C 360 
AC2 3 4  O VAL C 355 ? O VAL C 361 N LEU C 337 ? N LEU C 343 
AC2 4 5  O LEU C 338 ? O LEU C 344 N VAL C 321 ? N VAL C 327 
AC2 5 6  N SER C 320 ? N SER C 326 O PHE D 306 ? O PHE D 312 
AC2 6 7  N LYS D 305 ? N LYS D 311 O ILE D 328 ? O ILE D 334 
AC2 7 8  N SER D 329 ? N SER D 335 O ALA D 344 ? O ALA D 350 
AC2 8 9  N ARG D 343 ? N ARG D 349 O ILE D 361 ? O ILE D 367 
AC2 9 10 N LYS D 360 ? N LYS D 366 O ILE D 378 ? O ILE D 384 
AC3 1 2  O LEU D 90  ? O LEU D 96  N VAL D 59  ? N VAL D 65  
AC3 2 3  O GLY D 58  ? O GLY D 64  N VAL D 12  ? N VAL D 18  
AC3 3 4  N LEU D 13  ? N LEU D 19  O LEU D 127 ? O LEU D 133 
AC3 4 5  N ILE D 126 ? N ILE D 132 O TYR D 204 ? O TYR D 210 
AC3 5 6  O SER D 200 ? O SER D 206 N GLY D 167 ? N GLY D 173 
AC3 6 7  N HIS D 170 ? N HIS D 176 O ASP D 179 ? O ASP D 185 
AC4 1 2  O LEU D 90  ? O LEU D 96  N VAL D 59  ? N VAL D 65  
AC4 2 3  O GLY D 58  ? O GLY D 64  N VAL D 12  ? N VAL D 18  
AC4 3 4  N LEU D 13  ? N LEU D 19  O LEU D 127 ? O LEU D 133 
AC4 4 5  N ILE D 126 ? N ILE D 132 O TYR D 204 ? O TYR D 210 
AC4 5 6  O ALA D 197 ? O ALA D 203 N VAL D 158 ? N VAL D 164 
AC4 6 7  N ILE D 153 ? N ILE D 159 O HIS D 245 ? O HIS D 251 
AC5 1 2  N PHE D 35  ? N PHE D 41  O ALA D 39  ? O ALA D 45  
AC6 1 2  N ILE D 132 ? N ILE D 138 O ARG D 263 ? O ARG D 269 
AC7 1 2  O LEU E 90  ? O LEU E 96  N VAL E 59  ? N VAL E 65  
AC7 2 3  O ARG E 56  ? O ARG E 62  N ALA E 10  ? N ALA E 16  
AC7 3 4  N LEU E 13  ? N LEU E 19  O LEU E 127 ? O LEU E 133 
AC7 4 5  N ILE E 126 ? N ILE E 132 O TYR E 204 ? O TYR E 210 
AC7 5 6  O LEU E 198 ? O LEU E 204 N MET E 169 ? N MET E 175 
AC7 6 7  N VAL E 168 ? N VAL E 174 O ILE E 181 ? O ILE E 187 
AC8 1 2  O LEU E 90  ? O LEU E 96  N VAL E 59  ? N VAL E 65  
AC8 2 3  O ARG E 56  ? O ARG E 62  N ALA E 10  ? N ALA E 16  
AC8 3 4  N LEU E 13  ? N LEU E 19  O LEU E 127 ? O LEU E 133 
AC8 4 5  N ILE E 126 ? N ILE E 132 O TYR E 204 ? O TYR E 210 
AC8 5 6  O ALA E 197 ? O ALA E 203 N VAL E 158 ? N VAL E 164 
AC8 6 7  N ILE E 153 ? N ILE E 159 O VAL E 243 ? O VAL E 249 
AC9 1 2  N PHE E 35  ? N PHE E 41  O ALA E 39  ? O ALA E 45  
AD1 1 2  N ILE E 132 ? N ILE E 138 O ARG E 263 ? O ARG E 269 
AD2 1 2  O ILE E 378 ? O ILE E 384 N LYS E 360 ? N LYS E 366 
AD2 2 3  O ILE E 361 ? O ILE E 367 N ARG E 343 ? N ARG E 349 
AD2 3 4  O ALA E 344 ? O ALA E 350 N SER E 329 ? N SER E 335 
AD2 4 5  O ILE E 328 ? O ILE E 334 N LYS E 305 ? N LYS E 311 
AD2 5 6  N ALA E 304 ? N ALA E 310 O VAL F 322 ? O VAL F 328 
AD2 6 7  N VAL F 321 ? N VAL F 327 O LEU F 338 ? O LEU F 344 
AD2 7 8  N LEU F 337 ? N LEU F 343 O VAL F 355 ? O VAL F 361 
AD2 8 9  N VAL F 354 ? N VAL F 360 O VAL F 370 ? O VAL F 376 
AD2 9 10 N GLN F 366 ? N GLN F 372 O VAL F 384 ? O VAL F 390 
AD3 1 2  N VAL F 318 ? N VAL F 324 O LEU F 333 ? O LEU F 339 
AD3 2 3  N ALA F 332 ? N ALA F 338 O LEU F 350 ? O LEU F 356 
AD3 3 4  N VAL F 354 ? N VAL F 360 O VAL F 370 ? O VAL F 376 
AD3 4 5  N VAL F 371 ? N VAL F 377 O ILE F 405 ? O ILE F 411 
AD3 5 6  O LEU F 404 ? O LEU F 410 N ARG F 396 ? N ARG F 402 
AD4 1 2  N SER E 316 ? N SER E 322 O LEU E 333 ? O LEU E 339 
AD4 2 3  N ALA E 332 ? N ALA E 338 O LEU E 350 ? O LEU E 356 
AD4 3 4  N VAL E 354 ? N VAL E 360 O ILE E 372 ? O ILE E 378 
AD4 4 5  N VAL E 371 ? N VAL E 377 O ILE E 405 ? O ILE E 411 
AD4 5 6  O LEU E 404 ? O LEU E 410 N ARG E 396 ? N ARG E 402 
AD5 1 2  O VAL E 384 ? O VAL E 390 N GLN E 366 ? N GLN E 372 
AD5 2 3  O ILE E 372 ? O ILE E 378 N VAL E 354 ? N VAL E 360 
AD5 3 4  O VAL E 355 ? O VAL E 361 N LEU E 337 ? N LEU E 343 
AD5 4 5  O LEU E 338 ? O LEU E 344 N VAL E 321 ? N VAL E 327 
AD5 5 6  N SER E 320 ? N SER E 326 O PHE F 306 ? O PHE F 312 
AD5 6 7  N LYS F 305 ? N LYS F 311 O ILE F 328 ? O ILE F 334 
AD5 7 8  N SER F 329 ? N SER F 335 O ALA F 344 ? O ALA F 350 
AD5 8 9  N ARG F 343 ? N ARG F 349 O ILE F 361 ? O ILE F 367 
AD5 9 10 N LYS F 360 ? N LYS F 366 O ILE F 378 ? O ILE F 384 
AD6 1 2  O LEU F 90  ? O LEU F 96  N VAL F 59  ? N VAL F 65  
AD6 2 3  O GLY F 58  ? O GLY F 64  N VAL F 12  ? N VAL F 18  
AD6 3 4  N TYR F 11  ? N TYR F 17  O VAL F 125 ? O VAL F 131 
AD6 4 5  N ILE F 126 ? N ILE F 132 O TYR F 204 ? O TYR F 210 
AD6 5 6  O LEU F 198 ? O LEU F 204 N MET F 169 ? N MET F 175 
AD6 6 7  N HIS F 170 ? N HIS F 176 O ASP F 179 ? O ASP F 185 
AD7 1 2  O LEU F 90  ? O LEU F 96  N VAL F 59  ? N VAL F 65  
AD7 2 3  O GLY F 58  ? O GLY F 64  N VAL F 12  ? N VAL F 18  
AD7 3 4  N TYR F 11  ? N TYR F 17  O VAL F 125 ? O VAL F 131 
AD7 4 5  N ILE F 126 ? N ILE F 132 O TYR F 204 ? O TYR F 210 
AD7 5 6  O ALA F 199 ? O ALA F 205 N LEU F 156 ? N LEU F 162 
AD7 6 7  N ILE F 153 ? N ILE F 159 O HIS F 245 ? O HIS F 251 
AD8 1 2  N PHE F 35  ? N PHE F 41  O ALA F 39  ? O ALA F 45  
AD9 1 2  N ILE F 132 ? N ILE F 138 O ARG F 263 ? O ARG F 269 
AE1 1 2  O LEU G 90  ? O LEU G 96  N VAL G 59  ? N VAL G 65  
AE1 2 3  O GLY G 58  ? O GLY G 64  N VAL G 12  ? N VAL G 18  
AE1 3 4  N LEU G 13  ? N LEU G 19  O LEU G 127 ? O LEU G 133 
AE1 4 5  N ILE G 126 ? N ILE G 132 O TYR G 204 ? O TYR G 210 
AE1 5 6  O SER G 200 ? O SER G 206 N GLY G 167 ? N GLY G 173 
AE1 6 7  N HIS G 170 ? N HIS G 176 O ASP G 179 ? O ASP G 185 
AE2 1 2  O LEU G 90  ? O LEU G 96  N VAL G 59  ? N VAL G 65  
AE2 2 3  O GLY G 58  ? O GLY G 64  N VAL G 12  ? N VAL G 18  
AE2 3 4  N LEU G 13  ? N LEU G 19  O LEU G 127 ? O LEU G 133 
AE2 4 5  N ILE G 126 ? N ILE G 132 O TYR G 204 ? O TYR G 210 
AE2 5 6  O ALA G 199 ? O ALA G 205 N LEU G 156 ? N LEU G 162 
AE2 6 7  N ILE G 153 ? N ILE G 159 O HIS G 245 ? O HIS G 251 
AE3 1 2  N PHE G 35  ? N PHE G 41  O ALA G 39  ? O ALA G 45  
AE4 1 2  N ILE G 132 ? N ILE G 138 O ARG G 263 ? O ARG G 269 
AE5 1 2  O ILE G 378 ? O ILE G 384 N LYS G 360 ? N LYS G 366 
AE5 2 3  O ILE G 361 ? O ILE G 367 N ARG G 343 ? N ARG G 349 
AE5 3 4  O ALA G 344 ? O ALA G 350 N SER G 329 ? N SER G 335 
AE5 4 5  O ILE G 328 ? O ILE G 334 N LYS G 305 ? N LYS G 311 
AE5 5 6  N PHE G 306 ? N PHE G 312 O SER H 320 ? O SER H 326 
AE5 6 7  N VAL H 321 ? N VAL H 327 O LEU H 338 ? O LEU H 344 
AE5 7 8  N LEU H 337 ? N LEU H 343 O VAL H 355 ? O VAL H 361 
AE5 8 9  N VAL H 354 ? N VAL H 360 O ILE H 372 ? O ILE H 378 
AE5 9 10 N GLN H 366 ? N GLN H 372 O VAL H 384 ? O VAL H 390 
AE6 1 2  N SER H 316 ? N SER H 322 O LEU H 333 ? O LEU H 339 
AE6 2 3  N ALA H 332 ? N ALA H 338 O LEU H 350 ? O LEU H 356 
AE6 3 4  N VAL H 354 ? N VAL H 360 O ILE H 372 ? O ILE H 378 
AE6 4 5  N VAL H 371 ? N VAL H 377 O ILE H 405 ? O ILE H 411 
AE6 5 6  O LEU H 404 ? O LEU H 410 N ARG H 396 ? N ARG H 402 
AE7 1 2  N SER G 316 ? N SER G 322 O LEU G 333 ? O LEU G 339 
AE7 2 3  N ALA G 332 ? N ALA G 338 O LEU G 350 ? O LEU G 356 
AE7 3 4  N VAL G 354 ? N VAL G 360 O ILE G 372 ? O ILE G 378 
AE7 4 5  N VAL G 371 ? N VAL G 377 O ILE G 405 ? O ILE G 411 
AE7 5 6  O LEU G 404 ? O LEU G 410 N ARG G 396 ? N ARG G 402 
AE8 1 2  O VAL G 384 ? O VAL G 390 N GLN G 366 ? N GLN G 372 
AE8 2 3  O ILE G 372 ? O ILE G 378 N VAL G 354 ? N VAL G 360 
AE8 3 4  O VAL G 355 ? O VAL G 361 N LEU G 337 ? N LEU G 343 
AE8 4 5  O LEU G 338 ? O LEU G 344 N VAL G 321 ? N VAL G 327 
AE8 5 6  N SER G 320 ? N SER G 326 O PHE H 306 ? O PHE H 312 
AE8 6 7  N LYS H 305 ? N LYS H 311 O ILE H 328 ? O ILE H 334 
AE8 7 8  N SER H 329 ? N SER H 335 O ALA H 344 ? O ALA H 350 
AE8 8 9  N ARG H 343 ? N ARG H 349 O ILE H 361 ? O ILE H 367 
AE8 9 10 N LYS H 360 ? N LYS H 366 O ILE H 378 ? O ILE H 384 
AE9 1 2  O LEU H 90  ? O LEU H 96  N VAL H 59  ? N VAL H 65  
AE9 2 3  O GLY H 58  ? O GLY H 64  N VAL H 12  ? N VAL H 18  
AE9 3 4  N LEU H 13  ? N LEU H 19  O LEU H 127 ? O LEU H 133 
AE9 4 5  N ILE H 126 ? N ILE H 132 O TYR H 204 ? O TYR H 210 
AE9 5 6  O SER H 200 ? O SER H 206 N GLY H 167 ? N GLY H 173 
AE9 6 7  N HIS H 170 ? N HIS H 176 O ILE H 178 ? O ILE H 184 
AF1 1 2  O LEU H 90  ? O LEU H 96  N VAL H 59  ? N VAL H 65  
AF1 2 3  O GLY H 58  ? O GLY H 64  N VAL H 12  ? N VAL H 18  
AF1 3 4  N LEU H 13  ? N LEU H 19  O LEU H 127 ? O LEU H 133 
AF1 4 5  N ILE H 126 ? N ILE H 132 O TYR H 204 ? O TYR H 210 
AF1 5 6  O ALA H 199 ? O ALA H 205 N LEU H 156 ? N LEU H 162 
AF1 6 7  N ILE H 153 ? N ILE H 159 O HIS H 245 ? O HIS H 251 
AF2 1 2  N PHE H 35  ? N PHE H 41  O ALA H 39  ? O ALA H 45  
AF3 1 2  N ILE H 132 ? N ILE H 138 O ARG H 263 ? O ARG H 269 
AF4 1 2  O LEU I 90  ? O LEU I 96  N VAL I 59  ? N VAL I 65  
AF4 2 3  O GLY I 58  ? O GLY I 64  N VAL I 12  ? N VAL I 18  
AF4 3 4  N LEU I 13  ? N LEU I 19  O LEU I 127 ? O LEU I 133 
AF4 4 5  N ILE I 126 ? N ILE I 132 O TYR I 204 ? O TYR I 210 
AF4 5 6  O SER I 200 ? O SER I 206 N GLY I 167 ? N GLY I 173 
AF4 6 7  N HIS I 170 ? N HIS I 176 O ASP I 179 ? O ASP I 185 
AF5 1 2  O LEU I 90  ? O LEU I 96  N VAL I 59  ? N VAL I 65  
AF5 2 3  O GLY I 58  ? O GLY I 64  N VAL I 12  ? N VAL I 18  
AF5 3 4  N LEU I 13  ? N LEU I 19  O LEU I 127 ? O LEU I 133 
AF5 4 5  N ILE I 126 ? N ILE I 132 O TYR I 204 ? O TYR I 210 
AF5 5 6  O ALA I 197 ? O ALA I 203 N VAL I 158 ? N VAL I 164 
AF5 6 7  N ILE I 153 ? N ILE I 159 O HIS I 245 ? O HIS I 251 
AF6 1 2  N PHE I 35  ? N PHE I 41  O ALA I 39  ? O ALA I 45  
AF7 1 2  N ILE I 132 ? N ILE I 138 O ARG I 263 ? O ARG I 269 
AF8 1 2  O ILE I 378 ? O ILE I 384 N LYS I 360 ? N LYS I 366 
AF8 2 3  O ILE I 361 ? O ILE I 367 N ARG I 343 ? N ARG I 349 
AF8 3 4  O ALA I 344 ? O ALA I 350 N SER I 329 ? N SER I 335 
AF8 4 5  O ILE I 328 ? O ILE I 334 N LYS I 305 ? N LYS I 311 
AF8 5 6  N PHE I 306 ? N PHE I 312 O SER J 320 ? O SER J 326 
AF8 6 7  N VAL J 321 ? N VAL J 327 O LEU J 338 ? O LEU J 344 
AF8 7 8  N LEU J 337 ? N LEU J 343 O VAL J 355 ? O VAL J 361 
AF8 8 9  N ARG J 349 ? N ARG J 355 O LEU J 367 ? O LEU J 373 
AF8 9 10 N GLN J 366 ? N GLN J 372 O VAL J 384 ? O VAL J 390 
AF9 1 2  N SER J 316 ? N SER J 322 O LEU J 333 ? O LEU J 339 
AF9 2 3  N ALA J 332 ? N ALA J 338 O LEU J 350 ? O LEU J 356 
AF9 3 4  N ARG J 349 ? N ARG J 355 O LEU J 367 ? O LEU J 373 
AF9 4 5  N VAL J 371 ? N VAL J 377 O ILE J 405 ? O ILE J 411 
AF9 5 6  O LEU J 404 ? O LEU J 410 N ARG J 396 ? N ARG J 402 
AG1 1 2  N SER I 316 ? N SER I 322 O LEU I 333 ? O LEU I 339 
AG1 2 3  N ALA I 332 ? N ALA I 338 O LEU I 350 ? O LEU I 356 
AG1 3 4  N VAL I 354 ? N VAL I 360 O ILE I 372 ? O ILE I 378 
AG1 4 5  N VAL I 371 ? N VAL I 377 O ILE I 405 ? O ILE I 411 
AG1 5 6  O LEU I 404 ? O LEU I 410 N ARG I 396 ? N ARG I 402 
AG2 1 2  O VAL I 384 ? O VAL I 390 N GLN I 366 ? N GLN I 372 
AG2 2 3  O ILE I 372 ? O ILE I 378 N VAL I 354 ? N VAL I 360 
AG2 3 4  O VAL I 355 ? O VAL I 361 N LEU I 337 ? N LEU I 343 
AG2 4 5  O LEU I 338 ? O LEU I 344 N VAL I 321 ? N VAL I 327 
AG2 5 6  N SER I 320 ? N SER I 326 O PHE J 306 ? O PHE J 312 
AG2 6 7  N LYS J 305 ? N LYS J 311 O ILE J 328 ? O ILE J 334 
AG2 7 8  N SER J 329 ? N SER J 335 O ALA J 344 ? O ALA J 350 
AG2 8 9  N ARG J 343 ? N ARG J 349 O ILE J 361 ? O ILE J 367 
AG2 9 10 N LYS J 360 ? N LYS J 366 O ILE J 378 ? O ILE J 384 
AG3 1 2  O LEU J 90  ? O LEU J 96  N VAL J 59  ? N VAL J 65  
AG3 2 3  O GLY J 58  ? O GLY J 64  N VAL J 12  ? N VAL J 18  
AG3 3 4  N TYR J 11  ? N TYR J 17  O VAL J 125 ? O VAL J 131 
AG3 4 5  N MET J 124 ? N MET J 130 O PHE J 206 ? O PHE J 212 
AG3 5 6  O SER J 200 ? O SER J 206 N GLY J 167 ? N GLY J 173 
AG3 6 7  N HIS J 170 ? N HIS J 176 O ASP J 179 ? O ASP J 185 
AG4 1 2  O LEU J 90  ? O LEU J 96  N VAL J 59  ? N VAL J 65  
AG4 2 3  O GLY J 58  ? O GLY J 64  N VAL J 12  ? N VAL J 18  
AG4 3 4  N TYR J 11  ? N TYR J 17  O VAL J 125 ? O VAL J 131 
AG4 4 5  N MET J 124 ? N MET J 130 O PHE J 206 ? O PHE J 212 
AG4 5 6  O ALA J 197 ? O ALA J 203 N VAL J 158 ? N VAL J 164 
AG4 6 7  N ILE J 153 ? N ILE J 159 O HIS J 245 ? O HIS J 251 
AG5 1 2  N PHE J 35  ? N PHE J 41  O ALA J 39  ? O ALA J 45  
AG6 1 2  N ILE J 132 ? N ILE J 138 O ARG J 263 ? O ARG J 269 
AG7 1 2  O LEU K 90  ? O LEU K 96  N VAL K 59  ? N VAL K 65  
AG7 2 3  O GLY K 58  ? O GLY K 64  N VAL K 12  ? N VAL K 18  
AG7 3 4  N TYR K 11  ? N TYR K 17  O VAL K 125 ? O VAL K 131 
AG7 4 5  N ILE K 126 ? N ILE K 132 O TYR K 204 ? O TYR K 210 
AG7 5 6  O LEU K 198 ? O LEU K 204 N MET K 169 ? N MET K 175 
AG7 6 7  N HIS K 170 ? N HIS K 176 O ASP K 179 ? O ASP K 185 
AG8 1 2  O LEU K 90  ? O LEU K 96  N VAL K 59  ? N VAL K 65  
AG8 2 3  O GLY K 58  ? O GLY K 64  N VAL K 12  ? N VAL K 18  
AG8 3 4  N TYR K 11  ? N TYR K 17  O VAL K 125 ? O VAL K 131 
AG8 4 5  N ILE K 126 ? N ILE K 132 O TYR K 204 ? O TYR K 210 
AG8 5 6  O MET K 201 ? O MET K 207 N GLY K 154 ? N GLY K 160 
AG8 6 7  N ILE K 153 ? N ILE K 159 O VAL K 243 ? O VAL K 249 
AG9 1 2  N PHE K 35  ? N PHE K 41  O ALA K 39  ? O ALA K 45  
AH1 1 2  N ILE K 132 ? N ILE K 138 O ARG K 263 ? O ARG K 269 
AH2 1 2  O ILE K 378 ? O ILE K 384 N LYS K 360 ? N LYS K 366 
AH2 2 3  O ILE K 361 ? O ILE K 367 N ARG K 343 ? N ARG K 349 
AH2 3 4  O ALA K 344 ? O ALA K 350 N SER K 329 ? N SER K 335 
AH2 4 5  O ILE K 328 ? O ILE K 334 N LYS K 305 ? N LYS K 311 
AH2 5 6  N PHE K 306 ? N PHE K 312 O SER L 320 ? O SER L 326 
AH2 6 7  N VAL L 321 ? N VAL L 327 O LEU L 338 ? O LEU L 344 
AH2 7 8  N LEU L 337 ? N LEU L 343 O VAL L 355 ? O VAL L 361 
AH2 8 9  N VAL L 354 ? N VAL L 360 O ILE L 372 ? O ILE L 378 
AH2 9 10 N SER L 368 ? N SER L 374 O VAL L 384 ? O VAL L 390 
AH3 1 2  N VAL L 318 ? N VAL L 324 O LEU L 333 ? O LEU L 339 
AH3 2 3  N ASN L 334 ? N ASN L 340 O LEU L 350 ? O LEU L 356 
AH3 3 4  N VAL L 354 ? N VAL L 360 O ILE L 372 ? O ILE L 378 
AH3 4 5  N VAL L 371 ? N VAL L 377 O ILE L 405 ? O ILE L 411 
AH3 5 6  O LEU L 404 ? O LEU L 410 N ARG L 396 ? N ARG L 402 
AH4 1 2  N SER K 316 ? N SER K 322 O LEU K 333 ? O LEU K 339 
AH4 2 3  N LEU K 337 ? N LEU K 343 O VAL K 355 ? O VAL K 361 
AH4 3 4  N VAL K 354 ? N VAL K 360 O ILE K 372 ? O ILE K 378 
AH4 4 5  N VAL K 371 ? N VAL K 377 O ILE K 405 ? O ILE K 411 
AH4 5 6  O LEU K 404 ? O LEU K 410 N ARG K 396 ? N ARG K 402 
AH5 1 2  O VAL K 384 ? O VAL K 390 N SER K 368 ? N SER K 374 
AH5 2 3  O ILE K 372 ? O ILE K 378 N VAL K 354 ? N VAL K 360 
AH5 3 4  O VAL K 355 ? O VAL K 361 N LEU K 337 ? N LEU K 343 
AH5 4 5  O LEU K 338 ? O LEU K 344 N VAL K 321 ? N VAL K 327 
AH5 5 6  N SER K 320 ? N SER K 326 O PHE L 306 ? O PHE L 312 
AH5 6 7  N LYS L 305 ? N LYS L 311 O ILE L 328 ? O ILE L 334 
AH5 7 8  N SER L 329 ? N SER L 335 O ALA L 344 ? O ALA L 350 
AH5 8 9  N ARG L 343 ? N ARG L 349 O ILE L 361 ? O ILE L 367 
AH5 9 10 N LYS L 360 ? N LYS L 366 O ILE L 378 ? O ILE L 384 
AH6 1 2  O LEU L 90  ? O LEU L 96  N VAL L 59  ? N VAL L 65  
AH6 2 3  O GLY L 58  ? O GLY L 64  N VAL L 12  ? N VAL L 18  
AH6 3 4  N LEU L 13  ? N LEU L 19  O LEU L 127 ? O LEU L 133 
AH6 4 5  N ILE L 126 ? N ILE L 132 O TYR L 204 ? O TYR L 210 
AH6 5 6  O SER L 200 ? O SER L 206 N GLY L 167 ? N GLY L 173 
AH6 6 7  N HIS L 170 ? N HIS L 176 O ASP L 179 ? O ASP L 185 
AH7 1 2  O LEU L 90  ? O LEU L 96  N VAL L 59  ? N VAL L 65  
AH7 2 3  O GLY L 58  ? O GLY L 64  N VAL L 12  ? N VAL L 18  
AH7 3 4  N LEU L 13  ? N LEU L 19  O LEU L 127 ? O LEU L 133 
AH7 4 5  N ILE L 126 ? N ILE L 132 O TYR L 204 ? O TYR L 210 
AH7 5 6  O ALA L 197 ? O ALA L 203 N VAL L 158 ? N VAL L 164 
AH7 6 7  N ILE L 153 ? N ILE L 159 O VAL L 243 ? O VAL L 249 
AH8 1 2  N PHE L 35  ? N PHE L 41  O ALA L 39  ? O ALA L 45  
AH9 1 2  N ILE L 132 ? N ILE L 138 O ARG L 263 ? O ARG L 269 
AI1 1 2  O LEU M 90  ? O LEU M 96  N VAL M 59  ? N VAL M 65  
AI1 2 3  O GLY M 58  ? O GLY M 64  N VAL M 12  ? N VAL M 18  
AI1 3 4  N TYR M 11  ? N TYR M 17  O VAL M 125 ? O VAL M 131 
AI1 4 5  N ILE M 126 ? N ILE M 132 O TYR M 204 ? O TYR M 210 
AI1 5 6  O SER M 200 ? O SER M 206 N GLY M 167 ? N GLY M 173 
AI1 6 7  N HIS M 170 ? N HIS M 176 O ASP M 179 ? O ASP M 185 
AI2 1 2  O LEU M 90  ? O LEU M 96  N VAL M 59  ? N VAL M 65  
AI2 2 3  O GLY M 58  ? O GLY M 64  N VAL M 12  ? N VAL M 18  
AI2 3 4  N TYR M 11  ? N TYR M 17  O VAL M 125 ? O VAL M 131 
AI2 4 5  N ILE M 126 ? N ILE M 132 O TYR M 204 ? O TYR M 210 
AI2 5 6  O MET M 201 ? O MET M 207 N GLY M 154 ? N GLY M 160 
AI2 6 7  N ILE M 153 ? N ILE M 159 O HIS M 245 ? O HIS M 251 
AI3 1 2  N PHE M 35  ? N PHE M 41  O ALA M 39  ? O ALA M 45  
AI4 1 2  N ILE M 132 ? N ILE M 138 O ARG M 263 ? O ARG M 269 
AI5 1 2  O ILE M 378 ? O ILE M 384 N LYS M 360 ? N LYS M 366 
AI5 2 3  O ILE M 361 ? O ILE M 367 N ARG M 343 ? N ARG M 349 
AI5 3 4  O ALA M 344 ? O ALA M 350 N SER M 329 ? N SER M 335 
AI5 4 5  O ILE M 328 ? O ILE M 334 N LYS M 305 ? N LYS M 311 
AI5 5 6  N PHE M 306 ? N PHE M 312 O SER N 320 ? O SER N 326 
AI5 6 7  N VAL N 321 ? N VAL N 327 O LEU N 338 ? O LEU N 344 
AI5 7 8  N LEU N 337 ? N LEU N 343 O VAL N 355 ? O VAL N 361 
AI5 8 9  N VAL N 354 ? N VAL N 360 O ILE N 372 ? O ILE N 378 
AI5 9 10 N GLN N 366 ? N GLN N 372 O VAL N 384 ? O VAL N 390 
AI6 1 2  N SER N 316 ? N SER N 322 O LEU N 333 ? O LEU N 339 
AI6 2 3  N ALA N 332 ? N ALA N 338 O LEU N 350 ? O LEU N 356 
AI6 3 4  N VAL N 354 ? N VAL N 360 O ILE N 372 ? O ILE N 378 
AI6 4 5  N VAL N 371 ? N VAL N 377 O ILE N 405 ? O ILE N 411 
AI6 5 6  O LEU N 404 ? O LEU N 410 N ARG N 396 ? N ARG N 402 
AI7 1 2  N SER M 316 ? N SER M 322 O LEU M 333 ? O LEU M 339 
AI7 2 3  N ALA M 332 ? N ALA M 338 O LEU M 350 ? O LEU M 356 
AI7 3 4  N VAL M 354 ? N VAL M 360 O VAL M 370 ? O VAL M 376 
AI7 4 5  N VAL M 371 ? N VAL M 377 O ILE M 405 ? O ILE M 411 
AI7 5 6  O LEU M 404 ? O LEU M 410 N ARG M 396 ? N ARG M 402 
AI8 1 2  O VAL M 384 ? O VAL M 390 N GLN M 366 ? N GLN M 372 
AI8 2 3  O VAL M 370 ? O VAL M 376 N VAL M 354 ? N VAL M 360 
AI8 3 4  O VAL M 355 ? O VAL M 361 N LEU M 337 ? N LEU M 343 
AI8 4 5  O LEU M 338 ? O LEU M 344 N VAL M 321 ? N VAL M 327 
AI8 5 6  N VAL M 322 ? N VAL M 328 O ALA N 304 ? O ALA N 310 
AI8 6 7  N LYS N 305 ? N LYS N 311 O ILE N 328 ? O ILE N 334 
AI8 7 8  N SER N 329 ? N SER N 335 O ALA N 344 ? O ALA N 350 
AI8 8 9  N ARG N 343 ? N ARG N 349 O ILE N 361 ? O ILE N 367 
AI8 9 10 N LYS N 360 ? N LYS N 366 O ILE N 378 ? O ILE N 384 
AI9 1 2  O ASP N 88  ? O ASP N 94  N ILE N 57  ? N ILE N 63  
AI9 2 3  O GLY N 58  ? O GLY N 64  N VAL N 12  ? N VAL N 18  
AI9 3 4  N LEU N 13  ? N LEU N 19  O LEU N 127 ? O LEU N 133 
AI9 4 5  N ILE N 126 ? N ILE N 132 O TYR N 204 ? O TYR N 210 
AI9 5 6  O LEU N 198 ? O LEU N 204 N MET N 169 ? N MET N 175 
AI9 6 7  N VAL N 168 ? N VAL N 174 O ILE N 181 ? O ILE N 187 
AI9 7 8  N ILE N 177 ? N ILE N 183 O ALA N 242 ? O ALA N 248 
AI9 8 9  O HIS N 245 ? O HIS N 251 N ILE N 153 ? N ILE N 159 
AI9 9 10 N VAL N 158 ? N VAL N 164 O ALA N 197 ? O ALA N 203 
AJ1 1 2  N PHE N 35  ? N PHE N 41  O ALA N 39  ? O ALA N 45  
AJ2 1 2  N ILE N 132 ? N ILE N 138 O ARG N 263 ? O ARG N 269 
AJ3 1 2  O LEU O 90  ? O LEU O 96  N VAL O 59  ? N VAL O 65  
AJ3 2 3  O GLY O 58  ? O GLY O 64  N VAL O 12  ? N VAL O 18  
AJ3 3 4  N LEU O 13  ? N LEU O 19  O LEU O 127 ? O LEU O 133 
AJ3 4 5  N ILE O 126 ? N ILE O 132 O TYR O 204 ? O TYR O 210 
AJ3 5 6  O SER O 200 ? O SER O 206 N GLY O 167 ? N GLY O 173 
AJ3 6 7  N HIS O 170 ? N HIS O 176 O ASP O 179 ? O ASP O 185 
AJ4 1 2  O LEU O 90  ? O LEU O 96  N VAL O 59  ? N VAL O 65  
AJ4 2 3  O GLY O 58  ? O GLY O 64  N VAL O 12  ? N VAL O 18  
AJ4 3 4  N LEU O 13  ? N LEU O 19  O LEU O 127 ? O LEU O 133 
AJ4 4 5  N ILE O 126 ? N ILE O 132 O TYR O 204 ? O TYR O 210 
AJ4 5 6  O ALA O 199 ? O ALA O 205 N LEU O 156 ? N LEU O 162 
AJ4 6 7  N CYS O 155 ? N CYS O 161 O HIS O 245 ? O HIS O 251 
AJ5 1 2  N PHE O 35  ? N PHE O 41  O ALA O 39  ? O ALA O 45  
AJ6 1 2  N ILE O 132 ? N ILE O 138 O ARG O 263 ? O ARG O 269 
AJ7 1 2  O ILE O 378 ? O ILE O 384 N LYS O 360 ? N LYS O 366 
AJ7 2 3  O ILE O 361 ? O ILE O 367 N ARG O 343 ? N ARG O 349 
AJ7 3 4  O ALA O 344 ? O ALA O 350 N SER O 329 ? N SER O 335 
AJ7 4 5  O ILE O 328 ? O ILE O 334 N LYS O 305 ? N LYS O 311 
AJ7 5 6  N ALA O 304 ? N ALA O 310 O VAL P 322 ? O VAL P 328 
AJ7 6 7  N VAL P 321 ? N VAL P 327 O LEU P 338 ? O LEU P 344 
AJ7 7 8  N LEU P 337 ? N LEU P 343 O VAL P 355 ? O VAL P 361 
AJ7 8 9  N VAL P 354 ? N VAL P 360 O ILE P 372 ? O ILE P 378 
AJ7 9 10 N GLN P 366 ? N GLN P 372 O VAL P 384 ? O VAL P 390 
AJ8 1 2  N SER P 316 ? N SER P 322 O LEU P 333 ? O LEU P 339 
AJ8 2 3  N ASN P 334 ? N ASN P 340 O LEU P 350 ? O LEU P 356 
AJ8 3 4  N VAL P 354 ? N VAL P 360 O ILE P 372 ? O ILE P 378 
AJ8 4 5  N VAL P 371 ? N VAL P 377 O ILE P 405 ? O ILE P 411 
AJ8 5 6  O LEU P 404 ? O LEU P 410 N ARG P 396 ? N ARG P 402 
AJ9 1 2  N VAL O 318 ? N VAL O 324 O LEU O 333 ? O LEU O 339 
AJ9 2 3  N ALA O 332 ? N ALA O 338 O LEU O 350 ? O LEU O 356 
AJ9 3 4  N ARG O 349 ? N ARG O 355 O LEU O 367 ? O LEU O 373 
AJ9 4 5  N VAL O 371 ? N VAL O 377 O ILE O 405 ? O ILE O 411 
AJ9 5 6  O LEU O 404 ? O LEU O 410 N ARG O 396 ? N ARG O 402 
AK1 1 2  O VAL O 384 ? O VAL O 390 N GLN O 366 ? N GLN O 372 
AK1 2 3  O LEU O 367 ? O LEU O 373 N ARG O 349 ? N ARG O 355 
AK1 3 4  O VAL O 355 ? O VAL O 361 N LEU O 337 ? N LEU O 343 
AK1 4 5  O LEU O 338 ? O LEU O 344 N VAL O 321 ? N VAL O 327 
AK1 5 6  N VAL O 322 ? N VAL O 328 O ALA P 304 ? O ALA P 310 
AK1 6 7  N LYS P 305 ? N LYS P 311 O ILE P 328 ? O ILE P 334 
AK1 7 8  N SER P 329 ? N SER P 335 O ALA P 344 ? O ALA P 350 
AK1 8 9  N ARG P 343 ? N ARG P 349 O ILE P 361 ? O ILE P 367 
AK1 9 10 N LYS P 360 ? N LYS P 366 O ILE P 378 ? O ILE P 384 
AK2 1 2  O LEU P 90  ? O LEU P 96  N VAL P 59  ? N VAL P 65  
AK2 2 3  O GLY P 58  ? O GLY P 64  N VAL P 12  ? N VAL P 18  
AK2 3 4  N LEU P 13  ? N LEU P 19  O LEU P 127 ? O LEU P 133 
AK2 4 5  N ILE P 126 ? N ILE P 132 O TYR P 204 ? O TYR P 210 
AK2 5 6  O SER P 200 ? O SER P 206 N GLY P 167 ? N GLY P 173 
AK2 6 7  N VAL P 168 ? N VAL P 174 O ILE P 181 ? O ILE P 187 
AK3 1 2  O LEU P 90  ? O LEU P 96  N VAL P 59  ? N VAL P 65  
AK3 2 3  O GLY P 58  ? O GLY P 64  N VAL P 12  ? N VAL P 18  
AK3 3 4  N LEU P 13  ? N LEU P 19  O LEU P 127 ? O LEU P 133 
AK3 4 5  N ILE P 126 ? N ILE P 132 O TYR P 204 ? O TYR P 210 
AK3 5 6  O ALA P 199 ? O ALA P 205 N LEU P 156 ? N LEU P 162 
AK3 6 7  N ILE P 153 ? N ILE P 159 O HIS P 245 ? O HIS P 251 
AK4 1 2  N PHE P 35  ? N PHE P 41  O ALA P 39  ? O ALA P 45  
AK5 1 2  N ILE P 132 ? N ILE P 138 O ARG P 263 ? O ARG P 269 
AK6 1 2  O LEU Q 90  ? O LEU Q 96  N VAL Q 59  ? N VAL Q 65  
AK6 2 3  O GLY Q 58  ? O GLY Q 64  N VAL Q 12  ? N VAL Q 18  
AK6 3 4  N TYR Q 11  ? N TYR Q 17  O VAL Q 125 ? O VAL Q 131 
AK6 4 5  N MET Q 124 ? N MET Q 130 O PHE Q 206 ? O PHE Q 212 
AK6 5 6  O LEU Q 198 ? O LEU Q 204 N MET Q 169 ? N MET Q 175 
AK6 6 7  N VAL Q 168 ? N VAL Q 174 O ILE Q 181 ? O ILE Q 187 
AK7 1 2  O LEU Q 90  ? O LEU Q 96  N VAL Q 59  ? N VAL Q 65  
AK7 2 3  O GLY Q 58  ? O GLY Q 64  N VAL Q 12  ? N VAL Q 18  
AK7 3 4  N TYR Q 11  ? N TYR Q 17  O VAL Q 125 ? O VAL Q 131 
AK7 4 5  N MET Q 124 ? N MET Q 130 O PHE Q 206 ? O PHE Q 212 
AK7 5 6  O ALA Q 199 ? O ALA Q 205 N LEU Q 156 ? N LEU Q 162 
AK7 6 7  N ILE Q 153 ? N ILE Q 159 O HIS Q 245 ? O HIS Q 251 
AK8 1 2  N PHE Q 35  ? N PHE Q 41  O ALA Q 39  ? O ALA Q 45  
AK9 1 2  N ILE Q 132 ? N ILE Q 138 O ARG Q 263 ? O ARG Q 269 
AL1 1 2  O ILE Q 378 ? O ILE Q 384 N LYS Q 360 ? N LYS Q 366 
AL1 2 3  O ILE Q 361 ? O ILE Q 367 N ARG Q 343 ? N ARG Q 349 
AL1 3 4  O ALA Q 344 ? O ALA Q 350 N SER Q 329 ? N SER Q 335 
AL1 4 5  O ILE Q 328 ? O ILE Q 334 N LYS Q 305 ? N LYS Q 311 
AL1 5 6  N ALA Q 304 ? N ALA Q 310 O VAL R 322 ? O VAL R 328 
AL1 6 7  N VAL R 321 ? N VAL R 327 O LEU R 338 ? O LEU R 344 
AL1 7 8  N LEU R 337 ? N LEU R 343 O VAL R 355 ? O VAL R 361 
AL1 8 9  N VAL R 354 ? N VAL R 360 O ILE R 372 ? O ILE R 378 
AL1 9 10 N GLN R 366 ? N GLN R 372 O VAL R 384 ? O VAL R 390 
AL2 1 2  N SER R 316 ? N SER R 322 O LEU R 333 ? O LEU R 339 
AL2 2 3  N LEU R 337 ? N LEU R 343 O VAL R 355 ? O VAL R 361 
AL2 3 4  N VAL R 354 ? N VAL R 360 O ILE R 372 ? O ILE R 378 
AL2 4 5  N VAL R 371 ? N VAL R 377 O ILE R 405 ? O ILE R 411 
AL2 5 6  O LEU R 404 ? O LEU R 410 N ARG R 396 ? N ARG R 402 
AL3 1 2  N SER Q 316 ? N SER Q 322 O LEU Q 333 ? O LEU Q 339 
AL3 2 3  N ALA Q 332 ? N ALA Q 338 O LEU Q 350 ? O LEU Q 356 
AL3 3 4  N VAL Q 354 ? N VAL Q 360 O ILE Q 372 ? O ILE Q 378 
AL3 4 5  N VAL Q 371 ? N VAL Q 377 O ILE Q 405 ? O ILE Q 411 
AL3 5 6  O LEU Q 404 ? O LEU Q 410 N ARG Q 396 ? N ARG Q 402 
AL4 1 2  O VAL Q 384 ? O VAL Q 390 N GLN Q 366 ? N GLN Q 372 
AL4 2 3  O ILE Q 372 ? O ILE Q 378 N VAL Q 354 ? N VAL Q 360 
AL4 3 4  O VAL Q 355 ? O VAL Q 361 N LEU Q 337 ? N LEU Q 343 
AL4 4 5  O LEU Q 338 ? O LEU Q 344 N VAL Q 321 ? N VAL Q 327 
AL4 5 6  N VAL Q 322 ? N VAL Q 328 O ALA R 304 ? O ALA R 310 
AL4 6 7  N LYS R 305 ? N LYS R 311 O ILE R 328 ? O ILE R 334 
AL4 7 8  N SER R 329 ? N SER R 335 O ALA R 344 ? O ALA R 350 
AL4 8 9  N ARG R 343 ? N ARG R 349 O ILE R 361 ? O ILE R 367 
AL4 9 10 N LYS R 360 ? N LYS R 366 O ILE R 378 ? O ILE R 384 
AL5 1 2  O LEU R 90  ? O LEU R 96  N VAL R 59  ? N VAL R 65  
AL5 2 3  O GLY R 58  ? O GLY R 64  N VAL R 12  ? N VAL R 18  
AL5 3 4  N LEU R 13  ? N LEU R 19  O LEU R 127 ? O LEU R 133 
AL5 4 5  N ILE R 126 ? N ILE R 132 O TYR R 204 ? O TYR R 210 
AL5 5 6  O LEU R 198 ? O LEU R 204 N MET R 169 ? N MET R 175 
AL5 6 7  N VAL R 168 ? N VAL R 174 O ILE R 181 ? O ILE R 187 
AL6 1 2  O LEU R 90  ? O LEU R 96  N VAL R 59  ? N VAL R 65  
AL6 2 3  O GLY R 58  ? O GLY R 64  N VAL R 12  ? N VAL R 18  
AL6 3 4  N LEU R 13  ? N LEU R 19  O LEU R 127 ? O LEU R 133 
AL6 4 5  N ILE R 126 ? N ILE R 132 O TYR R 204 ? O TYR R 210 
AL6 5 6  O ALA R 199 ? O ALA R 205 N LEU R 156 ? N LEU R 162 
AL6 6 7  N ILE R 153 ? N ILE R 159 O HIS R 245 ? O HIS R 251 
AL7 1 2  N PHE R 35  ? N PHE R 41  O ALA R 39  ? O ALA R 45  
AL8 1 2  N ILE R 132 ? N ILE R 138 O ARG R 263 ? O ARG R 269 
AL9 1 2  O LEU S 90  ? O LEU Z 96  N VAL S 59  ? N VAL Z 65  
AL9 2 3  O GLY S 58  ? O GLY Z 64  N VAL S 12  ? N VAL Z 18  
AL9 3 4  N LEU S 13  ? N LEU Z 19  O LEU S 127 ? O LEU Z 133 
AL9 4 5  N ILE S 126 ? N ILE Z 132 O TYR S 204 ? O TYR Z 210 
AL9 5 6  O LEU S 198 ? O LEU Z 204 N MET S 169 ? N MET Z 175 
AL9 6 7  N HIS S 170 ? N HIS Z 176 O ASP S 179 ? O ASP Z 185 
AM1 1 2  O LEU S 90  ? O LEU Z 96  N VAL S 59  ? N VAL Z 65  
AM1 2 3  O GLY S 58  ? O GLY Z 64  N VAL S 12  ? N VAL Z 18  
AM1 3 4  N LEU S 13  ? N LEU Z 19  O LEU S 127 ? O LEU Z 133 
AM1 4 5  N ILE S 126 ? N ILE Z 132 O TYR S 204 ? O TYR Z 210 
AM1 5 6  O ALA S 199 ? O ALA Z 205 N LEU S 156 ? N LEU Z 162 
AM1 6 7  N CYS S 155 ? N CYS Z 161 O HIS S 245 ? O HIS Z 251 
AM2 1 2  N PHE S 35  ? N PHE Z 41  O ALA S 39  ? O ALA Z 45  
AM3 1 2  N ILE S 132 ? N ILE Z 138 O ARG S 263 ? O ARG Z 269 
AM4 1 2  O ILE S 378 ? O ILE Z 384 N LYS S 360 ? N LYS Z 366 
AM4 2 3  O ILE S 361 ? O ILE Z 367 N ARG S 343 ? N ARG Z 349 
AM4 3 4  O ALA S 344 ? O ALA Z 350 N SER S 329 ? N SER Z 335 
AM4 4 5  O ILE S 328 ? O ILE Z 334 N LYS S 305 ? N LYS Z 311 
AM4 5 6  N PHE S 306 ? N PHE Z 312 O SER T 320 ? O SER T 326 
AM4 6 7  N VAL T 321 ? N VAL T 327 O LEU T 338 ? O LEU T 344 
AM4 7 8  N LEU T 337 ? N LEU T 343 O VAL T 355 ? O VAL T 361 
AM4 8 9  N VAL T 354 ? N VAL T 360 O ILE T 372 ? O ILE T 378 
AM4 9 10 N GLN T 366 ? N GLN T 372 O VAL T 384 ? O VAL T 390 
AM5 1 2  N SER T 316 ? N SER T 322 O LEU T 333 ? O LEU T 339 
AM5 2 3  N ALA T 332 ? N ALA T 338 O LEU T 350 ? O LEU T 356 
AM5 3 4  N VAL T 354 ? N VAL T 360 O ILE T 372 ? O ILE T 378 
AM5 4 5  N VAL T 371 ? N VAL T 377 O ILE T 405 ? O ILE T 411 
AM5 5 6  O LEU T 404 ? O LEU T 410 N ARG T 396 ? N ARG T 402 
AM6 1 2  N VAL S 318 ? N VAL Z 324 O LEU S 333 ? O LEU Z 339 
AM6 2 3  N LEU S 337 ? N LEU Z 343 O VAL S 355 ? O VAL Z 361 
AM6 3 4  N VAL S 354 ? N VAL Z 360 O VAL S 370 ? O VAL Z 376 
AM6 4 5  N VAL S 371 ? N VAL Z 377 O ILE S 405 ? O ILE Z 411 
AM6 5 6  O LEU S 404 ? O LEU Z 410 N ARG S 396 ? N ARG Z 402 
AM7 1 2  O VAL S 384 ? O VAL Z 390 N GLN S 366 ? N GLN Z 372 
AM7 2 3  O VAL S 370 ? O VAL Z 376 N VAL S 354 ? N VAL Z 360 
AM7 3 4  O VAL S 355 ? O VAL Z 361 N LEU S 337 ? N LEU Z 343 
AM7 4 5  O LEU S 338 ? O LEU Z 344 N VAL S 321 ? N VAL Z 327 
AM7 5 6  N VAL S 322 ? N VAL Z 328 O ALA T 304 ? O ALA T 310 
AM7 6 7  N LYS T 305 ? N LYS T 311 O ILE T 328 ? O ILE T 334 
AM7 7 8  N SER T 329 ? N SER T 335 O ALA T 344 ? O ALA T 350 
AM7 8 9  N ARG T 343 ? N ARG T 349 O ILE T 361 ? O ILE T 367 
AM7 9 10 N LYS T 360 ? N LYS T 366 O ILE T 378 ? O ILE T 384 
AM8 1 2  O LEU T 90  ? O LEU T 96  N VAL T 59  ? N VAL T 65  
AM8 2 3  O GLY T 58  ? O GLY T 64  N VAL T 12  ? N VAL T 18  
AM8 3 4  N TYR T 11  ? N TYR T 17  O VAL T 125 ? O VAL T 131 
AM8 4 5  N ILE T 126 ? N ILE T 132 O TYR T 204 ? O TYR T 210 
AM8 5 6  O SER T 200 ? O SER T 206 N GLY T 167 ? N GLY T 173 
AM8 6 7  N HIS T 170 ? N HIS T 176 O ASP T 179 ? O ASP T 185 
AM8 7 8  N ILE T 177 ? N ILE T 183 O ALA T 242 ? O ALA T 248 
AM8 8 9  O HIS T 245 ? O HIS T 251 N ILE T 153 ? N ILE T 159 
AM8 9 10 N LEU T 156 ? N LEU T 162 O ALA T 199 ? O ALA T 205 
AM9 1 2  N PHE T 35  ? N PHE T 41  O ALA T 39  ? O ALA T 45  
AN1 1 2  N ILE T 132 ? N ILE T 138 O ARG T 263 ? O ARG T 269 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 501 ? 7  'binding site for residue SO4 A 501' 
AC2 Software A SO4 502 ? 7  'binding site for residue SO4 A 502' 
AC3 Software A SO4 503 ? 8  'binding site for residue SO4 A 503' 
AC4 Software A SO4 504 ? 5  'binding site for residue SO4 A 504' 
AC5 Software A GOL 505 ? 8  'binding site for residue GOL A 505' 
AC6 Software A 9X7 506 ? 12 'binding site for residue 9X7 A 506' 
AC7 Software B SO4 501 ? 10 'binding site for residue SO4 B 501' 
AC8 Software B SO4 502 ? 7  'binding site for residue SO4 B 502' 
AC9 Software B SO4 503 ? 6  'binding site for residue SO4 B 503' 
AD1 Software B GOL 504 ? 7  'binding site for residue GOL B 504' 
AD2 Software B GOL 505 ? 8  'binding site for residue GOL B 505' 
AD3 Software B GOL 506 ? 7  'binding site for residue GOL B 506' 
AD4 Software C SO4 501 ? 8  'binding site for residue SO4 C 501' 
AD5 Software C SO4 502 ? 8  'binding site for residue SO4 C 502' 
AD6 Software C SO4 503 ? 8  'binding site for residue SO4 C 503' 
AD7 Software C SO4 504 ? 4  'binding site for residue SO4 C 504' 
AD8 Software C GOL 505 ? 6  'binding site for residue GOL C 505' 
AD9 Software C GOL 506 ? 7  'binding site for residue GOL C 506' 
AE1 Software C GOL 507 ? 7  'binding site for residue GOL C 507' 
AE2 Software C GOL 508 ? 4  'binding site for residue GOL C 508' 
AE3 Software D SO4 501 ? 5  'binding site for residue SO4 D 501' 
AE4 Software D SO4 502 ? 8  'binding site for residue SO4 D 502' 
AE5 Software D SO4 503 ? 5  'binding site for residue SO4 D 503' 
AE6 Software D SO4 504 ? 5  'binding site for residue SO4 D 504' 
AE7 Software D GOL 505 ? 4  'binding site for residue GOL D 505' 
AE8 Software D GOL 506 ? 7  'binding site for residue GOL D 506' 
AE9 Software D GOL 507 ? 8  'binding site for residue GOL D 507' 
AF1 Software D 9X7 508 ? 17 'binding site for residue 9X7 D 508' 
AF2 Software E SO4 501 ? 8  'binding site for residue SO4 E 501' 
AF3 Software E SO4 502 ? 7  'binding site for residue SO4 E 502' 
AF4 Software E SO4 503 ? 8  'binding site for residue SO4 E 503' 
AF5 Software E GOL 504 ? 8  'binding site for residue GOL E 504' 
AF6 Software F SO4 501 ? 9  'binding site for residue SO4 F 501' 
AF7 Software F SO4 502 ? 6  'binding site for residue SO4 F 502' 
AF8 Software F 9X7 503 ? 12 'binding site for residue 9X7 F 503' 
AF9 Software G SO4 501 ? 10 'binding site for residue SO4 G 501' 
AG1 Software G SO4 502 ? 5  'binding site for residue SO4 G 502' 
AG2 Software G SO4 503 ? 7  'binding site for residue SO4 G 503' 
AG3 Software G GOL 504 ? 8  'binding site for residue GOL G 504' 
AG4 Software G GOL 505 ? 7  'binding site for residue GOL G 505' 
AG5 Software G 9X7 506 ? 14 'binding site for residue 9X7 G 506' 
AG6 Software H SO4 501 ? 6  'binding site for residue SO4 H 501' 
AG7 Software H SO4 502 ? 9  'binding site for residue SO4 H 502' 
AG8 Software H GOL 503 ? 3  'binding site for residue GOL H 503' 
AG9 Software I SO4 501 ? 6  'binding site for residue SO4 I 501' 
AH1 Software I SO4 502 ? 8  'binding site for residue SO4 I 502' 
AH2 Software I SO4 503 ? 8  'binding site for residue SO4 I 503' 
AH3 Software I SO4 504 ? 7  'binding site for residue SO4 I 504' 
AH4 Software I GOL 505 ? 4  'binding site for residue GOL I 505' 
AH5 Software I GOL 506 ? 6  'binding site for residue GOL I 506' 
AH6 Software I GOL 507 ? 6  'binding site for residue GOL I 507' 
AH7 Software I 9X7 508 ? 13 'binding site for residue 9X7 I 508' 
AH8 Software J SO4 501 ? 6  'binding site for residue SO4 J 501' 
AH9 Software J SO4 502 ? 7  'binding site for residue SO4 J 502' 
AI1 Software J SO4 503 ? 5  'binding site for residue SO4 J 503' 
AI2 Software J GOL 504 ? 6  'binding site for residue GOL J 504' 
AI3 Software J GOL 505 ? 7  'binding site for residue GOL J 505' 
AI4 Software J GOL 506 ? 10 'binding site for residue GOL J 506' 
AI5 Software J GOL 507 ? 6  'binding site for residue GOL J 507' 
AI6 Software K SO4 501 ? 7  'binding site for residue SO4 K 501' 
AI7 Software K SO4 502 ? 6  'binding site for residue SO4 K 502' 
AI8 Software K SO4 503 ? 4  'binding site for residue SO4 K 503' 
AI9 Software K GOL 504 ? 7  'binding site for residue GOL K 504' 
AJ1 Software K GOL 505 ? 8  'binding site for residue GOL K 505' 
AJ2 Software L SO4 501 ? 5  'binding site for residue SO4 L 501' 
AJ3 Software L SO4 502 ? 8  'binding site for residue SO4 L 502' 
AJ4 Software L SO4 503 ? 7  'binding site for residue SO4 L 503' 
AJ5 Software L SO4 504 ? 5  'binding site for residue SO4 L 504' 
AJ6 Software L GOL 505 ? 8  'binding site for residue GOL L 505' 
AJ7 Software L GOL 506 ? 3  'binding site for residue GOL L 506' 
AJ8 Software L 9X7 507 ? 11 'binding site for residue 9X7 L 507' 
AJ9 Software M SO4 501 ? 7  'binding site for residue SO4 M 501' 
AK1 Software M SO4 502 ? 9  'binding site for residue SO4 M 502' 
AK2 Software M SO4 503 ? 8  'binding site for residue SO4 M 503' 
AK3 Software M GOL 504 ? 8  'binding site for residue GOL M 504' 
AK4 Software M GOL 505 ? 6  'binding site for residue GOL M 505' 
AK5 Software M GOL 506 ? 7  'binding site for residue GOL M 506' 
AK6 Software M GOL 507 ? 4  'binding site for residue GOL M 507' 
AK7 Software M 9X7 508 ? 14 'binding site for residue 9X7 M 508' 
AK8 Software N SO4 501 ? 6  'binding site for residue SO4 N 501' 
AK9 Software N SO4 502 ? 9  'binding site for residue SO4 N 502' 
AL1 Software N SO4 503 ? 5  'binding site for residue SO4 N 503' 
AL2 Software N GOL 504 ? 6  'binding site for residue GOL N 504' 
AL3 Software N GOL 505 ? 4  'binding site for residue GOL N 505' 
AL4 Software O SO4 501 ? 8  'binding site for residue SO4 O 501' 
AL5 Software O SO4 502 ? 9  'binding site for residue SO4 O 502' 
AL6 Software O SO4 503 ? 8  'binding site for residue SO4 O 503' 
AL7 Software O SO4 504 ? 4  'binding site for residue SO4 O 504' 
AL8 Software O SO4 505 ? 6  'binding site for residue SO4 O 505' 
AL9 Software O GOL 506 ? 8  'binding site for residue GOL O 506' 
AM1 Software O GOL 507 ? 7  'binding site for residue GOL O 507' 
AM2 Software O 9X7 508 ? 15 'binding site for residue 9X7 O 508' 
AM3 Software P SO4 501 ? 8  'binding site for residue SO4 P 501' 
AM4 Software P SO4 502 ? 7  'binding site for residue SO4 P 502' 
AM5 Software P SO4 503 ? 7  'binding site for residue SO4 P 503' 
AM6 Software P SO4 504 ? 3  'binding site for residue SO4 P 504' 
AM7 Software P GOL 505 ? 6  'binding site for residue GOL P 505' 
AM8 Software P GOL 506 ? 6  'binding site for residue GOL P 506' 
AM9 Software Q SO4 501 ? 7  'binding site for residue SO4 Q 501' 
AN1 Software Q SO4 502 ? 5  'binding site for residue SO4 Q 502' 
AN2 Software Q SO4 503 ? 10 'binding site for residue SO4 Q 503' 
AN3 Software Q SO4 504 ? 7  'binding site for residue SO4 Q 504' 
AN4 Software Q SO4 505 ? 5  'binding site for residue SO4 Q 505' 
AN5 Software Q SO4 506 ? 6  'binding site for residue SO4 Q 506' 
AN6 Software Q SO4 507 ? 6  'binding site for residue SO4 Q 507' 
AN7 Software Q SO4 508 ? 4  'binding site for residue SO4 Q 508' 
AN8 Software Q GOL 509 ? 5  'binding site for residue GOL Q 509' 
AN9 Software Q GOL 510 ? 9  'binding site for residue GOL Q 510' 
AO1 Software Q GOL 511 ? 5  'binding site for residue GOL Q 511' 
AO2 Software R SO4 501 ? 9  'binding site for residue SO4 R 501' 
AO3 Software R SO4 502 ? 9  'binding site for residue SO4 R 502' 
AO4 Software R SO4 503 ? 10 'binding site for residue SO4 R 503' 
AO5 Software R SO4 504 ? 6  'binding site for residue SO4 R 504' 
AO6 Software R SO4 505 ? 2  'binding site for residue SO4 R 505' 
AO7 Software R SO4 506 ? 5  'binding site for residue SO4 R 506' 
AO8 Software R GOL 507 ? 5  'binding site for residue GOL R 507' 
AO9 Software R GOL 508 ? 6  'binding site for residue GOL R 508' 
AP1 Software R GOL 509 ? 8  'binding site for residue GOL R 509' 
AP2 Software R GOL 510 ? 5  'binding site for residue GOL R 510' 
AP3 Software R 9X7 511 ? 14 'binding site for residue 9X7 R 511' 
AP4 Software Z SO4 501 ? 9  'binding site for residue SO4 Z 501' 
AP5 Software Z SO4 502 ? 7  'binding site for residue SO4 Z 502' 
AP6 Software Z SO4 503 ? 9  'binding site for residue SO4 Z 503' 
AP7 Software Z GOL 504 ? 4  'binding site for residue GOL Z 504' 
AP8 Software Z GOL 505 ? 5  'binding site for residue GOL Z 505' 
AP9 Software Z 9X7 506 ? 14 'binding site for residue 9X7 Z 506' 
AQ1 Software T SO4 501 ? 7  'binding site for residue SO4 T 501' 
AQ2 Software T SO4 502 ? 7  'binding site for residue SO4 T 502' 
AQ3 Software T SO4 503 ? 9  'binding site for residue SO4 T 503' 
AQ4 Software T SO4 504 ? 2  'binding site for residue SO4 T 504' 
AQ5 Software T GOL 505 ? 4  'binding site for residue GOL T 505' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 7  SER A  329 ? SER A 335  . ? 1_555 ? 
2   AC1 7  ASN A  345 ? ASN A 351  . ? 1_555 ? 
3   AC1 7  SER A  346 ? SER A 352  . ? 1_555 ? 
4   AC1 7  ARG A  363 ? ARG A 369  . ? 1_555 ? 
5   AC1 7  HOH VE .   ? HOH A 611  . ? 1_555 ? 
6   AC1 7  HOH VE .   ? HOH A 723  . ? 1_555 ? 
7   AC1 7  HOH VE .   ? HOH A 754  . ? 1_555 ? 
8   AC2 7  ARG A  28  ? ARG A 34   . ? 1_555 ? 
9   AC2 7  TYR A  34  ? TYR A 40   . ? 1_555 ? 
10  AC2 7  ARG A  40  ? ARG A 46   . ? 1_555 ? 
11  AC2 7  SER A  67  ? SER A 73   . ? 1_555 ? 
12  AC2 7  HOH VE .   ? HOH A 740  . ? 1_555 ? 
13  AC2 7  HOH VE .   ? HOH A 761  . ? 1_555 ? 
14  AC2 7  HOH VE .   ? HOH A 919  . ? 1_555 ? 
15  AC3 8  ARG A  263 ? ARG A 269  . ? 1_555 ? 
16  AC3 8  ASP A  264 ? ASP A 270  . ? 1_555 ? 
17  AC3 8  VAL A  265 ? VAL A 271  . ? 1_555 ? 
18  AC3 8  ALA A  270 ? ALA A 276  . ? 1_555 ? 
19  AC3 8  HOH VE .   ? HOH A 779  . ? 1_555 ? 
20  AC3 8  HOH VE .   ? HOH A 835  . ? 1_555 ? 
21  AC3 8  HOH VE .   ? HOH A 885  . ? 1_555 ? 
22  AC3 8  HOH VE .   ? HOH A 902  . ? 1_555 ? 
23  AC4 5  ASP A  269 ? ASP A 275  . ? 1_555 ? 
24  AC4 5  THR A  398 ? THR A 404  . ? 1_555 ? 
25  AC4 5  GLU A  399 ? GLU A 405  . ? 1_555 ? 
26  AC4 5  HOH VE .   ? HOH A 618  . ? 1_555 ? 
27  AC4 5  HOH VE .   ? HOH A 738  . ? 1_555 ? 
28  AC5 8  THR A  105 ? THR A 111  . ? 1_555 ? 
29  AC5 8  TYR A  204 ? TYR A 210  . ? 1_555 ? 
30  AC5 8  ASP A  227 ? ASP A 233  . ? 1_555 ? 
31  AC5 8  PHE A  228 ? PHE A 234  . ? 1_555 ? 
32  AC5 8  GLY A  229 ? GLY A 235  . ? 1_555 ? 
33  AC5 8  HOH VE .   ? HOH A 629  . ? 1_555 ? 
34  AC5 8  HOH VE .   ? HOH A 695  . ? 1_555 ? 
35  AC5 8  HOH VE .   ? HOH A 905  . ? 1_555 ? 
36  AC6 12 LYS A  38  ? LYS A 44   . ? 1_555 ? 
37  AC6 12 THR A  301 ? THR A 307  . ? 1_555 ? 
38  AC6 12 PRO A  303 ? PRO A 309  . ? 1_555 ? 
39  AC6 12 ALA A  304 ? ALA A 310  . ? 1_555 ? 
40  AC6 12 VAL A  322 ? VAL A 328  . ? 1_555 ? 
41  AC6 12 SER A  323 ? SER A 329  . ? 1_555 ? 
42  AC6 12 GLY A  324 ? GLY A 330  . ? 1_555 ? 
43  AC6 12 LYS B  38  ? LYS B 44   . ? 1_555 ? 
44  AC6 12 PRO B  303 ? PRO B 309  . ? 1_555 ? 
45  AC6 12 ALA B  304 ? ALA B 310  . ? 1_555 ? 
46  AC6 12 SER B  323 ? SER B 329  . ? 1_555 ? 
47  AC6 12 GLY B  324 ? GLY B 330  . ? 1_555 ? 
48  AC7 10 ARG B  28  ? ARG B 34   . ? 1_555 ? 
49  AC7 10 TYR B  34  ? TYR B 40   . ? 1_555 ? 
50  AC7 10 ARG B  40  ? ARG B 46   . ? 1_555 ? 
51  AC7 10 SER B  67  ? SER B 73   . ? 1_555 ? 
52  AC7 10 ARG B  70  ? ARG B 76   . ? 1_555 ? 
53  AC7 10 HIS B  374 ? HIS B 380  . ? 1_555 ? 
54  AC7 10 HOH WE .   ? HOH B 640  . ? 1_555 ? 
55  AC7 10 HOH WE .   ? HOH B 684  . ? 1_555 ? 
56  AC7 10 HOH WE .   ? HOH B 728  . ? 1_555 ? 
57  AC7 10 HOH WE .   ? HOH B 842  . ? 1_555 ? 
58  AC8 7  SER B  329 ? SER B 335  . ? 1_555 ? 
59  AC8 7  ASN B  345 ? ASN B 351  . ? 1_555 ? 
60  AC8 7  SER B  346 ? SER B 352  . ? 1_555 ? 
61  AC8 7  ARG B  363 ? ARG B 369  . ? 1_555 ? 
62  AC8 7  HOH WE .   ? HOH B 656  . ? 1_555 ? 
63  AC8 7  HOH WE .   ? HOH B 756  . ? 1_555 ? 
64  AC8 7  HOH WE .   ? HOH B 835  . ? 1_555 ? 
65  AC9 6  ARG B  263 ? ARG B 269  . ? 1_555 ? 
66  AC9 6  ASP B  264 ? ASP B 270  . ? 1_555 ? 
67  AC9 6  VAL B  265 ? VAL B 271  . ? 1_555 ? 
68  AC9 6  ALA B  270 ? ALA B 276  . ? 1_555 ? 
69  AC9 6  HOH WE .   ? HOH B 607  . ? 1_555 ? 
70  AC9 6  HOH WE .   ? HOH B 904  . ? 1_555 ? 
71  AD1 7  ILE B  54  ? ILE B 60   . ? 1_555 ? 
72  AD1 7  ARG B  55  ? ARG B 61   . ? 1_555 ? 
73  AD1 7  HOH WE .   ? HOH B 630  . ? 1_555 ? 
74  AD1 7  HOH WE .   ? HOH B 644  . ? 1_555 ? 
75  AD1 7  HOH WE .   ? HOH B 672  . ? 1_555 ? 
76  AD1 7  GLU D  85  ? GLU D 91   . ? 1_555 ? 
77  AD1 7  HOH YE .   ? HOH D 741  . ? 1_555 ? 
78  AD2 8  THR B  105 ? THR B 111  . ? 1_555 ? 
79  AD2 8  GLY B  202 ? GLY B 208  . ? 1_555 ? 
80  AD2 8  TYR B  204 ? TYR B 210  . ? 1_555 ? 
81  AD2 8  PHE B  228 ? PHE B 234  . ? 1_555 ? 
82  AD2 8  GLY B  229 ? GLY B 235  . ? 1_555 ? 
83  AD2 8  HOH WE .   ? HOH B 639  . ? 1_555 ? 
84  AD2 8  HOH WE .   ? HOH B 654  . ? 1_555 ? 
85  AD2 8  HOH WE .   ? HOH B 722  . ? 1_555 ? 
86  AD3 7  GLY B  18  ? GLY B 24   . ? 1_555 ? 
87  AD3 7  SER B  19  ? SER B 25   . ? 1_555 ? 
88  AD3 7  ARG B  20  ? ARG B 26   . ? 1_555 ? 
89  AD3 7  GLY B  266 ? GLY B 272  . ? 1_555 ? 
90  AD3 7  HOH WE .   ? HOH B 610  . ? 1_555 ? 
91  AD3 7  HOH WE .   ? HOH B 716  . ? 1_555 ? 
92  AD3 7  HOH WE .   ? HOH B 787  . ? 1_555 ? 
93  AD4 8  ARG C  313 ? ARG C 319  . ? 1_555 ? 
94  AD4 8  SER C  329 ? SER C 335  . ? 1_555 ? 
95  AD4 8  ASN C  345 ? ASN C 351  . ? 1_555 ? 
96  AD4 8  SER C  346 ? SER C 352  . ? 1_555 ? 
97  AD4 8  ARG C  363 ? ARG C 369  . ? 1_555 ? 
98  AD4 8  HOH XE .   ? HOH C 731  . ? 1_555 ? 
99  AD4 8  HOH XE .   ? HOH C 883  . ? 1_555 ? 
100 AD4 8  HOH XE .   ? HOH C 941  . ? 1_555 ? 
101 AD5 8  ARG C  28  ? ARG C 34   . ? 1_555 ? 
102 AD5 8  TYR C  34  ? TYR C 40   . ? 1_555 ? 
103 AD5 8  ARG C  40  ? ARG C 46   . ? 1_555 ? 
104 AD5 8  SER C  67  ? SER C 73   . ? 1_555 ? 
105 AD5 8  HOH XE .   ? HOH C 604  . ? 1_555 ? 
106 AD5 8  HOH XE .   ? HOH C 636  . ? 1_555 ? 
107 AD5 8  HOH XE .   ? HOH C 769  . ? 1_555 ? 
108 AD5 8  HOH XE .   ? HOH C 927  . ? 1_555 ? 
109 AD6 8  ARG C  263 ? ARG C 269  . ? 1_555 ? 
110 AD6 8  ASP C  264 ? ASP C 270  . ? 1_555 ? 
111 AD6 8  VAL C  265 ? VAL C 271  . ? 1_555 ? 
112 AD6 8  GLY C  266 ? GLY C 272  . ? 1_555 ? 
113 AD6 8  ALA C  270 ? ALA C 276  . ? 1_555 ? 
114 AD6 8  HOH XE .   ? HOH C 713  . ? 1_555 ? 
115 AD6 8  HOH XE .   ? HOH C 726  . ? 1_555 ? 
116 AD6 8  HOH XE .   ? HOH C 843  . ? 1_555 ? 
117 AD7 4  LYS C  22  ? LYS C 28   . ? 1_555 ? 
118 AD7 4  ARG C  396 ? ARG C 402  . ? 1_555 ? 
119 AD7 4  HOH XE .   ? HOH C 611  . ? 1_555 ? 
120 AD7 4  HOH XE .   ? HOH C 836  . ? 1_555 ? 
121 AD8 6  ASP C  280 ? ASP C 286  . ? 1_555 ? 
122 AD8 6  VAL C  281 ? VAL C 287  . ? 1_555 ? 
123 AD8 6  VAL C  282 ? VAL C 288  . ? 1_555 ? 
124 AD8 6  HOH XE .   ? HOH C 741  . ? 1_555 ? 
125 AD8 6  HOH XE .   ? HOH C 802  . ? 1_555 ? 
126 AD8 6  HOH XE .   ? HOH C 920  . ? 1_555 ? 
127 AD9 7  ARG C  17  ? ARG C 23   . ? 1_555 ? 
128 AD9 7  GLY C  18  ? GLY C 24   . ? 1_555 ? 
129 AD9 7  SER C  19  ? SER C 25   . ? 1_555 ? 
130 AD9 7  ARG C  20  ? ARG C 26   . ? 1_555 ? 
131 AD9 7  HOH XE .   ? HOH C 619  . ? 1_555 ? 
132 AD9 7  HOH XE .   ? HOH C 629  . ? 1_555 ? 
133 AD9 7  HOH XE .   ? HOH C 702  . ? 1_555 ? 
134 AE1 7  THR C  105 ? THR C 111  . ? 1_555 ? 
135 AE1 7  TYR C  204 ? TYR C 210  . ? 1_555 ? 
136 AE1 7  ASP C  227 ? ASP C 233  . ? 1_555 ? 
137 AE1 7  PHE C  228 ? PHE C 234  . ? 1_555 ? 
138 AE1 7  GLY C  229 ? GLY C 235  . ? 1_555 ? 
139 AE1 7  HOH XE .   ? HOH C 602  . ? 1_555 ? 
140 AE1 7  HOH XE .   ? HOH C 889  . ? 1_555 ? 
141 AE2 4  ARG C  313 ? ARG C 319  . ? 1_555 ? 
142 AE2 4  ARG C  363 ? ARG C 369  . ? 1_555 ? 
143 AE2 4  HOH XE .   ? HOH C 605  . ? 1_555 ? 
144 AE2 4  HOH XE .   ? HOH C 612  . ? 1_555 ? 
145 AE3 5  SER D  329 ? SER D 335  . ? 1_555 ? 
146 AE3 5  ASN D  345 ? ASN D 351  . ? 1_555 ? 
147 AE3 5  SER D  346 ? SER D 352  . ? 1_555 ? 
148 AE3 5  ARG D  363 ? ARG D 369  . ? 1_555 ? 
149 AE3 5  HOH YE .   ? HOH D 840  . ? 1_555 ? 
150 AE4 8  ARG D  28  ? ARG D 34   . ? 1_555 ? 
151 AE4 8  TYR D  34  ? TYR D 40   . ? 1_555 ? 
152 AE4 8  ARG D  40  ? ARG D 46   . ? 1_555 ? 
153 AE4 8  SER D  67  ? SER D 73   . ? 1_555 ? 
154 AE4 8  HIS D  374 ? HIS D 380  . ? 1_555 ? 
155 AE4 8  HOH YE .   ? HOH D 604  . ? 1_555 ? 
156 AE4 8  HOH YE .   ? HOH D 658  . ? 1_555 ? 
157 AE4 8  HOH YE .   ? HOH D 849  . ? 1_555 ? 
158 AE5 5  ASP D  264 ? ASP D 270  . ? 1_555 ? 
159 AE5 5  VAL D  265 ? VAL D 271  . ? 1_555 ? 
160 AE5 5  ALA D  270 ? ALA D 276  . ? 1_555 ? 
161 AE5 5  HOH YE .   ? HOH D 740  . ? 1_555 ? 
162 AE5 5  HOH YE .   ? HOH D 760  . ? 1_555 ? 
163 AE6 5  LYS D  22  ? LYS D 28   . ? 1_555 ? 
164 AE6 5  ARG D  396 ? ARG D 402  . ? 1_555 ? 
165 AE6 5  HOH YE .   ? HOH D 752  . ? 1_555 ? 
166 AE6 5  HOH YE .   ? HOH D 831  . ? 1_555 ? 
167 AE6 5  HOH YE .   ? HOH D 920  . ? 1_555 ? 
168 AE7 4  ASP D  280 ? ASP D 286  . ? 1_555 ? 
169 AE7 4  VAL D  281 ? VAL D 287  . ? 1_555 ? 
170 AE7 4  VAL D  282 ? VAL D 288  . ? 1_555 ? 
171 AE7 4  HOH YE .   ? HOH D 866  . ? 1_555 ? 
172 AE8 7  ILE C  327 ? ILE C 333  . ? 1_555 ? 
173 AE8 7  PRO D  283 ? PRO D 289  . ? 1_555 ? 
174 AE8 7  ASP D  286 ? ASP D 292  . ? 1_555 ? 
175 AE8 7  TYR D  288 ? TYR D 294  . ? 1_555 ? 
176 AE8 7  HOH YE .   ? HOH D 638  . ? 1_555 ? 
177 AE8 7  HOH YE .   ? HOH D 691  . ? 1_555 ? 
178 AE8 7  HOH YE .   ? HOH D 722  . ? 1_555 ? 
179 AE9 8  THR D  105 ? THR D 111  . ? 1_555 ? 
180 AE9 8  TYR D  204 ? TYR D 210  . ? 1_555 ? 
181 AE9 8  PHE D  228 ? PHE D 234  . ? 1_555 ? 
182 AE9 8  GLY D  229 ? GLY D 235  . ? 1_555 ? 
183 AE9 8  HOH YE .   ? HOH D 623  . ? 1_555 ? 
184 AE9 8  HOH YE .   ? HOH D 643  . ? 1_555 ? 
185 AE9 8  HOH YE .   ? HOH D 746  . ? 1_555 ? 
186 AE9 8  HOH YE .   ? HOH D 860  . ? 1_555 ? 
187 AF1 17 LYS C  38  ? LYS C 44   . ? 1_555 ? 
188 AF1 17 THR C  301 ? THR C 307  . ? 1_555 ? 
189 AF1 17 PRO C  302 ? PRO C 308  . ? 1_555 ? 
190 AF1 17 PRO C  303 ? PRO C 309  . ? 1_555 ? 
191 AF1 17 ALA C  304 ? ALA C 310  . ? 1_555 ? 
192 AF1 17 VAL C  322 ? VAL C 328  . ? 1_555 ? 
193 AF1 17 SER C  323 ? SER C 329  . ? 1_555 ? 
194 AF1 17 GLY C  324 ? GLY C 330  . ? 1_555 ? 
195 AF1 17 HOH XE .   ? HOH C 928  . ? 1_555 ? 
196 AF1 17 LYS D  38  ? LYS D 44   . ? 1_555 ? 
197 AF1 17 THR D  301 ? THR D 307  . ? 1_555 ? 
198 AF1 17 PRO D  302 ? PRO D 308  . ? 1_555 ? 
199 AF1 17 PRO D  303 ? PRO D 309  . ? 1_555 ? 
200 AF1 17 ALA D  304 ? ALA D 310  . ? 1_555 ? 
201 AF1 17 VAL D  322 ? VAL D 328  . ? 1_555 ? 
202 AF1 17 SER D  323 ? SER D 329  . ? 1_555 ? 
203 AF1 17 GLY D  324 ? GLY D 330  . ? 1_555 ? 
204 AF2 8  ARG E  28  ? ARG E 34   . ? 1_555 ? 
205 AF2 8  TYR E  34  ? TYR E 40   . ? 1_555 ? 
206 AF2 8  ARG E  40  ? ARG E 46   . ? 1_555 ? 
207 AF2 8  SER E  67  ? SER E 73   . ? 1_555 ? 
208 AF2 8  HIS E  374 ? HIS E 380  . ? 1_555 ? 
209 AF2 8  HOH ZE .   ? HOH E 615  . ? 1_555 ? 
210 AF2 8  HOH ZE .   ? HOH E 644  . ? 1_555 ? 
211 AF2 8  HOH ZE .   ? HOH E 760  . ? 1_555 ? 
212 AF3 7  ARG E  313 ? ARG E 319  . ? 1_555 ? 
213 AF3 7  SER E  329 ? SER E 335  . ? 1_555 ? 
214 AF3 7  ASN E  345 ? ASN E 351  . ? 1_555 ? 
215 AF3 7  SER E  346 ? SER E 352  . ? 1_555 ? 
216 AF3 7  ARG E  363 ? ARG E 369  . ? 1_555 ? 
217 AF3 7  HOH ZE .   ? HOH E 616  . ? 1_555 ? 
218 AF3 7  HOH ZE .   ? HOH E 682  . ? 1_555 ? 
219 AF4 8  ARG E  263 ? ARG E 269  . ? 1_555 ? 
220 AF4 8  ASP E  264 ? ASP E 270  . ? 1_555 ? 
221 AF4 8  VAL E  265 ? VAL E 271  . ? 1_555 ? 
222 AF4 8  HOH ZE .   ? HOH E 656  . ? 1_555 ? 
223 AF4 8  HOH ZE .   ? HOH E 679  . ? 1_555 ? 
224 AF4 8  HOH ZE .   ? HOH E 766  . ? 1_555 ? 
225 AF4 8  HOH ZE .   ? HOH E 790  . ? 1_555 ? 
226 AF4 8  HOH ZE .   ? HOH E 899  . ? 1_555 ? 
227 AF5 8  THR E  105 ? THR E 111  . ? 1_555 ? 
228 AF5 8  GLY E  202 ? GLY E 208  . ? 1_555 ? 
229 AF5 8  TYR E  204 ? TYR E 210  . ? 1_555 ? 
230 AF5 8  ASP E  227 ? ASP E 233  . ? 1_555 ? 
231 AF5 8  PHE E  228 ? PHE E 234  . ? 1_555 ? 
232 AF5 8  GLY E  229 ? GLY E 235  . ? 1_555 ? 
233 AF5 8  HOH ZE .   ? HOH E 677  . ? 1_555 ? 
234 AF5 8  HOH ZE .   ? HOH E 777  . ? 1_555 ? 
235 AF6 9  ARG F  28  ? ARG F 34   . ? 1_555 ? 
236 AF6 9  TYR F  34  ? TYR F 40   . ? 1_555 ? 
237 AF6 9  ARG F  40  ? ARG F 46   . ? 1_555 ? 
238 AF6 9  SER F  67  ? SER F 73   . ? 1_555 ? 
239 AF6 9  HOH AF .   ? HOH F 649  . ? 1_555 ? 
240 AF6 9  HOH AF .   ? HOH F 695  . ? 1_555 ? 
241 AF6 9  HOH AF .   ? HOH F 734  . ? 1_555 ? 
242 AF6 9  HOH AF .   ? HOH F 845  . ? 1_555 ? 
243 AF6 9  HOH AF .   ? HOH F 902  . ? 1_555 ? 
244 AF7 6  SER F  329 ? SER F 335  . ? 1_555 ? 
245 AF7 6  ASN F  345 ? ASN F 351  . ? 1_555 ? 
246 AF7 6  SER F  346 ? SER F 352  . ? 1_555 ? 
247 AF7 6  ARG F  363 ? ARG F 369  . ? 1_555 ? 
248 AF7 6  HOH AF .   ? HOH F 876  . ? 1_555 ? 
249 AF7 6  HOH AF .   ? HOH F 942  . ? 1_555 ? 
250 AF8 12 LYS E  38  ? LYS E 44   . ? 1_555 ? 
251 AF8 12 VAL E  322 ? VAL E 328  . ? 1_555 ? 
252 AF8 12 SER E  323 ? SER E 329  . ? 1_555 ? 
253 AF8 12 GLY E  324 ? GLY E 330  . ? 1_555 ? 
254 AF8 12 LYS F  38  ? LYS F 44   . ? 1_555 ? 
255 AF8 12 THR F  301 ? THR F 307  . ? 1_555 ? 
256 AF8 12 PRO F  303 ? PRO F 309  . ? 1_555 ? 
257 AF8 12 ALA F  304 ? ALA F 310  . ? 1_555 ? 
258 AF8 12 VAL F  322 ? VAL F 328  . ? 1_555 ? 
259 AF8 12 SER F  323 ? SER F 329  . ? 1_555 ? 
260 AF8 12 GLY F  324 ? GLY F 330  . ? 1_555 ? 
261 AF8 12 HOH AF .   ? HOH F 777  . ? 1_555 ? 
262 AF9 10 ARG G  28  ? ARG G 34   . ? 1_555 ? 
263 AF9 10 TYR G  34  ? TYR G 40   . ? 1_555 ? 
264 AF9 10 ARG G  40  ? ARG G 46   . ? 1_555 ? 
265 AF9 10 SER G  67  ? SER G 73   . ? 1_555 ? 
266 AF9 10 HIS G  374 ? HIS G 380  . ? 1_555 ? 
267 AF9 10 HOH BF .   ? HOH G 617  . ? 1_555 ? 
268 AF9 10 HOH BF .   ? HOH G 642  . ? 1_555 ? 
269 AF9 10 HOH BF .   ? HOH G 763  . ? 1_555 ? 
270 AF9 10 HOH BF .   ? HOH G 888  . ? 1_555 ? 
271 AF9 10 HOH BF .   ? HOH G 928  . ? 1_555 ? 
272 AG1 5  ARG G  313 ? ARG G 319  . ? 1_555 ? 
273 AG1 5  SER G  329 ? SER G 335  . ? 1_555 ? 
274 AG1 5  ASN G  345 ? ASN G 351  . ? 1_555 ? 
275 AG1 5  SER G  346 ? SER G 352  . ? 1_555 ? 
276 AG1 5  ARG G  363 ? ARG G 369  . ? 1_555 ? 
277 AG2 7  ARG G  263 ? ARG G 269  . ? 1_555 ? 
278 AG2 7  ASP G  264 ? ASP G 270  . ? 1_555 ? 
279 AG2 7  VAL G  265 ? VAL G 271  . ? 1_555 ? 
280 AG2 7  HOH BF .   ? HOH G 623  . ? 1_555 ? 
281 AG2 7  HOH BF .   ? HOH G 737  . ? 1_555 ? 
282 AG2 7  HOH BF .   ? HOH G 777  . ? 1_555 ? 
283 AG2 7  HOH BF .   ? HOH G 841  . ? 1_555 ? 
284 AG3 8  ARG G  80  ? ARG G 86   . ? 1_555 ? 
285 AG3 8  HOH BF .   ? HOH G 787  . ? 1_555 ? 
286 AG3 8  HOH BF .   ? HOH G 797  . ? 1_555 ? 
287 AG3 8  HOH BF .   ? HOH G 798  . ? 1_555 ? 
288 AG3 8  ARG H  80  ? ARG H 86   . ? 1_555 ? 
289 AG3 8  ALA O  298 ? ALA O 304  . ? 1_565 ? 
290 AG3 8  HOH JF .   ? HOH O 808  . ? 1_565 ? 
291 AG3 8  ALA P  298 ? ALA P 304  . ? 1_565 ? 
292 AG4 7  THR G  105 ? THR G 111  . ? 1_555 ? 
293 AG4 7  TYR G  204 ? TYR G 210  . ? 1_555 ? 
294 AG4 7  ASP G  227 ? ASP G 233  . ? 1_555 ? 
295 AG4 7  GLY G  229 ? GLY G 235  . ? 1_555 ? 
296 AG4 7  LYS G  230 ? LYS G 236  . ? 1_555 ? 
297 AG4 7  HOH BF .   ? HOH G 826  . ? 1_555 ? 
298 AG4 7  HOH BF .   ? HOH G 981  . ? 1_555 ? 
299 AG5 14 LYS G  38  ? LYS G 44   . ? 1_555 ? 
300 AG5 14 GLU G  299 ? GLU G 305  . ? 1_555 ? 
301 AG5 14 THR G  301 ? THR G 307  . ? 1_555 ? 
302 AG5 14 PRO G  302 ? PRO G 308  . ? 1_555 ? 
303 AG5 14 PRO G  303 ? PRO G 309  . ? 1_555 ? 
304 AG5 14 SER G  323 ? SER G 329  . ? 1_555 ? 
305 AG5 14 GLY G  324 ? GLY G 330  . ? 1_555 ? 
306 AG5 14 HOH BF .   ? HOH G 683  . ? 1_555 ? 
307 AG5 14 HOH BF .   ? HOH G 936  . ? 1_555 ? 
308 AG5 14 LYS H  38  ? LYS H 44   . ? 1_555 ? 
309 AG5 14 PRO H  303 ? PRO H 309  . ? 1_555 ? 
310 AG5 14 VAL H  322 ? VAL H 328  . ? 1_555 ? 
311 AG5 14 SER H  323 ? SER H 329  . ? 1_555 ? 
312 AG5 14 GLY H  324 ? GLY H 330  . ? 1_555 ? 
313 AG6 6  SER H  329 ? SER H 335  . ? 1_555 ? 
314 AG6 6  ASN H  345 ? ASN H 351  . ? 1_555 ? 
315 AG6 6  SER H  346 ? SER H 352  . ? 1_555 ? 
316 AG6 6  ARG H  363 ? ARG H 369  . ? 1_555 ? 
317 AG6 6  HOH CF .   ? HOH H 719  . ? 1_555 ? 
318 AG6 6  HOH CF .   ? HOH H 743  . ? 1_555 ? 
319 AG7 9  ARG H  28  ? ARG H 34   . ? 1_555 ? 
320 AG7 9  TYR H  34  ? TYR H 40   . ? 1_555 ? 
321 AG7 9  ARG H  40  ? ARG H 46   . ? 1_555 ? 
322 AG7 9  SER H  67  ? SER H 73   . ? 1_555 ? 
323 AG7 9  HIS H  374 ? HIS H 380  . ? 1_555 ? 
324 AG7 9  HOH CF .   ? HOH H 603  . ? 1_555 ? 
325 AG7 9  HOH CF .   ? HOH H 699  . ? 1_555 ? 
326 AG7 9  HOH CF .   ? HOH H 751  . ? 1_555 ? 
327 AG7 9  HOH CF .   ? HOH H 838  . ? 1_555 ? 
328 AG8 3  ARG H  396 ? ARG H 402  . ? 1_555 ? 
329 AG8 3  HOH CF .   ? HOH H 623  . ? 1_555 ? 
330 AG8 3  HOH CF .   ? HOH H 626  . ? 1_555 ? 
331 AG9 6  ARG I  313 ? ARG I 319  . ? 1_555 ? 
332 AG9 6  SER I  329 ? SER I 335  . ? 1_555 ? 
333 AG9 6  ASN I  345 ? ASN I 351  . ? 1_555 ? 
334 AG9 6  SER I  346 ? SER I 352  . ? 1_555 ? 
335 AG9 6  ARG I  363 ? ARG I 369  . ? 1_555 ? 
336 AG9 6  HOH DF .   ? HOH I 699  . ? 1_555 ? 
337 AH1 8  ARG I  28  ? ARG I 34   . ? 1_555 ? 
338 AH1 8  TYR I  34  ? TYR I 40   . ? 1_555 ? 
339 AH1 8  ARG I  40  ? ARG I 46   . ? 1_555 ? 
340 AH1 8  SER I  67  ? SER I 73   . ? 1_555 ? 
341 AH1 8  HIS I  374 ? HIS I 380  . ? 1_555 ? 
342 AH1 8  HOH DF .   ? HOH I 614  . ? 1_555 ? 
343 AH1 8  HOH DF .   ? HOH I 619  . ? 1_555 ? 
344 AH1 8  HOH DF .   ? HOH I 911  . ? 1_555 ? 
345 AH2 8  ARG I  263 ? ARG I 269  . ? 1_555 ? 
346 AH2 8  ASP I  264 ? ASP I 270  . ? 1_555 ? 
347 AH2 8  VAL I  265 ? VAL I 271  . ? 1_555 ? 
348 AH2 8  ALA I  270 ? ALA I 276  . ? 1_555 ? 
349 AH2 8  HOH DF .   ? HOH I 658  . ? 1_555 ? 
350 AH2 8  HOH DF .   ? HOH I 829  . ? 1_555 ? 
351 AH2 8  HOH DF .   ? HOH I 848  . ? 1_555 ? 
352 AH2 8  HOH DF .   ? HOH I 854  . ? 1_555 ? 
353 AH3 7  ASP I  269 ? ASP I 275  . ? 1_555 ? 
354 AH3 7  GLU I  399 ? GLU I 405  . ? 1_555 ? 
355 AH3 7  HOH DF .   ? HOH I 607  . ? 1_555 ? 
356 AH3 7  HOH DF .   ? HOH I 679  . ? 1_555 ? 
357 AH3 7  HOH DF .   ? HOH I 725  . ? 1_555 ? 
358 AH3 7  HOH DF .   ? HOH I 789  . ? 1_555 ? 
359 AH3 7  HOH DF .   ? HOH I 883  . ? 1_555 ? 
360 AH4 4  ASP I  280 ? ASP I 286  . ? 1_555 ? 
361 AH4 4  VAL I  281 ? VAL I 287  . ? 1_555 ? 
362 AH4 4  VAL I  282 ? VAL I 288  . ? 1_555 ? 
363 AH4 4  HOH DF .   ? HOH I 937  . ? 1_555 ? 
364 AH5 6  THR I  105 ? THR I 111  . ? 1_555 ? 
365 AH5 6  TYR I  204 ? TYR I 210  . ? 1_555 ? 
366 AH5 6  ASP I  227 ? ASP I 233  . ? 1_555 ? 
367 AH5 6  PHE I  228 ? PHE I 234  . ? 1_555 ? 
368 AH5 6  GLY I  229 ? GLY I 235  . ? 1_555 ? 
369 AH5 6  HOH DF .   ? HOH I 632  . ? 1_555 ? 
370 AH6 6  ARG I  17  ? ARG I 23   . ? 1_555 ? 
371 AH6 6  GLY I  18  ? GLY I 24   . ? 1_555 ? 
372 AH6 6  SER I  19  ? SER I 25   . ? 1_555 ? 
373 AH6 6  ARG I  20  ? ARG I 26   . ? 1_555 ? 
374 AH6 6  HOH DF .   ? HOH I 741  . ? 1_555 ? 
375 AH6 6  HOH DF .   ? HOH I 766  . ? 1_555 ? 
376 AH7 13 LYS I  38  ? LYS I 44   . ? 1_555 ? 
377 AH7 13 PRO I  303 ? PRO I 309  . ? 1_555 ? 
378 AH7 13 ALA I  304 ? ALA I 310  . ? 1_555 ? 
379 AH7 13 VAL I  322 ? VAL I 328  . ? 1_555 ? 
380 AH7 13 SER I  323 ? SER I 329  . ? 1_555 ? 
381 AH7 13 GLY I  324 ? GLY I 330  . ? 1_555 ? 
382 AH7 13 HOH DF .   ? HOH I 627  . ? 1_555 ? 
383 AH7 13 LYS J  38  ? LYS J 44   . ? 1_555 ? 
384 AH7 13 THR J  301 ? THR J 307  . ? 1_555 ? 
385 AH7 13 PRO J  303 ? PRO J 309  . ? 1_555 ? 
386 AH7 13 VAL J  322 ? VAL J 328  . ? 1_555 ? 
387 AH7 13 SER J  323 ? SER J 329  . ? 1_555 ? 
388 AH7 13 GLY J  324 ? GLY J 330  . ? 1_555 ? 
389 AH8 6  SER J  329 ? SER J 335  . ? 1_555 ? 
390 AH8 6  ASN J  345 ? ASN J 351  . ? 1_555 ? 
391 AH8 6  SER J  346 ? SER J 352  . ? 1_555 ? 
392 AH8 6  ARG J  363 ? ARG J 369  . ? 1_555 ? 
393 AH8 6  HOH EF .   ? HOH J 795  . ? 1_555 ? 
394 AH8 6  HOH EF .   ? HOH J 968  . ? 1_555 ? 
395 AH9 7  ARG J  28  ? ARG J 34   . ? 1_555 ? 
396 AH9 7  TYR J  34  ? TYR J 40   . ? 1_555 ? 
397 AH9 7  ARG J  40  ? ARG J 46   . ? 1_555 ? 
398 AH9 7  SER J  67  ? SER J 73   . ? 1_555 ? 
399 AH9 7  HOH EF .   ? HOH J 628  . ? 1_555 ? 
400 AH9 7  HOH EF .   ? HOH J 703  . ? 1_555 ? 
401 AH9 7  HOH EF .   ? HOH J 797  . ? 1_555 ? 
402 AI1 5  LYS J  22  ? LYS J 28   . ? 1_555 ? 
403 AI1 5  ARG J  396 ? ARG J 402  . ? 1_555 ? 
404 AI1 5  HOH EF .   ? HOH J 635  . ? 1_555 ? 
405 AI1 5  HOH EF .   ? HOH J 654  . ? 1_555 ? 
406 AI1 5  HOH EF .   ? HOH J 772  . ? 1_555 ? 
407 AI2 6  GLY J  18  ? GLY J 24   . ? 1_555 ? 
408 AI2 6  SER J  19  ? SER J 25   . ? 1_555 ? 
409 AI2 6  ARG J  20  ? ARG J 26   . ? 1_555 ? 
410 AI2 6  HOH EF .   ? HOH J 642  . ? 1_555 ? 
411 AI2 6  HOH EF .   ? HOH J 664  . ? 1_555 ? 
412 AI2 6  HOH EF .   ? HOH J 677  . ? 1_555 ? 
413 AI3 7  THR J  105 ? THR J 111  . ? 1_555 ? 
414 AI3 7  GLY J  202 ? GLY J 208  . ? 1_555 ? 
415 AI3 7  TYR J  204 ? TYR J 210  . ? 1_555 ? 
416 AI3 7  ASP J  227 ? ASP J 233  . ? 1_555 ? 
417 AI3 7  PHE J  228 ? PHE J 234  . ? 1_555 ? 
418 AI3 7  GLY J  229 ? GLY J 235  . ? 1_555 ? 
419 AI3 7  HOH EF .   ? HOH J 679  . ? 1_555 ? 
420 AI4 10 ARG I  80  ? ARG I 86   . ? 1_555 ? 
421 AI4 10 ARG J  80  ? ARG J 86   . ? 1_555 ? 
422 AI4 10 GLU J  82  ? GLU J 88   . ? 1_555 ? 
423 AI4 10 HOH EF .   ? HOH J 618  . ? 1_555 ? 
424 AI4 10 HOH EF .   ? HOH J 680  . ? 1_555 ? 
425 AI4 10 HOH EF .   ? HOH J 901  . ? 1_555 ? 
426 AI4 10 ALA M  298 ? ALA M 304  . ? 1_555 ? 
427 AI4 10 ILE M  300 ? ILE M 306  . ? 1_555 ? 
428 AI4 10 HOH HF .   ? HOH M 817  . ? 1_555 ? 
429 AI4 10 ALA N  298 ? ALA N 304  . ? 1_555 ? 
430 AI5 6  ASP J  286 ? ASP J 292  . ? 1_555 ? 
431 AI5 6  TYR J  288 ? TYR J 294  . ? 1_555 ? 
432 AI5 6  HOH EF .   ? HOH J 603  . ? 1_555 ? 
433 AI5 6  HOH EF .   ? HOH J 625  . ? 1_555 ? 
434 AI5 6  HOH EF .   ? HOH J 666  . ? 1_555 ? 
435 AI5 6  HOH EF .   ? HOH J 714  . ? 1_555 ? 
436 AI6 7  ARG K  313 ? ARG K 319  . ? 1_555 ? 
437 AI6 7  SER K  329 ? SER K 335  . ? 1_555 ? 
438 AI6 7  ASN K  345 ? ASN K 351  . ? 1_555 ? 
439 AI6 7  SER K  346 ? SER K 352  . ? 1_555 ? 
440 AI6 7  ARG K  363 ? ARG K 369  . ? 1_555 ? 
441 AI6 7  SO4 DC .   ? SO4 K 503  . ? 1_555 ? 
442 AI6 7  HOH FF .   ? HOH K 743  . ? 1_555 ? 
443 AI7 6  ARG K  28  ? ARG K 34   . ? 1_555 ? 
444 AI7 6  TYR K  34  ? TYR K 40   . ? 1_555 ? 
445 AI7 6  ARG K  40  ? ARG K 46   . ? 1_555 ? 
446 AI7 6  SER K  67  ? SER K 73   . ? 1_555 ? 
447 AI7 6  HOH FF .   ? HOH K 613  . ? 1_555 ? 
448 AI7 6  HOH FF .   ? HOH K 840  . ? 1_555 ? 
449 AI8 4  ARG K  313 ? ARG K 319  . ? 1_555 ? 
450 AI8 4  ARG K  363 ? ARG K 369  . ? 1_555 ? 
451 AI8 4  SO4 BC .   ? SO4 K 501  . ? 1_555 ? 
452 AI8 4  HOH FF .   ? HOH K 670  . ? 1_555 ? 
453 AI9 7  THR K  105 ? THR K 111  . ? 1_555 ? 
454 AI9 7  TYR K  204 ? TYR K 210  . ? 1_555 ? 
455 AI9 7  ASP K  227 ? ASP K 233  . ? 1_555 ? 
456 AI9 7  PHE K  228 ? PHE K 234  . ? 1_555 ? 
457 AI9 7  GLY K  229 ? GLY K 235  . ? 1_555 ? 
458 AI9 7  HOH FF .   ? HOH K 866  . ? 1_555 ? 
459 AI9 7  HOH FF .   ? HOH K 980  . ? 1_555 ? 
460 AJ1 8  PRO K  283 ? PRO K 289  . ? 1_555 ? 
461 AJ1 8  LEU K  285 ? LEU K 291  . ? 1_555 ? 
462 AJ1 8  ASP K  286 ? ASP K 292  . ? 1_555 ? 
463 AJ1 8  ILE K  287 ? ILE K 293  . ? 1_555 ? 
464 AJ1 8  TYR K  288 ? TYR K 294  . ? 1_555 ? 
465 AJ1 8  HOH FF .   ? HOH K 689  . ? 1_555 ? 
466 AJ1 8  HOH FF .   ? HOH K 716  . ? 1_555 ? 
467 AJ1 8  LYS L  305 ? LYS L 311  . ? 1_555 ? 
468 AJ2 5  SER L  329 ? SER L 335  . ? 1_555 ? 
469 AJ2 5  ASN L  345 ? ASN L 351  . ? 1_555 ? 
470 AJ2 5  SER L  346 ? SER L 352  . ? 1_555 ? 
471 AJ2 5  ARG L  363 ? ARG L 369  . ? 1_555 ? 
472 AJ2 5  HOH GF .   ? HOH L 886  . ? 1_555 ? 
473 AJ3 8  ARG L  28  ? ARG L 34   . ? 1_555 ? 
474 AJ3 8  TYR L  34  ? TYR L 40   . ? 1_555 ? 
475 AJ3 8  ARG L  40  ? ARG L 46   . ? 1_555 ? 
476 AJ3 8  SER L  67  ? SER L 73   . ? 1_555 ? 
477 AJ3 8  HOH GF .   ? HOH L 652  . ? 1_555 ? 
478 AJ3 8  HOH GF .   ? HOH L 864  . ? 1_555 ? 
479 AJ3 8  HOH GF .   ? HOH L 884  . ? 1_555 ? 
480 AJ3 8  HOH GF .   ? HOH L 891  . ? 1_555 ? 
481 AJ4 7  ARG L  263 ? ARG L 269  . ? 1_555 ? 
482 AJ4 7  ASP L  264 ? ASP L 270  . ? 1_555 ? 
483 AJ4 7  VAL L  265 ? VAL L 271  . ? 1_555 ? 
484 AJ4 7  HOH GF .   ? HOH L 624  . ? 1_555 ? 
485 AJ4 7  HOH GF .   ? HOH L 665  . ? 1_555 ? 
486 AJ4 7  HOH GF .   ? HOH L 716  . ? 1_555 ? 
487 AJ4 7  HOH GF .   ? HOH L 833  . ? 1_555 ? 
488 AJ5 5  THR L  398 ? THR L 404  . ? 1_555 ? 
489 AJ5 5  GLU L  399 ? GLU L 405  . ? 1_555 ? 
490 AJ5 5  HOH GF .   ? HOH L 631  . ? 1_555 ? 
491 AJ5 5  HOH GF .   ? HOH L 679  . ? 1_555 ? 
492 AJ5 5  HOH GF .   ? HOH L 733  . ? 1_555 ? 
493 AJ6 8  THR L  105 ? THR L 111  . ? 1_555 ? 
494 AJ6 8  TYR L  204 ? TYR L 210  . ? 1_555 ? 
495 AJ6 8  ASP L  227 ? ASP L 233  . ? 1_555 ? 
496 AJ6 8  PHE L  228 ? PHE L 234  . ? 1_555 ? 
497 AJ6 8  GLY L  229 ? GLY L 235  . ? 1_555 ? 
498 AJ6 8  HOH GF .   ? HOH L 673  . ? 1_555 ? 
499 AJ6 8  HOH GF .   ? HOH L 791  . ? 1_555 ? 
500 AJ6 8  HOH GF .   ? HOH L 901  . ? 1_555 ? 
501 AJ7 3  ARG E  313 ? ARG E 319  . ? 1_444 ? 
502 AJ7 3  ARG E  363 ? ARG E 369  . ? 1_444 ? 
503 AJ7 3  HOH ZE .   ? HOH E 616  . ? 1_444 ? 
504 AJ8 11 LYS K  38  ? LYS K 44   . ? 1_555 ? 
505 AJ8 11 PRO K  303 ? PRO K 309  . ? 1_555 ? 
506 AJ8 11 SER K  323 ? SER K 329  . ? 1_555 ? 
507 AJ8 11 GLY K  324 ? GLY K 330  . ? 1_555 ? 
508 AJ8 11 LYS L  38  ? LYS L 44   . ? 1_555 ? 
509 AJ8 11 THR L  301 ? THR L 307  . ? 1_555 ? 
510 AJ8 11 PRO L  302 ? PRO L 308  . ? 1_555 ? 
511 AJ8 11 PRO L  303 ? PRO L 309  . ? 1_555 ? 
512 AJ8 11 VAL L  322 ? VAL L 328  . ? 1_555 ? 
513 AJ8 11 SER L  323 ? SER L 329  . ? 1_555 ? 
514 AJ8 11 GLY L  324 ? GLY L 330  . ? 1_555 ? 
515 AJ9 7  ARG M  28  ? ARG M 34   . ? 1_555 ? 
516 AJ9 7  TYR M  34  ? TYR M 40   . ? 1_555 ? 
517 AJ9 7  ARG M  40  ? ARG M 46   . ? 1_555 ? 
518 AJ9 7  SER M  67  ? SER M 73   . ? 1_555 ? 
519 AJ9 7  HOH HF .   ? HOH M 787  . ? 1_555 ? 
520 AJ9 7  HOH HF .   ? HOH M 795  . ? 1_555 ? 
521 AJ9 7  HOH HF .   ? HOH M 931  . ? 1_555 ? 
522 AK1 9  SER M  329 ? SER M 335  . ? 1_555 ? 
523 AK1 9  ASN M  345 ? ASN M 351  . ? 1_555 ? 
524 AK1 9  SER M  346 ? SER M 352  . ? 1_555 ? 
525 AK1 9  ARG M  363 ? ARG M 369  . ? 1_555 ? 
526 AK1 9  HOH HF .   ? HOH M 788  . ? 1_555 ? 
527 AK1 9  HOH HF .   ? HOH M 804  . ? 1_555 ? 
528 AK1 9  HOH HF .   ? HOH M 828  . ? 1_555 ? 
529 AK1 9  HOH HF .   ? HOH M 881  . ? 1_555 ? 
530 AK1 9  HOH HF .   ? HOH M 918  . ? 1_555 ? 
531 AK2 8  ARG M  263 ? ARG M 269  . ? 1_555 ? 
532 AK2 8  ASP M  264 ? ASP M 270  . ? 1_555 ? 
533 AK2 8  VAL M  265 ? VAL M 271  . ? 1_555 ? 
534 AK2 8  ALA M  270 ? ALA M 276  . ? 1_555 ? 
535 AK2 8  HOH HF .   ? HOH M 693  . ? 1_555 ? 
536 AK2 8  HOH HF .   ? HOH M 749  . ? 1_555 ? 
537 AK2 8  HOH HF .   ? HOH M 766  . ? 1_555 ? 
538 AK2 8  HOH HF .   ? HOH M 858  . ? 1_555 ? 
539 AK3 8  GLU I  85  ? GLU I 91   . ? 1_555 ? 
540 AK3 8  HOH DF .   ? HOH I 676  . ? 1_555 ? 
541 AK3 8  LEU M  50  ? LEU M 56   . ? 1_555 ? 
542 AK3 8  ARG M  55  ? ARG M 61   . ? 1_555 ? 
543 AK3 8  GLU M  85  ? GLU M 91   . ? 1_555 ? 
544 AK3 8  HOH HF .   ? HOH M 661  . ? 1_555 ? 
545 AK3 8  HOH HF .   ? HOH M 731  . ? 1_555 ? 
546 AK3 8  HOH HF .   ? HOH M 780  . ? 1_555 ? 
547 AK4 6  THR M  105 ? THR M 111  . ? 1_555 ? 
548 AK4 6  TYR M  204 ? TYR M 210  . ? 1_555 ? 
549 AK4 6  ASP M  227 ? ASP M 233  . ? 1_555 ? 
550 AK4 6  PHE M  228 ? PHE M 234  . ? 1_555 ? 
551 AK4 6  GLY M  229 ? GLY M 235  . ? 1_555 ? 
552 AK4 6  HOH HF .   ? HOH M 767  . ? 1_555 ? 
553 AK5 7  GLY M  15  ? GLY M 21   . ? 1_555 ? 
554 AK5 7  ALA M  60  ? ALA M 66   . ? 1_555 ? 
555 AK5 7  GLN M  62  ? GLN M 68   . ? 1_555 ? 
556 AK5 7  TYR M  102 ? TYR M 108  . ? 1_555 ? 
557 AK5 7  THR M  105 ? THR M 111  . ? 1_555 ? 
558 AK5 7  HOH HF .   ? HOH M 637  . ? 1_555 ? 
559 AK5 7  HOH HF .   ? HOH M 856  . ? 1_555 ? 
560 AK6 4  ASP M  269 ? ASP M 275  . ? 1_555 ? 
561 AK6 4  THR M  398 ? THR M 404  . ? 1_555 ? 
562 AK6 4  GLU M  399 ? GLU M 405  . ? 1_555 ? 
563 AK6 4  HOH HF .   ? HOH M 681  . ? 1_555 ? 
564 AK7 14 LYS M  38  ? LYS M 44   . ? 1_555 ? 
565 AK7 14 THR M  301 ? THR M 307  . ? 1_555 ? 
566 AK7 14 PRO M  303 ? PRO M 309  . ? 1_555 ? 
567 AK7 14 ALA M  304 ? ALA M 310  . ? 1_555 ? 
568 AK7 14 VAL M  322 ? VAL M 328  . ? 1_555 ? 
569 AK7 14 SER M  323 ? SER M 329  . ? 1_555 ? 
570 AK7 14 GLY M  324 ? GLY M 330  . ? 1_555 ? 
571 AK7 14 HOH HF .   ? HOH M 1001 . ? 1_555 ? 
572 AK7 14 LYS N  38  ? LYS N 44   . ? 1_555 ? 
573 AK7 14 PRO N  303 ? PRO N 309  . ? 1_555 ? 
574 AK7 14 ALA N  304 ? ALA N 310  . ? 1_555 ? 
575 AK7 14 VAL N  322 ? VAL N 328  . ? 1_555 ? 
576 AK7 14 SER N  323 ? SER N 329  . ? 1_555 ? 
577 AK7 14 GLY N  324 ? GLY N 330  . ? 1_555 ? 
578 AK8 6  SER N  329 ? SER N 335  . ? 1_555 ? 
579 AK8 6  ASN N  345 ? ASN N 351  . ? 1_555 ? 
580 AK8 6  SER N  346 ? SER N 352  . ? 1_555 ? 
581 AK8 6  ARG N  363 ? ARG N 369  . ? 1_555 ? 
582 AK8 6  HOH IF .   ? HOH N 656  . ? 1_555 ? 
583 AK8 6  HOH IF .   ? HOH N 700  . ? 1_555 ? 
584 AK9 9  ARG N  28  ? ARG N 34   . ? 1_555 ? 
585 AK9 9  TYR N  34  ? TYR N 40   . ? 1_555 ? 
586 AK9 9  ARG N  40  ? ARG N 46   . ? 1_555 ? 
587 AK9 9  SER N  67  ? SER N 73   . ? 1_555 ? 
588 AK9 9  ARG N  70  ? ARG N 76   . ? 1_555 ? 
589 AK9 9  HIS N  374 ? HIS N 380  . ? 1_555 ? 
590 AK9 9  HOH IF .   ? HOH N 710  . ? 1_555 ? 
591 AK9 9  HOH IF .   ? HOH N 722  . ? 1_555 ? 
592 AK9 9  HOH IF .   ? HOH N 800  . ? 1_555 ? 
593 AL1 5  ARG N  263 ? ARG N 269  . ? 1_555 ? 
594 AL1 5  ASP N  264 ? ASP N 270  . ? 1_555 ? 
595 AL1 5  VAL N  265 ? VAL N 271  . ? 1_555 ? 
596 AL1 5  ALA N  270 ? ALA N 276  . ? 1_555 ? 
597 AL1 5  HOH IF .   ? HOH N 758  . ? 1_555 ? 
598 AL2 6  THR N  105 ? THR N 111  . ? 1_555 ? 
599 AL2 6  TYR N  204 ? TYR N 210  . ? 1_555 ? 
600 AL2 6  ASP N  227 ? ASP N 233  . ? 1_555 ? 
601 AL2 6  PHE N  228 ? PHE N 234  . ? 1_555 ? 
602 AL2 6  GLY N  229 ? GLY N 235  . ? 1_555 ? 
603 AL2 6  HOH IF .   ? HOH N 921  . ? 1_555 ? 
604 AL3 4  ARG N  313 ? ARG N 319  . ? 1_555 ? 
605 AL3 4  ARG N  363 ? ARG N 369  . ? 1_555 ? 
606 AL3 4  HOH IF .   ? HOH N 610  . ? 1_555 ? 
607 AL3 4  HOH IF .   ? HOH N 869  . ? 1_555 ? 
608 AL4 8  ARG O  28  ? ARG O 34   . ? 1_555 ? 
609 AL4 8  TYR O  34  ? TYR O 40   . ? 1_555 ? 
610 AL4 8  ARG O  40  ? ARG O 46   . ? 1_555 ? 
611 AL4 8  SER O  67  ? SER O 73   . ? 1_555 ? 
612 AL4 8  HIS O  374 ? HIS O 380  . ? 1_555 ? 
613 AL4 8  HOH JF .   ? HOH O 624  . ? 1_555 ? 
614 AL4 8  HOH JF .   ? HOH O 711  . ? 1_555 ? 
615 AL4 8  HOH JF .   ? HOH O 773  . ? 1_555 ? 
616 AL5 9  SER O  329 ? SER O 335  . ? 1_555 ? 
617 AL5 9  ASN O  345 ? ASN O 351  . ? 1_555 ? 
618 AL5 9  SER O  346 ? SER O 352  . ? 1_555 ? 
619 AL5 9  ARG O  363 ? ARG O 369  . ? 1_555 ? 
620 AL5 9  HOH JF .   ? HOH O 644  . ? 1_555 ? 
621 AL5 9  HOH JF .   ? HOH O 720  . ? 1_555 ? 
622 AL5 9  HOH JF .   ? HOH O 794  . ? 1_555 ? 
623 AL5 9  HOH JF .   ? HOH O 882  . ? 1_555 ? 
624 AL5 9  HOH JF .   ? HOH O 928  . ? 1_555 ? 
625 AL6 8  ARG O  263 ? ARG O 269  . ? 1_555 ? 
626 AL6 8  ASP O  264 ? ASP O 270  . ? 1_555 ? 
627 AL6 8  VAL O  265 ? VAL O 271  . ? 1_555 ? 
628 AL6 8  HOH JF .   ? HOH O 613  . ? 1_555 ? 
629 AL6 8  HOH JF .   ? HOH O 669  . ? 1_555 ? 
630 AL6 8  HOH JF .   ? HOH O 761  . ? 1_555 ? 
631 AL6 8  HOH JF .   ? HOH O 785  . ? 1_555 ? 
632 AL6 8  HOH JF .   ? HOH O 866  . ? 1_555 ? 
633 AL7 4  ILE O  190 ? ILE O 196  . ? 1_555 ? 
634 AL7 4  ASN O  193 ? ASN O 199  . ? 1_555 ? 
635 AL7 4  ARG O  246 ? ARG O 252  . ? 1_555 ? 
636 AL7 4  HOH JF .   ? HOH O 698  . ? 1_555 ? 
637 AL8 6  LEU O  156 ? LEU O 162  . ? 1_555 ? 
638 AL8 6  GLU O  157 ? GLU O 163  . ? 1_555 ? 
639 AL8 6  ALA O  248 ? ALA O 254  . ? 1_555 ? 
640 AL8 6  PRO O  260 ? PRO O 266  . ? 1_555 ? 
641 AL8 6  HOH JF .   ? HOH O 611  . ? 1_555 ? 
642 AL8 6  HOH JF .   ? HOH O 793  . ? 1_555 ? 
643 AL9 8  ALA G  298 ? ALA G 304  . ? 1_545 ? 
644 AL9 8  ILE G  300 ? ILE G 306  . ? 1_545 ? 
645 AL9 8  ALA H  298 ? ALA H 304  . ? 1_545 ? 
646 AL9 8  ARG O  80  ? ARG O 86   . ? 1_555 ? 
647 AL9 8  HOH JF .   ? HOH O 609  . ? 1_555 ? 
648 AL9 8  HOH JF .   ? HOH O 622  . ? 1_555 ? 
649 AL9 8  HOH JF .   ? HOH O 637  . ? 1_555 ? 
650 AL9 8  HOH JF .   ? HOH O 649  . ? 1_555 ? 
651 AM1 7  THR O  105 ? THR O 111  . ? 1_555 ? 
652 AM1 7  TYR O  204 ? TYR O 210  . ? 1_555 ? 
653 AM1 7  GLY O  229 ? GLY O 235  . ? 1_555 ? 
654 AM1 7  LYS O  230 ? LYS O 236  . ? 1_555 ? 
655 AM1 7  HOH JF .   ? HOH O 638  . ? 1_555 ? 
656 AM1 7  HOH JF .   ? HOH O 790  . ? 1_555 ? 
657 AM1 7  HOH JF .   ? HOH O 820  . ? 1_555 ? 
658 AM2 15 LYS O  38  ? LYS O 44   . ? 1_555 ? 
659 AM2 15 THR O  301 ? THR O 307  . ? 1_555 ? 
660 AM2 15 PRO O  303 ? PRO O 309  . ? 1_555 ? 
661 AM2 15 VAL O  322 ? VAL O 328  . ? 1_555 ? 
662 AM2 15 SER O  323 ? SER O 329  . ? 1_555 ? 
663 AM2 15 GLY O  324 ? GLY O 330  . ? 1_555 ? 
664 AM2 15 LYS P  38  ? LYS P 44   . ? 1_555 ? 
665 AM2 15 THR P  301 ? THR P 307  . ? 1_555 ? 
666 AM2 15 PRO P  302 ? PRO P 308  . ? 1_555 ? 
667 AM2 15 PRO P  303 ? PRO P 309  . ? 1_555 ? 
668 AM2 15 VAL P  322 ? VAL P 328  . ? 1_555 ? 
669 AM2 15 SER P  323 ? SER P 329  . ? 1_555 ? 
670 AM2 15 GLY P  324 ? GLY P 330  . ? 1_555 ? 
671 AM2 15 HOH KF .   ? HOH P 916  . ? 1_555 ? 
672 AM2 15 HOH KF .   ? HOH P 935  . ? 1_555 ? 
673 AM3 8  SER P  329 ? SER P 335  . ? 1_555 ? 
674 AM3 8  ASN P  345 ? ASN P 351  . ? 1_555 ? 
675 AM3 8  SER P  346 ? SER P 352  . ? 1_555 ? 
676 AM3 8  ARG P  363 ? ARG P 369  . ? 1_555 ? 
677 AM3 8  HOH KF .   ? HOH P 737  . ? 1_555 ? 
678 AM3 8  HOH KF .   ? HOH P 799  . ? 1_555 ? 
679 AM3 8  HOH KF .   ? HOH P 822  . ? 1_555 ? 
680 AM3 8  HOH KF .   ? HOH P 911  . ? 1_555 ? 
681 AM4 7  ARG P  28  ? ARG P 34   . ? 1_555 ? 
682 AM4 7  TYR P  34  ? TYR P 40   . ? 1_555 ? 
683 AM4 7  ARG P  40  ? ARG P 46   . ? 1_555 ? 
684 AM4 7  SER P  67  ? SER P 73   . ? 1_555 ? 
685 AM4 7  HOH KF .   ? HOH P 630  . ? 1_555 ? 
686 AM4 7  HOH KF .   ? HOH P 683  . ? 1_555 ? 
687 AM4 7  HOH KF .   ? HOH P 824  . ? 1_555 ? 
688 AM5 7  ARG P  263 ? ARG P 269  . ? 1_555 ? 
689 AM5 7  ASP P  264 ? ASP P 270  . ? 1_555 ? 
690 AM5 7  VAL P  265 ? VAL P 271  . ? 1_555 ? 
691 AM5 7  HOH KF .   ? HOH P 606  . ? 1_555 ? 
692 AM5 7  HOH KF .   ? HOH P 616  . ? 1_555 ? 
693 AM5 7  HOH KF .   ? HOH P 713  . ? 1_555 ? 
694 AM5 7  HOH KF .   ? HOH P 923  . ? 1_555 ? 
695 AM6 3  ARG P  313 ? ARG P 319  . ? 1_555 ? 
696 AM6 3  ARG P  363 ? ARG P 369  . ? 1_555 ? 
697 AM6 3  HOH KF .   ? HOH P 682  . ? 1_555 ? 
698 AM7 6  ARG P  20  ? ARG P 26   . ? 1_555 ? 
699 AM7 6  GLU P  399 ? GLU P 405  . ? 1_555 ? 
700 AM7 6  HOH KF .   ? HOH P 628  . ? 1_555 ? 
701 AM7 6  HOH KF .   ? HOH P 659  . ? 1_555 ? 
702 AM7 6  HOH KF .   ? HOH P 779  . ? 1_555 ? 
703 AM7 6  HOH KF .   ? HOH P 907  . ? 1_555 ? 
704 AM8 6  ILE P  190 ? ILE P 196  . ? 1_555 ? 
705 AM8 6  ASN P  193 ? ASN P 199  . ? 1_555 ? 
706 AM8 6  ARG P  246 ? ARG P 252  . ? 1_555 ? 
707 AM8 6  HOH KF .   ? HOH P 643  . ? 1_555 ? 
708 AM8 6  HOH KF .   ? HOH P 655  . ? 1_555 ? 
709 AM8 6  HOH KF .   ? HOH P 695  . ? 1_555 ? 
710 AM9 7  SER Q  329 ? SER Q 335  . ? 1_555 ? 
711 AM9 7  ASN Q  345 ? ASN Q 351  . ? 1_555 ? 
712 AM9 7  SER Q  346 ? SER Q 352  . ? 1_555 ? 
713 AM9 7  ARG Q  363 ? ARG Q 369  . ? 1_555 ? 
714 AM9 7  HOH LF .   ? HOH Q 699  . ? 1_555 ? 
715 AM9 7  HOH LF .   ? HOH Q 781  . ? 1_555 ? 
716 AM9 7  HOH LF .   ? HOH Q 850  . ? 1_555 ? 
717 AN1 5  ARG Q  28  ? ARG Q 34   . ? 1_555 ? 
718 AN1 5  TYR Q  34  ? TYR Q 40   . ? 1_555 ? 
719 AN1 5  ARG Q  40  ? ARG Q 46   . ? 1_555 ? 
720 AN1 5  SER Q  67  ? SER Q 73   . ? 1_555 ? 
721 AN1 5  HOH LF .   ? HOH Q 683  . ? 1_555 ? 
722 AN2 10 ARG Q  263 ? ARG Q 269  . ? 1_555 ? 
723 AN2 10 ASP Q  264 ? ASP Q 270  . ? 1_555 ? 
724 AN2 10 VAL Q  265 ? VAL Q 271  . ? 1_555 ? 
725 AN2 10 HOH LF .   ? HOH Q 605  . ? 1_555 ? 
726 AN2 10 HOH LF .   ? HOH Q 651  . ? 1_555 ? 
727 AN2 10 HOH LF .   ? HOH Q 679  . ? 1_555 ? 
728 AN2 10 HOH LF .   ? HOH Q 804  . ? 1_555 ? 
729 AN2 10 HOH LF .   ? HOH Q 905  . ? 1_555 ? 
730 AN2 10 HOH LF .   ? HOH Q 919  . ? 1_555 ? 
731 AN2 10 HOH LF .   ? HOH Q 946  . ? 1_555 ? 
732 AN3 7  LEU Q  156 ? LEU Q 162  . ? 1_555 ? 
733 AN3 7  GLU Q  157 ? GLU Q 163  . ? 1_555 ? 
734 AN3 7  ALA Q  248 ? ALA Q 254  . ? 1_555 ? 
735 AN3 7  PRO Q  260 ? PRO Q 266  . ? 1_555 ? 
736 AN3 7  GOL YD .   ? GOL Q 511  . ? 1_555 ? 
737 AN3 7  HOH LF .   ? HOH Q 644  . ? 1_555 ? 
738 AN3 7  HOH LF .   ? HOH Q 736  . ? 1_555 ? 
739 AN4 5  THR Q  398 ? THR Q 404  . ? 1_555 ? 
740 AN4 5  GLU Q  399 ? GLU Q 405  . ? 1_555 ? 
741 AN4 5  HOH LF .   ? HOH Q 626  . ? 1_555 ? 
742 AN4 5  HOH LF .   ? HOH Q 655  . ? 1_555 ? 
743 AN4 5  HOH LF .   ? HOH Q 865  . ? 1_555 ? 
744 AN5 6  THR Q  105 ? THR Q 111  . ? 1_555 ? 
745 AN5 6  TYR Q  204 ? TYR Q 210  . ? 1_555 ? 
746 AN5 6  PHE Q  228 ? PHE Q 234  . ? 1_555 ? 
747 AN5 6  GLY Q  229 ? GLY Q 235  . ? 1_555 ? 
748 AN5 6  HOH LF .   ? HOH Q 650  . ? 1_555 ? 
749 AN5 6  HOH LF .   ? HOH Q 862  . ? 1_555 ? 
750 AN6 6  ILE Q  190 ? ILE Q 196  . ? 1_555 ? 
751 AN6 6  ASN Q  193 ? ASN Q 199  . ? 1_555 ? 
752 AN6 6  ARG Q  246 ? ARG Q 252  . ? 1_555 ? 
753 AN6 6  HOH LF .   ? HOH Q 788  . ? 1_555 ? 
754 AN6 6  HOH LF .   ? HOH Q 817  . ? 1_555 ? 
755 AN6 6  HOH LF .   ? HOH Q 979  . ? 1_555 ? 
756 AN7 4  LYS Q  22  ? LYS Q 28   . ? 1_555 ? 
757 AN7 4  ARG Q  396 ? ARG Q 402  . ? 1_555 ? 
758 AN7 4  HOH LF .   ? HOH Q 602  . ? 1_555 ? 
759 AN7 4  HOH LF .   ? HOH Q 925  . ? 1_555 ? 
760 AN8 5  ARG Q  313 ? ARG Q 319  . ? 1_555 ? 
761 AN8 5  ARG Q  363 ? ARG Q 369  . ? 1_555 ? 
762 AN8 5  HOH LF .   ? HOH Q 654  . ? 1_555 ? 
763 AN8 5  HOH LF .   ? HOH Q 792  . ? 1_555 ? 
764 AN8 5  HOH LF .   ? HOH Q 805  . ? 1_555 ? 
765 AN9 9  ARG E  80  ? ARG E 86   . ? 1_545 ? 
766 AN9 9  ARG F  80  ? ARG F 86   . ? 1_545 ? 
767 AN9 9  ALA Q  298 ? ALA Q 304  . ? 1_555 ? 
768 AN9 9  HOH LF .   ? HOH Q 627  . ? 1_555 ? 
769 AN9 9  HOH LF .   ? HOH Q 660  . ? 1_555 ? 
770 AN9 9  HOH LF .   ? HOH Q 670  . ? 1_555 ? 
771 AN9 9  HOH LF .   ? HOH Q 821  . ? 1_555 ? 
772 AN9 9  HOH LF .   ? HOH Q 947  . ? 1_555 ? 
773 AN9 9  ALA R  298 ? ALA R 304  . ? 1_555 ? 
774 AO1 5  PRO Q  260 ? PRO Q 266  . ? 1_555 ? 
775 AO1 5  SO4 RD .   ? SO4 Q 504  . ? 1_555 ? 
776 AO1 5  HOH LF .   ? HOH Q 618  . ? 1_555 ? 
777 AO1 5  HOH LF .   ? HOH Q 662  . ? 1_555 ? 
778 AO1 5  HOH LF .   ? HOH Q 666  . ? 1_555 ? 
779 AO2 9  SER R  329 ? SER R 335  . ? 1_555 ? 
780 AO2 9  ASN R  345 ? ASN R 351  . ? 1_555 ? 
781 AO2 9  SER R  346 ? SER R 352  . ? 1_555 ? 
782 AO2 9  ARG R  363 ? ARG R 369  . ? 1_555 ? 
783 AO2 9  HOH MF .   ? HOH R 694  . ? 1_555 ? 
784 AO2 9  HOH MF .   ? HOH R 699  . ? 1_555 ? 
785 AO2 9  HOH MF .   ? HOH R 789  . ? 1_555 ? 
786 AO2 9  HOH MF .   ? HOH R 851  . ? 1_555 ? 
787 AO2 9  HOH MF .   ? HOH R 920  . ? 1_555 ? 
788 AO3 9  ARG R  28  ? ARG R 34   . ? 1_555 ? 
789 AO3 9  TYR R  34  ? TYR R 40   . ? 1_555 ? 
790 AO3 9  ARG R  40  ? ARG R 46   . ? 1_555 ? 
791 AO3 9  SER R  67  ? SER R 73   . ? 1_555 ? 
792 AO3 9  ARG R  70  ? ARG R 76   . ? 1_555 ? 
793 AO3 9  HIS R  374 ? HIS R 380  . ? 1_555 ? 
794 AO3 9  HOH MF .   ? HOH R 622  . ? 1_555 ? 
795 AO3 9  HOH MF .   ? HOH R 727  . ? 1_555 ? 
796 AO3 9  HOH MF .   ? HOH R 779  . ? 1_555 ? 
797 AO4 10 ARG R  263 ? ARG R 269  . ? 1_555 ? 
798 AO4 10 ASP R  264 ? ASP R 270  . ? 1_555 ? 
799 AO4 10 VAL R  265 ? VAL R 271  . ? 1_555 ? 
800 AO4 10 ALA R  270 ? ALA R 276  . ? 1_555 ? 
801 AO4 10 HOH MF .   ? HOH R 605  . ? 1_555 ? 
802 AO4 10 HOH MF .   ? HOH R 734  . ? 1_555 ? 
803 AO4 10 HOH MF .   ? HOH R 738  . ? 1_555 ? 
804 AO4 10 HOH MF .   ? HOH R 748  . ? 1_555 ? 
805 AO4 10 HOH MF .   ? HOH R 868  . ? 1_555 ? 
806 AO4 10 HOH MF .   ? HOH R 887  . ? 1_555 ? 
807 AO5 6  ASP R  269 ? ASP R 275  . ? 1_555 ? 
808 AO5 6  THR R  398 ? THR R 404  . ? 1_555 ? 
809 AO5 6  GLU R  399 ? GLU R 405  . ? 1_555 ? 
810 AO5 6  HOH MF .   ? HOH R 646  . ? 1_555 ? 
811 AO5 6  HOH MF .   ? HOH R 668  . ? 1_555 ? 
812 AO5 6  HOH MF .   ? HOH R 681  . ? 1_555 ? 
813 AO6 2  ARG R  396 ? ARG R 402  . ? 1_555 ? 
814 AO6 2  HOH MF .   ? HOH R 616  . ? 1_555 ? 
815 AO7 5  ARG R  313 ? ARG R 319  . ? 1_555 ? 
816 AO7 5  ARG R  363 ? ARG R 369  . ? 1_555 ? 
817 AO7 5  HOH MF .   ? HOH R 609  . ? 1_555 ? 
818 AO7 5  HOH MF .   ? HOH R 635  . ? 1_555 ? 
819 AO7 5  HOH MF .   ? HOH R 697  . ? 1_555 ? 
820 AO8 5  ASP R  280 ? ASP R 286  . ? 1_555 ? 
821 AO8 5  VAL R  281 ? VAL R 287  . ? 1_555 ? 
822 AO8 5  VAL R  282 ? VAL R 288  . ? 1_555 ? 
823 AO8 5  HOH MF .   ? HOH R 628  . ? 1_555 ? 
824 AO8 5  HOH MF .   ? HOH R 719  . ? 1_555 ? 
825 AO9 6  LEU F  50  ? LEU F 56   . ? 1_545 ? 
826 AO9 6  ARG F  55  ? ARG F 61   . ? 1_545 ? 
827 AO9 6  PHE F  78  ? PHE F 84   . ? 1_545 ? 
828 AO9 6  GLU F  85  ? GLU F 91   . ? 1_545 ? 
829 AO9 6  HOH AF .   ? HOH F 1028 . ? 1_545 ? 
830 AO9 6  HOH MF .   ? HOH R 900  . ? 1_555 ? 
831 AP1 8  GLU R  157 ? GLU R 163  . ? 1_555 ? 
832 AP1 8  ILE R  190 ? ILE R 196  . ? 1_555 ? 
833 AP1 8  ASN R  193 ? ASN R 199  . ? 1_555 ? 
834 AP1 8  ARG R  246 ? ARG R 252  . ? 1_555 ? 
835 AP1 8  HOH MF .   ? HOH R 610  . ? 1_555 ? 
836 AP1 8  HOH MF .   ? HOH R 623  . ? 1_555 ? 
837 AP1 8  HOH MF .   ? HOH R 736  . ? 1_555 ? 
838 AP1 8  HOH MF .   ? HOH R 763  . ? 1_555 ? 
839 AP2 5  LEU R  156 ? LEU R 162  . ? 1_555 ? 
840 AP2 5  GLU R  157 ? GLU R 163  . ? 1_555 ? 
841 AP2 5  ALA R  248 ? ALA R 254  . ? 1_555 ? 
842 AP2 5  PRO R  260 ? PRO R 266  . ? 1_555 ? 
843 AP2 5  HOH MF .   ? HOH R 673  . ? 1_555 ? 
844 AP3 14 LYS Q  38  ? LYS Q 44   . ? 1_555 ? 
845 AP3 14 THR Q  301 ? THR Q 307  . ? 1_555 ? 
846 AP3 14 PRO Q  302 ? PRO Q 308  . ? 1_555 ? 
847 AP3 14 PRO Q  303 ? PRO Q 309  . ? 1_555 ? 
848 AP3 14 VAL Q  322 ? VAL Q 328  . ? 1_555 ? 
849 AP3 14 SER Q  323 ? SER Q 329  . ? 1_555 ? 
850 AP3 14 GLY Q  324 ? GLY Q 330  . ? 1_555 ? 
851 AP3 14 HOH LF .   ? HOH Q 960  . ? 1_555 ? 
852 AP3 14 LYS R  38  ? LYS R 44   . ? 1_555 ? 
853 AP3 14 PRO R  303 ? PRO R 309  . ? 1_555 ? 
854 AP3 14 VAL R  322 ? VAL R 328  . ? 1_555 ? 
855 AP3 14 SER R  323 ? SER R 329  . ? 1_555 ? 
856 AP3 14 GLY R  324 ? GLY R 330  . ? 1_555 ? 
857 AP3 14 HOH MF .   ? HOH R 661  . ? 1_555 ? 
858 AP4 9  ARG S  28  ? ARG Z 34   . ? 1_555 ? 
859 AP4 9  TYR S  34  ? TYR Z 40   . ? 1_555 ? 
860 AP4 9  ARG S  40  ? ARG Z 46   . ? 1_555 ? 
861 AP4 9  SER S  67  ? SER Z 73   . ? 1_555 ? 
862 AP4 9  ARG S  70  ? ARG Z 76   . ? 1_555 ? 
863 AP4 9  HIS S  374 ? HIS Z 380  . ? 1_555 ? 
864 AP4 9  HOH NF .   ? HOH Z 703  . ? 1_555 ? 
865 AP4 9  HOH NF .   ? HOH Z 724  . ? 1_555 ? 
866 AP4 9  HOH NF .   ? HOH Z 952  . ? 1_555 ? 
867 AP5 7  SER S  329 ? SER Z 335  . ? 1_555 ? 
868 AP5 7  ASN S  345 ? ASN Z 351  . ? 1_555 ? 
869 AP5 7  SER S  346 ? SER Z 352  . ? 1_555 ? 
870 AP5 7  ARG S  363 ? ARG Z 369  . ? 1_555 ? 
871 AP5 7  HOH NF .   ? HOH Z 675  . ? 1_555 ? 
872 AP5 7  HOH NF .   ? HOH Z 740  . ? 1_555 ? 
873 AP5 7  HOH NF .   ? HOH Z 786  . ? 1_555 ? 
874 AP6 9  ASP S  264 ? ASP Z 270  . ? 1_555 ? 
875 AP6 9  VAL S  265 ? VAL Z 271  . ? 1_555 ? 
876 AP6 9  ALA S  270 ? ALA Z 276  . ? 1_555 ? 
877 AP6 9  HOH NF .   ? HOH Z 644  . ? 1_555 ? 
878 AP6 9  HOH NF .   ? HOH Z 743  . ? 1_555 ? 
879 AP6 9  HOH NF .   ? HOH Z 760  . ? 1_555 ? 
880 AP6 9  HOH NF .   ? HOH Z 812  . ? 1_555 ? 
881 AP6 9  HOH NF .   ? HOH Z 821  . ? 1_555 ? 
882 AP6 9  HOH NF .   ? HOH Z 916  . ? 1_555 ? 
883 AP7 4  ASP S  280 ? ASP Z 286  . ? 1_555 ? 
884 AP7 4  VAL S  281 ? VAL Z 287  . ? 1_555 ? 
885 AP7 4  VAL S  282 ? VAL Z 288  . ? 1_555 ? 
886 AP7 4  HOH NF .   ? HOH Z 710  . ? 1_555 ? 
887 AP8 5  THR S  105 ? THR Z 111  . ? 1_555 ? 
888 AP8 5  TYR S  204 ? TYR Z 210  . ? 1_555 ? 
889 AP8 5  GLY S  229 ? GLY Z 235  . ? 1_555 ? 
890 AP8 5  HOH NF .   ? HOH Z 668  . ? 1_555 ? 
891 AP8 5  HOH NF .   ? HOH Z 728  . ? 1_555 ? 
892 AP9 14 LYS T  38  ? LYS T 44   . ? 1_555 ? 
893 AP9 14 PRO T  303 ? PRO T 309  . ? 1_555 ? 
894 AP9 14 VAL T  322 ? VAL T 328  . ? 1_555 ? 
895 AP9 14 SER T  323 ? SER T 329  . ? 1_555 ? 
896 AP9 14 GLY T  324 ? GLY T 330  . ? 1_555 ? 
897 AP9 14 HOH OF .   ? HOH T 640  . ? 1_555 ? 
898 AP9 14 LYS S  38  ? LYS Z 44   . ? 1_555 ? 
899 AP9 14 THR S  301 ? THR Z 307  . ? 1_555 ? 
900 AP9 14 PRO S  303 ? PRO Z 309  . ? 1_555 ? 
901 AP9 14 ALA S  304 ? ALA Z 310  . ? 1_555 ? 
902 AP9 14 VAL S  322 ? VAL Z 328  . ? 1_555 ? 
903 AP9 14 SER S  323 ? SER Z 329  . ? 1_555 ? 
904 AP9 14 GLY S  324 ? GLY Z 330  . ? 1_555 ? 
905 AP9 14 HOH NF .   ? HOH Z 992  . ? 1_555 ? 
906 AQ1 7  SER T  329 ? SER T 335  . ? 1_555 ? 
907 AQ1 7  ASN T  345 ? ASN T 351  . ? 1_555 ? 
908 AQ1 7  SER T  346 ? SER T 352  . ? 1_555 ? 
909 AQ1 7  ARG T  363 ? ARG T 369  . ? 1_555 ? 
910 AQ1 7  HOH OF .   ? HOH T 743  . ? 1_555 ? 
911 AQ1 7  HOH OF .   ? HOH T 801  . ? 1_555 ? 
912 AQ1 7  HOH OF .   ? HOH T 873  . ? 1_555 ? 
913 AQ2 7  ARG T  28  ? ARG T 34   . ? 1_555 ? 
914 AQ2 7  TYR T  34  ? TYR T 40   . ? 1_555 ? 
915 AQ2 7  ARG T  40  ? ARG T 46   . ? 1_555 ? 
916 AQ2 7  SER T  67  ? SER T 73   . ? 1_555 ? 
917 AQ2 7  HIS T  374 ? HIS T 380  . ? 1_555 ? 
918 AQ2 7  HOH OF .   ? HOH T 811  . ? 1_555 ? 
919 AQ2 7  HOH OF .   ? HOH T 888  . ? 1_555 ? 
920 AQ3 9  ARG T  263 ? ARG T 269  . ? 1_555 ? 
921 AQ3 9  ASP T  264 ? ASP T 270  . ? 1_555 ? 
922 AQ3 9  VAL T  265 ? VAL T 271  . ? 1_555 ? 
923 AQ3 9  HOH OF .   ? HOH T 604  . ? 1_555 ? 
924 AQ3 9  HOH OF .   ? HOH T 679  . ? 1_555 ? 
925 AQ3 9  HOH OF .   ? HOH T 770  . ? 1_555 ? 
926 AQ3 9  HOH OF .   ? HOH T 812  . ? 1_555 ? 
927 AQ3 9  HOH OF .   ? HOH T 863  . ? 1_555 ? 
928 AQ3 9  HOH OF .   ? HOH T 894  . ? 1_555 ? 
929 AQ4 2  ARG T  313 ? ARG T 319  . ? 1_555 ? 
930 AQ4 2  ARG T  363 ? ARG T 369  . ? 1_555 ? 
931 AQ5 4  ILE T  190 ? ILE T 196  . ? 1_555 ? 
932 AQ5 4  ASN T  193 ? ASN T 199  . ? 1_555 ? 
933 AQ5 4  ARG T  246 ? ARG T 252  . ? 1_555 ? 
934 AQ5 4  HOH OF .   ? HOH T 623  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5W5T 
_atom_sites.fract_transf_matrix[1][1]   0.010663 
_atom_sites.fract_transf_matrix[1][2]   0.000012 
_atom_sites.fract_transf_matrix[1][3]   0.002357 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007135 
_atom_sites.fract_transf_matrix[2][3]   0.002350 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004700 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . VAL A  1 1   ? -63.833 -42.007  75.623  1.00 45.54 ? 7    VAL A N   1 
ATOM   2     C CA  . VAL A  1 1   ? -62.962 -41.874  76.800  1.00 48.37 ? 7    VAL A CA  1 
ATOM   3     C C   . VAL A  1 1   ? -61.441 -41.707  76.454  1.00 41.55 ? 7    VAL A C   1 
ATOM   4     O O   . VAL A  1 1   ? -60.915 -40.603  76.567  1.00 42.29 ? 7    VAL A O   1 
ATOM   5     C CB  . VAL A  1 1   ? -63.207 -43.070  77.750  1.00 45.65 ? 7    VAL A CB  1 
ATOM   6     C CG1 . VAL A  1 1   ? -63.207 -44.420  76.969  1.00 55.63 ? 7    VAL A CG1 1 
ATOM   7     C CG2 . VAL A  1 1   ? -62.191 -43.092  78.881  1.00 40.21 ? 7    VAL A CG2 1 
ATOM   8     N N   . GLN A  1 2   ? -60.748 -42.790  76.068  1.00 42.12 ? 8    GLN A N   1 
ATOM   9     C CA  . GLN A  1 2   ? -59.523 -42.746  75.227  1.00 41.14 ? 8    GLN A CA  1 
ATOM   10    C C   . GLN A  1 2   ? -59.471 -41.755  74.080  1.00 37.38 ? 8    GLN A C   1 
ATOM   11    O O   . GLN A  1 2   ? -60.179 -41.909  73.096  1.00 37.38 ? 8    GLN A O   1 
ATOM   12    C CB  . GLN A  1 2   ? -59.185 -44.161  74.679  1.00 43.54 ? 8    GLN A CB  1 
ATOM   13    C CG  . GLN A  1 2   ? -57.740 -44.298  74.323  1.00 46.43 ? 8    GLN A CG  1 
ATOM   14    C CD  . GLN A  1 2   ? -57.418 -45.725  74.177  1.00 47.56 ? 8    GLN A CD  1 
ATOM   15    O OE1 . GLN A  1 2   ? -57.919 -46.538  74.982  1.00 53.93 ? 8    GLN A OE1 1 
ATOM   16    N NE2 . GLN A  1 2   ? -56.639 -46.068  73.235  1.00 44.28 ? 8    GLN A NE2 1 
ATOM   17    N N   . PRO A  1 3   ? -58.502 -40.822  74.163  1.00 31.11 ? 9    PRO A N   1 
ATOM   18    C CA  . PRO A  1 3   ? -58.190 -39.812  73.142  1.00 29.57 ? 9    PRO A CA  1 
ATOM   19    C C   . PRO A  1 3   ? -57.860 -40.458  71.797  1.00 23.52 ? 9    PRO A C   1 
ATOM   20    O O   . PRO A  1 3   ? -57.098 -41.422  71.688  1.00 23.16 ? 9    PRO A O   1 
ATOM   21    C CB  . PRO A  1 3   ? -56.993 -39.071  73.728  1.00 27.39 ? 9    PRO A CB  1 
ATOM   22    C CG  . PRO A  1 3   ? -56.403 -40.006  74.715  1.00 28.91 ? 9    PRO A CG  1 
ATOM   23    C CD  . PRO A  1 3   ? -57.521 -40.837  75.264  1.00 26.31 ? 9    PRO A CD  1 
ATOM   24    N N   . LEU A  1 4   ? -58.479 -39.906  70.767  1.00 18.68 ? 10   LEU A N   1 
ATOM   25    C CA  . LEU A  1 4   ? -58.282 -40.367  69.412  1.00 17.07 ? 10   LEU A CA  1 
ATOM   26    C C   . LEU A  1 4   ? -56.840 -40.154  68.949  1.00 16.44 ? 10   LEU A C   1 
ATOM   27    O O   . LEU A  1 4   ? -56.347 -40.891  68.101  1.00 19.64 ? 10   LEU A O   1 
ATOM   28    C CB  . LEU A  1 4   ? -59.265 -39.654  68.487  1.00 17.67 ? 10   LEU A CB  1 
ATOM   29    C CG  . LEU A  1 4   ? -60.722 -39.943  68.850  1.00 20.78 ? 10   LEU A CG  1 
ATOM   30    C CD1 . LEU A  1 4   ? -61.655 -39.092  68.012  1.00 24.57 ? 10   LEU A CD1 1 
ATOM   31    C CD2 . LEU A  1 4   ? -61.024 -41.424  68.659  1.00 23.18 ? 10   LEU A CD2 1 
ATOM   32    N N   . ALA A  1 5   ? -56.165 -39.160  69.517  1.00 16.65 ? 11   ALA A N   1 
ATOM   33    C CA  . ALA A  1 5   ? -54.781 -38.857  69.144  1.00 20.25 ? 11   ALA A CA  1 
ATOM   34    C C   . ALA A  1 5   ? -53.838 -40.054  69.322  1.00 19.76 ? 11   ALA A C   1 
ATOM   35    O O   . ALA A  1 5   ? -52.873 -40.213  68.565  1.00 21.75 ? 11   ALA A O   1 
ATOM   36    C CB  . ALA A  1 5   ? -54.268 -37.661  69.944  1.00 18.50 ? 11   ALA A CB  1 
ATOM   37    N N   . ARG A  1 6   ? -54.123 -40.899  70.308  1.00 18.71 ? 12   ARG A N   1 
ATOM   38    C CA  . ARG A  1 6   ? -53.298 -42.078  70.570  1.00 19.14 ? 12   ARG A CA  1 
ATOM   39    C C   . ARG A  1 6   ? -53.204 -42.955  69.343  1.00 18.92 ? 12   ARG A C   1 
ATOM   40    O O   . ARG A  1 6   ? -52.230 -43.685  69.163  1.00 19.85 ? 12   ARG A O   1 
ATOM   41    C CB  . ARG A  1 6   ? -53.859 -42.907  71.724  1.00 17.93 ? 12   ARG A CB  1 
ATOM   42    C CG  . ARG A  1 6   ? -53.717 -42.278  73.090  1.00 21.68 ? 12   ARG A CG  1 
ATOM   43    C CD  . ARG A  1 6   ? -54.106 -43.283  74.152  1.00 23.48 ? 12   ARG A CD  1 
ATOM   44    N NE  . ARG A  1 6   ? -54.379 -42.663  75.444  1.00 21.49 ? 12   ARG A NE  1 
ATOM   45    C CZ  . ARG A  1 6   ? -54.829 -43.338  76.493  1.00 16.91 ? 12   ARG A CZ  1 
ATOM   46    N NH1 . ARG A  1 6   ? -55.046 -44.639  76.377  1.00 19.34 ? 12   ARG A NH1 1 
ATOM   47    N NH2 . ARG A  1 6   ? -55.071 -42.719  77.645  1.00 12.45 ? 12   ARG A NH2 1 
ATOM   48    N N   . ASP A  1 7   ? -54.230 -42.891  68.505  1.00 19.67 ? 13   ASP A N   1 
ATOM   49    C CA  . ASP A  1 7   ? -54.305 -43.739  67.320  1.00 23.68 ? 13   ASP A CA  1 
ATOM   50    C C   . ASP A  1 7   ? -54.170 -42.953  66.023  1.00 20.72 ? 13   ASP A C   1 
ATOM   51    O O   . ASP A  1 7   ? -54.571 -43.427  64.964  1.00 18.94 ? 13   ASP A O   1 
ATOM   52    C CB  . ASP A  1 7   ? -55.623 -44.513  67.308  1.00 30.40 ? 13   ASP A CB  1 
ATOM   53    C CG  . ASP A  1 7   ? -55.737 -45.478  68.458  1.00 44.29 ? 13   ASP A CG  1 
ATOM   54    O OD1 . ASP A  1 7   ? -55.097 -46.546  68.384  1.00 49.46 ? 13   ASP A OD1 1 
ATOM   55    O OD2 . ASP A  1 7   ? -56.465 -45.178  69.431  1.00 49.32 ? 13   ASP A OD2 1 
ATOM   56    N N   . ALA A  1 8   ? -53.596 -41.759  66.107  1.00 18.85 ? 14   ALA A N   1 
ATOM   57    C CA  . ALA A  1 8   ? -53.443 -40.908  64.935  1.00 16.56 ? 14   ALA A CA  1 
ATOM   58    C C   . ALA A  1 8   ? -51.995 -40.837  64.476  1.00 16.82 ? 14   ALA A C   1 
ATOM   59    O O   . ALA A  1 8   ? -51.071 -40.974  65.273  1.00 15.97 ? 14   ALA A O   1 
ATOM   60    C CB  . ALA A  1 8   ? -53.961 -39.517  65.228  1.00 18.65 ? 14   ALA A CB  1 
ATOM   61    N N   . MET A  1 9   ? -51.810 -40.633  63.179  1.00 17.30 ? 15   MET A N   1 
ATOM   62    C CA  . MET A  1 9   ? -50.510 -40.279  62.627  1.00 16.58 ? 15   MET A CA  1 
ATOM   63    C C   . MET A  1 9   ? -50.624 -38.930  61.925  1.00 19.36 ? 15   MET A C   1 
ATOM   64    O O   . MET A  1 9   ? -51.473 -38.761  61.059  1.00 19.25 ? 15   MET A O   1 
ATOM   65    C CB  . MET A  1 9   ? -50.019 -41.342  61.646  1.00 17.88 ? 15   MET A CB  1 
ATOM   66    C CG  . MET A  1 9   ? -48.633 -41.072  61.053  1.00 20.71 ? 15   MET A CG  1 
ATOM   67    S SD  . MET A  1 9   ? -48.067 -42.427  60.002  1.00 22.60 ? 15   MET A SD  1 
ATOM   68    C CE  . MET A  1 9   ? -46.455 -41.855  59.462  1.00 14.48 ? 15   MET A CE  1 
ATOM   69    N N   . ALA A  1 10  ? -49.790 -37.969  62.309  1.00 16.95 ? 16   ALA A N   1 
ATOM   70    C CA  . ALA A  1 10  ? -49.741 -36.686  61.616  1.00 13.76 ? 16   ALA A CA  1 
ATOM   71    C C   . ALA A  1 10  ? -48.757 -36.767  60.473  1.00 14.96 ? 16   ALA A C   1 
ATOM   72    O O   . ALA A  1 10  ? -47.595 -37.110  60.673  1.00 19.11 ? 16   ALA A O   1 
ATOM   73    C CB  . ALA A  1 10  ? -49.361 -35.573  62.558  1.00 12.69 ? 16   ALA A CB  1 
ATOM   74    N N   . TYR A  1 11  ? -49.223 -36.442  59.274  1.00 15.38 ? 17   TYR A N   1 
ATOM   75    C CA  . TYR A  1 11  ? -48.397 -36.545  58.076  1.00 14.34 ? 17   TYR A CA  1 
ATOM   76    C C   . TYR A  1 11  ? -48.213 -35.166  57.444  1.00 14.36 ? 17   TYR A C   1 
ATOM   77    O O   . TYR A  1 11  ? -49.146 -34.597  56.881  1.00 12.46 ? 17   TYR A O   1 
ATOM   78    C CB  . TYR A  1 11  ? -49.019 -37.533  57.076  1.00 15.07 ? 17   TYR A CB  1 
ATOM   79    C CG  . TYR A  1 11  ? -48.032 -38.059  56.054  1.00 14.01 ? 17   TYR A CG  1 
ATOM   80    C CD1 . TYR A  1 11  ? -47.777 -37.361  54.884  1.00 17.51 ? 17   TYR A CD1 1 
ATOM   81    C CD2 . TYR A  1 11  ? -47.346 -39.251  56.269  1.00 15.16 ? 17   TYR A CD2 1 
ATOM   82    C CE1 . TYR A  1 11  ? -46.861 -37.834  53.949  1.00 15.71 ? 17   TYR A CE1 1 
ATOM   83    C CE2 . TYR A  1 11  ? -46.432 -39.735  55.344  1.00 17.24 ? 17   TYR A CE2 1 
ATOM   84    C CZ  . TYR A  1 11  ? -46.195 -39.024  54.186  1.00 16.82 ? 17   TYR A CZ  1 
ATOM   85    O OH  . TYR A  1 11  ? -45.286 -39.491  53.263  1.00 19.26 ? 17   TYR A OH  1 
ATOM   86    N N   . VAL A  1 12  ? -47.000 -34.640  57.542  1.00 15.98 ? 18   VAL A N   1 
ATOM   87    C CA  . VAL A  1 12  ? -46.721 -33.266  57.163  1.00 17.48 ? 18   VAL A CA  1 
ATOM   88    C C   . VAL A  1 12  ? -46.222 -33.156  55.732  1.00 19.13 ? 18   VAL A C   1 
ATOM   89    O O   . VAL A  1 12  ? -45.204 -33.739  55.368  1.00 18.43 ? 18   VAL A O   1 
ATOM   90    C CB  . VAL A  1 12  ? -45.670 -32.632  58.093  1.00 18.58 ? 18   VAL A CB  1 
ATOM   91    C CG1 . VAL A  1 12  ? -45.343 -31.213  57.635  1.00 19.61 ? 18   VAL A CG1 1 
ATOM   92    C CG2 . VAL A  1 12  ? -46.159 -32.644  59.531  1.00 12.47 ? 18   VAL A CG2 1 
ATOM   93    N N   . LEU A  1 13  ? -46.942 -32.391  54.923  1.00 14.72 ? 19   LEU A N   1 
ATOM   94    C CA  . LEU A  1 13  ? -46.519 -32.126  53.561  1.00 15.99 ? 19   LEU A CA  1 
ATOM   95    C C   . LEU A  1 13  ? -45.622 -30.894  53.583  1.00 19.33 ? 19   LEU A C   1 
ATOM   96    O O   . LEU A  1 13  ? -46.075 -29.781  53.860  1.00 18.10 ? 19   LEU A O   1 
ATOM   97    C CB  . LEU A  1 13  ? -47.736 -31.938  52.662  1.00 16.66 ? 19   LEU A CB  1 
ATOM   98    C CG  . LEU A  1 13  ? -48.730 -33.104  52.753  1.00 17.22 ? 19   LEU A CG  1 
ATOM   99    C CD1 . LEU A  1 13  ? -50.082 -32.732  52.159  1.00 22.77 ? 19   LEU A CD1 1 
ATOM   100   C CD2 . LEU A  1 13  ? -48.173 -34.359  52.095  1.00 17.56 ? 19   LEU A CD2 1 
ATOM   101   N N   . ALA A  1 14  ? -44.338 -31.107  53.320  1.00 19.39 ? 20   ALA A N   1 
ATOM   102   C CA  . ALA A  1 14  ? -43.330 -30.085  53.557  1.00 16.32 ? 20   ALA A CA  1 
ATOM   103   C C   . ALA A  1 14  ? -42.526 -29.785  52.302  1.00 21.55 ? 20   ALA A C   1 
ATOM   104   O O   . ALA A  1 14  ? -41.352 -29.419  52.384  1.00 18.89 ? 20   ALA A O   1 
ATOM   105   C CB  . ALA A  1 14  ? -42.403 -30.517  54.693  1.00 15.51 ? 20   ALA A CB  1 
ATOM   106   N N   . GLY A  1 15  ? -43.168 -29.917  51.143  1.00 19.70 ? 21   GLY A N   1 
ATOM   107   C CA  . GLY A  1 15  ? -42.483 -29.750  49.875  1.00 25.41 ? 21   GLY A CA  1 
ATOM   108   C C   . GLY A  1 15  ? -42.738 -28.411  49.214  1.00 35.69 ? 21   GLY A C   1 
ATOM   109   O O   . GLY A  1 15  ? -42.140 -28.110  48.180  1.00 42.45 ? 21   GLY A O   1 
ATOM   110   N N   . GLY A  1 16  ? -43.623 -27.613  49.807  1.00 35.83 ? 22   GLY A N   1 
ATOM   111   C CA  . GLY A  1 16  ? -43.972 -26.304  49.279  1.00 34.76 ? 22   GLY A CA  1 
ATOM   112   C C   . GLY A  1 16  ? -42.764 -25.434  48.994  1.00 31.40 ? 22   GLY A C   1 
ATOM   113   O O   . GLY A  1 16  ? -41.848 -25.332  49.811  1.00 25.62 ? 22   GLY A O   1 
ATOM   114   N N   . ARG A  1 17  ? -42.759 -24.799  47.828  1.00 33.68 ? 23   ARG A N   1 
ATOM   115   C CA  . ARG A  1 17  ? -41.573 -24.086  47.377  1.00 29.22 ? 23   ARG A CA  1 
ATOM   116   C C   . ARG A  1 17  ? -41.493 -22.660  47.894  1.00 24.73 ? 23   ARG A C   1 
ATOM   117   O O   . ARG A  1 17  ? -40.401 -22.115  48.015  1.00 25.47 ? 23   ARG A O   1 
ATOM   118   C CB  . ARG A  1 17  ? -41.505 -24.089  45.847  1.00 34.01 ? 23   ARG A CB  1 
ATOM   119   C CG  . ARG A  1 17  ? -41.011 -25.406  45.284  1.00 44.09 ? 23   ARG A CG  1 
ATOM   120   C CD  . ARG A  1 17  ? -41.367 -25.572  43.821  1.00 51.88 ? 23   ARG A CD  1 
ATOM   121   N NE  . ARG A  1 17  ? -42.810 -25.509  43.617  1.00 58.25 ? 23   ARG A NE  1 
ATOM   122   C CZ  . ARG A  1 17  ? -43.416 -25.755  42.461  1.00 61.81 ? 23   ARG A CZ  1 
ATOM   123   N NH1 . ARG A  1 17  ? -42.704 -26.094  41.392  1.00 63.12 ? 23   ARG A NH1 1 
ATOM   124   N NH2 . ARG A  1 17  ? -44.737 -25.668  42.376  1.00 62.28 ? 23   ARG A NH2 1 
ATOM   125   N N   . GLY A  1 18  ? -42.633 -22.055  48.206  1.00 18.78 ? 24   GLY A N   1 
ATOM   126   C CA  . GLY A  1 18  ? -42.635 -20.661  48.601  1.00 13.60 ? 24   GLY A CA  1 
ATOM   127   C C   . GLY A  1 18  ? -42.073 -19.803  47.482  1.00 22.30 ? 24   GLY A C   1 
ATOM   128   O O   . GLY A  1 18  ? -41.093 -19.073  47.666  1.00 20.21 ? 24   GLY A O   1 
ATOM   129   N N   . SER A  1 19  ? -42.694 -19.918  46.311  1.00 24.48 ? 25   SER A N   1 
ATOM   130   C CA  . SER A  1 19  ? -42.222 -19.256  45.102  1.00 27.37 ? 25   SER A CA  1 
ATOM   131   C C   . SER A  1 19  ? -42.042 -17.754  45.283  1.00 26.13 ? 25   SER A C   1 
ATOM   132   O O   . SER A  1 19  ? -40.958 -17.218  45.049  1.00 27.39 ? 25   SER A O   1 
ATOM   133   C CB  . SER A  1 19  ? -43.197 -19.521  43.954  1.00 29.52 ? 25   SER A CB  1 
ATOM   134   O OG  . SER A  1 19  ? -43.403 -20.910  43.783  1.00 35.18 ? 25   SER A OG  1 
ATOM   135   N N   . ARG A  1 20  ? -43.104 -17.084  45.714  1.00 22.25 ? 26   ARG A N   1 
ATOM   136   C CA  . ARG A  1 20  ? -43.106 -15.625  45.824  1.00 24.82 ? 26   ARG A CA  1 
ATOM   137   C C   . ARG A  1 20  ? -42.158 -15.071  46.898  1.00 26.51 ? 26   ARG A C   1 
ATOM   138   O O   . ARG A  1 20  ? -42.041 -13.855  47.042  1.00 28.59 ? 26   ARG A O   1 
ATOM   139   C CB  . ARG A  1 20  ? -44.529 -15.130  46.092  1.00 25.02 ? 26   ARG A CB  1 
ATOM   140   C CG  . ARG A  1 20  ? -45.524 -15.544  45.022  1.00 29.30 ? 26   ARG A CG  1 
ATOM   141   C CD  . ARG A  1 20  ? -46.214 -14.336  44.413  1.00 35.85 ? 26   ARG A CD  1 
ATOM   142   N NE  . ARG A  1 20  ? -47.297 -13.817  45.243  1.00 36.50 ? 26   ARG A NE  1 
ATOM   143   C CZ  . ARG A  1 20  ? -47.527 -12.523  45.442  1.00 37.71 ? 26   ARG A CZ  1 
ATOM   144   N NH1 . ARG A  1 20  ? -46.730 -11.612  44.900  1.00 37.22 ? 26   ARG A NH1 1 
ATOM   145   N NH2 . ARG A  1 20  ? -48.542 -12.140  46.201  1.00 41.50 ? 26   ARG A NH2 1 
ATOM   146   N N   . LEU A  1 21  ? -41.502 -15.949  47.661  1.00 25.05 ? 27   LEU A N   1 
ATOM   147   C CA  . LEU A  1 21  ? -40.505 -15.507  48.639  1.00 21.90 ? 27   LEU A CA  1 
ATOM   148   C C   . LEU A  1 21  ? -39.158 -15.304  47.944  1.00 17.25 ? 27   LEU A C   1 
ATOM   149   O O   . LEU A  1 21  ? -38.208 -14.825  48.545  1.00 18.02 ? 27   LEU A O   1 
ATOM   150   C CB  . LEU A  1 21  ? -40.379 -16.505  49.803  1.00 20.69 ? 27   LEU A CB  1 
ATOM   151   C CG  . LEU A  1 21  ? -41.426 -16.441  50.931  1.00 17.14 ? 27   LEU A CG  1 
ATOM   152   C CD1 . LEU A  1 21  ? -41.295 -17.640  51.884  1.00 17.01 ? 27   LEU A CD1 1 
ATOM   153   C CD2 . LEU A  1 21  ? -41.351 -15.128  51.713  1.00 14.44 ? 27   LEU A CD2 1 
ATOM   154   N N   . LYS A  1 22  ? -39.101 -15.656  46.664  1.00 19.85 ? 28   LYS A N   1 
ATOM   155   C CA  . LYS A  1 22  ? -37.933 -15.400  45.829  1.00 16.23 ? 28   LYS A CA  1 
ATOM   156   C C   . LYS A  1 22  ? -36.638 -15.885  46.460  1.00 15.92 ? 28   LYS A C   1 
ATOM   157   O O   . LYS A  1 22  ? -36.512 -17.058  46.792  1.00 18.06 ? 28   LYS A O   1 
ATOM   158   C CB  . LYS A  1 22  ? -37.839 -13.910  45.508  1.00 23.18 ? 28   LYS A CB  1 
ATOM   159   C CG  . LYS A  1 22  ? -39.033 -13.387  44.725  1.00 32.99 ? 28   LYS A CG  1 
ATOM   160   C CD  . LYS A  1 22  ? -39.027 -13.889  43.278  1.00 38.70 ? 28   LYS A CD  1 
ATOM   161   C CE  . LYS A  1 22  ? -40.406 -13.768  42.612  1.00 38.97 ? 28   LYS A CE  1 
ATOM   162   N NZ  . LYS A  1 22  ? -41.268 -12.726  43.249  1.00 36.84 ? 28   LYS A NZ  1 
ATOM   163   N N   . GLU A  1 23  ? -35.670 -14.993  46.634  1.00 18.93 ? 29   GLU A N   1 
ATOM   164   C CA  . GLU A  1 23  ? -34.335 -15.429  47.037  1.00 19.83 ? 29   GLU A CA  1 
ATOM   165   C C   . GLU A  1 23  ? -34.302 -16.024  48.446  1.00 22.36 ? 29   GLU A C   1 
ATOM   166   O O   . GLU A  1 23  ? -33.366 -16.738  48.799  1.00 22.81 ? 29   GLU A O   1 
ATOM   167   C CB  . GLU A  1 23  ? -33.334 -14.275  46.947  1.00 22.85 ? 29   GLU A CB  1 
ATOM   168   C CG  . GLU A  1 23  ? -32.998 -13.849  45.530  1.00 27.37 ? 29   GLU A CG  1 
ATOM   169   C CD  . GLU A  1 23  ? -34.028 -12.906  44.959  1.00 26.78 ? 29   GLU A CD  1 
ATOM   170   O OE1 . GLU A  1 23  ? -34.795 -12.329  45.753  1.00 25.02 ? 29   GLU A OE1 1 
ATOM   171   O OE2 . GLU A  1 23  ? -34.076 -12.737  43.720  1.00 28.76 ? 29   GLU A OE2 1 
ATOM   172   N N   . LEU A  1 24  ? -35.318 -15.731  49.247  1.00 18.47 ? 30   LEU A N   1 
ATOM   173   C CA  . LEU A  1 24  ? -35.383 -16.284  50.590  1.00 18.84 ? 30   LEU A CA  1 
ATOM   174   C C   . LEU A  1 24  ? -35.467 -17.802  50.517  1.00 19.69 ? 30   LEU A C   1 
ATOM   175   O O   . LEU A  1 24  ? -34.851 -18.511  51.320  1.00 20.69 ? 30   LEU A O   1 
ATOM   176   C CB  . LEU A  1 24  ? -36.574 -15.703  51.344  1.00 18.05 ? 30   LEU A CB  1 
ATOM   177   C CG  . LEU A  1 24  ? -36.498 -15.621  52.862  1.00 24.35 ? 30   LEU A CG  1 
ATOM   178   C CD1 . LEU A  1 24  ? -35.137 -15.134  53.333  1.00 23.48 ? 30   LEU A CD1 1 
ATOM   179   C CD2 . LEU A  1 24  ? -37.599 -14.692  53.327  1.00 27.21 ? 30   LEU A CD2 1 
ATOM   180   N N   . THR A  1 25  ? -36.203 -18.301  49.526  1.00 14.82 ? 31   THR A N   1 
ATOM   181   C CA  . THR A  1 25  ? -36.327 -19.743  49.331  1.00 12.33 ? 31   THR A CA  1 
ATOM   182   C C   . THR A  1 25  ? -35.516 -20.273  48.144  1.00 19.10 ? 31   THR A C   1 
ATOM   183   O O   . THR A  1 25  ? -35.908 -21.267  47.539  1.00 20.89 ? 31   THR A O   1 
ATOM   184   C CB  . THR A  1 25  ? -37.804 -20.164  49.114  1.00 24.17 ? 31   THR A CB  1 
ATOM   185   O OG1 . THR A  1 25  ? -38.371 -19.403  48.036  1.00 21.26 ? 31   THR A OG1 1 
ATOM   186   C CG2 . THR A  1 25  ? -38.637 -19.957  50.386  1.00 19.57 ? 31   THR A CG2 1 
ATOM   187   N N   . ASP A  1 26  ? -34.400 -19.628  47.806  1.00 20.88 ? 32   ASP A N   1 
ATOM   188   C CA  . ASP A  1 26  ? -33.610 -20.072  46.657  1.00 25.28 ? 32   ASP A CA  1 
ATOM   189   C C   . ASP A  1 26  ? -32.848 -21.371  46.938  1.00 28.27 ? 32   ASP A C   1 
ATOM   190   O O   . ASP A  1 26  ? -32.625 -22.161  46.021  1.00 28.14 ? 32   ASP A O   1 
ATOM   191   C CB  . ASP A  1 26  ? -32.637 -18.982  46.188  1.00 30.68 ? 32   ASP A CB  1 
ATOM   192   C CG  . ASP A  1 26  ? -33.187 -18.173  45.016  1.00 34.93 ? 32   ASP A CG  1 
ATOM   193   O OD1 . ASP A  1 26  ? -34.275 -18.515  44.493  1.00 34.85 ? 32   ASP A OD1 1 
ATOM   194   O OD2 . ASP A  1 26  ? -32.513 -17.204  44.606  1.00 36.65 ? 32   ASP A OD2 1 
ATOM   195   N N   . ARG A  1 27  ? -32.451 -21.601  48.188  1.00 26.98 ? 33   ARG A N   1 
ATOM   196   C CA  . ARG A  1 27  ? -31.817 -22.871  48.531  1.00 28.72 ? 33   ARG A CA  1 
ATOM   197   C C   . ARG A  1 27  ? -32.329 -23.450  49.846  1.00 27.55 ? 33   ARG A C   1 
ATOM   198   O O   . ARG A  1 27  ? -31.580 -24.061  50.597  1.00 29.02 ? 33   ARG A O   1 
ATOM   199   C CB  . ARG A  1 27  ? -30.297 -22.728  48.575  1.00 36.66 ? 33   ARG A CB  1 
ATOM   200   C CG  . ARG A  1 27  ? -29.725 -22.385  47.225  1.00 44.18 ? 33   ARG A CG  1 
ATOM   201   C CD  . ARG A  1 27  ? -28.207 -22.359  47.215  1.00 49.61 ? 33   ARG A CD  1 
ATOM   202   N NE  . ARG A  1 27  ? -27.731 -22.355  45.835  1.00 57.19 ? 33   ARG A NE  1 
ATOM   203   C CZ  . ARG A  1 27  ? -26.490 -22.081  45.454  1.00 59.03 ? 33   ARG A CZ  1 
ATOM   204   N NH1 . ARG A  1 27  ? -25.557 -21.790  46.351  1.00 61.62 ? 33   ARG A NH1 1 
ATOM   205   N NH2 . ARG A  1 27  ? -26.185 -22.110  44.162  1.00 61.11 ? 33   ARG A NH2 1 
ATOM   206   N N   . ARG A  1 28  ? -33.619 -23.273  50.100  1.00 22.51 ? 34   ARG A N   1 
ATOM   207   C CA  . ARG A  1 28  ? -34.276 -23.898  51.242  1.00 20.80 ? 34   ARG A CA  1 
ATOM   208   C C   . ARG A  1 28  ? -35.755 -23.959  50.920  1.00 19.33 ? 34   ARG A C   1 
ATOM   209   O O   . ARG A  1 28  ? -36.272 -23.103  50.199  1.00 19.39 ? 34   ARG A O   1 
ATOM   210   C CB  . ARG A  1 28  ? -34.019 -23.122  52.538  1.00 18.58 ? 34   ARG A CB  1 
ATOM   211   C CG  . ARG A  1 28  ? -34.648 -21.750  52.583  1.00 18.19 ? 34   ARG A CG  1 
ATOM   212   C CD  . ARG A  1 28  ? -34.564 -21.124  53.959  1.00 14.57 ? 34   ARG A CD  1 
ATOM   213   N NE  . ARG A  1 28  ? -33.189 -20.919  54.413  1.00 16.31 ? 34   ARG A NE  1 
ATOM   214   C CZ  . ARG A  1 28  ? -32.464 -19.833  54.153  1.00 20.12 ? 34   ARG A CZ  1 
ATOM   215   N NH1 . ARG A  1 28  ? -32.968 -18.854  53.411  1.00 19.84 ? 34   ARG A NH1 1 
ATOM   216   N NH2 . ARG A  1 28  ? -31.227 -19.729  54.622  1.00 20.99 ? 34   ARG A NH2 1 
ATOM   217   N N   . ALA A  1 29  ? -36.427 -24.989  51.417  1.00 13.16 ? 35   ALA A N   1 
ATOM   218   C CA  . ALA A  1 29  ? -37.864 -25.124  51.224  1.00 14.22 ? 35   ALA A CA  1 
ATOM   219   C C   . ALA A  1 29  ? -38.593 -24.132  52.120  1.00 15.92 ? 35   ALA A C   1 
ATOM   220   O O   . ALA A  1 29  ? -38.057 -23.697  53.139  1.00 19.42 ? 35   ALA A O   1 
ATOM   221   C CB  . ALA A  1 29  ? -38.309 -26.541  51.509  1.00 14.60 ? 35   ALA A CB  1 
ATOM   222   N N   . LYS A  1 30  ? -39.801 -23.748  51.735  1.00 15.22 ? 36   LYS A N   1 
ATOM   223   C CA  . LYS A  1 30  ? -40.541 -22.784  52.530  1.00 16.14 ? 36   LYS A CA  1 
ATOM   224   C C   . LYS A  1 30  ? -40.667 -23.220  53.997  1.00 19.51 ? 36   LYS A C   1 
ATOM   225   O O   . LYS A  1 30  ? -40.441 -22.402  54.883  1.00 17.43 ? 36   LYS A O   1 
ATOM   226   C CB  . LYS A  1 30  ? -41.930 -22.519  51.939  1.00 15.42 ? 36   LYS A CB  1 
ATOM   227   C CG  . LYS A  1 30  ? -42.649 -21.362  52.631  1.00 13.12 ? 36   LYS A CG  1 
ATOM   228   C CD  . LYS A  1 30  ? -44.022 -21.139  52.041  1.00 14.30 ? 36   LYS A CD  1 
ATOM   229   C CE  . LYS A  1 30  ? -44.810 -20.166  52.884  1.00 16.09 ? 36   LYS A CE  1 
ATOM   230   N NZ  . LYS A  1 30  ? -46.266 -20.332  52.662  1.00 17.91 ? 36   LYS A NZ  1 
ATOM   231   N N   . PRO A  1 31  ? -40.990 -24.507  54.264  1.00 20.63 ? 37   PRO A N   1 
ATOM   232   C CA  . PRO A  1 31  ? -41.070 -24.898  55.681  1.00 17.21 ? 37   PRO A CA  1 
ATOM   233   C C   . PRO A  1 31  ? -39.768 -24.748  56.468  1.00 15.90 ? 37   PRO A C   1 
ATOM   234   O O   . PRO A  1 31  ? -39.809 -24.786  57.694  1.00 14.80 ? 37   PRO A O   1 
ATOM   235   C CB  . PRO A  1 31  ? -41.472 -26.378  55.620  1.00 15.36 ? 37   PRO A CB  1 
ATOM   236   C CG  . PRO A  1 31  ? -42.171 -26.531  54.350  1.00 13.32 ? 37   PRO A CG  1 
ATOM   237   C CD  . PRO A  1 31  ? -41.491 -25.582  53.385  1.00 17.77 ? 37   PRO A CD  1 
ATOM   238   N N   . ALA A  1 32  ? -38.635 -24.590  55.798  1.00 14.16 ? 38   ALA A N   1 
ATOM   239   C CA  . ALA A  1 32  ? -37.369 -24.434  56.515  1.00 13.73 ? 38   ALA A CA  1 
ATOM   240   C C   . ALA A  1 32  ? -37.020 -22.970  56.768  1.00 13.90 ? 38   ALA A C   1 
ATOM   241   O O   . ALA A  1 32  ? -36.003 -22.661  57.386  1.00 12.98 ? 38   ALA A O   1 
ATOM   242   C CB  . ALA A  1 32  ? -36.239 -25.112  55.755  1.00 14.62 ? 38   ALA A CB  1 
ATOM   243   N N   . VAL A  1 33  ? -37.864 -22.066  56.289  1.00 17.01 ? 39   VAL A N   1 
ATOM   244   C CA  . VAL A  1 33  ? -37.635 -20.649  56.515  1.00 14.45 ? 39   VAL A CA  1 
ATOM   245   C C   . VAL A  1 33  ? -37.803 -20.305  58.003  1.00 15.68 ? 39   VAL A C   1 
ATOM   246   O O   . VAL A  1 33  ? -38.731 -20.758  58.665  1.00 12.37 ? 39   VAL A O   1 
ATOM   247   C CB  . VAL A  1 33  ? -38.571 -19.790  55.634  1.00 15.37 ? 39   VAL A CB  1 
ATOM   248   C CG1 . VAL A  1 33  ? -38.385 -18.320  55.927  1.00 14.23 ? 39   VAL A CG1 1 
ATOM   249   C CG2 . VAL A  1 33  ? -38.291 -20.062  54.146  1.00 11.79 ? 39   VAL A CG2 1 
ATOM   250   N N   . TYR A  1 34  ? -36.863 -19.522  58.515  1.00 12.77 ? 40   TYR A N   1 
ATOM   251   C CA  . TYR A  1 34  ? -36.848 -19.076  59.896  1.00 11.52 ? 40   TYR A CA  1 
ATOM   252   C C   . TYR A  1 34  ? -38.023 -18.189  60.273  1.00 14.01 ? 40   TYR A C   1 
ATOM   253   O O   . TYR A  1 34  ? -38.505 -17.404  59.461  1.00 16.02 ? 40   TYR A O   1 
ATOM   254   C CB  . TYR A  1 34  ? -35.556 -18.319  60.160  1.00 13.23 ? 40   TYR A CB  1 
ATOM   255   C CG  . TYR A  1 34  ? -34.320 -19.133  59.897  1.00 16.58 ? 40   TYR A CG  1 
ATOM   256   C CD1 . TYR A  1 34  ? -33.821 -19.991  60.866  1.00 18.60 ? 40   TYR A CD1 1 
ATOM   257   C CD2 . TYR A  1 34  ? -33.645 -19.042  58.687  1.00 21.08 ? 40   TYR A CD2 1 
ATOM   258   C CE1 . TYR A  1 34  ? -32.687 -20.736  60.643  1.00 22.64 ? 40   TYR A CE1 1 
ATOM   259   C CE2 . TYR A  1 34  ? -32.505 -19.785  58.452  1.00 21.23 ? 40   TYR A CE2 1 
ATOM   260   C CZ  . TYR A  1 34  ? -32.030 -20.631  59.436  1.00 22.37 ? 40   TYR A CZ  1 
ATOM   261   O OH  . TYR A  1 34  ? -30.894 -21.378  59.217  1.00 19.67 ? 40   TYR A OH  1 
ATOM   262   N N   . PHE A  1 35  ? -38.467 -18.288  61.522  1.00 12.49 ? 41   PHE A N   1 
ATOM   263   C CA  . PHE A  1 35  ? -39.531 -17.418  61.992  1.00 13.23 ? 41   PHE A CA  1 
ATOM   264   C C   . PHE A  1 35  ? -39.485 -17.180  63.488  1.00 13.80 ? 41   PHE A C   1 
ATOM   265   O O   . PHE A  1 35  ? -39.228 -18.098  64.262  1.00 14.24 ? 41   PHE A O   1 
ATOM   266   C CB  . PHE A  1 35  ? -40.894 -17.992  61.637  1.00 12.98 ? 41   PHE A CB  1 
ATOM   267   C CG  . PHE A  1 35  ? -42.017 -17.092  62.017  1.00 17.81 ? 41   PHE A CG  1 
ATOM   268   C CD1 . PHE A  1 35  ? -42.328 -15.996  61.226  1.00 22.11 ? 41   PHE A CD1 1 
ATOM   269   C CD2 . PHE A  1 35  ? -42.741 -17.310  63.178  1.00 11.75 ? 41   PHE A CD2 1 
ATOM   270   C CE1 . PHE A  1 35  ? -43.353 -15.150  61.577  1.00 25.08 ? 41   PHE A CE1 1 
ATOM   271   C CE2 . PHE A  1 35  ? -43.763 -16.465  63.536  1.00 17.11 ? 41   PHE A CE2 1 
ATOM   272   C CZ  . PHE A  1 35  ? -44.073 -15.385  62.735  1.00 20.97 ? 41   PHE A CZ  1 
ATOM   273   N N   . GLY A  1 36  ? -39.743 -15.944  63.897  1.00 13.43 ? 42   GLY A N   1 
ATOM   274   C CA  . GLY A  1 36  ? -39.978 -15.653  65.299  1.00 15.84 ? 42   GLY A CA  1 
ATOM   275   C C   . GLY A  1 36  ? -38.765 -15.447  66.177  1.00 13.74 ? 42   GLY A C   1 
ATOM   276   O O   . GLY A  1 36  ? -38.900 -15.134  67.357  1.00 19.25 ? 42   GLY A O   1 
ATOM   277   N N   . GLY A  1 37  ? -37.577 -15.615  65.618  1.00 9.99  ? 43   GLY A N   1 
ATOM   278   C CA  . GLY A  1 37  ? -36.360 -15.438  66.386  1.00 14.40 ? 43   GLY A CA  1 
ATOM   279   C C   . GLY A  1 37  ? -35.612 -16.730  66.679  1.00 16.64 ? 43   GLY A C   1 
ATOM   280   O O   . GLY A  1 37  ? -34.389 -16.724  66.787  1.00 18.77 ? 43   GLY A O   1 
ATOM   281   N N   . LYS A  1 38  ? -36.337 -17.841  66.792  1.00 18.48 ? 44   LYS A N   1 
ATOM   282   C CA  . LYS A  1 38  ? -35.734 -19.096  67.241  1.00 20.33 ? 44   LYS A CA  1 
ATOM   283   C C   . LYS A  1 38  ? -36.138 -20.324  66.431  1.00 19.21 ? 44   LYS A C   1 
ATOM   284   O O   . LYS A  1 38  ? -35.414 -21.318  66.403  1.00 21.49 ? 44   LYS A O   1 
ATOM   285   C CB  . LYS A  1 38  ? -36.082 -19.343  68.713  1.00 24.00 ? 44   LYS A CB  1 
ATOM   286   C CG  . LYS A  1 38  ? -35.523 -18.298  69.678  1.00 30.30 ? 44   LYS A CG  1 
ATOM   287   C CD  . LYS A  1 38  ? -34.155 -18.694  70.210  1.00 28.38 ? 44   LYS A CD  1 
ATOM   288   C CE  . LYS A  1 38  ? -33.581 -17.621  71.121  1.00 23.88 ? 44   LYS A CE  1 
ATOM   289   N NZ  . LYS A  1 38  ? -34.060 -17.726  72.524  1.00 18.33 ? 44   LYS A NZ  1 
ATOM   290   N N   . ALA A  1 39  ? -37.290 -20.264  65.779  1.00 18.29 ? 45   ALA A N   1 
ATOM   291   C CA  . ALA A  1 39  ? -37.866 -21.452  65.162  1.00 17.16 ? 45   ALA A CA  1 
ATOM   292   C C   . ALA A  1 39  ? -37.894 -21.351  63.640  1.00 18.60 ? 45   ALA A C   1 
ATOM   293   O O   . ALA A  1 39  ? -37.501 -20.333  63.061  1.00 17.07 ? 45   ALA A O   1 
ATOM   294   C CB  . ALA A  1 39  ? -39.277 -21.689  65.706  1.00 16.68 ? 45   ALA A CB  1 
ATOM   295   N N   . ARG A  1 40  ? -38.337 -22.427  62.999  1.00 11.72 ? 46   ARG A N   1 
ATOM   296   C CA  . ARG A  1 40  ? -38.603 -22.413  61.576  1.00 9.35  ? 46   ARG A CA  1 
ATOM   297   C C   . ARG A  1 40  ? -40.080 -22.665  61.390  1.00 14.36 ? 46   ARG A C   1 
ATOM   298   O O   . ARG A  1 40  ? -40.753 -23.101  62.316  1.00 12.35 ? 46   ARG A O   1 
ATOM   299   C CB  . ARG A  1 40  ? -37.774 -23.458  60.841  1.00 12.20 ? 46   ARG A CB  1 
ATOM   300   C CG  . ARG A  1 40  ? -36.276 -23.204  60.896  1.00 14.26 ? 46   ARG A CG  1 
ATOM   301   C CD  . ARG A  1 40  ? -35.537 -24.248  60.100  1.00 13.36 ? 46   ARG A CD  1 
ATOM   302   N NE  . ARG A  1 40  ? -34.111 -24.316  60.399  1.00 15.12 ? 46   ARG A NE  1 
ATOM   303   C CZ  . ARG A  1 40  ? -33.138 -24.055  59.528  1.00 20.07 ? 46   ARG A CZ  1 
ATOM   304   N NH1 . ARG A  1 40  ? -33.424 -23.679  58.291  1.00 23.43 ? 46   ARG A NH1 1 
ATOM   305   N NH2 . ARG A  1 40  ? -31.869 -24.169  59.899  1.00 18.05 ? 46   ARG A NH2 1 
ATOM   306   N N   . ILE A  1 41  ? -40.585 -22.397  60.195  1.00 15.15 ? 47   ILE A N   1 
ATOM   307   C CA  . ILE A  1 41  ? -42.017 -22.463  59.950  1.00 16.15 ? 47   ILE A CA  1 
ATOM   308   C C   . ILE A  1 41  ? -42.594 -23.853  60.239  1.00 14.86 ? 47   ILE A C   1 
ATOM   309   O O   . ILE A  1 41  ? -43.667 -23.978  60.833  1.00 15.49 ? 47   ILE A O   1 
ATOM   310   C CB  . ILE A  1 41  ? -42.331 -22.048  58.507  1.00 14.17 ? 47   ILE A CB  1 
ATOM   311   C CG1 . ILE A  1 41  ? -42.061 -20.554  58.340  1.00 15.43 ? 47   ILE A CG1 1 
ATOM   312   C CG2 . ILE A  1 41  ? -43.762 -22.341  58.171  1.00 18.04 ? 47   ILE A CG2 1 
ATOM   313   C CD1 . ILE A  1 41  ? -42.146 -20.064  56.906  1.00 16.03 ? 47   ILE A CD1 1 
ATOM   314   N N   . ILE A  1 42  ? -41.875 -24.897  59.852  1.00 10.15 ? 48   ILE A N   1 
ATOM   315   C CA  . ILE A  1 42  ? -42.394 -26.253  60.018  1.00 11.79 ? 48   ILE A CA  1 
ATOM   316   C C   . ILE A  1 42  ? -42.578 -26.663  61.488  1.00 10.73 ? 48   ILE A C   1 
ATOM   317   O O   . ILE A  1 42  ? -43.379 -27.555  61.781  1.00 14.64 ? 48   ILE A O   1 
ATOM   318   C CB  . ILE A  1 42  ? -41.496 -27.285  59.314  1.00 11.37 ? 48   ILE A CB  1 
ATOM   319   C CG1 . ILE A  1 42  ? -42.287 -28.574  59.077  1.00 16.29 ? 48   ILE A CG1 1 
ATOM   320   C CG2 . ILE A  1 42  ? -40.232 -27.531  60.123  1.00 12.29 ? 48   ILE A CG2 1 
ATOM   321   C CD1 . ILE A  1 42  ? -41.593 -29.593  58.263  1.00 18.58 ? 48   ILE A CD1 1 
ATOM   322   N N   . ASP A  1 43  ? -41.887 -25.996  62.416  1.00 9.67  ? 49   ASP A N   1 
ATOM   323   C CA  . ASP A  1 43  ? -41.974 -26.362  63.838  1.00 9.78  ? 49   ASP A CA  1 
ATOM   324   C C   . ASP A  1 43  ? -43.371 -26.156  64.414  1.00 10.39 ? 49   ASP A C   1 
ATOM   325   O O   . ASP A  1 43  ? -43.713 -26.728  65.448  1.00 12.33 ? 49   ASP A O   1 
ATOM   326   C CB  . ASP A  1 43  ? -40.954 -25.577  64.671  1.00 8.28  ? 49   ASP A CB  1 
ATOM   327   C CG  . ASP A  1 43  ? -39.532 -25.945  64.333  1.00 11.80 ? 49   ASP A CG  1 
ATOM   328   O OD1 . ASP A  1 43  ? -39.315 -27.123  63.989  1.00 11.61 ? 49   ASP A OD1 1 
ATOM   329   O OD2 . ASP A  1 43  ? -38.639 -25.067  64.399  1.00 13.68 ? 49   ASP A OD2 1 
ATOM   330   N N   . PHE A  1 44  ? -44.185 -25.353  63.736  1.00 14.05 ? 50   PHE A N   1 
ATOM   331   C CA  . PHE A  1 44  ? -45.521 -25.084  64.232  1.00 11.45 ? 50   PHE A CA  1 
ATOM   332   C C   . PHE A  1 44  ? -46.439 -26.279  63.994  1.00 11.21 ? 50   PHE A C   1 
ATOM   333   O O   . PHE A  1 44  ? -47.027 -26.799  64.944  1.00 15.53 ? 50   PHE A O   1 
ATOM   334   C CB  . PHE A  1 44  ? -46.064 -23.794  63.613  1.00 11.41 ? 50   PHE A CB  1 
ATOM   335   C CG  . PHE A  1 44  ? -45.418 -22.568  64.184  1.00 12.19 ? 50   PHE A CG  1 
ATOM   336   C CD1 . PHE A  1 44  ? -44.225 -22.096  63.668  1.00 10.79 ? 50   PHE A CD1 1 
ATOM   337   C CD2 . PHE A  1 44  ? -45.955 -21.939  65.297  1.00 14.71 ? 50   PHE A CD2 1 
ATOM   338   C CE1 . PHE A  1 44  ? -43.601 -20.999  64.216  1.00 8.43  ? 50   PHE A CE1 1 
ATOM   339   C CE2 . PHE A  1 44  ? -45.335 -20.834  65.844  1.00 11.73 ? 50   PHE A CE2 1 
ATOM   340   C CZ  . PHE A  1 44  ? -44.151 -20.368  65.307  1.00 10.55 ? 50   PHE A CZ  1 
ATOM   341   N N   . ALA A  1 45  ? -46.532 -26.748  62.758  1.00 12.66 ? 51   ALA A N   1 
ATOM   342   C CA  . ALA A  1 45  ? -47.326 -27.940  62.498  1.00 14.89 ? 51   ALA A CA  1 
ATOM   343   C C   . ALA A  1 45  ? -46.813 -29.125  63.328  1.00 17.59 ? 51   ALA A C   1 
ATOM   344   O O   . ALA A  1 45  ? -47.602 -29.915  63.843  1.00 14.17 ? 51   ALA A O   1 
ATOM   345   C CB  . ALA A  1 45  ? -47.323 -28.276  61.017  1.00 12.32 ? 51   ALA A CB  1 
ATOM   346   N N   . LEU A  1 46  ? -45.497 -29.240  63.478  1.00 12.96 ? 52   LEU A N   1 
ATOM   347   C CA  . LEU A  1 46  ? -44.923 -30.345  64.255  1.00 13.62 ? 52   LEU A CA  1 
ATOM   348   C C   . LEU A  1 46  ? -45.273 -30.240  65.739  1.00 14.63 ? 52   LEU A C   1 
ATOM   349   O O   . LEU A  1 46  ? -45.632 -31.235  66.375  1.00 11.63 ? 52   LEU A O   1 
ATOM   350   C CB  . LEU A  1 46  ? -43.400 -30.393  64.082  1.00 10.64 ? 52   LEU A CB  1 
ATOM   351   C CG  . LEU A  1 46  ? -42.878 -30.660  62.667  1.00 12.33 ? 52   LEU A CG  1 
ATOM   352   C CD1 . LEU A  1 46  ? -41.360 -30.596  62.637  1.00 10.72 ? 52   LEU A CD1 1 
ATOM   353   C CD2 . LEU A  1 46  ? -43.361 -32.002  62.146  1.00 11.14 ? 52   LEU A CD2 1 
ATOM   354   N N   . SER A  1 47  ? -45.175 -29.030  66.284  1.00 11.60 ? 53   SER A N   1 
ATOM   355   C CA  . SER A  1 47  ? -45.476 -28.811  67.695  1.00 10.92 ? 53   SER A CA  1 
ATOM   356   C C   . SER A  1 47  ? -46.966 -28.997  67.959  1.00 11.11 ? 53   SER A C   1 
ATOM   357   O O   . SER A  1 47  ? -47.347 -29.520  69.001  1.00 11.79 ? 53   SER A O   1 
ATOM   358   C CB  . SER A  1 47  ? -45.023 -27.419  68.143  1.00 9.52  ? 53   SER A CB  1 
ATOM   359   O OG  . SER A  1 47  ? -43.605 -27.310  68.117  1.00 11.46 ? 53   SER A OG  1 
ATOM   360   N N   . ASN A  1 48  ? -47.807 -28.581  67.014  1.00 13.04 ? 54   ASN A N   1 
ATOM   361   C CA  . ASN A  1 48  ? -49.245 -28.828  67.136  1.00 12.56 ? 54   ASN A CA  1 
ATOM   362   C C   . ASN A  1 48  ? -49.554 -30.327  67.260  1.00 8.95  ? 54   ASN A C   1 
ATOM   363   O O   . ASN A  1 48  ? -50.367 -30.736  68.085  1.00 13.69 ? 54   ASN A O   1 
ATOM   364   C CB  . ASN A  1 48  ? -50.006 -28.255  65.938  1.00 15.52 ? 54   ASN A CB  1 
ATOM   365   C CG  . ASN A  1 48  ? -50.073 -26.751  65.943  1.00 15.56 ? 54   ASN A CG  1 
ATOM   366   O OD1 . ASN A  1 48  ? -49.924 -26.109  66.980  1.00 15.65 ? 54   ASN A OD1 1 
ATOM   367   N ND2 . ASN A  1 48  ? -50.316 -26.178  64.774  1.00 11.32 ? 54   ASN A ND2 1 
ATOM   368   N N   . ALA A  1 49  ? -48.899 -31.134  66.433  1.00 10.00 ? 55   ALA A N   1 
ATOM   369   C CA  . ALA A  1 49  ? -49.064 -32.581  66.469  1.00 11.83 ? 55   ALA A CA  1 
ATOM   370   C C   . ALA A  1 49  ? -48.674 -33.131  67.837  1.00 14.74 ? 55   ALA A C   1 
ATOM   371   O O   . ALA A  1 49  ? -49.442 -33.855  68.470  1.00 15.64 ? 55   ALA A O   1 
ATOM   372   C CB  . ALA A  1 49  ? -48.235 -33.237  65.380  1.00 10.07 ? 55   ALA A CB  1 
ATOM   373   N N   . LEU A  1 50  ? -47.472 -32.774  68.282  1.00 11.68 ? 56   LEU A N   1 
ATOM   374   C CA  . LEU A  1 50  ? -46.961 -33.206  69.573  1.00 11.06 ? 56   LEU A CA  1 
ATOM   375   C C   . LEU A  1 50  ? -47.896 -32.782  70.713  1.00 11.19 ? 56   LEU A C   1 
ATOM   376   O O   . LEU A  1 50  ? -48.283 -33.598  71.552  1.00 12.48 ? 56   LEU A O   1 
ATOM   377   C CB  . LEU A  1 50  ? -45.552 -32.636  69.770  1.00 11.91 ? 56   LEU A CB  1 
ATOM   378   C CG  . LEU A  1 50  ? -44.814 -32.841  71.089  1.00 17.46 ? 56   LEU A CG  1 
ATOM   379   C CD1 . LEU A  1 50  ? -44.169 -34.186  71.112  1.00 17.90 ? 56   LEU A CD1 1 
ATOM   380   C CD2 . LEU A  1 50  ? -43.767 -31.758  71.235  1.00 15.77 ? 56   LEU A CD2 1 
ATOM   381   N N   . ASN A  1 51  ? -48.272 -31.505  70.730  1.00 7.67  ? 57   ASN A N   1 
ATOM   382   C CA  . ASN A  1 51  ? -49.084 -30.967  71.816  1.00 10.16 ? 57   ASN A CA  1 
ATOM   383   C C   . ASN A  1 51  ? -50.495 -31.543  71.822  1.00 14.64 ? 57   ASN A C   1 
ATOM   384   O O   . ASN A  1 51  ? -51.120 -31.637  72.881  1.00 13.38 ? 57   ASN A O   1 
ATOM   385   C CB  . ASN A  1 51  ? -49.139 -29.435  71.739  1.00 12.62 ? 57   ASN A CB  1 
ATOM   386   C CG  . ASN A  1 51  ? -47.782 -28.772  71.995  1.00 14.76 ? 57   ASN A CG  1 
ATOM   387   O OD1 . ASN A  1 51  ? -46.841 -29.405  72.471  1.00 16.72 ? 57   ASN A OD1 1 
ATOM   388   N ND2 . ASN A  1 51  ? -47.690 -27.489  71.686  1.00 11.80 ? 57   ASN A ND2 1 
ATOM   389   N N   . SER A  1 52  ? -50.984 -31.929  70.643  1.00 14.48 ? 58   SER A N   1 
ATOM   390   C CA  . SER A  1 52  ? -52.293 -32.580  70.486  1.00 17.16 ? 58   SER A CA  1 
ATOM   391   C C   . SER A  1 52  ? -52.292 -34.031  70.941  1.00 17.50 ? 58   SER A C   1 
ATOM   392   O O   . SER A  1 52  ? -53.335 -34.675  70.968  1.00 17.88 ? 58   SER A O   1 
ATOM   393   C CB  . SER A  1 52  ? -52.753 -32.542  69.021  1.00 16.41 ? 58   SER A CB  1 
ATOM   394   O OG  . SER A  1 52  ? -52.975 -31.224  68.568  1.00 15.57 ? 58   SER A OG  1 
ATOM   395   N N   . GLY A  1 53  ? -51.118 -34.558  71.258  1.00 14.22 ? 59   GLY A N   1 
ATOM   396   C CA  . GLY A  1 53  ? -51.012 -35.941  71.681  1.00 14.63 ? 59   GLY A CA  1 
ATOM   397   C C   . GLY A  1 53  ? -50.769 -36.923  70.554  1.00 13.85 ? 59   GLY A C   1 
ATOM   398   O O   . GLY A  1 53  ? -50.889 -38.134  70.740  1.00 16.06 ? 59   GLY A O   1 
ATOM   399   N N   . ILE A  1 54  ? -50.423 -36.413  69.379  1.00 15.66 ? 60   ILE A N   1 
ATOM   400   C CA  . ILE A  1 54  ? -50.075 -37.291  68.269  1.00 15.42 ? 60   ILE A CA  1 
ATOM   401   C C   . ILE A  1 54  ? -48.593 -37.652  68.370  1.00 17.01 ? 60   ILE A C   1 
ATOM   402   O O   . ILE A  1 54  ? -47.740 -36.777  68.307  1.00 24.41 ? 60   ILE A O   1 
ATOM   403   C CB  . ILE A  1 54  ? -50.380 -36.641  66.908  1.00 13.15 ? 60   ILE A CB  1 
ATOM   404   C CG1 . ILE A  1 54  ? -51.881 -36.397  66.755  1.00 11.46 ? 60   ILE A CG1 1 
ATOM   405   C CG2 . ILE A  1 54  ? -49.897 -37.520  65.778  1.00 11.44 ? 60   ILE A CG2 1 
ATOM   406   C CD1 . ILE A  1 54  ? -52.251 -35.723  65.456  1.00 15.14 ? 60   ILE A CD1 1 
ATOM   407   N N   . ARG A  1 55  ? -48.297 -38.941  68.545  1.00 17.10 ? 61   ARG A N   1 
ATOM   408   C CA  . ARG A  1 55  ? -46.930 -39.400  68.787  1.00 20.96 ? 61   ARG A CA  1 
ATOM   409   C C   . ARG A  1 55  ? -46.226 -39.911  67.519  1.00 18.13 ? 61   ARG A C   1 
ATOM   410   O O   . ARG A  1 55  ? -45.014 -40.101  67.513  1.00 18.83 ? 61   ARG A O   1 
ATOM   411   C CB  . ARG A  1 55  ? -46.936 -40.499  69.862  1.00 25.23 ? 61   ARG A CB  1 
ATOM   412   N N   . ARG A  1 56  ? -46.980 -40.141  66.448  1.00 16.00 ? 62   ARG A N   1 
ATOM   413   C CA  . ARG A  1 56  ? -46.373 -40.577  65.193  1.00 10.81 ? 62   ARG A CA  1 
ATOM   414   C C   . ARG A  1 56  ? -46.447 -39.477  64.144  1.00 10.31 ? 62   ARG A C   1 
ATOM   415   O O   . ARG A  1 56  ? -47.526 -39.016  63.810  1.00 12.61 ? 62   ARG A O   1 
ATOM   416   C CB  . ARG A  1 56  ? -47.051 -41.835  64.654  1.00 10.62 ? 62   ARG A CB  1 
ATOM   417   C CG  . ARG A  1 56  ? -47.100 -42.988  65.616  1.00 14.83 ? 62   ARG A CG  1 
ATOM   418   C CD  . ARG A  1 56  ? -47.331 -44.282  64.844  1.00 20.46 ? 62   ARG A CD  1 
ATOM   419   N NE  . ARG A  1 56  ? -47.257 -45.456  65.702  1.00 19.46 ? 62   ARG A NE  1 
ATOM   420   C CZ  . ARG A  1 56  ? -46.121 -46.043  66.069  1.00 21.55 ? 62   ARG A CZ  1 
ATOM   421   N NH1 . ARG A  1 56  ? -44.956 -45.558  65.665  1.00 19.54 ? 62   ARG A NH1 1 
ATOM   422   N NH2 . ARG A  1 56  ? -46.151 -47.108  66.854  1.00 23.67 ? 62   ARG A NH2 1 
ATOM   423   N N   . ILE A  1 57  ? -45.293 -39.080  63.620  1.00 12.18 ? 63   ILE A N   1 
ATOM   424   C CA  . ILE A  1 57  ? -45.207 -38.011  62.635  1.00 15.08 ? 63   ILE A CA  1 
ATOM   425   C C   . ILE A  1 57  ? -44.407 -38.472  61.424  1.00 14.16 ? 63   ILE A C   1 
ATOM   426   O O   . ILE A  1 57  ? -43.329 -39.048  61.563  1.00 15.00 ? 63   ILE A O   1 
ATOM   427   C CB  . ILE A  1 57  ? -44.545 -36.741  63.219  1.00 10.40 ? 63   ILE A CB  1 
ATOM   428   C CG1 . ILE A  1 57  ? -45.364 -36.180  64.380  1.00 12.45 ? 63   ILE A CG1 1 
ATOM   429   C CG2 . ILE A  1 57  ? -44.322 -35.703  62.135  1.00 12.87 ? 63   ILE A CG2 1 
ATOM   430   C CD1 . ILE A  1 57  ? -44.690 -34.996  65.071  1.00 14.09 ? 63   ILE A CD1 1 
ATOM   431   N N   . GLY A  1 58  ? -44.955 -38.230  60.243  1.00 14.04 ? 64   GLY A N   1 
ATOM   432   C CA  . GLY A  1 58  ? -44.221 -38.389  59.005  1.00 17.81 ? 64   GLY A CA  1 
ATOM   433   C C   . GLY A  1 58  ? -44.076 -37.022  58.357  1.00 15.85 ? 64   GLY A C   1 
ATOM   434   O O   . GLY A  1 58  ? -44.981 -36.195  58.441  1.00 13.40 ? 64   GLY A O   1 
ATOM   435   N N   . VAL A  1 59  ? -42.929 -36.764  57.742  1.00 13.13 ? 65   VAL A N   1 
ATOM   436   C CA  . VAL A  1 59  ? -42.723 -35.501  57.047  1.00 15.49 ? 65   VAL A CA  1 
ATOM   437   C C   . VAL A  1 59  ? -42.254 -35.767  55.632  1.00 17.15 ? 65   VAL A C   1 
ATOM   438   O O   . VAL A  1 59  ? -41.153 -36.262  55.432  1.00 18.26 ? 65   VAL A O   1 
ATOM   439   C CB  . VAL A  1 59  ? -41.684 -34.600  57.740  1.00 12.14 ? 65   VAL A CB  1 
ATOM   440   C CG1 . VAL A  1 59  ? -41.451 -33.343  56.908  1.00 16.89 ? 65   VAL A CG1 1 
ATOM   441   C CG2 . VAL A  1 59  ? -42.127 -34.251  59.166  1.00 14.23 ? 65   VAL A CG2 1 
ATOM   442   N N   . ALA A  1 60  ? -43.094 -35.441  54.656  1.00 16.89 ? 66   ALA A N   1 
ATOM   443   C CA  . ALA A  1 60  ? -42.728 -35.596  53.258  1.00 19.75 ? 66   ALA A CA  1 
ATOM   444   C C   . ALA A  1 60  ? -42.100 -34.320  52.734  1.00 21.11 ? 66   ALA A C   1 
ATOM   445   O O   . ALA A  1 60  ? -42.660 -33.239  52.863  1.00 20.20 ? 66   ALA A O   1 
ATOM   446   C CB  . ALA A  1 60  ? -43.943 -35.973  52.422  1.00 18.17 ? 66   ALA A CB  1 
ATOM   447   N N   . THR A  1 61  ? -40.928 -34.449  52.138  1.00 20.86 ? 67   THR A N   1 
ATOM   448   C CA  . THR A  1 61  ? -40.262 -33.296  51.572  1.00 23.46 ? 67   THR A CA  1 
ATOM   449   C C   . THR A  1 61  ? -40.108 -33.494  50.072  1.00 24.38 ? 67   THR A C   1 
ATOM   450   O O   . THR A  1 61  ? -40.270 -34.601  49.566  1.00 24.24 ? 67   THR A O   1 
ATOM   451   C CB  . THR A  1 61  ? -38.904 -33.072  52.220  1.00 22.25 ? 67   THR A CB  1 
ATOM   452   O OG1 . THR A  1 61  ? -38.042 -34.158  51.876  1.00 21.36 ? 67   THR A OG1 1 
ATOM   453   C CG2 . THR A  1 61  ? -39.057 -33.030  53.733  1.00 22.01 ? 67   THR A CG2 1 
ATOM   454   N N   . GLN A  1 62  ? -39.817 -32.410  49.370  1.00 25.55 ? 68   GLN A N   1 
ATOM   455   C CA  . GLN A  1 62  ? -39.666 -32.448  47.927  1.00 22.51 ? 68   GLN A CA  1 
ATOM   456   C C   . GLN A  1 62  ? -38.410 -31.687  47.534  1.00 19.21 ? 68   GLN A C   1 
ATOM   457   O O   . GLN A  1 62  ? -37.314 -32.224  47.614  1.00 22.42 ? 68   GLN A O   1 
ATOM   458   C CB  . GLN A  1 62  ? -40.905 -31.869  47.233  1.00 27.24 ? 68   GLN A CB  1 
ATOM   459   C CG  . GLN A  1 62  ? -40.872 -31.918  45.703  1.00 31.36 ? 68   GLN A CG  1 
ATOM   460   C CD  . GLN A  1 62  ? -41.399 -33.215  45.132  1.00 31.77 ? 68   GLN A CD  1 
ATOM   461   O OE1 . GLN A  1 62  ? -40.724 -34.244  45.173  1.00 29.46 ? 68   GLN A OE1 1 
ATOM   462   N NE2 . GLN A  1 62  ? -42.603 -33.165  44.566  1.00 34.36 ? 68   GLN A NE2 1 
ATOM   463   N N   . TYR A  1 63  ? -38.564 -30.428  47.147  1.00 18.49 ? 69   TYR A N   1 
ATOM   464   C CA  . TYR A  1 63  ? -37.453 -29.678  46.575  1.00 25.68 ? 69   TYR A CA  1 
ATOM   465   C C   . TYR A  1 63  ? -36.628 -28.943  47.622  1.00 19.42 ? 69   TYR A C   1 
ATOM   466   O O   . TYR A  1 63  ? -37.139 -28.566  48.676  1.00 19.78 ? 69   TYR A O   1 
ATOM   467   C CB  . TYR A  1 63  ? -37.979 -28.692  45.531  1.00 37.17 ? 69   TYR A CB  1 
ATOM   468   C CG  . TYR A  1 63  ? -38.649 -29.369  44.350  1.00 43.81 ? 69   TYR A CG  1 
ATOM   469   C CD1 . TYR A  1 63  ? -38.035 -30.431  43.697  1.00 46.68 ? 69   TYR A CD1 1 
ATOM   470   C CD2 . TYR A  1 63  ? -39.903 -28.959  43.901  1.00 45.17 ? 69   TYR A CD2 1 
ATOM   471   C CE1 . TYR A  1 63  ? -38.637 -31.056  42.625  1.00 48.94 ? 69   TYR A CE1 1 
ATOM   472   C CE2 . TYR A  1 63  ? -40.515 -29.581  42.826  1.00 48.55 ? 69   TYR A CE2 1 
ATOM   473   C CZ  . TYR A  1 63  ? -39.874 -30.630  42.192  1.00 51.07 ? 69   TYR A CZ  1 
ATOM   474   O OH  . TYR A  1 63  ? -40.467 -31.265  41.124  1.00 51.84 ? 69   TYR A OH  1 
ATOM   475   N N   . LYS A  1 64  ? -35.347 -28.763  47.317  1.00 17.09 ? 70   LYS A N   1 
ATOM   476   C CA  . LYS A  1 64  ? -34.416 -28.026  48.162  1.00 17.97 ? 70   LYS A CA  1 
ATOM   477   C C   . LYS A  1 64  ? -34.530 -28.427  49.632  1.00 19.59 ? 70   LYS A C   1 
ATOM   478   O O   . LYS A  1 64  ? -34.558 -27.567  50.507  1.00 21.87 ? 70   LYS A O   1 
ATOM   479   C CB  . LYS A  1 64  ? -34.648 -26.526  48.005  1.00 26.81 ? 70   LYS A CB  1 
ATOM   480   C CG  . LYS A  1 64  ? -34.540 -26.045  46.562  1.00 32.93 ? 70   LYS A CG  1 
ATOM   481   C CD  . LYS A  1 64  ? -34.923 -24.576  46.421  1.00 40.48 ? 70   LYS A CD  1 
ATOM   482   C CE  . LYS A  1 64  ? -36.397 -24.339  46.704  1.00 43.44 ? 70   LYS A CE  1 
ATOM   483   N NZ  . LYS A  1 64  ? -37.284 -24.696  45.567  1.00 47.20 ? 70   LYS A NZ  1 
ATOM   484   N N   . ALA A  1 65  ? -34.584 -29.734  49.888  1.00 20.35 ? 71   ALA A N   1 
ATOM   485   C CA  . ALA A  1 65  ? -34.934 -30.262  51.207  1.00 20.19 ? 71   ALA A CA  1 
ATOM   486   C C   . ALA A  1 65  ? -33.767 -30.418  52.176  1.00 25.77 ? 71   ALA A C   1 
ATOM   487   O O   . ALA A  1 65  ? -33.989 -30.767  53.340  1.00 29.64 ? 71   ALA A O   1 
ATOM   488   C CB  . ALA A  1 65  ? -35.623 -31.599  51.051  1.00 20.49 ? 71   ALA A CB  1 
ATOM   489   N N   . HIS A  1 66  ? -32.541 -30.156  51.727  1.00 18.27 ? 72   HIS A N   1 
ATOM   490   C CA  . HIS A  1 66  ? -31.369 -30.445  52.551  1.00 21.06 ? 72   HIS A CA  1 
ATOM   491   C C   . HIS A  1 66  ? -31.408 -29.871  53.963  1.00 19.99 ? 72   HIS A C   1 
ATOM   492   O O   . HIS A  1 66  ? -31.294 -30.603  54.946  1.00 18.57 ? 72   HIS A O   1 
ATOM   493   C CB  . HIS A  1 66  ? -30.094 -29.936  51.884  1.00 27.19 ? 72   HIS A CB  1 
ATOM   494   C CG  . HIS A  1 66  ? -28.934 -29.839  52.829  1.00 34.41 ? 72   HIS A CG  1 
ATOM   495   N ND1 . HIS A  1 66  ? -28.371 -28.637  53.202  1.00 34.06 ? 72   HIS A ND1 1 
ATOM   496   C CD2 . HIS A  1 66  ? -28.244 -30.799  53.492  1.00 35.92 ? 72   HIS A CD2 1 
ATOM   497   C CE1 . HIS A  1 66  ? -27.382 -28.860  54.051  1.00 32.29 ? 72   HIS A CE1 1 
ATOM   498   N NE2 . HIS A  1 66  ? -27.284 -30.164  54.242  1.00 35.28 ? 72   HIS A NE2 1 
ATOM   499   N N   . SER A  1 67  ? -31.537 -28.558  54.076  1.00 20.38 ? 73   SER A N   1 
ATOM   500   C CA  . SER A  1 67  ? -31.419 -27.947  55.387  1.00 15.63 ? 73   SER A CA  1 
ATOM   501   C C   . SER A  1 67  ? -32.670 -28.223  56.219  1.00 16.32 ? 73   SER A C   1 
ATOM   502   O O   . SER A  1 67  ? -32.602 -28.259  57.446  1.00 15.25 ? 73   SER A O   1 
ATOM   503   C CB  . SER A  1 67  ? -31.157 -26.447  55.260  1.00 17.86 ? 73   SER A CB  1 
ATOM   504   O OG  . SER A  1 67  ? -32.240 -25.769  54.645  1.00 18.75 ? 73   SER A OG  1 
ATOM   505   N N   . LEU A  1 68  ? -33.799 -28.442  55.547  1.00 15.22 ? 74   LEU A N   1 
ATOM   506   C CA  . LEU A  1 68  ? -35.037 -28.817  56.227  1.00 15.38 ? 74   LEU A CA  1 
ATOM   507   C C   . LEU A  1 68  ? -34.850 -30.172  56.888  1.00 16.92 ? 74   LEU A C   1 
ATOM   508   O O   . LEU A  1 68  ? -35.242 -30.390  58.030  1.00 13.00 ? 74   LEU A O   1 
ATOM   509   C CB  . LEU A  1 68  ? -36.208 -28.856  55.244  1.00 10.37 ? 74   LEU A CB  1 
ATOM   510   C CG  . LEU A  1 68  ? -37.550 -29.378  55.761  1.00 11.07 ? 74   LEU A CG  1 
ATOM   511   C CD1 . LEU A  1 68  ? -38.002 -28.596  56.967  1.00 10.07 ? 74   LEU A CD1 1 
ATOM   512   C CD2 . LEU A  1 68  ? -38.597 -29.321  54.680  1.00 12.36 ? 74   LEU A CD2 1 
ATOM   513   N N   . ILE A  1 69  ? -34.209 -31.079  56.170  1.00 15.18 ? 75   ILE A N   1 
ATOM   514   C CA  . ILE A  1 69  ? -33.986 -32.415  56.685  1.00 14.85 ? 75   ILE A CA  1 
ATOM   515   C C   . ILE A  1 69  ? -32.957 -32.400  57.815  1.00 13.18 ? 75   ILE A C   1 
ATOM   516   O O   . ILE A  1 69  ? -33.107 -33.112  58.800  1.00 13.11 ? 75   ILE A O   1 
ATOM   517   C CB  . ILE A  1 69  ? -33.560 -33.360  55.550  1.00 18.85 ? 75   ILE A CB  1 
ATOM   518   C CG1 . ILE A  1 69  ? -34.752 -33.578  54.608  1.00 17.74 ? 75   ILE A CG1 1 
ATOM   519   C CG2 . ILE A  1 69  ? -33.058 -34.688  56.112  1.00 24.57 ? 75   ILE A CG2 1 
ATOM   520   C CD1 . ILE A  1 69  ? -34.420 -34.353  53.344  1.00 22.26 ? 75   ILE A CD1 1 
ATOM   521   N N   . ARG A  1 70  ? -31.929 -31.568  57.701  1.00 15.19 ? 76   ARG A N   1 
ATOM   522   C CA  . ARG A  1 70  ? -30.953 -31.457  58.782  1.00 12.79 ? 76   ARG A CA  1 
ATOM   523   C C   . ARG A  1 70  ? -31.577 -30.849  60.039  1.00 11.67 ? 76   ARG A C   1 
ATOM   524   O O   . ARG A  1 70  ? -31.291 -31.282  61.155  1.00 12.25 ? 76   ARG A O   1 
ATOM   525   C CB  . ARG A  1 70  ? -29.749 -30.630  58.349  1.00 14.56 ? 76   ARG A CB  1 
ATOM   526   C CG  . ARG A  1 70  ? -28.689 -30.478  59.421  1.00 17.32 ? 76   ARG A CG  1 
ATOM   527   C CD  . ARG A  1 70  ? -27.708 -29.371  59.060  1.00 27.77 ? 76   ARG A CD  1 
ATOM   528   N NE  . ARG A  1 70  ? -26.336 -29.706  59.437  1.00 38.64 ? 76   ARG A NE  1 
ATOM   529   C CZ  . ARG A  1 70  ? -25.269 -28.985  59.094  1.00 45.52 ? 76   ARG A CZ  1 
ATOM   530   N NH1 . ARG A  1 70  ? -25.419 -27.884  58.364  1.00 51.01 ? 76   ARG A NH1 1 
ATOM   531   N NH2 . ARG A  1 70  ? -24.052 -29.364  59.473  1.00 39.39 ? 76   ARG A NH2 1 
ATOM   532   N N   . HIS A  1 71  ? -32.427 -29.846  59.859  1.00 11.64 ? 77   HIS A N   1 
ATOM   533   C CA  . HIS A  1 71  ? -33.205 -29.308  60.966  1.00 12.59 ? 77   HIS A CA  1 
ATOM   534   C C   . HIS A  1 71  ? -34.006 -30.422  61.658  1.00 9.96  ? 77   HIS A C   1 
ATOM   535   O O   . HIS A  1 71  ? -33.974 -30.536  62.868  1.00 9.01  ? 77   HIS A O   1 
ATOM   536   C CB  . HIS A  1 71  ? -34.134 -28.196  60.471  1.00 9.83  ? 77   HIS A CB  1 
ATOM   537   C CG  . HIS A  1 71  ? -35.012 -27.612  61.536  1.00 10.59 ? 77   HIS A CG  1 
ATOM   538   N ND1 . HIS A  1 71  ? -34.559 -26.694  62.460  1.00 11.68 ? 77   HIS A ND1 1 
ATOM   539   C CD2 . HIS A  1 71  ? -36.321 -27.813  61.816  1.00 10.10 ? 77   HIS A CD2 1 
ATOM   540   C CE1 . HIS A  1 71  ? -35.551 -26.357  63.261  1.00 11.83 ? 77   HIS A CE1 1 
ATOM   541   N NE2 . HIS A  1 71  ? -36.631 -27.023  62.893  1.00 11.79 ? 77   HIS A NE2 1 
ATOM   542   N N   . LEU A  1 72  ? -34.694 -31.257  60.891  1.00 14.16 ? 78   LEU A N   1 
ATOM   543   C CA  . LEU A  1 72  ? -35.510 -32.314  61.477  1.00 10.13 ? 78   LEU A CA  1 
ATOM   544   C C   . LEU A  1 72  ? -34.655 -33.336  62.235  1.00 11.37 ? 78   LEU A C   1 
ATOM   545   O O   . LEU A  1 72  ? -35.028 -33.766  63.324  1.00 11.24 ? 78   LEU A O   1 
ATOM   546   C CB  . LEU A  1 72  ? -36.342 -33.004  60.394  1.00 11.88 ? 78   LEU A CB  1 
ATOM   547   C CG  . LEU A  1 72  ? -37.390 -32.138  59.686  1.00 12.22 ? 78   LEU A CG  1 
ATOM   548   C CD1 . LEU A  1 72  ? -38.043 -32.885  58.526  1.00 15.21 ? 78   LEU A CD1 1 
ATOM   549   C CD2 . LEU A  1 72  ? -38.435 -31.648  60.674  1.00 15.54 ? 78   LEU A CD2 1 
ATOM   550   N N   . GLN A  1 73  ? -33.508 -33.703  61.663  1.00 12.46 ? 79   GLN A N   1 
ATOM   551   C CA  . GLN A  1 73  ? -32.565 -34.639  62.282  1.00 12.22 ? 79   GLN A CA  1 
ATOM   552   C C   . GLN A  1 73  ? -32.012 -34.116  63.609  1.00 15.03 ? 79   GLN A C   1 
ATOM   553   O O   . GLN A  1 73  ? -31.850 -34.865  64.574  1.00 13.02 ? 79   GLN A O   1 
ATOM   554   C CB  . GLN A  1 73  ? -31.396 -34.927  61.331  1.00 15.24 ? 79   GLN A CB  1 
ATOM   555   C CG  . GLN A  1 73  ? -31.779 -35.779  60.131  1.00 23.72 ? 79   GLN A CG  1 
ATOM   556   C CD  . GLN A  1 73  ? -30.695 -35.861  59.056  1.00 24.79 ? 79   GLN A CD  1 
ATOM   557   O OE1 . GLN A  1 73  ? -29.722 -35.107  59.060  1.00 23.10 ? 79   GLN A OE1 1 
ATOM   558   N NE2 . GLN A  1 73  ? -30.883 -36.776  58.116  1.00 24.88 ? 79   GLN A NE2 1 
ATOM   559   N N   . ARG A  1 74  ? -31.715 -32.824  63.648  1.00 12.75 ? 80   ARG A N   1 
ATOM   560   C CA  . ARG A  1 74  ? -31.113 -32.219  64.827  1.00 10.55 ? 80   ARG A CA  1 
ATOM   561   C C   . ARG A  1 74  ? -32.131 -31.899  65.902  1.00 12.12 ? 80   ARG A C   1 
ATOM   562   O O   . ARG A  1 74  ? -31.874 -32.108  67.081  1.00 13.57 ? 80   ARG A O   1 
ATOM   563   C CB  . ARG A  1 74  ? -30.379 -30.949  64.439  1.00 9.47  ? 80   ARG A CB  1 
ATOM   564   C CG  . ARG A  1 74  ? -29.161 -31.213  63.583  1.00 13.36 ? 80   ARG A CG  1 
ATOM   565   C CD  . ARG A  1 74  ? -28.373 -29.942  63.369  1.00 15.94 ? 80   ARG A CD  1 
ATOM   566   N NE  . ARG A  1 74  ? -26.980 -30.251  63.059  1.00 26.10 ? 80   ARG A NE  1 
ATOM   567   C CZ  . ARG A  1 74  ? -25.993 -29.363  63.066  1.00 27.98 ? 80   ARG A CZ  1 
ATOM   568   N NH1 . ARG A  1 74  ? -26.238 -28.099  63.370  1.00 27.54 ? 80   ARG A NH1 1 
ATOM   569   N NH2 . ARG A  1 74  ? -24.755 -29.747  62.780  1.00 29.28 ? 80   ARG A NH2 1 
ATOM   570   N N   . GLY A  1 75  ? -33.285 -31.384  65.493  1.00 10.05 ? 81   GLY A N   1 
ATOM   571   C CA  . GLY A  1 75  ? -34.260 -30.884  66.444  1.00 9.24  ? 81   GLY A CA  1 
ATOM   572   C C   . GLY A  1 75  ? -35.349 -31.859  66.861  1.00 8.68  ? 81   GLY A C   1 
ATOM   573   O O   . GLY A  1 75  ? -35.807 -31.823  67.994  1.00 15.74 ? 81   GLY A O   1 
ATOM   574   N N   . TRP A  1 76  ? -35.769 -32.730  65.957  1.00 10.20 ? 82   TRP A N   1 
ATOM   575   C CA  . TRP A  1 76  ? -36.901 -33.607  66.230  1.00 13.57 ? 82   TRP A CA  1 
ATOM   576   C C   . TRP A  1 76  ? -36.429 -35.048  66.371  1.00 17.16 ? 82   TRP A C   1 
ATOM   577   O O   . TRP A  1 76  ? -36.873 -35.953  65.662  1.00 17.86 ? 82   TRP A O   1 
ATOM   578   C CB  . TRP A  1 76  ? -37.959 -33.436  65.133  1.00 12.61 ? 82   TRP A CB  1 
ATOM   579   C CG  . TRP A  1 76  ? -38.599 -32.084  65.266  1.00 11.70 ? 82   TRP A CG  1 
ATOM   580   C CD1 . TRP A  1 76  ? -38.134 -30.899  64.768  1.00 10.85 ? 82   TRP A CD1 1 
ATOM   581   C CD2 . TRP A  1 76  ? -39.778 -31.772  66.011  1.00 10.80 ? 82   TRP A CD2 1 
ATOM   582   N NE1 . TRP A  1 76  ? -38.967 -29.873  65.138  1.00 10.36 ? 82   TRP A NE1 1 
ATOM   583   C CE2 . TRP A  1 76  ? -39.985 -30.384  65.903  1.00 12.04 ? 82   TRP A CE2 1 
ATOM   584   C CE3 . TRP A  1 76  ? -40.688 -32.536  66.745  1.00 11.10 ? 82   TRP A CE3 1 
ATOM   585   C CZ2 . TRP A  1 76  ? -41.063 -29.742  66.508  1.00 12.85 ? 82   TRP A CZ2 1 
ATOM   586   C CZ3 . TRP A  1 76  ? -41.763 -31.901  67.335  1.00 11.33 ? 82   TRP A CZ3 1 
ATOM   587   C CH2 . TRP A  1 76  ? -41.939 -30.516  67.216  1.00 9.89  ? 82   TRP A CH2 1 
ATOM   588   N N   . ASP A  1 77  ? -35.540 -35.240  67.337  1.00 17.38 ? 83   ASP A N   1 
ATOM   589   C CA  . ASP A  1 77  ? -34.758 -36.455  67.444  1.00 15.69 ? 83   ASP A CA  1 
ATOM   590   C C   . ASP A  1 77  ? -35.101 -37.294  68.671  1.00 14.61 ? 83   ASP A C   1 
ATOM   591   O O   . ASP A  1 77  ? -34.399 -38.252  68.980  1.00 19.07 ? 83   ASP A O   1 
ATOM   592   C CB  . ASP A  1 77  ? -33.276 -36.085  67.460  1.00 16.12 ? 83   ASP A CB  1 
ATOM   593   C CG  . ASP A  1 77  ? -32.904 -35.173  68.629  1.00 21.47 ? 83   ASP A CG  1 
ATOM   594   O OD1 . ASP A  1 77  ? -33.806 -34.684  69.352  1.00 18.32 ? 83   ASP A OD1 1 
ATOM   595   O OD2 . ASP A  1 77  ? -31.693 -34.944  68.826  1.00 18.94 ? 83   ASP A OD2 1 
ATOM   596   N N   . PHE A  1 78  ? -36.181 -36.944  69.360  1.00 10.51 ? 84   PHE A N   1 
ATOM   597   C CA  . PHE A  1 78  ? -36.469 -37.516  70.674  1.00 13.15 ? 84   PHE A CA  1 
ATOM   598   C C   . PHE A  1 78  ? -37.599 -38.548  70.690  1.00 16.03 ? 84   PHE A C   1 
ATOM   599   O O   . PHE A  1 78  ? -38.088 -38.910  71.759  1.00 16.10 ? 84   PHE A O   1 
ATOM   600   C CB  . PHE A  1 78  ? -36.791 -36.391  71.671  1.00 12.37 ? 84   PHE A CB  1 
ATOM   601   C CG  . PHE A  1 78  ? -37.913 -35.487  71.234  1.00 12.96 ? 84   PHE A CG  1 
ATOM   602   C CD1 . PHE A  1 78  ? -37.664 -34.372  70.435  1.00 15.24 ? 84   PHE A CD1 1 
ATOM   603   C CD2 . PHE A  1 78  ? -39.215 -35.735  71.632  1.00 10.28 ? 84   PHE A CD2 1 
ATOM   604   C CE1 . PHE A  1 78  ? -38.708 -33.522  70.031  1.00 14.88 ? 84   PHE A CE1 1 
ATOM   605   C CE2 . PHE A  1 78  ? -40.260 -34.899  71.226  1.00 14.10 ? 84   PHE A CE2 1 
ATOM   606   C CZ  . PHE A  1 78  ? -40.004 -33.790  70.429  1.00 14.83 ? 84   PHE A CZ  1 
ATOM   607   N N   . PHE A  1 79  ? -38.003 -39.029  69.519  1.00 12.78 ? 85   PHE A N   1 
ATOM   608   C CA  . PHE A  1 79  ? -39.053 -40.047  69.417  1.00 12.24 ? 85   PHE A CA  1 
ATOM   609   C C   . PHE A  1 79  ? -38.466 -41.460  69.418  1.00 14.82 ? 85   PHE A C   1 
ATOM   610   O O   . PHE A  1 79  ? -37.530 -41.749  68.674  1.00 14.32 ? 85   PHE A O   1 
ATOM   611   C CB  . PHE A  1 79  ? -39.894 -39.850  68.148  1.00 15.31 ? 85   PHE A CB  1 
ATOM   612   C CG  . PHE A  1 79  ? -40.679 -38.552  68.107  1.00 17.54 ? 85   PHE A CG  1 
ATOM   613   C CD1 . PHE A  1 79  ? -40.038 -37.323  68.034  1.00 16.66 ? 85   PHE A CD1 1 
ATOM   614   C CD2 . PHE A  1 79  ? -42.060 -38.573  68.084  1.00 21.06 ? 85   PHE A CD2 1 
ATOM   615   C CE1 . PHE A  1 79  ? -40.765 -36.147  67.984  1.00 21.29 ? 85   PHE A CE1 1 
ATOM   616   C CE2 . PHE A  1 79  ? -42.792 -37.397  68.026  1.00 23.53 ? 85   PHE A CE2 1 
ATOM   617   C CZ  . PHE A  1 79  ? -42.143 -36.187  67.977  1.00 22.23 ? 85   PHE A CZ  1 
ATOM   618   N N   . ARG A  1 80  ? -39.030 -42.342  70.239  1.00 10.27 ? 86   ARG A N   1 
ATOM   619   C CA  . ARG A  1 80  ? -38.556 -43.727  70.315  1.00 12.21 ? 86   ARG A CA  1 
ATOM   620   C C   . ARG A  1 80  ? -39.685 -44.703  69.986  1.00 12.03 ? 86   ARG A C   1 
ATOM   621   O O   . ARG A  1 80  ? -40.737 -44.666  70.617  1.00 12.60 ? 86   ARG A O   1 
ATOM   622   C CB  . ARG A  1 80  ? -37.983 -44.032  71.704  1.00 11.47 ? 86   ARG A CB  1 
ATOM   623   C CG  . ARG A  1 80  ? -36.659 -43.323  72.034  1.00 13.30 ? 86   ARG A CG  1 
ATOM   624   C CD  . ARG A  1 80  ? -35.493 -43.814  71.161  1.00 7.24  ? 86   ARG A CD  1 
ATOM   625   N NE  . ARG A  1 80  ? -35.145 -45.197  71.471  1.00 13.70 ? 86   ARG A NE  1 
ATOM   626   C CZ  . ARG A  1 80  ? -33.978 -45.775  71.197  1.00 17.89 ? 86   ARG A CZ  1 
ATOM   627   N NH1 . ARG A  1 80  ? -33.012 -45.096  70.588  1.00 17.08 ? 86   ARG A NH1 1 
ATOM   628   N NH2 . ARG A  1 80  ? -33.780 -47.041  71.537  1.00 16.22 ? 86   ARG A NH2 1 
ATOM   629   N N   . PRO A  1 81  ? -39.473 -45.576  68.991  1.00 13.70 ? 87   PRO A N   1 
ATOM   630   C CA  . PRO A  1 81  ? -40.503 -46.547  68.593  1.00 12.34 ? 87   PRO A CA  1 
ATOM   631   C C   . PRO A  1 81  ? -40.957 -47.507  69.708  1.00 10.38 ? 87   PRO A C   1 
ATOM   632   O O   . PRO A  1 81  ? -42.080 -47.999  69.643  1.00 11.52 ? 87   PRO A O   1 
ATOM   633   C CB  . PRO A  1 81  ? -39.826 -47.315  67.445  1.00 14.78 ? 87   PRO A CB  1 
ATOM   634   C CG  . PRO A  1 81  ? -38.848 -46.337  66.868  1.00 14.08 ? 87   PRO A CG  1 
ATOM   635   C CD  . PRO A  1 81  ? -38.336 -45.554  68.049  1.00 14.16 ? 87   PRO A CD  1 
ATOM   636   N N   . GLU A  1 82  ? -40.144 -47.753  70.729  1.00 10.58 ? 88   GLU A N   1 
ATOM   637   C CA  . GLU A  1 82  ? -40.598 -48.643  71.796  1.00 11.08 ? 88   GLU A CA  1 
ATOM   638   C C   . GLU A  1 82  ? -41.600 -47.944  72.721  1.00 15.43 ? 88   GLU A C   1 
ATOM   639   O O   . GLU A  1 82  ? -42.214 -48.584  73.565  1.00 21.71 ? 88   GLU A O   1 
ATOM   640   C CB  . GLU A  1 82  ? -39.413 -49.201  72.586  1.00 10.97 ? 88   GLU A CB  1 
ATOM   641   C CG  . GLU A  1 82  ? -38.394 -48.190  73.013  1.00 21.43 ? 88   GLU A CG  1 
ATOM   642   C CD  . GLU A  1 82  ? -37.205 -48.034  72.062  1.00 17.05 ? 88   GLU A CD  1 
ATOM   643   O OE1 . GLU A  1 82  ? -37.329 -47.243  71.119  1.00 14.39 ? 88   GLU A OE1 1 
ATOM   644   O OE2 . GLU A  1 82  ? -36.134 -48.644  72.296  1.00 16.53 ? 88   GLU A OE2 1 
ATOM   645   N N   . ARG A  1 83  ? -41.785 -46.640  72.538  1.00 13.97 ? 89   ARG A N   1 
ATOM   646   C CA  . ARG A  1 83  ? -42.792 -45.891  73.280  1.00 12.96 ? 89   ARG A CA  1 
ATOM   647   C C   . ARG A  1 83  ? -44.001 -45.571  72.381  1.00 14.53 ? 89   ARG A C   1 
ATOM   648   O O   . ARG A  1 83  ? -44.866 -44.763  72.731  1.00 12.98 ? 89   ARG A O   1 
ATOM   649   C CB  . ARG A  1 83  ? -42.174 -44.618  73.863  1.00 10.04 ? 89   ARG A CB  1 
ATOM   650   C CG  . ARG A  1 83  ? -41.058 -44.932  74.877  1.00 15.64 ? 89   ARG A CG  1 
ATOM   651   C CD  . ARG A  1 83  ? -40.697 -43.749  75.763  1.00 15.21 ? 89   ARG A CD  1 
ATOM   652   N NE  . ARG A  1 83  ? -40.180 -42.613  75.006  1.00 12.72 ? 89   ARG A NE  1 
ATOM   653   C CZ  . ARG A  1 83  ? -38.891 -42.291  74.912  1.00 10.24 ? 89   ARG A CZ  1 
ATOM   654   N NH1 . ARG A  1 83  ? -37.973 -43.028  75.513  1.00 8.00  ? 89   ARG A NH1 1 
ATOM   655   N NH2 . ARG A  1 83  ? -38.519 -41.234  74.204  1.00 14.93 ? 89   ARG A NH2 1 
ATOM   656   N N   . ASN A  1 84  ? -44.039 -46.229  71.225  1.00 15.62 ? 90   ASN A N   1 
ATOM   657   C CA  . ASN A  1 84  ? -45.062 -46.021  70.195  1.00 17.82 ? 90   ASN A CA  1 
ATOM   658   C C   . ASN A  1 84  ? -45.049 -44.608  69.613  1.00 20.96 ? 90   ASN A C   1 
ATOM   659   O O   . ASN A  1 84  ? -46.059 -44.100  69.126  1.00 20.03 ? 90   ASN A O   1 
ATOM   660   C CB  . ASN A  1 84  ? -46.439 -46.370  70.750  1.00 17.24 ? 90   ASN A CB  1 
ATOM   661   C CG  . ASN A  1 84  ? -46.616 -47.860  70.925  1.00 19.44 ? 90   ASN A CG  1 
ATOM   662   O OD1 . ASN A  1 84  ? -46.158 -48.649  70.096  1.00 22.43 ? 90   ASN A OD1 1 
ATOM   663   N ND2 . ASN A  1 84  ? -47.266 -48.255  72.005  1.00 17.85 ? 90   ASN A ND2 1 
ATOM   664   N N   . GLU A  1 85  ? -43.875 -43.996  69.664  1.00 20.83 ? 91   GLU A N   1 
ATOM   665   C CA  . GLU A  1 85  ? -43.611 -42.718  69.040  1.00 20.45 ? 91   GLU A CA  1 
ATOM   666   C C   . GLU A  1 85  ? -42.805 -42.970  67.790  1.00 22.04 ? 91   GLU A C   1 
ATOM   667   O O   . GLU A  1 85  ? -42.002 -43.894  67.758  1.00 28.13 ? 91   GLU A O   1 
ATOM   668   C CB  . GLU A  1 85  ? -42.829 -41.803  69.981  1.00 20.03 ? 91   GLU A CB  1 
ATOM   669   C CG  . GLU A  1 85  ? -43.380 -41.723  71.377  1.00 20.53 ? 91   GLU A CG  1 
ATOM   670   C CD  . GLU A  1 85  ? -42.389 -41.138  72.342  1.00 25.33 ? 91   GLU A CD  1 
ATOM   671   O OE1 . GLU A  1 85  ? -41.170 -41.270  72.100  1.00 17.94 ? 91   GLU A OE1 1 
ATOM   672   O OE2 . GLU A  1 85  ? -42.826 -40.538  73.343  1.00 36.93 ? 91   GLU A OE2 1 
ATOM   673   N N   . SER A  1 86  ? -42.991 -42.157  66.762  1.00 16.90 ? 92   SER A N   1 
ATOM   674   C CA  . SER A  1 86  ? -42.135 -42.267  65.594  1.00 14.29 ? 92   SER A CA  1 
ATOM   675   C C   . SER A  1 86  ? -42.049 -40.933  64.878  1.00 13.02 ? 92   SER A C   1 
ATOM   676   O O   . SER A  1 86  ? -42.938 -40.101  64.981  1.00 16.42 ? 92   SER A O   1 
ATOM   677   C CB  . SER A  1 86  ? -42.625 -43.367  64.638  1.00 17.20 ? 92   SER A CB  1 
ATOM   678   O OG  . SER A  1 86  ? -43.981 -43.211  64.249  1.00 13.07 ? 92   SER A OG  1 
ATOM   679   N N   . PHE A  1 87  ? -40.949 -40.731  64.175  1.00 13.38 ? 93   PHE A N   1 
ATOM   680   C CA  . PHE A  1 87  ? -40.753 -39.521  63.395  1.00 12.46 ? 93   PHE A CA  1 
ATOM   681   C C   . PHE A  1 87  ? -39.981 -39.936  62.158  1.00 13.48 ? 93   PHE A C   1 
ATOM   682   O O   . PHE A  1 87  ? -38.777 -40.209  62.215  1.00 16.98 ? 93   PHE A O   1 
ATOM   683   C CB  . PHE A  1 87  ? -40.006 -38.451  64.203  1.00 14.34 ? 93   PHE A CB  1 
ATOM   684   C CG  . PHE A  1 87  ? -40.093 -37.069  63.610  1.00 15.47 ? 93   PHE A CG  1 
ATOM   685   C CD1 . PHE A  1 87  ? -39.308 -36.710  62.520  1.00 20.53 ? 93   PHE A CD1 1 
ATOM   686   C CD2 . PHE A  1 87  ? -40.948 -36.125  64.151  1.00 12.63 ? 93   PHE A CD2 1 
ATOM   687   C CE1 . PHE A  1 87  ? -39.391 -35.441  61.972  1.00 15.86 ? 93   PHE A CE1 1 
ATOM   688   C CE2 . PHE A  1 87  ? -41.026 -34.855  63.619  1.00 10.72 ? 93   PHE A CE2 1 
ATOM   689   C CZ  . PHE A  1 87  ? -40.255 -34.517  62.525  1.00 14.92 ? 93   PHE A CZ  1 
ATOM   690   N N   . ASP A  1 88  ? -40.689 -40.021  61.041  1.00 14.52 ? 94   ASP A N   1 
ATOM   691   C CA  . ASP A  1 88  ? -40.086 -40.477  59.800  1.00 12.51 ? 94   ASP A CA  1 
ATOM   692   C C   . ASP A  1 88  ? -39.883 -39.337  58.816  1.00 17.01 ? 94   ASP A C   1 
ATOM   693   O O   . ASP A  1 88  ? -40.828 -38.613  58.499  1.00 18.80 ? 94   ASP A O   1 
ATOM   694   C CB  . ASP A  1 88  ? -40.957 -41.556  59.166  1.00 13.17 ? 94   ASP A CB  1 
ATOM   695   C CG  . ASP A  1 88  ? -40.927 -42.863  59.950  1.00 23.13 ? 94   ASP A CG  1 
ATOM   696   O OD1 . ASP A  1 88  ? -39.869 -43.531  59.940  1.00 25.09 ? 94   ASP A OD1 1 
ATOM   697   O OD2 . ASP A  1 88  ? -41.955 -43.217  60.569  1.00 23.66 ? 94   ASP A OD2 1 
ATOM   698   N N   . ILE A  1 89  ? -38.650 -39.186  58.342  1.00 12.30 ? 95   ILE A N   1 
ATOM   699   C CA  . ILE A  1 89  ? -38.324 -38.180  57.339  1.00 10.79 ? 95   ILE A CA  1 
ATOM   700   C C   . ILE A  1 89  ? -38.313 -38.832  55.963  1.00 14.80 ? 95   ILE A C   1 
ATOM   701   O O   . ILE A  1 89  ? -37.524 -39.728  55.710  1.00 18.68 ? 95   ILE A O   1 
ATOM   702   C CB  . ILE A  1 89  ? -36.979 -37.521  57.651  1.00 12.37 ? 95   ILE A CB  1 
ATOM   703   C CG1 . ILE A  1 89  ? -37.001 -36.981  59.089  1.00 16.69 ? 95   ILE A CG1 1 
ATOM   704   C CG2 . ILE A  1 89  ? -36.687 -36.422  56.658  1.00 18.37 ? 95   ILE A CG2 1 
ATOM   705   C CD1 . ILE A  1 89  ? -35.683 -36.458  59.583  1.00 15.26 ? 95   ILE A CD1 1 
ATOM   706   N N   . LEU A  1 90  ? -39.206 -38.381  55.085  1.00 15.68 ? 96   LEU A N   1 
ATOM   707   C CA  . LEU A  1 90  ? -39.555 -39.118  53.870  1.00 16.11 ? 96   LEU A CA  1 
ATOM   708   C C   . LEU A  1 90  ? -39.333 -38.328  52.594  1.00 18.80 ? 96   LEU A C   1 
ATOM   709   O O   . LEU A  1 90  ? -40.296 -37.858  51.985  1.00 18.82 ? 96   LEU A O   1 
ATOM   710   C CB  . LEU A  1 90  ? -41.016 -39.552  53.936  1.00 17.68 ? 96   LEU A CB  1 
ATOM   711   C CG  . LEU A  1 90  ? -41.316 -40.405  55.159  1.00 20.61 ? 96   LEU A CG  1 
ATOM   712   C CD1 . LEU A  1 90  ? -42.805 -40.597  55.354  1.00 20.80 ? 96   LEU A CD1 1 
ATOM   713   C CD2 . LEU A  1 90  ? -40.600 -41.736  55.011  1.00 21.01 ? 96   LEU A CD2 1 
ATOM   714   N N   . PRO A  1 91  ? -38.067 -38.190  52.178  1.00 21.50 ? 97   PRO A N   1 
ATOM   715   C CA  . PRO A  1 91  ? -37.690 -37.376  51.025  1.00 25.09 ? 97   PRO A CA  1 
ATOM   716   C C   . PRO A  1 91  ? -38.017 -38.055  49.705  1.00 28.66 ? 97   PRO A C   1 
ATOM   717   O O   . PRO A  1 91  ? -38.072 -39.281  49.652  1.00 28.51 ? 97   PRO A O   1 
ATOM   718   C CB  . PRO A  1 91  ? -36.173 -37.221  51.179  1.00 23.28 ? 97   PRO A CB  1 
ATOM   719   C CG  . PRO A  1 91  ? -35.831 -37.829  52.497  1.00 24.30 ? 97   PRO A CG  1 
ATOM   720   C CD  . PRO A  1 91  ? -36.892 -38.819  52.787  1.00 22.23 ? 97   PRO A CD  1 
ATOM   721   N N   . ALA A  1 92  ? -38.221 -37.252  48.664  1.00 26.86 ? 98   ALA A N   1 
ATOM   722   C CA  . ALA A  1 92  ? -38.431 -37.750  47.314  1.00 26.28 ? 98   ALA A CA  1 
ATOM   723   C C   . ALA A  1 92  ? -37.183 -38.446  46.785  1.00 25.29 ? 98   ALA A C   1 
ATOM   724   O O   . ALA A  1 92  ? -37.150 -39.666  46.642  1.00 29.49 ? 98   ALA A O   1 
ATOM   725   C CB  . ALA A  1 92  ? -38.830 -36.609  46.399  1.00 25.46 ? 98   ALA A CB  1 
ATOM   726   N N   . THR A  1 99  ? -35.171 -38.318  38.250  1.00 71.17 ? 105  THR A N   1 
ATOM   727   C CA  . THR A  1 99  ? -36.171 -39.348  37.985  1.00 66.94 ? 105  THR A CA  1 
ATOM   728   C C   . THR A  1 99  ? -36.733 -39.933  39.285  1.00 63.96 ? 105  THR A C   1 
ATOM   729   O O   . THR A  1 99  ? -37.022 -41.128  39.360  1.00 64.51 ? 105  THR A O   1 
ATOM   730   C CB  . THR A  1 99  ? -35.586 -40.488  37.123  1.00 63.28 ? 105  THR A CB  1 
ATOM   731   N N   . GLN A  1 100 ? -36.878 -39.085  40.302  1.00 56.62 ? 106  GLN A N   1 
ATOM   732   C CA  . GLN A  1 100 ? -37.427 -39.508  41.587  1.00 51.59 ? 106  GLN A CA  1 
ATOM   733   C C   . GLN A  1 100 ? -37.845 -38.285  42.419  1.00 42.81 ? 106  GLN A C   1 
ATOM   734   O O   . GLN A  1 100 ? -37.104 -37.814  43.283  1.00 37.65 ? 106  GLN A O   1 
ATOM   735   C CB  . GLN A  1 100 ? -36.410 -40.377  42.349  1.00 53.84 ? 106  GLN A CB  1 
ATOM   736   C CG  . GLN A  1 100 ? -36.883 -40.993  43.692  1.00 85.58 ? 106  GLN A CG  1 
ATOM   737   C CD  . GLN A  1 100 ? -37.990 -42.048  43.548  1.00 83.85 ? 106  GLN A CD  1 
ATOM   738   O OE1 . GLN A  1 100 ? -39.168 -41.767  43.782  1.00 82.24 ? 106  GLN A OE1 1 
ATOM   739   N NE2 . GLN A  1 100 ? -37.605 -43.269  43.180  1.00 82.70 ? 106  GLN A NE2 1 
ATOM   740   N N   . TRP A  1 101 ? -39.028 -37.764  42.103  1.00 39.14 ? 107  TRP A N   1 
ATOM   741   C CA  . TRP A  1 101 ? -39.733 -36.798  42.934  1.00 36.04 ? 107  TRP A CA  1 
ATOM   742   C C   . TRP A  1 101 ? -41.125 -37.338  43.228  1.00 31.31 ? 107  TRP A C   1 
ATOM   743   O O   . TRP A  1 101 ? -41.546 -38.327  42.633  1.00 33.91 ? 107  TRP A O   1 
ATOM   744   C CB  . TRP A  1 101 ? -39.854 -35.442  42.247  1.00 40.03 ? 107  TRP A CB  1 
ATOM   745   C CG  . TRP A  1 101 ? -38.573 -34.833  41.825  1.00 45.30 ? 107  TRP A CG  1 
ATOM   746   C CD1 . TRP A  1 101 ? -38.100 -34.725  40.551  1.00 49.51 ? 107  TRP A CD1 1 
ATOM   747   C CD2 . TRP A  1 101 ? -37.591 -34.228  42.671  1.00 45.81 ? 107  TRP A CD2 1 
ATOM   748   N NE1 . TRP A  1 101 ? -36.883 -34.090  40.549  1.00 49.81 ? 107  TRP A NE1 1 
ATOM   749   C CE2 . TRP A  1 101 ? -36.547 -33.775  41.840  1.00 47.95 ? 107  TRP A CE2 1 
ATOM   750   C CE3 . TRP A  1 101 ? -37.492 -34.025  44.051  1.00 42.31 ? 107  TRP A CE3 1 
ATOM   751   C CZ2 . TRP A  1 101 ? -35.418 -33.133  42.343  1.00 45.03 ? 107  TRP A CZ2 1 
ATOM   752   C CZ3 . TRP A  1 101 ? -36.371 -33.388  44.547  1.00 38.40 ? 107  TRP A CZ3 1 
ATOM   753   C CH2 . TRP A  1 101 ? -35.350 -32.950  43.697  1.00 41.64 ? 107  TRP A CH2 1 
ATOM   754   N N   . TYR A  1 102 ? -41.850 -36.695  44.133  1.00 25.77 ? 108  TYR A N   1 
ATOM   755   C CA  . TYR A  1 102 ? -43.267 -37.014  44.275  1.00 30.55 ? 108  TYR A CA  1 
ATOM   756   C C   . TYR A  1 102 ? -44.011 -36.357  43.124  1.00 35.11 ? 108  TYR A C   1 
ATOM   757   O O   . TYR A  1 102 ? -43.554 -35.347  42.594  1.00 35.94 ? 108  TYR A O   1 
ATOM   758   C CB  . TYR A  1 102 ? -43.833 -36.542  45.618  1.00 26.39 ? 108  TYR A CB  1 
ATOM   759   C CG  . TYR A  1 102 ? -43.204 -37.208  46.824  1.00 20.93 ? 108  TYR A CG  1 
ATOM   760   C CD1 . TYR A  1 102 ? -43.235 -38.585  46.976  1.00 21.53 ? 108  TYR A CD1 1 
ATOM   761   C CD2 . TYR A  1 102 ? -42.588 -36.455  47.811  1.00 21.46 ? 108  TYR A CD2 1 
ATOM   762   C CE1 . TYR A  1 102 ? -42.660 -39.195  48.071  1.00 18.87 ? 108  TYR A CE1 1 
ATOM   763   C CE2 . TYR A  1 102 ? -42.013 -37.054  48.914  1.00 20.68 ? 108  TYR A CE2 1 
ATOM   764   C CZ  . TYR A  1 102 ? -42.054 -38.422  49.039  1.00 21.68 ? 108  TYR A CZ  1 
ATOM   765   O OH  . TYR A  1 102 ? -41.481 -39.022  50.137  1.00 23.89 ? 108  TYR A OH  1 
ATOM   766   N N   . GLU A  1 103 ? -45.149 -36.927  42.739  1.00 39.81 ? 109  GLU A N   1 
ATOM   767   C CA  . GLU A  1 103 ? -45.932 -36.377  41.636  1.00 40.85 ? 109  GLU A CA  1 
ATOM   768   C C   . GLU A  1 103 ? -47.122 -35.563  42.121  1.00 40.66 ? 109  GLU A C   1 
ATOM   769   O O   . GLU A  1 103 ? -48.053 -35.303  41.360  1.00 44.00 ? 109  GLU A O   1 
ATOM   770   C CB  . GLU A  1 103 ? -46.414 -37.492  40.711  1.00 38.89 ? 109  GLU A CB  1 
ATOM   771   C CG  . GLU A  1 103 ? -45.351 -37.955  39.737  1.00 46.29 ? 109  GLU A CG  1 
ATOM   772   C CD  . GLU A  1 103 ? -45.914 -38.843  38.662  1.00 54.84 ? 109  GLU A CD  1 
ATOM   773   O OE1 . GLU A  1 103 ? -47.107 -39.196  38.759  1.00 61.07 ? 109  GLU A OE1 1 
ATOM   774   O OE2 . GLU A  1 103 ? -45.173 -39.180  37.716  1.00 56.69 ? 109  GLU A OE2 1 
ATOM   775   N N   . GLY A  1 104 ? -47.083 -35.152  43.383  1.00 32.05 ? 110  GLY A N   1 
ATOM   776   C CA  . GLY A  1 104 ? -48.146 -34.339  43.947  1.00 30.81 ? 110  GLY A CA  1 
ATOM   777   C C   . GLY A  1 104 ? -48.215 -34.576  45.439  1.00 29.64 ? 110  GLY A C   1 
ATOM   778   O O   . GLY A  1 104 ? -47.389 -35.309  45.953  1.00 29.19 ? 110  GLY A O   1 
ATOM   779   N N   . THR A  1 105 ? -49.176 -33.976  46.137  1.00 30.20 ? 111  THR A N   1 
ATOM   780   C CA  . THR A  1 105 ? -49.299 -34.184  47.585  1.00 30.18 ? 111  THR A CA  1 
ATOM   781   C C   . THR A  1 105 ? -49.879 -35.553  47.935  1.00 29.71 ? 111  THR A C   1 
ATOM   782   O O   . THR A  1 105 ? -49.549 -36.125  48.974  1.00 29.04 ? 111  THR A O   1 
ATOM   783   C CB  . THR A  1 105 ? -50.175 -33.122  48.234  1.00 30.51 ? 111  THR A CB  1 
ATOM   784   O OG1 . THR A  1 105 ? -51.416 -33.051  47.523  1.00 28.97 ? 111  THR A OG1 1 
ATOM   785   C CG2 . THR A  1 105 ? -49.478 -31.771  48.205  1.00 29.27 ? 111  THR A CG2 1 
ATOM   786   N N   . ALA A  1 106 ? -50.721 -36.090  47.058  1.00 24.88 ? 112  ALA A N   1 
ATOM   787   C CA  . ALA A  1 106 ? -51.274 -37.419  47.262  1.00 21.44 ? 112  ALA A CA  1 
ATOM   788   C C   . ALA A  1 106 ? -50.211 -38.496  47.041  1.00 24.46 ? 112  ALA A C   1 
ATOM   789   O O   . ALA A  1 106 ? -50.150 -39.477  47.765  1.00 22.18 ? 112  ALA A O   1 
ATOM   790   C CB  . ALA A  1 106 ? -52.466 -37.645  46.348  1.00 18.95 ? 112  ALA A CB  1 
ATOM   791   N N   . ASP A  1 107 ? -49.361 -38.308  46.044  1.00 26.28 ? 113  ASP A N   1 
ATOM   792   C CA  . ASP A  1 107 ? -48.311 -39.277  45.758  1.00 24.59 ? 113  ASP A CA  1 
ATOM   793   C C   . ASP A  1 107 ? -47.445 -39.588  46.996  1.00 23.09 ? 113  ASP A C   1 
ATOM   794   O O   . ASP A  1 107 ? -47.184 -40.749  47.300  1.00 26.23 ? 113  ASP A O   1 
ATOM   795   C CB  . ASP A  1 107 ? -47.442 -38.751  44.620  1.00 24.43 ? 113  ASP A CB  1 
ATOM   796   C CG  . ASP A  1 107 ? -46.567 -39.807  44.025  1.00 22.63 ? 113  ASP A CG  1 
ATOM   797   O OD1 . ASP A  1 107 ? -46.994 -40.979  43.969  1.00 23.55 ? 113  ASP A OD1 1 
ATOM   798   O OD2 . ASP A  1 107 ? -45.438 -39.459  43.620  1.00 24.89 ? 113  ASP A OD2 1 
ATOM   799   N N   . ALA A  1 108 ? -47.030 -38.544  47.713  1.00 24.23 ? 114  ALA A N   1 
ATOM   800   C CA  . ALA A  1 108 ? -46.127 -38.671  48.868  1.00 24.17 ? 114  ALA A CA  1 
ATOM   801   C C   . ALA A  1 108 ? -46.718 -39.515  49.979  1.00 22.12 ? 114  ALA A C   1 
ATOM   802   O O   . ALA A  1 108 ? -45.990 -40.034  50.805  1.00 25.66 ? 114  ALA A O   1 
ATOM   803   C CB  . ALA A  1 108 ? -45.742 -37.293  49.412  1.00 24.54 ? 114  ALA A CB  1 
ATOM   804   N N   . VAL A  1 109 ? -48.034 -39.651  50.014  1.00 17.77 ? 115  VAL A N   1 
ATOM   805   C CA  . VAL A  1 109 ? -48.607 -40.618  50.915  1.00 15.46 ? 115  VAL A CA  1 
ATOM   806   C C   . VAL A  1 109 ? -48.574 -41.968  50.215  1.00 22.18 ? 115  VAL A C   1 
ATOM   807   O O   . VAL A  1 109 ? -48.157 -42.968  50.803  1.00 25.31 ? 115  VAL A O   1 
ATOM   808   C CB  . VAL A  1 109 ? -50.030 -40.240  51.338  1.00 14.91 ? 115  VAL A CB  1 
ATOM   809   C CG1 . VAL A  1 109 ? -50.631 -41.324  52.227  1.00 16.39 ? 115  VAL A CG1 1 
ATOM   810   C CG2 . VAL A  1 109 ? -50.024 -38.897  52.057  1.00 15.99 ? 115  VAL A CG2 1 
ATOM   811   N N   . TYR A  1 110 ? -48.968 -41.991  48.944  1.00 20.77 ? 116  TYR A N   1 
ATOM   812   C CA  . TYR A  1 110 ? -49.037 -43.243  48.202  1.00 19.14 ? 116  TYR A CA  1 
ATOM   813   C C   . TYR A  1 110 ? -47.704 -43.972  48.167  1.00 19.90 ? 116  TYR A C   1 
ATOM   814   O O   . TYR A  1 110 ? -47.651 -45.172  48.387  1.00 27.70 ? 116  TYR A O   1 
ATOM   815   C CB  . TYR A  1 110 ? -49.518 -43.006  46.768  1.00 27.78 ? 116  TYR A CB  1 
ATOM   816   C CG  . TYR A  1 110 ? -49.446 -44.259  45.918  1.00 30.44 ? 116  TYR A CG  1 
ATOM   817   C CD1 . TYR A  1 110 ? -50.391 -45.269  46.062  1.00 28.63 ? 116  TYR A CD1 1 
ATOM   818   C CD2 . TYR A  1 110 ? -48.431 -44.439  44.984  1.00 27.62 ? 116  TYR A CD2 1 
ATOM   819   C CE1 . TYR A  1 110 ? -50.330 -46.416  45.308  1.00 30.22 ? 116  TYR A CE1 1 
ATOM   820   C CE2 . TYR A  1 110 ? -48.364 -45.587  44.220  1.00 27.87 ? 116  TYR A CE2 1 
ATOM   821   C CZ  . TYR A  1 110 ? -49.319 -46.570  44.388  1.00 31.95 ? 116  TYR A CZ  1 
ATOM   822   O OH  . TYR A  1 110 ? -49.273 -47.722  43.638  1.00 36.63 ? 116  TYR A OH  1 
ATOM   823   N N   . GLN A  1 111 ? -46.627 -43.247  47.894  1.00 19.43 ? 117  GLN A N   1 
ATOM   824   C CA  . GLN A  1 111 ? -45.306 -43.851  47.819  1.00 18.09 ? 117  GLN A CA  1 
ATOM   825   C C   . GLN A  1 111 ? -44.804 -44.330  49.172  1.00 23.37 ? 117  GLN A C   1 
ATOM   826   O O   . GLN A  1 111 ? -43.808 -45.040  49.252  1.00 25.99 ? 117  GLN A O   1 
ATOM   827   C CB  . GLN A  1 111 ? -44.301 -42.856  47.248  1.00 21.16 ? 117  GLN A CB  1 
ATOM   828   C CG  . GLN A  1 111 ? -44.690 -42.285  45.904  1.00 29.52 ? 117  GLN A CG  1 
ATOM   829   C CD  . GLN A  1 111 ? -44.480 -43.263  44.776  1.00 38.34 ? 117  GLN A CD  1 
ATOM   830   O OE1 . GLN A  1 111 ? -44.016 -44.381  44.992  1.00 44.63 ? 117  GLN A OE1 1 
ATOM   831   N NE2 . GLN A  1 111 ? -44.836 -42.856  43.561  1.00 38.63 ? 117  GLN A NE2 1 
ATOM   832   N N   . ASN A  1 112 ? -45.488 -43.934  50.237  1.00 23.24 ? 118  ASN A N   1 
ATOM   833   C CA  . ASN A  1 112 ? -45.011 -44.216  51.587  1.00 20.80 ? 118  ASN A CA  1 
ATOM   834   C C   . ASN A  1 112 ? -45.976 -45.056  52.401  1.00 23.34 ? 118  ASN A C   1 
ATOM   835   O O   . ASN A  1 112 ? -45.875 -45.121  53.622  1.00 19.66 ? 118  ASN A O   1 
ATOM   836   C CB  . ASN A  1 112 ? -44.730 -42.908  52.313  1.00 17.81 ? 118  ASN A CB  1 
ATOM   837   C CG  . ASN A  1 112 ? -43.482 -42.233  51.807  1.00 16.98 ? 118  ASN A CG  1 
ATOM   838   O OD1 . ASN A  1 112 ? -42.412 -42.823  51.803  1.00 20.14 ? 118  ASN A OD1 1 
ATOM   839   N ND2 . ASN A  1 112 ? -43.615 -41.003  51.355  1.00 20.09 ? 118  ASN A ND2 1 
ATOM   840   N N   . ILE A  1 113 ? -46.909 -45.701  51.713  1.00 27.30 ? 119  ILE A N   1 
ATOM   841   C CA  . ILE A  1 113 ? -47.875 -46.574  52.360  1.00 26.51 ? 119  ILE A CA  1 
ATOM   842   C C   . ILE A  1 113 ? -47.161 -47.668  53.159  1.00 26.25 ? 119  ILE A C   1 
ATOM   843   O O   . ILE A  1 113 ? -47.573 -48.006  54.272  1.00 27.86 ? 119  ILE A O   1 
ATOM   844   C CB  . ILE A  1 113 ? -48.823 -47.203  51.319  1.00 25.79 ? 119  ILE A CB  1 
ATOM   845   C CG1 . ILE A  1 113 ? -49.657 -46.118  50.638  1.00 26.66 ? 119  ILE A CG1 1 
ATOM   846   C CG2 . ILE A  1 113 ? -49.742 -48.203  51.961  1.00 27.75 ? 119  ILE A CG2 1 
ATOM   847   C CD1 . ILE A  1 113 ? -50.573 -46.642  49.544  1.00 27.77 ? 119  ILE A CD1 1 
ATOM   848   N N   . ASP A  1 114 ? -46.070 -48.189  52.597  1.00 23.39 ? 120  ASP A N   1 
ATOM   849   C CA  . ASP A  1 114 ? -45.321 -49.280  53.212  1.00 25.91 ? 120  ASP A CA  1 
ATOM   850   C C   . ASP A  1 114 ? -44.683 -48.882  54.533  1.00 30.26 ? 120  ASP A C   1 
ATOM   851   O O   . ASP A  1 114 ? -44.268 -49.744  55.303  1.00 32.92 ? 120  ASP A O   1 
ATOM   852   C CB  . ASP A  1 114 ? -44.224 -49.774  52.276  1.00 26.69 ? 120  ASP A CB  1 
ATOM   853   C CG  . ASP A  1 114 ? -43.093 -48.773  52.137  1.00 29.96 ? 120  ASP A CG  1 
ATOM   854   O OD1 . ASP A  1 114 ? -43.348 -47.559  52.247  1.00 36.04 ? 120  ASP A OD1 1 
ATOM   855   O OD2 . ASP A  1 114 ? -41.943 -49.195  51.927  1.00 30.33 ? 120  ASP A OD2 1 
ATOM   856   N N   . ILE A  1 115 ? -44.560 -47.581  54.773  1.00 27.21 ? 121  ILE A N   1 
ATOM   857   C CA  . ILE A  1 115 ? -43.992 -47.090  56.020  1.00 24.98 ? 121  ILE A CA  1 
ATOM   858   C C   . ILE A  1 115 ? -45.118 -46.768  56.992  1.00 27.67 ? 121  ILE A C   1 
ATOM   859   O O   . ILE A  1 115 ? -44.974 -46.961  58.199  1.00 30.29 ? 121  ILE A O   1 
ATOM   860   C CB  . ILE A  1 115 ? -43.097 -45.861  55.787  1.00 30.83 ? 121  ILE A CB  1 
ATOM   861   C CG1 . ILE A  1 115 ? -41.866 -46.275  54.980  1.00 29.39 ? 121  ILE A CG1 1 
ATOM   862   C CG2 . ILE A  1 115 ? -42.683 -45.220  57.109  1.00 36.54 ? 121  ILE A CG2 1 
ATOM   863   C CD1 . ILE A  1 115 ? -40.692 -45.342  55.117  1.00 29.83 ? 121  ILE A CD1 1 
ATOM   864   N N   . ILE A  1 116 ? -46.246 -46.313  56.451  1.00 23.02 ? 122  ILE A N   1 
ATOM   865   C CA  . ILE A  1 116 ? -47.419 -46.004  57.252  1.00 21.57 ? 122  ILE A CA  1 
ATOM   866   C C   . ILE A  1 116 ? -48.052 -47.252  57.852  1.00 27.87 ? 122  ILE A C   1 
ATOM   867   O O   . ILE A  1 116 ? -48.285 -47.321  59.054  1.00 30.13 ? 122  ILE A O   1 
ATOM   868   C CB  . ILE A  1 116 ? -48.496 -45.273  56.428  1.00 23.27 ? 122  ILE A CB  1 
ATOM   869   C CG1 . ILE A  1 116 ? -48.003 -43.897  55.977  1.00 20.42 ? 122  ILE A CG1 1 
ATOM   870   C CG2 . ILE A  1 116 ? -49.782 -45.129  57.239  1.00 26.05 ? 122  ILE A CG2 1 
ATOM   871   C CD1 . ILE A  1 116 ? -48.968 -43.171  55.052  1.00 18.04 ? 122  ILE A CD1 1 
ATOM   872   N N   . GLU A  1 117 ? -48.333 -48.239  57.011  1.00 29.49 ? 123  GLU A N   1 
ATOM   873   C CA  . GLU A  1 117 ? -49.163 -49.366  57.428  1.00 31.24 ? 123  GLU A CA  1 
ATOM   874   C C   . GLU A  1 117 ? -48.601 -50.266  58.550  1.00 29.99 ? 123  GLU A C   1 
ATOM   875   O O   . GLU A  1 117 ? -49.386 -50.790  59.338  1.00 32.27 ? 123  GLU A O   1 
ATOM   876   C CB  . GLU A  1 117 ? -49.515 -50.208  56.202  1.00 31.83 ? 123  GLU A CB  1 
ATOM   877   C CG  . GLU A  1 117 ? -50.598 -49.541  55.364  1.00 37.36 ? 123  GLU A CG  1 
ATOM   878   C CD  . GLU A  1 117 ? -50.969 -50.316  54.114  1.00 45.26 ? 123  GLU A CD  1 
ATOM   879   O OE1 . GLU A  1 117 ? -50.098 -51.012  53.548  1.00 46.04 ? 123  GLU A OE1 1 
ATOM   880   O OE2 . GLU A  1 117 ? -52.137 -50.212  53.686  1.00 46.74 ? 123  GLU A OE2 1 
ATOM   881   N N   . PRO A  1 118 ? -47.265 -50.449  58.639  1.00 29.46 ? 124  PRO A N   1 
ATOM   882   C CA  . PRO A  1 118 ? -46.734 -51.126  59.831  1.00 30.25 ? 124  PRO A CA  1 
ATOM   883   C C   . PRO A  1 118 ? -47.182 -50.489  61.146  1.00 33.80 ? 124  PRO A C   1 
ATOM   884   O O   . PRO A  1 118 ? -47.479 -51.205  62.103  1.00 36.80 ? 124  PRO A O   1 
ATOM   885   C CB  . PRO A  1 118 ? -45.223 -50.985  59.663  1.00 27.81 ? 124  PRO A CB  1 
ATOM   886   C CG  . PRO A  1 118 ? -45.024 -50.966  58.223  1.00 29.19 ? 124  PRO A CG  1 
ATOM   887   C CD  . PRO A  1 118 ? -46.211 -50.256  57.629  1.00 30.04 ? 124  PRO A CD  1 
ATOM   888   N N   . TYR A  1 119 ? -47.227 -49.159  61.186  1.00 29.13 ? 125  TYR A N   1 
ATOM   889   C CA  . TYR A  1 119 ? -47.704 -48.438  62.362  1.00 24.54 ? 125  TYR A CA  1 
ATOM   890   C C   . TYR A  1 119 ? -49.188 -48.672  62.557  1.00 26.89 ? 125  TYR A C   1 
ATOM   891   O O   . TYR A  1 119 ? -49.696 -48.577  63.677  1.00 28.55 ? 125  TYR A O   1 
ATOM   892   C CB  . TYR A  1 119 ? -47.438 -46.942  62.223  1.00 20.82 ? 125  TYR A CB  1 
ATOM   893   C CG  . TYR A  1 119 ? -45.977 -46.577  62.126  1.00 22.45 ? 125  TYR A CG  1 
ATOM   894   C CD1 . TYR A  1 119 ? -45.018 -47.246  62.871  1.00 24.18 ? 125  TYR A CD1 1 
ATOM   895   C CD2 . TYR A  1 119 ? -45.555 -45.566  61.274  1.00 24.11 ? 125  TYR A CD2 1 
ATOM   896   C CE1 . TYR A  1 119 ? -43.681 -46.908  62.775  1.00 23.31 ? 125  TYR A CE1 1 
ATOM   897   C CE2 . TYR A  1 119 ? -44.227 -45.228  61.171  1.00 22.20 ? 125  TYR A CE2 1 
ATOM   898   C CZ  . TYR A  1 119 ? -43.295 -45.897  61.920  1.00 21.26 ? 125  TYR A CZ  1 
ATOM   899   O OH  . TYR A  1 119 ? -41.975 -45.545  61.813  1.00 22.11 ? 125  TYR A OH  1 
ATOM   900   N N   . ALA A  1 120 ? -49.869 -48.964  61.449  1.00 25.63 ? 126  ALA A N   1 
ATOM   901   C CA  . ALA A  1 120 ? -51.320 -49.138  61.419  1.00 24.91 ? 126  ALA A CA  1 
ATOM   902   C C   . ALA A  1 120 ? -52.073 -48.107  62.258  1.00 21.99 ? 126  ALA A C   1 
ATOM   903   O O   . ALA A  1 120 ? -52.750 -48.469  63.215  1.00 23.66 ? 126  ALA A O   1 
ATOM   904   C CB  . ALA A  1 120 ? -51.682 -50.548  61.885  1.00 27.25 ? 126  ALA A CB  1 
ATOM   905   N N   . PRO A  1 121 ? -51.940 -46.815  61.928  1.00 20.96 ? 127  PRO A N   1 
ATOM   906   C CA  . PRO A  1 121 ? -52.740 -45.840  62.682  1.00 21.85 ? 127  PRO A CA  1 
ATOM   907   C C   . PRO A  1 121 ? -54.212 -45.931  62.311  1.00 22.32 ? 127  PRO A C   1 
ATOM   908   O O   . PRO A  1 121 ? -54.516 -46.322  61.194  1.00 22.23 ? 127  PRO A O   1 
ATOM   909   C CB  . PRO A  1 121 ? -52.145 -44.498  62.261  1.00 20.58 ? 127  PRO A CB  1 
ATOM   910   C CG  . PRO A  1 121 ? -51.559 -44.749  60.914  1.00 19.37 ? 127  PRO A CG  1 
ATOM   911   C CD  . PRO A  1 121 ? -51.047 -46.165  60.952  1.00 18.60 ? 127  PRO A CD  1 
ATOM   912   N N   . GLU A  1 122 ? -55.115 -45.608  63.229  1.00 21.66 ? 128  GLU A N   1 
ATOM   913   C CA  . GLU A  1 122 ? -56.530 -45.634  62.894  1.00 21.26 ? 128  GLU A CA  1 
ATOM   914   C C   . GLU A  1 122 ? -56.903 -44.399  62.083  1.00 21.97 ? 128  GLU A C   1 
ATOM   915   O O   . GLU A  1 122 ? -57.706 -44.486  61.157  1.00 20.02 ? 128  GLU A O   1 
ATOM   916   C CB  . GLU A  1 122 ? -57.400 -45.718  64.148  1.00 23.45 ? 128  GLU A CB  1 
ATOM   917   C CG  . GLU A  1 122 ? -57.156 -46.939  65.030  1.00 31.08 ? 128  GLU A CG  1 
ATOM   918   C CD  . GLU A  1 122 ? -57.325 -48.275  64.309  1.00 36.91 ? 128  GLU A CD  1 
ATOM   919   O OE1 . GLU A  1 122 ? -58.182 -48.390  63.407  1.00 36.59 ? 128  GLU A OE1 1 
ATOM   920   O OE2 . GLU A  1 122 ? -56.597 -49.225  64.663  1.00 40.69 ? 128  GLU A OE2 1 
ATOM   921   N N   . TYR A  1 123 ? -56.309 -43.257  62.432  1.00 21.41 ? 129  TYR A N   1 
ATOM   922   C CA  . TYR A  1 123 ? -56.599 -41.982  61.770  1.00 19.19 ? 129  TYR A CA  1 
ATOM   923   C C   . TYR A  1 123 ? -55.347 -41.362  61.189  1.00 19.44 ? 129  TYR A C   1 
ATOM   924   O O   . TYR A  1 123 ? -54.272 -41.482  61.768  1.00 23.09 ? 129  TYR A O   1 
ATOM   925   C CB  . TYR A  1 123 ? -57.243 -41.003  62.751  1.00 18.21 ? 129  TYR A CB  1 
ATOM   926   C CG  . TYR A  1 123 ? -58.237 -41.674  63.657  1.00 22.33 ? 129  TYR A CG  1 
ATOM   927   C CD1 . TYR A  1 123 ? -59.450 -42.146  63.159  1.00 25.03 ? 129  TYR A CD1 1 
ATOM   928   C CD2 . TYR A  1 123 ? -57.959 -41.861  65.002  1.00 22.48 ? 129  TYR A CD2 1 
ATOM   929   C CE1 . TYR A  1 123 ? -60.361 -42.780  63.984  1.00 28.03 ? 129  TYR A CE1 1 
ATOM   930   C CE2 . TYR A  1 123 ? -58.859 -42.490  65.834  1.00 30.46 ? 129  TYR A CE2 1 
ATOM   931   C CZ  . TYR A  1 123 ? -60.058 -42.948  65.320  1.00 30.72 ? 129  TYR A CZ  1 
ATOM   932   O OH  . TYR A  1 123 ? -60.950 -43.574  66.155  1.00 34.14 ? 129  TYR A OH  1 
ATOM   933   N N   . MET A  1 124 ? -55.482 -40.715  60.037  1.00 17.73 ? 130  MET A N   1 
ATOM   934   C CA  . MET A  1 124 ? -54.391 -39.933  59.465  1.00 14.68 ? 130  MET A CA  1 
ATOM   935   C C   . MET A  1 124 ? -54.747 -38.458  59.536  1.00 18.61 ? 130  MET A C   1 
ATOM   936   O O   . MET A  1 124 ? -55.832 -38.061  59.127  1.00 19.29 ? 130  MET A O   1 
ATOM   937   C CB  . MET A  1 124 ? -54.128 -40.318  58.016  1.00 17.60 ? 130  MET A CB  1 
ATOM   938   C CG  . MET A  1 124 ? -53.686 -41.738  57.799  1.00 16.54 ? 130  MET A CG  1 
ATOM   939   S SD  . MET A  1 124 ? -51.961 -41.993  58.238  1.00 26.65 ? 130  MET A SD  1 
ATOM   940   C CE  . MET A  1 124 ? -51.194 -40.505  57.594  1.00 40.04 ? 130  MET A CE  1 
ATOM   941   N N   . VAL A  1 125 ? -53.840 -37.649  60.065  1.00 20.35 ? 131  VAL A N   1 
ATOM   942   C CA  . VAL A  1 125 ? -54.022 -36.206  60.062  1.00 18.90 ? 131  VAL A CA  1 
ATOM   943   C C   . VAL A  1 125 ? -53.011 -35.623  59.096  1.00 15.81 ? 131  VAL A C   1 
ATOM   944   O O   . VAL A  1 125 ? -51.828 -35.545  59.412  1.00 15.45 ? 131  VAL A O   1 
ATOM   945   C CB  . VAL A  1 125 ? -53.854 -35.602  61.466  1.00 16.49 ? 131  VAL A CB  1 
ATOM   946   C CG1 . VAL A  1 125 ? -54.011 -34.065  61.437  1.00 14.86 ? 131  VAL A CG1 1 
ATOM   947   C CG2 . VAL A  1 125 ? -54.854 -36.225  62.414  1.00 16.17 ? 131  VAL A CG2 1 
ATOM   948   N N   . ILE A  1 126 ? -53.484 -35.261  57.902  1.00 17.79 ? 132  ILE A N   1 
ATOM   949   C CA  . ILE A  1 126 ? -52.635 -34.692  56.856  1.00 13.92 ? 132  ILE A CA  1 
ATOM   950   C C   . ILE A  1 126 ? -52.506 -33.189  57.078  1.00 18.32 ? 132  ILE A C   1 
ATOM   951   O O   . ILE A  1 126 ? -53.517 -32.502  57.243  1.00 16.57 ? 132  ILE A O   1 
ATOM   952   C CB  . ILE A  1 126 ? -53.205 -34.969  55.456  1.00 19.35 ? 132  ILE A CB  1 
ATOM   953   C CG1 . ILE A  1 126 ? -53.556 -36.450  55.314  1.00 20.96 ? 132  ILE A CG1 1 
ATOM   954   C CG2 . ILE A  1 126 ? -52.224 -34.528  54.388  1.00 18.95 ? 132  ILE A CG2 1 
ATOM   955   C CD1 . ILE A  1 126 ? -52.363 -37.388  55.487  1.00 21.30 ? 132  ILE A CD1 1 
ATOM   956   N N   . LEU A  1 127 ? -51.271 -32.688  57.103  1.00 16.47 ? 133  LEU A N   1 
ATOM   957   C CA  . LEU A  1 127 ? -51.008 -31.308  57.502  1.00 14.65 ? 133  LEU A CA  1 
ATOM   958   C C   . LEU A  1 127 ? -50.196 -30.573  56.459  1.00 13.50 ? 133  LEU A C   1 
ATOM   959   O O   . LEU A  1 127 ? -49.362 -31.166  55.782  1.00 18.18 ? 133  LEU A O   1 
ATOM   960   C CB  . LEU A  1 127 ? -50.269 -31.265  58.849  1.00 15.76 ? 133  LEU A CB  1 
ATOM   961   C CG  . LEU A  1 127 ? -51.040 -31.713  60.086  1.00 14.01 ? 133  LEU A CG  1 
ATOM   962   C CD1 . LEU A  1 127 ? -50.141 -31.761  61.314  1.00 11.27 ? 133  LEU A CD1 1 
ATOM   963   C CD2 . LEU A  1 127 ? -52.206 -30.775  60.326  1.00 12.16 ? 133  LEU A CD2 1 
ATOM   964   N N   . ALA A  1 128 ? -50.451 -29.280  56.321  1.00 16.54 ? 134  ALA A N   1 
ATOM   965   C CA  . ALA A  1 128 ? -49.591 -28.431  55.518  1.00 18.82 ? 134  ALA A CA  1 
ATOM   966   C C   . ALA A  1 128 ? -48.513 -27.878  56.447  1.00 17.22 ? 134  ALA A C   1 
ATOM   967   O O   . ALA A  1 128 ? -48.831 -27.348  57.518  1.00 14.98 ? 134  ALA A O   1 
ATOM   968   C CB  . ALA A  1 128 ? -50.394 -27.310  54.848  1.00 22.05 ? 134  ALA A CB  1 
ATOM   969   N N   . GLY A  1 129 ? -47.248 -28.013  56.047  1.00 13.96 ? 135  GLY A N   1 
ATOM   970   C CA  . GLY A  1 129 ? -46.137 -27.631  56.900  1.00 18.10 ? 135  GLY A CA  1 
ATOM   971   C C   . GLY A  1 129 ? -45.532 -26.258  56.653  1.00 17.97 ? 135  GLY A C   1 
ATOM   972   O O   . GLY A  1 129 ? -44.419 -25.990  57.103  1.00 17.41 ? 135  GLY A O   1 
ATOM   973   N N   . ASP A  1 130 ? -46.246 -25.385  55.947  1.00 17.76 ? 136  ASP A N   1 
ATOM   974   C CA  . ASP A  1 130 ? -45.708 -24.059  55.649  1.00 19.80 ? 136  ASP A CA  1 
ATOM   975   C C   . ASP A  1 130 ? -46.592 -22.913  56.172  1.00 18.57 ? 136  ASP A C   1 
ATOM   976   O O   . ASP A  1 130 ? -46.524 -21.785  55.682  1.00 19.23 ? 136  ASP A O   1 
ATOM   977   C CB  . ASP A  1 130 ? -45.480 -23.904  54.141  1.00 24.62 ? 136  ASP A CB  1 
ATOM   978   C CG  . ASP A  1 130 ? -46.769 -23.968  53.341  1.00 28.39 ? 136  ASP A CG  1 
ATOM   979   O OD1 . ASP A  1 130 ? -47.549 -24.922  53.537  1.00 30.18 ? 136  ASP A OD1 1 
ATOM   980   O OD2 . ASP A  1 130 ? -47.002 -23.055  52.514  1.00 27.68 ? 136  ASP A OD2 1 
ATOM   981   N N   . HIS A  1 131 ? -47.400 -23.202  57.184  1.00 17.35 ? 137  HIS A N   1 
ATOM   982   C CA  . HIS A  1 131 ? -48.215 -22.191  57.837  1.00 15.19 ? 137  HIS A CA  1 
ATOM   983   C C   . HIS A  1 131 ? -47.798 -22.015  59.293  1.00 17.67 ? 137  HIS A C   1 
ATOM   984   O O   . HIS A  1 131 ? -47.275 -22.938  59.913  1.00 17.14 ? 137  HIS A O   1 
ATOM   985   C CB  . HIS A  1 131 ? -49.682 -22.582  57.780  1.00 18.63 ? 137  HIS A CB  1 
ATOM   986   C CG  . HIS A  1 131 ? -50.177 -22.862  56.401  1.00 18.26 ? 137  HIS A CG  1 
ATOM   987   N ND1 . HIS A  1 131 ? -51.184 -23.766  56.145  1.00 18.03 ? 137  HIS A ND1 1 
ATOM   988   C CD2 . HIS A  1 131 ? -49.816 -22.347  55.205  1.00 19.13 ? 137  HIS A CD2 1 
ATOM   989   C CE1 . HIS A  1 131 ? -51.411 -23.807  54.845  1.00 21.42 ? 137  HIS A CE1 1 
ATOM   990   N NE2 . HIS A  1 131 ? -50.600 -22.950  54.253  1.00 20.90 ? 137  HIS A NE2 1 
ATOM   991   N N   . ILE A  1 132 ? -48.051 -20.830  59.835  1.00 14.39 ? 138  ILE A N   1 
ATOM   992   C CA  . ILE A  1 132 ? -47.795 -20.535  61.239  1.00 15.84 ? 138  ILE A CA  1 
ATOM   993   C C   . ILE A  1 132 ? -49.126 -20.415  61.950  1.00 17.76 ? 138  ILE A C   1 
ATOM   994   O O   . ILE A  1 132 ? -49.894 -19.479  61.707  1.00 16.50 ? 138  ILE A O   1 
ATOM   995   C CB  . ILE A  1 132 ? -46.990 -19.241  61.400  1.00 11.23 ? 138  ILE A CB  1 
ATOM   996   C CG1 . ILE A  1 132 ? -45.714 -19.332  60.567  1.00 11.05 ? 138  ILE A CG1 1 
ATOM   997   C CG2 . ILE A  1 132 ? -46.691 -18.943  62.879  1.00 11.98 ? 138  ILE A CG2 1 
ATOM   998   C CD1 . ILE A  1 132 ? -45.054 -18.018  60.384  1.00 15.19 ? 138  ILE A CD1 1 
ATOM   999   N N   . TYR A  1 133 ? -49.407 -21.389  62.804  1.00 12.47 ? 139  TYR A N   1 
ATOM   1000  C CA  . TYR A  1 133 ? -50.655 -21.430  63.543  1.00 11.64 ? 139  TYR A CA  1 
ATOM   1001  C C   . TYR A  1 133 ? -50.525 -22.413  64.702  1.00 16.12 ? 139  TYR A C   1 
ATOM   1002  O O   . TYR A  1 133 ? -49.627 -23.253  64.719  1.00 12.58 ? 139  TYR A O   1 
ATOM   1003  C CB  . TYR A  1 133 ? -51.821 -21.830  62.625  1.00 10.14 ? 139  TYR A CB  1 
ATOM   1004  C CG  . TYR A  1 133 ? -51.766 -23.280  62.191  1.00 12.33 ? 139  TYR A CG  1 
ATOM   1005  C CD1 . TYR A  1 133 ? -50.843 -23.705  61.245  1.00 10.42 ? 139  TYR A CD1 1 
ATOM   1006  C CD2 . TYR A  1 133 ? -52.634 -24.226  62.740  1.00 11.65 ? 139  TYR A CD2 1 
ATOM   1007  C CE1 . TYR A  1 133 ? -50.781 -25.024  60.866  1.00 11.57 ? 139  TYR A CE1 1 
ATOM   1008  C CE2 . TYR A  1 133 ? -52.578 -25.543  62.367  1.00 10.30 ? 139  TYR A CE2 1 
ATOM   1009  C CZ  . TYR A  1 133 ? -51.649 -25.941  61.430  1.00 11.31 ? 139  TYR A CZ  1 
ATOM   1010  O OH  . TYR A  1 133 ? -51.596 -27.262  61.049  1.00 14.59 ? 139  TYR A OH  1 
ATOM   1011  N N   . LYS A  1 134 ? -51.426 -22.294  65.669  1.00 13.78 ? 140  LYS A N   1 
ATOM   1012  C CA  . LYS A  1 134 ? -51.509 -23.232  66.776  1.00 10.37 ? 140  LYS A CA  1 
ATOM   1013  C C   . LYS A  1 134 ? -52.910 -23.822  66.815  1.00 14.07 ? 140  LYS A C   1 
ATOM   1014  O O   . LYS A  1 134 ? -53.903 -23.092  66.792  1.00 16.99 ? 140  LYS A O   1 
ATOM   1015  C CB  . LYS A  1 134 ? -51.149 -22.536  68.084  1.00 8.94  ? 140  LYS A CB  1 
ATOM   1016  C CG  . LYS A  1 134 ? -49.703 -22.089  68.115  1.00 10.01 ? 140  LYS A CG  1 
ATOM   1017  C CD  . LYS A  1 134 ? -49.375 -21.286  69.350  1.00 13.97 ? 140  LYS A CD  1 
ATOM   1018  C CE  . LYS A  1 134 ? -50.231 -20.053  69.397  1.00 22.73 ? 140  LYS A CE  1 
ATOM   1019  N NZ  . LYS A  1 134 ? -49.793 -19.146  70.489  1.00 28.99 ? 140  LYS A NZ  1 
ATOM   1020  N N   . MET A  1 135 ? -52.987 -25.148  66.852  1.00 14.77 ? 141  MET A N   1 
ATOM   1021  C CA  . MET A  1 135 ? -54.255 -25.858  66.716  1.00 17.13 ? 141  MET A CA  1 
ATOM   1022  C C   . MET A  1 135 ? -54.222 -27.224  67.399  1.00 19.62 ? 141  MET A C   1 
ATOM   1023  O O   . MET A  1 135 ? -53.296 -27.997  67.190  1.00 20.70 ? 141  MET A O   1 
ATOM   1024  C CB  . MET A  1 135 ? -54.592 -26.047  65.238  1.00 13.46 ? 141  MET A CB  1 
ATOM   1025  C CG  . MET A  1 135 ? -55.966 -26.619  64.953  1.00 15.75 ? 141  MET A CG  1 
ATOM   1026  S SD  . MET A  1 135 ? -56.224 -26.782  63.172  1.00 23.65 ? 141  MET A SD  1 
ATOM   1027  C CE  . MET A  1 135 ? -58.010 -26.802  63.065  1.00 28.95 ? 141  MET A CE  1 
ATOM   1028  N N   . ASP A  1 136 ? -55.255 -27.517  68.186  1.00 17.54 ? 142  ASP A N   1 
ATOM   1029  C CA  . ASP A  1 136 ? -55.381 -28.786  68.900  1.00 14.71 ? 142  ASP A CA  1 
ATOM   1030  C C   . ASP A  1 136 ? -56.140 -29.777  68.028  1.00 19.93 ? 142  ASP A C   1 
ATOM   1031  O O   . ASP A  1 136 ? -57.372 -29.717  67.943  1.00 18.25 ? 142  ASP A O   1 
ATOM   1032  C CB  . ASP A  1 136 ? -56.103 -28.559  70.220  1.00 11.66 ? 142  ASP A CB  1 
ATOM   1033  C CG  . ASP A  1 136 ? -56.215 -29.814  71.067  1.00 16.25 ? 142  ASP A CG  1 
ATOM   1034  O OD1 . ASP A  1 136 ? -55.908 -30.929  70.588  1.00 19.05 ? 142  ASP A OD1 1 
ATOM   1035  O OD2 . ASP A  1 136 ? -56.639 -29.677  72.235  1.00 20.91 ? 142  ASP A OD2 1 
ATOM   1036  N N   . TYR A  1 137 ? -55.415 -30.701  67.396  1.00 19.46 ? 143  TYR A N   1 
ATOM   1037  C CA  . TYR A  1 137 ? -56.025 -31.584  66.401  1.00 17.35 ? 143  TYR A CA  1 
ATOM   1038  C C   . TYR A  1 137 ? -57.035 -32.582  66.973  1.00 19.26 ? 143  TYR A C   1 
ATOM   1039  O O   . TYR A  1 137 ? -57.810 -33.160  66.219  1.00 22.62 ? 143  TYR A O   1 
ATOM   1040  C CB  . TYR A  1 137 ? -54.944 -32.335  65.636  1.00 14.09 ? 143  TYR A CB  1 
ATOM   1041  C CG  . TYR A  1 137 ? -53.997 -31.409  64.916  1.00 14.72 ? 143  TYR A CG  1 
ATOM   1042  C CD1 . TYR A  1 137 ? -54.460 -30.501  63.963  1.00 15.24 ? 143  TYR A CD1 1 
ATOM   1043  C CD2 . TYR A  1 137 ? -52.647 -31.438  65.182  1.00 12.55 ? 143  TYR A CD2 1 
ATOM   1044  C CE1 . TYR A  1 137 ? -53.587 -29.644  63.308  1.00 14.59 ? 143  TYR A CE1 1 
ATOM   1045  C CE2 . TYR A  1 137 ? -51.778 -30.605  64.528  1.00 9.93  ? 143  TYR A CE2 1 
ATOM   1046  C CZ  . TYR A  1 137 ? -52.245 -29.700  63.599  1.00 8.96  ? 143  TYR A CZ  1 
ATOM   1047  O OH  . TYR A  1 137 ? -51.356 -28.865  62.967  1.00 11.60 ? 143  TYR A OH  1 
ATOM   1048  N N   . GLU A  1 138 ? -57.038 -32.778  68.290  1.00 18.19 ? 144  GLU A N   1 
ATOM   1049  C CA  . GLU A  1 138 ? -57.991 -33.709  68.907  1.00 21.74 ? 144  GLU A CA  1 
ATOM   1050  C C   . GLU A  1 138 ? -59.454 -33.297  68.608  1.00 21.13 ? 144  GLU A C   1 
ATOM   1051  O O   . GLU A  1 138 ? -60.307 -34.158  68.399  1.00 18.97 ? 144  GLU A O   1 
ATOM   1052  C CB  . GLU A  1 138 ? -57.737 -33.811  70.416  1.00 21.65 ? 144  GLU A CB  1 
ATOM   1053  C CG  . GLU A  1 138 ? -58.646 -34.782  71.188  1.00 26.62 ? 144  GLU A CG  1 
ATOM   1054  C CD  . GLU A  1 138 ? -58.326 -36.274  70.983  1.00 26.35 ? 144  GLU A CD  1 
ATOM   1055  O OE1 . GLU A  1 138 ? -57.167 -36.633  70.675  1.00 21.93 ? 144  GLU A OE1 1 
ATOM   1056  O OE2 . GLU A  1 138 ? -59.251 -37.100  71.160  1.00 23.73 ? 144  GLU A OE2 1 
ATOM   1057  N N   . TYR A  1 139 ? -59.732 -31.995  68.552  1.00 18.00 ? 145  TYR A N   1 
ATOM   1058  C CA  . TYR A  1 139 ? -61.061 -31.515  68.152  1.00 18.30 ? 145  TYR A CA  1 
ATOM   1059  C C   . TYR A  1 139 ? -61.474 -32.052  66.792  1.00 20.63 ? 145  TYR A C   1 
ATOM   1060  O O   . TYR A  1 139 ? -62.592 -32.542  66.601  1.00 19.82 ? 145  TYR A O   1 
ATOM   1061  C CB  . TYR A  1 139 ? -61.097 -29.991  68.114  1.00 17.67 ? 145  TYR A CB  1 
ATOM   1062  C CG  . TYR A  1 139 ? -61.106 -29.357  69.472  1.00 23.60 ? 145  TYR A CG  1 
ATOM   1063  C CD1 . TYR A  1 139 ? -62.300 -29.079  70.116  1.00 28.25 ? 145  TYR A CD1 1 
ATOM   1064  C CD2 . TYR A  1 139 ? -59.921 -29.045  70.121  1.00 24.19 ? 145  TYR A CD2 1 
ATOM   1065  C CE1 . TYR A  1 139 ? -62.316 -28.505  71.373  1.00 31.06 ? 145  TYR A CE1 1 
ATOM   1066  C CE2 . TYR A  1 139 ? -59.926 -28.468  71.370  1.00 27.62 ? 145  TYR A CE2 1 
ATOM   1067  C CZ  . TYR A  1 139 ? -61.125 -28.198  71.994  1.00 33.58 ? 145  TYR A CZ  1 
ATOM   1068  O OH  . TYR A  1 139 ? -61.124 -27.626  73.245  1.00 38.64 ? 145  TYR A OH  1 
ATOM   1069  N N   . MET A  1 140 ? -60.563 -31.952  65.839  1.00 20.31 ? 146  MET A N   1 
ATOM   1070  C CA  . MET A  1 140 ? -60.871 -32.345  64.473  1.00 20.67 ? 146  MET A CA  1 
ATOM   1071  C C   . MET A  1 140 ? -61.038 -33.848  64.342  1.00 16.88 ? 146  MET A C   1 
ATOM   1072  O O   . MET A  1 140 ? -61.842 -34.323  63.546  1.00 20.30 ? 146  MET A O   1 
ATOM   1073  C CB  . MET A  1 140 ? -59.780 -31.862  63.537  1.00 22.25 ? 146  MET A CB  1 
ATOM   1074  C CG  . MET A  1 140 ? -60.267 -31.499  62.178  1.00 27.66 ? 146  MET A CG  1 
ATOM   1075  S SD  . MET A  1 140 ? -58.947 -30.675  61.306  1.00 33.35 ? 146  MET A SD  1 
ATOM   1076  C CE  . MET A  1 140 ? -59.359 -31.143  59.636  1.00 19.20 ? 146  MET A CE  1 
ATOM   1077  N N   . LEU A  1 141 ? -60.256 -34.592  65.112  1.00 16.48 ? 147  LEU A N   1 
ATOM   1078  C CA  . LEU A  1 141 ? -60.391 -36.039  65.158  1.00 18.46 ? 147  LEU A CA  1 
ATOM   1079  C C   . LEU A  1 141 ? -61.762 -36.449  65.674  1.00 17.96 ? 147  LEU A C   1 
ATOM   1080  O O   . LEU A  1 141 ? -62.384 -37.359  65.139  1.00 21.01 ? 147  LEU A O   1 
ATOM   1081  C CB  . LEU A  1 141 ? -59.294 -36.650  66.037  1.00 20.53 ? 147  LEU A CB  1 
ATOM   1082  C CG  . LEU A  1 141 ? -57.901 -36.693  65.423  1.00 15.54 ? 147  LEU A CG  1 
ATOM   1083  C CD1 . LEU A  1 141 ? -56.886 -37.077  66.473  1.00 13.87 ? 147  LEU A CD1 1 
ATOM   1084  C CD2 . LEU A  1 141 ? -57.877 -37.682  64.276  1.00 17.80 ? 147  LEU A CD2 1 
ATOM   1085  N N   . GLN A  1 142 ? -62.228 -35.773  66.715  1.00 17.50 ? 148  GLN A N   1 
ATOM   1086  C CA  . GLN A  1 142 ? -63.491 -36.122  67.338  1.00 18.99 ? 148  GLN A CA  1 
ATOM   1087  C C   . GLN A  1 142 ? -64.694 -35.749  66.476  1.00 21.79 ? 148  GLN A C   1 
ATOM   1088  O O   . GLN A  1 142 ? -65.680 -36.477  66.445  1.00 22.49 ? 148  GLN A O   1 
ATOM   1089  C CB  . GLN A  1 142 ? -63.610 -35.460  68.700  1.00 20.66 ? 148  GLN A CB  1 
ATOM   1090  C CG  . GLN A  1 142 ? -63.157 -36.338  69.838  1.00 30.60 ? 148  GLN A CG  1 
ATOM   1091  C CD  . GLN A  1 142 ? -63.494 -35.728  71.171  1.00 42.17 ? 148  GLN A CD  1 
ATOM   1092  O OE1 . GLN A  1 142 ? -63.683 -34.520  71.273  1.00 45.35 ? 148  GLN A OE1 1 
ATOM   1093  N NE2 . GLN A  1 142 ? -63.576 -36.555  72.203  1.00 49.64 ? 148  GLN A NE2 1 
ATOM   1094  N N   . GLN A  1 143 ? -64.623 -34.618  65.785  1.00 20.31 ? 149  GLN A N   1 
ATOM   1095  C CA  . GLN A  1 143 ? -65.666 -34.293  64.817  1.00 17.86 ? 149  GLN A CA  1 
ATOM   1096  C C   . GLN A  1 143 ? -65.705 -35.328  63.701  1.00 23.32 ? 149  GLN A C   1 
ATOM   1097  O O   . GLN A  1 143 ? -66.770 -35.700  63.236  1.00 25.36 ? 149  GLN A O   1 
ATOM   1098  C CB  . GLN A  1 143 ? -65.459 -32.909  64.218  1.00 20.77 ? 149  GLN A CB  1 
ATOM   1099  C CG  . GLN A  1 143 ? -66.486 -32.572  63.146  1.00 21.00 ? 149  GLN A CG  1 
ATOM   1100  C CD  . GLN A  1 143 ? -66.241 -31.225  62.506  1.00 22.30 ? 149  GLN A CD  1 
ATOM   1101  O OE1 . GLN A  1 143 ? -65.625 -30.348  63.107  1.00 27.02 ? 149  GLN A OE1 1 
ATOM   1102  N NE2 . GLN A  1 143 ? -66.723 -31.054  61.279  1.00 22.78 ? 149  GLN A NE2 1 
ATOM   1103  N N   . HIS A  1 144 ? -64.539 -35.801  63.279  1.00 23.91 ? 150  HIS A N   1 
ATOM   1104  C CA  . HIS A  1 144 ? -64.465 -36.752  62.183  1.00 24.34 ? 150  HIS A CA  1 
ATOM   1105  C C   . HIS A  1 144 ? -65.147 -38.086  62.486  1.00 28.60 ? 150  HIS A C   1 
ATOM   1106  O O   . HIS A  1 144 ? -65.961 -38.564  61.689  1.00 30.43 ? 150  HIS A O   1 
ATOM   1107  C CB  . HIS A  1 144 ? -63.020 -37.018  61.800  1.00 21.53 ? 150  HIS A CB  1 
ATOM   1108  C CG  . HIS A  1 144 ? -62.879 -37.870  60.582  1.00 19.89 ? 150  HIS A CG  1 
ATOM   1109  N ND1 . HIS A  1 144 ? -62.942 -37.355  59.308  1.00 21.26 ? 150  HIS A ND1 1 
ATOM   1110  C CD2 . HIS A  1 144 ? -62.704 -39.204  60.440  1.00 20.93 ? 150  HIS A CD2 1 
ATOM   1111  C CE1 . HIS A  1 144 ? -62.798 -38.331  58.430  1.00 16.45 ? 150  HIS A CE1 1 
ATOM   1112  N NE2 . HIS A  1 144 ? -62.655 -39.464  59.090  1.00 18.82 ? 150  HIS A NE2 1 
ATOM   1113  N N   . VAL A  1 145 ? -64.805 -38.701  63.617  1.00 25.90 ? 151  VAL A N   1 
ATOM   1114  C CA  . VAL A  1 145 ? -65.388 -39.998  63.940  1.00 26.75 ? 151  VAL A CA  1 
ATOM   1115  C C   . VAL A  1 145 ? -66.873 -39.852  64.289  1.00 30.51 ? 151  VAL A C   1 
ATOM   1116  O O   . VAL A  1 145 ? -67.668 -40.745  64.007  1.00 37.09 ? 151  VAL A O   1 
ATOM   1117  C CB  . VAL A  1 145 ? -64.644 -40.700  65.097  1.00 25.06 ? 151  VAL A CB  1 
ATOM   1118  C CG1 . VAL A  1 145 ? -63.153 -40.702  64.836  1.00 24.96 ? 151  VAL A CG1 1 
ATOM   1119  C CG2 . VAL A  1 145 ? -64.937 -40.028  66.415  1.00 27.50 ? 151  VAL A CG2 1 
ATOM   1120  N N   . ASP A  1 146 ? -67.251 -38.720  64.874  1.00 26.11 ? 152  ASP A N   1 
ATOM   1121  C CA  . ASP A  1 146 ? -68.618 -38.535  65.331  1.00 29.27 ? 152  ASP A CA  1 
ATOM   1122  C C   . ASP A  1 146 ? -69.534 -38.100  64.202  1.00 31.82 ? 152  ASP A C   1 
ATOM   1123  O O   . ASP A  1 146 ? -70.748 -38.232  64.309  1.00 35.05 ? 152  ASP A O   1 
ATOM   1124  C CB  . ASP A  1 146 ? -68.679 -37.514  66.471  1.00 37.86 ? 152  ASP A CB  1 
ATOM   1125  C CG  . ASP A  1 146 ? -68.179 -38.083  67.799  1.00 44.59 ? 152  ASP A CG  1 
ATOM   1126  O OD1 . ASP A  1 146 ? -67.915 -39.304  67.862  1.00 43.92 ? 152  ASP A OD1 1 
ATOM   1127  O OD2 . ASP A  1 146 ? -68.061 -37.313  68.784  1.00 46.96 ? 152  ASP A OD2 1 
ATOM   1128  N N   . SER A  1 147 ? -68.959 -37.590  63.118  1.00 28.10 ? 153  SER A N   1 
ATOM   1129  C CA  . SER A  1 147 ? -69.763 -37.119  61.992  1.00 29.24 ? 153  SER A CA  1 
ATOM   1130  C C   . SER A  1 147 ? -69.920 -38.180  60.923  1.00 28.91 ? 153  SER A C   1 
ATOM   1131  O O   . SER A  1 147 ? -70.772 -38.057  60.050  1.00 33.78 ? 153  SER A O   1 
ATOM   1132  C CB  . SER A  1 147 ? -69.144 -35.881  61.353  1.00 28.85 ? 153  SER A CB  1 
ATOM   1133  O OG  . SER A  1 147 ? -68.047 -36.259  60.539  1.00 30.96 ? 153  SER A OG  1 
ATOM   1134  N N   . GLY A  1 148 ? -69.074 -39.202  60.973  1.00 32.43 ? 154  GLY A N   1 
ATOM   1135  C CA  . GLY A  1 148 ? -69.098 -40.263  59.982  1.00 31.65 ? 154  GLY A CA  1 
ATOM   1136  C C   . GLY A  1 148 ? -68.572 -39.833  58.626  1.00 29.96 ? 154  GLY A C   1 
ATOM   1137  O O   . GLY A  1 148 ? -68.663 -40.575  57.643  1.00 26.92 ? 154  GLY A O   1 
ATOM   1138  N N   . ALA A  1 149 ? -68.016 -38.629  58.574  1.00 32.31 ? 155  ALA A N   1 
ATOM   1139  C CA  . ALA A  1 149 ? -67.438 -38.102  57.346  1.00 27.05 ? 155  ALA A CA  1 
ATOM   1140  C C   . ALA A  1 149 ? -66.367 -39.026  56.788  1.00 28.13 ? 155  ALA A C   1 
ATOM   1141  O O   . ALA A  1 149 ? -65.660 -39.695  57.537  1.00 29.27 ? 155  ALA A O   1 
ATOM   1142  C CB  . ALA A  1 149 ? -66.855 -36.724  57.591  1.00 24.34 ? 155  ALA A CB  1 
ATOM   1143  N N   . ASP A  1 150 ? -66.259 -39.065  55.466  1.00 29.62 ? 156  ASP A N   1 
ATOM   1144  C CA  . ASP A  1 150 ? -65.094 -39.650  54.822  1.00 33.55 ? 156  ASP A CA  1 
ATOM   1145  C C   . ASP A  1 150 ? -63.878 -38.769  55.108  1.00 34.62 ? 156  ASP A C   1 
ATOM   1146  O O   . ASP A  1 150 ? -62.795 -39.264  55.433  1.00 36.36 ? 156  ASP A O   1 
ATOM   1147  C CB  . ASP A  1 150 ? -65.306 -39.783  53.313  1.00 36.18 ? 156  ASP A CB  1 
ATOM   1148  C CG  . ASP A  1 150 ? -66.281 -40.884  52.955  1.00 37.09 ? 156  ASP A CG  1 
ATOM   1149  O OD1 . ASP A  1 150 ? -66.174 -41.976  53.558  1.00 40.32 ? 156  ASP A OD1 1 
ATOM   1150  O OD2 . ASP A  1 150 ? -67.144 -40.661  52.072  1.00 32.37 ? 156  ASP A OD2 1 
ATOM   1151  N N   . VAL A  1 151 ? -64.076 -37.457  54.998  1.00 25.37 ? 157  VAL A N   1 
ATOM   1152  C CA  . VAL A  1 151 ? -62.987 -36.506  55.135  1.00 23.24 ? 157  VAL A CA  1 
ATOM   1153  C C   . VAL A  1 151 ? -63.455 -35.287  55.932  1.00 24.67 ? 157  VAL A C   1 
ATOM   1154  O O   . VAL A  1 151 ? -64.568 -34.796  55.738  1.00 28.93 ? 157  VAL A O   1 
ATOM   1155  C CB  . VAL A  1 151 ? -62.442 -36.095  53.732  1.00 32.20 ? 157  VAL A CB  1 
ATOM   1156  C CG1 . VAL A  1 151 ? -63.527 -35.485  52.886  1.00 32.01 ? 157  VAL A CG1 1 
ATOM   1157  C CG2 . VAL A  1 151 ? -61.327 -35.134  53.837  1.00 32.69 ? 157  VAL A CG2 1 
ATOM   1158  N N   . THR A  1 152 ? -62.619 -34.825  56.862  1.00 24.64 ? 158  THR A N   1 
ATOM   1159  C CA  . THR A  1 152 ? -62.899 -33.590  57.590  1.00 22.16 ? 158  THR A CA  1 
ATOM   1160  C C   . THR A  1 152 ? -61.829 -32.564  57.215  1.00 23.43 ? 158  THR A C   1 
ATOM   1161  O O   . THR A  1 152 ? -60.637 -32.855  57.287  1.00 24.50 ? 158  THR A O   1 
ATOM   1162  C CB  . THR A  1 152 ? -62.944 -33.816  59.118  1.00 23.18 ? 158  THR A CB  1 
ATOM   1163  O OG1 . THR A  1 152 ? -63.978 -34.753  59.426  1.00 24.44 ? 158  THR A OG1 1 
ATOM   1164  C CG2 . THR A  1 152 ? -63.230 -32.524  59.862  1.00 20.67 ? 158  THR A CG2 1 
ATOM   1165  N N   . ILE A  1 153 ? -62.252 -31.379  56.781  1.00 22.89 ? 159  ILE A N   1 
ATOM   1166  C CA  . ILE A  1 153 ? -61.320 -30.395  56.241  1.00 22.22 ? 159  ILE A CA  1 
ATOM   1167  C C   . ILE A  1 153 ? -61.268 -29.166  57.123  1.00 21.98 ? 159  ILE A C   1 
ATOM   1168  O O   . ILE A  1 153 ? -62.297 -28.589  57.460  1.00 20.54 ? 159  ILE A O   1 
ATOM   1169  C CB  . ILE A  1 153 ? -61.695 -29.965  54.802  1.00 25.35 ? 159  ILE A CB  1 
ATOM   1170  C CG1 . ILE A  1 153 ? -62.232 -31.160  54.009  1.00 28.74 ? 159  ILE A CG1 1 
ATOM   1171  C CG2 . ILE A  1 153 ? -60.500 -29.324  54.095  1.00 21.48 ? 159  ILE A CG2 1 
ATOM   1172  C CD1 . ILE A  1 153 ? -62.222 -30.979  52.502  1.00 26.35 ? 159  ILE A CD1 1 
ATOM   1173  N N   . GLY A  1 154 ? -60.062 -28.768  57.504  1.00 17.36 ? 160  GLY A N   1 
ATOM   1174  C CA  . GLY A  1 154 ? -59.908 -27.580  58.313  1.00 17.35 ? 160  GLY A CA  1 
ATOM   1175  C C   . GLY A  1 154 ? -60.020 -26.321  57.477  1.00 21.50 ? 160  GLY A C   1 
ATOM   1176  O O   . GLY A  1 154 ? -59.418 -26.223  56.409  1.00 24.15 ? 160  GLY A O   1 
ATOM   1177  N N   . CYS A  1 155 ? -60.782 -25.353  57.977  1.00 21.88 ? 161  CYS A N   1 
ATOM   1178  C CA  . CYS A  1 155 ? -61.092 -24.138  57.225  1.00 17.45 ? 161  CYS A CA  1 
ATOM   1179  C C   . CYS A  1 155 ? -61.037 -22.878  58.084  1.00 23.08 ? 161  CYS A C   1 
ATOM   1180  O O   . CYS A  1 155 ? -61.504 -22.870  59.220  1.00 21.72 ? 161  CYS A O   1 
ATOM   1181  C CB  . CYS A  1 155 ? -62.479 -24.252  56.593  1.00 18.02 ? 161  CYS A CB  1 
ATOM   1182  S SG  . CYS A  1 155 ? -62.595 -25.542  55.347  1.00 28.04 ? 161  CYS A SG  1 
ATOM   1183  N N   . LEU A  1 156 ? -60.462 -21.815  57.534  1.00 28.12 ? 162  LEU A N   1 
ATOM   1184  C CA  . LEU A  1 156 ? -60.554 -20.495  58.146  1.00 25.57 ? 162  LEU A CA  1 
ATOM   1185  C C   . LEU A  1 156 ? -61.844 -19.833  57.688  1.00 27.17 ? 162  LEU A C   1 
ATOM   1186  O O   . LEU A  1 156 ? -62.292 -20.070  56.572  1.00 30.23 ? 162  LEU A O   1 
ATOM   1187  C CB  . LEU A  1 156 ? -59.368 -19.612  57.752  1.00 23.39 ? 162  LEU A CB  1 
ATOM   1188  C CG  . LEU A  1 156 ? -57.975 -20.229  57.751  1.00 22.39 ? 162  LEU A CG  1 
ATOM   1189  C CD1 . LEU A  1 156 ? -57.048 -19.412  56.872  1.00 21.16 ? 162  LEU A CD1 1 
ATOM   1190  C CD2 . LEU A  1 156 ? -57.454 -20.293  59.169  1.00 18.94 ? 162  LEU A CD2 1 
ATOM   1191  N N   . GLU A  1 157 ? -62.440 -19.002  58.537  1.00 28.96 ? 163  GLU A N   1 
ATOM   1192  C CA  . GLU A  1 157 ? -63.513 -18.122  58.083  1.00 27.32 ? 163  GLU A CA  1 
ATOM   1193  C C   . GLU A  1 157 ? -62.886 -16.814  57.674  1.00 26.89 ? 163  GLU A C   1 
ATOM   1194  O O   . GLU A  1 157 ? -62.360 -16.093  58.520  1.00 28.80 ? 163  GLU A O   1 
ATOM   1195  C CB  . GLU A  1 157 ? -64.557 -17.869  59.168  1.00 36.00 ? 163  GLU A CB  1 
ATOM   1196  C CG  . GLU A  1 157 ? -65.456 -19.041  59.478  1.00 44.27 ? 163  GLU A CG  1 
ATOM   1197  C CD  . GLU A  1 157 ? -66.726 -18.621  60.205  1.00 52.35 ? 163  GLU A CD  1 
ATOM   1198  O OE1 . GLU A  1 157 ? -67.167 -17.463  60.035  1.00 53.02 ? 163  GLU A OE1 1 
ATOM   1199  O OE2 . GLU A  1 157 ? -67.274 -19.446  60.963  1.00 56.01 ? 163  GLU A OE2 1 
ATOM   1200  N N   . VAL A  1 158 ? -62.916 -16.506  56.385  1.00 25.26 ? 164  VAL A N   1 
ATOM   1201  C CA  . VAL A  1 158 ? -62.334 -15.253  55.928  1.00 24.67 ? 164  VAL A CA  1 
ATOM   1202  C C   . VAL A  1 158 ? -63.394 -14.447  55.191  1.00 30.69 ? 164  VAL A C   1 
ATOM   1203  O O   . VAL A  1 158 ? -64.303 -15.022  54.588  1.00 32.85 ? 164  VAL A O   1 
ATOM   1204  C CB  . VAL A  1 158 ? -61.111 -15.476  55.011  1.00 20.78 ? 164  VAL A CB  1 
ATOM   1205  C CG1 . VAL A  1 158 ? -59.999 -16.220  55.763  1.00 26.18 ? 164  VAL A CG1 1 
ATOM   1206  C CG2 . VAL A  1 158 ? -61.509 -16.234  53.775  1.00 25.08 ? 164  VAL A CG2 1 
ATOM   1207  N N   . PRO A  1 159 ? -63.295 -13.111  55.260  1.00 30.18 ? 165  PRO A N   1 
ATOM   1208  C CA  . PRO A  1 159 ? -64.176 -12.259  54.461  1.00 28.21 ? 165  PRO A CA  1 
ATOM   1209  C C   . PRO A  1 159 ? -64.143 -12.693  53.004  1.00 30.81 ? 165  PRO A C   1 
ATOM   1210  O O   . PRO A  1 159 ? -63.048 -12.963  52.496  1.00 32.02 ? 165  PRO A O   1 
ATOM   1211  C CB  . PRO A  1 159 ? -63.568 -10.868  54.641  1.00 28.57 ? 165  PRO A CB  1 
ATOM   1212  C CG  . PRO A  1 159 ? -62.906 -10.928  55.963  1.00 32.31 ? 165  PRO A CG  1 
ATOM   1213  C CD  . PRO A  1 159 ? -62.364 -12.323  56.085  1.00 31.12 ? 165  PRO A CD  1 
ATOM   1214  N N   . ARG A  1 160 ? -65.306 -12.764  52.354  1.00 28.69 ? 166  ARG A N   1 
ATOM   1215  C CA  . ARG A  1 160 ? -65.405 -13.255  50.985  1.00 28.17 ? 166  ARG A CA  1 
ATOM   1216  C C   . ARG A  1 160 ? -64.363 -12.670  50.034  1.00 30.22 ? 166  ARG A C   1 
ATOM   1217  O O   . ARG A  1 160 ? -63.903 -13.356  49.129  1.00 36.62 ? 166  ARG A O   1 
ATOM   1218  C CB  . ARG A  1 160 ? -66.805 -12.986  50.424  1.00 33.25 ? 166  ARG A CB  1 
ATOM   1219  C CG  . ARG A  1 160 ? -67.790 -14.120  50.653  1.00 36.19 ? 166  ARG A CG  1 
ATOM   1220  C CD  . ARG A  1 160 ? -69.118 -13.883  49.939  1.00 38.21 ? 166  ARG A CD  1 
ATOM   1221  N NE  . ARG A  1 160 ? -68.971 -13.735  48.492  1.00 39.43 ? 166  ARG A NE  1 
ATOM   1222  C CZ  . ARG A  1 160 ? -69.139 -12.589  47.840  1.00 46.67 ? 166  ARG A CZ  1 
ATOM   1223  N NH1 . ARG A  1 160 ? -69.457 -11.487  48.509  1.00 45.42 ? 166  ARG A NH1 1 
ATOM   1224  N NH2 . ARG A  1 160 ? -68.989 -12.538  46.520  1.00 51.06 ? 166  ARG A NH2 1 
ATOM   1225  N N   . MET A  1 161 ? -63.980 -11.414  50.226  1.00 26.88 ? 167  MET A N   1 
ATOM   1226  C CA  . MET A  1 161 ? -62.978 -10.839  49.341  1.00 25.88 ? 167  MET A CA  1 
ATOM   1227  C C   . MET A  1 161 ? -61.603 -11.485  49.518  1.00 31.69 ? 167  MET A C   1 
ATOM   1228  O O   . MET A  1 161 ? -60.859 -11.623  48.547  1.00 33.73 ? 167  MET A O   1 
ATOM   1229  C CB  . MET A  1 161 ? -62.876 -9.323   49.533  1.00 30.17 ? 167  MET A CB  1 
ATOM   1230  C CG  . MET A  1 161 ? -61.928 -8.672   48.525  1.00 40.44 ? 167  MET A CG  1 
ATOM   1231  S SD  . MET A  1 161 ? -62.546 -7.165   47.735  1.00 50.06 ? 167  MET A SD  1 
ATOM   1232  C CE  . MET A  1 161 ? -61.374 -6.987   46.388  1.00 43.14 ? 167  MET A CE  1 
ATOM   1233  N N   . GLU A  1 162 ? -61.263 -11.899  50.740  1.00 29.40 ? 168  GLU A N   1 
ATOM   1234  C CA  . GLU A  1 162 ? -59.947 -12.498  50.971  1.00 33.68 ? 168  GLU A CA  1 
ATOM   1235  C C   . GLU A  1 162 ? -59.906 -13.935  50.465  1.00 30.81 ? 168  GLU A C   1 
ATOM   1236  O O   . GLU A  1 162 ? -58.846 -14.436  50.083  1.00 33.77 ? 168  GLU A O   1 
ATOM   1237  C CB  . GLU A  1 162 ? -59.556 -12.453  52.455  1.00 42.17 ? 168  GLU A CB  1 
ATOM   1238  C CG  . GLU A  1 162 ? -58.127 -12.963  52.725  1.00 53.21 ? 168  GLU A CG  1 
ATOM   1239  C CD  . GLU A  1 162 ? -57.865 -13.375  54.178  1.00 61.21 ? 168  GLU A CD  1 
ATOM   1240  O OE1 . GLU A  1 162 ? -58.728 -13.130  55.050  1.00 67.30 ? 168  GLU A OE1 1 
ATOM   1241  O OE2 . GLU A  1 162 ? -56.779 -13.942  54.447  1.00 59.21 ? 168  GLU A OE2 1 
ATOM   1242  N N   . ALA A  1 163 ? -61.063 -14.588  50.448  1.00 22.64 ? 169  ALA A N   1 
ATOM   1243  C CA  . ALA A  1 163 ? -61.144 -15.987  50.050  1.00 23.77 ? 169  ALA A CA  1 
ATOM   1244  C C   . ALA A  1 163 ? -60.724 -16.215  48.600  1.00 30.77 ? 169  ALA A C   1 
ATOM   1245  O O   . ALA A  1 163 ? -60.449 -17.350  48.206  1.00 33.98 ? 169  ALA A O   1 
ATOM   1246  C CB  . ALA A  1 163 ? -62.548 -16.513  50.274  1.00 25.15 ? 169  ALA A CB  1 
ATOM   1247  N N   . THR A  1 164 ? -60.665 -15.142  47.814  1.00 33.05 ? 170  THR A N   1 
ATOM   1248  C CA  . THR A  1 164 ? -60.389 -15.248  46.386  1.00 31.71 ? 170  THR A CA  1 
ATOM   1249  C C   . THR A  1 164 ? -59.016 -15.849  46.087  1.00 34.09 ? 170  THR A C   1 
ATOM   1250  O O   . THR A  1 164 ? -58.749 -16.263  44.963  1.00 34.33 ? 170  THR A O   1 
ATOM   1251  C CB  . THR A  1 164 ? -60.496 -13.866  45.677  1.00 27.11 ? 170  THR A CB  1 
ATOM   1252  O OG1 . THR A  1 164 ? -59.492 -12.974  46.174  1.00 32.80 ? 170  THR A OG1 1 
ATOM   1253  C CG2 . THR A  1 164 ? -61.872 -13.236  45.879  1.00 22.58 ? 170  THR A CG2 1 
ATOM   1254  N N   . GLY A  1 165 ? -58.147 -15.906  47.090  1.00 35.90 ? 171  GLY A N   1 
ATOM   1255  C CA  . GLY A  1 165 ? -56.831 -16.490  46.909  1.00 29.88 ? 171  GLY A CA  1 
ATOM   1256  C C   . GLY A  1 165 ? -56.713 -17.876  47.510  1.00 25.61 ? 171  GLY A C   1 
ATOM   1257  O O   . GLY A  1 165 ? -55.687 -18.536  47.392  1.00 24.66 ? 171  GLY A O   1 
ATOM   1258  N N   . PHE A  1 166 ? -57.776 -18.325  48.156  1.00 22.69 ? 172  PHE A N   1 
ATOM   1259  C CA  . PHE A  1 166 ? -57.774 -19.632  48.776  1.00 23.70 ? 172  PHE A CA  1 
ATOM   1260  C C   . PHE A  1 166 ? -58.530 -20.645  47.937  1.00 24.00 ? 172  PHE A C   1 
ATOM   1261  O O   . PHE A  1 166 ? -59.335 -20.280  47.086  1.00 24.65 ? 172  PHE A O   1 
ATOM   1262  C CB  . PHE A  1 166 ? -58.393 -19.552  50.168  1.00 26.26 ? 172  PHE A CB  1 
ATOM   1263  C CG  . PHE A  1 166 ? -57.550 -18.812  51.165  1.00 26.60 ? 172  PHE A CG  1 
ATOM   1264  C CD1 . PHE A  1 166 ? -56.694 -19.499  52.013  1.00 21.47 ? 172  PHE A CD1 1 
ATOM   1265  C CD2 . PHE A  1 166 ? -57.603 -17.433  51.245  1.00 25.66 ? 172  PHE A CD2 1 
ATOM   1266  C CE1 . PHE A  1 166 ? -55.922 -18.824  52.927  1.00 21.23 ? 172  PHE A CE1 1 
ATOM   1267  C CE2 . PHE A  1 166 ? -56.830 -16.747  52.156  1.00 23.31 ? 172  PHE A CE2 1 
ATOM   1268  C CZ  . PHE A  1 166 ? -55.988 -17.441  53.000  1.00 22.46 ? 172  PHE A CZ  1 
ATOM   1269  N N   . GLY A  1 167 ? -58.267 -21.921  48.176  1.00 20.35 ? 173  GLY A N   1 
ATOM   1270  C CA  . GLY A  1 167 ? -59.156 -22.960  47.702  1.00 25.76 ? 173  GLY A CA  1 
ATOM   1271  C C   . GLY A  1 167 ? -60.361 -22.886  48.620  1.00 28.44 ? 173  GLY A C   1 
ATOM   1272  O O   . GLY A  1 167 ? -60.225 -22.956  49.844  1.00 28.41 ? 173  GLY A O   1 
ATOM   1273  N N   . VAL A  1 168 ? -61.543 -22.710  48.052  1.00 23.57 ? 174  VAL A N   1 
ATOM   1274  C CA  . VAL A  1 168 ? -62.710 -22.435  48.877  1.00 21.90 ? 174  VAL A CA  1 
ATOM   1275  C C   . VAL A  1 168 ? -63.692 -23.607  48.850  1.00 24.92 ? 174  VAL A C   1 
ATOM   1276  O O   . VAL A  1 168 ? -63.958 -24.195  47.800  1.00 26.78 ? 174  VAL A O   1 
ATOM   1277  C CB  . VAL A  1 168 ? -63.408 -21.119  48.430  1.00 22.68 ? 174  VAL A CB  1 
ATOM   1278  C CG1 . VAL A  1 168 ? -64.705 -20.892  49.199  1.00 23.69 ? 174  VAL A CG1 1 
ATOM   1279  C CG2 . VAL A  1 168 ? -62.471 -19.944  48.629  1.00 19.46 ? 174  VAL A CG2 1 
ATOM   1280  N N   . MET A  1 169 ? -64.209 -23.950  50.025  1.00 26.57 ? 175  MET A N   1 
ATOM   1281  C CA  . MET A  1 169 ? -65.168 -25.035  50.154  1.00 26.17 ? 175  MET A CA  1 
ATOM   1282  C C   . MET A  1 169 ? -66.582 -24.485  50.168  1.00 34.13 ? 175  MET A C   1 
ATOM   1283  O O   . MET A  1 169 ? -66.919 -23.608  50.966  1.00 36.05 ? 175  MET A O   1 
ATOM   1284  C CB  . MET A  1 169 ? -64.897 -25.863  51.418  1.00 24.23 ? 175  MET A CB  1 
ATOM   1285  C CG  . MET A  1 169 ? -63.492 -26.463  51.467  1.00 20.00 ? 175  MET A CG  1 
ATOM   1286  S SD  . MET A  1 169 ? -63.280 -27.884  50.380  1.00 31.29 ? 175  MET A SD  1 
ATOM   1287  C CE  . MET A  1 169 ? -61.502 -28.163  50.459  1.00 31.19 ? 175  MET A CE  1 
ATOM   1288  N N   . HIS A  1 170 ? -67.402 -25.001  49.260  1.00 31.75 ? 176  HIS A N   1 
ATOM   1289  C CA  . HIS A  1 170 ? -68.812 -24.670  49.236  1.00 33.45 ? 176  HIS A CA  1 
ATOM   1290  C C   . HIS A  1 170 ? -69.564 -25.681  50.090  1.00 29.58 ? 176  HIS A C   1 
ATOM   1291  O O   . HIS A  1 170 ? -69.604 -26.861  49.758  1.00 31.39 ? 176  HIS A O   1 
ATOM   1292  C CB  . HIS A  1 170 ? -69.327 -24.663  47.798  1.00 33.99 ? 176  HIS A CB  1 
ATOM   1293  C CG  . HIS A  1 170 ? -70.603 -23.912  47.620  1.00 33.79 ? 176  HIS A CG  1 
ATOM   1294  N ND1 . HIS A  1 170 ? -71.359 -23.991  46.472  1.00 34.98 ? 176  HIS A ND1 1 
ATOM   1295  C CD2 . HIS A  1 170 ? -71.265 -23.075  48.453  1.00 37.09 ? 176  HIS A CD2 1 
ATOM   1296  C CE1 . HIS A  1 170 ? -72.429 -23.228  46.603  1.00 40.30 ? 176  HIS A CE1 1 
ATOM   1297  N NE2 . HIS A  1 170 ? -72.397 -22.661  47.796  1.00 38.62 ? 176  HIS A NE2 1 
ATOM   1298  N N   . VAL A  1 171 ? -70.128 -25.230  51.206  1.00 27.30 ? 177  VAL A N   1 
ATOM   1299  C CA  . VAL A  1 171 ? -70.831 -26.133  52.106  1.00 28.96 ? 177  VAL A CA  1 
ATOM   1300  C C   . VAL A  1 171 ? -72.295 -25.749  52.249  1.00 31.89 ? 177  VAL A C   1 
ATOM   1301  O O   . VAL A  1 171 ? -72.726 -24.722  51.743  1.00 32.59 ? 177  VAL A O   1 
ATOM   1302  C CB  . VAL A  1 171 ? -70.190 -26.160  53.514  1.00 32.17 ? 177  VAL A CB  1 
ATOM   1303  C CG1 . VAL A  1 171 ? -68.686 -26.316  53.418  1.00 30.98 ? 177  VAL A CG1 1 
ATOM   1304  C CG2 . VAL A  1 171 ? -70.544 -24.905  54.288  1.00 31.21 ? 177  VAL A CG2 1 
ATOM   1305  N N   . ASN A  1 172 ? -73.055 -26.577  52.953  1.00 32.61 ? 178  ASN A N   1 
ATOM   1306  C CA  . ASN A  1 172 ? -74.450 -26.275  53.232  1.00 35.45 ? 178  ASN A CA  1 
ATOM   1307  C C   . ASN A  1 172 ? -74.655 -25.815  54.667  1.00 39.20 ? 178  ASN A C   1 
ATOM   1308  O O   . ASN A  1 172 ? -73.730 -25.311  55.305  1.00 38.70 ? 178  ASN A O   1 
ATOM   1309  C CB  . ASN A  1 172 ? -75.330 -27.491  52.935  1.00 33.36 ? 178  ASN A CB  1 
ATOM   1310  C CG  . ASN A  1 172 ? -74.961 -28.713  53.768  1.00 35.00 ? 178  ASN A CG  1 
ATOM   1311  O OD1 . ASN A  1 172 ? -74.569 -28.608  54.935  1.00 35.44 ? 178  ASN A OD1 1 
ATOM   1312  N ND2 . ASN A  1 172 ? -75.120 -29.886  53.176  1.00 34.64 ? 178  ASN A ND2 1 
ATOM   1313  N N   . GLU A  1 173 ? -75.860 -26.017  55.186  1.00 39.50 ? 179  GLU A N   1 
ATOM   1314  C CA  . GLU A  1 173 ? -76.211 -25.507  56.504  1.00 36.74 ? 179  GLU A CA  1 
ATOM   1315  C C   . GLU A  1 173 ? -75.704 -26.443  57.602  1.00 35.28 ? 179  GLU A C   1 
ATOM   1316  O O   . GLU A  1 173 ? -75.746 -26.112  58.784  1.00 36.97 ? 179  GLU A O   1 
ATOM   1317  C CB  . GLU A  1 173 ? -77.730 -25.314  56.608  1.00 43.85 ? 179  GLU A CB  1 
ATOM   1318  C CG  . GLU A  1 173 ? -78.535 -26.427  55.941  1.00 53.11 ? 179  GLU A CG  1 
ATOM   1319  C CD  . GLU A  1 173 ? -78.862 -26.156  54.480  1.00 60.56 ? 179  GLU A CD  1 
ATOM   1320  O OE1 . GLU A  1 173 ? -78.378 -25.147  53.918  1.00 63.25 ? 179  GLU A OE1 1 
ATOM   1321  O OE2 . GLU A  1 173 ? -79.565 -26.994  53.876  1.00 62.28 ? 179  GLU A OE2 1 
ATOM   1322  N N   . LYS A  1 174 ? -75.208 -27.613  57.213  1.00 32.62 ? 180  LYS A N   1 
ATOM   1323  C CA  . LYS A  1 174 ? -74.640 -28.538  58.191  1.00 37.33 ? 180  LYS A CA  1 
ATOM   1324  C C   . LYS A  1 174 ? -73.126 -28.694  58.020  1.00 33.26 ? 180  LYS A C   1 
ATOM   1325  O O   . LYS A  1 174 ? -72.527 -29.616  58.561  1.00 33.69 ? 180  LYS A O   1 
ATOM   1326  C CB  . LYS A  1 174 ? -75.333 -29.903  58.105  1.00 45.12 ? 180  LYS A CB  1 
ATOM   1327  C CG  . LYS A  1 174 ? -76.706 -29.918  58.777  1.00 49.09 ? 180  LYS A CG  1 
ATOM   1328  C CD  . LYS A  1 174 ? -77.429 -31.251  58.597  1.00 54.18 ? 180  LYS A CD  1 
ATOM   1329  C CE  . LYS A  1 174 ? -78.088 -31.374  57.232  1.00 57.16 ? 180  LYS A CE  1 
ATOM   1330  N NZ  . LYS A  1 174 ? -79.214 -30.410  57.051  1.00 58.26 ? 180  LYS A NZ  1 
ATOM   1331  N N   . ASP A  1 175 ? -72.527 -27.778  57.265  1.00 27.86 ? 181  ASP A N   1 
ATOM   1332  C CA  . ASP A  1 175 ? -71.089 -27.756  57.010  1.00 27.37 ? 181  ASP A CA  1 
ATOM   1333  C C   . ASP A  1 175 ? -70.581 -29.004  56.304  1.00 30.29 ? 181  ASP A C   1 
ATOM   1334  O O   . ASP A  1 175 ? -69.401 -29.343  56.413  1.00 33.12 ? 181  ASP A O   1 
ATOM   1335  C CB  . ASP A  1 175 ? -70.315 -27.548  58.310  1.00 23.96 ? 181  ASP A CB  1 
ATOM   1336  C CG  . ASP A  1 175 ? -70.005 -26.097  58.565  1.00 26.02 ? 181  ASP A CG  1 
ATOM   1337  O OD1 . ASP A  1 175 ? -70.436 -25.266  57.741  1.00 27.41 ? 181  ASP A OD1 1 
ATOM   1338  O OD2 . ASP A  1 175 ? -69.343 -25.785  59.580  1.00 23.40 ? 181  ASP A OD2 1 
ATOM   1339  N N   . GLU A  1 176 ? -71.464 -29.682  55.577  1.00 26.73 ? 182  GLU A N   1 
ATOM   1340  C CA  . GLU A  1 176 ? -71.020 -30.688  54.617  1.00 26.36 ? 182  GLU A CA  1 
ATOM   1341  C C   . GLU A  1 176 ? -70.649 -29.974  53.322  1.00 24.39 ? 182  GLU A C   1 
ATOM   1342  O O   . GLU A  1 176 ? -71.383 -29.110  52.855  1.00 28.91 ? 182  GLU A O   1 
ATOM   1343  C CB  . GLU A  1 176 ? -72.101 -31.741  54.369  1.00 32.72 ? 182  GLU A CB  1 
ATOM   1344  C CG  . GLU A  1 176 ? -72.711 -32.344  55.631  1.00 39.36 ? 182  GLU A CG  1 
ATOM   1345  C CD  . GLU A  1 176 ? -73.998 -33.125  55.359  1.00 46.05 ? 182  GLU A CD  1 
ATOM   1346  O OE1 . GLU A  1 176 ? -74.357 -33.312  54.172  1.00 45.94 ? 182  GLU A OE1 1 
ATOM   1347  O OE2 . GLU A  1 176 ? -74.652 -33.555  56.336  1.00 47.75 ? 182  GLU A OE2 1 
ATOM   1348  N N   . ILE A  1 177 ? -69.509 -30.330  52.743  1.00 23.96 ? 183  ILE A N   1 
ATOM   1349  C CA  . ILE A  1 177 ? -68.982 -29.614  51.585  1.00 25.82 ? 183  ILE A CA  1 
ATOM   1350  C C   . ILE A  1 177 ? -69.595 -30.120  50.279  1.00 33.84 ? 183  ILE A C   1 
ATOM   1351  O O   . ILE A  1 177 ? -69.532 -31.310  49.976  1.00 36.25 ? 183  ILE A O   1 
ATOM   1352  C CB  . ILE A  1 177 ? -67.455 -29.733  51.513  1.00 27.26 ? 183  ILE A CB  1 
ATOM   1353  C CG1 . ILE A  1 177 ? -66.832 -29.252  52.825  1.00 29.14 ? 183  ILE A CG1 1 
ATOM   1354  C CG2 . ILE A  1 177 ? -66.904 -28.930  50.350  1.00 23.88 ? 183  ILE A CG2 1 
ATOM   1355  C CD1 . ILE A  1 177 ? -65.436 -29.755  53.050  1.00 25.77 ? 183  ILE A CD1 1 
ATOM   1356  N N   . ILE A  1 178 ? -70.169 -29.199  49.506  1.00 34.29 ? 184  ILE A N   1 
ATOM   1357  C CA  . ILE A  1 178 ? -70.932 -29.544  48.310  1.00 29.63 ? 184  ILE A CA  1 
ATOM   1358  C C   . ILE A  1 178 ? -70.209 -29.171  47.020  1.00 31.38 ? 184  ILE A C   1 
ATOM   1359  O O   . ILE A  1 178 ? -70.591 -29.614  45.943  1.00 33.55 ? 184  ILE A O   1 
ATOM   1360  C CB  . ILE A  1 178 ? -72.297 -28.865  48.332  1.00 30.34 ? 184  ILE A CB  1 
ATOM   1361  C CG1 . ILE A  1 178 ? -72.155 -27.380  48.014  1.00 32.39 ? 184  ILE A CG1 1 
ATOM   1362  C CG2 . ILE A  1 178 ? -72.960 -29.061  49.691  1.00 31.26 ? 184  ILE A CG2 1 
ATOM   1363  C CD1 . ILE A  1 178 ? -73.346 -26.552  48.433  1.00 37.33 ? 184  ILE A CD1 1 
ATOM   1364  N N   . ASP A  1 179 ? -69.170 -28.350  47.134  1.00 32.95 ? 185  ASP A N   1 
ATOM   1365  C CA  . ASP A  1 179 ? -68.270 -28.077  46.015  1.00 33.73 ? 185  ASP A CA  1 
ATOM   1366  C C   . ASP A  1 179 ? -66.998 -27.424  46.526  1.00 31.56 ? 185  ASP A C   1 
ATOM   1367  O O   . ASP A  1 179 ? -66.976 -26.834  47.606  1.00 28.54 ? 185  ASP A O   1 
ATOM   1368  C CB  . ASP A  1 179 ? -68.932 -27.178  44.949  1.00 41.27 ? 185  ASP A CB  1 
ATOM   1369  C CG  . ASP A  1 179 ? -68.128 -27.112  43.635  1.00 42.94 ? 185  ASP A CG  1 
ATOM   1370  O OD1 . ASP A  1 179 ? -67.533 -28.133  43.236  1.00 46.69 ? 185  ASP A OD1 1 
ATOM   1371  O OD2 . ASP A  1 179 ? -68.092 -26.042  42.993  1.00 42.30 ? 185  ASP A OD2 1 
ATOM   1372  N N   . PHE A  1 180 ? -65.942 -27.551  45.734  1.00 32.38 ? 186  PHE A N   1 
ATOM   1373  C CA  . PHE A  1 180 ? -64.667 -26.918  46.010  1.00 33.72 ? 186  PHE A CA  1 
ATOM   1374  C C   . PHE A  1 180 ? -64.251 -26.128  44.787  1.00 35.97 ? 186  PHE A C   1 
ATOM   1375  O O   . PHE A  1 180 ? -64.381 -26.612  43.664  1.00 40.29 ? 186  PHE A O   1 
ATOM   1376  C CB  . PHE A  1 180 ? -63.605 -27.957  46.357  1.00 32.00 ? 186  PHE A CB  1 
ATOM   1377  C CG  . PHE A  1 180 ? -62.208 -27.425  46.316  1.00 33.21 ? 186  PHE A CG  1 
ATOM   1378  C CD1 . PHE A  1 180 ? -61.714 -26.665  47.358  1.00 33.68 ? 186  PHE A CD1 1 
ATOM   1379  C CD2 . PHE A  1 180 ? -61.392 -27.676  45.230  1.00 32.67 ? 186  PHE A CD2 1 
ATOM   1380  C CE1 . PHE A  1 180 ? -60.427 -26.172  47.323  1.00 34.99 ? 186  PHE A CE1 1 
ATOM   1381  C CE2 . PHE A  1 180 ? -60.104 -27.183  45.186  1.00 36.40 ? 186  PHE A CE2 1 
ATOM   1382  C CZ  . PHE A  1 180 ? -59.620 -26.429  46.233  1.00 35.97 ? 186  PHE A CZ  1 
ATOM   1383  N N   . ILE A  1 181 ? -63.762 -24.910  44.998  1.00 29.05 ? 187  ILE A N   1 
ATOM   1384  C CA  . ILE A  1 181 ? -63.324 -24.077  43.890  1.00 23.74 ? 187  ILE A CA  1 
ATOM   1385  C C   . ILE A  1 181 ? -61.969 -23.466  44.186  1.00 21.39 ? 187  ILE A C   1 
ATOM   1386  O O   . ILE A  1 181 ? -61.783 -22.818  45.208  1.00 24.53 ? 187  ILE A O   1 
ATOM   1387  C CB  . ILE A  1 181 ? -64.340 -22.935  43.578  1.00 30.16 ? 187  ILE A CB  1 
ATOM   1388  C CG1 . ILE A  1 181 ? -65.754 -23.482  43.382  1.00 35.51 ? 187  ILE A CG1 1 
ATOM   1389  C CG2 . ILE A  1 181 ? -63.917 -22.164  42.343  1.00 27.54 ? 187  ILE A CG2 1 
ATOM   1390  C CD1 . ILE A  1 181 ? -66.631 -23.392  44.612  1.00 39.13 ? 187  ILE A CD1 1 
ATOM   1391  N N   . GLU A  1 182 ? -61.017 -23.667  43.289  1.00 23.72 ? 188  GLU A N   1 
ATOM   1392  C CA  . GLU A  1 182 ? -59.707 -23.058  43.454  1.00 28.64 ? 188  GLU A CA  1 
ATOM   1393  C C   . GLU A  1 182 ? -59.731 -21.568  43.133  1.00 30.12 ? 188  GLU A C   1 
ATOM   1394  O O   . GLU A  1 182 ? -60.030 -21.166  42.005  1.00 28.43 ? 188  GLU A O   1 
ATOM   1395  C CB  . GLU A  1 182 ? -58.676 -23.754  42.568  1.00 33.83 ? 188  GLU A CB  1 
ATOM   1396  C CG  . GLU A  1 182 ? -57.374 -22.987  42.404  1.00 39.04 ? 188  GLU A CG  1 
ATOM   1397  C CD  . GLU A  1 182 ? -56.289 -23.475  43.336  1.00 46.56 ? 188  GLU A CD  1 
ATOM   1398  O OE1 . GLU A  1 182 ? -56.428 -24.599  43.867  1.00 55.13 ? 188  GLU A OE1 1 
ATOM   1399  O OE2 . GLU A  1 182 ? -55.300 -22.738  43.538  1.00 44.69 ? 188  GLU A OE2 1 
ATOM   1400  N N   . LYS A  1 183 ? -59.396 -20.762  44.133  1.00 26.56 ? 189  LYS A N   1 
ATOM   1401  C CA  . LYS A  1 183 ? -59.317 -19.313  43.997  1.00 23.39 ? 189  LYS A CA  1 
ATOM   1402  C C   . LYS A  1 183 ? -60.526 -18.695  43.309  1.00 25.53 ? 189  LYS A C   1 
ATOM   1403  O O   . LYS A  1 183 ? -60.360 -17.952  42.341  1.00 25.41 ? 189  LYS A O   1 
ATOM   1404  C CB  . LYS A  1 183 ? -58.053 -18.930  43.232  1.00 21.82 ? 189  LYS A CB  1 
ATOM   1405  C CG  . LYS A  1 183 ? -56.803 -19.582  43.769  1.00 28.56 ? 189  LYS A CG  1 
ATOM   1406  C CD  . LYS A  1 183 ? -55.579 -18.811  43.350  1.00 33.50 ? 189  LYS A CD  1 
ATOM   1407  C CE  . LYS A  1 183 ? -54.318 -19.571  43.704  1.00 44.84 ? 189  LYS A CE  1 
ATOM   1408  N NZ  . LYS A  1 183 ? -53.265 -19.350  42.676  1.00 51.57 ? 189  LYS A NZ  1 
ATOM   1409  N N   . PRO A  1 184 ? -61.742 -18.999  43.801  1.00 30.77 ? 190  PRO A N   1 
ATOM   1410  C CA  . PRO A  1 184 ? -62.905 -18.453  43.105  1.00 30.78 ? 190  PRO A CA  1 
ATOM   1411  C C   . PRO A  1 184 ? -62.859 -16.946  43.152  1.00 33.76 ? 190  PRO A C   1 
ATOM   1412  O O   . PRO A  1 184 ? -62.596 -16.332  44.189  1.00 35.67 ? 190  PRO A O   1 
ATOM   1413  C CB  . PRO A  1 184 ? -64.093 -18.999  43.895  1.00 30.71 ? 190  PRO A CB  1 
ATOM   1414  C CG  . PRO A  1 184 ? -63.547 -19.203  45.264  1.00 29.74 ? 190  PRO A CG  1 
ATOM   1415  C CD  . PRO A  1 184 ? -62.115 -19.623  45.082  1.00 29.56 ? 190  PRO A CD  1 
ATOM   1416  N N   . ALA A  1 185 ? -63.097 -16.351  42.000  1.00 33.97 ? 191  ALA A N   1 
ATOM   1417  C CA  . ALA A  1 185 ? -62.971 -14.927  41.863  1.00 32.00 ? 191  ALA A CA  1 
ATOM   1418  C C   . ALA A  1 185 ? -64.193 -14.231  42.492  1.00 31.91 ? 191  ALA A C   1 
ATOM   1419  O O   . ALA A  1 185 ? -64.140 -13.072  42.927  1.00 30.89 ? 191  ALA A O   1 
ATOM   1420  C CB  . ALA A  1 185 ? -62.794 -14.617  40.409  1.00 34.62 ? 191  ALA A CB  1 
ATOM   1421  N N   . ASP A  1 186 ? -65.289 -14.978  42.544  1.00 30.12 ? 192  ASP A N   1 
ATOM   1422  C CA  . ASP A  1 186 ? -66.470 -14.610  43.316  1.00 28.36 ? 192  ASP A CA  1 
ATOM   1423  C C   . ASP A  1 186 ? -66.768 -15.744  44.295  1.00 33.41 ? 192  ASP A C   1 
ATOM   1424  O O   . ASP A  1 186 ? -67.603 -16.600  44.012  1.00 34.07 ? 192  ASP A O   1 
ATOM   1425  C CB  . ASP A  1 186 ? -67.672 -14.352  42.391  1.00 27.62 ? 192  ASP A CB  1 
ATOM   1426  C CG  . ASP A  1 186 ? -68.924 -13.821  43.140  1.00 40.50 ? 192  ASP A CG  1 
ATOM   1427  O OD1 . ASP A  1 186 ? -68.815 -13.413  44.320  1.00 44.61 ? 192  ASP A OD1 1 
ATOM   1428  O OD2 . ASP A  1 186 ? -70.029 -13.798  42.540  1.00 38.11 ? 192  ASP A OD2 1 
ATOM   1429  N N   . PRO A  1 187 ? -66.083 -15.752  45.455  1.00 36.52 ? 193  PRO A N   1 
ATOM   1430  C CA  . PRO A  1 187 ? -66.099 -16.910  46.356  1.00 30.84 ? 193  PRO A CA  1 
ATOM   1431  C C   . PRO A  1 187 ? -67.463 -17.249  46.918  1.00 27.10 ? 193  PRO A C   1 
ATOM   1432  O O   . PRO A  1 187 ? -68.162 -16.362  47.396  1.00 27.16 ? 193  PRO A O   1 
ATOM   1433  C CB  . PRO A  1 187 ? -65.163 -16.481  47.490  1.00 33.44 ? 193  PRO A CB  1 
ATOM   1434  C CG  . PRO A  1 187 ? -64.302 -15.443  46.898  1.00 33.31 ? 193  PRO A CG  1 
ATOM   1435  C CD  . PRO A  1 187 ? -65.197 -14.693  45.964  1.00 33.62 ? 193  PRO A CD  1 
ATOM   1436  N N   . PRO A  1 188 ? -67.834 -18.533  46.873  1.00 26.37 ? 194  PRO A N   1 
ATOM   1437  C CA  . PRO A  1 188 ? -69.106 -18.962  47.457  1.00 25.97 ? 194  PRO A CA  1 
ATOM   1438  C C   . PRO A  1 188 ? -69.137 -18.674  48.943  1.00 26.82 ? 194  PRO A C   1 
ATOM   1439  O O   . PRO A  1 188 ? -68.190 -19.017  49.650  1.00 35.09 ? 194  PRO A O   1 
ATOM   1440  C CB  . PRO A  1 188 ? -69.146 -20.467  47.172  1.00 27.31 ? 194  PRO A CB  1 
ATOM   1441  C CG  . PRO A  1 188 ? -67.752 -20.843  46.787  1.00 28.32 ? 194  PRO A CG  1 
ATOM   1442  C CD  . PRO A  1 188 ? -67.128 -19.631  46.195  1.00 27.67 ? 194  PRO A CD  1 
ATOM   1443  N N   . GLY A  1 189 ? -70.201 -18.030  49.406  1.00 23.25 ? 195  GLY A N   1 
ATOM   1444  C CA  . GLY A  1 189 ? -70.313 -17.667  50.805  1.00 24.75 ? 195  GLY A CA  1 
ATOM   1445  C C   . GLY A  1 189 ? -70.914 -18.769  51.656  1.00 27.30 ? 195  GLY A C   1 
ATOM   1446  O O   . GLY A  1 189 ? -71.457 -19.746  51.148  1.00 30.69 ? 195  GLY A O   1 
ATOM   1447  N N   . ILE A  1 190 ? -70.808 -18.612  52.967  1.00 28.01 ? 196  ILE A N   1 
ATOM   1448  C CA  . ILE A  1 190 ? -71.403 -19.554  53.897  1.00 29.22 ? 196  ILE A CA  1 
ATOM   1449  C C   . ILE A  1 190 ? -72.904 -19.338  53.942  1.00 34.33 ? 196  ILE A C   1 
ATOM   1450  O O   . ILE A  1 190 ? -73.357 -18.236  54.244  1.00 35.92 ? 196  ILE A O   1 
ATOM   1451  C CB  . ILE A  1 190 ? -70.813 -19.393  55.310  1.00 27.77 ? 196  ILE A CB  1 
ATOM   1452  C CG1 . ILE A  1 190 ? -69.325 -19.748  55.307  1.00 26.16 ? 196  ILE A CG1 1 
ATOM   1453  C CG2 . ILE A  1 190 ? -71.569 -20.254  56.320  1.00 27.90 ? 196  ILE A CG2 1 
ATOM   1454  C CD1 . ILE A  1 190 ? -68.601 -19.328  56.564  1.00 26.98 ? 196  ILE A CD1 1 
ATOM   1455  N N   . PRO A  1 191 ? -73.683 -20.384  53.636  1.00 37.62 ? 197  PRO A N   1 
ATOM   1456  C CA  . PRO A  1 191 ? -75.146 -20.278  53.674  1.00 41.10 ? 197  PRO A CA  1 
ATOM   1457  C C   . PRO A  1 191 ? -75.665 -19.735  55.009  1.00 41.22 ? 197  PRO A C   1 
ATOM   1458  O O   . PRO A  1 191 ? -75.502 -20.372  56.053  1.00 41.60 ? 197  PRO A O   1 
ATOM   1459  C CB  . PRO A  1 191 ? -75.598 -21.721  53.447  1.00 41.08 ? 197  PRO A CB  1 
ATOM   1460  C CG  . PRO A  1 191 ? -74.525 -22.296  52.592  1.00 39.14 ? 197  PRO A CG  1 
ATOM   1461  C CD  . PRO A  1 191 ? -73.244 -21.690  53.112  1.00 37.33 ? 197  PRO A CD  1 
ATOM   1462  N N   . GLY A  1 192 ? -76.276 -18.555  54.961  1.00 37.62 ? 198  GLY A N   1 
ATOM   1463  C CA  . GLY A  1 192 ? -76.773 -17.900  56.155  1.00 37.77 ? 198  GLY A CA  1 
ATOM   1464  C C   . GLY A  1 192 ? -75.757 -16.932  56.730  1.00 40.79 ? 198  GLY A C   1 
ATOM   1465  O O   . GLY A  1 192 ? -76.000 -16.300  57.758  1.00 44.83 ? 198  GLY A O   1 
ATOM   1466  N N   . ASN A  1 193 ? -74.613 -16.813  56.059  1.00 35.40 ? 199  ASN A N   1 
ATOM   1467  C CA  . ASN A  1 193 ? -73.538 -15.936  56.510  1.00 31.76 ? 199  ASN A CA  1 
ATOM   1468  C C   . ASN A  1 193 ? -72.654 -15.510  55.343  1.00 28.52 ? 199  ASN A C   1 
ATOM   1469  O O   . ASN A  1 193 ? -71.450 -15.756  55.338  1.00 28.35 ? 199  ASN A O   1 
ATOM   1470  C CB  . ASN A  1 193 ? -72.700 -16.634  57.584  1.00 34.91 ? 199  ASN A CB  1 
ATOM   1471  C CG  . ASN A  1 193 ? -71.731 -15.700  58.276  1.00 34.70 ? 199  ASN A CG  1 
ATOM   1472  O OD1 . ASN A  1 193 ? -71.851 -14.479  58.191  1.00 35.42 ? 199  ASN A OD1 1 
ATOM   1473  N ND2 . ASN A  1 193 ? -70.754 -16.276  58.962  1.00 35.39 ? 199  ASN A ND2 1 
ATOM   1474  N N   . GLU A  1 194 ? -73.268 -14.879  54.344  1.00 25.73 ? 200  GLU A N   1 
ATOM   1475  C CA  . GLU A  1 194 ? -72.554 -14.401  53.169  1.00 20.76 ? 200  GLU A CA  1 
ATOM   1476  C C   . GLU A  1 194 ? -71.512 -13.384  53.573  1.00 26.09 ? 200  GLU A C   1 
ATOM   1477  O O   . GLU A  1 194 ? -71.469 -12.936  54.721  1.00 34.40 ? 200  GLU A O   1 
ATOM   1478  C CB  . GLU A  1 194 ? -73.530 -13.795  52.162  1.00 29.70 ? 200  GLU A CB  1 
ATOM   1479  C CG  . GLU A  1 194 ? -74.301 -14.816  51.345  1.00 34.75 ? 200  GLU A CG  1 
ATOM   1480  C CD  . GLU A  1 194 ? -73.445 -15.497  50.291  1.00 40.14 ? 200  GLU A CD  1 
ATOM   1481  O OE1 . GLU A  1 194 ? -72.527 -14.845  49.742  1.00 42.33 ? 200  GLU A OE1 1 
ATOM   1482  O OE2 . GLU A  1 194 ? -73.691 -16.693  50.017  1.00 38.00 ? 200  GLU A OE2 1 
ATOM   1483  N N   . GLY A  1 195 ? -70.641 -13.029  52.645  1.00 30.06 ? 201  GLY A N   1 
ATOM   1484  C CA  . GLY A  1 195 ? -69.561 -12.122  52.989  1.00 37.96 ? 201  GLY A CA  1 
ATOM   1485  C C   . GLY A  1 195 ? -68.515 -12.795  53.859  1.00 34.28 ? 201  GLY A C   1 
ATOM   1486  O O   . GLY A  1 195 ? -67.557 -12.165  54.299  1.00 33.23 ? 201  GLY A O   1 
ATOM   1487  N N   . PHE A  1 196 ? -68.732 -14.077  54.130  1.00 32.93 ? 202  PHE A N   1 
ATOM   1488  C CA  . PHE A  1 196 ? -67.723 -14.939  54.715  1.00 29.20 ? 202  PHE A CA  1 
ATOM   1489  C C   . PHE A  1 196 ? -67.689 -16.241  53.944  1.00 29.48 ? 202  PHE A C   1 
ATOM   1490  O O   . PHE A  1 196 ? -68.727 -16.772  53.549  1.00 29.84 ? 202  PHE A O   1 
ATOM   1491  C CB  . PHE A  1 196 ? -67.994 -15.203  56.191  1.00 30.46 ? 202  PHE A CB  1 
ATOM   1492  C CG  . PHE A  1 196 ? -67.527 -14.104  57.095  1.00 32.86 ? 202  PHE A CG  1 
ATOM   1493  C CD1 . PHE A  1 196 ? -66.176 -13.949  57.374  1.00 34.02 ? 202  PHE A CD1 1 
ATOM   1494  C CD2 . PHE A  1 196 ? -68.433 -13.232  57.672  1.00 36.38 ? 202  PHE A CD2 1 
ATOM   1495  C CE1 . PHE A  1 196 ? -65.738 -12.943  58.208  1.00 33.39 ? 202  PHE A CE1 1 
ATOM   1496  C CE2 . PHE A  1 196 ? -68.000 -12.221  58.511  1.00 34.97 ? 202  PHE A CE2 1 
ATOM   1497  C CZ  . PHE A  1 196 ? -66.652 -12.076  58.780  1.00 33.77 ? 202  PHE A CZ  1 
ATOM   1498  N N   . ALA A  1 197 ? -66.484 -16.744  53.720  1.00 25.14 ? 203  ALA A N   1 
ATOM   1499  C CA  . ALA A  1 197 ? -66.296 -17.999  53.017  1.00 22.14 ? 203  ALA A CA  1 
ATOM   1500  C C   . ALA A  1 197 ? -65.440 -18.931  53.866  1.00 25.51 ? 203  ALA A C   1 
ATOM   1501  O O   . ALA A  1 197 ? -64.727 -18.480  54.769  1.00 25.40 ? 203  ALA A O   1 
ATOM   1502  C CB  . ALA A  1 197 ? -65.647 -17.761  51.665  1.00 18.77 ? 203  ALA A CB  1 
ATOM   1503  N N   . LEU A  1 198 ? -65.510 -20.226  53.581  1.00 24.45 ? 204  LEU A N   1 
ATOM   1504  C CA  . LEU A  1 198 ? -64.644 -21.186  54.253  1.00 23.60 ? 204  LEU A CA  1 
ATOM   1505  C C   . LEU A  1 198 ? -63.424 -21.484  53.392  1.00 23.66 ? 204  LEU A C   1 
ATOM   1506  O O   . LEU A  1 198 ? -63.538 -22.080  52.326  1.00 25.27 ? 204  LEU A O   1 
ATOM   1507  C CB  . LEU A  1 198 ? -65.410 -22.462  54.584  1.00 21.68 ? 204  LEU A CB  1 
ATOM   1508  C CG  . LEU A  1 198 ? -66.357 -22.326  55.782  1.00 22.39 ? 204  LEU A CG  1 
ATOM   1509  C CD1 . LEU A  1 198 ? -67.078 -23.633  56.075  1.00 23.27 ? 204  LEU A CD1 1 
ATOM   1510  C CD2 . LEU A  1 198 ? -65.610 -21.850  57.012  1.00 23.40 ? 204  LEU A CD2 1 
ATOM   1511  N N   . ALA A  1 199 ? -62.261 -21.047  53.871  1.00 23.81 ? 205  ALA A N   1 
ATOM   1512  C CA  . ALA A  1 199 ? -60.998 -21.178  53.142  1.00 21.46 ? 205  ALA A CA  1 
ATOM   1513  C C   . ALA A  1 199 ? -60.172 -22.353  53.662  1.00 21.05 ? 205  ALA A C   1 
ATOM   1514  O O   . ALA A  1 199 ? -59.855 -22.411  54.844  1.00 23.15 ? 205  ALA A O   1 
ATOM   1515  C CB  . ALA A  1 199 ? -60.199 -19.892  53.251  1.00 19.50 ? 205  ALA A CB  1 
ATOM   1516  N N   . SER A  1 200 ? -59.815 -23.273  52.771  1.00 20.23 ? 206  SER A N   1 
ATOM   1517  C CA  . SER A  1 200 ? -59.121 -24.504  53.150  1.00 22.44 ? 206  SER A CA  1 
ATOM   1518  C C   . SER A  1 200 ? -57.728 -24.246  53.726  1.00 19.73 ? 206  SER A C   1 
ATOM   1519  O O   . SER A  1 200 ? -56.951 -23.476  53.167  1.00 19.01 ? 206  SER A O   1 
ATOM   1520  C CB  . SER A  1 200 ? -59.014 -25.435  51.944  1.00 23.51 ? 206  SER A CB  1 
ATOM   1521  O OG  . SER A  1 200 ? -58.543 -26.707  52.343  1.00 27.26 ? 206  SER A OG  1 
ATOM   1522  N N   . MET A  1 201 ? -57.411 -24.902  54.842  1.00 21.38 ? 207  MET A N   1 
ATOM   1523  C CA  . MET A  1 201 ? -56.092 -24.759  55.465  1.00 22.66 ? 207  MET A CA  1 
ATOM   1524  C C   . MET A  1 201 ? -55.068 -25.781  54.967  1.00 20.41 ? 207  MET A C   1 
ATOM   1525  O O   . MET A  1 201 ? -53.903 -25.747  55.366  1.00 23.13 ? 207  MET A O   1 
ATOM   1526  C CB  . MET A  1 201 ? -56.203 -24.878  56.983  1.00 22.06 ? 207  MET A CB  1 
ATOM   1527  C CG  . MET A  1 201 ? -57.133 -23.881  57.598  1.00 17.34 ? 207  MET A CG  1 
ATOM   1528  S SD  . MET A  1 201 ? -57.111 -23.954  59.379  1.00 28.13 ? 207  MET A SD  1 
ATOM   1529  C CE  . MET A  1 201 ? -57.641 -25.601  59.706  1.00 42.26 ? 207  MET A CE  1 
ATOM   1530  N N   . GLY A  1 202 ? -55.492 -26.695  54.106  1.00 18.27 ? 208  GLY A N   1 
ATOM   1531  C CA  . GLY A  1 202 ? -54.614 -27.780  53.704  1.00 22.42 ? 208  GLY A CA  1 
ATOM   1532  C C   . GLY A  1 202 ? -54.402 -28.786  54.826  1.00 20.09 ? 208  GLY A C   1 
ATOM   1533  O O   . GLY A  1 202 ? -53.340 -29.392  54.941  1.00 20.55 ? 208  GLY A O   1 
ATOM   1534  N N   . ILE A  1 203 ? -55.425 -28.946  55.660  1.00 21.10 ? 209  ILE A N   1 
ATOM   1535  C CA  . ILE A  1 203 ? -55.431 -29.931  56.738  1.00 18.79 ? 209  ILE A CA  1 
ATOM   1536  C C   . ILE A  1 203 ? -56.565 -30.918  56.504  1.00 24.65 ? 209  ILE A C   1 
ATOM   1537  O O   . ILE A  1 203 ? -57.711 -30.507  56.324  1.00 23.54 ? 209  ILE A O   1 
ATOM   1538  C CB  . ILE A  1 203 ? -55.602 -29.268  58.124  1.00 19.75 ? 209  ILE A CB  1 
ATOM   1539  C CG1 . ILE A  1 203 ? -54.474 -28.266  58.384  1.00 17.25 ? 209  ILE A CG1 1 
ATOM   1540  C CG2 . ILE A  1 203 ? -55.658 -30.332  59.226  1.00 18.90 ? 209  ILE A CG2 1 
ATOM   1541  C CD1 . ILE A  1 203 ? -54.707 -27.393  59.593  1.00 17.24 ? 209  ILE A CD1 1 
ATOM   1542  N N   . TYR A  1 204 ? -56.239 -32.210  56.488  1.00 25.49 ? 210  TYR A N   1 
ATOM   1543  C CA  . TYR A  1 204 ? -57.210 -33.250  56.168  1.00 24.66 ? 210  TYR A CA  1 
ATOM   1544  C C   . TYR A  1 204 ? -57.158 -34.439  57.118  1.00 22.60 ? 210  TYR A C   1 
ATOM   1545  O O   . TYR A  1 204 ? -56.131 -35.093  57.221  1.00 23.79 ? 210  TYR A O   1 
ATOM   1546  C CB  . TYR A  1 204 ? -57.009 -33.766  54.730  1.00 22.60 ? 210  TYR A CB  1 
ATOM   1547  C CG  . TYR A  1 204 ? -56.778 -32.687  53.704  1.00 21.03 ? 210  TYR A CG  1 
ATOM   1548  C CD1 . TYR A  1 204 ? -57.761 -31.752  53.417  1.00 17.85 ? 210  TYR A CD1 1 
ATOM   1549  C CD2 . TYR A  1 204 ? -55.589 -32.611  53.013  1.00 24.85 ? 210  TYR A CD2 1 
ATOM   1550  C CE1 . TYR A  1 204 ? -57.570 -30.769  52.497  1.00 23.13 ? 210  TYR A CE1 1 
ATOM   1551  C CE2 . TYR A  1 204 ? -55.379 -31.616  52.074  1.00 26.38 ? 210  TYR A CE2 1 
ATOM   1552  C CZ  . TYR A  1 204 ? -56.381 -30.696  51.818  1.00 26.22 ? 210  TYR A CZ  1 
ATOM   1553  O OH  . TYR A  1 204 ? -56.201 -29.699  50.885  1.00 26.71 ? 210  TYR A OH  1 
ATOM   1554  N N   . VAL A  1 205 ? -58.273 -34.723  57.792  1.00 22.40 ? 211  VAL A N   1 
ATOM   1555  C CA  . VAL A  1 205 ? -58.375 -35.870  58.691  1.00 19.65 ? 211  VAL A CA  1 
ATOM   1556  C C   . VAL A  1 205 ? -59.119 -37.035  58.047  1.00 24.14 ? 211  VAL A C   1 
ATOM   1557  O O   . VAL A  1 205 ? -60.242 -36.871  57.573  1.00 24.79 ? 211  VAL A O   1 
ATOM   1558  C CB  . VAL A  1 205 ? -59.088 -35.496  59.996  1.00 18.18 ? 211  VAL A CB  1 
ATOM   1559  C CG1 . VAL A  1 205 ? -59.254 -36.733  60.886  1.00 14.64 ? 211  VAL A CG1 1 
ATOM   1560  C CG2 . VAL A  1 205 ? -58.303 -34.432  60.723  1.00 17.72 ? 211  VAL A CG2 1 
ATOM   1561  N N   . PHE A  1 206 ? -58.469 -38.195  57.992  1.00 23.22 ? 212  PHE A N   1 
ATOM   1562  C CA  . PHE A  1 206 ? -59.052 -39.412  57.430  1.00 20.58 ? 212  PHE A CA  1 
ATOM   1563  C C   . PHE A  1 206 ? -59.047 -40.572  58.433  1.00 22.69 ? 212  PHE A C   1 
ATOM   1564  O O   . PHE A  1 206 ? -58.194 -40.624  59.325  1.00 21.50 ? 212  PHE A O   1 
ATOM   1565  C CB  . PHE A  1 206 ? -58.279 -39.874  56.189  1.00 22.92 ? 212  PHE A CB  1 
ATOM   1566  C CG  . PHE A  1 206 ? -58.258 -38.892  55.046  1.00 23.51 ? 212  PHE A CG  1 
ATOM   1567  C CD1 . PHE A  1 206 ? -57.238 -37.965  54.935  1.00 21.33 ? 212  PHE A CD1 1 
ATOM   1568  C CD2 . PHE A  1 206 ? -59.226 -38.945  54.047  1.00 24.31 ? 212  PHE A CD2 1 
ATOM   1569  C CE1 . PHE A  1 206 ? -57.196 -37.083  53.861  1.00 21.64 ? 212  PHE A CE1 1 
ATOM   1570  C CE2 . PHE A  1 206 ? -59.193 -38.067  52.976  1.00 24.25 ? 212  PHE A CE2 1 
ATOM   1571  C CZ  . PHE A  1 206 ? -58.176 -37.130  52.885  1.00 23.38 ? 212  PHE A CZ  1 
ATOM   1572  N N   . HIS A  1 207 ? -59.972 -41.517  58.271  1.00 22.76 ? 213  HIS A N   1 
ATOM   1573  C CA  . HIS A  1 207 ? -59.724 -42.868  58.764  1.00 25.21 ? 213  HIS A CA  1 
ATOM   1574  C C   . HIS A  1 207 ? -58.579 -43.371  57.903  1.00 24.96 ? 213  HIS A C   1 
ATOM   1575  O O   . HIS A  1 207 ? -58.458 -42.923  56.776  1.00 27.79 ? 213  HIS A O   1 
ATOM   1576  C CB  . HIS A  1 207 ? -60.971 -43.756  58.654  1.00 25.03 ? 213  HIS A CB  1 
ATOM   1577  C CG  . HIS A  1 207 ? -62.019 -43.451  59.685  1.00 21.52 ? 213  HIS A CG  1 
ATOM   1578  N ND1 . HIS A  1 207 ? -61.966 -43.957  60.965  1.00 21.18 ? 213  HIS A ND1 1 
ATOM   1579  C CD2 . HIS A  1 207 ? -63.142 -42.694  59.628  1.00 24.70 ? 213  HIS A CD2 1 
ATOM   1580  C CE1 . HIS A  1 207 ? -63.003 -43.520  61.657  1.00 20.33 ? 213  HIS A CE1 1 
ATOM   1581  N NE2 . HIS A  1 207 ? -63.737 -42.757  60.868  1.00 26.12 ? 213  HIS A NE2 1 
ATOM   1582  N N   . THR A  1 208 ? -57.725 -44.264  58.397  1.00 24.20 ? 214  THR A N   1 
ATOM   1583  C CA  . THR A  1 208 ? -56.522 -44.605  57.643  1.00 22.50 ? 214  THR A CA  1 
ATOM   1584  C C   . THR A  1 208 ? -56.791 -45.546  56.475  1.00 26.41 ? 214  THR A C   1 
ATOM   1585  O O   . THR A  1 208 ? -56.233 -45.367  55.397  1.00 25.42 ? 214  THR A O   1 
ATOM   1586  C CB  . THR A  1 208 ? -55.461 -45.221  58.548  1.00 24.68 ? 214  THR A CB  1 
ATOM   1587  O OG1 . THR A  1 208 ? -55.221 -44.350  59.661  1.00 23.92 ? 214  THR A OG1 1 
ATOM   1588  C CG2 . THR A  1 208 ? -54.146 -45.453  57.793  1.00 24.73 ? 214  THR A CG2 1 
ATOM   1589  N N   . LYS A  1 209 ? -57.734 -46.464  56.629  1.00 30.14 ? 215  LYS A N   1 
ATOM   1590  C CA  . LYS A  1 209 ? -57.983 -47.437  55.570  1.00 32.88 ? 215  LYS A CA  1 
ATOM   1591  C C   . LYS A  1 209 ? -58.704 -46.820  54.355  1.00 31.12 ? 215  LYS A C   1 
ATOM   1592  O O   . LYS A  1 209 ? -58.396 -47.173  53.221  1.00 32.17 ? 215  LYS A O   1 
ATOM   1593  C CB  . LYS A  1 209 ? -58.756 -48.639  56.141  1.00 34.32 ? 215  LYS A CB  1 
ATOM   1594  C CG  . LYS A  1 209 ? -57.874 -49.562  57.026  1.00 52.64 ? 215  LYS A CG  1 
ATOM   1595  C CD  . LYS A  1 209 ? -58.598 -50.826  57.503  1.00 50.00 ? 215  LYS A CD  1 
ATOM   1596  C CE  . LYS A  1 209 ? -59.629 -50.482  58.573  1.00 48.69 ? 215  LYS A CE  1 
ATOM   1597  N NZ  . LYS A  1 209 ? -60.363 -51.667  59.097  1.00 48.51 ? 215  LYS A NZ  1 
ATOM   1598  N N   . PHE A  1 210 ? -59.623 -45.878  54.588  1.00 35.16 ? 216  PHE A N   1 
ATOM   1599  C CA  . PHE A  1 210 ? -60.326 -45.157  53.503  1.00 36.90 ? 216  PHE A CA  1 
ATOM   1600  C C   . PHE A  1 210 ? -59.327 -44.396  52.618  1.00 32.42 ? 216  PHE A C   1 
ATOM   1601  O O   . PHE A  1 210 ? -59.386 -44.464  51.399  1.00 32.92 ? 216  PHE A O   1 
ATOM   1602  C CB  . PHE A  1 210 ? -61.365 -44.139  54.038  1.00 46.33 ? 216  PHE A CB  1 
ATOM   1603  C CG  . PHE A  1 210 ? -62.291 -44.657  55.130  1.00 56.70 ? 216  PHE A CG  1 
ATOM   1604  C CD1 . PHE A  1 210 ? -62.381 -46.012  55.447  1.00 60.17 ? 216  PHE A CD1 1 
ATOM   1605  C CD2 . PHE A  1 210 ? -63.116 -43.764  55.814  1.00 59.60 ? 216  PHE A CD2 1 
ATOM   1606  C CE1 . PHE A  1 210 ? -63.242 -46.457  56.444  1.00 60.00 ? 216  PHE A CE1 1 
ATOM   1607  C CE2 . PHE A  1 210 ? -63.982 -44.208  56.806  1.00 59.86 ? 216  PHE A CE2 1 
ATOM   1608  C CZ  . PHE A  1 210 ? -64.044 -45.554  57.120  1.00 59.26 ? 216  PHE A CZ  1 
ATOM   1609  N N   . LEU A  1 211 ? -58.419 -43.665  53.270  1.00 27.88 ? 217  LEU A N   1 
ATOM   1610  C CA  . LEU A  1 211 ? -57.378 -42.866  52.626  1.00 26.50 ? 217  LEU A CA  1 
ATOM   1611  C C   . LEU A  1 211 ? -56.487 -43.751  51.774  1.00 29.63 ? 217  LEU A C   1 
ATOM   1612  O O   . LEU A  1 211 ? -56.249 -43.452  50.610  1.00 35.41 ? 217  LEU A O   1 
ATOM   1613  C CB  . LEU A  1 211 ? -56.538 -42.119  53.686  1.00 24.67 ? 217  LEU A CB  1 
ATOM   1614  C CG  . LEU A  1 211 ? -55.495 -41.085  53.238  1.00 27.06 ? 217  LEU A CG  1 
ATOM   1615  C CD1 . LEU A  1 211 ? -56.164 -39.985  52.471  1.00 28.66 ? 217  LEU A CD1 1 
ATOM   1616  C CD2 . LEU A  1 211 ? -54.716 -40.490  54.405  1.00 29.91 ? 217  LEU A CD2 1 
ATOM   1617  N N   . MET A  1 212 ? -56.014 -44.850  52.361  1.00 30.79 ? 218  MET A N   1 
ATOM   1618  C CA  . MET A  1 212 ? -55.153 -45.801  51.659  1.00 30.93 ? 218  MET A CA  1 
ATOM   1619  C C   . MET A  1 212 ? -55.757 -46.193  50.313  1.00 36.85 ? 218  MET A C   1 
ATOM   1620  O O   . MET A  1 212 ? -55.092 -46.116  49.281  1.00 40.41 ? 218  MET A O   1 
ATOM   1621  C CB  . MET A  1 212 ? -54.900 -47.044  52.521  1.00 24.48 ? 218  MET A CB  1 
ATOM   1622  C CG  . MET A  1 212 ? -54.055 -46.753  53.740  1.00 24.41 ? 218  MET A CG  1 
ATOM   1623  S SD  . MET A  1 212 ? -52.503 -45.961  53.284  1.00 61.26 ? 218  MET A SD  1 
ATOM   1624  C CE  . MET A  1 212 ? -52.659 -44.403  54.153  1.00 50.20 ? 218  MET A CE  1 
ATOM   1625  N N   . GLU A  1 213 ? -57.028 -46.577  50.323  1.00 40.13 ? 219  GLU A N   1 
ATOM   1626  C CA  . GLU A  1 213 ? -57.730 -46.885  49.081  1.00 42.74 ? 219  GLU A CA  1 
ATOM   1627  C C   . GLU A  1 213 ? -57.866 -45.642  48.207  1.00 36.58 ? 219  GLU A C   1 
ATOM   1628  O O   . GLU A  1 213 ? -57.663 -45.700  46.993  1.00 34.36 ? 219  GLU A O   1 
ATOM   1629  C CB  . GLU A  1 213 ? -59.107 -47.474  49.377  1.00 50.78 ? 219  GLU A CB  1 
ATOM   1630  C CG  . GLU A  1 213 ? -59.769 -48.131  48.182  1.00 60.75 ? 219  GLU A CG  1 
ATOM   1631  C CD  . GLU A  1 213 ? -60.824 -49.140  48.594  1.00 71.32 ? 219  GLU A CD  1 
ATOM   1632  O OE1 . GLU A  1 213 ? -61.313 -49.050  49.742  1.00 74.79 ? 219  GLU A OE1 1 
ATOM   1633  O OE2 . GLU A  1 213 ? -61.167 -50.021  47.773  1.00 74.91 ? 219  GLU A OE2 1 
ATOM   1634  N N   . ALA A  1 214 ? -58.197 -44.521  48.840  1.00 28.50 ? 220  ALA A N   1 
ATOM   1635  C CA  . ALA A  1 214 ? -58.368 -43.264  48.136  1.00 27.68 ? 220  ALA A CA  1 
ATOM   1636  C C   . ALA A  1 214 ? -57.102 -42.842  47.403  1.00 30.90 ? 220  ALA A C   1 
ATOM   1637  O O   . ALA A  1 214 ? -57.174 -42.218  46.349  1.00 32.13 ? 220  ALA A O   1 
ATOM   1638  C CB  . ALA A  1 214 ? -58.801 -42.183  49.099  1.00 29.86 ? 220  ALA A CB  1 
ATOM   1639  N N   . LEU A  1 215 ? -55.939 -43.176  47.947  1.00 29.71 ? 221  LEU A N   1 
ATOM   1640  C CA  . LEU A  1 215 ? -54.693 -42.856  47.260  1.00 27.46 ? 221  LEU A CA  1 
ATOM   1641  C C   . LEU A  1 215 ? -54.260 -43.919  46.278  1.00 26.03 ? 221  LEU A C   1 
ATOM   1642  O O   . LEU A  1 215 ? -53.515 -43.640  45.341  1.00 25.62 ? 221  LEU A O   1 
ATOM   1643  C CB  . LEU A  1 215 ? -53.584 -42.621  48.263  1.00 36.83 ? 221  LEU A CB  1 
ATOM   1644  C CG  . LEU A  1 215 ? -53.751 -41.178  48.681  1.00 46.75 ? 221  LEU A CG  1 
ATOM   1645  C CD1 . LEU A  1 215 ? -54.586 -41.089  49.877  1.00 47.48 ? 221  LEU A CD1 1 
ATOM   1646  C CD2 . LEU A  1 215 ? -52.441 -40.641  48.992  1.00 53.96 ? 221  LEU A CD2 1 
ATOM   1647  N N   . ARG A  1 216 ? -54.715 -45.142  46.505  1.00 33.14 ? 222  ARG A N   1 
ATOM   1648  C CA  . ARG A  1 216 ? -54.483 -46.217  45.557  1.00 35.29 ? 222  ARG A CA  1 
ATOM   1649  C C   . ARG A  1 216 ? -55.260 -45.898  44.296  1.00 41.25 ? 222  ARG A C   1 
ATOM   1650  O O   . ARG A  1 216 ? -54.722 -45.939  43.190  1.00 43.21 ? 222  ARG A O   1 
ATOM   1651  C CB  . ARG A  1 216 ? -54.903 -47.558  46.145  1.00 31.28 ? 222  ARG A CB  1 
ATOM   1652  C CG  . ARG A  1 216 ? -53.847 -48.171  47.041  1.00 36.78 ? 222  ARG A CG  1 
ATOM   1653  C CD  . ARG A  1 216 ? -54.478 -49.090  48.074  1.00 41.91 ? 222  ARG A CD  1 
ATOM   1654  N NE  . ARG A  1 216 ? -53.475 -49.736  48.913  1.00 44.12 ? 222  ARG A NE  1 
ATOM   1655  C CZ  . ARG A  1 216 ? -53.702 -50.186  50.142  1.00 44.53 ? 222  ARG A CZ  1 
ATOM   1656  N NH1 . ARG A  1 216 ? -54.904 -50.052  50.689  1.00 46.33 ? 222  ARG A NH1 1 
ATOM   1657  N NH2 . ARG A  1 216 ? -52.724 -50.764  50.827  1.00 43.38 ? 222  ARG A NH2 1 
ATOM   1658  N N   . ARG A  1 217 ? -56.526 -45.547  44.488  1.00 41.29 ? 223  ARG A N   1 
ATOM   1659  C CA  . ARG A  1 217 ? -57.405 -45.160  43.397  1.00 40.24 ? 223  ARG A CA  1 
ATOM   1660  C C   . ARG A  1 217 ? -56.784 -44.041  42.575  1.00 40.11 ? 223  ARG A C   1 
ATOM   1661  O O   . ARG A  1 217 ? -56.862 -44.040  41.352  1.00 42.26 ? 223  ARG A O   1 
ATOM   1662  C CB  . ARG A  1 217 ? -58.756 -44.717  43.949  1.00 39.03 ? 223  ARG A CB  1 
ATOM   1663  C CG  . ARG A  1 217 ? -59.861 -44.636  42.921  1.00 44.03 ? 223  ARG A CG  1 
ATOM   1664  C CD  . ARG A  1 217 ? -61.122 -44.106  43.573  1.00 46.11 ? 223  ARG A CD  1 
ATOM   1665  N NE  . ARG A  1 217 ? -61.392 -44.783  44.840  1.00 49.25 ? 223  ARG A NE  1 
ATOM   1666  C CZ  . ARG A  1 217 ? -61.716 -44.152  45.963  1.00 50.57 ? 223  ARG A CZ  1 
ATOM   1667  N NH1 . ARG A  1 217 ? -61.777 -42.833  45.972  1.00 50.07 ? 223  ARG A NH1 1 
ATOM   1668  N NH2 . ARG A  1 217 ? -61.950 -44.829  47.078  1.00 52.35 ? 223  ARG A NH2 1 
ATOM   1669  N N   . ASP A  1 218 ? -56.155 -43.098  43.267  1.00 40.24 ? 224  ASP A N   1 
ATOM   1670  C CA  . ASP A  1 218 ? -55.569 -41.921  42.640  1.00 34.33 ? 224  ASP A CA  1 
ATOM   1671  C C   . ASP A  1 218 ? -54.322 -42.281  41.845  1.00 31.25 ? 224  ASP A C   1 
ATOM   1672  O O   . ASP A  1 218 ? -54.037 -41.680  40.809  1.00 32.41 ? 224  ASP A O   1 
ATOM   1673  C CB  . ASP A  1 218 ? -55.237 -40.874  43.702  1.00 36.15 ? 224  ASP A CB  1 
ATOM   1674  C CG  . ASP A  1 218 ? -54.814 -39.554  43.106  1.00 36.10 ? 224  ASP A CG  1 
ATOM   1675  O OD1 . ASP A  1 218 ? -55.698 -38.809  42.630  1.00 29.92 ? 224  ASP A OD1 1 
ATOM   1676  O OD2 . ASP A  1 218 ? -53.597 -39.264  43.112  1.00 37.87 ? 224  ASP A OD2 1 
ATOM   1677  N N   . ALA A  1 219 ? -53.583 -43.269  42.333  1.00 31.02 ? 225  ALA A N   1 
ATOM   1678  C CA  . ALA A  1 219 ? -52.383 -43.726  41.644  1.00 35.39 ? 225  ALA A CA  1 
ATOM   1679  C C   . ALA A  1 219 ? -52.744 -44.343  40.297  1.00 42.45 ? 225  ALA A C   1 
ATOM   1680  O O   . ALA A  1 219 ? -52.006 -44.197  39.321  1.00 42.78 ? 225  ALA A O   1 
ATOM   1681  C CB  . ALA A  1 219 ? -51.628 -44.723  42.495  1.00 30.83 ? 225  ALA A CB  1 
ATOM   1682  N N   . ALA A  1 220 ? -53.889 -45.023  40.261  1.00 47.57 ? 226  ALA A N   1 
ATOM   1683  C CA  . ALA A  1 220 ? -54.370 -45.719  39.065  1.00 47.89 ? 226  ALA A CA  1 
ATOM   1684  C C   . ALA A  1 220 ? -54.921 -44.777  37.993  1.00 51.34 ? 226  ALA A C   1 
ATOM   1685  O O   . ALA A  1 220 ? -54.779 -45.035  36.796  1.00 54.97 ? 226  ALA A O   1 
ATOM   1686  C CB  . ALA A  1 220 ? -55.436 -46.728  39.455  1.00 45.90 ? 226  ALA A CB  1 
ATOM   1687  N N   . ASP A  1 221 ? -55.549 -43.688  38.427  1.00 50.83 ? 227  ASP A N   1 
ATOM   1688  C CA  . ASP A  1 221 ? -56.233 -42.777  37.513  1.00 48.98 ? 227  ASP A CA  1 
ATOM   1689  C C   . ASP A  1 221 ? -55.312 -41.798  36.784  1.00 46.43 ? 227  ASP A C   1 
ATOM   1690  O O   . ASP A  1 221 ? -54.675 -40.947  37.403  1.00 43.53 ? 227  ASP A O   1 
ATOM   1691  C CB  . ASP A  1 221 ? -57.300 -41.988  38.263  1.00 50.40 ? 227  ASP A CB  1 
ATOM   1692  C CG  . ASP A  1 221 ? -57.827 -40.826  37.456  1.00 56.57 ? 227  ASP A CG  1 
ATOM   1693  O OD1 . ASP A  1 221 ? -58.727 -41.038  36.618  1.00 60.02 ? 227  ASP A OD1 1 
ATOM   1694  O OD2 . ASP A  1 221 ? -57.337 -39.697  37.655  1.00 59.70 ? 227  ASP A OD2 1 
ATOM   1695  N N   . PRO A  1 222 ? -55.274 -41.904  35.449  1.00 45.10 ? 228  PRO A N   1 
ATOM   1696  C CA  . PRO A  1 222 ? -54.478 -41.091  34.522  1.00 39.53 ? 228  PRO A CA  1 
ATOM   1697  C C   . PRO A  1 222 ? -54.793 -39.602  34.587  1.00 35.65 ? 228  PRO A C   1 
ATOM   1698  O O   . PRO A  1 222 ? -53.920 -38.774  34.317  1.00 32.88 ? 228  PRO A O   1 
ATOM   1699  C CB  . PRO A  1 222 ? -54.863 -41.652  33.151  1.00 44.26 ? 228  PRO A CB  1 
ATOM   1700  C CG  . PRO A  1 222 ? -56.171 -42.345  33.370  1.00 47.88 ? 228  PRO A CG  1 
ATOM   1701  C CD  . PRO A  1 222 ? -56.073 -42.914  34.739  1.00 45.96 ? 228  PRO A CD  1 
ATOM   1702  N N   . THR A  1 223 ? -56.037 -39.277  34.924  1.00 38.04 ? 229  THR A N   1 
ATOM   1703  C CA  . THR A  1 223 ? -56.523 -37.896  34.976  1.00 39.65 ? 229  THR A CA  1 
ATOM   1704  C C   . THR A  1 223 ? -55.856 -37.115  36.100  1.00 39.92 ? 229  THR A C   1 
ATOM   1705  O O   . THR A  1 223 ? -55.615 -35.913  35.992  1.00 37.54 ? 229  THR A O   1 
ATOM   1706  C CB  . THR A  1 223 ? -58.070 -37.865  35.167  1.00 54.65 ? 229  THR A CB  1 
ATOM   1707  O OG1 . THR A  1 223 ? -58.719 -37.984  33.894  1.00 56.10 ? 229  THR A OG1 1 
ATOM   1708  C CG2 . THR A  1 223 ? -58.531 -36.577  35.843  1.00 54.54 ? 229  THR A CG2 1 
ATOM   1709  N N   . SER A  1 224 ? -55.521 -37.828  37.167  1.00 41.32 ? 230  SER A N   1 
ATOM   1710  C CA  . SER A  1 224 ? -55.162 -37.199  38.430  1.00 36.02 ? 230  SER A CA  1 
ATOM   1711  C C   . SER A  1 224 ? -53.827 -36.467  38.436  1.00 30.48 ? 230  SER A C   1 
ATOM   1712  O O   . SER A  1 224 ? -52.798 -37.019  38.048  1.00 26.48 ? 230  SER A O   1 
ATOM   1713  C CB  . SER A  1 224 ? -55.154 -38.248  39.537  1.00 36.56 ? 230  SER A CB  1 
ATOM   1714  O OG  . SER A  1 224 ? -55.110 -37.620  40.803  1.00 38.33 ? 230  SER A OG  1 
ATOM   1715  N N   . SER A  1 225 ? -53.865 -35.221  38.907  1.00 35.30 ? 231  SER A N   1 
ATOM   1716  C CA  . SER A  1 225 ? -52.664 -34.426  39.174  1.00 40.92 ? 231  SER A CA  1 
ATOM   1717  C C   . SER A  1 225 ? -51.989 -34.846  40.490  1.00 39.39 ? 231  SER A C   1 
ATOM   1718  O O   . SER A  1 225 ? -50.994 -34.248  40.911  1.00 34.75 ? 231  SER A O   1 
ATOM   1719  C CB  . SER A  1 225 ? -53.016 -32.937  39.216  1.00 44.99 ? 231  SER A CB  1 
ATOM   1720  O OG  . SER A  1 225 ? -51.907 -32.153  39.621  1.00 47.70 ? 231  SER A OG  1 
ATOM   1721  N N   . ARG A  1 226 ? -52.555 -35.871  41.127  1.00 38.78 ? 232  ARG A N   1 
ATOM   1722  C CA  . ARG A  1 226 ? -51.989 -36.507  42.318  1.00 32.75 ? 232  ARG A CA  1 
ATOM   1723  C C   . ARG A  1 226 ? -51.879 -35.573  43.529  1.00 34.43 ? 232  ARG A C   1 
ATOM   1724  O O   . ARG A  1 226 ? -50.959 -35.714  44.330  1.00 36.13 ? 232  ARG A O   1 
ATOM   1725  C CB  . ARG A  1 226 ? -50.608 -37.090  41.997  1.00 32.47 ? 232  ARG A CB  1 
ATOM   1726  C CG  . ARG A  1 226 ? -50.533 -37.912  40.717  1.00 31.46 ? 232  ARG A CG  1 
ATOM   1727  C CD  . ARG A  1 226 ? -51.382 -39.165  40.800  1.00 31.97 ? 232  ARG A CD  1 
ATOM   1728  N NE  . ARG A  1 226 ? -51.170 -39.901  42.044  1.00 35.26 ? 232  ARG A NE  1 
ATOM   1729  C CZ  . ARG A  1 226 ? -50.167 -40.748  42.260  1.00 33.42 ? 232  ARG A CZ  1 
ATOM   1730  N NH1 . ARG A  1 226 ? -49.266 -40.974  41.315  1.00 34.72 ? 232  ARG A NH1 1 
ATOM   1731  N NH2 . ARG A  1 226 ? -50.063 -41.367  43.429  1.00 30.97 ? 232  ARG A NH2 1 
ATOM   1732  N N   . ASP A  1 227 ? -52.816 -34.634  43.662  1.00 34.31 ? 233  ASP A N   1 
ATOM   1733  C CA  . ASP A  1 227 ? -52.850 -33.696  44.790  1.00 35.09 ? 233  ASP A CA  1 
ATOM   1734  C C   . ASP A  1 227 ? -54.054 -33.944  45.691  1.00 33.79 ? 233  ASP A C   1 
ATOM   1735  O O   . ASP A  1 227 ? -55.076 -34.442  45.234  1.00 35.24 ? 233  ASP A O   1 
ATOM   1736  C CB  . ASP A  1 227 ? -52.889 -32.243  44.294  1.00 38.43 ? 233  ASP A CB  1 
ATOM   1737  C CG  . ASP A  1 227 ? -51.507 -31.614  44.189  1.00 47.47 ? 233  ASP A CG  1 
ATOM   1738  O OD1 . ASP A  1 227 ? -50.511 -32.360  44.079  1.00 48.21 ? 233  ASP A OD1 1 
ATOM   1739  O OD2 . ASP A  1 227 ? -51.418 -30.366  44.222  1.00 50.29 ? 233  ASP A OD2 1 
ATOM   1740  N N   . PHE A  1 228 ? -53.953 -33.585  46.967  1.00 28.70 ? 234  PHE A N   1 
ATOM   1741  C CA  . PHE A  1 228 ? -55.128 -33.661  47.835  1.00 27.94 ? 234  PHE A CA  1 
ATOM   1742  C C   . PHE A  1 228 ? -56.169 -32.609  47.452  1.00 29.18 ? 234  PHE A C   1 
ATOM   1743  O O   . PHE A  1 228 ? -57.355 -32.903  47.359  1.00 30.27 ? 234  PHE A O   1 
ATOM   1744  C CB  . PHE A  1 228 ? -54.740 -33.495  49.310  1.00 26.62 ? 234  PHE A CB  1 
ATOM   1745  C CG  . PHE A  1 228 ? -54.169 -34.737  49.931  1.00 23.65 ? 234  PHE A CG  1 
ATOM   1746  C CD1 . PHE A  1 228 ? -54.999 -35.675  50.517  1.00 26.86 ? 234  PHE A CD1 1 
ATOM   1747  C CD2 . PHE A  1 228 ? -52.801 -34.973  49.919  1.00 21.23 ? 234  PHE A CD2 1 
ATOM   1748  C CE1 . PHE A  1 228 ? -54.470 -36.832  51.084  1.00 24.40 ? 234  PHE A CE1 1 
ATOM   1749  C CE2 . PHE A  1 228 ? -52.272 -36.126  50.479  1.00 15.80 ? 234  PHE A CE2 1 
ATOM   1750  C CZ  . PHE A  1 228 ? -53.104 -37.050  51.063  1.00 17.71 ? 234  PHE A CZ  1 
ATOM   1751  N N   . GLY A  1 229 ? -55.708 -31.385  47.222  1.00 30.91 ? 235  GLY A N   1 
ATOM   1752  C CA  . GLY A  1 229 ? -56.588 -30.251  46.990  1.00 34.92 ? 235  GLY A CA  1 
ATOM   1753  C C   . GLY A  1 229 ? -57.448 -30.335  45.742  1.00 37.38 ? 235  GLY A C   1 
ATOM   1754  O O   . GLY A  1 229 ? -58.618 -29.955  45.762  1.00 41.75 ? 235  GLY A O   1 
ATOM   1755  N N   . LYS A  1 230 ? -56.869 -30.842  44.659  1.00 38.39 ? 236  LYS A N   1 
ATOM   1756  C CA  . LYS A  1 230 ? -57.547 -30.880  43.366  1.00 39.71 ? 236  LYS A CA  1 
ATOM   1757  C C   . LYS A  1 230 ? -58.045 -32.263  42.979  1.00 43.66 ? 236  LYS A C   1 
ATOM   1758  O O   . LYS A  1 230 ? -59.049 -32.396  42.292  1.00 48.52 ? 236  LYS A O   1 
ATOM   1759  C CB  . LYS A  1 230 ? -56.613 -30.356  42.272  1.00 42.66 ? 236  LYS A CB  1 
ATOM   1760  C CG  . LYS A  1 230 ? -57.159 -30.477  40.860  1.00 48.00 ? 236  LYS A CG  1 
ATOM   1761  C CD  . LYS A  1 230 ? -57.493 -29.121  40.284  1.00 54.08 ? 236  LYS A CD  1 
ATOM   1762  C CE  . LYS A  1 230 ? -58.244 -29.222  38.972  1.00 56.71 ? 236  LYS A CE  1 
ATOM   1763  N NZ  . LYS A  1 230 ? -59.510 -28.427  38.958  1.00 61.15 ? 236  LYS A NZ  1 
ATOM   1764  N N   . ASP A  1 231 ? -57.342 -33.297  43.415  1.00 40.79 ? 237  ASP A N   1 
ATOM   1765  C CA  . ASP A  1 231 ? -57.681 -34.659  43.007  1.00 38.08 ? 237  ASP A CA  1 
ATOM   1766  C C   . ASP A  1 231 ? -58.423 -35.438  44.090  1.00 36.42 ? 237  ASP A C   1 
ATOM   1767  O O   . ASP A  1 231 ? -59.594 -35.789  43.914  1.00 37.02 ? 237  ASP A O   1 
ATOM   1768  C CB  . ASP A  1 231 ? -56.414 -35.405  42.588  1.00 40.57 ? 237  ASP A CB  1 
ATOM   1769  C CG  . ASP A  1 231 ? -55.669 -34.691  41.476  1.00 46.10 ? 237  ASP A CG  1 
ATOM   1770  O OD1 . ASP A  1 231 ? -56.009 -34.923  40.299  1.00 52.73 ? 237  ASP A OD1 1 
ATOM   1771  O OD2 . ASP A  1 231 ? -54.754 -33.892  41.770  1.00 42.81 ? 237  ASP A OD2 1 
ATOM   1772  N N   . ILE A  1 232 ? -57.756 -35.693  45.211  1.00 29.51 ? 238  ILE A N   1 
ATOM   1773  C CA  . ILE A  1 232 ? -58.372 -36.466  46.277  1.00 27.63 ? 238  ILE A CA  1 
ATOM   1774  C C   . ILE A  1 232 ? -59.672 -35.830  46.766  1.00 30.50 ? 238  ILE A C   1 
ATOM   1775  O O   . ILE A  1 232 ? -60.743 -36.422  46.640  1.00 31.21 ? 238  ILE A O   1 
ATOM   1776  C CB  . ILE A  1 232 ? -57.433 -36.634  47.479  1.00 25.42 ? 238  ILE A CB  1 
ATOM   1777  C CG1 . ILE A  1 232 ? -56.120 -37.288  47.050  1.00 27.23 ? 238  ILE A CG1 1 
ATOM   1778  C CG2 . ILE A  1 232 ? -58.122 -37.462  48.547  1.00 20.76 ? 238  ILE A CG2 1 
ATOM   1779  C CD1 . ILE A  1 232 ? -56.261 -38.751  46.694  1.00 25.78 ? 238  ILE A CD1 1 
ATOM   1780  N N   . ILE A  1 233 ? -59.572 -34.621  47.314  1.00 31.65 ? 239  ILE A N   1 
ATOM   1781  C CA  . ILE A  1 233 ? -60.703 -33.986  47.981  1.00 32.61 ? 239  ILE A CA  1 
ATOM   1782  C C   . ILE A  1 233 ? -61.909 -33.775  47.062  1.00 38.10 ? 239  ILE A C   1 
ATOM   1783  O O   . ILE A  1 233 ? -63.011 -34.196  47.409  1.00 38.97 ? 239  ILE A O   1 
ATOM   1784  C CB  . ILE A  1 233 ? -60.298 -32.635  48.613  1.00 39.90 ? 239  ILE A CB  1 
ATOM   1785  C CG1 . ILE A  1 233 ? -59.390 -32.865  49.825  1.00 44.88 ? 239  ILE A CG1 1 
ATOM   1786  C CG2 . ILE A  1 233 ? -61.529 -31.812  48.985  1.00 41.99 ? 239  ILE A CG2 1 
ATOM   1787  C CD1 . ILE A  1 233 ? -59.950 -33.833  50.838  1.00 45.20 ? 239  ILE A CD1 1 
ATOM   1788  N N   . PRO A  1 234 ? -61.719 -33.138  45.890  1.00 38.60 ? 240  PRO A N   1 
ATOM   1789  C CA  . PRO A  1 234 ? -62.914 -32.892  45.073  1.00 39.19 ? 240  PRO A CA  1 
ATOM   1790  C C   . PRO A  1 234 ? -63.625 -34.177  44.698  1.00 35.37 ? 240  PRO A C   1 
ATOM   1791  O O   . PRO A  1 234 ? -64.859 -34.206  44.669  1.00 31.43 ? 240  PRO A O   1 
ATOM   1792  C CB  . PRO A  1 234 ? -62.350 -32.197  43.834  1.00 39.37 ? 240  PRO A CB  1 
ATOM   1793  C CG  . PRO A  1 234 ? -61.114 -31.539  44.334  1.00 41.02 ? 240  PRO A CG  1 
ATOM   1794  C CD  . PRO A  1 234 ? -60.524 -32.556  45.260  1.00 38.60 ? 240  PRO A CD  1 
ATOM   1795  N N   . TYR A  1 235 ? -62.849 -35.226  44.439  1.00 34.13 ? 241  TYR A N   1 
ATOM   1796  C CA  . TYR A  1 235 ? -63.418 -36.535  44.175  1.00 31.95 ? 241  TYR A CA  1 
ATOM   1797  C C   . TYR A  1 235 ? -64.324 -36.923  45.342  1.00 34.99 ? 241  TYR A C   1 
ATOM   1798  O O   . TYR A  1 235 ? -65.481 -37.272  45.142  1.00 31.08 ? 241  TYR A O   1 
ATOM   1799  C CB  . TYR A  1 235 ? -62.318 -37.576  43.953  1.00 37.60 ? 241  TYR A CB  1 
ATOM   1800  C CG  . TYR A  1 235 ? -62.838 -38.929  43.508  1.00 47.08 ? 241  TYR A CG  1 
ATOM   1801  C CD1 . TYR A  1 235 ? -63.364 -39.830  44.425  1.00 50.42 ? 241  TYR A CD1 1 
ATOM   1802  C CD2 . TYR A  1 235 ? -62.810 -39.304  42.171  1.00 52.29 ? 241  TYR A CD2 1 
ATOM   1803  C CE1 . TYR A  1 235 ? -63.846 -41.061  44.026  1.00 55.75 ? 241  TYR A CE1 1 
ATOM   1804  C CE2 . TYR A  1 235 ? -63.290 -40.539  41.762  1.00 55.91 ? 241  TYR A CE2 1 
ATOM   1805  C CZ  . TYR A  1 235 ? -63.809 -41.412  42.697  1.00 58.42 ? 241  TYR A CZ  1 
ATOM   1806  O OH  . TYR A  1 235 ? -64.290 -42.643  42.307  1.00 61.77 ? 241  TYR A OH  1 
ATOM   1807  N N   . ILE A  1 236 ? -63.804 -36.835  46.564  1.00 36.39 ? 242  ILE A N   1 
ATOM   1808  C CA  . ILE A  1 236 ? -64.598 -37.126  47.755  1.00 34.38 ? 242  ILE A CA  1 
ATOM   1809  C C   . ILE A  1 236 ? -65.817 -36.213  47.833  1.00 32.78 ? 242  ILE A C   1 
ATOM   1810  O O   . ILE A  1 236 ? -66.909 -36.648  48.196  1.00 35.83 ? 242  ILE A O   1 
ATOM   1811  C CB  . ILE A  1 236 ? -63.798 -36.926  49.068  1.00 30.01 ? 242  ILE A CB  1 
ATOM   1812  C CG1 . ILE A  1 236 ? -62.441 -37.624  49.040  1.00 36.57 ? 242  ILE A CG1 1 
ATOM   1813  C CG2 . ILE A  1 236 ? -64.609 -37.417  50.243  1.00 24.37 ? 242  ILE A CG2 1 
ATOM   1814  C CD1 . ILE A  1 236 ? -62.516 -39.032  48.704  1.00 40.82 ? 242  ILE A CD1 1 
ATOM   1815  N N   . VAL A  1 237 ? -65.617 -34.933  47.524  1.00 33.10 ? 243  VAL A N   1 
ATOM   1816  C CA  . VAL A  1 237 ? -66.697 -33.957  47.626  1.00 35.62 ? 243  VAL A CA  1 
ATOM   1817  C C   . VAL A  1 237 ? -67.821 -34.373  46.689  1.00 36.63 ? 243  VAL A C   1 
ATOM   1818  O O   . VAL A  1 237 ? -68.995 -34.329  47.058  1.00 36.91 ? 243  VAL A O   1 
ATOM   1819  C CB  . VAL A  1 237 ? -66.226 -32.520  47.291  1.00 34.16 ? 243  VAL A CB  1 
ATOM   1820  C CG1 . VAL A  1 237 ? -67.394 -31.559  47.340  1.00 34.28 ? 243  VAL A CG1 1 
ATOM   1821  C CG2 . VAL A  1 237 ? -65.154 -32.066  48.263  1.00 34.26 ? 243  VAL A CG2 1 
ATOM   1822  N N   . GLU A  1 238 ? -67.437 -34.836  45.500  1.00 39.88 ? 244  GLU A N   1 
ATOM   1823  C CA  . GLU A  1 238 ? -68.383 -35.193  44.444  1.00 45.24 ? 244  GLU A CA  1 
ATOM   1824  C C   . GLU A  1 238 ? -68.955 -36.611  44.583  1.00 46.38 ? 244  GLU A C   1 
ATOM   1825  O O   . GLU A  1 238 ? -70.084 -36.868  44.171  1.00 47.04 ? 244  GLU A O   1 
ATOM   1826  C CB  . GLU A  1 238 ? -67.709 -35.031  43.073  1.00 48.69 ? 244  GLU A CB  1 
ATOM   1827  C CG  . GLU A  1 238 ? -68.612 -35.293  41.864  1.00 58.02 ? 244  GLU A CG  1 
ATOM   1828  C CD  . GLU A  1 238 ? -69.763 -34.294  41.733  1.00 65.48 ? 244  GLU A CD  1 
ATOM   1829  O OE1 . GLU A  1 238 ? -69.754 -33.251  42.425  1.00 65.68 ? 244  GLU A OE1 1 
ATOM   1830  O OE2 . GLU A  1 238 ? -70.684 -34.555  40.926  1.00 68.94 ? 244  GLU A OE2 1 
ATOM   1831  N N   . HIS A  1 239 ? -68.190 -37.529  45.167  1.00 47.13 ? 245  HIS A N   1 
ATOM   1832  C CA  . HIS A  1 239 ? -68.618 -38.928  45.216  1.00 43.98 ? 245  HIS A CA  1 
ATOM   1833  C C   . HIS A  1 239 ? -68.794 -39.469  46.629  1.00 38.32 ? 245  HIS A C   1 
ATOM   1834  O O   . HIS A  1 239 ? -69.260 -40.587  46.806  1.00 38.42 ? 245  HIS A O   1 
ATOM   1835  C CB  . HIS A  1 239 ? -67.624 -39.817  44.462  1.00 46.01 ? 245  HIS A CB  1 
ATOM   1836  C CG  . HIS A  1 239 ? -67.384 -39.394  43.046  1.00 48.95 ? 245  HIS A CG  1 
ATOM   1837  N ND1 . HIS A  1 239 ? -66.132 -39.075  42.569  1.00 51.21 ? 245  HIS A ND1 1 
ATOM   1838  C CD2 . HIS A  1 239 ? -68.239 -39.219  42.010  1.00 50.95 ? 245  HIS A CD2 1 
ATOM   1839  C CE1 . HIS A  1 239 ? -66.222 -38.732  41.296  1.00 54.47 ? 245  HIS A CE1 1 
ATOM   1840  N NE2 . HIS A  1 239 ? -67.490 -38.810  40.932  1.00 53.98 ? 245  HIS A NE2 1 
ATOM   1841  N N   . GLY A  1 240 ? -68.419 -38.688  47.634  1.00 39.27 ? 246  GLY A N   1 
ATOM   1842  C CA  . GLY A  1 240 ? -68.492 -39.158  49.007  1.00 38.26 ? 246  GLY A CA  1 
ATOM   1843  C C   . GLY A  1 240 ? -68.894 -38.074  49.988  1.00 36.11 ? 246  GLY A C   1 
ATOM   1844  O O   . GLY A  1 240 ? -69.492 -37.069  49.595  1.00 30.27 ? 246  GLY A O   1 
ATOM   1845  N N   . LYS A  1 241 ? -68.552 -38.269  51.261  1.00 31.60 ? 247  LYS A N   1 
ATOM   1846  C CA  . LYS A  1 241 ? -68.982 -37.352  52.307  1.00 29.23 ? 247  LYS A CA  1 
ATOM   1847  C C   . LYS A  1 241 ? -67.837 -36.503  52.865  1.00 30.40 ? 247  LYS A C   1 
ATOM   1848  O O   . LYS A  1 241 ? -66.964 -36.997  53.585  1.00 28.99 ? 247  LYS A O   1 
ATOM   1849  C CB  . LYS A  1 241 ? -69.667 -38.132  53.434  1.00 32.33 ? 247  LYS A CB  1 
ATOM   1850  C CG  . LYS A  1 241 ? -69.876 -37.320  54.703  1.00 38.23 ? 247  LYS A CG  1 
ATOM   1851  C CD  . LYS A  1 241 ? -71.340 -37.189  55.076  1.00 40.71 ? 247  LYS A CD  1 
ATOM   1852  C CE  . LYS A  1 241 ? -71.510 -36.193  56.211  1.00 40.83 ? 247  LYS A CE  1 
ATOM   1853  N NZ  . LYS A  1 241 ? -72.941 -35.940  56.516  1.00 43.35 ? 247  LYS A NZ  1 
ATOM   1854  N N   . ALA A  1 242 ? -67.855 -35.216  52.524  1.00 28.83 ? 248  ALA A N   1 
ATOM   1855  C CA  . ALA A  1 242 ? -66.846 -34.271  52.992  1.00 26.63 ? 248  ALA A CA  1 
ATOM   1856  C C   . ALA A  1 242 ? -67.463 -33.290  53.978  1.00 28.71 ? 248  ALA A C   1 
ATOM   1857  O O   . ALA A  1 242 ? -68.576 -32.821  53.769  1.00 31.25 ? 248  ALA A O   1 
ATOM   1858  C CB  . ALA A  1 242 ? -66.223 -33.529  51.816  1.00 23.40 ? 248  ALA A CB  1 
ATOM   1859  N N   . VAL A  1 243 ? -66.744 -32.983  55.054  1.00 27.08 ? 249  VAL A N   1 
ATOM   1860  C CA  . VAL A  1 243 ? -67.267 -32.094  56.087  1.00 25.91 ? 249  VAL A CA  1 
ATOM   1861  C C   . VAL A  1 243 ? -66.216 -31.062  56.513  1.00 27.74 ? 249  VAL A C   1 
ATOM   1862  O O   . VAL A  1 243 ? -65.022 -31.356  56.550  1.00 31.11 ? 249  VAL A O   1 
ATOM   1863  C CB  . VAL A  1 243 ? -67.758 -32.908  57.315  1.00 30.78 ? 249  VAL A CB  1 
ATOM   1864  C CG1 . VAL A  1 243 ? -68.130 -32.003  58.467  1.00 34.14 ? 249  VAL A CG1 1 
ATOM   1865  C CG2 . VAL A  1 243 ? -68.950 -33.778  56.937  1.00 30.59 ? 249  VAL A CG2 1 
ATOM   1866  N N   . ALA A  1 244 ? -66.668 -29.848  56.815  1.00 25.95 ? 250  ALA A N   1 
ATOM   1867  C CA  . ALA A  1 244 ? -65.783 -28.761  57.219  1.00 27.16 ? 250  ALA A CA  1 
ATOM   1868  C C   . ALA A  1 244 ? -65.579 -28.674  58.723  1.00 24.12 ? 250  ALA A C   1 
ATOM   1869  O O   . ALA A  1 244 ? -66.520 -28.799  59.502  1.00 27.92 ? 250  ALA A O   1 
ATOM   1870  C CB  . ALA A  1 244 ? -66.324 -27.431  56.706  1.00 27.44 ? 250  ALA A CB  1 
ATOM   1871  N N   . HIS A  1 245 ? -64.340 -28.433  59.126  1.00 16.32 ? 251  HIS A N   1 
ATOM   1872  C CA  . HIS A  1 245 ? -64.052 -28.100  60.496  1.00 15.65 ? 251  HIS A CA  1 
ATOM   1873  C C   . HIS A  1 245 ? -63.546 -26.674  60.538  1.00 18.23 ? 251  HIS A C   1 
ATOM   1874  O O   . HIS A  1 245 ? -62.676 -26.300  59.766  1.00 18.67 ? 251  HIS A O   1 
ATOM   1875  C CB  . HIS A  1 245 ? -63.015 -29.060  61.087  1.00 17.16 ? 251  HIS A CB  1 
ATOM   1876  C CG  . HIS A  1 245 ? -62.593 -28.703  62.474  1.00 13.36 ? 251  HIS A CG  1 
ATOM   1877  N ND1 . HIS A  1 245 ? -63.295 -29.103  63.588  1.00 13.10 ? 251  HIS A ND1 1 
ATOM   1878  C CD2 . HIS A  1 245 ? -61.560 -27.956  62.927  1.00 13.05 ? 251  HIS A CD2 1 
ATOM   1879  C CE1 . HIS A  1 245 ? -62.710 -28.624  64.668  1.00 13.50 ? 251  HIS A CE1 1 
ATOM   1880  N NE2 . HIS A  1 245 ? -61.655 -27.922  64.295  1.00 12.99 ? 251  HIS A NE2 1 
ATOM   1881  N N   . ARG A  1 246 ? -64.084 -25.871  61.440  1.00 21.82 ? 252  ARG A N   1 
ATOM   1882  C CA  . ARG A  1 246 ? -63.700 -24.467  61.491  1.00 23.90 ? 252  ARG A CA  1 
ATOM   1883  C C   . ARG A  1 246 ? -62.571 -24.213  62.481  1.00 24.94 ? 252  ARG A C   1 
ATOM   1884  O O   . ARG A  1 246 ? -62.660 -24.586  63.655  1.00 23.12 ? 252  ARG A O   1 
ATOM   1885  C CB  . ARG A  1 246 ? -64.909 -23.601  61.842  1.00 26.69 ? 252  ARG A CB  1 
ATOM   1886  C CG  . ARG A  1 246 ? -66.119 -23.869  60.958  1.00 20.20 ? 252  ARG A CG  1 
ATOM   1887  C CD  . ARG A  1 246 ? -66.804 -22.583  60.577  1.00 26.14 ? 252  ARG A CD  1 
ATOM   1888  N NE  . ARG A  1 246 ? -68.084 -22.823  59.920  1.00 26.87 ? 252  ARG A NE  1 
ATOM   1889  C CZ  . ARG A  1 246 ? -69.147 -22.032  60.040  1.00 32.06 ? 252  ARG A CZ  1 
ATOM   1890  N NH1 . ARG A  1 246 ? -69.081 -20.939  60.791  1.00 31.43 ? 252  ARG A NH1 1 
ATOM   1891  N NH2 . ARG A  1 246 ? -70.276 -22.330  59.404  1.00 29.96 ? 252  ARG A NH2 1 
ATOM   1892  N N   . PHE A  1 247 ? -61.518 -23.561  61.990  1.00 24.22 ? 253  PHE A N   1 
ATOM   1893  C CA  . PHE A  1 247 ? -60.319 -23.251  62.771  1.00 20.70 ? 253  PHE A CA  1 
ATOM   1894  C C   . PHE A  1 247 ? -60.636 -22.584  64.103  1.00 20.23 ? 253  PHE A C   1 
ATOM   1895  O O   . PHE A  1 247 ? -59.976 -22.843  65.103  1.00 24.47 ? 253  PHE A O   1 
ATOM   1896  C CB  . PHE A  1 247 ? -59.376 -22.363  61.942  1.00 18.36 ? 253  PHE A CB  1 
ATOM   1897  C CG  . PHE A  1 247 ? -58.118 -21.927  62.676  1.00 18.66 ? 253  PHE A CG  1 
ATOM   1898  C CD1 . PHE A  1 247 ? -57.251 -22.859  63.222  1.00 19.51 ? 253  PHE A CD1 1 
ATOM   1899  C CD2 . PHE A  1 247 ? -57.784 -20.583  62.774  1.00 18.55 ? 253  PHE A CD2 1 
ATOM   1900  C CE1 . PHE A  1 247 ? -56.097 -22.460  63.875  1.00 15.26 ? 253  PHE A CE1 1 
ATOM   1901  C CE2 . PHE A  1 247 ? -56.632 -20.183  63.419  1.00 15.43 ? 253  PHE A CE2 1 
ATOM   1902  C CZ  . PHE A  1 247 ? -55.790 -21.126  63.974  1.00 12.94 ? 253  PHE A CZ  1 
ATOM   1903  N N   . ALA A  1 248 ? -61.655 -21.738  64.127  1.00 18.74 ? 254  ALA A N   1 
ATOM   1904  C CA  . ALA A  1 248 ? -62.027 -21.082  65.371  1.00 21.34 ? 254  ALA A CA  1 
ATOM   1905  C C   . ALA A  1 248 ? -62.402 -22.092  66.457  1.00 18.37 ? 254  ALA A C   1 
ATOM   1906  O O   . ALA A  1 248 ? -62.284 -21.793  67.635  1.00 21.82 ? 254  ALA A O   1 
ATOM   1907  C CB  . ALA A  1 248 ? -63.172 -20.116  65.137  1.00 26.39 ? 254  ALA A CB  1 
ATOM   1908  N N   . ASP A  1 249 ? -62.848 -23.282  66.058  1.00 18.25 ? 255  ASP A N   1 
ATOM   1909  C CA  . ASP A  1 249 ? -63.256 -24.314  67.009  1.00 19.38 ? 255  ASP A CA  1 
ATOM   1910  C C   . ASP A  1 249 ? -62.070 -25.047  67.667  1.00 24.75 ? 255  ASP A C   1 
ATOM   1911  O O   . ASP A  1 249 ? -62.221 -25.611  68.750  1.00 24.95 ? 255  ASP A O   1 
ATOM   1912  C CB  . ASP A  1 249 ? -64.156 -25.345  66.320  1.00 22.90 ? 255  ASP A CB  1 
ATOM   1913  C CG  . ASP A  1 249 ? -65.386 -24.722  65.673  1.00 36.20 ? 255  ASP A CG  1 
ATOM   1914  O OD1 . ASP A  1 249 ? -66.007 -23.821  66.280  1.00 37.21 ? 255  ASP A OD1 1 
ATOM   1915  O OD2 . ASP A  1 249 ? -65.741 -25.153  64.556  1.00 43.90 ? 255  ASP A OD2 1 
ATOM   1916  N N   . SER A  1 250 ? -60.906 -25.031  67.014  1.00 22.71 ? 256  SER A N   1 
ATOM   1917  C CA  . SER A  1 250 ? -59.748 -25.829  67.424  1.00 22.69 ? 256  SER A CA  1 
ATOM   1918  C C   . SER A  1 250 ? -58.547 -24.989  67.788  1.00 21.30 ? 256  SER A C   1 
ATOM   1919  O O   . SER A  1 250 ? -57.606 -25.466  68.420  1.00 16.99 ? 256  SER A O   1 
ATOM   1920  C CB  . SER A  1 250 ? -59.326 -26.741  66.289  1.00 29.00 ? 256  SER A CB  1 
ATOM   1921  O OG  . SER A  1 250 ? -60.396 -27.541  65.891  1.00 42.53 ? 256  SER A OG  1 
ATOM   1922  N N   . CYS A  1 251 ? -58.549 -23.755  67.307  1.00 22.21 ? 257  CYS A N   1 
ATOM   1923  C CA  . CYS A  1 251 ? -57.413 -22.862  67.476  1.00 23.62 ? 257  CYS A CA  1 
ATOM   1924  C C   . CYS A  1 251 ? -57.019 -22.733  68.923  1.00 22.41 ? 257  CYS A C   1 
ATOM   1925  O O   . CYS A  1 251 ? -57.864 -22.536  69.790  1.00 21.56 ? 257  CYS A O   1 
ATOM   1926  C CB  . CYS A  1 251 ? -57.727 -21.480  66.919  1.00 26.37 ? 257  CYS A CB  1 
ATOM   1927  S SG  . CYS A  1 251 ? -56.424 -20.305  67.278  1.00 27.53 ? 257  CYS A SG  1 
ATOM   1928  N N   . VAL A  1 252 ? -55.729 -22.859  69.189  1.00 20.55 ? 258  VAL A N   1 
ATOM   1929  C CA  . VAL A  1 252 ? -55.237 -22.644  70.534  1.00 20.30 ? 258  VAL A CA  1 
ATOM   1930  C C   . VAL A  1 252 ? -54.761 -21.206  70.644  1.00 26.88 ? 258  VAL A C   1 
ATOM   1931  O O   . VAL A  1 252 ? -53.633 -20.891  70.287  1.00 30.65 ? 258  VAL A O   1 
ATOM   1932  C CB  . VAL A  1 252 ? -54.093 -23.604  70.881  1.00 17.84 ? 258  VAL A CB  1 
ATOM   1933  C CG1 . VAL A  1 252 ? -53.693 -23.435  72.327  1.00 22.66 ? 258  VAL A CG1 1 
ATOM   1934  C CG2 . VAL A  1 252 ? -54.507 -25.038  70.597  1.00 17.77 ? 258  VAL A CG2 1 
ATOM   1935  N N   . ARG A  1 253 ? -55.625 -20.316  71.112  1.00 29.20 ? 259  ARG A N   1 
ATOM   1936  C CA  . ARG A  1 253 ? -55.216 -18.928  71.208  1.00 29.97 ? 259  ARG A CA  1 
ATOM   1937  C C   . ARG A  1 253 ? -55.017 -18.570  72.658  1.00 33.97 ? 259  ARG A C   1 
ATOM   1938  O O   . ARG A  1 253 ? -55.782 -18.983  73.531  1.00 40.19 ? 259  ARG A O   1 
ATOM   1939  C CB  . ARG A  1 253 ? -56.226 -17.985  70.535  1.00 29.29 ? 259  ARG A CB  1 
ATOM   1940  C CG  . ARG A  1 253 ? -57.456 -17.660  71.335  1.00 35.52 ? 259  ARG A CG  1 
ATOM   1941  C CD  . ARG A  1 253 ? -58.319 -16.628  70.629  1.00 43.87 ? 259  ARG A CD  1 
ATOM   1942  N NE  . ARG A  1 253 ? -58.758 -17.099  69.320  1.00 51.12 ? 259  ARG A NE  1 
ATOM   1943  C CZ  . ARG A  1 253 ? -59.855 -17.824  69.112  1.00 53.46 ? 259  ARG A CZ  1 
ATOM   1944  N NH1 . ARG A  1 253 ? -60.633 -18.172  70.129  1.00 49.31 ? 259  ARG A NH1 1 
ATOM   1945  N NH2 . ARG A  1 253 ? -60.177 -18.210  67.883  1.00 56.40 ? 259  ARG A NH2 1 
ATOM   1946  N N   . SER A  1 254 ? -53.945 -17.835  72.909  1.00 31.88 ? 260  SER A N   1 
ATOM   1947  C CA  . SER A  1 254 ? -53.665 -17.299  74.227  1.00 34.72 ? 260  SER A CA  1 
ATOM   1948  C C   . SER A  1 254 ? -54.730 -16.256  74.560  1.00 34.50 ? 260  SER A C   1 
ATOM   1949  O O   . SER A  1 254 ? -55.363 -15.709  73.656  1.00 31.52 ? 260  SER A O   1 
ATOM   1950  C CB  . SER A  1 254 ? -52.257 -16.700  74.246  1.00 35.94 ? 260  SER A CB  1 
ATOM   1951  O OG  . SER A  1 254 ? -51.931 -16.111  75.482  1.00 39.43 ? 260  SER A OG  1 
ATOM   1952  N N   . ASP A  1 255 ? -54.948 -15.991  75.847  1.00 37.73 ? 261  ASP A N   1 
ATOM   1953  C CA  . ASP A  1 255 ? -55.813 -14.880  76.246  1.00 38.15 ? 261  ASP A CA  1 
ATOM   1954  C C   . ASP A  1 255 ? -55.289 -13.573  75.666  1.00 39.83 ? 261  ASP A C   1 
ATOM   1955  O O   . ASP A  1 255 ? -56.038 -12.609  75.491  1.00 40.03 ? 261  ASP A O   1 
ATOM   1956  C CB  . ASP A  1 255 ? -55.905 -14.758  77.765  1.00 37.08 ? 261  ASP A CB  1 
ATOM   1957  C CG  . ASP A  1 255 ? -56.813 -15.793  78.378  1.00 43.30 ? 261  ASP A CG  1 
ATOM   1958  O OD1 . ASP A  1 255 ? -57.609 -16.399  77.629  1.00 46.13 ? 261  ASP A OD1 1 
ATOM   1959  O OD2 . ASP A  1 255 ? -56.740 -15.992  79.611  1.00 44.63 ? 261  ASP A OD2 1 
ATOM   1960  N N   . PHE A  1 256 ? -53.993 -13.562  75.366  1.00 34.95 ? 262  PHE A N   1 
ATOM   1961  C CA  . PHE A  1 256 ? -53.297 -12.369  74.910  1.00 29.31 ? 262  PHE A CA  1 
ATOM   1962  C C   . PHE A  1 256 ? -53.174 -12.345  73.395  1.00 30.58 ? 262  PHE A C   1 
ATOM   1963  O O   . PHE A  1 256 ? -52.382 -11.591  72.828  1.00 31.18 ? 262  PHE A O   1 
ATOM   1964  C CB  . PHE A  1 256 ? -51.936 -12.303  75.581  1.00 26.26 ? 262  PHE A CB  1 
ATOM   1965  C CG  . PHE A  1 256 ? -52.009 -12.519  77.062  1.00 28.37 ? 262  PHE A CG  1 
ATOM   1966  C CD1 . PHE A  1 256 ? -52.238 -11.457  77.912  1.00 25.26 ? 262  PHE A CD1 1 
ATOM   1967  C CD2 . PHE A  1 256 ? -51.889 -13.788  77.599  1.00 30.09 ? 262  PHE A CD2 1 
ATOM   1968  C CE1 . PHE A  1 256 ? -52.324 -11.652  79.271  1.00 28.01 ? 262  PHE A CE1 1 
ATOM   1969  C CE2 . PHE A  1 256 ? -51.974 -13.993  78.960  1.00 31.98 ? 262  PHE A CE2 1 
ATOM   1970  C CZ  . PHE A  1 256 ? -52.192 -12.924  79.797  1.00 32.81 ? 262  PHE A CZ  1 
ATOM   1971  N N   . GLU A  1 257 ? -53.980 -13.177  72.747  1.00 31.19 ? 263  GLU A N   1 
ATOM   1972  C CA  . GLU A  1 257 ? -54.107 -13.158  71.300  1.00 30.26 ? 263  GLU A CA  1 
ATOM   1973  C C   . GLU A  1 257 ? -55.538 -12.768  70.938  1.00 34.48 ? 263  GLU A C   1 
ATOM   1974  O O   . GLU A  1 257 ? -56.474 -13.531  71.174  1.00 38.66 ? 263  GLU A O   1 
ATOM   1975  C CB  . GLU A  1 257 ? -53.720 -14.518  70.719  1.00 29.21 ? 263  GLU A CB  1 
ATOM   1976  C CG  . GLU A  1 257 ? -52.264 -14.884  71.018  1.00 32.99 ? 263  GLU A CG  1 
ATOM   1977  C CD  . GLU A  1 257 ? -51.809 -16.164  70.334  1.00 36.59 ? 263  GLU A CD  1 
ATOM   1978  O OE1 . GLU A  1 257 ? -52.658 -16.841  69.718  1.00 43.44 ? 263  GLU A OE1 1 
ATOM   1979  O OE2 . GLU A  1 257 ? -50.605 -16.496  70.417  1.00 28.08 ? 263  GLU A OE2 1 
ATOM   1980  N N   . HIS A  1 258 ? -55.702 -11.574  70.366  1.00 35.68 ? 264  HIS A N   1 
ATOM   1981  C CA  . HIS A  1 258 ? -57.023 -10.959  70.233  1.00 38.80 ? 264  HIS A CA  1 
ATOM   1982  C C   . HIS A  1 258 ? -57.923 -11.633  69.192  1.00 41.12 ? 264  HIS A C   1 
ATOM   1983  O O   . HIS A  1 258 ? -59.083 -11.254  69.034  1.00 41.18 ? 264  HIS A O   1 
ATOM   1984  C CB  . HIS A  1 258 ? -56.877 -9.466   69.906  1.00 39.55 ? 264  HIS A CB  1 
ATOM   1985  C CG  . HIS A  1 258 ? -56.546 -9.180   68.473  1.00 43.30 ? 264  HIS A CG  1 
ATOM   1986  N ND1 . HIS A  1 258 ? -55.254 -8.992   68.030  1.00 47.63 ? 264  HIS A ND1 1 
ATOM   1987  C CD2 . HIS A  1 258 ? -57.341 -9.014   67.388  1.00 43.10 ? 264  HIS A CD2 1 
ATOM   1988  C CE1 . HIS A  1 258 ? -55.266 -8.745   66.732  1.00 45.22 ? 264  HIS A CE1 1 
ATOM   1989  N NE2 . HIS A  1 258 ? -56.520 -8.753   66.318  1.00 43.28 ? 264  HIS A NE2 1 
ATOM   1990  N N   . GLU A  1 259 ? -57.391 -12.633  68.495  1.00 40.22 ? 265  GLU A N   1 
ATOM   1991  C CA  . GLU A  1 259 ? -58.152 -13.387  67.496  1.00 34.51 ? 265  GLU A CA  1 
ATOM   1992  C C   . GLU A  1 259 ? -57.382 -14.666  67.146  1.00 30.78 ? 265  GLU A C   1 
ATOM   1993  O O   . GLU A  1 259 ? -56.212 -14.786  67.512  1.00 27.90 ? 265  GLU A O   1 
ATOM   1994  C CB  . GLU A  1 259 ? -58.394 -12.532  66.249  1.00 32.92 ? 265  GLU A CB  1 
ATOM   1995  C CG  . GLU A  1 259 ? -57.131 -12.162  65.503  1.00 36.54 ? 265  GLU A CG  1 
ATOM   1996  C CD  . GLU A  1 259 ? -57.408 -11.555  64.140  1.00 41.45 ? 265  GLU A CD  1 
ATOM   1997  O OE1 . GLU A  1 259 ? -58.588 -11.501  63.730  1.00 43.20 ? 265  GLU A OE1 1 
ATOM   1998  O OE2 . GLU A  1 259 ? -56.439 -11.141  63.470  1.00 41.59 ? 265  GLU A OE2 1 
ATOM   1999  N N   . PRO A  1 260 ? -58.024 -15.628  66.447  1.00 30.21 ? 266  PRO A N   1 
ATOM   2000  C CA  . PRO A  1 260 ? -57.242 -16.802  66.034  1.00 25.86 ? 266  PRO A CA  1 
ATOM   2001  C C   . PRO A  1 260 ? -56.091 -16.402  65.118  1.00 23.57 ? 266  PRO A C   1 
ATOM   2002  O O   . PRO A  1 260 ? -56.281 -15.548  64.265  1.00 25.44 ? 266  PRO A O   1 
ATOM   2003  C CB  . PRO A  1 260 ? -58.263 -17.672  65.290  1.00 26.79 ? 266  PRO A CB  1 
ATOM   2004  C CG  . PRO A  1 260 ? -59.342 -16.743  64.885  1.00 33.05 ? 266  PRO A CG  1 
ATOM   2005  C CD  . PRO A  1 260 ? -59.418 -15.715  65.980  1.00 31.73 ? 266  PRO A CD  1 
ATOM   2006  N N   . TYR A  1 261 ? -54.915 -16.987  65.320  1.00 20.18 ? 267  TYR A N   1 
ATOM   2007  C CA  . TYR A  1 261 ? -53.733 -16.635  64.544  1.00 16.30 ? 267  TYR A CA  1 
ATOM   2008  C C   . TYR A  1 261 ? -53.442 -17.686  63.498  1.00 16.11 ? 267  TYR A C   1 
ATOM   2009  O O   . TYR A  1 261 ? -53.298 -18.860  63.816  1.00 18.66 ? 267  TYR A O   1 
ATOM   2010  C CB  . TYR A  1 261 ? -52.518 -16.475  65.457  1.00 15.41 ? 267  TYR A CB  1 
ATOM   2011  C CG  . TYR A  1 261 ? -51.276 -15.930  64.782  1.00 13.60 ? 267  TYR A CG  1 
ATOM   2012  C CD1 . TYR A  1 261 ? -50.339 -16.779  64.203  1.00 13.66 ? 267  TYR A CD1 1 
ATOM   2013  C CD2 . TYR A  1 261 ? -51.034 -14.567  64.740  1.00 12.02 ? 267  TYR A CD2 1 
ATOM   2014  C CE1 . TYR A  1 261 ? -49.195 -16.284  63.598  1.00 14.08 ? 267  TYR A CE1 1 
ATOM   2015  C CE2 . TYR A  1 261 ? -49.905 -14.064  64.138  1.00 15.82 ? 267  TYR A CE2 1 
ATOM   2016  C CZ  . TYR A  1 261 ? -48.984 -14.923  63.572  1.00 17.78 ? 267  TYR A CZ  1 
ATOM   2017  O OH  . TYR A  1 261 ? -47.857 -14.402  62.977  1.00 20.44 ? 267  TYR A OH  1 
ATOM   2018  N N   . TRP A  1 262 ? -53.361 -17.261  62.250  1.00 16.21 ? 268  TRP A N   1 
ATOM   2019  C CA  . TRP A  1 262 ? -52.922 -18.124  61.170  1.00 14.29 ? 268  TRP A CA  1 
ATOM   2020  C C   . TRP A  1 262 ? -52.222 -17.247  60.139  1.00 17.27 ? 268  TRP A C   1 
ATOM   2021  O O   . TRP A  1 262 ? -52.734 -16.190  59.777  1.00 19.66 ? 268  TRP A O   1 
ATOM   2022  C CB  . TRP A  1 262 ? -54.106 -18.874  60.561  1.00 13.45 ? 268  TRP A CB  1 
ATOM   2023  C CG  . TRP A  1 262 ? -53.750 -19.859  59.482  1.00 16.67 ? 268  TRP A CG  1 
ATOM   2024  C CD1 . TRP A  1 262 ? -53.558 -21.200  59.630  1.00 19.76 ? 268  TRP A CD1 1 
ATOM   2025  C CD2 . TRP A  1 262 ? -53.568 -19.583  58.087  1.00 17.98 ? 268  TRP A CD2 1 
ATOM   2026  N NE1 . TRP A  1 262 ? -53.262 -21.774  58.421  1.00 20.65 ? 268  TRP A NE1 1 
ATOM   2027  C CE2 . TRP A  1 262 ? -53.261 -20.801  57.458  1.00 21.91 ? 268  TRP A CE2 1 
ATOM   2028  C CE3 . TRP A  1 262 ? -53.634 -18.425  57.313  1.00 21.72 ? 268  TRP A CE3 1 
ATOM   2029  C CZ2 . TRP A  1 262 ? -53.014 -20.892  56.092  1.00 19.67 ? 268  TRP A CZ2 1 
ATOM   2030  C CZ3 . TRP A  1 262 ? -53.387 -18.520  55.953  1.00 18.71 ? 268  TRP A CZ3 1 
ATOM   2031  C CH2 . TRP A  1 262 ? -53.082 -19.742  55.361  1.00 15.92 ? 268  TRP A CH2 1 
ATOM   2032  N N   . ARG A  1 263 ? -51.038 -17.653  59.694  1.00 18.46 ? 269  ARG A N   1 
ATOM   2033  C CA  . ARG A  1 263 ? -50.316 -16.897  58.670  1.00 17.66 ? 269  ARG A CA  1 
ATOM   2034  C C   . ARG A  1 263 ? -49.650 -17.829  57.680  1.00 17.19 ? 269  ARG A C   1 
ATOM   2035  O O   . ARG A  1 263 ? -49.033 -18.818  58.063  1.00 14.79 ? 269  ARG A O   1 
ATOM   2036  C CB  . ARG A  1 263 ? -49.247 -15.978  59.285  1.00 18.93 ? 269  ARG A CB  1 
ATOM   2037  C CG  . ARG A  1 263 ? -49.734 -14.992  60.334  1.00 18.31 ? 269  ARG A CG  1 
ATOM   2038  C CD  . ARG A  1 263 ? -50.371 -13.768  59.714  1.00 16.81 ? 269  ARG A CD  1 
ATOM   2039  N NE  . ARG A  1 263 ? -50.632 -12.715  60.701  1.00 21.71 ? 269  ARG A NE  1 
ATOM   2040  C CZ  . ARG A  1 263 ? -51.693 -12.680  61.507  1.00 21.18 ? 269  ARG A CZ  1 
ATOM   2041  N NH1 . ARG A  1 263 ? -52.592 -13.654  61.466  1.00 16.10 ? 269  ARG A NH1 1 
ATOM   2042  N NH2 . ARG A  1 263 ? -51.853 -11.678  62.363  1.00 19.32 ? 269  ARG A NH2 1 
ATOM   2043  N N   . ASP A  1 264 ? -49.754 -17.468  56.404  1.00 15.84 ? 270  ASP A N   1 
ATOM   2044  C CA  . ASP A  1 264 ? -49.142 -18.192  55.300  1.00 20.33 ? 270  ASP A CA  1 
ATOM   2045  C C   . ASP A  1 264 ? -47.741 -17.665  54.980  1.00 17.73 ? 270  ASP A C   1 
ATOM   2046  O O   . ASP A  1 264 ? -46.944 -18.357  54.356  1.00 17.29 ? 270  ASP A O   1 
ATOM   2047  C CB  . ASP A  1 264 ? -50.058 -18.079  54.071  1.00 28.89 ? 270  ASP A CB  1 
ATOM   2048  C CG  . ASP A  1 264 ? -49.500 -18.762  52.835  1.00 34.00 ? 270  ASP A CG  1 
ATOM   2049  O OD1 . ASP A  1 264 ? -48.768 -19.767  52.960  1.00 34.48 ? 270  ASP A OD1 1 
ATOM   2050  O OD2 . ASP A  1 264 ? -49.809 -18.284  51.722  1.00 33.19 ? 270  ASP A OD2 1 
ATOM   2051  N N   . VAL A  1 265 ? -47.443 -16.453  55.452  1.00 15.76 ? 271  VAL A N   1 
ATOM   2052  C CA  . VAL A  1 265 ? -46.233 -15.694  55.090  1.00 8.64  ? 271  VAL A CA  1 
ATOM   2053  C C   . VAL A  1 265 ? -45.760 -15.991  53.657  1.00 15.31 ? 271  VAL A C   1 
ATOM   2054  O O   . VAL A  1 265 ? -44.607 -16.332  53.420  1.00 19.65 ? 271  VAL A O   1 
ATOM   2055  C CB  . VAL A  1 265 ? -45.064 -15.927  56.112  1.00 14.05 ? 271  VAL A CB  1 
ATOM   2056  C CG1 . VAL A  1 265 ? -45.367 -15.195  57.409  1.00 9.67  ? 271  VAL A CG1 1 
ATOM   2057  C CG2 . VAL A  1 265 ? -44.802 -17.415  56.397  1.00 16.00 ? 271  VAL A CG2 1 
ATOM   2058  N N   . GLY A  1 266 ? -46.671 -15.834  52.702  1.00 16.81 ? 272  GLY A N   1 
ATOM   2059  C CA  . GLY A  1 266 ? -46.420 -16.243  51.331  1.00 22.05 ? 272  GLY A CA  1 
ATOM   2060  C C   . GLY A  1 266 ? -45.708 -15.242  50.437  1.00 25.20 ? 272  GLY A C   1 
ATOM   2061  O O   . GLY A  1 266 ? -45.422 -15.544  49.279  1.00 27.09 ? 272  GLY A O   1 
ATOM   2062  N N   . THR A  1 267 ? -45.438 -14.049  50.958  1.00 20.31 ? 273  THR A N   1 
ATOM   2063  C CA  . THR A  1 267 ? -44.730 -13.009  50.215  1.00 20.81 ? 273  THR A CA  1 
ATOM   2064  C C   . THR A  1 267 ? -43.729 -12.336  51.141  1.00 18.56 ? 273  THR A C   1 
ATOM   2065  O O   . THR A  1 267 ? -43.884 -12.404  52.353  1.00 19.28 ? 273  THR A O   1 
ATOM   2066  C CB  . THR A  1 267 ? -45.691 -11.937  49.650  1.00 19.56 ? 273  THR A CB  1 
ATOM   2067  O OG1 . THR A  1 267 ? -46.258 -11.181  50.727  1.00 19.85 ? 273  THR A OG1 1 
ATOM   2068  C CG2 . THR A  1 267 ? -46.813 -12.574  48.858  1.00 22.90 ? 273  THR A CG2 1 
ATOM   2069  N N   . ILE A  1 268 ? -42.719 -11.676  50.586  1.00 13.53 ? 274  ILE A N   1 
ATOM   2070  C CA  . ILE A  1 268 ? -41.734 -10.971  51.410  1.00 15.12 ? 274  ILE A CA  1 
ATOM   2071  C C   . ILE A  1 268 ? -42.396 -9.945   52.346  1.00 19.51 ? 274  ILE A C   1 
ATOM   2072  O O   . ILE A  1 268 ? -41.998 -9.796   53.501  1.00 19.44 ? 274  ILE A O   1 
ATOM   2073  C CB  . ILE A  1 268 ? -40.679 -10.269  50.535  1.00 17.02 ? 274  ILE A CB  1 
ATOM   2074  C CG1 . ILE A  1 268 ? -39.934 -11.303  49.698  1.00 19.92 ? 274  ILE A CG1 1 
ATOM   2075  C CG2 . ILE A  1 268 ? -39.694 -9.460   51.392  1.00 16.16 ? 274  ILE A CG2 1 
ATOM   2076  C CD1 . ILE A  1 268 ? -39.068 -10.702  48.610  1.00 24.91 ? 274  ILE A CD1 1 
ATOM   2077  N N   . ASP A  1 269 ? -43.418 -9.257   51.856  1.00 20.76 ? 275  ASP A N   1 
ATOM   2078  C CA  . ASP A  1 269 ? -44.161 -8.320   52.693  1.00 23.23 ? 275  ASP A CA  1 
ATOM   2079  C C   . ASP A  1 269 ? -44.848 -9.012   53.871  1.00 20.03 ? 275  ASP A C   1 
ATOM   2080  O O   . ASP A  1 269 ? -44.755 -8.554   55.006  1.00 18.88 ? 275  ASP A O   1 
ATOM   2081  C CB  . ASP A  1 269 ? -45.205 -7.572   51.866  1.00 29.05 ? 275  ASP A CB  1 
ATOM   2082  C CG  . ASP A  1 269 ? -44.580 -6.684   50.819  1.00 44.22 ? 275  ASP A CG  1 
ATOM   2083  O OD1 . ASP A  1 269 ? -43.499 -6.119   51.095  1.00 50.98 ? 275  ASP A OD1 1 
ATOM   2084  O OD2 . ASP A  1 269 ? -45.160 -6.563   49.718  1.00 47.63 ? 275  ASP A OD2 1 
ATOM   2085  N N   . ALA A  1 270 ? -45.550 -10.103  53.592  1.00 17.36 ? 276  ALA A N   1 
ATOM   2086  C CA  . ALA A  1 270 ? -46.283 -10.804  54.630  1.00 16.00 ? 276  ALA A CA  1 
ATOM   2087  C C   . ALA A  1 270 ? -45.314 -11.452  55.614  1.00 15.43 ? 276  ALA A C   1 
ATOM   2088  O O   . ALA A  1 270 ? -45.583 -11.504  56.814  1.00 18.57 ? 276  ALA A O   1 
ATOM   2089  C CB  . ALA A  1 270 ? -47.199 -11.836  54.025  1.00 12.23 ? 276  ALA A CB  1 
ATOM   2090  N N   . TYR A  1 271 ? -44.186 -11.934  55.099  1.00 14.77 ? 277  TYR A N   1 
ATOM   2091  C CA  . TYR A  1 271 ? -43.138 -12.522  55.931  1.00 16.13 ? 277  TYR A CA  1 
ATOM   2092  C C   . TYR A  1 271 ? -42.476 -11.486  56.833  1.00 16.13 ? 277  TYR A C   1 
ATOM   2093  O O   . TYR A  1 271 ? -42.303 -11.710  58.026  1.00 18.16 ? 277  TYR A O   1 
ATOM   2094  C CB  . TYR A  1 271 ? -42.078 -13.188  55.053  1.00 17.93 ? 277  TYR A CB  1 
ATOM   2095  C CG  . TYR A  1 271 ? -40.904 -13.760  55.811  1.00 16.57 ? 277  TYR A CG  1 
ATOM   2096  C CD1 . TYR A  1 271 ? -40.994 -14.999  56.443  1.00 15.05 ? 277  TYR A CD1 1 
ATOM   2097  C CD2 . TYR A  1 271 ? -39.701 -13.068  55.894  1.00 15.49 ? 277  TYR A CD2 1 
ATOM   2098  C CE1 . TYR A  1 271 ? -39.923 -15.526  57.133  1.00 14.28 ? 277  TYR A CE1 1 
ATOM   2099  C CE2 . TYR A  1 271 ? -38.625 -13.588  56.581  1.00 14.86 ? 277  TYR A CE2 1 
ATOM   2100  C CZ  . TYR A  1 271 ? -38.736 -14.818  57.195  1.00 15.00 ? 277  TYR A CZ  1 
ATOM   2101  O OH  . TYR A  1 271 ? -37.658 -15.339  57.869  1.00 14.57 ? 277  TYR A OH  1 
ATOM   2102  N N   . TRP A  1 272 ? -42.087 -10.359  56.252  1.00 15.70 ? 278  TRP A N   1 
ATOM   2103  C CA  . TRP A  1 272 ? -41.486 -9.280   57.021  1.00 13.56 ? 278  TRP A CA  1 
ATOM   2104  C C   . TRP A  1 272 ? -42.471 -8.815   58.098  1.00 16.12 ? 278  TRP A C   1 
ATOM   2105  O O   . TRP A  1 272 ? -42.107 -8.718   59.275  1.00 15.06 ? 278  TRP A O   1 
ATOM   2106  C CB  . TRP A  1 272 ? -41.073 -8.128   56.093  1.00 15.65 ? 278  TRP A CB  1 
ATOM   2107  C CG  . TRP A  1 272 ? -40.576 -6.901   56.792  1.00 13.97 ? 278  TRP A CG  1 
ATOM   2108  C CD1 . TRP A  1 272 ? -39.287 -6.616   57.148  1.00 14.93 ? 278  TRP A CD1 1 
ATOM   2109  C CD2 . TRP A  1 272 ? -41.363 -5.788   57.212  1.00 17.34 ? 278  TRP A CD2 1 
ATOM   2110  N NE1 . TRP A  1 272 ? -39.226 -5.390   57.773  1.00 18.64 ? 278  TRP A NE1 1 
ATOM   2111  C CE2 . TRP A  1 272 ? -40.490 -4.864   57.824  1.00 20.60 ? 278  TRP A CE2 1 
ATOM   2112  C CE3 . TRP A  1 272 ? -42.725 -5.485   57.139  1.00 20.19 ? 278  TRP A CE3 1 
ATOM   2113  C CZ2 . TRP A  1 272 ? -40.935 -3.662   58.351  1.00 23.59 ? 278  TRP A CZ2 1 
ATOM   2114  C CZ3 . TRP A  1 272 ? -43.167 -4.291   57.667  1.00 25.18 ? 278  TRP A CZ3 1 
ATOM   2115  C CH2 . TRP A  1 272 ? -42.276 -3.394   58.266  1.00 24.48 ? 278  TRP A CH2 1 
ATOM   2116  N N   . GLN A  1 273 ? -43.725 -8.578   57.709  1.00 16.05 ? 279  GLN A N   1 
ATOM   2117  C CA  . GLN A  1 273 ? -44.727 -8.055   58.640  1.00 18.70 ? 279  GLN A CA  1 
ATOM   2118  C C   . GLN A  1 273 ? -44.987 -9.009   59.811  1.00 17.29 ? 279  GLN A C   1 
ATOM   2119  O O   . GLN A  1 273 ? -45.052 -8.583   60.963  1.00 14.89 ? 279  GLN A O   1 
ATOM   2120  C CB  . GLN A  1 273 ? -46.044 -7.758   57.914  1.00 22.52 ? 279  GLN A CB  1 
ATOM   2121  C CG  . GLN A  1 273 ? -47.048 -6.946   58.749  1.00 23.21 ? 279  GLN A CG  1 
ATOM   2122  C CD  . GLN A  1 273 ? -46.647 -5.481   58.909  1.00 28.32 ? 279  GLN A CD  1 
ATOM   2123  O OE1 . GLN A  1 273 ? -46.511 -4.753   57.927  1.00 28.50 ? 279  GLN A OE1 1 
ATOM   2124  N NE2 . GLN A  1 273 ? -46.446 -5.048   60.153  1.00 31.36 ? 279  GLN A NE2 1 
ATOM   2125  N N   . ALA A  1 274 ? -45.126 -10.297  59.517  1.00 17.17 ? 280  ALA A N   1 
ATOM   2126  C CA  . ALA A  1 274 ? -45.419 -11.286  60.551  1.00 16.61 ? 280  ALA A CA  1 
ATOM   2127  C C   . ALA A  1 274 ? -44.328 -11.336  61.621  1.00 15.47 ? 280  ALA A C   1 
ATOM   2128  O O   . ALA A  1 274 ? -44.632 -11.444  62.801  1.00 18.15 ? 280  ALA A O   1 
ATOM   2129  C CB  . ALA A  1 274 ? -45.618 -12.669  59.926  1.00 16.93 ? 280  ALA A CB  1 
ATOM   2130  N N   . ASN A  1 275 ? -43.065 -11.255  61.214  1.00 12.44 ? 281  ASN A N   1 
ATOM   2131  C CA  . ASN A  1 275 ? -41.952 -11.216  62.166  1.00 14.31 ? 281  ASN A CA  1 
ATOM   2132  C C   . ASN A  1 275 ? -41.863 -9.891   62.900  1.00 17.65 ? 281  ASN A C   1 
ATOM   2133  O O   . ASN A  1 275 ? -41.672 -9.857   64.115  1.00 20.03 ? 281  ASN A O   1 
ATOM   2134  C CB  . ASN A  1 275 ? -40.622 -11.477  61.461  1.00 18.26 ? 281  ASN A CB  1 
ATOM   2135  C CG  . ASN A  1 275 ? -40.366 -12.946  61.236  1.00 17.63 ? 281  ASN A CG  1 
ATOM   2136  O OD1 . ASN A  1 275 ? -39.847 -13.640  62.110  1.00 12.60 ? 281  ASN A OD1 1 
ATOM   2137  N ND2 . ASN A  1 275 ? -40.735 -13.433  60.057  1.00 13.51 ? 281  ASN A ND2 1 
ATOM   2138  N N   . ILE A  1 276 ? -41.992 -8.795   62.163  1.00 14.15 ? 282  ILE A N   1 
ATOM   2139  C CA  . ILE A  1 276 ? -41.821 -7.485   62.758  1.00 15.02 ? 282  ILE A CA  1 
ATOM   2140  C C   . ILE A  1 276 ? -42.990 -7.190   63.710  1.00 16.29 ? 282  ILE A C   1 
ATOM   2141  O O   . ILE A  1 276 ? -42.838 -6.439   64.667  1.00 19.85 ? 282  ILE A O   1 
ATOM   2142  C CB  . ILE A  1 276 ? -41.673 -6.391   61.658  1.00 21.88 ? 282  ILE A CB  1 
ATOM   2143  C CG1 . ILE A  1 276 ? -40.642 -5.345   62.082  1.00 24.32 ? 282  ILE A CG1 1 
ATOM   2144  C CG2 . ILE A  1 276 ? -43.003 -5.769   61.305  1.00 21.86 ? 282  ILE A CG2 1 
ATOM   2145  C CD1 . ILE A  1 276 ? -39.257 -5.922   62.272  1.00 18.07 ? 282  ILE A CD1 1 
ATOM   2146  N N   . ASP A  1 277 ? -44.138 -7.818   63.472  1.00 14.60 ? 283  ASP A N   1 
ATOM   2147  C CA  . ASP A  1 277 ? -45.297 -7.633   64.343  1.00 17.38 ? 283  ASP A CA  1 
ATOM   2148  C C   . ASP A  1 277 ? -45.002 -8.165   65.746  1.00 17.11 ? 283  ASP A C   1 
ATOM   2149  O O   . ASP A  1 277 ? -45.531 -7.667   66.731  1.00 17.51 ? 283  ASP A O   1 
ATOM   2150  C CB  . ASP A  1 277 ? -46.545 -8.317   63.765  1.00 22.70 ? 283  ASP A CB  1 
ATOM   2151  C CG  . ASP A  1 277 ? -47.218 -7.502   62.635  1.00 26.35 ? 283  ASP A CG  1 
ATOM   2152  O OD1 . ASP A  1 277 ? -46.825 -6.339   62.386  1.00 23.41 ? 283  ASP A OD1 1 
ATOM   2153  O OD2 . ASP A  1 277 ? -48.158 -8.031   61.998  1.00 22.87 ? 283  ASP A OD2 1 
ATOM   2154  N N   . LEU A  1 278 ? -44.117 -9.150   65.839  1.00 18.26 ? 284  LEU A N   1 
ATOM   2155  C CA  . LEU A  1 278 ? -43.710 -9.700   67.126  1.00 17.01 ? 284  LEU A CA  1 
ATOM   2156  C C   . LEU A  1 278 ? -42.991 -8.665   67.987  1.00 14.76 ? 284  LEU A C   1 
ATOM   2157  O O   . LEU A  1 278 ? -42.708 -8.912   69.157  1.00 10.96 ? 284  LEU A O   1 
ATOM   2158  C CB  . LEU A  1 278 ? -42.811 -10.925  66.925  1.00 17.80 ? 284  LEU A CB  1 
ATOM   2159  C CG  . LEU A  1 278 ? -43.423 -12.095  66.152  1.00 17.09 ? 284  LEU A CG  1 
ATOM   2160  C CD1 . LEU A  1 278 ? -42.359 -13.120  65.757  1.00 14.84 ? 284  LEU A CD1 1 
ATOM   2161  C CD2 . LEU A  1 278 ? -44.521 -12.750  66.983  1.00 20.37 ? 284  LEU A CD2 1 
ATOM   2162  N N   . THR A  1 279 ? -42.702 -7.503   67.413  1.00 15.74 ? 285  THR A N   1 
ATOM   2163  C CA  . THR A  1 279 ? -42.027 -6.460   68.171  1.00 17.22 ? 285  THR A CA  1 
ATOM   2164  C C   . THR A  1 279 ? -43.035 -5.544   68.876  1.00 18.33 ? 285  THR A C   1 
ATOM   2165  O O   . THR A  1 279 ? -42.639 -4.702   69.670  1.00 19.36 ? 285  THR A O   1 
ATOM   2166  C CB  . THR A  1 279 ? -41.089 -5.596   67.277  1.00 15.89 ? 285  THR A CB  1 
ATOM   2167  O OG1 . THR A  1 279 ? -41.862 -4.822   66.355  1.00 19.61 ? 285  THR A OG1 1 
ATOM   2168  C CG2 . THR A  1 279 ? -40.101 -6.467   66.509  1.00 14.76 ? 285  THR A CG2 1 
ATOM   2169  N N   . ASP A  1 280 ? -44.327 -5.715   68.589  1.00 20.58 ? 286  ASP A N   1 
ATOM   2170  C CA  . ASP A  1 280 ? -45.394 -4.911   69.215  1.00 19.17 ? 286  ASP A CA  1 
ATOM   2171  C C   . ASP A  1 280 ? -45.457 -5.008   70.734  1.00 17.79 ? 286  ASP A C   1 
ATOM   2172  O O   . ASP A  1 280 ? -44.954 -5.963   71.330  1.00 15.24 ? 286  ASP A O   1 
ATOM   2173  C CB  . ASP A  1 280 ? -46.767 -5.315   68.676  1.00 18.27 ? 286  ASP A CB  1 
ATOM   2174  C CG  . ASP A  1 280 ? -46.923 -5.024   67.220  1.00 21.55 ? 286  ASP A CG  1 
ATOM   2175  O OD1 . ASP A  1 280 ? -46.092 -4.268   66.681  1.00 25.91 ? 286  ASP A OD1 1 
ATOM   2176  O OD2 . ASP A  1 280 ? -47.883 -5.543   66.616  1.00 26.84 ? 286  ASP A OD2 1 
ATOM   2177  N N   . VAL A  1 281 ? -46.106 -4.023   71.356  1.00 17.73 ? 287  VAL A N   1 
ATOM   2178  C CA  . VAL A  1 281 ? -46.397 -4.108   72.783  1.00 17.22 ? 287  VAL A CA  1 
ATOM   2179  C C   . VAL A  1 281 ? -47.399 -5.237   72.986  1.00 19.44 ? 287  VAL A C   1 
ATOM   2180  O O   . VAL A  1 281 ? -47.282 -6.010   73.920  1.00 20.22 ? 287  VAL A O   1 
ATOM   2181  C CB  . VAL A  1 281 ? -46.968 -2.793   73.360  1.00 16.92 ? 287  VAL A CB  1 
ATOM   2182  C CG1 . VAL A  1 281 ? -47.256 -2.960   74.829  1.00 19.17 ? 287  VAL A CG1 1 
ATOM   2183  C CG2 . VAL A  1 281 ? -46.007 -1.644   73.155  1.00 19.65 ? 287  VAL A CG2 1 
ATOM   2184  N N   . VAL A  1 282 ? -48.367 -5.341   72.080  1.00 19.75 ? 288  VAL A N   1 
ATOM   2185  C CA  . VAL A  1 282 ? -49.345 -6.430   72.123  1.00 24.02 ? 288  VAL A CA  1 
ATOM   2186  C C   . VAL A  1 282 ? -49.347 -7.238   70.822  1.00 18.87 ? 288  VAL A C   1 
ATOM   2187  O O   . VAL A  1 282 ? -50.178 -7.021   69.948  1.00 21.93 ? 288  VAL A O   1 
ATOM   2188  C CB  . VAL A  1 282 ? -50.765 -5.892   72.384  1.00 27.33 ? 288  VAL A CB  1 
ATOM   2189  C CG1 . VAL A  1 282 ? -51.748 -7.038   72.636  1.00 28.26 ? 288  VAL A CG1 1 
ATOM   2190  C CG2 . VAL A  1 282 ? -50.743 -4.940   73.558  1.00 27.12 ? 288  VAL A CG2 1 
ATOM   2191  N N   . PRO A  1 283 ? -48.400 -8.172   70.683  1.00 18.15 ? 289  PRO A N   1 
ATOM   2192  C CA  . PRO A  1 283 ? -48.322 -8.911   69.417  1.00 18.19 ? 289  PRO A CA  1 
ATOM   2193  C C   . PRO A  1 283 ? -49.540 -9.795   69.158  1.00 20.33 ? 289  PRO A C   1 
ATOM   2194  O O   . PRO A  1 283 ? -50.130 -10.314  70.106  1.00 27.55 ? 289  PRO A O   1 
ATOM   2195  C CB  . PRO A  1 283 ? -47.062 -9.769   69.590  1.00 16.49 ? 289  PRO A CB  1 
ATOM   2196  C CG  . PRO A  1 283 ? -46.275 -9.089   70.684  1.00 18.76 ? 289  PRO A CG  1 
ATOM   2197  C CD  . PRO A  1 283 ? -47.298 -8.510   71.598  1.00 15.85 ? 289  PRO A CD  1 
ATOM   2198  N N   . ASP A  1 284 ? -49.899 -9.960   67.888  1.00 19.91 ? 290  ASP A N   1 
ATOM   2199  C CA  . ASP A  1 284 ? -50.938 -10.901  67.476  1.00 21.31 ? 290  ASP A CA  1 
ATOM   2200  C C   . ASP A  1 284 ? -50.635 -12.325  67.923  1.00 17.67 ? 290  ASP A C   1 
ATOM   2201  O O   . ASP A  1 284 ? -51.539 -13.075  68.286  1.00 20.07 ? 290  ASP A O   1 
ATOM   2202  C CB  . ASP A  1 284 ? -51.104 -10.886  65.958  1.00 21.79 ? 290  ASP A CB  1 
ATOM   2203  C CG  . ASP A  1 284 ? -51.667 -9.581   65.442  1.00 30.24 ? 290  ASP A CG  1 
ATOM   2204  O OD1 . ASP A  1 284 ? -52.072 -8.728   66.265  1.00 34.83 ? 290  ASP A OD1 1 
ATOM   2205  O OD2 . ASP A  1 284 ? -51.720 -9.425   64.203  1.00 30.09 ? 290  ASP A OD2 1 
ATOM   2206  N N   . LEU A  1 285 ? -49.358 -12.691  67.873  1.00 12.72 ? 291  LEU A N   1 
ATOM   2207  C CA  . LEU A  1 285 ? -48.901 -14.013  68.284  1.00 11.55 ? 291  LEU A CA  1 
ATOM   2208  C C   . LEU A  1 285 ? -48.226 -13.950  69.647  1.00 17.36 ? 291  LEU A C   1 
ATOM   2209  O O   . LEU A  1 285 ? -47.292 -13.179  69.847  1.00 17.98 ? 291  LEU A O   1 
ATOM   2210  C CB  . LEU A  1 285 ? -47.949 -14.594  67.241  1.00 13.22 ? 291  LEU A CB  1 
ATOM   2211  C CG  . LEU A  1 285 ? -47.477 -16.020  67.469  1.00 18.88 ? 291  LEU A CG  1 
ATOM   2212  C CD1 . LEU A  1 285 ? -48.662 -16.976  67.574  1.00 18.75 ? 291  LEU A CD1 1 
ATOM   2213  C CD2 . LEU A  1 285 ? -46.551 -16.412  66.316  1.00 19.00 ? 291  LEU A CD2 1 
ATOM   2214  N N   . ASP A  1 286 ? -48.723 -14.753  70.585  1.00 17.43 ? 292  ASP A N   1 
ATOM   2215  C CA  . ASP A  1 286 ? -48.195 -14.780  71.943  1.00 19.68 ? 292  ASP A CA  1 
ATOM   2216  C C   . ASP A  1 286 ? -47.166 -15.876  72.040  1.00 20.50 ? 292  ASP A C   1 
ATOM   2217  O O   . ASP A  1 286 ? -47.498 -17.024  72.291  1.00 26.58 ? 292  ASP A O   1 
ATOM   2218  C CB  . ASP A  1 286 ? -49.308 -15.005  72.970  1.00 18.18 ? 292  ASP A CB  1 
ATOM   2219  C CG  . ASP A  1 286 ? -48.786 -15.088  74.392  1.00 23.77 ? 292  ASP A CG  1 
ATOM   2220  O OD1 . ASP A  1 286 ? -47.625 -14.691  74.632  1.00 26.99 ? 292  ASP A OD1 1 
ATOM   2221  O OD2 . ASP A  1 286 ? -49.541 -15.541  75.278  1.00 22.37 ? 292  ASP A OD2 1 
ATOM   2222  N N   . ILE A  1 287 ? -45.909 -15.519  71.827  1.00 19.59 ? 293  ILE A N   1 
ATOM   2223  C CA  . ILE A  1 287 ? -44.848 -16.510  71.851  1.00 24.00 ? 293  ILE A CA  1 
ATOM   2224  C C   . ILE A  1 287 ? -44.477 -16.897  73.280  1.00 24.58 ? 293  ILE A C   1 
ATOM   2225  O O   . ILE A  1 287 ? -43.534 -17.649  73.492  1.00 26.25 ? 293  ILE A O   1 
ATOM   2226  C CB  . ILE A  1 287 ? -43.610 -16.005  71.115  1.00 27.29 ? 293  ILE A CB  1 
ATOM   2227  C CG1 . ILE A  1 287 ? -43.011 -14.807  71.848  1.00 33.15 ? 293  ILE A CG1 1 
ATOM   2228  C CG2 . ILE A  1 287 ? -43.968 -15.646  69.685  1.00 28.62 ? 293  ILE A CG2 1 
ATOM   2229  C CD1 . ILE A  1 287 ? -41.723 -14.284  71.241  1.00 38.29 ? 293  ILE A CD1 1 
ATOM   2230  N N   . TYR A  1 288 ? -45.226 -16.384  74.254  1.00 23.16 ? 294  TYR A N   1 
ATOM   2231  C CA  . TYR A  1 288 ? -44.991 -16.695  75.662  1.00 26.55 ? 294  TYR A CA  1 
ATOM   2232  C C   . TYR A  1 288 ? -46.063 -17.605  76.234  1.00 26.27 ? 294  TYR A C   1 
ATOM   2233  O O   . TYR A  1 288 ? -46.176 -17.753  77.450  1.00 26.19 ? 294  TYR A O   1 
ATOM   2234  C CB  . TYR A  1 288 ? -44.919 -15.412  76.494  1.00 25.91 ? 294  TYR A CB  1 
ATOM   2235  C CG  . TYR A  1 288 ? -43.799 -14.516  76.057  1.00 22.25 ? 294  TYR A CG  1 
ATOM   2236  C CD1 . TYR A  1 288 ? -44.007 -13.527  75.102  1.00 25.97 ? 294  TYR A CD1 1 
ATOM   2237  C CD2 . TYR A  1 288 ? -42.526 -14.678  76.568  1.00 20.34 ? 294  TYR A CD2 1 
ATOM   2238  C CE1 . TYR A  1 288 ? -42.977 -12.716  74.683  1.00 22.62 ? 294  TYR A CE1 1 
ATOM   2239  C CE2 . TYR A  1 288 ? -41.491 -13.874  76.154  1.00 19.94 ? 294  TYR A CE2 1 
ATOM   2240  C CZ  . TYR A  1 288 ? -41.724 -12.896  75.213  1.00 23.99 ? 294  TYR A CZ  1 
ATOM   2241  O OH  . TYR A  1 288 ? -40.698 -12.093  74.796  1.00 22.69 ? 294  TYR A OH  1 
ATOM   2242  N N   . ASP A  1 289 ? -46.860 -18.201  75.360  1.00 26.33 ? 295  ASP A N   1 
ATOM   2243  C CA  . ASP A  1 289 ? -47.909 -19.095  75.808  1.00 27.93 ? 295  ASP A CA  1 
ATOM   2244  C C   . ASP A  1 289 ? -47.306 -20.476  76.074  1.00 25.52 ? 295  ASP A C   1 
ATOM   2245  O O   . ASP A  1 289 ? -47.164 -21.286  75.155  1.00 21.94 ? 295  ASP A O   1 
ATOM   2246  C CB  . ASP A  1 289 ? -49.032 -19.161  74.774  1.00 32.10 ? 295  ASP A CB  1 
ATOM   2247  C CG  . ASP A  1 289 ? -50.244 -19.907  75.278  1.00 34.40 ? 295  ASP A CG  1 
ATOM   2248  O OD1 . ASP A  1 289 ? -50.284 -20.218  76.487  1.00 36.53 ? 295  ASP A OD1 1 
ATOM   2249  O OD2 . ASP A  1 289 ? -51.158 -20.175  74.469  1.00 32.02 ? 295  ASP A OD2 1 
ATOM   2250  N N   . LYS A  1 290 ? -46.944 -20.724  77.336  1.00 22.67 ? 296  LYS A N   1 
ATOM   2251  C CA  . LYS A  1 290 ? -46.261 -21.950  77.739  1.00 18.74 ? 296  LYS A CA  1 
ATOM   2252  C C   . LYS A  1 290 ? -47.220 -23.130  77.801  1.00 17.78 ? 296  LYS A C   1 
ATOM   2253  O O   . LYS A  1 290 ? -46.807 -24.268  78.003  1.00 21.71 ? 296  LYS A O   1 
ATOM   2254  C CB  . LYS A  1 290 ? -45.572 -21.765  79.091  1.00 21.58 ? 296  LYS A CB  1 
ATOM   2255  C CG  . LYS A  1 290 ? -44.435 -20.758  79.069  1.00 23.37 ? 296  LYS A CG  1 
ATOM   2256  C CD  . LYS A  1 290 ? -43.632 -20.786  80.352  1.00 25.02 ? 296  LYS A CD  1 
ATOM   2257  C CE  . LYS A  1 290 ? -44.383 -20.157  81.513  1.00 31.59 ? 296  LYS A CE  1 
ATOM   2258  N NZ  . LYS A  1 290 ? -44.599 -18.682  81.372  1.00 39.57 ? 296  LYS A NZ  1 
ATOM   2259  N N   . SER A  1 291 ? -48.502 -22.860  77.612  1.00 19.56 ? 297  SER A N   1 
ATOM   2260  C CA  . SER A  1 291 ? -49.490 -23.931  77.582  1.00 19.00 ? 297  SER A CA  1 
ATOM   2261  C C   . SER A  1 291 ? -49.460 -24.677  76.249  1.00 14.78 ? 297  SER A C   1 
ATOM   2262  O O   . SER A  1 291 ? -49.872 -25.823  76.172  1.00 16.11 ? 297  SER A O   1 
ATOM   2263  C CB  . SER A  1 291 ? -50.895 -23.380  77.844  1.00 20.69 ? 297  SER A CB  1 
ATOM   2264  O OG  . SER A  1 291 ? -51.523 -22.952  76.642  1.00 22.40 ? 297  SER A OG  1 
ATOM   2265  N N   . TRP A  1 292 ? -48.984 -24.024  75.192  1.00 15.18 ? 298  TRP A N   1 
ATOM   2266  C CA  . TRP A  1 292 ? -48.908 -24.674  73.881  1.00 12.96 ? 298  TRP A CA  1 
ATOM   2267  C C   . TRP A  1 292 ? -47.580 -24.309  73.237  1.00 13.06 ? 298  TRP A C   1 
ATOM   2268  O O   . TRP A  1 292 ? -47.530 -23.505  72.307  1.00 15.45 ? 298  TRP A O   1 
ATOM   2269  C CB  . TRP A  1 292 ? -50.088 -24.266  72.980  1.00 8.79  ? 298  TRP A CB  1 
ATOM   2270  C CG  . TRP A  1 292 ? -50.379 -25.241  71.861  1.00 10.31 ? 298  TRP A CG  1 
ATOM   2271  C CD1 . TRP A  1 292 ? -49.880 -25.199  70.601  1.00 11.73 ? 298  TRP A CD1 1 
ATOM   2272  C CD2 . TRP A  1 292 ? -51.242 -26.389  71.910  1.00 9.01  ? 298  TRP A CD2 1 
ATOM   2273  N NE1 . TRP A  1 292 ? -50.362 -26.247  69.858  1.00 14.76 ? 298  TRP A NE1 1 
ATOM   2274  C CE2 . TRP A  1 292 ? -51.205 -26.992  70.637  1.00 10.79 ? 298  TRP A CE2 1 
ATOM   2275  C CE3 . TRP A  1 292 ? -52.034 -26.969  72.908  1.00 14.16 ? 298  TRP A CE3 1 
ATOM   2276  C CZ2 . TRP A  1 292 ? -51.932 -28.140  70.326  1.00 13.82 ? 298  TRP A CZ2 1 
ATOM   2277  C CZ3 . TRP A  1 292 ? -52.747 -28.119  72.603  1.00 14.49 ? 298  TRP A CZ3 1 
ATOM   2278  C CH2 . TRP A  1 292 ? -52.696 -28.688  71.320  1.00 12.19 ? 298  TRP A CH2 1 
ATOM   2279  N N   . PRO A  1 293 ? -46.490 -24.899  73.743  1.00 12.08 ? 299  PRO A N   1 
ATOM   2280  C CA  . PRO A  1 293 ? -45.151 -24.461  73.351  1.00 13.82 ? 299  PRO A CA  1 
ATOM   2281  C C   . PRO A  1 293 ? -44.728 -24.938  71.966  1.00 14.63 ? 299  PRO A C   1 
ATOM   2282  O O   . PRO A  1 293 ? -45.171 -25.978  71.491  1.00 20.02 ? 299  PRO A O   1 
ATOM   2283  C CB  . PRO A  1 293 ? -44.262 -25.087  74.422  1.00 13.64 ? 299  PRO A CB  1 
ATOM   2284  C CG  . PRO A  1 293 ? -44.985 -26.325  74.789  1.00 14.03 ? 299  PRO A CG  1 
ATOM   2285  C CD  . PRO A  1 293 ? -46.438 -25.965  74.759  1.00 11.03 ? 299  PRO A CD  1 
ATOM   2286  N N   . ILE A  1 294 ? -43.849 -24.167  71.340  1.00 11.87 ? 300  ILE A N   1 
ATOM   2287  C CA  . ILE A  1 294 ? -43.308 -24.522  70.049  1.00 9.88  ? 300  ILE A CA  1 
ATOM   2288  C C   . ILE A  1 294 ? -41.910 -25.083  70.254  1.00 10.21 ? 300  ILE A C   1 
ATOM   2289  O O   . ILE A  1 294 ? -40.991 -24.369  70.649  1.00 11.34 ? 300  ILE A O   1 
ATOM   2290  C CB  . ILE A  1 294 ? -43.276 -23.317  69.110  1.00 12.57 ? 300  ILE A CB  1 
ATOM   2291  C CG1 . ILE A  1 294 ? -44.669 -22.675  69.033  1.00 12.60 ? 300  ILE A CG1 1 
ATOM   2292  C CG2 . ILE A  1 294 ? -42.751 -23.720  67.730  1.00 12.48 ? 300  ILE A CG2 1 
ATOM   2293  C CD1 . ILE A  1 294 ? -45.795 -23.632  68.640  1.00 11.80 ? 300  ILE A CD1 1 
ATOM   2294  N N   . TRP A  1 295 ? -41.767 -26.379  70.028  1.00 7.74  ? 301  TRP A N   1 
ATOM   2295  C CA  . TRP A  1 295 ? -40.466 -27.015  70.114  1.00 7.92  ? 301  TRP A CA  1 
ATOM   2296  C C   . TRP A  1 295 ? -39.700 -26.725  68.838  1.00 10.10 ? 301  TRP A C   1 
ATOM   2297  O O   . TRP A  1 295 ? -40.298 -26.646  67.772  1.00 11.83 ? 301  TRP A O   1 
ATOM   2298  C CB  . TRP A  1 295 ? -40.597 -28.527  70.328  1.00 10.33 ? 301  TRP A CB  1 
ATOM   2299  C CG  . TRP A  1 295 ? -39.268 -29.207  70.403  1.00 9.76  ? 301  TRP A CG  1 
ATOM   2300  C CD1 . TRP A  1 295 ? -38.643 -29.885  69.402  1.00 11.99 ? 301  TRP A CD1 1 
ATOM   2301  C CD2 . TRP A  1 295 ? -38.382 -29.252  71.531  1.00 9.50  ? 301  TRP A CD2 1 
ATOM   2302  N NE1 . TRP A  1 295 ? -37.436 -30.359  69.839  1.00 13.23 ? 301  TRP A NE1 1 
ATOM   2303  C CE2 . TRP A  1 295 ? -37.250 -29.978  71.140  1.00 10.72 ? 301  TRP A CE2 1 
ATOM   2304  C CE3 . TRP A  1 295 ? -38.450 -28.762  72.841  1.00 11.93 ? 301  TRP A CE3 1 
ATOM   2305  C CZ2 . TRP A  1 295 ? -36.180 -30.224  72.002  1.00 12.71 ? 301  TRP A CZ2 1 
ATOM   2306  C CZ3 . TRP A  1 295 ? -37.392 -29.010  73.699  1.00 11.62 ? 301  TRP A CZ3 1 
ATOM   2307  C CH2 . TRP A  1 295 ? -36.268 -29.729  73.273  1.00 15.73 ? 301  TRP A CH2 1 
ATOM   2308  N N   . THR A  1 296 ? -38.381 -26.575  68.938  1.00 9.53  ? 302  THR A N   1 
ATOM   2309  C CA  . THR A  1 296 ? -37.553 -26.370  67.753  1.00 7.71  ? 302  THR A CA  1 
ATOM   2310  C C   . THR A  1 296 ? -36.136 -26.896  67.974  1.00 16.43 ? 302  THR A C   1 
ATOM   2311  O O   . THR A  1 296 ? -35.835 -27.469  69.026  1.00 15.12 ? 302  THR A O   1 
ATOM   2312  C CB  . THR A  1 296 ? -37.487 -24.870  67.357  1.00 15.36 ? 302  THR A CB  1 
ATOM   2313  O OG1 . THR A  1 296 ? -36.879 -24.728  66.060  1.00 14.76 ? 302  THR A OG1 1 
ATOM   2314  C CG2 . THR A  1 296 ? -36.698 -24.068  68.386  1.00 13.99 ? 302  THR A CG2 1 
ATOM   2315  N N   . TYR A  1 297 ? -35.265 -26.708  66.982  1.00 13.59 ? 303  TYR A N   1 
ATOM   2316  C CA  . TYR A  1 297 ? -33.849 -26.962  67.191  1.00 14.28 ? 303  TYR A CA  1 
ATOM   2317  C C   . TYR A  1 297 ? -33.193 -25.728  67.778  1.00 15.61 ? 303  TYR A C   1 
ATOM   2318  O O   . TYR A  1 297 ? -33.275 -24.639  67.211  1.00 19.81 ? 303  TYR A O   1 
ATOM   2319  C CB  . TYR A  1 297 ? -33.126 -27.344  65.901  1.00 11.04 ? 303  TYR A CB  1 
ATOM   2320  C CG  . TYR A  1 297 ? -31.641 -27.545  66.141  1.00 13.82 ? 303  TYR A CG  1 
ATOM   2321  C CD1 . TYR A  1 297 ? -31.193 -28.512  67.038  1.00 15.22 ? 303  TYR A CD1 1 
ATOM   2322  C CD2 . TYR A  1 297 ? -30.690 -26.774  65.479  1.00 17.70 ? 303  TYR A CD2 1 
ATOM   2323  C CE1 . TYR A  1 297 ? -29.843 -28.700  67.281  1.00 14.29 ? 303  TYR A CE1 1 
ATOM   2324  C CE2 . TYR A  1 297 ? -29.334 -26.961  65.708  1.00 14.21 ? 303  TYR A CE2 1 
ATOM   2325  C CZ  . TYR A  1 297 ? -28.921 -27.923  66.610  1.00 15.66 ? 303  TYR A CZ  1 
ATOM   2326  O OH  . TYR A  1 297 ? -27.581 -28.117  66.846  1.00 19.08 ? 303  TYR A OH  1 
ATOM   2327  N N   . ALA A  1 298 ? -32.533 -25.905  68.911  1.00 10.08 ? 304  ALA A N   1 
ATOM   2328  C CA  . ALA A  1 298 ? -31.818 -24.819  69.550  1.00 11.95 ? 304  ALA A CA  1 
ATOM   2329  C C   . ALA A  1 298 ? -30.617 -25.360  70.296  1.00 16.58 ? 304  ALA A C   1 
ATOM   2330  O O   . ALA A  1 298 ? -30.665 -26.437  70.886  1.00 23.26 ? 304  ALA A O   1 
ATOM   2331  C CB  . ALA A  1 298 ? -32.727 -24.060  70.501  1.00 18.73 ? 304  ALA A CB  1 
ATOM   2332  N N   . GLU A  1 299 ? -29.542 -24.594  70.272  1.00 13.84 ? 305  GLU A N   1 
ATOM   2333  C CA  . GLU A  1 299 ? -28.340 -24.967  70.974  1.00 9.80  ? 305  GLU A CA  1 
ATOM   2334  C C   . GLU A  1 299 ? -28.138 -24.055  72.154  1.00 12.36 ? 305  GLU A C   1 
ATOM   2335  O O   . GLU A  1 299 ? -28.720 -22.979  72.224  1.00 18.26 ? 305  GLU A O   1 
ATOM   2336  C CB  . GLU A  1 299 ? -27.132 -24.897  70.049  1.00 14.71 ? 305  GLU A CB  1 
ATOM   2337  C CG  . GLU A  1 299 ? -27.273 -25.761  68.823  1.00 16.24 ? 305  GLU A CG  1 
ATOM   2338  C CD  . GLU A  1 299 ? -26.150 -25.564  67.812  1.00 24.18 ? 305  GLU A CD  1 
ATOM   2339  O OE1 . GLU A  1 299 ? -25.314 -24.646  67.985  1.00 23.16 ? 305  GLU A OE1 1 
ATOM   2340  O OE2 . GLU A  1 299 ? -26.115 -26.336  66.832  1.00 23.14 ? 305  GLU A OE2 1 
ATOM   2341  N N   . ILE A  1 300 ? -27.311 -24.499  73.084  1.00 11.66 ? 306  ILE A N   1 
ATOM   2342  C CA  . ILE A  1 300 ? -26.859 -23.654  74.169  1.00 13.84 ? 306  ILE A CA  1 
ATOM   2343  C C   . ILE A  1 300 ? -26.050 -22.495  73.599  1.00 17.77 ? 306  ILE A C   1 
ATOM   2344  O O   . ILE A  1 300 ? -25.105 -22.697  72.837  1.00 16.09 ? 306  ILE A O   1 
ATOM   2345  C CB  . ILE A  1 300 ? -26.036 -24.460  75.172  1.00 9.49  ? 306  ILE A CB  1 
ATOM   2346  C CG1 . ILE A  1 300 ? -26.897 -25.592  75.720  1.00 13.34 ? 306  ILE A CG1 1 
ATOM   2347  C CG2 . ILE A  1 300 ? -25.569 -23.578  76.307  1.00 16.06 ? 306  ILE A CG2 1 
ATOM   2348  C CD1 . ILE A  1 300 ? -26.223 -26.408  76.771  1.00 18.29 ? 306  ILE A CD1 1 
ATOM   2349  N N   . THR A  1 301 ? -26.456 -21.273  73.926  1.00 16.32 ? 307  THR A N   1 
ATOM   2350  C CA  . THR A  1 301 ? -25.755 -20.095  73.440  1.00 18.89 ? 307  THR A CA  1 
ATOM   2351  C C   . THR A  1 301 ? -25.451 -19.188  74.621  1.00 17.45 ? 307  THR A C   1 
ATOM   2352  O O   . THR A  1 301 ? -26.051 -19.333  75.681  1.00 15.94 ? 307  THR A O   1 
ATOM   2353  C CB  . THR A  1 301 ? -26.583 -19.303  72.389  1.00 19.84 ? 307  THR A CB  1 
ATOM   2354  O OG1 . THR A  1 301 ? -27.717 -18.719  73.024  1.00 19.82 ? 307  THR A OG1 1 
ATOM   2355  C CG2 . THR A  1 301 ? -27.058 -20.199  71.264  1.00 20.77 ? 307  THR A CG2 1 
ATOM   2356  N N   . PRO A  1 302 ? -24.507 -18.257  74.447  1.00 17.51 ? 308  PRO A N   1 
ATOM   2357  C CA  . PRO A  1 302 ? -24.370 -17.170  75.417  1.00 19.41 ? 308  PRO A CA  1 
ATOM   2358  C C   . PRO A  1 302 ? -25.569 -16.211  75.354  1.00 18.11 ? 308  PRO A C   1 
ATOM   2359  O O   . PRO A  1 302 ? -26.309 -16.211  74.373  1.00 17.28 ? 308  PRO A O   1 
ATOM   2360  C CB  . PRO A  1 302 ? -23.074 -16.481  74.988  1.00 17.77 ? 308  PRO A CB  1 
ATOM   2361  C CG  . PRO A  1 302 ? -22.895 -16.864  73.558  1.00 22.69 ? 308  PRO A CG  1 
ATOM   2362  C CD  . PRO A  1 302 ? -23.458 -18.221  73.411  1.00 20.18 ? 308  PRO A CD  1 
ATOM   2363  N N   . PRO A  1 303 ? -25.782 -15.424  76.412  1.00 18.14 ? 309  PRO A N   1 
ATOM   2364  C CA  . PRO A  1 303 ? -26.885 -14.461  76.367  1.00 15.43 ? 309  PRO A CA  1 
ATOM   2365  C C   . PRO A  1 303 ? -26.585 -13.296  75.423  1.00 15.19 ? 309  PRO A C   1 
ATOM   2366  O O   . PRO A  1 303 ? -25.485 -13.221  74.887  1.00 18.37 ? 309  PRO A O   1 
ATOM   2367  C CB  . PRO A  1 303 ? -27.019 -13.994  77.821  1.00 17.69 ? 309  PRO A CB  1 
ATOM   2368  C CG  . PRO A  1 303 ? -25.818 -14.488  78.534  1.00 22.81 ? 309  PRO A CG  1 
ATOM   2369  C CD  . PRO A  1 303 ? -25.216 -15.595  77.759  1.00 22.47 ? 309  PRO A CD  1 
ATOM   2370  N N   . ALA A  1 304 ? -27.559 -12.422  75.196  1.00 13.23 ? 310  ALA A N   1 
ATOM   2371  C CA  . ALA A  1 304 ? -27.348 -11.258  74.351  1.00 13.21 ? 310  ALA A CA  1 
ATOM   2372  C C   . ALA A  1 304 ? -26.515 -10.208  75.086  1.00 13.88 ? 310  ALA A C   1 
ATOM   2373  O O   . ALA A  1 304 ? -26.601 -10.072  76.305  1.00 14.34 ? 310  ALA A O   1 
ATOM   2374  C CB  . ALA A  1 304 ? -28.684 -10.675  73.895  1.00 14.96 ? 310  ALA A CB  1 
ATOM   2375  N N   . LYS A  1 305 ? -25.697 -9.473   74.343  1.00 14.83 ? 311  LYS A N   1 
ATOM   2376  C CA  . LYS A  1 305 ? -24.762 -8.529   74.949  1.00 15.11 ? 311  LYS A CA  1 
ATOM   2377  C C   . LYS A  1 305 ? -24.892 -7.176   74.273  1.00 11.83 ? 311  LYS A C   1 
ATOM   2378  O O   . LYS A  1 305 ? -25.021 -7.096   73.051  1.00 16.49 ? 311  LYS A O   1 
ATOM   2379  C CB  . LYS A  1 305 ? -23.327 -9.059   74.847  1.00 15.48 ? 311  LYS A CB  1 
ATOM   2380  C CG  . LYS A  1 305 ? -22.261 -8.200   75.510  1.00 15.01 ? 311  LYS A CG  1 
ATOM   2381  C CD  . LYS A  1 305 ? -20.925 -8.940   75.567  1.00 19.98 ? 311  LYS A CD  1 
ATOM   2382  C CE  . LYS A  1 305 ? -19.784 -8.021   75.946  1.00 20.99 ? 311  LYS A CE  1 
ATOM   2383  N NZ  . LYS A  1 305 ? -19.814 -7.604   77.364  1.00 26.30 ? 311  LYS A NZ  1 
ATOM   2384  N N   . PHE A  1 306 ? -24.901 -6.117   75.078  1.00 12.59 ? 312  PHE A N   1 
ATOM   2385  C CA  . PHE A  1 306 ? -24.973 -4.754   74.569  1.00 14.68 ? 312  PHE A CA  1 
ATOM   2386  C C   . PHE A  1 306 ? -23.809 -3.987   75.145  1.00 13.21 ? 312  PHE A C   1 
ATOM   2387  O O   . PHE A  1 306 ? -23.559 -4.050   76.346  1.00 14.74 ? 312  PHE A O   1 
ATOM   2388  C CB  . PHE A  1 306 ? -26.291 -4.079   74.953  1.00 12.69 ? 312  PHE A CB  1 
ATOM   2389  C CG  . PHE A  1 306 ? -27.499 -4.788   74.452  1.00 13.55 ? 312  PHE A CG  1 
ATOM   2390  C CD1 . PHE A  1 306 ? -28.025 -5.867   75.151  1.00 15.00 ? 312  PHE A CD1 1 
ATOM   2391  C CD2 . PHE A  1 306 ? -28.122 -4.375   73.282  1.00 15.57 ? 312  PHE A CD2 1 
ATOM   2392  C CE1 . PHE A  1 306 ? -29.146 -6.527   74.684  1.00 16.62 ? 312  PHE A CE1 1 
ATOM   2393  C CE2 . PHE A  1 306 ? -29.246 -5.027   72.810  1.00 17.27 ? 312  PHE A CE2 1 
ATOM   2394  C CZ  . PHE A  1 306 ? -29.759 -6.104   73.512  1.00 15.85 ? 312  PHE A CZ  1 
ATOM   2395  N N   . VAL A  1 307 ? -23.100 -3.259   74.297  1.00 16.05 ? 313  VAL A N   1 
ATOM   2396  C CA  . VAL A  1 307 ? -21.897 -2.589   74.749  1.00 19.18 ? 313  VAL A CA  1 
ATOM   2397  C C   . VAL A  1 307 ? -21.748 -1.205   74.083  1.00 17.57 ? 313  VAL A C   1 
ATOM   2398  O O   . VAL A  1 307 ? -22.347 -0.950   73.034  1.00 15.19 ? 313  VAL A O   1 
ATOM   2399  C CB  . VAL A  1 307 ? -20.675 -3.514   74.502  1.00 25.26 ? 313  VAL A CB  1 
ATOM   2400  C CG1 . VAL A  1 307 ? -19.580 -2.839   73.699  1.00 30.08 ? 313  VAL A CG1 1 
ATOM   2401  C CG2 . VAL A  1 307 ? -20.170 -4.062   75.821  1.00 23.23 ? 313  VAL A CG2 1 
ATOM   2402  N N   . HIS A  1 308 ? -21.011 -0.316   74.761  1.00 17.60 ? 314  HIS A N   1 
ATOM   2403  C CA  . HIS A  1 308 ? -20.734 1.069    74.355  1.00 16.12 ? 314  HIS A CA  1 
ATOM   2404  C C   . HIS A  1 308 ? -21.913 1.981    74.608  1.00 19.87 ? 314  HIS A C   1 
ATOM   2405  O O   . HIS A  1 308 ? -23.065 1.625    74.355  1.00 21.02 ? 314  HIS A O   1 
ATOM   2406  C CB  . HIS A  1 308 ? -20.314 1.133    72.888  1.00 20.42 ? 314  HIS A CB  1 
ATOM   2407  C CG  . HIS A  1 308 ? -18.911 0.678    72.657  1.00 26.70 ? 314  HIS A CG  1 
ATOM   2408  N ND1 . HIS A  1 308 ? -18.044 0.413    73.692  1.00 33.62 ? 314  HIS A ND1 1 
ATOM   2409  C CD2 . HIS A  1 308 ? -18.256 0.340    71.523  1.00 36.31 ? 314  HIS A CD2 1 
ATOM   2410  C CE1 . HIS A  1 308 ? -16.892 -0.006   73.204  1.00 39.07 ? 314  HIS A CE1 1 
ATOM   2411  N NE2 . HIS A  1 308 ? -16.995 -0.063   71.889  1.00 41.33 ? 314  HIS A NE2 1 
ATOM   2412  N N   . ASP A  1 309 ? -21.605 3.157    75.140  1.00 19.98 ? 315  ASP A N   1 
ATOM   2413  C CA  . ASP A  1 309 ? -22.609 4.153    75.465  1.00 24.76 ? 315  ASP A CA  1 
ATOM   2414  C C   . ASP A  1 309 ? -21.956 5.510    75.684  1.00 31.08 ? 315  ASP A C   1 
ATOM   2415  O O   . ASP A  1 309 ? -21.676 5.897    76.821  1.00 32.30 ? 315  ASP A O   1 
ATOM   2416  C CB  . ASP A  1 309 ? -23.395 3.743    76.709  1.00 26.22 ? 315  ASP A CB  1 
ATOM   2417  C CG  . ASP A  1 309 ? -24.475 4.745    77.079  1.00 30.76 ? 315  ASP A CG  1 
ATOM   2418  O OD1 . ASP A  1 309 ? -24.978 5.464    76.189  1.00 32.53 ? 315  ASP A OD1 1 
ATOM   2419  O OD2 . ASP A  1 309 ? -24.831 4.800    78.272  1.00 33.19 ? 315  ASP A OD2 1 
ATOM   2420  N N   . ASP A  1 310 ? -21.702 6.224    74.595  1.00 30.01 ? 316  ASP A N   1 
ATOM   2421  C CA  . ASP A  1 310 ? -21.151 7.562    74.710  1.00 32.83 ? 316  ASP A CA  1 
ATOM   2422  C C   . ASP A  1 310 ? -21.821 8.532    73.749  1.00 37.12 ? 316  ASP A C   1 
ATOM   2423  O O   . ASP A  1 310 ? -22.938 8.289    73.281  1.00 32.29 ? 316  ASP A O   1 
ATOM   2424  C CB  . ASP A  1 310 ? -19.641 7.539    74.485  1.00 31.87 ? 316  ASP A CB  1 
ATOM   2425  C CG  . ASP A  1 310 ? -19.253 6.916    73.164  1.00 36.77 ? 316  ASP A CG  1 
ATOM   2426  O OD1 . ASP A  1 310 ? -19.921 7.183    72.141  1.00 34.29 ? 316  ASP A OD1 1 
ATOM   2427  O OD2 . ASP A  1 310 ? -18.259 6.159    73.147  1.00 42.70 ? 316  ASP A OD2 1 
ATOM   2428  N N   . GLU A  1 311 ? -21.117 9.626    73.463  1.00 42.87 ? 317  GLU A N   1 
ATOM   2429  C CA  . GLU A  1 311 ? -21.629 10.716   72.638  1.00 43.45 ? 317  GLU A CA  1 
ATOM   2430  C C   . GLU A  1 311 ? -22.249 10.218   71.344  1.00 40.83 ? 317  GLU A C   1 
ATOM   2431  O O   . GLU A  1 311 ? -23.388 10.556   71.029  1.00 45.57 ? 317  GLU A O   1 
ATOM   2432  C CB  . GLU A  1 311 ? -20.509 11.720   72.312  1.00 46.06 ? 317  GLU A CB  1 
ATOM   2433  C CG  . GLU A  1 311 ? -19.902 12.423   73.525  1.00 47.39 ? 317  GLU A CG  1 
ATOM   2434  C CD  . GLU A  1 311 ? -18.784 13.398   73.160  1.00 49.91 ? 317  GLU A CD  1 
ATOM   2435  O OE1 . GLU A  1 311 ? -17.905 13.046   72.343  1.00 48.23 ? 317  GLU A OE1 1 
ATOM   2436  O OE2 . GLU A  1 311 ? -18.781 14.523   73.701  1.00 54.08 ? 317  GLU A OE2 1 
ATOM   2437  N N   . ASP A  1 312 ? -21.507 9.392    70.612  1.00 34.99 ? 318  ASP A N   1 
ATOM   2438  C CA  . ASP A  1 312 ? -21.868 9.066    69.237  1.00 32.30 ? 318  ASP A CA  1 
ATOM   2439  C C   . ASP A  1 312 ? -22.284 7.622    69.021  1.00 30.10 ? 318  ASP A C   1 
ATOM   2440  O O   . ASP A  1 312 ? -22.746 7.268    67.936  1.00 36.21 ? 318  ASP A O   1 
ATOM   2441  C CB  . ASP A  1 312 ? -20.705 9.397    68.301  1.00 35.33 ? 318  ASP A CB  1 
ATOM   2442  C CG  . ASP A  1 312 ? -20.384 10.878   68.275  1.00 38.44 ? 318  ASP A CG  1 
ATOM   2443  O OD1 . ASP A  1 312 ? -21.002 11.611   67.474  1.00 39.45 ? 318  ASP A OD1 1 
ATOM   2444  O OD2 . ASP A  1 312 ? -19.511 11.310   69.057  1.00 41.88 ? 318  ASP A OD2 1 
ATOM   2445  N N   . ARG A  1 313 ? -22.123 6.781    70.035  1.00 24.67 ? 319  ARG A N   1 
ATOM   2446  C CA  . ARG A  1 313 ? -22.568 5.401    69.905  1.00 19.31 ? 319  ARG A CA  1 
ATOM   2447  C C   . ARG A  1 313 ? -23.084 4.837    71.215  1.00 22.55 ? 319  ARG A C   1 
ATOM   2448  O O   . ARG A  1 313 ? -22.597 5.157    72.300  1.00 21.85 ? 319  ARG A O   1 
ATOM   2449  C CB  . ARG A  1 313 ? -21.448 4.506    69.369  1.00 17.75 ? 319  ARG A CB  1 
ATOM   2450  C CG  . ARG A  1 313 ? -20.232 4.434    70.249  1.00 19.05 ? 319  ARG A CG  1 
ATOM   2451  C CD  . ARG A  1 313 ? -19.233 3.418    69.724  1.00 21.43 ? 319  ARG A CD  1 
ATOM   2452  N NE  . ARG A  1 313 ? -17.942 3.554    70.385  1.00 19.61 ? 319  ARG A NE  1 
ATOM   2453  C CZ  . ARG A  1 313 ? -16.874 2.826    70.091  1.00 22.26 ? 319  ARG A CZ  1 
ATOM   2454  N NH1 . ARG A  1 313 ? -16.948 1.890    69.160  1.00 23.66 ? 319  ARG A NH1 1 
ATOM   2455  N NH2 . ARG A  1 313 ? -15.735 3.028    70.738  1.00 26.54 ? 319  ARG A NH2 1 
ATOM   2456  N N   . ARG A  1 314 ? -24.095 3.994    71.086  1.00 21.34 ? 320  ARG A N   1 
ATOM   2457  C CA  . ARG A  1 314 ? -24.695 3.310    72.213  1.00 19.79 ? 320  ARG A CA  1 
ATOM   2458  C C   . ARG A  1 314 ? -25.255 2.006    71.682  1.00 20.62 ? 320  ARG A C   1 
ATOM   2459  O O   . ARG A  1 314 ? -26.148 2.011    70.837  1.00 24.08 ? 320  ARG A O   1 
ATOM   2460  C CB  . ARG A  1 314 ? -25.784 4.168    72.865  1.00 22.38 ? 320  ARG A CB  1 
ATOM   2461  C CG  . ARG A  1 314 ? -26.585 3.477    73.958  1.00 25.75 ? 320  ARG A CG  1 
ATOM   2462  C CD  . ARG A  1 314 ? -27.499 4.454    74.692  1.00 28.65 ? 320  ARG A CD  1 
ATOM   2463  N NE  . ARG A  1 314 ? -28.615 4.904    73.869  1.00 35.92 ? 320  ARG A NE  1 
ATOM   2464  C CZ  . ARG A  1 314 ? -29.448 5.882    74.216  1.00 38.07 ? 320  ARG A CZ  1 
ATOM   2465  N NH1 . ARG A  1 314 ? -29.290 6.511    75.375  1.00 39.52 ? 320  ARG A NH1 1 
ATOM   2466  N NH2 . ARG A  1 314 ? -30.438 6.234    73.405  1.00 35.99 ? 320  ARG A NH2 1 
ATOM   2467  N N   . GLY A  1 315 ? -24.698 0.893    72.136  1.00 18.86 ? 321  GLY A N   1 
ATOM   2468  C CA  . GLY A  1 315 ? -25.210 -0.404   71.745  1.00 15.14 ? 321  GLY A CA  1 
ATOM   2469  C C   . GLY A  1 315 ? -26.492 -0.643   72.512  1.00 16.68 ? 321  GLY A C   1 
ATOM   2470  O O   . GLY A  1 315 ? -26.460 -0.844   73.730  1.00 17.89 ? 321  GLY A O   1 
ATOM   2471  N N   . SER A  1 316 ? -27.623 -0.598   71.813  1.00 15.17 ? 322  SER A N   1 
ATOM   2472  C CA  . SER A  1 316 ? -28.887 -0.794   72.494  1.00 15.66 ? 322  SER A CA  1 
ATOM   2473  C C   . SER A  1 316 ? -30.007 -1.188   71.555  1.00 14.40 ? 322  SER A C   1 
ATOM   2474  O O   . SER A  1 316 ? -29.957 -0.919   70.363  1.00 16.76 ? 322  SER A O   1 
ATOM   2475  C CB  . SER A  1 316 ? -29.284 0.467    73.262  1.00 21.88 ? 322  SER A CB  1 
ATOM   2476  O OG  . SER A  1 316 ? -29.930 1.386    72.405  1.00 33.08 ? 322  SER A OG  1 
ATOM   2477  N N   . ALA A  1 317 ? -31.013 -1.856   72.119  1.00 16.99 ? 323  ALA A N   1 
ATOM   2478  C CA  . ALA A  1 317 ? -32.193 -2.248   71.367  1.00 18.04 ? 323  ALA A CA  1 
ATOM   2479  C C   . ALA A  1 317 ? -33.430 -1.636   72.005  1.00 18.43 ? 323  ALA A C   1 
ATOM   2480  O O   . ALA A  1 317 ? -33.577 -1.613   73.228  1.00 24.52 ? 323  ALA A O   1 
ATOM   2481  C CB  . ALA A  1 317 ? -32.316 -3.764   71.297  1.00 16.70 ? 323  ALA A CB  1 
ATOM   2482  N N   . VAL A  1 318 ? -34.314 -1.130   71.161  1.00 15.10 ? 324  VAL A N   1 
ATOM   2483  C CA  . VAL A  1 318 ? -35.529 -0.475   71.608  1.00 15.02 ? 324  VAL A CA  1 
ATOM   2484  C C   . VAL A  1 318 ? -36.663 -1.006   70.739  1.00 16.65 ? 324  VAL A C   1 
ATOM   2485  O O   . VAL A  1 318 ? -36.492 -1.140   69.526  1.00 16.89 ? 324  VAL A O   1 
ATOM   2486  C CB  . VAL A  1 318 ? -35.399 1.059    71.497  1.00 18.42 ? 324  VAL A CB  1 
ATOM   2487  C CG1 . VAL A  1 318 ? -36.748 1.703    71.450  1.00 23.66 ? 324  VAL A CG1 1 
ATOM   2488  C CG2 . VAL A  1 318 ? -34.581 1.601    72.661  1.00 18.84 ? 324  VAL A CG2 1 
ATOM   2489  N N   . SER A  1 319 ? -37.792 -1.349   71.357  1.00 13.51 ? 325  SER A N   1 
ATOM   2490  C CA  . SER A  1 319 ? -38.916 -1.960   70.645  1.00 13.78 ? 325  SER A CA  1 
ATOM   2491  C C   . SER A  1 319 ? -38.454 -3.083   69.738  1.00 12.45 ? 325  SER A C   1 
ATOM   2492  O O   . SER A  1 319 ? -38.869 -3.175   68.590  1.00 12.56 ? 325  SER A O   1 
ATOM   2493  C CB  . SER A  1 319 ? -39.659 -0.912   69.829  1.00 17.85 ? 325  SER A CB  1 
ATOM   2494  O OG  . SER A  1 319 ? -39.773 0.289    70.564  1.00 16.02 ? 325  SER A OG  1 
ATOM   2495  N N   . SER A  1 320 ? -37.579 -3.927   70.265  1.00 16.01 ? 326  SER A N   1 
ATOM   2496  C CA  . SER A  1 320 ? -36.921 -4.953   69.469  1.00 14.97 ? 326  SER A CA  1 
ATOM   2497  C C   . SER A  1 320 ? -36.851 -6.283   70.209  1.00 13.03 ? 326  SER A C   1 
ATOM   2498  O O   . SER A  1 320 ? -37.019 -6.341   71.426  1.00 13.37 ? 326  SER A O   1 
ATOM   2499  C CB  . SER A  1 320 ? -35.514 -4.494   69.075  1.00 16.83 ? 326  SER A CB  1 
ATOM   2500  O OG  . SER A  1 320 ? -35.555 -3.340   68.246  1.00 16.44 ? 326  SER A OG  1 
ATOM   2501  N N   . VAL A  1 321 ? -36.614 -7.349   69.453  1.00 13.73 ? 327  VAL A N   1 
ATOM   2502  C CA  . VAL A  1 321 ? -36.516 -8.700   69.989  1.00 13.48 ? 327  VAL A CA  1 
ATOM   2503  C C   . VAL A  1 321 ? -35.157 -9.279   69.617  1.00 13.23 ? 327  VAL A C   1 
ATOM   2504  O O   . VAL A  1 321 ? -34.811 -9.326   68.442  1.00 16.18 ? 327  VAL A O   1 
ATOM   2505  C CB  . VAL A  1 321 ? -37.637 -9.593   69.448  1.00 10.18 ? 327  VAL A CB  1 
ATOM   2506  C CG1 . VAL A  1 321 ? -37.336 -11.039  69.717  1.00 10.87 ? 327  VAL A CG1 1 
ATOM   2507  C CG2 . VAL A  1 321 ? -38.965 -9.201   70.044  1.00 12.20 ? 327  VAL A CG2 1 
ATOM   2508  N N   . VAL A  1 322 ? -34.379 -9.710   70.606  1.00 11.46 ? 328  VAL A N   1 
ATOM   2509  C CA  . VAL A  1 322 ? -32.997 -10.128  70.352  1.00 11.11 ? 328  VAL A CA  1 
ATOM   2510  C C   . VAL A  1 322 ? -32.714 -11.513  70.921  1.00 13.40 ? 328  VAL A C   1 
ATOM   2511  O O   . VAL A  1 322 ? -32.957 -11.765  72.100  1.00 11.71 ? 328  VAL A O   1 
ATOM   2512  C CB  . VAL A  1 322 ? -31.979 -9.107   70.942  1.00 11.52 ? 328  VAL A CB  1 
ATOM   2513  C CG1 . VAL A  1 322 ? -30.557 -9.473   70.557  1.00 10.55 ? 328  VAL A CG1 1 
ATOM   2514  C CG2 . VAL A  1 322 ? -32.287 -7.706   70.448  1.00 13.85 ? 328  VAL A CG2 1 
ATOM   2515  N N   . SER A  1 323 ? -32.208 -12.411  70.078  1.00 12.92 ? 329  SER A N   1 
ATOM   2516  C CA  . SER A  1 323 ? -31.874 -13.770  70.498  1.00 14.20 ? 329  SER A CA  1 
ATOM   2517  C C   . SER A  1 323 ? -30.485 -13.876  71.108  1.00 14.35 ? 329  SER A C   1 
ATOM   2518  O O   . SER A  1 323 ? -29.723 -12.919  71.134  1.00 17.97 ? 329  SER A O   1 
ATOM   2519  C CB  . SER A  1 323 ? -31.964 -14.741  69.326  1.00 20.24 ? 329  SER A CB  1 
ATOM   2520  O OG  . SER A  1 323 ? -33.271 -14.779  68.803  1.00 25.68 ? 329  SER A OG  1 
ATOM   2521  N N   . GLY A  1 324 ? -30.154 -15.067  71.588  1.00 13.82 ? 330  GLY A N   1 
ATOM   2522  C CA  . GLY A  1 324 ? -28.854 -15.296  72.178  1.00 12.55 ? 330  GLY A CA  1 
ATOM   2523  C C   . GLY A  1 324 ? -27.738 -15.269  71.159  1.00 15.32 ? 330  GLY A C   1 
ATOM   2524  O O   . GLY A  1 324 ? -27.983 -15.244  69.954  1.00 12.62 ? 330  GLY A O   1 
ATOM   2525  N N   . ASP A  1 325 ? -26.509 -15.261  71.669  1.00 19.33 ? 331  ASP A N   1 
ATOM   2526  C CA  . ASP A  1 325 ? -25.307 -15.173  70.848  1.00 15.40 ? 331  ASP A CA  1 
ATOM   2527  C C   . ASP A  1 325 ? -25.331 -13.906  69.979  1.00 17.13 ? 331  ASP A C   1 
ATOM   2528  O O   . ASP A  1 325 ? -24.693 -13.848  68.931  1.00 21.20 ? 331  ASP A O   1 
ATOM   2529  C CB  . ASP A  1 325 ? -25.157 -16.436  69.989  1.00 15.94 ? 331  ASP A CB  1 
ATOM   2530  C CG  . ASP A  1 325 ? -23.786 -16.549  69.340  1.00 25.04 ? 331  ASP A CG  1 
ATOM   2531  O OD1 . ASP A  1 325 ? -22.786 -16.229  70.007  1.00 28.18 ? 331  ASP A OD1 1 
ATOM   2532  O OD2 . ASP A  1 325 ? -23.708 -16.948  68.158  1.00 25.82 ? 331  ASP A OD2 1 
ATOM   2533  N N   . CYS A  1 326 ? -26.067 -12.888  70.413  1.00 11.38 ? 332  CYS A N   1 
ATOM   2534  C CA  . CYS A  1 326 ? -26.080 -11.620  69.690  1.00 14.44 ? 332  CYS A CA  1 
ATOM   2535  C C   . CYS A  1 326 ? -25.224 -10.604  70.421  1.00 14.88 ? 332  CYS A C   1 
ATOM   2536  O O   . CYS A  1 326 ? -25.371 -10.417  71.619  1.00 14.20 ? 332  CYS A O   1 
ATOM   2537  C CB  . CYS A  1 326 ? -27.504 -11.084  69.525  1.00 12.83 ? 332  CYS A CB  1 
ATOM   2538  S SG  . CYS A  1 326 ? -28.492 -11.931  68.277  1.00 16.91 ? 332  CYS A SG  1 
ATOM   2539  N N   . ILE A  1 327 ? -24.306 -9.960   69.714  1.00 16.27 ? 333  ILE A N   1 
ATOM   2540  C CA  . ILE A  1 327 ? -23.522 -8.906   70.338  1.00 12.58 ? 333  ILE A CA  1 
ATOM   2541  C C   . ILE A  1 327 ? -23.846 -7.594   69.661  1.00 12.73 ? 333  ILE A C   1 
ATOM   2542  O O   . ILE A  1 327 ? -23.574 -7.410   68.470  1.00 17.36 ? 333  ILE A O   1 
ATOM   2543  C CB  . ILE A  1 327 ? -22.012 -9.169   70.264  1.00 14.45 ? 333  ILE A CB  1 
ATOM   2544  C CG1 . ILE A  1 327 ? -21.689 -10.525  70.890  1.00 12.75 ? 333  ILE A CG1 1 
ATOM   2545  C CG2 . ILE A  1 327 ? -21.255 -8.057   70.986  1.00 13.60 ? 333  ILE A CG2 1 
ATOM   2546  C CD1 . ILE A  1 327 ? -20.222 -10.759  71.121  1.00 15.50 ? 333  ILE A CD1 1 
ATOM   2547  N N   . ILE A  1 328 ? -24.453 -6.697   70.428  1.00 13.50 ? 334  ILE A N   1 
ATOM   2548  C CA  . ILE A  1 328 ? -24.862 -5.386   69.942  1.00 15.54 ? 334  ILE A CA  1 
ATOM   2549  C C   . ILE A  1 328 ? -23.850 -4.339   70.400  1.00 16.10 ? 334  ILE A C   1 
ATOM   2550  O O   . ILE A  1 328 ? -23.982 -3.771   71.481  1.00 17.99 ? 334  ILE A O   1 
ATOM   2551  C CB  . ILE A  1 328 ? -26.258 -5.020   70.449  1.00 15.97 ? 334  ILE A CB  1 
ATOM   2552  C CG1 . ILE A  1 328 ? -27.212 -6.208   70.284  1.00 18.89 ? 334  ILE A CG1 1 
ATOM   2553  C CG2 . ILE A  1 328 ? -26.760 -3.767   69.766  1.00 16.56 ? 334  ILE A CG2 1 
ATOM   2554  C CD1 . ILE A  1 328 ? -27.450 -6.615   68.853  1.00 25.23 ? 334  ILE A CD1 1 
ATOM   2555  N N   . SER A  1 329 ? -22.832 -4.110   69.573  1.00 15.33 ? 335  SER A N   1 
ATOM   2556  C CA  . SER A  1 329 ? -21.677 -3.308   69.965  1.00 17.53 ? 335  SER A CA  1 
ATOM   2557  C C   . SER A  1 329 ? -21.711 -1.926   69.329  1.00 19.11 ? 335  SER A C   1 
ATOM   2558  O O   . SER A  1 329 ? -21.229 -1.742   68.217  1.00 22.07 ? 335  SER A O   1 
ATOM   2559  C CB  . SER A  1 329 ? -20.381 -4.031   69.581  1.00 19.24 ? 335  SER A CB  1 
ATOM   2560  O OG  . SER A  1 329 ? -19.243 -3.314   70.024  1.00 18.47 ? 335  SER A OG  1 
ATOM   2561  N N   . GLY A  1 330 ? -22.287 -0.958   70.033  1.00 15.68 ? 336  GLY A N   1 
ATOM   2562  C CA  . GLY A  1 330 ? -22.368 0.399    69.526  1.00 15.74 ? 336  GLY A CA  1 
ATOM   2563  C C   . GLY A  1 330 ? -23.400 0.535    68.424  1.00 17.62 ? 336  GLY A C   1 
ATOM   2564  O O   . GLY A  1 330 ? -23.448 1.544    67.723  1.00 20.36 ? 336  GLY A O   1 
ATOM   2565  N N   . ALA A  1 331 ? -24.231 -0.486   68.269  1.00 16.92 ? 337  ALA A N   1 
ATOM   2566  C CA  . ALA A  1 331 ? -25.265 -0.457   67.251  1.00 13.66 ? 337  ALA A CA  1 
ATOM   2567  C C   . ALA A  1 331 ? -26.631 -0.139   67.866  1.00 17.31 ? 337  ALA A C   1 
ATOM   2568  O O   . ALA A  1 331 ? -27.016 -0.705   68.886  1.00 16.47 ? 337  ALA A O   1 
ATOM   2569  C CB  . ALA A  1 331 ? -25.306 -1.770   66.513  1.00 13.44 ? 337  ALA A CB  1 
ATOM   2570  N N   . ALA A  1 332 ? -27.357 0.771    67.225  1.00 18.64 ? 338  ALA A N   1 
ATOM   2571  C CA  . ALA A  1 332 ? -28.684 1.163    67.678  1.00 17.81 ? 338  ALA A CA  1 
ATOM   2572  C C   . ALA A  1 332 ? -29.760 0.424    66.898  1.00 17.11 ? 338  ALA A C   1 
ATOM   2573  O O   . ALA A  1 332 ? -29.871 0.592    65.685  1.00 18.64 ? 338  ALA A O   1 
ATOM   2574  C CB  . ALA A  1 332 ? -28.865 2.667    67.533  1.00 16.49 ? 338  ALA A CB  1 
ATOM   2575  N N   . LEU A  1 333 ? -30.554 -0.385   67.595  1.00 17.14 ? 339  LEU A N   1 
ATOM   2576  C CA  . LEU A  1 333 ? -31.634 -1.137   66.960  1.00 15.78 ? 339  LEU A CA  1 
ATOM   2577  C C   . LEU A  1 333 ? -33.005 -0.621   67.372  1.00 16.42 ? 339  LEU A C   1 
ATOM   2578  O O   . LEU A  1 333 ? -33.250 -0.353   68.552  1.00 17.27 ? 339  LEU A O   1 
ATOM   2579  C CB  . LEU A  1 333 ? -31.539 -2.622   67.306  1.00 17.80 ? 339  LEU A CB  1 
ATOM   2580  C CG  . LEU A  1 333 ? -30.141 -3.226   67.383  1.00 22.46 ? 339  LEU A CG  1 
ATOM   2581  C CD1 . LEU A  1 333 ? -30.250 -4.712   67.695  1.00 20.81 ? 339  LEU A CD1 1 
ATOM   2582  C CD2 . LEU A  1 333 ? -29.366 -2.976   66.103  1.00 19.42 ? 339  LEU A CD2 1 
ATOM   2583  N N   . ASN A  1 334 ? -33.897 -0.491   66.396  1.00 14.65 ? 340  ASN A N   1 
ATOM   2584  C CA  . ASN A  1 334 ? -35.268 -0.096   66.667  1.00 16.75 ? 340  ASN A CA  1 
ATOM   2585  C C   . ASN A  1 334 ? -36.237 -0.884   65.804  1.00 15.57 ? 340  ASN A C   1 
ATOM   2586  O O   . ASN A  1 334 ? -36.010 -1.052   64.614  1.00 14.60 ? 340  ASN A O   1 
ATOM   2587  C CB  . ASN A  1 334 ? -35.470 1.401    66.429  1.00 17.03 ? 340  ASN A CB  1 
ATOM   2588  C CG  . ASN A  1 334 ? -36.898 1.845    66.712  1.00 21.59 ? 340  ASN A CG  1 
ATOM   2589  O OD1 . ASN A  1 334 ? -37.530 1.377    67.656  1.00 20.71 ? 340  ASN A OD1 1 
ATOM   2590  N ND2 . ASN A  1 334 ? -37.417 2.735    65.879  1.00 28.75 ? 340  ASN A ND2 1 
ATOM   2591  N N   . ARG A  1 335 ? -37.317 -1.352   66.416  1.00 13.88 ? 341  ARG A N   1 
ATOM   2592  C CA  . ARG A  1 335 ? -38.346 -2.119   65.714  1.00 14.02 ? 341  ARG A CA  1 
ATOM   2593  C C   . ARG A  1 335 ? -37.736 -3.208   64.834  1.00 16.85 ? 341  ARG A C   1 
ATOM   2594  O O   . ARG A  1 335 ? -38.050 -3.340   63.649  1.00 13.82 ? 341  ARG A O   1 
ATOM   2595  C CB  . ARG A  1 335 ? -39.238 -1.197   64.887  1.00 15.79 ? 341  ARG A CB  1 
ATOM   2596  C CG  . ARG A  1 335 ? -40.654 -1.715   64.797  1.00 26.25 ? 341  ARG A CG  1 
ATOM   2597  C CD  . ARG A  1 335 ? -41.445 -1.026   63.712  1.00 34.08 ? 341  ARG A CD  1 
ATOM   2598  N NE  . ARG A  1 335 ? -42.784 -1.593   63.595  1.00 33.64 ? 341  ARG A NE  1 
ATOM   2599  C CZ  . ARG A  1 335 ? -43.460 -1.678   62.457  1.00 34.47 ? 341  ARG A CZ  1 
ATOM   2600  N NH1 . ARG A  1 335 ? -42.922 -1.227   61.337  1.00 36.05 ? 341  ARG A NH1 1 
ATOM   2601  N NH2 . ARG A  1 335 ? -44.676 -2.207   62.441  1.00 32.28 ? 341  ARG A NH2 1 
ATOM   2602  N N   . SER A  1 336 ? -36.847 -3.986   65.433  1.00 16.30 ? 342  SER A N   1 
ATOM   2603  C CA  . SER A  1 336 ? -36.158 -5.038   64.712  1.00 17.52 ? 342  SER A CA  1 
ATOM   2604  C C   . SER A  1 336 ? -36.199 -6.353   65.463  1.00 15.85 ? 342  SER A C   1 
ATOM   2605  O O   . SER A  1 336 ? -36.258 -6.385   66.689  1.00 13.91 ? 342  SER A O   1 
ATOM   2606  C CB  . SER A  1 336 ? -34.706 -4.640   64.447  1.00 16.43 ? 342  SER A CB  1 
ATOM   2607  O OG  . SER A  1 336 ? -34.649 -3.477   63.645  1.00 18.90 ? 342  SER A OG  1 
ATOM   2608  N N   . LEU A  1 337 ? -36.158 -7.438   64.709  1.00 14.54 ? 343  LEU A N   1 
ATOM   2609  C CA  . LEU A  1 337 ? -36.108 -8.769   65.283  1.00 15.44 ? 343  LEU A CA  1 
ATOM   2610  C C   . LEU A  1 337 ? -34.809 -9.437   64.835  1.00 14.82 ? 343  LEU A C   1 
ATOM   2611  O O   . LEU A  1 337 ? -34.543 -9.549   63.643  1.00 14.78 ? 343  LEU A O   1 
ATOM   2612  C CB  . LEU A  1 337 ? -37.343 -9.570   64.862  1.00 11.47 ? 343  LEU A CB  1 
ATOM   2613  C CG  . LEU A  1 337 ? -37.542 -10.953  65.467  1.00 12.08 ? 343  LEU A CG  1 
ATOM   2614  C CD1 . LEU A  1 337 ? -39.011 -11.215  65.621  1.00 15.07 ? 343  LEU A CD1 1 
ATOM   2615  C CD2 . LEU A  1 337 ? -36.935 -11.985  64.566  1.00 13.48 ? 343  LEU A CD2 1 
ATOM   2616  N N   . LEU A  1 338 ? -33.994 -9.851   65.801  1.00 15.00 ? 344  LEU A N   1 
ATOM   2617  C CA  . LEU A  1 338 ? -32.701 -10.472  65.525  1.00 15.93 ? 344  LEU A CA  1 
ATOM   2618  C C   . LEU A  1 338 ? -32.696 -11.931  65.934  1.00 17.77 ? 344  LEU A C   1 
ATOM   2619  O O   . LEU A  1 338 ? -32.910 -12.251  67.102  1.00 17.38 ? 344  LEU A O   1 
ATOM   2620  C CB  . LEU A  1 338 ? -31.576 -9.743   66.262  1.00 16.04 ? 344  LEU A CB  1 
ATOM   2621  C CG  . LEU A  1 338 ? -30.959 -8.526   65.586  1.00 16.26 ? 344  LEU A CG  1 
ATOM   2622  C CD1 . LEU A  1 338 ? -31.955 -7.372   65.455  1.00 12.53 ? 344  LEU A CD1 1 
ATOM   2623  C CD2 . LEU A  1 338 ? -29.731 -8.101   66.348  1.00 15.74 ? 344  LEU A CD2 1 
ATOM   2624  N N   . PHE A  1 339 ? -32.455 -12.813  64.970  1.00 14.00 ? 345  PHE A N   1 
ATOM   2625  C CA  . PHE A  1 339 ? -32.291 -14.234  65.241  1.00 12.69 ? 345  PHE A CA  1 
ATOM   2626  C C   . PHE A  1 339 ? -30.923 -14.480  65.872  1.00 11.94 ? 345  PHE A C   1 
ATOM   2627  O O   . PHE A  1 339 ? -30.117 -13.576  65.988  1.00 14.26 ? 345  PHE A O   1 
ATOM   2628  C CB  . PHE A  1 339 ? -32.429 -15.065  63.967  1.00 13.45 ? 345  PHE A CB  1 
ATOM   2629  C CG  . PHE A  1 339 ? -33.832 -15.132  63.409  1.00 14.25 ? 345  PHE A CG  1 
ATOM   2630  C CD1 . PHE A  1 339 ? -34.411 -14.037  62.788  1.00 18.97 ? 345  PHE A CD1 1 
ATOM   2631  C CD2 . PHE A  1 339 ? -34.553 -16.311  63.470  1.00 17.46 ? 345  PHE A CD2 1 
ATOM   2632  C CE1 . PHE A  1 339 ? -35.685 -14.117  62.255  1.00 16.43 ? 345  PHE A CE1 1 
ATOM   2633  C CE2 . PHE A  1 339 ? -35.828 -16.391  62.951  1.00 14.66 ? 345  PHE A CE2 1 
ATOM   2634  C CZ  . PHE A  1 339 ? -36.389 -15.296  62.335  1.00 13.32 ? 345  PHE A CZ  1 
ATOM   2635  N N   . THR A  1 340 ? -30.663 -15.716  66.262  1.00 14.90 ? 346  THR A N   1 
ATOM   2636  C CA  . THR A  1 340 ? -29.434 -16.063  66.969  1.00 13.53 ? 346  THR A CA  1 
ATOM   2637  C C   . THR A  1 340 ? -28.141 -15.749  66.211  1.00 15.20 ? 346  THR A C   1 
ATOM   2638  O O   . THR A  1 340 ? -28.024 -16.012  65.015  1.00 15.52 ? 346  THR A O   1 
ATOM   2639  C CB  . THR A  1 340 ? -29.440 -17.555  67.312  1.00 17.33 ? 346  THR A CB  1 
ATOM   2640  O OG1 . THR A  1 340 ? -30.597 -17.843  68.109  1.00 20.55 ? 346  THR A OG1 1 
ATOM   2641  C CG2 . THR A  1 340 ? -28.198 -17.931  68.072  1.00 14.72 ? 346  THR A CG2 1 
ATOM   2642  N N   . GLY A  1 341 ? -27.170 -15.185  66.917  1.00 15.80 ? 347  GLY A N   1 
ATOM   2643  C CA  . GLY A  1 341 ? -25.831 -15.065  66.387  1.00 14.42 ? 347  GLY A CA  1 
ATOM   2644  C C   . GLY A  1 341 ? -25.480 -13.766  65.693  1.00 15.79 ? 347  GLY A C   1 
ATOM   2645  O O   . GLY A  1 341 ? -24.407 -13.662  65.099  1.00 21.73 ? 347  GLY A O   1 
ATOM   2646  N N   . VAL A  1 342 ? -26.352 -12.768  65.757  1.00 12.87 ? 348  VAL A N   1 
ATOM   2647  C CA  . VAL A  1 342 ? -26.091 -11.538  65.007  1.00 15.89 ? 348  VAL A CA  1 
ATOM   2648  C C   . VAL A  1 342 ? -25.029 -10.674  65.681  1.00 18.97 ? 348  VAL A C   1 
ATOM   2649  O O   . VAL A  1 342 ? -25.027 -10.500  66.897  1.00 18.84 ? 348  VAL A O   1 
ATOM   2650  C CB  . VAL A  1 342 ? -27.379 -10.725  64.803  1.00 16.58 ? 348  VAL A CB  1 
ATOM   2651  C CG1 . VAL A  1 342 ? -27.084 -9.431   64.060  1.00 17.02 ? 348  VAL A CG1 1 
ATOM   2652  C CG2 . VAL A  1 342 ? -28.395 -11.561  64.027  1.00 15.82 ? 348  VAL A CG2 1 
ATOM   2653  N N   . ARG A  1 343 ? -24.095 -10.174  64.874  1.00 16.98 ? 349  ARG A N   1 
ATOM   2654  C CA  . ARG A  1 343 ? -23.079 -9.238   65.329  1.00 14.25 ? 349  ARG A CA  1 
ATOM   2655  C C   . ARG A  1 343 ? -23.331 -7.892   64.668  1.00 14.76 ? 349  ARG A C   1 
ATOM   2656  O O   . ARG A  1 343 ? -23.244 -7.778   63.453  1.00 19.42 ? 349  ARG A O   1 
ATOM   2657  C CB  . ARG A  1 343 ? -21.676 -9.742   64.983  1.00 15.07 ? 349  ARG A CB  1 
ATOM   2658  C CG  . ARG A  1 343 ? -21.348 -11.128  65.515  1.00 19.73 ? 349  ARG A CG  1 
ATOM   2659  C CD  . ARG A  1 343 ? -20.720 -11.019  66.891  1.00 23.02 ? 349  ARG A CD  1 
ATOM   2660  N NE  . ARG A  1 343 ? -20.425 -12.306  67.513  1.00 23.17 ? 349  ARG A NE  1 
ATOM   2661  C CZ  . ARG A  1 343 ? -21.330 -13.043  68.145  1.00 23.62 ? 349  ARG A CZ  1 
ATOM   2662  N NH1 . ARG A  1 343 ? -20.992 -14.203  68.706  1.00 21.75 ? 349  ARG A NH1 1 
ATOM   2663  N NH2 . ARG A  1 343 ? -22.580 -12.617  68.203  1.00 23.01 ? 349  ARG A NH2 1 
ATOM   2664  N N   . ALA A  1 344 ? -23.685 -6.883   65.453  1.00 14.37 ? 350  ALA A N   1 
ATOM   2665  C CA  . ALA A  1 344 ? -23.897 -5.550   64.903  1.00 17.01 ? 350  ALA A CA  1 
ATOM   2666  C C   . ALA A  1 344 ? -22.869 -4.621   65.513  1.00 18.69 ? 350  ALA A C   1 
ATOM   2667  O O   . ALA A  1 344 ? -22.727 -4.568   66.730  1.00 18.35 ? 350  ALA A O   1 
ATOM   2668  C CB  . ALA A  1 344 ? -25.296 -5.063   65.176  1.00 16.34 ? 350  ALA A CB  1 
ATOM   2669  N N   . ASN A  1 345 ? -22.149 -3.893   64.664  1.00 17.15 ? 351  ASN A N   1 
ATOM   2670  C CA  . ASN A  1 345 ? -20.968 -3.173   65.115  1.00 16.91 ? 351  ASN A CA  1 
ATOM   2671  C C   . ASN A  1 345 ? -21.178 -1.683   65.189  1.00 17.76 ? 351  ASN A C   1 
ATOM   2672  O O   . ASN A  1 345 ? -22.232 -1.174   64.811  1.00 19.72 ? 351  ASN A O   1 
ATOM   2673  C CB  . ASN A  1 345 ? -19.784 -3.483   64.201  1.00 21.08 ? 351  ASN A CB  1 
ATOM   2674  C CG  . ASN A  1 345 ? -19.545 -4.966   64.062  1.00 24.16 ? 351  ASN A CG  1 
ATOM   2675  O OD1 . ASN A  1 345 ? -19.612 -5.514   62.966  1.00 29.03 ? 351  ASN A OD1 1 
ATOM   2676  N ND2 . ASN A  1 345 ? -19.305 -5.634   65.184  1.00 19.64 ? 351  ASN A ND2 1 
ATOM   2677  N N   . SER A  1 346 ? -20.152 -0.996   65.678  1.00 18.68 ? 352  SER A N   1 
ATOM   2678  C CA  . SER A  1 346 ? -20.253 0.403    66.065  1.00 17.15 ? 352  SER A CA  1 
ATOM   2679  C C   . SER A  1 346 ? -20.789 1.312    64.976  1.00 15.30 ? 352  SER A C   1 
ATOM   2680  O O   . SER A  1 346 ? -20.419 1.201    63.812  1.00 20.70 ? 352  SER A O   1 
ATOM   2681  C CB  . SER A  1 346 ? -18.895 0.912    66.529  1.00 14.50 ? 352  SER A CB  1 
ATOM   2682  O OG  . SER A  1 346 ? -18.583 0.382    67.800  1.00 17.25 ? 352  SER A OG  1 
ATOM   2683  N N   . TYR A  1 347 ? -21.682 2.202    65.385  1.00 14.56 ? 353  TYR A N   1 
ATOM   2684  C CA  . TYR A  1 347 ? -22.221 3.267    64.544  1.00 18.55 ? 353  TYR A CA  1 
ATOM   2685  C C   . TYR A  1 347 ? -23.174 2.750    63.464  1.00 22.46 ? 353  TYR A C   1 
ATOM   2686  O O   . TYR A  1 347 ? -23.641 3.523    62.632  1.00 24.92 ? 353  TYR A O   1 
ATOM   2687  C CB  . TYR A  1 347 ? -21.080 4.086    63.913  1.00 18.12 ? 353  TYR A CB  1 
ATOM   2688  C CG  . TYR A  1 347 ? -20.033 4.512    64.923  1.00 19.47 ? 353  TYR A CG  1 
ATOM   2689  C CD1 . TYR A  1 347 ? -20.319 5.476    65.881  1.00 19.05 ? 353  TYR A CD1 1 
ATOM   2690  C CD2 . TYR A  1 347 ? -18.765 3.936    64.933  1.00 20.55 ? 353  TYR A CD2 1 
ATOM   2691  C CE1 . TYR A  1 347 ? -19.376 5.862    66.811  1.00 18.43 ? 353  TYR A CE1 1 
ATOM   2692  C CE2 . TYR A  1 347 ? -17.818 4.314    65.866  1.00 16.87 ? 353  TYR A CE2 1 
ATOM   2693  C CZ  . TYR A  1 347 ? -18.130 5.277    66.800  1.00 17.73 ? 353  TYR A CZ  1 
ATOM   2694  O OH  . TYR A  1 347 ? -17.204 5.665    67.740  1.00 22.65 ? 353  TYR A OH  1 
ATOM   2695  N N   . SER A  1 348 ? -23.489 1.459    63.482  1.00 18.67 ? 354  SER A N   1 
ATOM   2696  C CA  . SER A  1 348 ? -24.522 0.965    62.582  1.00 15.46 ? 354  SER A CA  1 
ATOM   2697  C C   . SER A  1 348 ? -25.909 1.208    63.187  1.00 16.05 ? 354  SER A C   1 
ATOM   2698  O O   . SER A  1 348 ? -26.046 1.392    64.393  1.00 15.62 ? 354  SER A O   1 
ATOM   2699  C CB  . SER A  1 348 ? -24.319 -0.517   62.268  1.00 18.01 ? 354  SER A CB  1 
ATOM   2700  O OG  . SER A  1 348 ? -24.488 -1.314   63.419  1.00 21.96 ? 354  SER A OG  1 
ATOM   2701  N N   . ARG A  1 349 ? -26.929 1.235    62.337  1.00 17.69 ? 355  ARG A N   1 
ATOM   2702  C CA  . ARG A  1 349 ? -28.305 1.418    62.778  1.00 18.85 ? 355  ARG A CA  1 
ATOM   2703  C C   . ARG A  1 349 ? -29.243 0.475    62.041  1.00 22.66 ? 355  ARG A C   1 
ATOM   2704  O O   . ARG A  1 349 ? -29.136 0.313    60.826  1.00 20.26 ? 355  ARG A O   1 
ATOM   2705  C CB  . ARG A  1 349 ? -28.762 2.852    62.554  1.00 20.64 ? 355  ARG A CB  1 
ATOM   2706  C CG  . ARG A  1 349 ? -28.007 3.878    63.338  1.00 28.54 ? 355  ARG A CG  1 
ATOM   2707  C CD  . ARG A  1 349 ? -28.612 5.249    63.109  1.00 38.54 ? 355  ARG A CD  1 
ATOM   2708  N NE  . ARG A  1 349 ? -30.071 5.235    63.226  1.00 39.34 ? 355  ARG A NE  1 
ATOM   2709  C CZ  . ARG A  1 349 ? -30.736 5.409    64.362  1.00 40.97 ? 355  ARG A CZ  1 
ATOM   2710  N NH1 . ARG A  1 349 ? -30.083 5.607    65.498  1.00 39.82 ? 355  ARG A NH1 1 
ATOM   2711  N NH2 . ARG A  1 349 ? -32.060 5.385    64.359  1.00 44.99 ? 355  ARG A NH2 1 
ATOM   2712  N N   . LEU A  1 350 ? -30.163 -0.140   62.782  1.00 19.77 ? 356  LEU A N   1 
ATOM   2713  C CA  . LEU A  1 350 ? -31.180 -1.008   62.194  1.00 16.79 ? 356  LEU A CA  1 
ATOM   2714  C C   . LEU A  1 350 ? -32.569 -0.500   62.536  1.00 15.57 ? 356  LEU A C   1 
ATOM   2715  O O   . LEU A  1 350 ? -32.843 -0.188   63.681  1.00 21.98 ? 356  LEU A O   1 
ATOM   2716  C CB  . LEU A  1 350 ? -31.022 -2.442   62.692  1.00 16.01 ? 356  LEU A CB  1 
ATOM   2717  C CG  . LEU A  1 350 ? -29.797 -3.206   62.214  1.00 21.94 ? 356  LEU A CG  1 
ATOM   2718  C CD1 . LEU A  1 350 ? -29.729 -4.578   62.858  1.00 19.55 ? 356  LEU A CD1 1 
ATOM   2719  C CD2 . LEU A  1 350 ? -29.875 -3.332   60.713  1.00 23.92 ? 356  LEU A CD2 1 
ATOM   2720  N N   . GLU A  1 351 ? -33.440 -0.410   61.546  1.00 17.91 ? 357  GLU A N   1 
ATOM   2721  C CA  . GLU A  1 351 ? -34.830 -0.087   61.807  1.00 18.90 ? 357  GLU A CA  1 
ATOM   2722  C C   . GLU A  1 351 ? -35.723 -0.910   60.915  1.00 16.72 ? 357  GLU A C   1 
ATOM   2723  O O   . GLU A  1 351 ? -35.411 -1.099   59.755  1.00 16.07 ? 357  GLU A O   1 
ATOM   2724  C CB  . GLU A  1 351 ? -35.109 1.392    61.592  1.00 24.19 ? 357  GLU A CB  1 
ATOM   2725  C CG  . GLU A  1 351 ? -34.895 2.226    62.828  1.00 38.07 ? 357  GLU A CG  1 
ATOM   2726  C CD  . GLU A  1 351 ? -35.701 3.504    62.807  1.00 46.24 ? 357  GLU A CD  1 
ATOM   2727  O OE1 . GLU A  1 351 ? -36.508 3.679    61.869  1.00 50.83 ? 357  GLU A OE1 1 
ATOM   2728  O OE2 . GLU A  1 351 ? -35.533 4.330    63.730  1.00 47.26 ? 357  GLU A OE2 1 
ATOM   2729  N N   . ASN A  1 352 ? -36.833 -1.389   61.469  1.00 18.11 ? 358  ASN A N   1 
ATOM   2730  C CA  . ASN A  1 352 ? -37.776 -2.202   60.720  1.00 20.00 ? 358  ASN A CA  1 
ATOM   2731  C C   . ASN A  1 352 ? -37.065 -3.380   60.069  1.00 18.71 ? 358  ASN A C   1 
ATOM   2732  O O   . ASN A  1 352 ? -37.348 -3.726   58.928  1.00 15.67 ? 358  ASN A O   1 
ATOM   2733  C CB  . ASN A  1 352 ? -38.493 -1.357   59.664  1.00 19.85 ? 358  ASN A CB  1 
ATOM   2734  C CG  . ASN A  1 352 ? -39.484 -0.378   60.267  1.00 23.72 ? 358  ASN A CG  1 
ATOM   2735  O OD1 . ASN A  1 352 ? -39.468 -0.116   61.470  1.00 26.51 ? 358  ASN A OD1 1 
ATOM   2736  N ND2 . ASN A  1 352 ? -40.361 0.168    59.424  1.00 27.18 ? 358  ASN A ND2 1 
ATOM   2737  N N   . ALA A  1 353 ? -36.152 -3.992   60.820  1.00 16.82 ? 359  ALA A N   1 
ATOM   2738  C CA  . ALA A  1 353 ? -35.263 -5.014   60.290  1.00 14.87 ? 359  ALA A CA  1 
ATOM   2739  C C   . ALA A  1 353 ? -35.538 -6.405   60.844  1.00 16.19 ? 359  ALA A C   1 
ATOM   2740  O O   . ALA A  1 353 ? -35.575 -6.616   62.054  1.00 17.28 ? 359  ALA A O   1 
ATOM   2741  C CB  . ALA A  1 353 ? -33.820 -4.636   60.568  1.00 13.52 ? 359  ALA A CB  1 
ATOM   2742  N N   . VAL A  1 354 ? -35.718 -7.358   59.940  1.00 13.79 ? 360  VAL A N   1 
ATOM   2743  C CA  . VAL A  1 354 ? -35.798 -8.762   60.306  1.00 10.09 ? 360  VAL A CA  1 
ATOM   2744  C C   . VAL A  1 354 ? -34.471 -9.393   59.923  1.00 13.84 ? 360  VAL A C   1 
ATOM   2745  O O   . VAL A  1 354 ? -34.160 -9.539   58.744  1.00 14.93 ? 360  VAL A O   1 
ATOM   2746  C CB  . VAL A  1 354 ? -36.963 -9.454   59.612  1.00 13.60 ? 360  VAL A CB  1 
ATOM   2747  C CG1 . VAL A  1 354 ? -36.899 -10.954  59.833  1.00 17.15 ? 360  VAL A CG1 1 
ATOM   2748  C CG2 . VAL A  1 354 ? -38.279 -8.880   60.121  1.00 9.97  ? 360  VAL A CG2 1 
ATOM   2749  N N   . VAL A  1 355 ? -33.674 -9.730   60.928  1.00 11.08 ? 361  VAL A N   1 
ATOM   2750  C CA  . VAL A  1 355 ? -32.297 -10.157  60.714  1.00 13.21 ? 361  VAL A CA  1 
ATOM   2751  C C   . VAL A  1 355 ? -32.116 -11.642  61.038  1.00 17.64 ? 361  VAL A C   1 
ATOM   2752  O O   . VAL A  1 355 ? -32.177 -12.043  62.197  1.00 15.40 ? 361  VAL A O   1 
ATOM   2753  C CB  . VAL A  1 355 ? -31.338 -9.323   61.568  1.00 12.92 ? 361  VAL A CB  1 
ATOM   2754  C CG1 . VAL A  1 355 ? -29.907 -9.562   61.150  1.00 15.73 ? 361  VAL A CG1 1 
ATOM   2755  C CG2 . VAL A  1 355 ? -31.675 -7.861   61.442  1.00 13.29 ? 361  VAL A CG2 1 
ATOM   2756  N N   . LEU A  1 356 ? -31.876 -12.445  60.004  1.00 16.02 ? 362  LEU A N   1 
ATOM   2757  C CA  . LEU A  1 356 ? -31.821 -13.904  60.118  1.00 14.94 ? 362  LEU A CA  1 
ATOM   2758  C C   . LEU A  1 356 ? -30.512 -14.361  60.782  1.00 12.38 ? 362  LEU A C   1 
ATOM   2759  O O   . LEU A  1 356 ? -29.645 -13.533  61.028  1.00 13.77 ? 362  LEU A O   1 
ATOM   2760  C CB  . LEU A  1 356 ? -32.015 -14.532  58.730  1.00 11.72 ? 362  LEU A CB  1 
ATOM   2761  C CG  . LEU A  1 356 ? -33.478 -14.900  58.438  1.00 14.06 ? 362  LEU A CG  1 
ATOM   2762  C CD1 . LEU A  1 356 ? -34.399 -13.689  58.435  1.00 13.67 ? 362  LEU A CD1 1 
ATOM   2763  C CD2 . LEU A  1 356 ? -33.617 -15.675  57.138  1.00 12.47 ? 362  LEU A CD2 1 
ATOM   2764  N N   . PRO A  1 357 ? -30.385 -15.666  61.119  1.00 14.80 ? 363  PRO A N   1 
ATOM   2765  C CA  . PRO A  1 357 ? -29.240 -16.064  61.945  1.00 14.10 ? 363  PRO A CA  1 
ATOM   2766  C C   . PRO A  1 357 ? -27.849 -15.710  61.395  1.00 19.60 ? 363  PRO A C   1 
ATOM   2767  O O   . PRO A  1 357 ? -27.590 -15.789  60.198  1.00 19.70 ? 363  PRO A O   1 
ATOM   2768  C CB  . PRO A  1 357 ? -29.403 -17.583  62.038  1.00 12.75 ? 363  PRO A CB  1 
ATOM   2769  C CG  . PRO A  1 357 ? -30.857 -17.793  61.984  1.00 15.32 ? 363  PRO A CG  1 
ATOM   2770  C CD  . PRO A  1 357 ? -31.373 -16.760  61.018  1.00 14.47 ? 363  PRO A CD  1 
ATOM   2771  N N   . SER A  1 358 ? -26.978 -15.284  62.305  1.00 15.57 ? 364  SER A N   1 
ATOM   2772  C CA  . SER A  1 358 ? -25.536 -15.175  62.074  1.00 15.84 ? 364  SER A CA  1 
ATOM   2773  C C   . SER A  1 358 ? -25.115 -14.011  61.175  1.00 19.73 ? 364  SER A C   1 
ATOM   2774  O O   . SER A  1 358 ? -23.964 -13.950  60.749  1.00 29.85 ? 364  SER A O   1 
ATOM   2775  C CB  . SER A  1 358 ? -24.988 -16.486  61.493  1.00 19.26 ? 364  SER A CB  1 
ATOM   2776  O OG  . SER A  1 358 ? -25.046 -17.544  62.437  1.00 20.12 ? 364  SER A OG  1 
ATOM   2777  N N   . VAL A  1 359 ? -26.030 -13.094  60.890  1.00 14.31 ? 365  VAL A N   1 
ATOM   2778  C CA  . VAL A  1 359 ? -25.704 -11.907  60.104  1.00 12.86 ? 365  VAL A CA  1 
ATOM   2779  C C   . VAL A  1 359 ? -24.681 -11.006  60.811  1.00 16.17 ? 365  VAL A C   1 
ATOM   2780  O O   . VAL A  1 359 ? -24.713 -10.859  62.029  1.00 16.82 ? 365  VAL A O   1 
ATOM   2781  C CB  . VAL A  1 359 ? -26.992 -11.112  59.795  1.00 10.27 ? 365  VAL A CB  1 
ATOM   2782  C CG1 . VAL A  1 359 ? -26.696 -9.675   59.408  1.00 10.32 ? 365  VAL A CG1 1 
ATOM   2783  C CG2 . VAL A  1 359 ? -27.778 -11.812  58.724  1.00 12.50 ? 365  VAL A CG2 1 
ATOM   2784  N N   . LYS A  1 360 ? -23.750 -10.431  60.053  1.00 15.68 ? 366  LYS A N   1 
ATOM   2785  C CA  . LYS A  1 360 ? -22.877 -9.385   60.570  1.00 15.56 ? 366  LYS A CA  1 
ATOM   2786  C C   . LYS A  1 360 ? -23.213 -8.045   59.923  1.00 16.98 ? 366  LYS A C   1 
ATOM   2787  O O   . LYS A  1 360 ? -23.293 -7.951   58.703  1.00 18.60 ? 366  LYS A O   1 
ATOM   2788  C CB  . LYS A  1 360 ? -21.407 -9.708   60.314  1.00 19.26 ? 366  LYS A CB  1 
ATOM   2789  C CG  . LYS A  1 360 ? -20.672 -10.286  61.499  1.00 27.89 ? 366  LYS A CG  1 
ATOM   2790  C CD  . LYS A  1 360 ? -19.185 -9.985   61.408  1.00 32.30 ? 366  LYS A CD  1 
ATOM   2791  C CE  . LYS A  1 360 ? -18.833 -8.695   62.128  1.00 32.18 ? 366  LYS A CE  1 
ATOM   2792  N NZ  . LYS A  1 360 ? -18.431 -8.945   63.552  1.00 27.78 ? 366  LYS A NZ  1 
ATOM   2793  N N   . ILE A  1 361 ? -23.426 -7.020   60.742  1.00 18.77 ? 367  ILE A N   1 
ATOM   2794  C CA  . ILE A  1 361 ? -23.626 -5.661   60.253  1.00 14.77 ? 367  ILE A CA  1 
ATOM   2795  C C   . ILE A  1 361 ? -22.357 -4.861   60.534  1.00 18.76 ? 367  ILE A C   1 
ATOM   2796  O O   . ILE A  1 361 ? -21.959 -4.704   61.688  1.00 17.14 ? 367  ILE A O   1 
ATOM   2797  C CB  . ILE A  1 361 ? -24.839 -4.974   60.915  1.00 15.81 ? 367  ILE A CB  1 
ATOM   2798  C CG1 . ILE A  1 361 ? -26.022 -5.932   60.983  1.00 16.58 ? 367  ILE A CG1 1 
ATOM   2799  C CG2 . ILE A  1 361 ? -25.221 -3.701   60.167  1.00 17.74 ? 367  ILE A CG2 1 
ATOM   2800  C CD1 . ILE A  1 361 ? -26.676 -6.150   59.674  1.00 17.22 ? 367  ILE A CD1 1 
ATOM   2801  N N   . GLY A  1 362 ? -21.708 -4.378   59.478  1.00 19.29 ? 368  GLY A N   1 
ATOM   2802  C CA  . GLY A  1 362 ? -20.465 -3.641   59.639  1.00 19.62 ? 368  GLY A CA  1 
ATOM   2803  C C   . GLY A  1 362 ? -20.673 -2.244   60.186  1.00 18.84 ? 368  GLY A C   1 
ATOM   2804  O O   . GLY A  1 362 ? -21.773 -1.697   60.106  1.00 17.49 ? 368  GLY A O   1 
ATOM   2805  N N   . ARG A  1 363 ? -19.619 -1.670   60.757  1.00 20.21 ? 369  ARG A N   1 
ATOM   2806  C CA  . ARG A  1 363 ? -19.673 -0.301   61.251  1.00 16.00 ? 369  ARG A CA  1 
ATOM   2807  C C   . ARG A  1 363 ? -20.307 0.665    60.259  1.00 19.49 ? 369  ARG A C   1 
ATOM   2808  O O   . ARG A  1 363 ? -20.125 0.531    59.050  1.00 22.93 ? 369  ARG A O   1 
ATOM   2809  C CB  . ARG A  1 363 ? -18.277 0.199    61.596  1.00 13.65 ? 369  ARG A CB  1 
ATOM   2810  C CG  . ARG A  1 363 ? -17.689 -0.367   62.867  1.00 17.88 ? 369  ARG A CG  1 
ATOM   2811  C CD  . ARG A  1 363 ? -16.460 0.436    63.244  1.00 24.42 ? 369  ARG A CD  1 
ATOM   2812  N NE  . ARG A  1 363 ? -15.941 0.096    64.564  1.00 30.48 ? 369  ARG A NE  1 
ATOM   2813  C CZ  . ARG A  1 363 ? -15.118 0.879    65.252  1.00 32.83 ? 369  ARG A CZ  1 
ATOM   2814  N NH1 . ARG A  1 363 ? -14.731 2.039    64.740  1.00 36.21 ? 369  ARG A NH1 1 
ATOM   2815  N NH2 . ARG A  1 363 ? -14.681 0.513    66.447  1.00 30.53 ? 369  ARG A NH2 1 
ATOM   2816  N N   . HIS A  1 364 ? -21.067 1.618    60.790  1.00 17.92 ? 370  HIS A N   1 
ATOM   2817  C CA  . HIS A  1 364 ? -21.632 2.732    60.026  1.00 20.35 ? 370  HIS A CA  1 
ATOM   2818  C C   . HIS A  1 364 ? -22.733 2.353    59.030  1.00 21.58 ? 370  HIS A C   1 
ATOM   2819  O O   . HIS A  1 364 ? -23.332 3.232    58.419  1.00 26.97 ? 370  HIS A O   1 
ATOM   2820  C CB  . HIS A  1 364 ? -20.514 3.488    59.289  1.00 19.80 ? 370  HIS A CB  1 
ATOM   2821  C CG  . HIS A  1 364 ? -19.493 4.092    60.204  1.00 17.47 ? 370  HIS A CG  1 
ATOM   2822  N ND1 . HIS A  1 364 ? -19.684 5.299    60.839  1.00 19.92 ? 370  HIS A ND1 1 
ATOM   2823  C CD2 . HIS A  1 364 ? -18.276 3.648    60.601  1.00 19.13 ? 370  HIS A CD2 1 
ATOM   2824  C CE1 . HIS A  1 364 ? -18.627 5.575    61.584  1.00 21.62 ? 370  HIS A CE1 1 
ATOM   2825  N NE2 . HIS A  1 364 ? -17.756 4.591    61.452  1.00 21.25 ? 370  HIS A NE2 1 
ATOM   2826  N N   . ALA A  1 365 ? -23.022 1.068    58.872  1.00 17.04 ? 371  ALA A N   1 
ATOM   2827  C CA  . ALA A  1 365 ? -24.111 0.676    57.983  1.00 16.78 ? 371  ALA A CA  1 
ATOM   2828  C C   . ALA A  1 365 ? -25.457 1.157    58.530  1.00 17.84 ? 371  ALA A C   1 
ATOM   2829  O O   . ALA A  1 365 ? -25.677 1.158    59.737  1.00 21.68 ? 371  ALA A O   1 
ATOM   2830  C CB  . ALA A  1 365 ? -24.117 -0.822   57.790  1.00 17.73 ? 371  ALA A CB  1 
ATOM   2831  N N   . GLN A  1 366 ? -26.350 1.593    57.652  1.00 17.59 ? 372  GLN A N   1 
ATOM   2832  C CA  . GLN A  1 366 ? -27.680 2.001    58.088  1.00 19.77 ? 372  GLN A CA  1 
ATOM   2833  C C   . GLN A  1 366 ? -28.743 1.347    57.225  1.00 22.57 ? 372  GLN A C   1 
ATOM   2834  O O   . GLN A  1 366 ? -28.770 1.529    56.006  1.00 23.34 ? 372  GLN A O   1 
ATOM   2835  C CB  . GLN A  1 366 ? -27.824 3.518    58.057  1.00 20.48 ? 372  GLN A CB  1 
ATOM   2836  C CG  . GLN A  1 366 ? -26.873 4.222    59.000  1.00 27.04 ? 372  GLN A CG  1 
ATOM   2837  C CD  . GLN A  1 366 ? -27.162 5.695    59.101  1.00 34.50 ? 372  GLN A CD  1 
ATOM   2838  O OE1 . GLN A  1 366 ? -27.892 6.247    58.279  1.00 35.25 ? 372  GLN A OE1 1 
ATOM   2839  N NE2 . GLN A  1 366 ? -26.604 6.342    60.118  1.00 37.92 ? 372  GLN A NE2 1 
ATOM   2840  N N   . LEU A  1 367 ? -29.619 0.582    57.868  1.00 17.58 ? 373  LEU A N   1 
ATOM   2841  C CA  . LEU A  1 367 ? -30.581 -0.247   57.157  1.00 15.25 ? 373  LEU A CA  1 
ATOM   2842  C C   . LEU A  1 367 ? -31.991 -0.040   57.681  1.00 18.38 ? 373  LEU A C   1 
ATOM   2843  O O   . LEU A  1 367 ? -32.207 -0.006   58.885  1.00 21.95 ? 373  LEU A O   1 
ATOM   2844  C CB  . LEU A  1 367 ? -30.202 -1.721   57.283  1.00 18.48 ? 373  LEU A CB  1 
ATOM   2845  C CG  . LEU A  1 367 ? -28.725 -2.067   57.092  1.00 21.73 ? 373  LEU A CG  1 
ATOM   2846  C CD1 . LEU A  1 367 ? -28.495 -3.528   57.370  1.00 24.35 ? 373  LEU A CD1 1 
ATOM   2847  C CD2 . LEU A  1 367 ? -28.292 -1.727   55.687  1.00 24.97 ? 373  LEU A CD2 1 
ATOM   2848  N N   . SER A  1 368 ? -32.948 0.072    56.772  1.00 18.80 ? 374  SER A N   1 
ATOM   2849  C CA  . SER A  1 368 ? -34.339 0.245    57.148  1.00 21.38 ? 374  SER A CA  1 
ATOM   2850  C C   . SER A  1 368 ? -35.261 -0.595   56.274  1.00 25.53 ? 374  SER A C   1 
ATOM   2851  O O   . SER A  1 368 ? -35.031 -0.723   55.069  1.00 27.59 ? 374  SER A O   1 
ATOM   2852  C CB  . SER A  1 368 ? -34.740 1.712    57.053  1.00 25.29 ? 374  SER A CB  1 
ATOM   2853  O OG  . SER A  1 368 ? -34.113 2.463    58.073  1.00 33.42 ? 374  SER A OG  1 
ATOM   2854  N N   . ASN A  1 369 ? -36.295 -1.162   56.901  1.00 21.88 ? 375  ASN A N   1 
ATOM   2855  C CA  . ASN A  1 369 ? -37.329 -1.943   56.221  1.00 21.75 ? 375  ASN A CA  1 
ATOM   2856  C C   . ASN A  1 369 ? -36.731 -3.050   55.363  1.00 22.91 ? 375  ASN A C   1 
ATOM   2857  O O   . ASN A  1 369 ? -36.887 -3.078   54.141  1.00 22.81 ? 375  ASN A O   1 
ATOM   2858  C CB  . ASN A  1 369 ? -38.215 -1.012   55.394  1.00 23.27 ? 375  ASN A CB  1 
ATOM   2859  C CG  . ASN A  1 369 ? -38.891 0.052    56.252  1.00 22.97 ? 375  ASN A CG  1 
ATOM   2860  O OD1 . ASN A  1 369 ? -39.798 -0.240   57.028  1.00 23.88 ? 375  ASN A OD1 1 
ATOM   2861  N ND2 . ASN A  1 369 ? -38.431 1.288    56.128  1.00 23.99 ? 375  ASN A ND2 1 
ATOM   2862  N N   . VAL A  1 370 ? -36.031 -3.962   56.034  1.00 20.07 ? 376  VAL A N   1 
ATOM   2863  C CA  . VAL A  1 370 ? -35.281 -5.017   55.372  1.00 19.22 ? 376  VAL A CA  1 
ATOM   2864  C C   . VAL A  1 370 ? -35.526 -6.396   55.994  1.00 18.49 ? 376  VAL A C   1 
ATOM   2865  O O   . VAL A  1 370 ? -35.880 -6.524   57.165  1.00 17.02 ? 376  VAL A O   1 
ATOM   2866  C CB  . VAL A  1 370 ? -33.749 -4.734   55.401  1.00 17.44 ? 376  VAL A CB  1 
ATOM   2867  C CG1 . VAL A  1 370 ? -33.406 -3.476   54.598  1.00 19.30 ? 376  VAL A CG1 1 
ATOM   2868  C CG2 . VAL A  1 370 ? -33.235 -4.616   56.827  1.00 13.20 ? 376  VAL A CG2 1 
ATOM   2869  N N   . VAL A  1 371 ? -35.341 -7.416   55.169  1.00 17.76 ? 377  VAL A N   1 
ATOM   2870  C CA  . VAL A  1 371 ? -35.171 -8.783   55.615  1.00 17.92 ? 377  VAL A CA  1 
ATOM   2871  C C   . VAL A  1 371 ? -33.783 -9.221   55.182  1.00 19.53 ? 377  VAL A C   1 
ATOM   2872  O O   . VAL A  1 371 ? -33.506 -9.320   53.987  1.00 21.53 ? 377  VAL A O   1 
ATOM   2873  C CB  . VAL A  1 371 ? -36.212 -9.721   55.012  1.00 15.93 ? 377  VAL A CB  1 
ATOM   2874  C CG1 . VAL A  1 371 ? -35.949 -11.144  55.465  1.00 15.54 ? 377  VAL A CG1 1 
ATOM   2875  C CG2 . VAL A  1 371 ? -37.618 -9.271   55.370  1.00 18.56 ? 377  VAL A CG2 1 
ATOM   2876  N N   . ILE A  1 372 ? -32.896 -9.456   56.140  1.00 17.80 ? 378  ILE A N   1 
ATOM   2877  C CA  . ILE A  1 372 ? -31.538 -9.875   55.811  1.00 17.21 ? 378  ILE A CA  1 
ATOM   2878  C C   . ILE A  1 372 ? -31.430 -11.393  55.951  1.00 18.21 ? 378  ILE A C   1 
ATOM   2879  O O   . ILE A  1 372 ? -31.737 -11.945  57.000  1.00 20.28 ? 378  ILE A O   1 
ATOM   2880  C CB  . ILE A  1 372 ? -30.507 -9.185   56.714  1.00 15.23 ? 378  ILE A CB  1 
ATOM   2881  C CG1 . ILE A  1 372 ? -30.790 -7.690   56.791  1.00 15.87 ? 378  ILE A CG1 1 
ATOM   2882  C CG2 . ILE A  1 372 ? -29.088 -9.442   56.225  1.00 13.25 ? 378  ILE A CG2 1 
ATOM   2883  C CD1 . ILE A  1 372 ? -29.813 -6.959   57.664  1.00 18.45 ? 378  ILE A CD1 1 
ATOM   2884  N N   . ASP A  1 373 ? -31.006 -12.057  54.880  1.00 14.41 ? 379  ASP A N   1 
ATOM   2885  C CA  . ASP A  1 373 ? -30.914 -13.518  54.811  1.00 12.77 ? 379  ASP A CA  1 
ATOM   2886  C C   . ASP A  1 373 ? -29.848 -14.098  55.748  1.00 12.59 ? 379  ASP A C   1 
ATOM   2887  O O   . ASP A  1 373 ? -28.932 -13.401  56.181  1.00 12.26 ? 379  ASP A O   1 
ATOM   2888  C CB  . ASP A  1 373 ? -30.639 -13.933  53.354  1.00 17.54 ? 379  ASP A CB  1 
ATOM   2889  C CG  . ASP A  1 373 ? -30.675 -15.439  53.137  1.00 20.90 ? 379  ASP A CG  1 
ATOM   2890  O OD1 . ASP A  1 373 ? -31.424 -16.146  53.846  1.00 18.80 ? 379  ASP A OD1 1 
ATOM   2891  O OD2 . ASP A  1 373 ? -29.957 -15.917  52.229  1.00 20.75 ? 379  ASP A OD2 1 
ATOM   2892  N N   . HIS A  1 374 ? -30.001 -15.375  56.068  1.00 15.18 ? 380  HIS A N   1 
ATOM   2893  C CA  . HIS A  1 374 ? -29.069 -16.113  56.909  1.00 20.74 ? 380  HIS A CA  1 
ATOM   2894  C C   . HIS A  1 374 ? -27.608 -15.844  56.547  1.00 21.01 ? 380  HIS A C   1 
ATOM   2895  O O   . HIS A  1 374 ? -27.219 -16.010  55.393  1.00 19.11 ? 380  HIS A O   1 
ATOM   2896  C CB  . HIS A  1 374 ? -29.375 -17.617  56.795  1.00 23.11 ? 380  HIS A CB  1 
ATOM   2897  C CG  . HIS A  1 374 ? -28.514 -18.487  57.659  1.00 22.07 ? 380  HIS A CG  1 
ATOM   2898  N ND1 . HIS A  1 374 ? -27.166 -18.657  57.440  1.00 21.13 ? 380  HIS A ND1 1 
ATOM   2899  C CD2 . HIS A  1 374 ? -28.813 -19.233  58.747  1.00 20.11 ? 380  HIS A CD2 1 
ATOM   2900  C CE1 . HIS A  1 374 ? -26.671 -19.471  58.356  1.00 17.62 ? 380  HIS A CE1 1 
ATOM   2901  N NE2 . HIS A  1 374 ? -27.650 -19.832  59.163  1.00 17.34 ? 380  HIS A NE2 1 
ATOM   2902  N N   . GLY A  1 375 ? -26.809 -15.409  57.520  1.00 11.75 ? 381  GLY A N   1 
ATOM   2903  C CA  . GLY A  1 375 ? -25.366 -15.357  57.346  1.00 12.55 ? 381  GLY A CA  1 
ATOM   2904  C C   . GLY A  1 375 ? -24.801 -14.242  56.478  1.00 20.42 ? 381  GLY A C   1 
ATOM   2905  O O   . GLY A  1 375 ? -23.586 -14.161  56.293  1.00 26.08 ? 381  GLY A O   1 
ATOM   2906  N N   . VAL A  1 376 ? -25.665 -13.384  55.941  1.00 16.79 ? 382  VAL A N   1 
ATOM   2907  C CA  . VAL A  1 376 ? -25.224 -12.247  55.133  1.00 17.06 ? 382  VAL A CA  1 
ATOM   2908  C C   . VAL A  1 376 ? -24.266 -11.336  55.907  1.00 19.63 ? 382  VAL A C   1 
ATOM   2909  O O   . VAL A  1 376 ? -24.522 -10.984  57.054  1.00 21.36 ? 382  VAL A O   1 
ATOM   2910  C CB  . VAL A  1 376 ? -26.440 -11.421  54.642  1.00 15.21 ? 382  VAL A CB  1 
ATOM   2911  C CG1 . VAL A  1 376 ? -26.013 -10.075  54.073  1.00 17.23 ? 382  VAL A CG1 1 
ATOM   2912  C CG2 . VAL A  1 376 ? -27.218 -12.201  53.613  1.00 18.00 ? 382  VAL A CG2 1 
ATOM   2913  N N   . VAL A  1 377 ? -23.146 -10.976  55.292  1.00 18.22 ? 383  VAL A N   1 
ATOM   2914  C CA  . VAL A  1 377 ? -22.247 -9.999   55.886  1.00 14.23 ? 383  VAL A CA  1 
ATOM   2915  C C   . VAL A  1 377 ? -22.509 -8.643   55.237  1.00 19.51 ? 383  VAL A C   1 
ATOM   2916  O O   . VAL A  1 377 ? -22.265 -8.471   54.042  1.00 24.46 ? 383  VAL A O   1 
ATOM   2917  C CB  . VAL A  1 377 ? -20.766 -10.398  55.713  1.00 14.59 ? 383  VAL A CB  1 
ATOM   2918  C CG1 . VAL A  1 377 ? -19.845 -9.277   56.176  1.00 16.04 ? 383  VAL A CG1 1 
ATOM   2919  C CG2 . VAL A  1 377 ? -20.477 -11.671  56.471  1.00 16.11 ? 383  VAL A CG2 1 
ATOM   2920  N N   . ILE A  1 378 ? -23.031 -7.694   56.011  1.00 14.85 ? 384  ILE A N   1 
ATOM   2921  C CA  . ILE A  1 378 ? -23.325 -6.358   55.496  1.00 13.45 ? 384  ILE A CA  1 
ATOM   2922  C C   . ILE A  1 378 ? -22.063 -5.502   55.552  1.00 20.08 ? 384  ILE A C   1 
ATOM   2923  O O   . ILE A  1 378 ? -21.487 -5.305   56.629  1.00 23.93 ? 384  ILE A O   1 
ATOM   2924  C CB  . ILE A  1 378 ? -24.457 -5.672   56.290  1.00 16.67 ? 384  ILE A CB  1 
ATOM   2925  C CG1 . ILE A  1 378 ? -25.746 -6.486   56.216  1.00 16.92 ? 384  ILE A CG1 1 
ATOM   2926  C CG2 . ILE A  1 378 ? -24.721 -4.291   55.741  1.00 17.35 ? 384  ILE A CG2 1 
ATOM   2927  C CD1 . ILE A  1 378 ? -26.442 -6.427   54.876  1.00 15.54 ? 384  ILE A CD1 1 
ATOM   2928  N N   . PRO A  1 379 ? -21.613 -4.999   54.389  1.00 19.73 ? 385  PRO A N   1 
ATOM   2929  C CA  . PRO A  1 379 ? -20.362 -4.241   54.359  1.00 20.70 ? 385  PRO A CA  1 
ATOM   2930  C C   . PRO A  1 379 ? -20.457 -2.943   55.151  1.00 23.79 ? 385  PRO A C   1 
ATOM   2931  O O   . PRO A  1 379 ? -21.554 -2.386   55.282  1.00 20.99 ? 385  PRO A O   1 
ATOM   2932  C CB  . PRO A  1 379 ? -20.163 -3.961   52.874  1.00 21.72 ? 385  PRO A CB  1 
ATOM   2933  C CG  . PRO A  1 379 ? -21.529 -3.985   52.306  1.00 23.45 ? 385  PRO A CG  1 
ATOM   2934  C CD  . PRO A  1 379 ? -22.269 -5.032   53.071  1.00 19.01 ? 385  PRO A CD  1 
ATOM   2935  N N   . GLU A  1 380 ? -19.326 -2.478   55.677  1.00 20.59 ? 386  GLU A N   1 
ATOM   2936  C CA  . GLU A  1 380 ? -19.294 -1.225   56.424  1.00 25.34 ? 386  GLU A CA  1 
ATOM   2937  C C   . GLU A  1 380 ? -19.813 -0.071   55.582  1.00 22.55 ? 386  GLU A C   1 
ATOM   2938  O O   . GLU A  1 380 ? -19.415 0.087    54.431  1.00 23.93 ? 386  GLU A O   1 
ATOM   2939  C CB  . GLU A  1 380 ? -17.878 -0.921   56.899  1.00 30.19 ? 386  GLU A CB  1 
ATOM   2940  C CG  . GLU A  1 380 ? -17.275 -2.006   57.763  1.00 36.85 ? 386  GLU A CG  1 
ATOM   2941  C CD  . GLU A  1 380 ? -15.827 -1.728   58.084  1.00 46.54 ? 386  GLU A CD  1 
ATOM   2942  O OE1 . GLU A  1 380 ? -15.215 -0.917   57.360  1.00 50.86 ? 386  GLU A OE1 1 
ATOM   2943  O OE2 . GLU A  1 380 ? -15.298 -2.304   59.058  1.00 49.70 ? 386  GLU A OE2 1 
ATOM   2944  N N   . GLY A  1 381 ? -20.726 0.710    56.146  1.00 20.71 ? 387  GLY A N   1 
ATOM   2945  C CA  . GLY A  1 381 ? -21.233 1.894    55.483  1.00 20.44 ? 387  GLY A CA  1 
ATOM   2946  C C   . GLY A  1 381 ? -22.455 1.750    54.592  1.00 20.70 ? 387  GLY A C   1 
ATOM   2947  O O   . GLY A  1 381 ? -23.036 2.762    54.204  1.00 23.21 ? 387  GLY A O   1 
ATOM   2948  N N   . LEU A  1 382 ? -22.852 0.523    54.257  1.00 20.97 ? 388  LEU A N   1 
ATOM   2949  C CA  . LEU A  1 382 ? -23.991 0.329    53.352  1.00 25.04 ? 388  LEU A CA  1 
ATOM   2950  C C   . LEU A  1 382 ? -25.238 1.084    53.838  1.00 27.84 ? 388  LEU A C   1 
ATOM   2951  O O   . LEU A  1 382 ? -25.517 1.135    55.041  1.00 29.73 ? 388  LEU A O   1 
ATOM   2952  C CB  . LEU A  1 382 ? -24.307 -1.162   53.186  1.00 24.83 ? 388  LEU A CB  1 
ATOM   2953  C CG  . LEU A  1 382 ? -25.525 -1.488   52.310  1.00 24.26 ? 388  LEU A CG  1 
ATOM   2954  C CD1 . LEU A  1 382 ? -25.252 -1.129   50.856  1.00 26.13 ? 388  LEU A CD1 1 
ATOM   2955  C CD2 . LEU A  1 382 ? -25.976 -2.944   52.438  1.00 21.15 ? 388  LEU A CD2 1 
ATOM   2956  N N   . ILE A  1 383 ? -25.963 1.699    52.906  1.00 22.58 ? 389  ILE A N   1 
ATOM   2957  C CA  . ILE A  1 383 ? -27.212 2.384    53.236  1.00 23.58 ? 389  ILE A CA  1 
ATOM   2958  C C   . ILE A  1 383 ? -28.390 1.771    52.501  1.00 27.08 ? 389  ILE A C   1 
ATOM   2959  O O   . ILE A  1 383 ? -28.405 1.735    51.270  1.00 24.97 ? 389  ILE A O   1 
ATOM   2960  C CB  . ILE A  1 383 ? -27.174 3.873    52.883  1.00 23.05 ? 389  ILE A CB  1 
ATOM   2961  C CG1 . ILE A  1 383 ? -26.004 4.558    53.583  1.00 21.29 ? 389  ILE A CG1 1 
ATOM   2962  C CG2 . ILE A  1 383 ? -28.491 4.524    53.258  1.00 20.58 ? 389  ILE A CG2 1 
ATOM   2963  C CD1 . ILE A  1 383 ? -26.166 4.659    55.074  1.00 15.53 ? 389  ILE A CD1 1 
ATOM   2964  N N   . VAL A  1 384 ? -29.371 1.279    53.252  1.00 25.62 ? 390  VAL A N   1 
ATOM   2965  C CA  . VAL A  1 384 ? -30.598 0.776    52.646  1.00 22.89 ? 390  VAL A CA  1 
ATOM   2966  C C   . VAL A  1 384 ? -31.798 1.415    53.314  1.00 22.73 ? 390  VAL A C   1 
ATOM   2967  O O   . VAL A  1 384 ? -31.888 1.467    54.535  1.00 21.61 ? 390  VAL A O   1 
ATOM   2968  C CB  . VAL A  1 384 ? -30.720 -0.757   52.743  1.00 23.31 ? 390  VAL A CB  1 
ATOM   2969  C CG1 . VAL A  1 384 ? -31.873 -1.238   51.878  1.00 22.76 ? 390  VAL A CG1 1 
ATOM   2970  C CG2 . VAL A  1 384 ? -29.431 -1.427   52.307  1.00 21.50 ? 390  VAL A CG2 1 
ATOM   2971  N N   . GLY A  1 385 ? -32.722 1.909    52.504  1.00 25.37 ? 391  GLY A N   1 
ATOM   2972  C CA  . GLY A  1 385 ? -33.897 2.569    53.028  1.00 26.79 ? 391  GLY A CA  1 
ATOM   2973  C C   . GLY A  1 385 ? -33.807 4.073    52.885  1.00 32.99 ? 391  GLY A C   1 
ATOM   2974  O O   . GLY A  1 385 ? -34.623 4.805    53.447  1.00 36.28 ? 391  GLY A O   1 
ATOM   2975  N N   . GLU A  1 386 ? -32.810 4.535    52.134  1.00 33.77 ? 392  GLU A N   1 
ATOM   2976  C CA  . GLU A  1 386 ? -32.674 5.955    51.836  1.00 32.03 ? 392  GLU A CA  1 
ATOM   2977  C C   . GLU A  1 386 ? -33.035 6.275    50.387  1.00 27.83 ? 392  GLU A C   1 
ATOM   2978  O O   . GLU A  1 386 ? -33.709 7.262    50.116  1.00 33.77 ? 392  GLU A O   1 
ATOM   2979  C CB  . GLU A  1 386 ? -31.252 6.436    52.121  1.00 34.37 ? 392  GLU A CB  1 
ATOM   2980  C CG  . GLU A  1 386 ? -30.989 7.830    51.563  1.00 39.17 ? 392  GLU A CG  1 
ATOM   2981  C CD  . GLU A  1 386 ? -29.581 8.347    51.820  1.00 41.06 ? 392  GLU A CD  1 
ATOM   2982  O OE1 . GLU A  1 386 ? -28.613 7.811    51.236  1.00 34.85 ? 392  GLU A OE1 1 
ATOM   2983  O OE2 . GLU A  1 386 ? -29.449 9.308    52.604  1.00 47.16 ? 392  GLU A OE2 1 
ATOM   2984  N N   . ASP A  1 387 ? -32.588 5.431    49.465  1.00 22.17 ? 393  ASP A N   1 
ATOM   2985  C CA  . ASP A  1 387 ? -32.757 5.665    48.033  1.00 23.56 ? 393  ASP A CA  1 
ATOM   2986  C C   . ASP A  1 387 ? -33.554 4.534    47.404  1.00 24.61 ? 393  ASP A C   1 
ATOM   2987  O O   . ASP A  1 387 ? -32.971 3.542    46.981  1.00 27.25 ? 393  ASP A O   1 
ATOM   2988  C CB  . ASP A  1 387 ? -31.384 5.780    47.366  1.00 27.19 ? 393  ASP A CB  1 
ATOM   2989  C CG  . ASP A  1 387 ? -31.456 6.169    45.893  1.00 33.61 ? 393  ASP A CG  1 
ATOM   2990  O OD1 . ASP A  1 387 ? -32.492 5.950    45.229  1.00 37.76 ? 393  ASP A OD1 1 
ATOM   2991  O OD2 . ASP A  1 387 ? -30.446 6.698    45.391  1.00 34.06 ? 393  ASP A OD2 1 
ATOM   2992  N N   . PRO A  1 388 ? -34.886 4.677    47.334  1.00 26.23 ? 394  PRO A N   1 
ATOM   2993  C CA  . PRO A  1 388 ? -35.748 3.592    46.844  1.00 27.49 ? 394  PRO A CA  1 
ATOM   2994  C C   . PRO A  1 388 ? -35.300 3.002    45.511  1.00 32.64 ? 394  PRO A C   1 
ATOM   2995  O O   . PRO A  1 388 ? -35.484 1.816    45.263  1.00 33.46 ? 394  PRO A O   1 
ATOM   2996  C CB  . PRO A  1 388 ? -37.111 4.270    46.705  1.00 25.93 ? 394  PRO A CB  1 
ATOM   2997  C CG  . PRO A  1 388 ? -37.098 5.339    47.739  1.00 26.83 ? 394  PRO A CG  1 
ATOM   2998  C CD  . PRO A  1 388 ? -35.669 5.837    47.796  1.00 28.57 ? 394  PRO A CD  1 
ATOM   2999  N N   . GLU A  1 389 ? -34.687 3.823    44.668  1.00 40.32 ? 395  GLU A N   1 
ATOM   3000  C CA  . GLU A  1 389 ? -34.375 3.408    43.305  1.00 39.27 ? 395  GLU A CA  1 
ATOM   3001  C C   . GLU A  1 389 ? -33.030 2.681    43.210  1.00 31.56 ? 395  GLU A C   1 
ATOM   3002  O O   . GLU A  1 389 ? -32.900 1.683    42.498  1.00 28.58 ? 395  GLU A O   1 
ATOM   3003  C CB  . GLU A  1 389 ? -34.425 4.632    42.388  1.00 50.29 ? 395  GLU A CB  1 
ATOM   3004  C CG  . GLU A  1 389 ? -35.282 5.755    42.962  1.00 58.39 ? 395  GLU A CG  1 
ATOM   3005  C CD  . GLU A  1 389 ? -35.820 6.687    41.896  1.00 69.63 ? 395  GLU A CD  1 
ATOM   3006  O OE1 . GLU A  1 389 ? -35.049 7.079    40.993  1.00 74.72 ? 395  GLU A OE1 1 
ATOM   3007  O OE2 . GLU A  1 389 ? -37.026 7.014    41.953  1.00 72.58 ? 395  GLU A OE2 1 
ATOM   3008  N N   . LEU A  1 390 ? -32.039 3.168    43.943  1.00 29.27 ? 396  LEU A N   1 
ATOM   3009  C CA  . LEU A  1 390 ? -30.784 2.445    44.077  1.00 22.59 ? 396  LEU A CA  1 
ATOM   3010  C C   . LEU A  1 390 ? -31.010 1.104    44.789  1.00 27.32 ? 396  LEU A C   1 
ATOM   3011  O O   . LEU A  1 390 ? -30.455 0.077    44.397  1.00 28.57 ? 396  LEU A O   1 
ATOM   3012  C CB  . LEU A  1 390 ? -29.778 3.294    44.840  1.00 22.32 ? 396  LEU A CB  1 
ATOM   3013  C CG  . LEU A  1 390 ? -28.452 2.634    45.190  1.00 26.07 ? 396  LEU A CG  1 
ATOM   3014  C CD1 . LEU A  1 390 ? -27.730 2.201    43.936  1.00 29.95 ? 396  LEU A CD1 1 
ATOM   3015  C CD2 . LEU A  1 390 ? -27.598 3.586    45.995  1.00 26.66 ? 396  LEU A CD2 1 
ATOM   3016  N N   . ASP A  1 391 ? -31.833 1.123    45.835  1.00 28.39 ? 397  ASP A N   1 
ATOM   3017  C CA  . ASP A  1 391 ? -32.161 -0.092   46.582  1.00 23.39 ? 397  ASP A CA  1 
ATOM   3018  C C   . ASP A  1 391 ? -32.791 -1.140   45.676  1.00 24.84 ? 397  ASP A C   1 
ATOM   3019  O O   . ASP A  1 391 ? -32.455 -2.321   45.746  1.00 25.01 ? 397  ASP A O   1 
ATOM   3020  C CB  . ASP A  1 391 ? -33.118 0.207    47.742  1.00 20.01 ? 397  ASP A CB  1 
ATOM   3021  C CG  . ASP A  1 391 ? -32.501 1.092    48.807  1.00 24.62 ? 397  ASP A CG  1 
ATOM   3022  O OD1 . ASP A  1 391 ? -31.262 1.261    48.804  1.00 29.32 ? 397  ASP A OD1 1 
ATOM   3023  O OD2 . ASP A  1 391 ? -33.259 1.604    49.664  1.00 25.48 ? 397  ASP A OD2 1 
ATOM   3024  N N   . ALA A  1 392 ? -33.714 -0.703   44.826  1.00 26.59 ? 398  ALA A N   1 
ATOM   3025  C CA  . ALA A  1 392 ? -34.418 -1.623   43.945  1.00 26.53 ? 398  ALA A CA  1 
ATOM   3026  C C   . ALA A  1 392 ? -33.473 -2.217   42.913  1.00 27.23 ? 398  ALA A C   1 
ATOM   3027  O O   . ALA A  1 392 ? -33.710 -3.309   42.404  1.00 27.85 ? 398  ALA A O   1 
ATOM   3028  C CB  . ALA A  1 392 ? -35.575 -0.925   43.267  1.00 26.96 ? 398  ALA A CB  1 
ATOM   3029  N N   . LYS A  1 393 ? -32.390 -1.509   42.613  1.00 27.49 ? 399  LYS A N   1 
ATOM   3030  C CA  . LYS A  1 393 ? -31.427 -2.000   41.634  1.00 29.71 ? 399  LYS A CA  1 
ATOM   3031  C C   . LYS A  1 393 ? -30.473 -3.013   42.264  1.00 29.87 ? 399  LYS A C   1 
ATOM   3032  O O   . LYS A  1 393 ? -30.100 -4.010   41.634  1.00 26.31 ? 399  LYS A O   1 
ATOM   3033  C CB  . LYS A  1 393 ? -30.644 -0.835   41.019  1.00 32.78 ? 399  LYS A CB  1 
ATOM   3034  N N   . ARG A  1 394 ? -30.096 -2.757   43.515  1.00 31.10 ? 400  ARG A N   1 
ATOM   3035  C CA  . ARG A  1 394 ? -29.150 -3.609   44.239  1.00 23.59 ? 400  ARG A CA  1 
ATOM   3036  C C   . ARG A  1 394 ? -29.789 -4.846   44.846  1.00 20.85 ? 400  ARG A C   1 
ATOM   3037  O O   . ARG A  1 394 ? -29.166 -5.895   44.898  1.00 26.53 ? 400  ARG A O   1 
ATOM   3038  C CB  . ARG A  1 394 ? -28.467 -2.825   45.359  1.00 20.17 ? 400  ARG A CB  1 
ATOM   3039  C CG  . ARG A  1 394 ? -27.557 -1.698   44.903  1.00 23.35 ? 400  ARG A CG  1 
ATOM   3040  C CD  . ARG A  1 394 ? -27.179 -0.845   46.106  1.00 26.97 ? 400  ARG A CD  1 
ATOM   3041  N NE  . ARG A  1 394 ? -25.845 -0.275   45.995  1.00 30.57 ? 400  ARG A NE  1 
ATOM   3042  C CZ  . ARG A  1 394 ? -25.286 0.497    46.919  1.00 33.73 ? 400  ARG A CZ  1 
ATOM   3043  N NH1 . ARG A  1 394 ? -25.948 0.791    48.033  1.00 34.53 ? 400  ARG A NH1 1 
ATOM   3044  N NH2 . ARG A  1 394 ? -24.064 0.976    46.729  1.00 33.12 ? 400  ARG A NH2 1 
ATOM   3045  N N   . PHE A  1 395 ? -31.019 -4.729   45.331  1.00 22.52 ? 401  PHE A N   1 
ATOM   3046  C CA  . PHE A  1 395 ? -31.611 -5.827   46.096  1.00 25.39 ? 401  PHE A CA  1 
ATOM   3047  C C   . PHE A  1 395 ? -33.004 -6.155   45.597  1.00 26.37 ? 401  PHE A C   1 
ATOM   3048  O O   . PHE A  1 395 ? -33.527 -5.483   44.715  1.00 33.18 ? 401  PHE A O   1 
ATOM   3049  C CB  . PHE A  1 395 ? -31.672 -5.483   47.592  1.00 28.99 ? 401  PHE A CB  1 
ATOM   3050  C CG  . PHE A  1 395 ? -30.419 -4.838   48.130  1.00 24.54 ? 401  PHE A CG  1 
ATOM   3051  C CD1 . PHE A  1 395 ? -29.232 -5.545   48.198  1.00 20.65 ? 401  PHE A CD1 1 
ATOM   3052  C CD2 . PHE A  1 395 ? -30.441 -3.527   48.587  1.00 24.21 ? 401  PHE A CD2 1 
ATOM   3053  C CE1 . PHE A  1 395 ? -28.084 -4.953   48.688  1.00 19.27 ? 401  PHE A CE1 1 
ATOM   3054  C CE2 . PHE A  1 395 ? -29.297 -2.927   49.082  1.00 20.79 ? 401  PHE A CE2 1 
ATOM   3055  C CZ  . PHE A  1 395 ? -28.117 -3.642   49.138  1.00 20.40 ? 401  PHE A CZ  1 
ATOM   3056  N N   . ARG A  1 396 ? -33.599 -7.194   46.164  1.00 22.33 ? 402  ARG A N   1 
ATOM   3057  C CA  . ARG A  1 396 ? -34.994 -7.517   45.892  1.00 24.09 ? 402  ARG A CA  1 
ATOM   3058  C C   . ARG A  1 396 ? -35.884 -6.600   46.721  1.00 25.49 ? 402  ARG A C   1 
ATOM   3059  O O   . ARG A  1 396 ? -36.008 -6.776   47.927  1.00 28.95 ? 402  ARG A O   1 
ATOM   3060  C CB  . ARG A  1 396 ? -35.270 -8.994   46.204  1.00 24.00 ? 402  ARG A CB  1 
ATOM   3061  C CG  . ARG A  1 396 ? -36.739 -9.388   46.303  1.00 24.53 ? 402  ARG A CG  1 
ATOM   3062  C CD  . ARG A  1 396 ? -37.342 -9.661   44.945  1.00 27.17 ? 402  ARG A CD  1 
ATOM   3063  N NE  . ARG A  1 396 ? -36.573 -10.640  44.187  1.00 28.06 ? 402  ARG A NE  1 
ATOM   3064  C CZ  . ARG A  1 396 ? -36.924 -11.097  42.989  1.00 26.39 ? 402  ARG A CZ  1 
ATOM   3065  N NH1 . ARG A  1 396 ? -38.044 -10.670  42.415  1.00 23.52 ? 402  ARG A NH1 1 
ATOM   3066  N NH2 . ARG A  1 396 ? -36.164 -11.986  42.368  1.00 23.49 ? 402  ARG A NH2 1 
ATOM   3067  N N   . ARG A  1 397 ? -36.495 -5.609   46.080  1.00 25.67 ? 403  ARG A N   1 
ATOM   3068  C CA  . ARG A  1 397 ? -37.314 -4.636   46.795  1.00 25.85 ? 403  ARG A CA  1 
ATOM   3069  C C   . ARG A  1 397 ? -38.790 -4.783   46.451  1.00 31.38 ? 403  ARG A C   1 
ATOM   3070  O O   . ARG A  1 397 ? -39.157 -4.909   45.283  1.00 35.30 ? 403  ARG A O   1 
ATOM   3071  C CB  . ARG A  1 397 ? -36.843 -3.220   46.485  1.00 20.79 ? 403  ARG A CB  1 
ATOM   3072  C CG  . ARG A  1 397 ? -37.540 -2.129   47.290  1.00 21.74 ? 403  ARG A CG  1 
ATOM   3073  C CD  . ARG A  1 397 ? -36.954 -0.772   46.923  1.00 23.78 ? 403  ARG A CD  1 
ATOM   3074  N NE  . ARG A  1 397 ? -37.275 0.277    47.880  1.00 25.77 ? 403  ARG A NE  1 
ATOM   3075  C CZ  . ARG A  1 397 ? -38.385 1.005    47.844  1.00 28.40 ? 403  ARG A CZ  1 
ATOM   3076  N NH1 . ARG A  1 397 ? -39.293 0.789    46.904  1.00 29.96 ? 403  ARG A NH1 1 
ATOM   3077  N NH2 . ARG A  1 397 ? -38.588 1.945    48.754  1.00 27.90 ? 403  ARG A NH2 1 
ATOM   3078  N N   . THR A  1 398 ? -39.636 -4.775   47.473  1.00 27.17 ? 404  THR A N   1 
ATOM   3079  C CA  . THR A  1 398 ? -41.075 -4.883   47.269  1.00 28.80 ? 404  THR A CA  1 
ATOM   3080  C C   . THR A  1 398 ? -41.680 -3.516   46.961  1.00 31.22 ? 404  THR A C   1 
ATOM   3081  O O   . THR A  1 398 ? -41.079 -2.489   47.248  1.00 26.59 ? 404  THR A O   1 
ATOM   3082  C CB  . THR A  1 398 ? -41.779 -5.477   48.506  1.00 22.12 ? 404  THR A CB  1 
ATOM   3083  O OG1 . THR A  1 398 ? -41.666 -4.562   49.601  1.00 21.58 ? 404  THR A OG1 1 
ATOM   3084  C CG2 . THR A  1 398 ? -41.149 -6.811   48.898  1.00 18.14 ? 404  THR A CG2 1 
ATOM   3085  N N   . GLU A  1 399 ? -42.881 -3.515   46.388  1.00 37.79 ? 405  GLU A N   1 
ATOM   3086  C CA  . GLU A  1 399 ? -43.603 -2.280   46.106  1.00 37.50 ? 405  GLU A CA  1 
ATOM   3087  C C   . GLU A  1 399 ? -43.803 -1.490   47.393  1.00 35.75 ? 405  GLU A C   1 
ATOM   3088  O O   . GLU A  1 399 ? -43.669 -0.265   47.405  1.00 39.01 ? 405  GLU A O   1 
ATOM   3089  C CB  . GLU A  1 399 ? -44.948 -2.576   45.429  1.00 39.76 ? 405  GLU A CB  1 
ATOM   3090  C CG  . GLU A  1 399 ? -46.088 -1.632   45.818  1.00 49.37 ? 405  GLU A CG  1 
ATOM   3091  C CD  . GLU A  1 399 ? -45.946 -0.216   45.259  1.00 62.63 ? 405  GLU A CD  1 
ATOM   3092  O OE1 . GLU A  1 399 ? -44.870 0.125    44.720  1.00 68.16 ? 405  GLU A OE1 1 
ATOM   3093  O OE2 . GLU A  1 399 ? -46.921 0.564    45.361  1.00 66.19 ? 405  GLU A OE2 1 
ATOM   3094  N N   . SER A  1 400 ? -44.100 -2.194   48.481  1.00 31.49 ? 406  SER A N   1 
ATOM   3095  C CA  . SER A  1 400 ? -44.224 -1.549   49.778  1.00 27.03 ? 406  SER A CA  1 
ATOM   3096  C C   . SER A  1 400 ? -42.876 -1.040   50.279  1.00 24.00 ? 406  SER A C   1 
ATOM   3097  O O   . SER A  1 400 ? -42.818 -0.287   51.248  1.00 29.02 ? 406  SER A O   1 
ATOM   3098  C CB  . SER A  1 400 ? -44.828 -2.506   50.797  1.00 31.67 ? 406  SER A CB  1 
ATOM   3099  O OG  . SER A  1 400 ? -43.958 -3.596   51.023  1.00 38.10 ? 406  SER A OG  1 
ATOM   3100  N N   . GLY A  1 401 ? -41.794 -1.464   49.632  1.00 20.54 ? 407  GLY A N   1 
ATOM   3101  C CA  . GLY A  1 401 ? -40.475 -0.944   49.943  1.00 20.01 ? 407  GLY A CA  1 
ATOM   3102  C C   . GLY A  1 401 ? -39.655 -1.735   50.944  1.00 22.59 ? 407  GLY A C   1 
ATOM   3103  O O   . GLY A  1 401 ? -38.815 -1.171   51.644  1.00 22.55 ? 407  GLY A O   1 
ATOM   3104  N N   . ILE A  1 402 ? -39.892 -3.039   51.024  1.00 23.08 ? 408  ILE A N   1 
ATOM   3105  C CA  . ILE A  1 402 ? -39.037 -3.899   51.837  1.00 20.70 ? 408  ILE A CA  1 
ATOM   3106  C C   . ILE A  1 402 ? -37.952 -4.483   50.951  1.00 19.39 ? 408  ILE A C   1 
ATOM   3107  O O   . ILE A  1 402 ? -38.258 -5.055   49.914  1.00 21.62 ? 408  ILE A O   1 
ATOM   3108  C CB  . ILE A  1 402 ? -39.811 -5.060   52.501  1.00 18.93 ? 408  ILE A CB  1 
ATOM   3109  C CG1 . ILE A  1 402 ? -40.965 -4.538   53.366  1.00 15.92 ? 408  ILE A CG1 1 
ATOM   3110  C CG2 . ILE A  1 402 ? -38.852 -5.947   53.290  1.00 18.35 ? 408  ILE A CG2 1 
ATOM   3111  C CD1 . ILE A  1 402 ? -40.536 -3.686   54.556  1.00 19.24 ? 408  ILE A CD1 1 
ATOM   3112  N N   . CYS A  1 403 ? -36.690 -4.343   51.347  1.00 15.42 ? 409  CYS A N   1 
ATOM   3113  C CA  . CYS A  1 403 ? -35.605 -4.996   50.625  1.00 16.94 ? 409  CYS A CA  1 
ATOM   3114  C C   . CYS A  1 403 ? -35.176 -6.315   51.249  1.00 23.11 ? 409  CYS A C   1 
ATOM   3115  O O   . CYS A  1 403 ? -34.688 -6.344   52.378  1.00 20.63 ? 409  CYS A O   1 
ATOM   3116  C CB  . CYS A  1 403 ? -34.389 -4.083   50.529  1.00 18.89 ? 409  CYS A CB  1 
ATOM   3117  S SG  . CYS A  1 403 ? -34.720 -2.592   49.591  1.00 27.52 ? 409  CYS A SG  1 
ATOM   3118  N N   . LEU A  1 404 ? -35.350 -7.398   50.495  1.00 22.90 ? 410  LEU A N   1 
ATOM   3119  C CA  . LEU A  1 404 ? -34.766 -8.688   50.837  1.00 19.29 ? 410  LEU A CA  1 
ATOM   3120  C C   . LEU A  1 404 ? -33.315 -8.694   50.412  1.00 20.82 ? 410  LEU A C   1 
ATOM   3121  O O   . LEU A  1 404 ? -33.011 -8.519   49.232  1.00 20.03 ? 410  LEU A O   1 
ATOM   3122  C CB  . LEU A  1 404 ? -35.516 -9.825   50.159  1.00 19.12 ? 410  LEU A CB  1 
ATOM   3123  C CG  . LEU A  1 404 ? -34.798 -11.168  50.135  1.00 17.07 ? 410  LEU A CG  1 
ATOM   3124  C CD1 . LEU A  1 404 ? -34.589 -11.663  51.561  1.00 19.35 ? 410  LEU A CD1 1 
ATOM   3125  C CD2 . LEU A  1 404 ? -35.595 -12.171  49.324  1.00 14.74 ? 410  LEU A CD2 1 
ATOM   3126  N N   . ILE A  1 405 ? -32.420 -8.892   51.373  1.00 17.68 ? 411  ILE A N   1 
ATOM   3127  C CA  . ILE A  1 405 ? -30.988 -8.837   51.113  1.00 21.55 ? 411  ILE A CA  1 
ATOM   3128  C C   . ILE A  1 405 ? -30.320 -10.205  51.242  1.00 22.92 ? 411  ILE A C   1 
ATOM   3129  O O   . ILE A  1 405 ? -30.412 -10.845  52.283  1.00 17.52 ? 411  ILE A O   1 
ATOM   3130  C CB  . ILE A  1 405 ? -30.294 -7.867   52.071  1.00 17.30 ? 411  ILE A CB  1 
ATOM   3131  C CG1 . ILE A  1 405 ? -30.937 -6.486   51.989  1.00 19.20 ? 411  ILE A CG1 1 
ATOM   3132  C CG2 . ILE A  1 405 ? -28.803 -7.793   51.773  1.00 17.53 ? 411  ILE A CG2 1 
ATOM   3133  C CD1 . ILE A  1 405 ? -30.346 -5.488   52.961  1.00 20.72 ? 411  ILE A CD1 1 
ATOM   3134  N N   . THR A  1 406 ? -29.641 -10.644  50.183  1.00 22.37 ? 412  THR A N   1 
ATOM   3135  C CA  . THR A  1 406 ? -28.898 -11.905  50.235  1.00 22.90 ? 412  THR A CA  1 
ATOM   3136  C C   . THR A  1 406 ? -27.432 -11.667  49.958  1.00 19.74 ? 412  THR A C   1 
ATOM   3137  O O   . THR A  1 406 ? -27.043 -10.606  49.477  1.00 21.53 ? 412  THR A O   1 
ATOM   3138  C CB  . THR A  1 406 ? -29.416 -12.956  49.230  1.00 24.15 ? 412  THR A CB  1 
ATOM   3139  O OG1 . THR A  1 406 ? -29.306 -12.446  47.896  1.00 25.34 ? 412  THR A OG1 1 
ATOM   3140  C CG2 . THR A  1 406 ? -30.861 -13.316  49.521  1.00 21.97 ? 412  THR A CG2 1 
ATOM   3141  N N   . GLN A  1 407 ? -26.608 -12.653  50.291  1.00 17.36 ? 413  GLN A N   1 
ATOM   3142  C CA  . GLN A  1 407 ? -25.171 -12.521  50.119  1.00 20.95 ? 413  GLN A CA  1 
ATOM   3143  C C   . GLN A  1 407 ? -24.799 -12.384  48.644  1.00 21.48 ? 413  GLN A C   1 
ATOM   3144  O O   . GLN A  1 407 ? -23.890 -11.634  48.293  1.00 20.52 ? 413  GLN A O   1 
ATOM   3145  C CB  . GLN A  1 407 ? -24.449 -13.711  50.733  1.00 20.66 ? 413  GLN A CB  1 
ATOM   3146  C CG  . GLN A  1 407 ? -22.958 -13.535  50.736  1.00 19.56 ? 413  GLN A CG  1 
ATOM   3147  C CD  . GLN A  1 407 ? -22.539 -12.300  51.483  1.00 20.94 ? 413  GLN A CD  1 
ATOM   3148  O OE1 . GLN A  1 407 ? -22.911 -12.113  52.637  1.00 23.51 ? 413  GLN A OE1 1 
ATOM   3149  N NE2 . GLN A  1 407 ? -21.763 -11.444  50.834  1.00 23.15 ? 413  GLN A NE2 1 
ATOM   3150  N N   . SER A  1 408 ? -25.511 -13.107  47.786  1.00 20.99 ? 414  SER A N   1 
ATOM   3151  C CA  . SER A  1 408 ? -25.328 -12.980  46.343  1.00 26.15 ? 414  SER A CA  1 
ATOM   3152  C C   . SER A  1 408 ? -25.512 -11.535  45.874  1.00 24.27 ? 414  SER A C   1 
ATOM   3153  O O   . SER A  1 408 ? -24.774 -11.059  45.017  1.00 24.91 ? 414  SER A O   1 
ATOM   3154  C CB  . SER A  1 408 ? -26.299 -13.903  45.601  1.00 32.37 ? 414  SER A CB  1 
ATOM   3155  O OG  . SER A  1 408 ? -26.268 -13.681  44.200  1.00 35.00 ? 414  SER A OG  1 
ATOM   3156  N N   . MET A  1 409 ? -26.490 -10.839  46.445  1.00 24.34 ? 415  MET A N   1 
ATOM   3157  C CA  . MET A  1 409 ? -26.761 -9.457   46.076  1.00 22.03 ? 415  MET A CA  1 
ATOM   3158  C C   . MET A  1 409 ? -25.629 -8.539   46.518  1.00 20.82 ? 415  MET A C   1 
ATOM   3159  O O   . MET A  1 409 ? -25.240 -7.632   45.792  1.00 27.40 ? 415  MET A O   1 
ATOM   3160  C CB  . MET A  1 409 ? -28.077 -8.982   46.685  1.00 20.02 ? 415  MET A CB  1 
ATOM   3161  C CG  . MET A  1 409 ? -29.297 -9.721   46.198  1.00 22.61 ? 415  MET A CG  1 
ATOM   3162  S SD  . MET A  1 409 ? -30.735 -9.273   47.191  1.00 21.00 ? 415  MET A SD  1 
ATOM   3163  C CE  . MET A  1 409 ? -31.953 -10.466  46.648  1.00 17.71 ? 415  MET A CE  1 
ATOM   3164  N N   . ILE A  1 410 ? -25.107 -8.782   47.713  1.00 18.59 ? 416  ILE A N   1 
ATOM   3165  C CA  . ILE A  1 410 ? -24.043 -7.959   48.281  1.00 20.32 ? 416  ILE A CA  1 
ATOM   3166  C C   . ILE A  1 410 ? -22.751 -8.069   47.474  1.00 22.40 ? 416  ILE A C   1 
ATOM   3167  O O   . ILE A  1 410 ? -22.071 -7.076   47.241  1.00 22.22 ? 416  ILE A O   1 
ATOM   3168  C CB  . ILE A  1 410 ? -23.738 -8.353   49.748  1.00 19.23 ? 416  ILE A CB  1 
ATOM   3169  C CG1 . ILE A  1 410 ? -24.943 -8.072   50.653  1.00 16.99 ? 416  ILE A CG1 1 
ATOM   3170  C CG2 . ILE A  1 410 ? -22.517 -7.606   50.261  1.00 17.08 ? 416  ILE A CG2 1 
ATOM   3171  C CD1 . ILE A  1 410 ? -25.339 -6.627   50.689  1.00 17.97 ? 416  ILE A CD1 1 
ATOM   3172  N N   . ASP A  1 411 ? -22.421 -9.286   47.057  1.00 26.55 ? 417  ASP A N   1 
ATOM   3173  C CA  . ASP A  1 411 ? -21.177 -9.544   46.337  1.00 27.56 ? 417  ASP A CA  1 
ATOM   3174  C C   . ASP A  1 411 ? -21.078 -8.718   45.049  1.00 30.81 ? 417  ASP A C   1 
ATOM   3175  O O   . ASP A  1 411 ? -20.006 -8.237   44.689  1.00 32.86 ? 417  ASP A O   1 
ATOM   3176  C CB  . ASP A  1 411 ? -21.048 -11.038  46.023  1.00 23.76 ? 417  ASP A CB  1 
ATOM   3177  C CG  . ASP A  1 411 ? -20.809 -11.886  47.266  1.00 25.58 ? 417  ASP A CG  1 
ATOM   3178  O OD1 . ASP A  1 411 ? -20.294 -11.351  48.276  1.00 24.55 ? 417  ASP A OD1 1 
ATOM   3179  O OD2 . ASP A  1 411 ? -21.118 -13.102  47.226  1.00 29.00 ? 417  ASP A OD2 1 
ATOM   3180  N N   . LYS A  1 412 ? -22.213 -8.536   44.382  1.00 27.98 ? 418  LYS A N   1 
ATOM   3181  C CA  . LYS A  1 412 ? -22.269 -7.820   43.117  1.00 29.14 ? 418  LYS A CA  1 
ATOM   3182  C C   . LYS A  1 412 ? -22.194 -6.307   43.266  1.00 34.78 ? 418  LYS A C   1 
ATOM   3183  O O   . LYS A  1 412 ? -22.341 -5.587   42.280  1.00 43.06 ? 418  LYS A O   1 
ATOM   3184  C CB  . LYS A  1 412 ? -23.556 -8.169   42.365  1.00 26.97 ? 418  LYS A CB  1 
ATOM   3185  C CG  . LYS A  1 412 ? -23.799 -9.639   42.157  1.00 26.51 ? 418  LYS A CG  1 
ATOM   3186  C CD  . LYS A  1 412 ? -25.064 -9.865   41.338  1.00 29.99 ? 418  LYS A CD  1 
ATOM   3187  C CE  . LYS A  1 412 ? -25.263 -11.347  41.046  1.00 38.25 ? 418  LYS A CE  1 
ATOM   3188  N NZ  . LYS A  1 412 ? -26.433 -11.632  40.161  1.00 43.17 ? 418  LYS A NZ  1 
ATOM   3189  N N   . LEU A  1 413 ? -21.984 -5.816   44.481  1.00 33.53 ? 419  LEU A N   1 
ATOM   3190  C CA  . LEU A  1 413 ? -21.977 -4.371   44.700  1.00 35.75 ? 419  LEU A CA  1 
ATOM   3191  C C   . LEU A  1 413 ? -20.692 -3.728   44.182  1.00 37.52 ? 419  LEU A C   1 
ATOM   3192  O O   . LEU A  1 413 ? -19.658 -3.742   44.844  1.00 38.41 ? 419  LEU A O   1 
ATOM   3193  C CB  . LEU A  1 413 ? -22.175 -4.043   46.182  1.00 34.63 ? 419  LEU A CB  1 
ATOM   3194  C CG  . LEU A  1 413 ? -23.579 -4.289   46.738  1.00 31.74 ? 419  LEU A CG  1 
ATOM   3195  C CD1 . LEU A  1 413 ? -23.655 -3.910   48.211  1.00 29.34 ? 419  LEU A CD1 1 
ATOM   3196  C CD2 . LEU A  1 413 ? -24.628 -3.536   45.931  1.00 33.71 ? 419  LEU A CD2 1 
ATOM   3197  N N   . VAL B  1 1   ? 1.215   -42.680  72.057  1.00 49.07 ? 7    VAL B N   1 
ATOM   3198  C CA  . VAL B  1 1   ? 0.188   -42.296  71.093  1.00 47.71 ? 7    VAL B CA  1 
ATOM   3199  C C   . VAL B  1 1   ? -1.142  -42.025  71.797  1.00 47.52 ? 7    VAL B C   1 
ATOM   3200  O O   . VAL B  1 1   ? -1.723  -40.953  71.628  1.00 47.39 ? 7    VAL B O   1 
ATOM   3201  C CB  . VAL B  1 1   ? -0.002  -43.375  69.995  1.00 30.64 ? 7    VAL B CB  1 
ATOM   3202  C CG1 . VAL B  1 1   ? -1.330  -43.198  69.276  1.00 27.88 ? 7    VAL B CG1 1 
ATOM   3203  C CG2 . VAL B  1 1   ? 1.159   -43.337  68.995  1.00 31.73 ? 7    VAL B CG2 1 
ATOM   3204  N N   . GLN B  1 2   ? -1.610  -42.978  72.601  1.00 44.96 ? 8    GLN B N   1 
ATOM   3205  C CA  . GLN B  1 2   ? -2.929  -42.868  73.231  1.00 44.01 ? 8    GLN B CA  1 
ATOM   3206  C C   . GLN B  1 2   ? -3.021  -41.747  74.264  1.00 35.34 ? 8    GLN B C   1 
ATOM   3207  O O   . GLN B  1 2   ? -2.149  -41.622  75.123  1.00 28.72 ? 8    GLN B O   1 
ATOM   3208  C CB  . GLN B  1 2   ? -3.316  -44.181  73.909  1.00 45.15 ? 8    GLN B CB  1 
ATOM   3209  C CG  . GLN B  1 2   ? -3.292  -45.390  73.012  1.00 46.40 ? 8    GLN B CG  1 
ATOM   3210  C CD  . GLN B  1 2   ? -3.607  -46.655  73.779  1.00 48.02 ? 8    GLN B CD  1 
ATOM   3211  O OE1 . GLN B  1 2   ? -3.954  -46.605  74.961  1.00 46.80 ? 8    GLN B OE1 1 
ATOM   3212  N NE2 . GLN B  1 2   ? -3.496  -47.798  73.113  1.00 50.01 ? 8    GLN B NE2 1 
ATOM   3213  N N   . PRO B  1 3   ? -4.086  -40.930  74.177  1.00 29.01 ? 9    PRO B N   1 
ATOM   3214  C CA  . PRO B  1 3   ? -4.371  -39.924  75.205  1.00 22.34 ? 9    PRO B CA  1 
ATOM   3215  C C   . PRO B  1 3   ? -4.667  -40.567  76.553  1.00 18.45 ? 9    PRO B C   1 
ATOM   3216  O O   . PRO B  1 3   ? -5.391  -41.554  76.630  1.00 19.82 ? 9    PRO B O   1 
ATOM   3217  C CB  . PRO B  1 3   ? -5.600  -39.184  74.658  1.00 20.43 ? 9    PRO B CB  1 
ATOM   3218  C CG  . PRO B  1 3   ? -6.094  -40.000  73.521  1.00 26.71 ? 9    PRO B CG  1 
ATOM   3219  C CD  . PRO B  1 3   ? -4.941  -40.768  72.992  1.00 27.99 ? 9    PRO B CD  1 
ATOM   3220  N N   . LEU B  1 4   ? -4.100  -40.008  77.612  1.00 17.22 ? 10   LEU B N   1 
ATOM   3221  C CA  . LEU B  1 4   ? -4.287  -40.556  78.940  1.00 17.59 ? 10   LEU B CA  1 
ATOM   3222  C C   . LEU B  1 4   ? -5.707  -40.317  79.454  1.00 21.01 ? 10   LEU B C   1 
ATOM   3223  O O   . LEU B  1 4   ? -6.168  -41.013  80.361  1.00 19.14 ? 10   LEU B O   1 
ATOM   3224  C CB  . LEU B  1 4   ? -3.275  -39.946  79.900  1.00 17.48 ? 10   LEU B CB  1 
ATOM   3225  C CG  . LEU B  1 4   ? -1.817  -40.238  79.553  1.00 19.46 ? 10   LEU B CG  1 
ATOM   3226  C CD1 . LEU B  1 4   ? -0.912  -39.581  80.561  1.00 20.02 ? 10   LEU B CD1 1 
ATOM   3227  C CD2 . LEU B  1 4   ? -1.577  -41.733  79.511  1.00 17.31 ? 10   LEU B CD2 1 
ATOM   3228  N N   . ALA B  1 5   ? -6.389  -39.328  78.879  1.00 21.19 ? 11   ALA B N   1 
ATOM   3229  C CA  . ALA B  1 5   ? -7.736  -38.977  79.322  1.00 22.69 ? 11   ALA B CA  1 
ATOM   3230  C C   . ALA B  1 5   ? -8.695  -40.141  79.134  1.00 23.16 ? 11   ALA B C   1 
ATOM   3231  O O   . ALA B  1 5   ? -9.608  -40.315  79.931  1.00 23.53 ? 11   ALA B O   1 
ATOM   3232  C CB  . ALA B  1 5   ? -8.246  -37.755  78.590  1.00 20.49 ? 11   ALA B CB  1 
ATOM   3233  N N   . ARG B  1 6   ? -8.480  -40.943  78.093  1.00 20.89 ? 12   ARG B N   1 
ATOM   3234  C CA  . ARG B  1 6   ? -9.282  -42.148  77.889  1.00 21.38 ? 12   ARG B CA  1 
ATOM   3235  C C   . ARG B  1 6   ? -9.294  -43.039  79.119  1.00 23.91 ? 12   ARG B C   1 
ATOM   3236  O O   . ARG B  1 6   ? -10.259 -43.760  79.351  1.00 29.12 ? 12   ARG B O   1 
ATOM   3237  C CB  . ARG B  1 6   ? -8.764  -42.972  76.711  1.00 20.83 ? 12   ARG B CB  1 
ATOM   3238  C CG  . ARG B  1 6   ? -8.911  -42.346  75.364  1.00 16.57 ? 12   ARG B CG  1 
ATOM   3239  C CD  . ARG B  1 6   ? -8.472  -43.353  74.330  1.00 19.59 ? 12   ARG B CD  1 
ATOM   3240  N NE  . ARG B  1 6   ? -8.246  -42.766  73.017  1.00 19.36 ? 12   ARG B NE  1 
ATOM   3241  C CZ  . ARG B  1 6   ? -7.691  -43.428  72.012  1.00 18.48 ? 12   ARG B CZ  1 
ATOM   3242  N NH1 . ARG B  1 6   ? -7.306  -44.683  72.194  1.00 21.85 ? 12   ARG B NH1 1 
ATOM   3243  N NH2 . ARG B  1 6   ? -7.507  -42.840  70.838  1.00 15.14 ? 12   ARG B NH2 1 
ATOM   3244  N N   . ASP B  1 7   ? -8.217  -42.990  79.898  1.00 21.79 ? 13   ASP B N   1 
ATOM   3245  C CA  . ASP B  1 7   ? -8.034  -43.906  81.019  1.00 24.96 ? 13   ASP B CA  1 
ATOM   3246  C C   . ASP B  1 7   ? -8.250  -43.225  82.363  1.00 20.37 ? 13   ASP B C   1 
ATOM   3247  O O   . ASP B  1 7   ? -7.809  -43.726  83.394  1.00 18.01 ? 13   ASP B O   1 
ATOM   3248  C CB  . ASP B  1 7   ? -6.628  -44.521  80.980  1.00 30.71 ? 13   ASP B CB  1 
ATOM   3249  C CG  . ASP B  1 7   ? -6.180  -44.889  79.564  1.00 37.11 ? 13   ASP B CG  1 
ATOM   3250  O OD1 . ASP B  1 7   ? -7.044  -45.272  78.745  1.00 34.91 ? 13   ASP B OD1 1 
ATOM   3251  O OD2 . ASP B  1 7   ? -4.964  -44.790  79.270  1.00 39.36 ? 13   ASP B OD2 1 
ATOM   3252  N N   . ALA B  1 8   ? -8.938  -42.089  82.352  1.00 17.31 ? 14   ALA B N   1 
ATOM   3253  C CA  . ALA B  1 8   ? -9.086  -41.300  83.566  1.00 15.92 ? 14   ALA B CA  1 
ATOM   3254  C C   . ALA B  1 8   ? -10.533 -41.163  83.993  1.00 14.91 ? 14   ALA B C   1 
ATOM   3255  O O   . ALA B  1 8   ? -11.451 -41.206  83.169  1.00 18.77 ? 14   ALA B O   1 
ATOM   3256  C CB  . ALA B  1 8   ? -8.477  -39.925  83.378  1.00 15.62 ? 14   ALA B CB  1 
ATOM   3257  N N   . MET B  1 9   ? -10.723 -41.004  85.295  1.00 11.36 ? 15   MET B N   1 
ATOM   3258  C CA  . MET B  1 9   ? -12.012 -40.633  85.847  1.00 12.45 ? 15   MET B CA  1 
ATOM   3259  C C   . MET B  1 9   ? -11.863 -39.298  86.563  1.00 15.72 ? 15   MET B C   1 
ATOM   3260  O O   . MET B  1 9   ? -10.905 -39.105  87.308  1.00 15.56 ? 15   MET B O   1 
ATOM   3261  C CB  . MET B  1 9   ? -12.514 -41.702  86.811  1.00 15.57 ? 15   MET B CB  1 
ATOM   3262  C CG  . MET B  1 9   ? -13.926 -41.493  87.296  1.00 19.72 ? 15   MET B CG  1 
ATOM   3263  S SD  . MET B  1 9   ? -14.337 -42.742  88.512  1.00 19.97 ? 15   MET B SD  1 
ATOM   3264  C CE  . MET B  1 9   ? -16.042 -42.350  88.888  1.00 32.28 ? 15   MET B CE  1 
ATOM   3265  N N   . ALA B  1 10  ? -12.785 -38.374  86.313  1.00 14.84 ? 16   ALA B N   1 
ATOM   3266  C CA  . ALA B  1 10  ? -12.807 -37.109  87.039  1.00 13.23 ? 16   ALA B CA  1 
ATOM   3267  C C   . ALA B  1 10  ? -13.778 -37.227  88.202  1.00 15.69 ? 16   ALA B C   1 
ATOM   3268  O O   . ALA B  1 10  ? -14.923 -37.624  88.026  1.00 22.58 ? 16   ALA B O   1 
ATOM   3269  C CB  . ALA B  1 10  ? -13.190 -35.970  86.125  1.00 14.63 ? 16   ALA B CB  1 
ATOM   3270  N N   . TYR B  1 11  ? -13.309 -36.903  89.398  1.00 13.80 ? 17   TYR B N   1 
ATOM   3271  C CA  . TYR B  1 11  ? -14.115 -37.037  90.595  1.00 14.19 ? 17   TYR B CA  1 
ATOM   3272  C C   . TYR B  1 11  ? -14.276 -35.664  91.264  1.00 15.54 ? 17   TYR B C   1 
ATOM   3273  O O   . TYR B  1 11  ? -13.351 -35.157  91.879  1.00 20.18 ? 17   TYR B O   1 
ATOM   3274  C CB  . TYR B  1 11  ? -13.468 -38.046  91.539  1.00 17.13 ? 17   TYR B CB  1 
ATOM   3275  C CG  . TYR B  1 11  ? -14.410 -38.665  92.531  1.00 15.73 ? 17   TYR B CG  1 
ATOM   3276  C CD1 . TYR B  1 11  ? -14.653 -38.063  93.755  1.00 17.30 ? 17   TYR B CD1 1 
ATOM   3277  C CD2 . TYR B  1 11  ? -15.048 -39.858  92.255  1.00 15.49 ? 17   TYR B CD2 1 
ATOM   3278  C CE1 . TYR B  1 11  ? -15.520 -38.630  94.673  1.00 17.39 ? 17   TYR B CE1 1 
ATOM   3279  C CE2 . TYR B  1 11  ? -15.916 -40.434  93.168  1.00 18.22 ? 17   TYR B CE2 1 
ATOM   3280  C CZ  . TYR B  1 11  ? -16.142 -39.817  94.375  1.00 17.49 ? 17   TYR B CZ  1 
ATOM   3281  O OH  . TYR B  1 11  ? -17.001 -40.380  95.281  1.00 21.24 ? 17   TYR B OH  1 
ATOM   3282  N N   . VAL B  1 12  ? -15.455 -35.069  91.128  1.00 10.36 ? 18   VAL B N   1 
ATOM   3283  C CA  . VAL B  1 12  ? -15.682 -33.688  91.519  1.00 11.29 ? 18   VAL B CA  1 
ATOM   3284  C C   . VAL B  1 12  ? -16.243 -33.582  92.934  1.00 16.72 ? 18   VAL B C   1 
ATOM   3285  O O   . VAL B  1 12  ? -17.290 -34.142  93.240  1.00 16.76 ? 18   VAL B O   1 
ATOM   3286  C CB  . VAL B  1 12  ? -16.645 -33.000  90.542  1.00 13.02 ? 18   VAL B CB  1 
ATOM   3287  C CG1 . VAL B  1 12  ? -16.891 -31.550  90.947  1.00 14.97 ? 18   VAL B CG1 1 
ATOM   3288  C CG2 . VAL B  1 12  ? -16.095 -33.069  89.144  1.00 10.69 ? 18   VAL B CG2 1 
ATOM   3289  N N   . LEU B  1 13  ? -15.538 -32.867  93.803  1.00 15.12 ? 19   LEU B N   1 
ATOM   3290  C CA  . LEU B  1 13  ? -16.028 -32.644  95.154  1.00 16.87 ? 19   LEU B CA  1 
ATOM   3291  C C   . LEU B  1 13  ? -16.947 -31.431  95.135  1.00 16.03 ? 19   LEU B C   1 
ATOM   3292  O O   . LEU B  1 13  ? -16.515 -30.317  94.840  1.00 18.06 ? 19   LEU B O   1 
ATOM   3293  C CB  . LEU B  1 13  ? -14.864 -32.443  96.118  1.00 16.28 ? 19   LEU B CB  1 
ATOM   3294  C CG  . LEU B  1 13  ? -13.779 -33.511  96.002  1.00 16.56 ? 19   LEU B CG  1 
ATOM   3295  C CD1 . LEU B  1 13  ? -12.514 -33.042  96.702  1.00 18.20 ? 19   LEU B CD1 1 
ATOM   3296  C CD2 . LEU B  1 13  ? -14.283 -34.801  96.600  1.00 17.01 ? 19   LEU B CD2 1 
ATOM   3297  N N   . ALA B  1 14  ? -18.218 -31.650  95.443  1.00 13.91 ? 20   ALA B N   1 
ATOM   3298  C CA  . ALA B  1 14  ? -19.232 -30.631  95.227  1.00 14.09 ? 20   ALA B CA  1 
ATOM   3299  C C   . ALA B  1 14  ? -20.079 -30.416  96.473  1.00 17.81 ? 20   ALA B C   1 
ATOM   3300  O O   . ALA B  1 14  ? -21.292 -30.234  96.384  1.00 21.19 ? 20   ALA B O   1 
ATOM   3301  C CB  . ALA B  1 14  ? -20.110 -31.014  94.032  1.00 15.52 ? 20   ALA B CB  1 
ATOM   3302  N N   . GLY B  1 15  ? -19.433 -30.442  97.636  1.00 19.68 ? 21   GLY B N   1 
ATOM   3303  C CA  . GLY B  1 15  ? -20.124 -30.209  98.890  1.00 22.16 ? 21   GLY B CA  1 
ATOM   3304  C C   . GLY B  1 15  ? -19.890 -28.816  99.454  1.00 25.03 ? 21   GLY B C   1 
ATOM   3305  O O   . GLY B  1 15  ? -20.311 -28.523  100.575 1.00 26.60 ? 21   GLY B O   1 
ATOM   3306  N N   . GLY B  1 16  ? -19.218 -27.963  98.679  1.00 21.19 ? 22   GLY B N   1 
ATOM   3307  C CA  . GLY B  1 16  ? -18.897 -26.609  99.101  1.00 22.18 ? 22   GLY B CA  1 
ATOM   3308  C C   . GLY B  1 16  ? -20.079 -25.801  99.613  1.00 25.01 ? 22   GLY B C   1 
ATOM   3309  O O   . GLY B  1 16  ? -21.092 -25.643  98.929  1.00 21.41 ? 22   GLY B O   1 
ATOM   3310  N N   . ARG B  1 17  ? -19.950 -25.278  100.829 1.00 25.30 ? 23   ARG B N   1 
ATOM   3311  C CA  . ARG B  1 17  ? -21.058 -24.573  101.456 1.00 24.94 ? 23   ARG B CA  1 
ATOM   3312  C C   . ARG B  1 17  ? -21.155 -23.135  100.968 1.00 19.35 ? 23   ARG B C   1 
ATOM   3313  O O   . ARG B  1 17  ? -22.249 -22.590  100.850 1.00 23.09 ? 23   ARG B O   1 
ATOM   3314  C CB  . ARG B  1 17  ? -20.914 -24.603  102.980 1.00 30.71 ? 23   ARG B CB  1 
ATOM   3315  C CG  . ARG B  1 17  ? -22.150 -25.104  103.710 1.00 41.71 ? 23   ARG B CG  1 
ATOM   3316  C CD  . ARG B  1 17  ? -21.755 -25.843  104.978 1.00 47.61 ? 23   ARG B CD  1 
ATOM   3317  N NE  . ARG B  1 17  ? -20.670 -25.153  105.668 1.00 54.39 ? 23   ARG B NE  1 
ATOM   3318  C CZ  . ARG B  1 17  ? -20.189 -25.505  106.856 1.00 60.79 ? 23   ARG B CZ  1 
ATOM   3319  N NH1 . ARG B  1 17  ? -20.688 -26.558  107.493 1.00 66.17 ? 23   ARG B NH1 1 
ATOM   3320  N NH2 . ARG B  1 17  ? -19.199 -24.809  107.402 1.00 59.28 ? 23   ARG B NH2 1 
ATOM   3321  N N   . GLY B  1 18  ? -20.011 -22.522  100.687 1.00 20.32 ? 24   GLY B N   1 
ATOM   3322  C CA  . GLY B  1 18  ? -19.977 -21.113  100.333 1.00 21.84 ? 24   GLY B CA  1 
ATOM   3323  C C   . GLY B  1 18  ? -20.541 -20.261  101.458 1.00 23.03 ? 24   GLY B C   1 
ATOM   3324  O O   . GLY B  1 18  ? -21.450 -19.455  101.251 1.00 19.74 ? 24   GLY B O   1 
ATOM   3325  N N   . SER B  1 19  ? -19.999 -20.447  102.658 1.00 25.47 ? 25   SER B N   1 
ATOM   3326  C CA  . SER B  1 19  ? -20.544 -19.817  103.860 1.00 28.55 ? 25   SER B CA  1 
ATOM   3327  C C   . SER B  1 19  ? -20.576 -18.295  103.778 1.00 24.88 ? 25   SER B C   1 
ATOM   3328  O O   . SER B  1 19  ? -21.539 -17.675  104.213 1.00 25.48 ? 25   SER B O   1 
ATOM   3329  C CB  . SER B  1 19  ? -19.743 -20.250  105.087 1.00 26.68 ? 25   SER B CB  1 
ATOM   3330  O OG  . SER B  1 19  ? -19.838 -21.650  105.266 1.00 31.18 ? 25   SER B OG  1 
ATOM   3331  N N   . ARG B  1 20  ? -19.532 -17.700  103.212 1.00 22.54 ? 26   ARG B N   1 
ATOM   3332  C CA  . ARG B  1 20  ? -19.443 -16.248  103.112 1.00 19.22 ? 26   ARG B CA  1 
ATOM   3333  C C   . ARG B  1 20  ? -20.349 -15.676  102.028 1.00 23.19 ? 26   ARG B C   1 
ATOM   3334  O O   . ARG B  1 20  ? -20.389 -14.463  101.845 1.00 24.12 ? 26   ARG B O   1 
ATOM   3335  C CB  . ARG B  1 20  ? -18.006 -15.817  102.846 1.00 18.56 ? 26   ARG B CB  1 
ATOM   3336  C CG  . ARG B  1 20  ? -17.083 -15.932  104.041 1.00 25.22 ? 26   ARG B CG  1 
ATOM   3337  C CD  . ARG B  1 20  ? -15.648 -15.650  103.631 1.00 27.69 ? 26   ARG B CD  1 
ATOM   3338  N NE  . ARG B  1 20  ? -15.280 -16.417  102.442 1.00 34.86 ? 26   ARG B NE  1 
ATOM   3339  C CZ  . ARG B  1 20  ? -14.268 -16.108  101.636 1.00 37.74 ? 26   ARG B CZ  1 
ATOM   3340  N NH1 . ARG B  1 20  ? -13.516 -15.045  101.888 1.00 39.14 ? 26   ARG B NH1 1 
ATOM   3341  N NH2 . ARG B  1 20  ? -14.008 -16.859  100.575 1.00 37.94 ? 26   ARG B NH2 1 
ATOM   3342  N N   . LEU B  1 21  ? -21.058 -16.545  101.305 1.00 21.38 ? 27   LEU B N   1 
ATOM   3343  C CA  . LEU B  1 21  ? -22.022 -16.109  100.297 1.00 19.09 ? 27   LEU B CA  1 
ATOM   3344  C C   . LEU B  1 21  ? -23.376 -15.873  100.948 1.00 19.44 ? 27   LEU B C   1 
ATOM   3345  O O   . LEU B  1 21  ? -24.299 -15.347  100.325 1.00 21.34 ? 27   LEU B O   1 
ATOM   3346  C CB  . LEU B  1 21  ? -22.134 -17.137  99.165  1.00 20.24 ? 27   LEU B CB  1 
ATOM   3347  C CG  . LEU B  1 21  ? -20.914 -17.202  98.249  1.00 16.97 ? 27   LEU B CG  1 
ATOM   3348  C CD1 . LEU B  1 21  ? -21.080 -18.268  97.169  1.00 18.68 ? 27   LEU B CD1 1 
ATOM   3349  C CD2 . LEU B  1 21  ? -20.682 -15.842  97.625  1.00 11.65 ? 27   LEU B CD2 1 
ATOM   3350  N N   . LYS B  1 22  ? -23.473 -16.275  102.213 1.00 21.81 ? 28   LYS B N   1 
ATOM   3351  C CA  . LYS B  1 22  ? -24.608 -15.960  103.074 1.00 20.45 ? 28   LYS B CA  1 
ATOM   3352  C C   . LYS B  1 22  ? -25.922 -16.513  102.540 1.00 19.47 ? 28   LYS B C   1 
ATOM   3353  O O   . LYS B  1 22  ? -26.035 -17.711  102.308 1.00 23.63 ? 28   LYS B O   1 
ATOM   3354  C CB  . LYS B  1 22  ? -24.695 -14.448  103.283 1.00 22.73 ? 28   LYS B CB  1 
ATOM   3355  C CG  . LYS B  1 22  ? -23.398 -13.864  103.830 1.00 26.00 ? 28   LYS B CG  1 
ATOM   3356  C CD  . LYS B  1 22  ? -23.054 -14.491  105.180 1.00 31.51 ? 28   LYS B CD  1 
ATOM   3357  C CE  . LYS B  1 22  ? -21.557 -14.459  105.476 1.00 36.13 ? 28   LYS B CE  1 
ATOM   3358  N NZ  . LYS B  1 22  ? -20.944 -13.112  105.331 1.00 35.71 ? 28   LYS B NZ  1 
ATOM   3359  N N   . GLU B  1 23  ? -26.919 -15.662  102.351 1.00 14.95 ? 29   GLU B N   1 
ATOM   3360  C CA  . GLU B  1 23  ? -28.242 -16.167  102.000 1.00 17.23 ? 29   GLU B CA  1 
ATOM   3361  C C   . GLU B  1 23  ? -28.278 -16.795  100.605 1.00 19.36 ? 29   GLU B C   1 
ATOM   3362  O O   . GLU B  1 23  ? -29.156 -17.597  100.300 1.00 17.29 ? 29   GLU B O   1 
ATOM   3363  C CB  . GLU B  1 23  ? -29.283 -15.056  102.097 1.00 21.86 ? 29   GLU B CB  1 
ATOM   3364  C CG  . GLU B  1 23  ? -29.694 -14.716  103.517 1.00 26.20 ? 29   GLU B CG  1 
ATOM   3365  C CD  . GLU B  1 23  ? -28.798 -13.680  104.155 1.00 28.25 ? 29   GLU B CD  1 
ATOM   3366  O OE1 . GLU B  1 23  ? -27.812 -13.258  103.511 1.00 29.79 ? 29   GLU B OE1 1 
ATOM   3367  O OE2 . GLU B  1 23  ? -29.076 -13.293  105.310 1.00 24.72 ? 29   GLU B OE2 1 
ATOM   3368  N N   . LEU B  1 24  ? -27.308 -16.447  99.770  1.00 20.33 ? 30   LEU B N   1 
ATOM   3369  C CA  . LEU B  1 24  ? -27.216 -17.028  98.436  1.00 19.11 ? 30   LEU B CA  1 
ATOM   3370  C C   . LEU B  1 24  ? -27.067 -18.553  98.481  1.00 22.95 ? 30   LEU B C   1 
ATOM   3371  O O   . LEU B  1 24  ? -27.470 -19.241  97.546  1.00 22.07 ? 30   LEU B O   1 
ATOM   3372  C CB  . LEU B  1 24  ? -26.046 -16.419  97.683  1.00 19.29 ? 30   LEU B CB  1 
ATOM   3373  C CG  . LEU B  1 24  ? -26.103 -16.415  96.165  1.00 21.28 ? 30   LEU B CG  1 
ATOM   3374  C CD1 . LEU B  1 24  ? -27.301 -15.624  95.691  1.00 18.40 ? 30   LEU B CD1 1 
ATOM   3375  C CD2 . LEU B  1 24  ? -24.822 -15.814  95.636  1.00 20.47 ? 30   LEU B CD2 1 
ATOM   3376  N N   . THR B  1 25  ? -26.504 -19.078  99.570  1.00 19.83 ? 31   THR B N   1 
ATOM   3377  C CA  . THR B  1 25  ? -26.340 -20.525  99.722  1.00 19.04 ? 31   THR B CA  1 
ATOM   3378  C C   . THR B  1 25  ? -27.071 -21.102  100.932 1.00 21.27 ? 31   THR B C   1 
ATOM   3379  O O   . THR B  1 25  ? -26.706 -22.168  101.426 1.00 20.50 ? 31   THR B O   1 
ATOM   3380  C CB  . THR B  1 25  ? -24.866 -20.923  99.846  1.00 17.13 ? 31   THR B CB  1 
ATOM   3381  O OG1 . THR B  1 25  ? -24.233 -20.122  100.851 1.00 18.39 ? 31   THR B OG1 1 
ATOM   3382  C CG2 . THR B  1 25  ? -24.149 -20.730  98.523  1.00 20.23 ? 31   THR B CG2 1 
ATOM   3383  N N   . ASP B  1 26  ? -28.103 -20.421  101.413 1.00 21.80 ? 32   ASP B N   1 
ATOM   3384  C CA  . ASP B  1 26  ? -28.861 -20.965  102.533 1.00 21.97 ? 32   ASP B CA  1 
ATOM   3385  C C   . ASP B  1 26  ? -29.680 -22.183  102.106 1.00 22.63 ? 32   ASP B C   1 
ATOM   3386  O O   . ASP B  1 26  ? -30.015 -23.025  102.933 1.00 24.57 ? 32   ASP B O   1 
ATOM   3387  C CB  . ASP B  1 26  ? -29.771 -19.904  103.152 1.00 30.56 ? 32   ASP B CB  1 
ATOM   3388  C CG  . ASP B  1 26  ? -29.083 -19.123  104.259 1.00 34.73 ? 32   ASP B CG  1 
ATOM   3389  O OD1 . ASP B  1 26  ? -27.982 -19.533  104.684 1.00 39.59 ? 32   ASP B OD1 1 
ATOM   3390  O OD2 . ASP B  1 26  ? -29.649 -18.112  104.720 1.00 35.55 ? 32   ASP B OD2 1 
ATOM   3391  N N   . ARG B  1 27  ? -29.982 -22.296  100.817 1.00 20.45 ? 33   ARG B N   1 
ATOM   3392  C CA  . ARG B  1 27  ? -30.768 -23.423  100.329 1.00 19.90 ? 33   ARG B CA  1 
ATOM   3393  C C   . ARG B  1 27  ? -30.141 -24.120  99.107  1.00 20.84 ? 33   ARG B C   1 
ATOM   3394  O O   . ARG B  1 27  ? -30.815 -24.853  98.380  1.00 22.42 ? 33   ARG B O   1 
ATOM   3395  C CB  . ARG B  1 27  ? -32.185 -22.947  100.007 1.00 23.32 ? 33   ARG B CB  1 
ATOM   3396  C CG  . ARG B  1 27  ? -32.986 -22.645  101.258 1.00 29.86 ? 33   ARG B CG  1 
ATOM   3397  C CD  . ARG B  1 27  ? -34.239 -21.835  100.997 1.00 38.00 ? 33   ARG B CD  1 
ATOM   3398  N NE  . ARG B  1 27  ? -35.128 -21.914  102.153 1.00 49.11 ? 33   ARG B NE  1 
ATOM   3399  C CZ  . ARG B  1 27  ? -35.997 -20.972  102.502 1.00 57.87 ? 33   ARG B CZ  1 
ATOM   3400  N NH1 . ARG B  1 27  ? -36.094 -19.857  101.789 1.00 62.01 ? 33   ARG B NH1 1 
ATOM   3401  N NH2 . ARG B  1 27  ? -36.760 -21.142  103.573 1.00 59.60 ? 33   ARG B NH2 1 
ATOM   3402  N N   . ARG B  1 28  ? -28.851 -23.895  98.895  1.00 14.17 ? 34   ARG B N   1 
ATOM   3403  C CA  . ARG B  1 28  ? -28.145 -24.510  97.786  1.00 17.78 ? 34   ARG B CA  1 
ATOM   3404  C C   . ARG B  1 28  ? -26.657 -24.575  98.102  1.00 18.78 ? 34   ARG B C   1 
ATOM   3405  O O   . ARG B  1 28  ? -26.126 -23.713  98.811  1.00 16.02 ? 34   ARG B O   1 
ATOM   3406  C CB  . ARG B  1 28  ? -28.385 -23.727  96.483  1.00 15.28 ? 34   ARG B CB  1 
ATOM   3407  C CG  . ARG B  1 28  ? -27.876 -22.289  96.537  1.00 14.50 ? 34   ARG B CG  1 
ATOM   3408  C CD  . ARG B  1 28  ? -27.930 -21.593  95.182  1.00 14.09 ? 34   ARG B CD  1 
ATOM   3409  N NE  . ARG B  1 28  ? -29.296 -21.420  94.693  1.00 16.67 ? 34   ARG B NE  1 
ATOM   3410  C CZ  . ARG B  1 28  ? -30.031 -20.326  94.875  1.00 22.08 ? 34   ARG B CZ  1 
ATOM   3411  N NH1 . ARG B  1 28  ? -29.540 -19.281  95.527  1.00 24.99 ? 34   ARG B NH1 1 
ATOM   3412  N NH2 . ARG B  1 28  ? -31.261 -20.273  94.396  1.00 25.80 ? 34   ARG B NH2 1 
ATOM   3413  N N   . ALA B  1 29  ? -25.990 -25.599  97.577  1.00 13.23 ? 35   ALA B N   1 
ATOM   3414  C CA  . ALA B  1 29  ? -24.545 -25.716  97.709  1.00 13.38 ? 35   ALA B CA  1 
ATOM   3415  C C   . ALA B  1 29  ? -23.889 -24.694  96.794  1.00 13.38 ? 35   ALA B C   1 
ATOM   3416  O O   . ALA B  1 29  ? -24.498 -24.249  95.831  1.00 12.53 ? 35   ALA B O   1 
ATOM   3417  C CB  . ALA B  1 29  ? -24.090 -27.118  97.368  1.00 12.83 ? 35   ALA B CB  1 
ATOM   3418  N N   . LYS B  1 30  ? -22.656 -24.310  97.094  1.00 12.57 ? 36   LYS B N   1 
ATOM   3419  C CA  . LYS B  1 30  ? -21.956 -23.341  96.259  1.00 11.96 ? 36   LYS B CA  1 
ATOM   3420  C C   . LYS B  1 30  ? -21.830 -23.763  94.779  1.00 14.84 ? 36   LYS B C   1 
ATOM   3421  O O   . LYS B  1 30  ? -21.999 -22.927  93.893  1.00 13.36 ? 36   LYS B O   1 
ATOM   3422  C CB  . LYS B  1 30  ? -20.565 -23.056  96.829  1.00 9.30  ? 36   LYS B CB  1 
ATOM   3423  C CG  . LYS B  1 30  ? -19.813 -21.980  96.076  1.00 10.09 ? 36   LYS B CG  1 
ATOM   3424  C CD  . LYS B  1 30  ? -18.522 -21.619  96.780  1.00 12.56 ? 36   LYS B CD  1 
ATOM   3425  C CE  . LYS B  1 30  ? -17.765 -20.548  96.017  1.00 12.15 ? 36   LYS B CE  1 
ATOM   3426  N NZ  . LYS B  1 30  ? -16.285 -20.799  96.017  1.00 15.54 ? 36   LYS B NZ  1 
ATOM   3427  N N   . PRO B  1 31  ? -21.534 -25.050  94.494  1.00 16.68 ? 37   PRO B N   1 
ATOM   3428  C CA  . PRO B  1 31  ? -21.425 -25.387  93.065  1.00 15.67 ? 37   PRO B CA  1 
ATOM   3429  C C   . PRO B  1 31  ? -22.713 -25.162  92.265  1.00 14.68 ? 37   PRO B C   1 
ATOM   3430  O O   . PRO B  1 31  ? -22.665 -25.022  91.050  1.00 15.49 ? 37   PRO B O   1 
ATOM   3431  C CB  . PRO B  1 31  ? -21.068 -26.878  93.082  1.00 17.07 ? 37   PRO B CB  1 
ATOM   3432  C CG  . PRO B  1 31  ? -20.469 -27.117  94.419  1.00 15.84 ? 37   PRO B CG  1 
ATOM   3433  C CD  . PRO B  1 31  ? -21.201 -26.207  95.349  1.00 14.91 ? 37   PRO B CD  1 
ATOM   3434  N N   . ALA B  1 32  ? -23.849 -25.123  92.943  1.00 10.53 ? 38   ALA B N   1 
ATOM   3435  C CA  . ALA B  1 32  ? -25.127 -24.902  92.278  1.00 11.24 ? 38   ALA B CA  1 
ATOM   3436  C C   . ALA B  1 32  ? -25.420 -23.412  92.094  1.00 9.61  ? 38   ALA B C   1 
ATOM   3437  O O   . ALA B  1 32  ? -26.448 -23.042  91.544  1.00 10.04 ? 38   ALA B O   1 
ATOM   3438  C CB  . ALA B  1 32  ? -26.253 -25.570  93.064  1.00 12.33 ? 38   ALA B CB  1 
ATOM   3439  N N   . VAL B  1 33  ? -24.531 -22.547  92.567  1.00 12.14 ? 39   VAL B N   1 
ATOM   3440  C CA  . VAL B  1 33  ? -24.777 -21.116  92.431  1.00 12.76 ? 39   VAL B CA  1 
ATOM   3441  C C   . VAL B  1 33  ? -24.642 -20.706  90.958  1.00 12.24 ? 39   VAL B C   1 
ATOM   3442  O O   . VAL B  1 33  ? -23.701 -21.101  90.278  1.00 9.35  ? 39   VAL B O   1 
ATOM   3443  C CB  . VAL B  1 33  ? -23.847 -20.293  93.347  1.00 13.13 ? 39   VAL B CB  1 
ATOM   3444  C CG1 . VAL B  1 33  ? -23.810 -18.852  92.929  1.00 13.41 ? 39   VAL B CG1 1 
ATOM   3445  C CG2 . VAL B  1 33  ? -24.335 -20.396  94.791  1.00 12.02 ? 39   VAL B CG2 1 
ATOM   3446  N N   . TYR B  1 34  ? -25.631 -19.955  90.476  1.00 13.54 ? 40   TYR B N   1 
ATOM   3447  C CA  . TYR B  1 34  ? -25.693 -19.465  89.099  1.00 12.24 ? 40   TYR B CA  1 
ATOM   3448  C C   . TYR B  1 34  ? -24.530 -18.557  88.751  1.00 14.43 ? 40   TYR B C   1 
ATOM   3449  O O   . TYR B  1 34  ? -24.055 -17.804  89.597  1.00 14.70 ? 40   TYR B O   1 
ATOM   3450  C CB  . TYR B  1 34  ? -26.987 -18.693  88.871  1.00 13.75 ? 40   TYR B CB  1 
ATOM   3451  C CG  . TYR B  1 34  ? -28.247 -19.482  89.131  1.00 17.41 ? 40   TYR B CG  1 
ATOM   3452  C CD1 . TYR B  1 34  ? -28.741 -20.372  88.187  1.00 16.71 ? 40   TYR B CD1 1 
ATOM   3453  C CD2 . TYR B  1 34  ? -28.953 -19.318  90.311  1.00 19.41 ? 40   TYR B CD2 1 
ATOM   3454  C CE1 . TYR B  1 34  ? -29.898 -21.085  88.423  1.00 16.89 ? 40   TYR B CE1 1 
ATOM   3455  C CE2 . TYR B  1 34  ? -30.112 -20.030  90.558  1.00 16.93 ? 40   TYR B CE2 1 
ATOM   3456  C CZ  . TYR B  1 34  ? -30.573 -20.908  89.610  1.00 16.94 ? 40   TYR B CZ  1 
ATOM   3457  O OH  . TYR B  1 34  ? -31.723 -21.612  89.849  1.00 19.99 ? 40   TYR B OH  1 
ATOM   3458  N N   . PHE B  1 35  ? -24.093 -18.600  87.499  1.00 13.51 ? 41   PHE B N   1 
ATOM   3459  C CA  . PHE B  1 35  ? -23.044 -17.688  87.068  1.00 16.14 ? 41   PHE B CA  1 
ATOM   3460  C C   . PHE B  1 35  ? -23.101 -17.374  85.590  1.00 17.73 ? 41   PHE B C   1 
ATOM   3461  O O   . PHE B  1 35  ? -23.287 -18.257  84.754  1.00 19.85 ? 41   PHE B O   1 
ATOM   3462  C CB  . PHE B  1 35  ? -21.660 -18.247  87.402  1.00 17.27 ? 41   PHE B CB  1 
ATOM   3463  C CG  . PHE B  1 35  ? -20.538 -17.384  86.895  1.00 20.95 ? 41   PHE B CG  1 
ATOM   3464  C CD1 . PHE B  1 35  ? -20.168 -16.232  87.583  1.00 21.52 ? 41   PHE B CD1 1 
ATOM   3465  C CD2 . PHE B  1 35  ? -19.883 -17.698  85.711  1.00 18.15 ? 41   PHE B CD2 1 
ATOM   3466  C CE1 . PHE B  1 35  ? -19.152 -15.422  87.108  1.00 16.86 ? 41   PHE B CE1 1 
ATOM   3467  C CE2 . PHE B  1 35  ? -18.859 -16.888  85.229  1.00 17.70 ? 41   PHE B CE2 1 
ATOM   3468  C CZ  . PHE B  1 35  ? -18.494 -15.755  85.930  1.00 18.91 ? 41   PHE B CZ  1 
ATOM   3469  N N   . GLY B  1 36  ? -22.928 -16.101  85.268  1.00 12.29 ? 42   GLY B N   1 
ATOM   3470  C CA  . GLY B  1 36  ? -22.705 -15.702  83.894  1.00 14.31 ? 42   GLY B CA  1 
ATOM   3471  C C   . GLY B  1 36  ? -23.913 -15.621  82.991  1.00 15.19 ? 42   GLY B C   1 
ATOM   3472  O O   . GLY B  1 36  ? -23.775 -15.395  81.793  1.00 18.72 ? 42   GLY B O   1 
ATOM   3473  N N   . GLY B  1 37  ? -25.099 -15.813  83.547  1.00 14.12 ? 43   GLY B N   1 
ATOM   3474  C CA  . GLY B  1 37  ? -26.315 -15.677  82.768  1.00 19.28 ? 43   GLY B CA  1 
ATOM   3475  C C   . GLY B  1 37  ? -27.022 -16.988  82.456  1.00 19.36 ? 43   GLY B C   1 
ATOM   3476  O O   . GLY B  1 37  ? -28.250 -17.022  82.342  1.00 20.25 ? 43   GLY B O   1 
ATOM   3477  N N   . LYS B  1 38  ? -26.259 -18.072  82.320  1.00 19.70 ? 44   LYS B N   1 
ATOM   3478  C CA  . LYS B  1 38  ? -26.845 -19.361  81.947  1.00 19.12 ? 44   LYS B CA  1 
ATOM   3479  C C   . LYS B  1 38  ? -26.416 -20.528  82.842  1.00 19.91 ? 44   LYS B C   1 
ATOM   3480  O O   . LYS B  1 38  ? -27.247 -21.325  83.260  1.00 19.09 ? 44   LYS B O   1 
ATOM   3481  C CB  . LYS B  1 38  ? -26.508 -19.686  80.494  1.00 19.67 ? 44   LYS B CB  1 
ATOM   3482  C CG  . LYS B  1 38  ? -26.795 -18.540  79.519  1.00 21.87 ? 44   LYS B CG  1 
ATOM   3483  C CD  . LYS B  1 38  ? -27.956 -18.827  78.579  1.00 26.29 ? 44   LYS B CD  1 
ATOM   3484  C CE  . LYS B  1 38  ? -28.238 -17.625  77.696  1.00 25.79 ? 44   LYS B CE  1 
ATOM   3485  N NZ  . LYS B  1 38  ? -29.168 -17.933  76.576  1.00 32.15 ? 44   LYS B NZ  1 
ATOM   3486  N N   . ALA B  1 39  ? -25.128 -20.626  83.149  1.00 16.38 ? 45   ALA B N   1 
ATOM   3487  C CA  . ALA B  1 39  ? -24.601 -21.820  83.813  1.00 12.35 ? 45   ALA B CA  1 
ATOM   3488  C C   . ALA B  1 39  ? -24.646 -21.758  85.344  1.00 13.42 ? 45   ALA B C   1 
ATOM   3489  O O   . ALA B  1 39  ? -25.074 -20.768  85.937  1.00 12.38 ? 45   ALA B O   1 
ATOM   3490  C CB  . ALA B  1 39  ? -23.175 -22.079  83.352  1.00 10.74 ? 45   ALA B CB  1 
ATOM   3491  N N   . ARG B  1 40  ? -24.214 -22.842  85.978  1.00 9.84  ? 46   ARG B N   1 
ATOM   3492  C CA  . ARG B  1 40  ? -23.947 -22.829  87.402  1.00 10.52 ? 46   ARG B CA  1 
ATOM   3493  C C   . ARG B  1 40  ? -22.462 -23.080  87.558  1.00 12.83 ? 46   ARG B C   1 
ATOM   3494  O O   . ARG B  1 40  ? -21.820 -23.545  86.616  1.00 14.86 ? 46   ARG B O   1 
ATOM   3495  C CB  . ARG B  1 40  ? -24.771 -23.880  88.146  1.00 10.07 ? 46   ARG B CB  1 
ATOM   3496  C CG  . ARG B  1 40  ? -26.292 -23.729  88.007  1.00 10.93 ? 46   ARG B CG  1 
ATOM   3497  C CD  . ARG B  1 40  ? -26.991 -24.793  88.848  1.00 10.79 ? 46   ARG B CD  1 
ATOM   3498  N NE  . ARG B  1 40  ? -28.445 -24.839  88.684  1.00 12.06 ? 46   ARG B NE  1 
ATOM   3499  C CZ  . ARG B  1 40  ? -29.323 -24.486  89.619  1.00 12.07 ? 46   ARG B CZ  1 
ATOM   3500  N NH1 . ARG B  1 40  ? -28.924 -24.020  90.789  1.00 11.34 ? 46   ARG B NH1 1 
ATOM   3501  N NH2 . ARG B  1 40  ? -30.611 -24.586  89.381  1.00 14.08 ? 46   ARG B NH2 1 
ATOM   3502  N N   . ILE B  1 41  ? -21.918 -22.775  88.731  1.00 9.99  ? 47   ILE B N   1 
ATOM   3503  C CA  . ILE B  1 41  ? -20.486 -22.875  88.965  1.00 10.80 ? 47   ILE B CA  1 
ATOM   3504  C C   . ILE B  1 41  ? -19.935 -24.252  88.605  1.00 10.54 ? 47   ILE B C   1 
ATOM   3505  O O   . ILE B  1 41  ? -18.945 -24.357  87.883  1.00 10.90 ? 47   ILE B O   1 
ATOM   3506  C CB  . ILE B  1 41  ? -20.135 -22.549  90.436  1.00 14.14 ? 47   ILE B CB  1 
ATOM   3507  C CG1 . ILE B  1 41  ? -20.326 -21.053  90.709  1.00 13.33 ? 47   ILE B CG1 1 
ATOM   3508  C CG2 . ILE B  1 41  ? -18.703 -22.936  90.739  1.00 10.92 ? 47   ILE B CG2 1 
ATOM   3509  C CD1 . ILE B  1 41  ? -20.068 -20.647  92.161  1.00 14.05 ? 47   ILE B CD1 1 
ATOM   3510  N N   . ILE B  1 42  ? -20.596 -25.307  89.067  1.00 11.28 ? 48   ILE B N   1 
ATOM   3511  C CA  . ILE B  1 42  ? -20.084 -26.660  88.864  1.00 11.52 ? 48   ILE B CA  1 
ATOM   3512  C C   . ILE B  1 42  ? -19.875 -27.016  87.385  1.00 12.14 ? 48   ILE B C   1 
ATOM   3513  O O   . ILE B  1 42  ? -19.085 -27.900  87.063  1.00 13.88 ? 48   ILE B O   1 
ATOM   3514  C CB  . ILE B  1 42  ? -21.013 -27.710  89.506  1.00 10.99 ? 48   ILE B CB  1 
ATOM   3515  C CG1 . ILE B  1 42  ? -20.272 -29.049  89.655  1.00 14.50 ? 48   ILE B CG1 1 
ATOM   3516  C CG2 . ILE B  1 42  ? -22.304 -27.840  88.712  1.00 7.88  ? 48   ILE B CG2 1 
ATOM   3517  C CD1 . ILE B  1 42  ? -20.928 -30.017  90.585  1.00 15.63 ? 48   ILE B CD1 1 
ATOM   3518  N N   . ASP B  1 43  ? -20.558 -26.313  86.488  1.00 8.84  ? 49   ASP B N   1 
ATOM   3519  C CA  . ASP B  1 43  ? -20.494 -26.621  85.057  1.00 9.84  ? 49   ASP B CA  1 
ATOM   3520  C C   . ASP B  1 43  ? -19.122 -26.379  84.418  1.00 12.66 ? 49   ASP B C   1 
ATOM   3521  O O   . ASP B  1 43  ? -18.856 -26.847  83.309  1.00 12.95 ? 49   ASP B O   1 
ATOM   3522  C CB  . ASP B  1 43  ? -21.535 -25.811  84.301  1.00 8.39  ? 49   ASP B CB  1 
ATOM   3523  C CG  . ASP B  1 43  ? -22.951 -26.184  84.690  1.00 8.24  ? 49   ASP B CG  1 
ATOM   3524  O OD1 . ASP B  1 43  ? -23.176 -27.346  85.087  1.00 9.79  ? 49   ASP B OD1 1 
ATOM   3525  O OD2 . ASP B  1 43  ? -23.832 -25.315  84.583  1.00 10.43 ? 49   ASP B OD2 1 
ATOM   3526  N N   . PHE B  1 44  ? -18.267 -25.639  85.112  1.00 12.89 ? 50   PHE B N   1 
ATOM   3527  C CA  . PHE B  1 44  ? -16.942 -25.360  84.583  1.00 10.10 ? 50   PHE B CA  1 
ATOM   3528  C C   . PHE B  1 44  ? -16.028 -26.567  84.778  1.00 11.35 ? 50   PHE B C   1 
ATOM   3529  O O   . PHE B  1 44  ? -15.441 -27.045  83.812  1.00 12.71 ? 50   PHE B O   1 
ATOM   3530  C CB  . PHE B  1 44  ? -16.380 -24.083  85.212  1.00 10.83 ? 50   PHE B CB  1 
ATOM   3531  C CG  . PHE B  1 44  ? -17.027 -22.840  84.669  1.00 14.10 ? 50   PHE B CG  1 
ATOM   3532  C CD1 . PHE B  1 44  ? -18.252 -22.410  85.162  1.00 15.24 ? 50   PHE B CD1 1 
ATOM   3533  C CD2 . PHE B  1 44  ? -16.455 -22.152  83.608  1.00 13.42 ? 50   PHE B CD2 1 
ATOM   3534  C CE1 . PHE B  1 44  ? -18.878 -21.291  84.632  1.00 12.85 ? 50   PHE B CE1 1 
ATOM   3535  C CE2 . PHE B  1 44  ? -17.072 -21.042  83.078  1.00 13.90 ? 50   PHE B CE2 1 
ATOM   3536  C CZ  . PHE B  1 44  ? -18.286 -20.609  83.589  1.00 11.59 ? 50   PHE B CZ  1 
ATOM   3537  N N   . ALA B  1 45  ? -15.952 -27.102  85.993  1.00 8.83  ? 51   ALA B N   1 
ATOM   3538  C CA  . ALA B  1 45  ? -15.153 -28.304  86.223  1.00 11.23 ? 51   ALA B CA  1 
ATOM   3539  C C   . ALA B  1 45  ? -15.624 -29.487  85.368  1.00 10.14 ? 51   ALA B C   1 
ATOM   3540  O O   . ALA B  1 45  ? -14.810 -30.249  84.860  1.00 11.57 ? 51   ALA B O   1 
ATOM   3541  C CB  . ALA B  1 45  ? -15.180 -28.678  87.673  1.00 12.22 ? 51   ALA B CB  1 
ATOM   3542  N N   . LEU B  1 46  ? -16.938 -29.635  85.209  1.00 11.35 ? 52   LEU B N   1 
ATOM   3543  C CA  . LEU B  1 46  ? -17.495 -30.731  84.426  1.00 9.97  ? 52   LEU B CA  1 
ATOM   3544  C C   . LEU B  1 46  ? -17.208 -30.524  82.946  1.00 8.03  ? 52   LEU B C   1 
ATOM   3545  O O   . LEU B  1 46  ? -16.921 -31.480  82.231  1.00 11.62 ? 52   LEU B O   1 
ATOM   3546  C CB  . LEU B  1 46  ? -19.008 -30.865  84.662  1.00 10.12 ? 52   LEU B CB  1 
ATOM   3547  C CG  . LEU B  1 46  ? -19.509 -31.181  86.084  1.00 7.73  ? 52   LEU B CG  1 
ATOM   3548  C CD1 . LEU B  1 46  ? -21.016 -31.014  86.188  1.00 11.09 ? 52   LEU B CD1 1 
ATOM   3549  C CD2 . LEU B  1 46  ? -19.108 -32.579  86.521  1.00 9.40  ? 52   LEU B CD2 1 
ATOM   3550  N N   . SER B  1 47  ? -17.283 -29.280  82.479  1.00 9.73  ? 53   SER B N   1 
ATOM   3551  C CA  . SER B  1 47  ? -16.963 -28.994  81.078  1.00 8.57  ? 53   SER B CA  1 
ATOM   3552  C C   . SER B  1 47  ? -15.465 -29.144  80.810  1.00 12.55 ? 53   SER B C   1 
ATOM   3553  O O   . SER B  1 47  ? -15.083 -29.594  79.734  1.00 12.86 ? 53   SER B O   1 
ATOM   3554  C CB  . SER B  1 47  ? -17.428 -27.599  80.682  1.00 10.29 ? 53   SER B CB  1 
ATOM   3555  O OG  . SER B  1 47  ? -18.828 -27.477  80.874  1.00 13.68 ? 53   SER B OG  1 
ATOM   3556  N N   . ASN B  1 48  ? -14.625 -28.770  81.776  1.00 11.45 ? 54   ASN B N   1 
ATOM   3557  C CA  . ASN B  1 48  ? -13.188 -29.061  81.683  1.00 11.94 ? 54   ASN B CA  1 
ATOM   3558  C C   . ASN B  1 48  ? -12.903 -30.556  81.508  1.00 14.41 ? 54   ASN B C   1 
ATOM   3559  O O   . ASN B  1 48  ? -12.121 -30.947  80.644  1.00 11.47 ? 54   ASN B O   1 
ATOM   3560  C CB  . ASN B  1 48  ? -12.437 -28.568  82.923  1.00 9.76  ? 54   ASN B CB  1 
ATOM   3561  C CG  . ASN B  1 48  ? -12.402 -27.071  83.028  1.00 10.99 ? 54   ASN B CG  1 
ATOM   3562  O OD1 . ASN B  1 48  ? -12.458 -26.369  82.022  1.00 13.57 ? 54   ASN B OD1 1 
ATOM   3563  N ND2 . ASN B  1 48  ? -12.303 -26.569  84.250  1.00 12.22 ? 54   ASN B ND2 1 
ATOM   3564  N N   . ALA B  1 49  ? -13.522 -31.378  82.353  1.00 14.79 ? 55   ALA B N   1 
ATOM   3565  C CA  . ALA B  1 49  ? -13.347 -32.827  82.285  1.00 14.06 ? 55   ALA B CA  1 
ATOM   3566  C C   . ALA B  1 49  ? -13.808 -33.380  80.929  1.00 14.23 ? 55   ALA B C   1 
ATOM   3567  O O   . ALA B  1 49  ? -13.098 -34.166  80.294  1.00 20.15 ? 55   ALA B O   1 
ATOM   3568  C CB  . ALA B  1 49  ? -14.092 -33.506  83.434  1.00 10.87 ? 55   ALA B CB  1 
ATOM   3569  N N   . LEU B  1 50  ? -14.981 -32.951  80.478  1.00 13.47 ? 56   LEU B N   1 
ATOM   3570  C CA  . LEU B  1 50  ? -15.523 -33.330  79.166  1.00 13.39 ? 56   LEU B CA  1 
ATOM   3571  C C   . LEU B  1 50  ? -14.612 -32.913  77.998  1.00 15.30 ? 56   LEU B C   1 
ATOM   3572  O O   . LEU B  1 50  ? -14.242 -33.726  77.148  1.00 14.00 ? 56   LEU B O   1 
ATOM   3573  C CB  . LEU B  1 50  ? -16.906 -32.699  78.983  1.00 14.69 ? 56   LEU B CB  1 
ATOM   3574  C CG  . LEU B  1 50  ? -17.677 -32.951  77.691  1.00 21.56 ? 56   LEU B CG  1 
ATOM   3575  C CD1 . LEU B  1 50  ? -18.218 -34.357  77.689  1.00 28.88 ? 56   LEU B CD1 1 
ATOM   3576  C CD2 . LEU B  1 50  ? -18.800 -31.931  77.518  1.00 17.26 ? 56   LEU B CD2 1 
ATOM   3577  N N   . ASN B  1 51  ? -14.267 -31.629  77.962  1.00 16.56 ? 57   ASN B N   1 
ATOM   3578  C CA  . ASN B  1 51  ? -13.449 -31.069  76.894  1.00 16.89 ? 57   ASN B CA  1 
ATOM   3579  C C   . ASN B  1 51  ? -12.033 -31.637  76.883  1.00 15.61 ? 57   ASN B C   1 
ATOM   3580  O O   . ASN B  1 51  ? -11.379 -31.643  75.849  1.00 19.76 ? 57   ASN B O   1 
ATOM   3581  C CB  . ASN B  1 51  ? -13.395 -29.535  77.003  1.00 15.15 ? 57   ASN B CB  1 
ATOM   3582  C CG  . ASN B  1 51  ? -14.731 -28.871  76.713  1.00 16.29 ? 57   ASN B CG  1 
ATOM   3583  O OD1 . ASN B  1 51  ? -15.633 -29.474  76.140  1.00 21.01 ? 57   ASN B OD1 1 
ATOM   3584  N ND2 . ASN B  1 51  ? -14.853 -27.615  77.093  1.00 15.36 ? 57   ASN B ND2 1 
ATOM   3585  N N   . SER B  1 52  ? -11.559 -32.117  78.026  1.00 11.89 ? 58   SER B N   1 
ATOM   3586  C CA  . SER B  1 52  ? -10.228 -32.713  78.095  1.00 13.47 ? 58   SER B CA  1 
ATOM   3587  C C   . SER B  1 52  ? -10.214 -34.152  77.589  1.00 14.14 ? 58   SER B C   1 
ATOM   3588  O O   . SER B  1 52  ? -9.150  -34.738  77.424  1.00 18.29 ? 58   SER B O   1 
ATOM   3589  C CB  . SER B  1 52  ? -9.691  -32.676  79.524  1.00 14.86 ? 58   SER B CB  1 
ATOM   3590  O OG  . SER B  1 52  ? -9.567  -31.342  79.974  1.00 19.64 ? 58   SER B OG  1 
ATOM   3591  N N   . GLY B  1 53  ? -11.393 -34.720  77.363  1.00 14.61 ? 59   GLY B N   1 
ATOM   3592  C CA  . GLY B  1 53  ? -11.493 -36.090  76.895  1.00 16.89 ? 59   GLY B CA  1 
ATOM   3593  C C   . GLY B  1 53  ? -11.777 -37.120  77.978  1.00 17.16 ? 59   GLY B C   1 
ATOM   3594  O O   . GLY B  1 53  ? -11.786 -38.323  77.705  1.00 16.90 ? 59   GLY B O   1 
ATOM   3595  N N   . ILE B  1 54  ? -12.001 -36.667  79.208  1.00 13.73 ? 60   ILE B N   1 
ATOM   3596  C CA  . ILE B  1 54  ? -12.350 -37.580  80.290  1.00 12.91 ? 60   ILE B CA  1 
ATOM   3597  C C   . ILE B  1 54  ? -13.823 -37.994  80.133  1.00 16.79 ? 60   ILE B C   1 
ATOM   3598  O O   . ILE B  1 54  ? -14.694 -37.143  79.959  1.00 17.33 ? 60   ILE B O   1 
ATOM   3599  C CB  . ILE B  1 54  ? -12.095 -36.945  81.675  1.00 10.42 ? 60   ILE B CB  1 
ATOM   3600  C CG1 . ILE B  1 54  ? -10.609 -36.632  81.847  1.00 10.00 ? 60   ILE B CG1 1 
ATOM   3601  C CG2 . ILE B  1 54  ? -12.562 -37.857  82.785  1.00 8.00  ? 60   ILE B CG2 1 
ATOM   3602  C CD1 . ILE B  1 54  ? -10.236 -36.099  83.253  1.00 9.89  ? 60   ILE B CD1 1 
ATOM   3603  N N   . ARG B  1 55  ? -14.084 -39.302  80.175  1.00 14.37 ? 61   ARG B N   1 
ATOM   3604  C CA  . ARG B  1 55  ? -15.402 -39.861  79.852  1.00 18.98 ? 61   ARG B CA  1 
ATOM   3605  C C   . ARG B  1 55  ? -16.176 -40.367  81.058  1.00 14.43 ? 61   ARG B C   1 
ATOM   3606  O O   . ARG B  1 55  ? -17.352 -40.677  80.945  1.00 16.86 ? 61   ARG B O   1 
ATOM   3607  C CB  . ARG B  1 55  ? -15.255 -41.013  78.854  1.00 18.14 ? 61   ARG B CB  1 
ATOM   3608  N N   . ARG B  1 56  ? -15.501 -40.488  82.193  1.00 11.57 ? 62   ARG B N   1 
ATOM   3609  C CA  . ARG B  1 56  ? -16.117 -40.959  83.424  1.00 11.07 ? 62   ARG B CA  1 
ATOM   3610  C C   . ARG B  1 56  ? -16.043 -39.874  84.485  1.00 10.29 ? 62   ARG B C   1 
ATOM   3611  O O   . ARG B  1 56  ? -14.961 -39.418  84.831  1.00 14.80 ? 62   ARG B O   1 
ATOM   3612  C CB  . ARG B  1 56  ? -15.426 -42.210  83.937  1.00 13.29 ? 62   ARG B CB  1 
ATOM   3613  C CG  . ARG B  1 56  ? -15.431 -43.348  82.967  1.00 12.77 ? 62   ARG B CG  1 
ATOM   3614  C CD  . ARG B  1 56  ? -15.230 -44.653  83.692  1.00 14.52 ? 62   ARG B CD  1 
ATOM   3615  N NE  . ARG B  1 56  ? -15.240 -45.776  82.769  1.00 14.50 ? 62   ARG B NE  1 
ATOM   3616  C CZ  . ARG B  1 56  ? -16.335 -46.409  82.364  1.00 13.63 ? 62   ARG B CZ  1 
ATOM   3617  N NH1 . ARG B  1 56  ? -17.529 -46.029  82.800  1.00 17.20 ? 62   ARG B NH1 1 
ATOM   3618  N NH2 . ARG B  1 56  ? -16.230 -47.425  81.517  1.00 12.66 ? 62   ARG B NH2 1 
ATOM   3619  N N   . ILE B  1 57  ? -17.191 -39.468  85.005  1.00 11.27 ? 63   ILE B N   1 
ATOM   3620  C CA  . ILE B  1 57  ? -17.223 -38.429  86.011  1.00 14.10 ? 63   ILE B CA  1 
ATOM   3621  C C   . ILE B  1 57  ? -17.998 -38.917  87.235  1.00 16.72 ? 63   ILE B C   1 
ATOM   3622  O O   . ILE B  1 57  ? -19.044 -39.554  87.105  1.00 18.55 ? 63   ILE B O   1 
ATOM   3623  C CB  . ILE B  1 57  ? -17.842 -37.130  85.440  1.00 11.83 ? 63   ILE B CB  1 
ATOM   3624  C CG1 . ILE B  1 57  ? -17.049 -36.679  84.208  1.00 10.11 ? 63   ILE B CG1 1 
ATOM   3625  C CG2 . ILE B  1 57  ? -17.898 -36.052  86.507  1.00 12.12 ? 63   ILE B CG2 1 
ATOM   3626  C CD1 . ILE B  1 57  ? -17.642 -35.504  83.472  1.00 14.35 ? 63   ILE B CD1 1 
ATOM   3627  N N   . GLY B  1 58  ? -17.453 -38.660  88.419  1.00 12.48 ? 64   GLY B N   1 
ATOM   3628  C CA  . GLY B  1 58  ? -18.186 -38.840  89.656  1.00 11.63 ? 64   GLY B CA  1 
ATOM   3629  C C   . GLY B  1 58  ? -18.342 -37.481  90.321  1.00 16.88 ? 64   GLY B C   1 
ATOM   3630  O O   . GLY B  1 58  ? -17.430 -36.659  90.254  1.00 18.46 ? 64   GLY B O   1 
ATOM   3631  N N   . VAL B  1 59  ? -19.497 -37.220  90.930  1.00 16.00 ? 65   VAL B N   1 
ATOM   3632  C CA  . VAL B  1 59  ? -19.711 -35.958  91.639  1.00 14.48 ? 65   VAL B CA  1 
ATOM   3633  C C   . VAL B  1 59  ? -20.247 -36.261  93.017  1.00 15.30 ? 65   VAL B C   1 
ATOM   3634  O O   . VAL B  1 59  ? -21.342 -36.796  93.148  1.00 14.79 ? 65   VAL B O   1 
ATOM   3635  C CB  . VAL B  1 59  ? -20.709 -35.023  90.913  1.00 14.10 ? 65   VAL B CB  1 
ATOM   3636  C CG1 . VAL B  1 59  ? -20.928 -33.752  91.731  1.00 17.88 ? 65   VAL B CG1 1 
ATOM   3637  C CG2 . VAL B  1 59  ? -20.230 -34.683  89.500  1.00 7.60  ? 65   VAL B CG2 1 
ATOM   3638  N N   . ALA B  1 60  ? -19.468 -35.924  94.043  1.00 17.01 ? 66   ALA B N   1 
ATOM   3639  C CA  . ALA B  1 60  ? -19.847 -36.176  95.427  1.00 14.25 ? 66   ALA B CA  1 
ATOM   3640  C C   . ALA B  1 60  ? -20.487 -34.949  96.034  1.00 14.27 ? 66   ALA B C   1 
ATOM   3641  O O   . ALA B  1 60  ? -19.868 -33.893  96.089  1.00 15.94 ? 66   ALA B O   1 
ATOM   3642  C CB  . ALA B  1 60  ? -18.635 -36.589  96.243  1.00 18.60 ? 66   ALA B CB  1 
ATOM   3643  N N   . THR B  1 61  ? -21.726 -35.077  96.486  1.00 16.69 ? 67   THR B N   1 
ATOM   3644  C CA  . THR B  1 61  ? -22.418 -33.932  97.066  1.00 19.85 ? 67   THR B CA  1 
ATOM   3645  C C   . THR B  1 61  ? -22.600 -34.128  98.560  1.00 18.66 ? 67   THR B C   1 
ATOM   3646  O O   . THR B  1 61  ? -22.537 -35.249  99.063  1.00 19.59 ? 67   THR B O   1 
ATOM   3647  C CB  . THR B  1 61  ? -23.788 -33.690  96.419  1.00 19.34 ? 67   THR B CB  1 
ATOM   3648  O OG1 . THR B  1 61  ? -24.645 -34.791  96.713  1.00 21.77 ? 67   THR B OG1 1 
ATOM   3649  C CG2 . THR B  1 61  ? -23.654 -33.572  94.923  1.00 16.51 ? 67   THR B CG2 1 
ATOM   3650  N N   . GLN B  1 62  ? -22.822 -33.021  99.258  1.00 17.19 ? 68   GLN B N   1 
ATOM   3651  C CA  . GLN B  1 62  ? -22.940 -33.017  100.707 1.00 16.66 ? 68   GLN B CA  1 
ATOM   3652  C C   . GLN B  1 62  ? -24.159 -32.181  101.086 1.00 15.27 ? 68   GLN B C   1 
ATOM   3653  O O   . GLN B  1 62  ? -25.285 -32.636  100.938 1.00 19.13 ? 68   GLN B O   1 
ATOM   3654  C CB  . GLN B  1 62  ? -21.646 -32.486  101.353 1.00 18.82 ? 68   GLN B CB  1 
ATOM   3655  C CG  . GLN B  1 62  ? -21.569 -32.532  102.888 1.00 21.30 ? 68   GLN B CG  1 
ATOM   3656  C CD  . GLN B  1 62  ? -21.143 -33.879  103.445 1.00 20.52 ? 68   GLN B CD  1 
ATOM   3657  O OE1 . GLN B  1 62  ? -21.728 -34.914  103.132 1.00 20.50 ? 68   GLN B OE1 1 
ATOM   3658  N NE2 . GLN B  1 62  ? -20.129 -33.864  104.296 1.00 20.00 ? 68   GLN B NE2 1 
ATOM   3659  N N   . TYR B  1 63  ? -23.950 -30.953  101.538 1.00 17.38 ? 69   TYR B N   1 
ATOM   3660  C CA  . TYR B  1 63  ? -25.056 -30.189  102.118 1.00 22.65 ? 69   TYR B CA  1 
ATOM   3661  C C   . TYR B  1 63  ? -25.923 -29.455  101.081 1.00 19.25 ? 69   TYR B C   1 
ATOM   3662  O O   . TYR B  1 63  ? -25.440 -29.065  100.021 1.00 22.47 ? 69   TYR B O   1 
ATOM   3663  C CB  . TYR B  1 63  ? -24.501 -29.197  103.144 1.00 31.87 ? 69   TYR B CB  1 
ATOM   3664  C CG  . TYR B  1 63  ? -23.746 -29.850  104.294 1.00 37.01 ? 69   TYR B CG  1 
ATOM   3665  C CD1 . TYR B  1 63  ? -24.202 -31.031  104.868 1.00 37.99 ? 69   TYR B CD1 1 
ATOM   3666  C CD2 . TYR B  1 63  ? -22.576 -29.286  104.800 1.00 40.41 ? 69   TYR B CD2 1 
ATOM   3667  C CE1 . TYR B  1 63  ? -23.519 -31.633  105.915 1.00 42.76 ? 69   TYR B CE1 1 
ATOM   3668  C CE2 . TYR B  1 63  ? -21.885 -29.880  105.845 1.00 42.37 ? 69   TYR B CE2 1 
ATOM   3669  C CZ  . TYR B  1 63  ? -22.362 -31.054  106.399 1.00 44.40 ? 69   TYR B CZ  1 
ATOM   3670  O OH  . TYR B  1 63  ? -21.681 -31.652  107.437 1.00 45.46 ? 69   TYR B OH  1 
ATOM   3671  N N   . LYS B  1 64  ? -27.210 -29.306  101.393 1.00 11.05 ? 70   LYS B N   1 
ATOM   3672  C CA  . LYS B  1 64  ? -28.147 -28.491  100.621 1.00 11.82 ? 70   LYS B CA  1 
ATOM   3673  C C   . LYS B  1 64  ? -28.121 -28.839  99.122  1.00 17.41 ? 70   LYS B C   1 
ATOM   3674  O O   . LYS B  1 64  ? -28.025 -27.957  98.264  1.00 15.49 ? 70   LYS B O   1 
ATOM   3675  C CB  . LYS B  1 64  ? -27.836 -27.005  100.849 1.00 19.49 ? 70   LYS B CB  1 
ATOM   3676  C CG  . LYS B  1 64  ? -27.631 -26.648  102.342 1.00 17.70 ? 70   LYS B CG  1 
ATOM   3677  C CD  . LYS B  1 64  ? -26.903 -25.301  102.570 1.00 19.64 ? 70   LYS B CD  1 
ATOM   3678  C CE  . LYS B  1 64  ? -25.607 -25.155  101.748 1.00 20.73 ? 70   LYS B CE  1 
ATOM   3679  N NZ  . LYS B  1 64  ? -24.664 -26.303  101.842 1.00 25.00 ? 70   LYS B NZ  1 
ATOM   3680  N N   . ALA B  1 65  ? -28.222 -30.126  98.809  1.00 16.07 ? 71   ALA B N   1 
ATOM   3681  C CA  . ALA B  1 65  ? -27.796 -30.580  97.490  1.00 17.29 ? 71   ALA B CA  1 
ATOM   3682  C C   . ALA B  1 65  ? -28.905 -30.854  96.480  1.00 16.02 ? 71   ALA B C   1 
ATOM   3683  O O   . ALA B  1 65  ? -28.594 -31.137  95.325  1.00 17.38 ? 71   ALA B O   1 
ATOM   3684  C CB  . ALA B  1 65  ? -26.925 -31.832  97.642  1.00 13.89 ? 71   ALA B CB  1 
ATOM   3685  N N   . HIS B  1 66  ? -30.178 -30.768  96.870  1.00 15.28 ? 72   HIS B N   1 
ATOM   3686  C CA  . HIS B  1 66  ? -31.235 -31.198  95.948  1.00 15.24 ? 72   HIS B CA  1 
ATOM   3687  C C   . HIS B  1 66  ? -31.222 -30.439  94.621  1.00 12.70 ? 72   HIS B C   1 
ATOM   3688  O O   . HIS B  1 66  ? -31.391 -31.045  93.570  1.00 17.14 ? 72   HIS B O   1 
ATOM   3689  C CB  . HIS B  1 66  ? -32.631 -31.070  96.565  1.00 22.24 ? 72   HIS B CB  1 
ATOM   3690  C CG  . HIS B  1 66  ? -33.736 -31.414  95.604  1.00 29.15 ? 72   HIS B CG  1 
ATOM   3691  N ND1 . HIS B  1 66  ? -33.717 -32.552  94.824  1.00 35.67 ? 72   HIS B ND1 1 
ATOM   3692  C CD2 . HIS B  1 66  ? -34.867 -30.751  95.264  1.00 28.44 ? 72   HIS B CD2 1 
ATOM   3693  C CE1 . HIS B  1 66  ? -34.797 -32.585  94.063  1.00 32.18 ? 72   HIS B CE1 1 
ATOM   3694  N NE2 . HIS B  1 66  ? -35.511 -31.502  94.308  1.00 23.84 ? 72   HIS B NE2 1 
ATOM   3695  N N   . SER B  1 67  ? -31.029 -29.123  94.650  1.00 12.98 ? 73   SER B N   1 
ATOM   3696  C CA  . SER B  1 67  ? -31.081 -28.372  93.396  1.00 13.73 ? 73   SER B CA  1 
ATOM   3697  C C   . SER B  1 67  ? -29.837 -28.635  92.551  1.00 15.33 ? 73   SER B C   1 
ATOM   3698  O O   . SER B  1 67  ? -29.930 -28.692  91.324  1.00 18.76 ? 73   SER B O   1 
ATOM   3699  C CB  . SER B  1 67  ? -31.253 -26.882  93.648  1.00 12.73 ? 73   SER B CB  1 
ATOM   3700  O OG  . SER B  1 67  ? -30.155 -26.358  94.358  1.00 17.32 ? 73   SER B OG  1 
ATOM   3701  N N   . LEU B  1 68  ? -28.686 -28.810  93.197  1.00 11.85 ? 74   LEU B N   1 
ATOM   3702  C CA  . LEU B  1 68  ? -27.485 -29.236  92.478  1.00 6.50  ? 74   LEU B CA  1 
ATOM   3703  C C   . LEU B  1 68  ? -27.717 -30.578  91.824  1.00 12.50 ? 74   LEU B C   1 
ATOM   3704  O O   . LEU B  1 68  ? -27.398 -30.783  90.650  1.00 12.78 ? 74   LEU B O   1 
ATOM   3705  C CB  . LEU B  1 68  ? -26.281 -29.335  93.414  1.00 9.10  ? 74   LEU B CB  1 
ATOM   3706  C CG  . LEU B  1 68  ? -25.038 -29.960  92.779  1.00 10.68 ? 74   LEU B CG  1 
ATOM   3707  C CD1 . LEU B  1 68  ? -24.577 -29.133  91.610  1.00 9.12  ? 74   LEU B CD1 1 
ATOM   3708  C CD2 . LEU B  1 68  ? -23.928 -30.040  93.800  1.00 11.73 ? 74   LEU B CD2 1 
ATOM   3709  N N   . ILE B  1 69  ? -28.266 -31.504  92.591  1.00 12.13 ? 75   ILE B N   1 
ATOM   3710  C CA  . ILE B  1 69  ? -28.462 -32.836  92.071  1.00 14.72 ? 75   ILE B CA  1 
ATOM   3711  C C   . ILE B  1 69  ? -29.482 -32.781  90.928  1.00 11.46 ? 75   ILE B C   1 
ATOM   3712  O O   . ILE B  1 69  ? -29.214 -33.316  89.859  1.00 15.36 ? 75   ILE B O   1 
ATOM   3713  C CB  . ILE B  1 69  ? -28.873 -33.813  93.182  1.00 14.29 ? 75   ILE B CB  1 
ATOM   3714  C CG1 . ILE B  1 69  ? -27.713 -34.023  94.144  1.00 11.55 ? 75   ILE B CG1 1 
ATOM   3715  C CG2 . ILE B  1 69  ? -29.085 -35.149  92.627  1.00 14.41 ? 75   ILE B CG2 1 
ATOM   3716  C CD1 . ILE B  1 69  ? -28.083 -34.924  95.304  1.00 15.65 ? 75   ILE B CD1 1 
ATOM   3717  N N   . ARG B  1 70  ? -30.611 -32.096  91.116  1.00 12.00 ? 76   ARG B N   1 
ATOM   3718  C CA  . ARG B  1 70  ? -31.577 -31.883  90.018  1.00 13.93 ? 76   ARG B CA  1 
ATOM   3719  C C   . ARG B  1 70  ? -30.919 -31.313  88.749  1.00 13.69 ? 76   ARG B C   1 
ATOM   3720  O O   . ARG B  1 70  ? -31.114 -31.830  87.648  1.00 11.12 ? 76   ARG B O   1 
ATOM   3721  C CB  . ARG B  1 70  ? -32.713 -30.953  90.471  1.00 15.33 ? 76   ARG B CB  1 
ATOM   3722  C CG  . ARG B  1 70  ? -33.844 -30.790  89.454  1.00 20.82 ? 76   ARG B CG  1 
ATOM   3723  C CD  . ARG B  1 70  ? -34.979 -29.906  89.980  1.00 20.87 ? 76   ARG B CD  1 
ATOM   3724  N NE  . ARG B  1 70  ? -34.528 -28.546  90.256  1.00 26.15 ? 76   ARG B NE  1 
ATOM   3725  C CZ  . ARG B  1 70  ? -34.863 -27.852  91.339  1.00 34.00 ? 76   ARG B CZ  1 
ATOM   3726  N NH1 . ARG B  1 70  ? -35.674 -28.381  92.245  1.00 36.81 ? 76   ARG B NH1 1 
ATOM   3727  N NH2 . ARG B  1 70  ? -34.394 -26.624  91.511  1.00 37.64 ? 76   ARG B NH2 1 
ATOM   3728  N N   . HIS B  1 71  ? -30.133 -30.253  88.915  1.00 15.42 ? 77   HIS B N   1 
ATOM   3729  C CA  . HIS B  1 71  ? -29.340 -29.697  87.823  1.00 12.66 ? 77   HIS B CA  1 
ATOM   3730  C C   . HIS B  1 71  ? -28.491 -30.770  87.117  1.00 11.01 ? 77   HIS B C   1 
ATOM   3731  O O   . HIS B  1 71  ? -28.445 -30.838  85.899  1.00 11.84 ? 77   HIS B O   1 
ATOM   3732  C CB  . HIS B  1 71  ? -28.425 -28.586  88.339  1.00 12.33 ? 77   HIS B CB  1 
ATOM   3733  C CG  . HIS B  1 71  ? -27.418 -28.121  87.332  1.00 10.96 ? 77   HIS B CG  1 
ATOM   3734  N ND1 . HIS B  1 71  ? -27.738 -27.262  86.304  1.00 13.93 ? 77   HIS B ND1 1 
ATOM   3735  C CD2 . HIS B  1 71  ? -26.097 -28.386  87.204  1.00 8.93  ? 77   HIS B CD2 1 
ATOM   3736  C CE1 . HIS B  1 71  ? -26.656 -27.015  85.587  1.00 12.11 ? 77   HIS B CE1 1 
ATOM   3737  N NE2 . HIS B  1 71  ? -25.648 -27.690  86.109  1.00 12.33 ? 77   HIS B NE2 1 
ATOM   3738  N N   . LEU B  1 72  ? -27.828 -31.616  87.887  1.00 9.16  ? 78   LEU B N   1 
ATOM   3739  C CA  . LEU B  1 72  ? -26.952 -32.616  87.304  1.00 11.19 ? 78   LEU B CA  1 
ATOM   3740  C C   . LEU B  1 72  ? -27.758 -33.660  86.558  1.00 15.35 ? 78   LEU B C   1 
ATOM   3741  O O   . LEU B  1 72  ? -27.296 -34.169  85.495  1.00 11.86 ? 78   LEU B O   1 
ATOM   3742  C CB  . LEU B  1 72  ? -26.123 -33.301  88.358  1.00 10.62 ? 78   LEU B CB  1 
ATOM   3743  C CG  . LEU B  1 72  ? -25.135 -32.401  89.071  1.00 7.46  ? 78   LEU B CG  1 
ATOM   3744  C CD1 . LEU B  1 72  ? -24.470 -33.141  90.237  1.00 7.23  ? 78   LEU B CD1 1 
ATOM   3745  C CD2 . LEU B  1 72  ? -24.096 -31.907  88.083  1.00 9.25  ? 78   LEU B CD2 1 
ATOM   3746  N N   . GLN B  1 73  ? -28.996 -33.932  87.049  1.00 15.34 ? 79   GLN B N   1 
ATOM   3747  C CA  . GLN B  1 73  ? -29.749 -35.127  86.505  1.00 14.94 ? 79   GLN B CA  1 
ATOM   3748  C C   . GLN B  1 73  ? -30.249 -34.725  85.142  1.00 12.36 ? 79   GLN B C   1 
ATOM   3749  O O   . GLN B  1 73  ? -30.433 -35.552  84.236  1.00 16.38 ? 79   GLN B O   1 
ATOM   3750  C CB  . GLN B  1 73  ? -30.973 -35.636  87.297  1.00 19.76 ? 79   GLN B CB  1 
ATOM   3751  C CG  . GLN B  1 73  ? -30.659 -35.503  88.776  1.00 31.60 ? 79   GLN B CG  1 
ATOM   3752  C CD  . GLN B  1 73  ? -31.551 -36.396  89.615  1.00 40.70 ? 79   GLN B CD  1 
ATOM   3753  O OE1 . GLN B  1 73  ? -32.785 -36.661  89.350  1.00 59.81 ? 79   GLN B OE1 1 
ATOM   3754  N NE2 . GLN B  1 73  ? -31.036 -36.634  90.759  1.00 32.53 ? 79   GLN B NE2 1 
ATOM   3755  N N   . ARG B  1 74  ? -30.528 -33.429  85.029  1.00 13.11 ? 80   ARG B N   1 
ATOM   3756  C CA  . ARG B  1 74  ? -31.177 -32.856  83.850  1.00 12.06 ? 80   ARG B CA  1 
ATOM   3757  C C   . ARG B  1 74  ? -30.190 -32.330  82.828  1.00 11.40 ? 80   ARG B C   1 
ATOM   3758  O O   . ARG B  1 74  ? -30.441 -32.393  81.632  1.00 12.77 ? 80   ARG B O   1 
ATOM   3759  C CB  . ARG B  1 74  ? -32.124 -31.717  84.244  1.00 11.32 ? 80   ARG B CB  1 
ATOM   3760  C CG  . ARG B  1 74  ? -33.399 -32.148  84.965  1.00 15.32 ? 80   ARG B CG  1 
ATOM   3761  C CD  . ARG B  1 74  ? -34.107 -30.961  85.645  1.00 25.51 ? 80   ARG B CD  1 
ATOM   3762  N NE  . ARG B  1 74  ? -35.459 -31.318  86.096  1.00 31.48 ? 80   ARG B NE  1 
ATOM   3763  C CZ  . ARG B  1 74  ? -36.409 -30.447  86.439  1.00 36.01 ? 80   ARG B CZ  1 
ATOM   3764  N NH1 . ARG B  1 74  ? -36.180 -29.139  86.403  1.00 34.10 ? 80   ARG B NH1 1 
ATOM   3765  N NH2 . ARG B  1 74  ? -37.597 -30.899  86.828  1.00 38.83 ? 80   ARG B NH2 1 
ATOM   3766  N N   . GLY B  1 75  ? -29.074 -31.779  83.282  1.00 11.30 ? 81   GLY B N   1 
ATOM   3767  C CA  . GLY B  1 75  ? -28.129 -31.204  82.342  1.00 9.51  ? 81   GLY B CA  1 
ATOM   3768  C C   . GLY B  1 75  ? -27.031 -32.157  81.905  1.00 9.31  ? 81   GLY B C   1 
ATOM   3769  O O   . GLY B  1 75  ? -26.553 -32.095  80.778  1.00 15.45 ? 81   GLY B O   1 
ATOM   3770  N N   . TRP B  1 76  ? -26.612 -33.034  82.806  1.00 11.04 ? 82   TRP B N   1 
ATOM   3771  C CA  . TRP B  1 76  ? -25.528 -33.950  82.505  1.00 10.96 ? 82   TRP B CA  1 
ATOM   3772  C C   . TRP B  1 76  ? -26.055 -35.377  82.362  1.00 10.74 ? 82   TRP B C   1 
ATOM   3773  O O   . TRP B  1 76  ? -25.702 -36.281  83.120  1.00 15.49 ? 82   TRP B O   1 
ATOM   3774  C CB  . TRP B  1 76  ? -24.442 -33.831  83.581  1.00 9.13  ? 82   TRP B CB  1 
ATOM   3775  C CG  . TRP B  1 76  ? -23.799 -32.474  83.524  1.00 10.15 ? 82   TRP B CG  1 
ATOM   3776  C CD1 . TRP B  1 76  ? -24.212 -31.343  84.158  1.00 13.43 ? 82   TRP B CD1 1 
ATOM   3777  C CD2 . TRP B  1 76  ? -22.670 -32.098  82.727  1.00 12.17 ? 82   TRP B CD2 1 
ATOM   3778  N NE1 . TRP B  1 76  ? -23.398 -30.288  83.824  1.00 14.04 ? 82   TRP B NE1 1 
ATOM   3779  C CE2 . TRP B  1 76  ? -22.444 -30.726  82.944  1.00 13.85 ? 82   TRP B CE2 1 
ATOM   3780  C CE3 . TRP B  1 76  ? -21.826 -32.792  81.853  1.00 14.69 ? 82   TRP B CE3 1 
ATOM   3781  C CZ2 . TRP B  1 76  ? -21.403 -30.036  82.328  1.00 14.15 ? 82   TRP B CZ2 1 
ATOM   3782  C CZ3 . TRP B  1 76  ? -20.791 -32.101  81.238  1.00 16.23 ? 82   TRP B CZ3 1 
ATOM   3783  C CH2 . TRP B  1 76  ? -20.588 -30.740  81.484  1.00 15.10 ? 82   TRP B CH2 1 
ATOM   3784  N N   . ASP B  1 77  ? -26.881 -35.562  81.338  1.00 9.12  ? 83   ASP B N   1 
ATOM   3785  C CA  . ASP B  1 77  ? -27.671 -36.770  81.178  1.00 7.93  ? 83   ASP B CA  1 
ATOM   3786  C C   . ASP B  1 77  ? -27.370 -37.536  79.891  1.00 12.97 ? 83   ASP B C   1 
ATOM   3787  O O   . ASP B  1 77  ? -28.165 -38.380  79.469  1.00 18.04 ? 83   ASP B O   1 
ATOM   3788  C CB  . ASP B  1 77  ? -29.158 -36.408  81.208  1.00 12.59 ? 83   ASP B CB  1 
ATOM   3789  C CG  . ASP B  1 77  ? -29.608 -35.626  79.969  1.00 17.80 ? 83   ASP B CG  1 
ATOM   3790  O OD1 . ASP B  1 77  ? -28.750 -35.180  79.176  1.00 21.57 ? 83   ASP B OD1 1 
ATOM   3791  O OD2 . ASP B  1 77  ? -30.832 -35.450  79.786  1.00 16.95 ? 83   ASP B OD2 1 
ATOM   3792  N N   . PHE B  1 78  ? -26.239 -37.240  79.260  1.00 11.99 ? 84   PHE B N   1 
ATOM   3793  C CA  . PHE B  1 78  ? -25.979 -37.735  77.913  1.00 14.11 ? 84   PHE B CA  1 
ATOM   3794  C C   . PHE B  1 78  ? -24.837 -38.754  77.840  1.00 17.77 ? 84   PHE B C   1 
ATOM   3795  O O   . PHE B  1 78  ? -24.396 -39.120  76.752  1.00 20.28 ? 84   PHE B O   1 
ATOM   3796  C CB  . PHE B  1 78  ? -25.686 -36.559  76.971  1.00 10.31 ? 84   PHE B CB  1 
ATOM   3797  C CG  . PHE B  1 78  ? -24.585 -35.655  77.450  1.00 13.36 ? 84   PHE B CG  1 
ATOM   3798  C CD1 . PHE B  1 78  ? -24.859 -34.586  78.294  1.00 13.14 ? 84   PHE B CD1 1 
ATOM   3799  C CD2 . PHE B  1 78  ? -23.273 -35.873  77.064  1.00 16.22 ? 84   PHE B CD2 1 
ATOM   3800  C CE1 . PHE B  1 78  ? -23.845 -33.758  78.733  1.00 13.92 ? 84   PHE B CE1 1 
ATOM   3801  C CE2 . PHE B  1 78  ? -22.250 -35.043  77.504  1.00 15.82 ? 84   PHE B CE2 1 
ATOM   3802  C CZ  . PHE B  1 78  ? -22.535 -33.987  78.334  1.00 14.57 ? 84   PHE B CZ  1 
ATOM   3803  N N   . PHE B  1 79  ? -24.374 -39.226  78.991  1.00 17.34 ? 85   PHE B N   1 
ATOM   3804  C CA  . PHE B  1 79  ? -23.300 -40.226  79.032  1.00 18.97 ? 85   PHE B CA  1 
ATOM   3805  C C   . PHE B  1 79  ? -23.876 -41.638  79.010  1.00 19.25 ? 85   PHE B C   1 
ATOM   3806  O O   . PHE B  1 79  ? -24.750 -41.959  79.805  1.00 17.90 ? 85   PHE B O   1 
ATOM   3807  C CB  . PHE B  1 79  ? -22.442 -40.064  80.286  1.00 18.70 ? 85   PHE B CB  1 
ATOM   3808  C CG  . PHE B  1 79  ? -21.632 -38.796  80.331  1.00 23.12 ? 85   PHE B CG  1 
ATOM   3809  C CD1 . PHE B  1 79  ? -22.247 -37.559  80.463  1.00 22.86 ? 85   PHE B CD1 1 
ATOM   3810  C CD2 . PHE B  1 79  ? -20.252 -38.848  80.299  1.00 22.69 ? 85   PHE B CD2 1 
ATOM   3811  C CE1 . PHE B  1 79  ? -21.493 -36.404  80.526  1.00 23.08 ? 85   PHE B CE1 1 
ATOM   3812  C CE2 . PHE B  1 79  ? -19.494 -37.694  80.362  1.00 22.76 ? 85   PHE B CE2 1 
ATOM   3813  C CZ  . PHE B  1 79  ? -20.119 -36.473  80.474  1.00 21.75 ? 85   PHE B CZ  1 
ATOM   3814  N N   . ARG B  1 80  ? -23.368 -42.488  78.125  1.00 15.67 ? 86   ARG B N   1 
ATOM   3815  C CA  . ARG B  1 80  ? -23.852 -43.865  78.045  1.00 10.24 ? 86   ARG B CA  1 
ATOM   3816  C C   . ARG B  1 80  ? -22.750 -44.868  78.390  1.00 8.98  ? 86   ARG B C   1 
ATOM   3817  O O   . ARG B  1 80  ? -21.689 -44.870  77.765  1.00 9.46  ? 86   ARG B O   1 
ATOM   3818  C CB  . ARG B  1 80  ? -24.423 -44.150  76.644  1.00 8.39  ? 86   ARG B CB  1 
ATOM   3819  C CG  . ARG B  1 80  ? -25.749 -43.430  76.376  1.00 10.48 ? 86   ARG B CG  1 
ATOM   3820  C CD  . ARG B  1 80  ? -26.875 -43.915  77.309  1.00 8.64  ? 86   ARG B CD  1 
ATOM   3821  N NE  . ARG B  1 80  ? -27.053 -45.368  77.223  1.00 11.71 ? 86   ARG B NE  1 
ATOM   3822  C CZ  . ARG B  1 80  ? -28.175 -46.018  77.523  1.00 17.00 ? 86   ARG B CZ  1 
ATOM   3823  N NH1 . ARG B  1 80  ? -29.250 -45.355  77.933  1.00 18.09 ? 86   ARG B NH1 1 
ATOM   3824  N NH2 . ARG B  1 80  ? -28.230 -47.338  77.393  1.00 14.70 ? 86   ARG B NH2 1 
ATOM   3825  N N   . PRO B  1 81  ? -23.007 -45.736  79.379  1.00 10.44 ? 87   PRO B N   1 
ATOM   3826  C CA  . PRO B  1 81  ? -22.018 -46.706  79.862  1.00 13.28 ? 87   PRO B CA  1 
ATOM   3827  C C   . PRO B  1 81  ? -21.488 -47.680  78.814  1.00 13.42 ? 87   PRO B C   1 
ATOM   3828  O O   . PRO B  1 81  ? -20.346 -48.097  78.928  1.00 16.51 ? 87   PRO B O   1 
ATOM   3829  C CB  . PRO B  1 81  ? -22.785 -47.458  80.954  1.00 17.69 ? 87   PRO B CB  1 
ATOM   3830  C CG  . PRO B  1 81  ? -23.765 -46.450  81.462  1.00 13.83 ? 87   PRO B CG  1 
ATOM   3831  C CD  . PRO B  1 81  ? -24.219 -45.739  80.220  1.00 11.67 ? 87   PRO B CD  1 
ATOM   3832  N N   . GLU B  1 82  ? -22.268 -48.046  77.804  1.00 17.60 ? 88   GLU B N   1 
ATOM   3833  C CA  . GLU B  1 82  ? -21.758 -49.054  76.890  1.00 14.77 ? 88   GLU B CA  1 
ATOM   3834  C C   . GLU B  1 82  ? -20.873 -48.379  75.830  1.00 14.30 ? 88   GLU B C   1 
ATOM   3835  O O   . GLU B  1 82  ? -20.263 -49.053  75.006  1.00 15.35 ? 88   GLU B O   1 
ATOM   3836  C CB  . GLU B  1 82  ? -22.903 -49.896  76.295  1.00 20.12 ? 88   GLU B CB  1 
ATOM   3837  C CG  . GLU B  1 82  ? -23.926 -49.181  75.452  1.00 13.80 ? 88   GLU B CG  1 
ATOM   3838  C CD  . GLU B  1 82  ? -25.086 -48.570  76.233  1.00 11.41 ? 88   GLU B CD  1 
ATOM   3839  O OE1 . GLU B  1 82  ? -24.856 -47.679  77.073  1.00 14.49 ? 88   GLU B OE1 1 
ATOM   3840  O OE2 . GLU B  1 82  ? -26.247 -48.936  75.958  1.00 11.27 ? 88   GLU B OE2 1 
ATOM   3841  N N   . ARG B  1 83  ? -20.754 -47.052  75.896  1.00 12.05 ? 89   ARG B N   1 
ATOM   3842  C CA  . ARG B  1 83  ? -19.720 -46.340  75.137  1.00 14.85 ? 89   ARG B CA  1 
ATOM   3843  C C   . ARG B  1 83  ? -18.512 -46.006  76.030  1.00 11.82 ? 89   ARG B C   1 
ATOM   3844  O O   . ARG B  1 83  ? -17.671 -45.176  75.676  1.00 14.24 ? 89   ARG B O   1 
ATOM   3845  C CB  . ARG B  1 83  ? -20.283 -45.060  74.506  1.00 16.56 ? 89   ARG B CB  1 
ATOM   3846  C CG  . ARG B  1 83  ? -21.341 -45.304  73.437  1.00 13.17 ? 89   ARG B CG  1 
ATOM   3847  C CD  . ARG B  1 83  ? -21.571 -44.074  72.582  1.00 12.29 ? 89   ARG B CD  1 
ATOM   3848  N NE  . ARG B  1 83  ? -22.058 -42.914  73.325  1.00 11.42 ? 89   ARG B NE  1 
ATOM   3849  C CZ  . ARG B  1 83  ? -23.339 -42.556  73.424  1.00 14.11 ? 89   ARG B CZ  1 
ATOM   3850  N NH1 . ARG B  1 83  ? -24.279 -43.272  72.837  1.00 13.94 ? 89   ARG B NH1 1 
ATOM   3851  N NH2 . ARG B  1 83  ? -23.681 -41.475  74.107  1.00 13.80 ? 89   ARG B NH2 1 
ATOM   3852  N N   . ASN B  1 84  ? -18.437 -46.665  77.185  1.00 13.19 ? 90   ASN B N   1 
ATOM   3853  C CA  . ASN B  1 84  ? -17.404 -46.426  78.202  1.00 11.11 ? 90   ASN B CA  1 
ATOM   3854  C C   . ASN B  1 84  ? -17.357 -44.994  78.730  1.00 13.88 ? 90   ASN B C   1 
ATOM   3855  O O   . ASN B  1 84  ? -16.291 -44.436  79.005  1.00 18.49 ? 90   ASN B O   1 
ATOM   3856  C CB  . ASN B  1 84  ? -16.045 -46.845  77.667  1.00 14.62 ? 90   ASN B CB  1 
ATOM   3857  C CG  . ASN B  1 84  ? -15.906 -48.336  77.625  1.00 16.85 ? 90   ASN B CG  1 
ATOM   3858  O OD1 . ASN B  1 84  ? -16.514 -49.037  78.436  1.00 20.66 ? 90   ASN B OD1 1 
ATOM   3859  N ND2 . ASN B  1 84  ? -15.137 -48.841  76.673  1.00 16.23 ? 90   ASN B ND2 1 
ATOM   3860  N N   . GLU B  1 85  ? -18.544 -44.423  78.873  1.00 13.21 ? 91   GLU B N   1 
ATOM   3861  C CA  . GLU B  1 85  ? -18.759 -43.159  79.543  1.00 14.07 ? 91   GLU B CA  1 
ATOM   3862  C C   . GLU B  1 85  ? -19.528 -43.443  80.815  1.00 14.44 ? 91   GLU B C   1 
ATOM   3863  O O   . GLU B  1 85  ? -20.141 -44.494  80.946  1.00 16.15 ? 91   GLU B O   1 
ATOM   3864  C CB  . GLU B  1 85  ? -19.544 -42.205  78.647  1.00 18.01 ? 91   GLU B CB  1 
ATOM   3865  C CG  . GLU B  1 85  ? -18.998 -42.120  77.249  1.00 20.99 ? 91   GLU B CG  1 
ATOM   3866  C CD  . GLU B  1 85  ? -20.039 -41.739  76.226  1.00 26.65 ? 91   GLU B CD  1 
ATOM   3867  O OE1 . GLU B  1 85  ? -21.214 -41.544  76.600  1.00 24.23 ? 91   GLU B OE1 1 
ATOM   3868  O OE2 . GLU B  1 85  ? -19.687 -41.657  75.032  1.00 29.77 ? 91   GLU B OE2 1 
ATOM   3869  N N   . SER B  1 86  ? -19.501 -42.517  81.758  1.00 16.22 ? 92   SER B N   1 
ATOM   3870  C CA  . SER B  1 86  ? -20.350 -42.624  82.932  1.00 12.77 ? 92   SER B CA  1 
ATOM   3871  C C   . SER B  1 86  ? -20.438 -41.292  83.641  1.00 12.14 ? 92   SER B C   1 
ATOM   3872  O O   . SER B  1 86  ? -19.554 -40.458  83.548  1.00 16.13 ? 92   SER B O   1 
ATOM   3873  C CB  . SER B  1 86  ? -19.849 -43.710  83.898  1.00 14.29 ? 92   SER B CB  1 
ATOM   3874  O OG  . SER B  1 86  ? -18.471 -43.568  84.182  1.00 14.83 ? 92   SER B OG  1 
ATOM   3875  N N   . PHE B  1 87  ? -21.546 -41.092  84.329  1.00 13.29 ? 93   PHE B N   1 
ATOM   3876  C CA  . PHE B  1 87  ? -21.739 -39.897  85.118  1.00 12.88 ? 93   PHE B CA  1 
ATOM   3877  C C   . PHE B  1 87  ? -22.488 -40.311  86.374  1.00 15.06 ? 93   PHE B C   1 
ATOM   3878  O O   . PHE B  1 87  ? -23.683 -40.620  86.323  1.00 16.06 ? 93   PHE B O   1 
ATOM   3879  C CB  . PHE B  1 87  ? -22.496 -38.840  84.316  1.00 9.26  ? 93   PHE B CB  1 
ATOM   3880  C CG  . PHE B  1 87  ? -22.368 -37.459  84.876  1.00 16.04 ? 93   PHE B CG  1 
ATOM   3881  C CD1 . PHE B  1 87  ? -23.097 -37.080  85.995  1.00 14.68 ? 93   PHE B CD1 1 
ATOM   3882  C CD2 . PHE B  1 87  ? -21.518 -36.538  84.289  1.00 13.20 ? 93   PHE B CD2 1 
ATOM   3883  C CE1 . PHE B  1 87  ? -22.975 -35.807  86.520  1.00 16.83 ? 93   PHE B CE1 1 
ATOM   3884  C CE2 . PHE B  1 87  ? -21.392 -35.265  84.809  1.00 15.12 ? 93   PHE B CE2 1 
ATOM   3885  C CZ  . PHE B  1 87  ? -22.119 -34.899  85.926  1.00 19.12 ? 93   PHE B CZ  1 
ATOM   3886  N N   . ASP B  1 88  ? -21.771 -40.353  87.491  1.00 11.42 ? 94   ASP B N   1 
ATOM   3887  C CA  . ASP B  1 88  ? -22.312 -40.841  88.756  1.00 12.39 ? 94   ASP B CA  1 
ATOM   3888  C C   . ASP B  1 88  ? -22.550 -39.712  89.748  1.00 14.64 ? 94   ASP B C   1 
ATOM   3889  O O   . ASP B  1 88  ? -21.628 -38.964  90.064  1.00 17.57 ? 94   ASP B O   1 
ATOM   3890  C CB  . ASP B  1 88  ? -21.361 -41.863  89.377  1.00 13.24 ? 94   ASP B CB  1 
ATOM   3891  C CG  . ASP B  1 88  ? -21.367 -43.192  88.640  1.00 20.08 ? 94   ASP B CG  1 
ATOM   3892  O OD1 . ASP B  1 88  ? -22.385 -43.910  88.735  1.00 27.24 ? 94   ASP B OD1 1 
ATOM   3893  O OD2 . ASP B  1 88  ? -20.357 -43.530  87.981  1.00 18.13 ? 94   ASP B OD2 1 
ATOM   3894  N N   . ILE B  1 89  ? -23.783 -39.597  90.235  1.00 14.02 ? 95   ILE B N   1 
ATOM   3895  C CA  . ILE B  1 89  ? -24.143 -38.589  91.228  1.00 11.69 ? 95   ILE B CA  1 
ATOM   3896  C C   . ILE B  1 89  ? -24.184 -39.254  92.589  1.00 15.41 ? 95   ILE B C   1 
ATOM   3897  O O   . ILE B  1 89  ? -24.992 -40.149  92.807  1.00 17.36 ? 95   ILE B O   1 
ATOM   3898  C CB  . ILE B  1 89  ? -25.501 -37.944  90.906  1.00 15.49 ? 95   ILE B CB  1 
ATOM   3899  C CG1 . ILE B  1 89  ? -25.439 -37.276  89.527  1.00 17.10 ? 95   ILE B CG1 1 
ATOM   3900  C CG2 . ILE B  1 89  ? -25.888 -36.957  91.994  1.00 13.36 ? 95   ILE B CG2 1 
ATOM   3901  C CD1 . ILE B  1 89  ? -26.775 -36.866  88.959  1.00 17.75 ? 95   ILE B CD1 1 
ATOM   3902  N N   . LEU B  1 90  ? -23.311 -38.815  93.495  1.00 13.72 ? 96   LEU B N   1 
ATOM   3903  C CA  . LEU B  1 90  ? -22.999 -39.564  94.717  1.00 14.06 ? 96   LEU B CA  1 
ATOM   3904  C C   . LEU B  1 90  ? -23.181 -38.774  96.010  1.00 15.94 ? 96   LEU B C   1 
ATOM   3905  O O   . LEU B  1 90  ? -22.211 -38.262  96.570  1.00 17.93 ? 96   LEU B O   1 
ATOM   3906  C CB  . LEU B  1 90  ? -21.559 -40.070  94.653  1.00 14.14 ? 96   LEU B CB  1 
ATOM   3907  C CG  . LEU B  1 90  ? -21.270 -40.972  93.460  1.00 19.62 ? 96   LEU B CG  1 
ATOM   3908  C CD1 . LEU B  1 90  ? -19.819 -41.333  93.447  1.00 16.36 ? 96   LEU B CD1 1 
ATOM   3909  C CD2 . LEU B  1 90  ? -22.148 -42.213  93.530  1.00 18.31 ? 96   LEU B CD2 1 
ATOM   3910  N N   . PRO B  1 91  ? -24.426 -38.672  96.488  1.00 21.55 ? 97   PRO B N   1 
ATOM   3911  C CA  . PRO B  1 91  ? -24.733 -38.029  97.770  1.00 23.65 ? 97   PRO B CA  1 
ATOM   3912  C C   . PRO B  1 91  ? -24.342 -38.940  98.923  1.00 33.80 ? 97   PRO B C   1 
ATOM   3913  O O   . PRO B  1 91  ? -24.362 -40.155  98.714  1.00 35.53 ? 97   PRO B O   1 
ATOM   3914  C CB  . PRO B  1 91  ? -26.251 -37.834  97.718  1.00 20.91 ? 97   PRO B CB  1 
ATOM   3915  C CG  . PRO B  1 91  ? -26.652 -38.150  96.323  1.00 24.09 ? 97   PRO B CG  1 
ATOM   3916  C CD  . PRO B  1 91  ? -25.645 -39.095  95.792  1.00 21.49 ? 97   PRO B CD  1 
ATOM   3917  N N   . ALA B  1 92  ? -24.025 -38.364  100.088 1.00 41.45 ? 98   ALA B N   1 
ATOM   3918  C CA  . ALA B  1 92  ? -23.530 -39.085  101.273 1.00 45.77 ? 98   ALA B CA  1 
ATOM   3919  C C   . ALA B  1 92  ? -23.957 -40.538  101.367 1.00 48.54 ? 98   ALA B C   1 
ATOM   3920  O O   . ALA B  1 92  ? -23.290 -41.425  100.829 1.00 53.26 ? 98   ALA B O   1 
ATOM   3921  C CB  . ALA B  1 92  ? -23.958 -38.361  102.542 1.00 49.09 ? 98   ALA B CB  1 
ATOM   3922  N N   . SER B  1 93  ? -25.057 -40.787  102.065 1.00 47.19 ? 99   SER B N   1 
ATOM   3923  C CA  . SER B  1 93  ? -25.520 -42.157  102.234 1.00 53.63 ? 99   SER B CA  1 
ATOM   3924  C C   . SER B  1 93  ? -26.562 -42.523  101.177 1.00 62.35 ? 99   SER B C   1 
ATOM   3925  O O   . SER B  1 93  ? -27.738 -42.166  101.298 1.00 66.18 ? 99   SER B O   1 
ATOM   3926  C CB  . SER B  1 93  ? -26.086 -42.373  103.641 1.00 49.92 ? 99   SER B CB  1 
ATOM   3927  N N   . GLN B  1 94  ? -26.099 -43.207  100.131 1.00 62.01 ? 100  GLN B N   1 
ATOM   3928  C CA  . GLN B  1 94  ? -26.961 -43.865  99.144  1.00 62.21 ? 100  GLN B CA  1 
ATOM   3929  C C   . GLN B  1 94  ? -27.938 -42.951  98.400  1.00 63.41 ? 100  GLN B C   1 
ATOM   3930  O O   . GLN B  1 94  ? -29.127 -42.932  98.726  1.00 69.27 ? 100  GLN B O   1 
ATOM   3931  C CB  . GLN B  1 94  ? -27.756 -44.986  99.823  1.00 62.66 ? 100  GLN B CB  1 
ATOM   3932  N N   . ARG B  1 95  ? -27.429 -42.244  97.388  1.00 56.33 ? 101  ARG B N   1 
ATOM   3933  C CA  . ARG B  1 95  ? -28.199 -41.336  96.521  1.00 50.70 ? 101  ARG B CA  1 
ATOM   3934  C C   . ARG B  1 95  ? -29.487 -40.779  97.129  1.00 43.47 ? 101  ARG B C   1 
ATOM   3935  O O   . ARG B  1 95  ? -29.975 -39.729  96.717  1.00 37.82 ? 101  ARG B O   1 
ATOM   3936  C CB  . ARG B  1 95  ? -28.524 -42.029  95.190  1.00 52.04 ? 101  ARG B CB  1 
ATOM   3937  C CG  . ARG B  1 95  ? -27.324 -42.140  94.255  1.00 54.26 ? 101  ARG B CG  1 
ATOM   3938  C CD  . ARG B  1 95  ? -27.715 -42.265  92.781  1.00 53.94 ? 101  ARG B CD  1 
ATOM   3939  N NE  . ARG B  1 95  ? -26.540 -42.246  91.905  1.00 51.87 ? 101  ARG B NE  1 
ATOM   3940  C CZ  . ARG B  1 95  ? -25.748 -43.295  91.687  1.00 48.76 ? 101  ARG B CZ  1 
ATOM   3941  N NH1 . ARG B  1 95  ? -26.005 -44.458  92.259  1.00 48.76 ? 101  ARG B NH1 1 
ATOM   3942  N NH2 . ARG B  1 95  ? -24.706 -43.183  90.878  1.00 44.50 ? 101  ARG B NH2 1 
ATOM   3943  N N   . THR B  1 99  ? -27.002 -37.964  109.918 1.00 57.42 ? 105  THR B N   1 
ATOM   3944  C CA  . THR B  1 99  ? -26.139 -39.118  110.130 1.00 54.18 ? 105  THR B CA  1 
ATOM   3945  C C   . THR B  1 99  ? -25.522 -39.614  108.826 1.00 55.05 ? 105  THR B C   1 
ATOM   3946  O O   . THR B  1 99  ? -26.024 -39.332  107.734 1.00 52.40 ? 105  THR B O   1 
ATOM   3947  C CB  . THR B  1 99  ? -26.902 -40.280  110.789 1.00 51.02 ? 105  THR B CB  1 
ATOM   3948  N N   . GLN B  1 100 ? -24.416 -40.337  108.965 1.00 58.66 ? 106  GLN B N   1 
ATOM   3949  C CA  . GLN B  1 100 ? -23.731 -40.994  107.856 1.00 62.29 ? 106  GLN B CA  1 
ATOM   3950  C C   . GLN B  1 100 ? -23.444 -40.062  106.657 1.00 65.32 ? 106  GLN B C   1 
ATOM   3951  O O   . GLN B  1 100 ? -23.442 -40.511  105.505 1.00 67.98 ? 106  GLN B O   1 
ATOM   3952  C CB  . GLN B  1 100 ? -24.543 -42.216  107.398 1.00 64.07 ? 106  GLN B CB  1 
ATOM   3953  C CG  . GLN B  1 100 ? -23.697 -43.465  107.119 1.00 66.86 ? 106  GLN B CG  1 
ATOM   3954  C CD  . GLN B  1 100 ? -24.510 -44.749  107.072 1.00 66.11 ? 106  GLN B CD  1 
ATOM   3955  O OE1 . GLN B  1 100 ? -24.755 -45.297  105.998 1.00 68.44 ? 106  GLN B OE1 1 
ATOM   3956  N NE2 . GLN B  1 100 ? -24.938 -45.230  108.235 1.00 63.08 ? 106  GLN B NE2 1 
ATOM   3957  N N   . TRP B  1 101 ? -23.220 -38.773  106.938 1.00 60.14 ? 107  TRP B N   1 
ATOM   3958  C CA  . TRP B  1 101 ? -22.635 -37.831  105.975 1.00 45.97 ? 107  TRP B CA  1 
ATOM   3959  C C   . TRP B  1 101 ? -21.231 -38.292  105.596 1.00 38.20 ? 107  TRP B C   1 
ATOM   3960  O O   . TRP B  1 101 ? -20.664 -39.155  106.259 1.00 40.69 ? 107  TRP B O   1 
ATOM   3961  C CB  . TRP B  1 101 ? -22.534 -36.414  106.556 1.00 43.20 ? 107  TRP B CB  1 
ATOM   3962  C CG  . TRP B  1 101 ? -23.811 -35.653  106.800 1.00 47.87 ? 107  TRP B CG  1 
ATOM   3963  C CD1 . TRP B  1 101 ? -24.408 -35.422  108.008 1.00 49.54 ? 107  TRP B CD1 1 
ATOM   3964  C CD2 . TRP B  1 101 ? -24.615 -34.971  105.823 1.00 50.05 ? 107  TRP B CD2 1 
ATOM   3965  N NE1 . TRP B  1 101 ? -25.543 -34.665  107.842 1.00 47.10 ? 107  TRP B NE1 1 
ATOM   3966  C CE2 . TRP B  1 101 ? -25.691 -34.374  106.510 1.00 47.86 ? 107  TRP B CE2 1 
ATOM   3967  C CE3 . TRP B  1 101 ? -24.538 -34.823  104.433 1.00 48.35 ? 107  TRP B CE3 1 
ATOM   3968  C CZ2 . TRP B  1 101 ? -26.680 -33.639  105.855 1.00 46.44 ? 107  TRP B CZ2 1 
ATOM   3969  C CZ3 . TRP B  1 101 ? -25.521 -34.092  103.786 1.00 46.57 ? 107  TRP B CZ3 1 
ATOM   3970  C CH2 . TRP B  1 101 ? -26.578 -33.512  104.496 1.00 45.36 ? 107  TRP B CH2 1 
ATOM   3971  N N   . TYR B  1 102 ? -20.650 -37.703  104.555 1.00 29.95 ? 108  TYR B N   1 
ATOM   3972  C CA  . TYR B  1 102 ? -19.222 -37.897  104.310 1.00 26.34 ? 108  TYR B CA  1 
ATOM   3973  C C   . TYR B  1 102 ? -18.470 -37.231  105.441 1.00 25.26 ? 108  TYR B C   1 
ATOM   3974  O O   . TYR B  1 102 ? -18.783 -36.110  105.812 1.00 28.96 ? 108  TYR B O   1 
ATOM   3975  C CB  . TYR B  1 102 ? -18.769 -37.309  102.969 1.00 21.84 ? 108  TYR B CB  1 
ATOM   3976  C CG  . TYR B  1 102 ? -19.354 -37.980  101.749 1.00 21.75 ? 108  TYR B CG  1 
ATOM   3977  C CD1 . TYR B  1 102 ? -19.418 -39.365  101.648 1.00 23.18 ? 108  TYR B CD1 1 
ATOM   3978  C CD2 . TYR B  1 102 ? -19.853 -37.220  100.699 1.00 21.18 ? 108  TYR B CD2 1 
ATOM   3979  C CE1 . TYR B  1 102 ? -19.971 -39.978  100.520 1.00 26.10 ? 108  TYR B CE1 1 
ATOM   3980  C CE2 . TYR B  1 102 ? -20.404 -37.815  99.572  1.00 24.67 ? 108  TYR B CE2 1 
ATOM   3981  C CZ  . TYR B  1 102 ? -20.464 -39.192  99.481  1.00 23.73 ? 108  TYR B CZ  1 
ATOM   3982  O OH  . TYR B  1 102 ? -21.014 -39.776  98.351  1.00 14.83 ? 108  TYR B OH  1 
ATOM   3983  N N   . GLU B  1 103 ? -17.476 -37.915  105.987 1.00 24.03 ? 109  GLU B N   1 
ATOM   3984  C CA  . GLU B  1 103 ? -16.711 -37.364  107.093 1.00 20.12 ? 109  GLU B CA  1 
ATOM   3985  C C   . GLU B  1 103 ? -15.696 -36.352  106.598 1.00 19.60 ? 109  GLU B C   1 
ATOM   3986  O O   . GLU B  1 103 ? -15.116 -35.609  107.384 1.00 20.55 ? 109  GLU B O   1 
ATOM   3987  C CB  . GLU B  1 103 ? -16.027 -38.480  107.862 1.00 24.75 ? 109  GLU B CB  1 
ATOM   3988  C CG  . GLU B  1 103 ? -17.018 -39.443  108.457 1.00 31.15 ? 109  GLU B CG  1 
ATOM   3989  C CD  . GLU B  1 103 ? -16.372 -40.408  109.404 1.00 41.93 ? 109  GLU B CD  1 
ATOM   3990  O OE1 . GLU B  1 103 ? -15.145 -40.302  109.610 1.00 44.89 ? 109  GLU B OE1 1 
ATOM   3991  O OE2 . GLU B  1 103 ? -17.088 -41.275  109.942 1.00 48.39 ? 109  GLU B OE2 1 
ATOM   3992  N N   . GLY B  1 104 ? -15.515 -36.303  105.284 1.00 19.60 ? 110  GLY B N   1 
ATOM   3993  C CA  . GLY B  1 104 ? -14.575 -35.387  104.667 1.00 18.51 ? 110  GLY B CA  1 
ATOM   3994  C C   . GLY B  1 104 ? -14.447 -35.681  103.185 1.00 18.36 ? 110  GLY B C   1 
ATOM   3995  O O   . GLY B  1 104 ? -15.142 -36.541  102.654 1.00 21.19 ? 110  GLY B O   1 
ATOM   3996  N N   . THR B  1 105 ? -13.553 -34.969  102.515 1.00 17.62 ? 111  THR B N   1 
ATOM   3997  C CA  . THR B  1 105 ? -13.408 -35.122  101.074 1.00 17.70 ? 111  THR B CA  1 
ATOM   3998  C C   . THR B  1 105 ? -12.783 -36.456  100.690 1.00 22.01 ? 111  THR B C   1 
ATOM   3999  O O   . THR B  1 105 ? -13.144 -37.038  99.673  1.00 22.07 ? 111  THR B O   1 
ATOM   4000  C CB  . THR B  1 105 ? -12.576 -33.986  100.472 1.00 17.65 ? 111  THR B CB  1 
ATOM   4001  O OG1 . THR B  1 105 ? -11.490 -33.679  101.348 1.00 19.68 ? 111  THR B OG1 1 
ATOM   4002  C CG2 . THR B  1 105 ? -13.434 -32.745  100.285 1.00 17.49 ? 111  THR B CG2 1 
ATOM   4003  N N   . ALA B  1 106 ? -11.850 -36.949  101.493 1.00 18.93 ? 112  ALA B N   1 
ATOM   4004  C CA  . ALA B  1 106 ? -11.249 -38.244  101.213 1.00 16.50 ? 112  ALA B CA  1 
ATOM   4005  C C   . ALA B  1 106 ? -12.279 -39.339  101.472 1.00 20.13 ? 112  ALA B C   1 
ATOM   4006  O O   . ALA B  1 106 ? -12.319 -40.350  100.773 1.00 23.09 ? 112  ALA B O   1 
ATOM   4007  C CB  . ALA B  1 106 ? -10.004 -38.456  102.053 1.00 16.36 ? 112  ALA B CB  1 
ATOM   4008  N N   . ASP B  1 107 ? -13.125 -39.127  102.473 1.00 16.42 ? 113  ASP B N   1 
ATOM   4009  C CA  . ASP B  1 107 ? -14.202 -40.060  102.744 1.00 16.59 ? 113  ASP B CA  1 
ATOM   4010  C C   . ASP B  1 107 ? -15.159 -40.115  101.560 1.00 21.41 ? 113  ASP B C   1 
ATOM   4011  O O   . ASP B  1 107 ? -15.662 -41.179  101.215 1.00 22.72 ? 113  ASP B O   1 
ATOM   4012  C CB  . ASP B  1 107 ? -14.954 -39.662  104.007 1.00 16.15 ? 113  ASP B CB  1 
ATOM   4013  C CG  . ASP B  1 107 ? -15.927 -40.717  104.448 1.00 20.58 ? 113  ASP B CG  1 
ATOM   4014  O OD1 . ASP B  1 107 ? -15.578 -41.916  104.371 1.00 21.74 ? 113  ASP B OD1 1 
ATOM   4015  O OD2 . ASP B  1 107 ? -17.043 -40.356  104.864 1.00 22.97 ? 113  ASP B OD2 1 
ATOM   4016  N N   . ALA B  1 108 ? -15.397 -38.959  100.940 1.00 23.40 ? 114  ALA B N   1 
ATOM   4017  C CA  . ALA B  1 108 ? -16.254 -38.873  99.754  1.00 22.18 ? 114  ALA B CA  1 
ATOM   4018  C C   . ALA B  1 108 ? -15.785 -39.802  98.635  1.00 20.69 ? 114  ALA B C   1 
ATOM   4019  O O   . ALA B  1 108 ? -16.589 -40.260  97.831  1.00 23.08 ? 114  ALA B O   1 
ATOM   4020  C CB  . ALA B  1 108 ? -16.323 -37.439  99.250  1.00 18.56 ? 114  ALA B CB  1 
ATOM   4021  N N   . VAL B  1 109 ? -14.485 -40.066  98.567  1.00 19.35 ? 115  VAL B N   1 
ATOM   4022  C CA  . VAL B  1 109 ? -13.989 -41.058  97.630  1.00 16.98 ? 115  VAL B CA  1 
ATOM   4023  C C   . VAL B  1 109 ? -14.099 -42.440  98.262  1.00 20.51 ? 115  VAL B C   1 
ATOM   4024  O O   . VAL B  1 109 ? -14.673 -43.365  97.676  1.00 17.29 ? 115  VAL B O   1 
ATOM   4025  C CB  . VAL B  1 109 ? -12.528 -40.798  97.214  1.00 18.48 ? 115  VAL B CB  1 
ATOM   4026  C CG1 . VAL B  1 109 ? -12.073 -41.863  96.246  1.00 18.13 ? 115  VAL B CG1 1 
ATOM   4027  C CG2 . VAL B  1 109 ? -12.389 -39.431  96.582  1.00 16.73 ? 115  VAL B CG2 1 
ATOM   4028  N N   . TYR B  1 110 ? -13.564 -42.564  99.471  1.00 22.47 ? 116  TYR B N   1 
ATOM   4029  C CA  . TYR B  1 110 ? -13.488 -43.847  100.148 1.00 19.62 ? 116  TYR B CA  1 
ATOM   4030  C C   . TYR B  1 110 ? -14.837 -44.546  100.183 1.00 21.99 ? 116  TYR B C   1 
ATOM   4031  O O   . TYR B  1 110 ? -14.921 -45.749  99.945  1.00 23.91 ? 116  TYR B O   1 
ATOM   4032  C CB  . TYR B  1 110 ? -12.950 -43.675  101.570 1.00 21.98 ? 116  TYR B CB  1 
ATOM   4033  C CG  . TYR B  1 110 ? -12.972 -44.954  102.379 1.00 25.17 ? 116  TYR B CG  1 
ATOM   4034  C CD1 . TYR B  1 110 ? -12.008 -45.937  102.189 1.00 24.96 ? 116  TYR B CD1 1 
ATOM   4035  C CD2 . TYR B  1 110 ? -13.958 -45.181  103.329 1.00 27.53 ? 116  TYR B CD2 1 
ATOM   4036  C CE1 . TYR B  1 110 ? -12.028 -47.116  102.923 1.00 27.73 ? 116  TYR B CE1 1 
ATOM   4037  C CE2 . TYR B  1 110 ? -13.984 -46.355  104.071 1.00 32.12 ? 116  TYR B CE2 1 
ATOM   4038  C CZ  . TYR B  1 110 ? -13.014 -47.318  103.862 1.00 29.62 ? 116  TYR B CZ  1 
ATOM   4039  O OH  . TYR B  1 110 ? -13.031 -48.486  104.592 1.00 31.35 ? 116  TYR B OH  1 
ATOM   4040  N N   . GLN B  1 111 ? -15.896 -43.795  100.463 1.00 19.49 ? 117  GLN B N   1 
ATOM   4041  C CA  . GLN B  1 111 ? -17.214 -44.397  100.551 1.00 18.59 ? 117  GLN B CA  1 
ATOM   4042  C C   . GLN B  1 111 ? -17.671 -44.916  99.206  1.00 18.69 ? 117  GLN B C   1 
ATOM   4043  O O   . GLN B  1 111 ? -18.538 -45.781  99.135  1.00 20.49 ? 117  GLN B O   1 
ATOM   4044  C CB  . GLN B  1 111 ? -18.242 -43.408  101.081 1.00 18.76 ? 117  GLN B CB  1 
ATOM   4045  C CG  . GLN B  1 111 ? -18.081 -43.074  102.539 1.00 24.95 ? 117  GLN B CG  1 
ATOM   4046  C CD  . GLN B  1 111 ? -18.010 -44.303  103.414 1.00 33.82 ? 117  GLN B CD  1 
ATOM   4047  O OE1 . GLN B  1 111 ? -18.581 -45.350  103.096 1.00 37.69 ? 117  GLN B OE1 1 
ATOM   4048  N NE2 . GLN B  1 111 ? -17.306 -44.184  104.533 1.00 35.79 ? 117  GLN B NE2 1 
ATOM   4049  N N   . ASN B  1 112 ? -17.075 -44.385  98.145  1.00 16.20 ? 118  ASN B N   1 
ATOM   4050  C CA  . ASN B  1 112 ? -17.500 -44.702  96.795  1.00 19.28 ? 118  ASN B CA  1 
ATOM   4051  C C   . ASN B  1 112 ? -16.477 -45.520  96.024  1.00 21.25 ? 118  ASN B C   1 
ATOM   4052  O O   . ASN B  1 112 ? -16.451 -45.491  94.792  1.00 24.33 ? 118  ASN B O   1 
ATOM   4053  C CB  . ASN B  1 112 ? -17.814 -43.412  96.051  1.00 18.76 ? 118  ASN B CB  1 
ATOM   4054  C CG  . ASN B  1 112 ? -18.971 -42.667  96.667  1.00 20.60 ? 118  ASN B CG  1 
ATOM   4055  O OD1 . ASN B  1 112 ? -20.075 -43.185  96.728  1.00 24.35 ? 118  ASN B OD1 1 
ATOM   4056  N ND2 . ASN B  1 112 ? -18.728 -41.452  97.132  1.00 22.65 ? 118  ASN B ND2 1 
ATOM   4057  N N   . ILE B  1 113 ? -15.642 -46.261  96.746  1.00 19.34 ? 119  ILE B N   1 
ATOM   4058  C CA  . ILE B  1 113 ? -14.640 -47.096  96.101  1.00 19.95 ? 119  ILE B CA  1 
ATOM   4059  C C   . ILE B  1 113 ? -15.318 -48.150  95.238  1.00 18.93 ? 119  ILE B C   1 
ATOM   4060  O O   . ILE B  1 113 ? -14.852 -48.450  94.144  1.00 22.68 ? 119  ILE B O   1 
ATOM   4061  C CB  . ILE B  1 113 ? -13.718 -47.778  97.124  1.00 24.91 ? 119  ILE B CB  1 
ATOM   4062  C CG1 . ILE B  1 113 ? -12.688 -46.780  97.653  1.00 27.68 ? 119  ILE B CG1 1 
ATOM   4063  C CG2 . ILE B  1 113 ? -12.985 -48.954  96.493  1.00 27.64 ? 119  ILE B CG2 1 
ATOM   4064  C CD1 . ILE B  1 113 ? -11.594 -47.418  98.479  1.00 28.65 ? 119  ILE B CD1 1 
ATOM   4065  N N   . ASP B  1 114 ? -16.441 -48.680  95.715  1.00 19.07 ? 120  ASP B N   1 
ATOM   4066  C CA  . ASP B  1 114 ? -17.150 -49.733  94.990  1.00 20.14 ? 120  ASP B CA  1 
ATOM   4067  C C   . ASP B  1 114 ? -17.851 -49.235  93.725  1.00 21.92 ? 120  ASP B C   1 
ATOM   4068  O O   . ASP B  1 114 ? -18.293 -50.037  92.911  1.00 25.90 ? 120  ASP B O   1 
ATOM   4069  C CB  . ASP B  1 114 ? -18.178 -50.411  95.892  1.00 23.35 ? 120  ASP B CB  1 
ATOM   4070  C CG  . ASP B  1 114 ? -19.239 -49.455  96.381  1.00 33.74 ? 120  ASP B CG  1 
ATOM   4071  O OD1 . ASP B  1 114 ? -18.898 -48.308  96.730  1.00 39.70 ? 120  ASP B OD1 1 
ATOM   4072  O OD2 . ASP B  1 114 ? -20.423 -49.839  96.399  1.00 37.80 ? 120  ASP B OD2 1 
ATOM   4073  N N   . ILE B  1 115 ? -17.979 -47.923  93.571  1.00 15.84 ? 121  ILE B N   1 
ATOM   4074  C CA  . ILE B  1 115 ? -18.485 -47.343  92.332  1.00 14.07 ? 121  ILE B CA  1 
ATOM   4075  C C   . ILE B  1 115 ? -17.330 -47.211  91.355  1.00 17.65 ? 121  ILE B C   1 
ATOM   4076  O O   . ILE B  1 115 ? -17.463 -47.500  90.166  1.00 19.86 ? 121  ILE B O   1 
ATOM   4077  C CB  . ILE B  1 115 ? -19.128 -45.947  92.548  1.00 30.86 ? 121  ILE B CB  1 
ATOM   4078  C CG1 . ILE B  1 115 ? -20.540 -46.074  93.111  1.00 33.52 ? 121  ILE B CG1 1 
ATOM   4079  C CG2 . ILE B  1 115 ? -19.185 -45.161  91.245  1.00 30.61 ? 121  ILE B CG2 1 
ATOM   4080  C CD1 . ILE B  1 115 ? -20.591 -46.159  94.614  1.00 37.02 ? 121  ILE B CD1 1 
ATOM   4081  N N   . ILE B  1 116 ? -16.195 -46.768  91.883  1.00 16.13 ? 122  ILE B N   1 
ATOM   4082  C CA  . ILE B  1 116 ? -15.019 -46.481  91.087  1.00 18.79 ? 122  ILE B CA  1 
ATOM   4083  C C   . ILE B  1 116 ? -14.362 -47.732  90.527  1.00 21.36 ? 122  ILE B C   1 
ATOM   4084  O O   . ILE B  1 116 ? -14.108 -47.817  89.329  1.00 19.04 ? 122  ILE B O   1 
ATOM   4085  C CB  . ILE B  1 116 ? -13.977 -45.699  91.908  1.00 18.57 ? 122  ILE B CB  1 
ATOM   4086  C CG1 . ILE B  1 116 ? -14.542 -44.341  92.333  1.00 15.88 ? 122  ILE B CG1 1 
ATOM   4087  C CG2 . ILE B  1 116 ? -12.688 -45.537  91.115  1.00 18.53 ? 122  ILE B CG2 1 
ATOM   4088  C CD1 . ILE B  1 116 ? -13.636 -43.563  93.264  1.00 16.23 ? 122  ILE B CD1 1 
ATOM   4089  N N   . GLU B  1 117 ? -14.091 -48.694  91.398  1.00 23.34 ? 123  GLU B N   1 
ATOM   4090  C CA  . GLU B  1 117 ? -13.363 -49.910  91.035  1.00 26.77 ? 123  GLU B CA  1 
ATOM   4091  C C   . GLU B  1 117 ? -13.882 -50.679  89.796  1.00 27.62 ? 123  GLU B C   1 
ATOM   4092  O O   . GLU B  1 117 ? -13.069 -51.112  88.976  1.00 27.76 ? 123  GLU B O   1 
ATOM   4093  C CB  . GLU B  1 117 ? -13.324 -50.843  92.245  1.00 32.18 ? 123  GLU B CB  1 
ATOM   4094  C CG  . GLU B  1 117 ? -11.923 -51.033  92.786  1.00 39.98 ? 123  GLU B CG  1 
ATOM   4095  C CD  . GLU B  1 117 ? -11.888 -51.451  94.244  1.00 40.72 ? 123  GLU B CD  1 
ATOM   4096  O OE1 . GLU B  1 117 ? -12.882 -52.026  94.733  1.00 41.55 ? 123  GLU B OE1 1 
ATOM   4097  O OE2 . GLU B  1 117 ? -10.856 -51.199  94.900  1.00 40.72 ? 123  GLU B OE2 1 
ATOM   4098  N N   . PRO B  1 118 ? -15.218 -50.842  89.638  1.00 27.18 ? 124  PRO B N   1 
ATOM   4099  C CA  . PRO B  1 118 ? -15.681 -51.527  88.427  1.00 24.49 ? 124  PRO B CA  1 
ATOM   4100  C C   . PRO B  1 118 ? -15.221 -50.872  87.127  1.00 23.92 ? 124  PRO B C   1 
ATOM   4101  O O   . PRO B  1 118 ? -15.045 -51.578  86.140  1.00 24.00 ? 124  PRO B O   1 
ATOM   4102  C CB  . PRO B  1 118 ? -17.205 -51.449  88.547  1.00 25.82 ? 124  PRO B CB  1 
ATOM   4103  C CG  . PRO B  1 118 ? -17.456 -51.357  89.980  1.00 24.03 ? 124  PRO B CG  1 
ATOM   4104  C CD  . PRO B  1 118 ? -16.353 -50.512  90.517  1.00 24.52 ? 124  PRO B CD  1 
ATOM   4105  N N   . TYR B  1 119 ? -15.030 -49.555  87.122  1.00 24.71 ? 125  TYR B N   1 
ATOM   4106  C CA  . TYR B  1 119 ? -14.577 -48.846  85.918  1.00 23.90 ? 125  TYR B CA  1 
ATOM   4107  C C   . TYR B  1 119 ? -13.087 -49.017  85.704  1.00 20.68 ? 125  TYR B C   1 
ATOM   4108  O O   . TYR B  1 119 ? -12.592 -48.806  84.597  1.00 19.34 ? 125  TYR B O   1 
ATOM   4109  C CB  . TYR B  1 119 ? -14.896 -47.357  85.997  1.00 17.23 ? 125  TYR B CB  1 
ATOM   4110  C CG  . TYR B  1 119 ? -16.347 -47.055  86.229  1.00 17.14 ? 125  TYR B CG  1 
ATOM   4111  C CD1 . TYR B  1 119 ? -17.333 -47.758  85.558  1.00 17.58 ? 125  TYR B CD1 1 
ATOM   4112  C CD2 . TYR B  1 119 ? -16.735 -46.056  87.113  1.00 17.34 ? 125  TYR B CD2 1 
ATOM   4113  C CE1 . TYR B  1 119 ? -18.666 -47.481  85.763  1.00 20.51 ? 125  TYR B CE1 1 
ATOM   4114  C CE2 . TYR B  1 119 ? -18.062 -45.773  87.323  1.00 19.03 ? 125  TYR B CE2 1 
ATOM   4115  C CZ  . TYR B  1 119 ? -19.022 -46.489  86.647  1.00 21.38 ? 125  TYR B CZ  1 
ATOM   4116  O OH  . TYR B  1 119 ? -20.348 -46.202  86.848  1.00 26.14 ? 125  TYR B OH  1 
ATOM   4117  N N   . ALA B  1 120 ? -12.390 -49.377  86.778  1.00 14.50 ? 126  ALA B N   1 
ATOM   4118  C CA  . ALA B  1 120 ? -10.944 -49.552  86.765  1.00 16.84 ? 126  ALA B CA  1 
ATOM   4119  C C   . ALA B  1 120 ? -10.206 -48.474  85.981  1.00 20.66 ? 126  ALA B C   1 
ATOM   4120  O O   . ALA B  1 120 ? -9.424  -48.794  85.093  1.00 23.17 ? 126  ALA B O   1 
ATOM   4121  C CB  . ALA B  1 120 ? -10.596 -50.922  86.204  1.00 19.09 ? 126  ALA B CB  1 
ATOM   4122  N N   . PRO B  1 121 ? -10.446 -47.190  86.295  1.00 22.44 ? 127  PRO B N   1 
ATOM   4123  C CA  . PRO B  1 121 ? -9.686  -46.189  85.536  1.00 20.74 ? 127  PRO B CA  1 
ATOM   4124  C C   . PRO B  1 121 ? -8.212  -46.209  85.936  1.00 20.23 ? 127  PRO B C   1 
ATOM   4125  O O   . PRO B  1 121 ? -7.917  -46.567  87.072  1.00 20.64 ? 127  PRO B O   1 
ATOM   4126  C CB  . PRO B  1 121 ? -10.354 -44.871  85.926  1.00 18.96 ? 127  PRO B CB  1 
ATOM   4127  C CG  . PRO B  1 121 ? -10.878 -45.117  87.298  1.00 22.02 ? 127  PRO B CG  1 
ATOM   4128  C CD  . PRO B  1 121 ? -11.290 -46.573  87.336  1.00 23.24 ? 127  PRO B CD  1 
ATOM   4129  N N   . GLU B  1 122 ? -7.310  -45.853  85.030  1.00 16.87 ? 128  GLU B N   1 
ATOM   4130  C CA  . GLU B  1 122 ? -5.885  -45.862  85.349  1.00 20.66 ? 128  GLU B CA  1 
ATOM   4131  C C   . GLU B  1 122 ? -5.487  -44.645  86.180  1.00 23.51 ? 128  GLU B C   1 
ATOM   4132  O O   . GLU B  1 122 ? -4.509  -44.683  86.920  1.00 26.46 ? 128  GLU B O   1 
ATOM   4133  C CB  . GLU B  1 122 ? -5.052  -45.911  84.071  1.00 24.66 ? 128  GLU B CB  1 
ATOM   4134  C CG  . GLU B  1 122 ? -5.361  -47.109  83.185  1.00 30.31 ? 128  GLU B CG  1 
ATOM   4135  C CD  . GLU B  1 122 ? -5.069  -48.436  83.867  1.00 40.06 ? 128  GLU B CD  1 
ATOM   4136  O OE1 . GLU B  1 122 ? -4.002  -48.558  84.504  1.00 43.04 ? 128  GLU B OE1 1 
ATOM   4137  O OE2 . GLU B  1 122 ? -5.906  -49.362  83.766  1.00 42.41 ? 128  GLU B OE2 1 
ATOM   4138  N N   . TYR B  1 123 ? -6.248  -43.562  86.055  1.00 22.67 ? 129  TYR B N   1 
ATOM   4139  C CA  . TYR B  1 123 ? -5.933  -42.331  86.776  1.00 20.33 ? 129  TYR B CA  1 
ATOM   4140  C C   . TYR B  1 123 ? -7.187  -41.699  87.350  1.00 16.77 ? 129  TYR B C   1 
ATOM   4141  O O   . TYR B  1 123 ? -8.274  -41.831  86.785  1.00 15.56 ? 129  TYR B O   1 
ATOM   4142  C CB  . TYR B  1 123 ? -5.218  -41.332  85.859  1.00 23.46 ? 129  TYR B CB  1 
ATOM   4143  C CG  . TYR B  1 123 ? -4.291  -41.992  84.865  1.00 20.93 ? 129  TYR B CG  1 
ATOM   4144  C CD1 . TYR B  1 123 ? -3.028  -42.433  85.244  1.00 23.26 ? 129  TYR B CD1 1 
ATOM   4145  C CD2 . TYR B  1 123 ? -4.689  -42.192  83.551  1.00 23.33 ? 129  TYR B CD2 1 
ATOM   4146  C CE1 . TYR B  1 123 ? -2.191  -43.051  84.340  1.00 22.94 ? 129  TYR B CE1 1 
ATOM   4147  C CE2 . TYR B  1 123 ? -3.858  -42.811  82.641  1.00 26.84 ? 129  TYR B CE2 1 
ATOM   4148  C CZ  . TYR B  1 123 ? -2.614  -43.237  83.038  1.00 27.46 ? 129  TYR B CZ  1 
ATOM   4149  O OH  . TYR B  1 123 ? -1.794  -43.849  82.114  1.00 29.56 ? 129  TYR B OH  1 
ATOM   4150  N N   . MET B  1 124 ? -7.023  -41.018  88.479  1.00 17.94 ? 130  MET B N   1 
ATOM   4151  C CA  . MET B  1 124 ? -8.102  -40.267  89.105  1.00 16.38 ? 130  MET B CA  1 
ATOM   4152  C C   . MET B  1 124 ? -7.760  -38.789  89.127  1.00 14.00 ? 130  MET B C   1 
ATOM   4153  O O   . MET B  1 124 ? -6.683  -38.418  89.565  1.00 15.93 ? 130  MET B O   1 
ATOM   4154  C CB  . MET B  1 124 ? -8.342  -40.764  90.522  1.00 19.90 ? 130  MET B CB  1 
ATOM   4155  C CG  . MET B  1 124 ? -8.799  -42.199  90.592  1.00 21.69 ? 130  MET B CG  1 
ATOM   4156  S SD  . MET B  1 124 ? -10.487 -42.386  90.012  1.00 21.91 ? 130  MET B SD  1 
ATOM   4157  C CE  . MET B  1 124 ? -11.379 -41.362  91.188  1.00 23.01 ? 130  MET B CE  1 
ATOM   4158  N N   . VAL B  1 125 ? -8.670  -37.955  88.636  1.00 15.51 ? 131  VAL B N   1 
ATOM   4159  C CA  . VAL B  1 125 ? -8.510  -36.506  88.706  1.00 15.45 ? 131  VAL B CA  1 
ATOM   4160  C C   . VAL B  1 125 ? -9.498  -35.960  89.727  1.00 14.87 ? 131  VAL B C   1 
ATOM   4161  O O   . VAL B  1 125 ? -10.698 -35.919  89.463  1.00 16.65 ? 131  VAL B O   1 
ATOM   4162  C CB  . VAL B  1 125 ? -8.736  -35.840  87.336  1.00 15.50 ? 131  VAL B CB  1 
ATOM   4163  C CG1 . VAL B  1 125 ? -8.532  -34.338  87.429  1.00 13.42 ? 131  VAL B CG1 1 
ATOM   4164  C CG2 . VAL B  1 125 ? -7.806  -36.440  86.286  1.00 10.64 ? 131  VAL B CG2 1 
ATOM   4165  N N   . ILE B  1 126 ? -9.006  -35.593  90.910  1.00 16.13 ? 132  ILE B N   1 
ATOM   4166  C CA  . ILE B  1 126 ? -9.864  -35.051  91.963  1.00 16.35 ? 132  ILE B CA  1 
ATOM   4167  C C   . ILE B  1 126 ? -10.045 -33.555  91.713  1.00 17.79 ? 132  ILE B C   1 
ATOM   4168  O O   . ILE B  1 126 ? -9.056  -32.834  91.583  1.00 19.95 ? 132  ILE B O   1 
ATOM   4169  C CB  . ILE B  1 126 ? -9.281  -35.274  93.387  1.00 11.94 ? 132  ILE B CB  1 
ATOM   4170  C CG1 . ILE B  1 126 ? -8.970  -36.755  93.643  1.00 11.31 ? 132  ILE B CG1 1 
ATOM   4171  C CG2 . ILE B  1 126 ? -10.233 -34.727  94.443  1.00 14.20 ? 132  ILE B CG2 1 
ATOM   4172  C CD1 . ILE B  1 126 ? -10.137 -37.689  93.423  1.00 12.45 ? 132  ILE B CD1 1 
ATOM   4173  N N   . LEU B  1 127 ? -11.298 -33.101  91.624  1.00 12.83 ? 133  LEU B N   1 
ATOM   4174  C CA  . LEU B  1 127 ? -11.608 -31.713  91.275  1.00 15.20 ? 133  LEU B CA  1 
ATOM   4175  C C   . LEU B  1 127 ? -12.463 -31.002  92.328  1.00 14.96 ? 133  LEU B C   1 
ATOM   4176  O O   . LEU B  1 127 ? -13.353 -31.592  92.924  1.00 15.44 ? 133  LEU B O   1 
ATOM   4177  C CB  . LEU B  1 127 ? -12.334 -31.650  89.926  1.00 13.40 ? 133  LEU B CB  1 
ATOM   4178  C CG  . LEU B  1 127 ? -11.561 -32.152  88.713  1.00 13.89 ? 133  LEU B CG  1 
ATOM   4179  C CD1 . LEU B  1 127 ? -12.448 -32.157  87.475  1.00 11.57 ? 133  LEU B CD1 1 
ATOM   4180  C CD2 . LEU B  1 127 ? -10.317 -31.296  88.496  1.00 11.24 ? 133  LEU B CD2 1 
ATOM   4181  N N   . ALA B  1 128 ? -12.184 -29.726  92.556  1.00 20.05 ? 134  ALA B N   1 
ATOM   4182  C CA  . ALA B  1 128 ? -13.071 -28.902  93.364  1.00 19.55 ? 134  ALA B CA  1 
ATOM   4183  C C   . ALA B  1 128 ? -14.169 -28.358  92.449  1.00 17.80 ? 134  ALA B C   1 
ATOM   4184  O O   . ALA B  1 128 ? -13.880 -27.803  91.393  1.00 21.62 ? 134  ALA B O   1 
ATOM   4185  C CB  . ALA B  1 128 ? -12.292 -27.772  94.037  1.00 17.51 ? 134  ALA B CB  1 
ATOM   4186  N N   . GLY B  1 129 ? -15.426 -28.530  92.833  1.00 16.26 ? 135  GLY B N   1 
ATOM   4187  C CA  . GLY B  1 129 ? -16.525 -28.097  91.987  1.00 12.94 ? 135  GLY B CA  1 
ATOM   4188  C C   . GLY B  1 129 ? -17.039 -26.690  92.253  1.00 10.80 ? 135  GLY B C   1 
ATOM   4189  O O   . GLY B  1 129 ? -18.103 -26.324  91.781  1.00 18.39 ? 135  GLY B O   1 
ATOM   4190  N N   . ASP B  1 130 ? -16.279 -25.888  92.986  1.00 10.87 ? 136  ASP B N   1 
ATOM   4191  C CA  . ASP B  1 130 ? -16.757 -24.569  93.372  1.00 13.37 ? 136  ASP B CA  1 
ATOM   4192  C C   . ASP B  1 130 ? -15.896 -23.419  92.848  1.00 15.18 ? 136  ASP B C   1 
ATOM   4193  O O   . ASP B  1 130 ? -15.960 -22.316  93.379  1.00 15.69 ? 136  ASP B O   1 
ATOM   4194  C CB  . ASP B  1 130 ? -16.857 -24.481  94.889  1.00 16.04 ? 136  ASP B CB  1 
ATOM   4195  C CG  . ASP B  1 130 ? -15.491 -24.435  95.561  1.00 19.21 ? 136  ASP B CG  1 
ATOM   4196  O OD1 . ASP B  1 130 ? -14.584 -25.161  95.110  1.00 22.46 ? 136  ASP B OD1 1 
ATOM   4197  O OD2 . ASP B  1 130 ? -15.319 -23.661  96.526  1.00 19.14 ? 136  ASP B OD2 1 
ATOM   4198  N N   . HIS B  1 131 ? -15.124 -23.661  91.792  1.00 14.43 ? 137  HIS B N   1 
ATOM   4199  C CA  . HIS B  1 131 ? -14.334 -22.608  91.152  1.00 14.05 ? 137  HIS B CA  1 
ATOM   4200  C C   . HIS B  1 131 ? -14.702 -22.433  89.686  1.00 13.52 ? 137  HIS B C   1 
ATOM   4201  O O   . HIS B  1 131 ? -15.124 -23.371  89.026  1.00 14.56 ? 137  HIS B O   1 
ATOM   4202  C CB  . HIS B  1 131 ? -12.836 -22.906  91.244  1.00 15.71 ? 137  HIS B CB  1 
ATOM   4203  C CG  . HIS B  1 131 ? -12.336 -23.107  92.636  1.00 16.01 ? 137  HIS B CG  1 
ATOM   4204  N ND1 . HIS B  1 131 ? -11.292 -23.954  92.931  1.00 19.03 ? 137  HIS B ND1 1 
ATOM   4205  C CD2 . HIS B  1 131 ? -12.731 -22.570  93.812  1.00 16.34 ? 137  HIS B CD2 1 
ATOM   4206  C CE1 . HIS B  1 131 ? -11.067 -23.933  94.233  1.00 20.88 ? 137  HIS B CE1 1 
ATOM   4207  N NE2 . HIS B  1 131 ? -11.927 -23.101  94.790  1.00 17.74 ? 137  HIS B NE2 1 
ATOM   4208  N N   . ILE B  1 132 ? -14.506 -21.224  89.179  1.00 15.27 ? 138  ILE B N   1 
ATOM   4209  C CA  . ILE B  1 132 ? -14.744 -20.902  87.779  1.00 10.92 ? 138  ILE B CA  1 
ATOM   4210  C C   . ILE B  1 132 ? -13.404 -20.762  87.057  1.00 11.32 ? 138  ILE B C   1 
ATOM   4211  O O   . ILE B  1 132 ? -12.624 -19.867  87.365  1.00 15.28 ? 138  ILE B O   1 
ATOM   4212  C CB  . ILE B  1 132 ? -15.555 -19.605  87.646  1.00 13.62 ? 138  ILE B CB  1 
ATOM   4213  C CG1 . ILE B  1 132 ? -16.848 -19.718  88.454  1.00 15.92 ? 138  ILE B CG1 1 
ATOM   4214  C CG2 . ILE B  1 132 ? -15.848 -19.273  86.183  1.00 15.24 ? 138  ILE B CG2 1 
ATOM   4215  C CD1 . ILE B  1 132 ? -17.659 -18.470  88.473  1.00 19.98 ? 138  ILE B CD1 1 
ATOM   4216  N N   . TYR B  1 133 ? -13.144 -21.654  86.107  1.00 11.18 ? 139  TYR B N   1 
ATOM   4217  C CA  . TYR B  1 133 ? -11.851 -21.719  85.421  1.00 12.34 ? 139  TYR B CA  1 
ATOM   4218  C C   . TYR B  1 133 ? -11.917 -22.719  84.282  1.00 15.89 ? 139  TYR B C   1 
ATOM   4219  O O   . TYR B  1 133 ? -12.757 -23.626  84.300  1.00 16.03 ? 139  TYR B O   1 
ATOM   4220  C CB  . TYR B  1 133 ? -10.739 -22.125  86.390  1.00 10.99 ? 139  TYR B CB  1 
ATOM   4221  C CG  . TYR B  1 133 ? -10.793 -23.591  86.754  1.00 12.92 ? 139  TYR B CG  1 
ATOM   4222  C CD1 . TYR B  1 133 ? -11.737 -24.062  87.655  1.00 15.55 ? 139  TYR B CD1 1 
ATOM   4223  C CD2 . TYR B  1 133 ? -9.907  -24.504  86.195  1.00 14.97 ? 139  TYR B CD2 1 
ATOM   4224  C CE1 . TYR B  1 133 ? -11.801 -25.389  87.983  1.00 14.52 ? 139  TYR B CE1 1 
ATOM   4225  C CE2 . TYR B  1 133 ? -9.960  -25.841  86.523  1.00 12.35 ? 139  TYR B CE2 1 
ATOM   4226  C CZ  . TYR B  1 133 ? -10.909 -26.278  87.417  1.00 13.86 ? 139  TYR B CZ  1 
ATOM   4227  O OH  . TYR B  1 133 ? -10.986 -27.609  87.748  1.00 13.45 ? 139  TYR B OH  1 
ATOM   4228  N N   . LYS B  1 134 ? -11.032 -22.551  83.299  1.00 13.19 ? 140  LYS B N   1 
ATOM   4229  C CA  . LYS B  1 134 ? -10.922 -23.463  82.168  1.00 14.82 ? 140  LYS B CA  1 
ATOM   4230  C C   . LYS B  1 134 ? -9.516  -24.040  82.102  1.00 16.34 ? 140  LYS B C   1 
ATOM   4231  O O   . LYS B  1 134 ? -8.528  -23.308  82.136  1.00 15.62 ? 140  LYS B O   1 
ATOM   4232  C CB  . LYS B  1 134 ? -11.281 -22.753  80.865  1.00 10.78 ? 140  LYS B CB  1 
ATOM   4233  C CG  . LYS B  1 134 ? -12.676 -22.187  80.891  1.00 13.76 ? 140  LYS B CG  1 
ATOM   4234  C CD  . LYS B  1 134 ? -13.041 -21.550  79.590  1.00 17.95 ? 140  LYS B CD  1 
ATOM   4235  C CE  . LYS B  1 134 ? -12.264 -20.281  79.383  1.00 27.84 ? 140  LYS B CE  1 
ATOM   4236  N NZ  . LYS B  1 134 ? -12.848 -19.513  78.254  1.00 32.06 ? 140  LYS B NZ  1 
ATOM   4237  N N   . MET B  1 135 ? -9.440  -25.364  82.023  1.00 15.53 ? 141  MET B N   1 
ATOM   4238  C CA  . MET B  1 135 ? -8.180  -26.081  82.123  1.00 15.11 ? 141  MET B CA  1 
ATOM   4239  C C   . MET B  1 135 ? -8.257  -27.369  81.310  1.00 22.23 ? 141  MET B C   1 
ATOM   4240  O O   . MET B  1 135 ? -9.297  -28.027  81.273  1.00 22.05 ? 141  MET B O   1 
ATOM   4241  C CB  . MET B  1 135 ? -7.873  -26.387  83.587  1.00 14.44 ? 141  MET B CB  1 
ATOM   4242  C CG  . MET B  1 135 ? -6.469  -26.875  83.867  1.00 16.65 ? 141  MET B CG  1 
ATOM   4243  S SD  . MET B  1 135 ? -6.214  -27.048  85.637  1.00 25.82 ? 141  MET B SD  1 
ATOM   4244  C CE  . MET B  1 135 ? -4.432  -27.218  85.719  1.00 18.24 ? 141  MET B CE  1 
ATOM   4245  N N   . ASP B  1 136 ? -7.162  -27.712  80.644  1.00 20.72 ? 142  ASP B N   1 
ATOM   4246  C CA  . ASP B  1 136 ? -7.079  -28.949  79.878  1.00 16.56 ? 142  ASP B CA  1 
ATOM   4247  C C   . ASP B  1 136 ? -6.320  -29.970  80.723  1.00 19.14 ? 142  ASP B C   1 
ATOM   4248  O O   . ASP B  1 136 ? -5.097  -29.899  80.823  1.00 19.91 ? 142  ASP B O   1 
ATOM   4249  C CB  . ASP B  1 136 ? -6.387  -28.684  78.539  1.00 14.18 ? 142  ASP B CB  1 
ATOM   4250  C CG  . ASP B  1 136 ? -6.338  -29.902  77.631  1.00 22.33 ? 142  ASP B CG  1 
ATOM   4251  O OD1 . ASP B  1 136 ? -6.535  -31.044  78.107  1.00 25.07 ? 142  ASP B OD1 1 
ATOM   4252  O OD2 . ASP B  1 136 ? -6.083  -29.708  76.420  1.00 22.94 ? 142  ASP B OD2 1 
ATOM   4253  N N   . TYR B  1 137 ? -7.037  -30.915  81.334  1.00 15.92 ? 143  TYR B N   1 
ATOM   4254  C CA  . TYR B  1 137 ? -6.416  -31.828  82.301  1.00 14.72 ? 143  TYR B CA  1 
ATOM   4255  C C   . TYR B  1 137 ? -5.432  -32.809  81.675  1.00 16.15 ? 143  TYR B C   1 
ATOM   4256  O O   . TYR B  1 137 ? -4.704  -33.502  82.387  1.00 16.60 ? 143  TYR B O   1 
ATOM   4257  C CB  . TYR B  1 137 ? -7.484  -32.612  83.065  1.00 14.38 ? 143  TYR B CB  1 
ATOM   4258  C CG  . TYR B  1 137 ? -8.457  -31.734  83.803  1.00 15.33 ? 143  TYR B CG  1 
ATOM   4259  C CD1 . TYR B  1 137 ? -8.015  -30.715  84.642  1.00 15.14 ? 143  TYR B CD1 1 
ATOM   4260  C CD2 . TYR B  1 137 ? -9.820  -31.914  83.658  1.00 12.99 ? 143  TYR B CD2 1 
ATOM   4261  C CE1 . TYR B  1 137 ? -8.913  -29.900  85.316  1.00 17.09 ? 143  TYR B CE1 1 
ATOM   4262  C CE2 . TYR B  1 137 ? -10.723 -31.112  84.328  1.00 15.30 ? 143  TYR B CE2 1 
ATOM   4263  C CZ  . TYR B  1 137 ? -10.269 -30.105  85.155  1.00 13.07 ? 143  TYR B CZ  1 
ATOM   4264  O OH  . TYR B  1 137 ? -11.184 -29.307  85.806  1.00 11.89 ? 143  TYR B OH  1 
ATOM   4265  N N   . GLU B  1 138 ? -5.405  -32.880  80.351  1.00 17.80 ? 144  GLU B N   1 
ATOM   4266  C CA  . GLU B  1 138 ? -4.515  -33.829  79.691  1.00 17.03 ? 144  GLU B CA  1 
ATOM   4267  C C   . GLU B  1 138 ? -3.045  -33.470  79.969  1.00 19.80 ? 144  GLU B C   1 
ATOM   4268  O O   . GLU B  1 138 ? -2.243  -34.358  80.237  1.00 18.69 ? 144  GLU B O   1 
ATOM   4269  C CB  . GLU B  1 138 ? -4.810  -33.889  78.189  1.00 17.42 ? 144  GLU B CB  1 
ATOM   4270  C CG  . GLU B  1 138 ? -3.929  -34.878  77.395  1.00 23.49 ? 144  GLU B CG  1 
ATOM   4271  C CD  . GLU B  1 138 ? -4.214  -36.361  77.678  1.00 24.83 ? 144  GLU B CD  1 
ATOM   4272  O OE1 . GLU B  1 138 ? -5.346  -36.708  78.072  1.00 19.17 ? 144  GLU B OE1 1 
ATOM   4273  O OE2 . GLU B  1 138 ? -3.292  -37.190  77.496  1.00 23.29 ? 144  GLU B OE2 1 
ATOM   4274  N N   . TYR B  1 139 ? -2.699  -32.181  79.958  1.00 19.38 ? 145  TYR B N   1 
ATOM   4275  C CA  . TYR B  1 139 ? -1.331  -31.768  80.293  1.00 19.03 ? 145  TYR B CA  1 
ATOM   4276  C C   . TYR B  1 139 ? -0.954  -32.235  81.689  1.00 19.47 ? 145  TYR B C   1 
ATOM   4277  O O   . TYR B  1 139 ? 0.146   -32.738  81.914  1.00 25.57 ? 145  TYR B O   1 
ATOM   4278  C CB  . TYR B  1 139 ? -1.163  -30.249  80.211  1.00 25.54 ? 145  TYR B CB  1 
ATOM   4279  C CG  . TYR B  1 139 ? -1.280  -29.660  78.825  1.00 27.45 ? 145  TYR B CG  1 
ATOM   4280  C CD1 . TYR B  1 139 ? -0.164  -29.537  78.004  1.00 29.26 ? 145  TYR B CD1 1 
ATOM   4281  C CD2 . TYR B  1 139 ? -2.499  -29.217  78.342  1.00 24.17 ? 145  TYR B CD2 1 
ATOM   4282  C CE1 . TYR B  1 139 ? -0.267  -29.000  76.735  1.00 28.23 ? 145  TYR B CE1 1 
ATOM   4283  C CE2 . TYR B  1 139 ? -2.613  -28.678  77.076  1.00 25.71 ? 145  TYR B CE2 1 
ATOM   4284  C CZ  . TYR B  1 139 ? -1.493  -28.572  76.275  1.00 30.97 ? 145  TYR B CZ  1 
ATOM   4285  O OH  . TYR B  1 139 ? -1.607  -28.035  75.011  1.00 34.70 ? 145  TYR B OH  1 
ATOM   4286  N N   . MET B  1 140 ? -1.880  -32.085  82.628  1.00 18.92 ? 146  MET B N   1 
ATOM   4287  C CA  . MET B  1 140 ? -1.622  -32.449  84.015  1.00 18.78 ? 146  MET B CA  1 
ATOM   4288  C C   . MET B  1 140 ? -1.480  -33.958  84.180  1.00 21.72 ? 146  MET B C   1 
ATOM   4289  O O   . MET B  1 140 ? -0.713  -34.428  85.017  1.00 25.45 ? 146  MET B O   1 
ATOM   4290  C CB  . MET B  1 140 ? -2.739  -31.918  84.910  1.00 22.54 ? 146  MET B CB  1 
ATOM   4291  C CG  . MET B  1 140 ? -2.391  -31.865  86.369  1.00 24.34 ? 146  MET B CG  1 
ATOM   4292  S SD  . MET B  1 140 ? -3.733  -31.144  87.316  1.00 28.82 ? 146  MET B SD  1 
ATOM   4293  C CE  . MET B  1 140 ? -3.123  -31.489  88.964  1.00 13.37 ? 146  MET B CE  1 
ATOM   4294  N N   . LEU B  1 141 ? -2.228  -34.716  83.384  1.00 21.79 ? 147  LEU B N   1 
ATOM   4295  C CA  . LEU B  1 141 ? -2.076  -36.168  83.347  1.00 17.59 ? 147  LEU B CA  1 
ATOM   4296  C C   . LEU B  1 141 ? -0.703  -36.541  82.793  1.00 16.29 ? 147  LEU B C   1 
ATOM   4297  O O   . LEU B  1 141 ? -0.001  -37.367  83.372  1.00 16.53 ? 147  LEU B O   1 
ATOM   4298  C CB  . LEU B  1 141 ? -3.184  -36.813  82.503  1.00 14.97 ? 147  LEU B CB  1 
ATOM   4299  C CG  . LEU B  1 141 ? -4.582  -36.864  83.117  1.00 14.19 ? 147  LEU B CG  1 
ATOM   4300  C CD1 . LEU B  1 141 ? -5.618  -37.235  82.065  1.00 13.01 ? 147  LEU B CD1 1 
ATOM   4301  C CD2 . LEU B  1 141 ? -4.600  -37.850  84.270  1.00 16.88 ? 147  LEU B CD2 1 
ATOM   4302  N N   . GLN B  1 142 ? -0.335  -35.918  81.672  1.00 18.55 ? 148  GLN B N   1 
ATOM   4303  C CA  . GLN B  1 142 ? 0.971   -36.126  81.042  1.00 20.35 ? 148  GLN B CA  1 
ATOM   4304  C C   . GLN B  1 142 ? 2.103   -35.921  82.017  1.00 20.71 ? 148  GLN B C   1 
ATOM   4305  O O   . GLN B  1 142 ? 2.990   -36.756  82.129  1.00 26.65 ? 148  GLN B O   1 
ATOM   4306  C CB  . GLN B  1 142 ? 1.187   -35.171  79.868  1.00 23.64 ? 148  GLN B CB  1 
ATOM   4307  C CG  . GLN B  1 142 ? 0.231   -35.311  78.714  1.00 30.31 ? 148  GLN B CG  1 
ATOM   4308  C CD  . GLN B  1 142 ? 0.427   -36.576  77.919  1.00 35.11 ? 148  GLN B CD  1 
ATOM   4309  O OE1 . GLN B  1 142 ? 1.300   -37.396  78.216  1.00 38.68 ? 148  GLN B OE1 1 
ATOM   4310  N NE2 . GLN B  1 142 ? -0.387  -36.741  76.888  1.00 34.35 ? 148  GLN B NE2 1 
ATOM   4311  N N   . GLN B  1 143 ? 2.082   -34.785  82.707  1.00 22.53 ? 149  GLN B N   1 
ATOM   4312  C CA  . GLN B  1 143 ? 3.136   -34.476  83.657  1.00 23.35 ? 149  GLN B CA  1 
ATOM   4313  C C   . GLN B  1 143 ? 3.174   -35.538  84.738  1.00 24.93 ? 149  GLN B C   1 
ATOM   4314  O O   . GLN B  1 143 ? 4.245   -35.981  85.129  1.00 29.72 ? 149  GLN B O   1 
ATOM   4315  C CB  . GLN B  1 143 ? 2.948   -33.092  84.290  1.00 22.51 ? 149  GLN B CB  1 
ATOM   4316  C CG  . GLN B  1 143 ? 3.987   -32.792  85.376  1.00 28.64 ? 149  GLN B CG  1 
ATOM   4317  C CD  . GLN B  1 143 ? 3.766   -31.464  86.081  1.00 32.30 ? 149  GLN B CD  1 
ATOM   4318  O OE1 . GLN B  1 143 ? 3.722   -30.410  85.447  1.00 35.28 ? 149  GLN B OE1 1 
ATOM   4319  N NE2 . GLN B  1 143 ? 3.636   -31.510  87.403  1.00 29.61 ? 149  GLN B NE2 1 
ATOM   4320  N N   . HIS B  1 144 ? 2.005   -35.957  85.206  1.00 18.58 ? 150  HIS B N   1 
ATOM   4321  C CA  . HIS B  1 144 ? 1.932   -36.910  86.306  1.00 19.15 ? 150  HIS B CA  1 
ATOM   4322  C C   . HIS B  1 144 ? 2.595   -38.242  85.971  1.00 21.43 ? 150  HIS B C   1 
ATOM   4323  O O   . HIS B  1 144 ? 3.304   -38.803  86.804  1.00 23.67 ? 150  HIS B O   1 
ATOM   4324  C CB  . HIS B  1 144 ? 0.483   -37.164  86.722  1.00 19.37 ? 150  HIS B CB  1 
ATOM   4325  C CG  . HIS B  1 144 ? 0.352   -38.101  87.882  1.00 18.28 ? 150  HIS B CG  1 
ATOM   4326  N ND1 . HIS B  1 144 ? 0.603   -37.716  89.180  1.00 18.35 ? 150  HIS B ND1 1 
ATOM   4327  C CD2 . HIS B  1 144 ? 0.027   -39.415  87.936  1.00 15.47 ? 150  HIS B CD2 1 
ATOM   4328  C CE1 . HIS B  1 144 ? 0.422   -38.747  89.987  1.00 18.23 ? 150  HIS B CE1 1 
ATOM   4329  N NE2 . HIS B  1 144 ? 0.068   -39.790  89.256  1.00 15.76 ? 150  HIS B NE2 1 
ATOM   4330  N N   . VAL B  1 145 ? 2.367   -38.763  84.768  1.00 24.59 ? 151  VAL B N   1 
ATOM   4331  C CA  . VAL B  1 145 ? 3.006   -40.028  84.416  1.00 28.09 ? 151  VAL B CA  1 
ATOM   4332  C C   . VAL B  1 145 ? 4.468   -39.783  84.048  1.00 30.56 ? 151  VAL B C   1 
ATOM   4333  O O   . VAL B  1 145 ? 5.337   -40.548  84.457  1.00 32.59 ? 151  VAL B O   1 
ATOM   4334  C CB  . VAL B  1 145 ? 2.279   -40.783  83.260  1.00 25.58 ? 151  VAL B CB  1 
ATOM   4335  C CG1 . VAL B  1 145 ? 0.833   -41.050  83.629  1.00 23.54 ? 151  VAL B CG1 1 
ATOM   4336  C CG2 . VAL B  1 145 ? 2.375   -40.033  81.942  1.00 31.57 ? 151  VAL B CG2 1 
ATOM   4337  N N   . ASP B  1 146 ? 4.747   -38.699  83.323  1.00 31.75 ? 152  ASP B N   1 
ATOM   4338  C CA  . ASP B  1 146 ? 6.094   -38.453  82.813  1.00 28.72 ? 152  ASP B CA  1 
ATOM   4339  C C   . ASP B  1 146 ? 7.038   -38.008  83.910  1.00 28.87 ? 152  ASP B C   1 
ATOM   4340  O O   . ASP B  1 146 ? 8.250   -37.984  83.712  1.00 34.10 ? 152  ASP B O   1 
ATOM   4341  C CB  . ASP B  1 146 ? 6.078   -37.407  81.695  1.00 33.42 ? 152  ASP B CB  1 
ATOM   4342  C CG  . ASP B  1 146 ? 5.735   -38.006  80.331  1.00 40.81 ? 152  ASP B CG  1 
ATOM   4343  O OD1 . ASP B  1 146 ? 5.688   -39.247  80.216  1.00 37.56 ? 152  ASP B OD1 1 
ATOM   4344  O OD2 . ASP B  1 146 ? 5.525   -37.231  79.368  1.00 46.23 ? 152  ASP B OD2 1 
ATOM   4345  N N   . SER B  1 147 ? 6.486   -37.657  85.068  1.00 28.75 ? 153  SER B N   1 
ATOM   4346  C CA  . SER B  1 147 ? 7.296   -37.229  86.206  1.00 27.40 ? 153  SER B CA  1 
ATOM   4347  C C   . SER B  1 147 ? 7.428   -38.307  87.267  1.00 28.98 ? 153  SER B C   1 
ATOM   4348  O O   . SER B  1 147 ? 8.301   -38.229  88.125  1.00 37.65 ? 153  SER B O   1 
ATOM   4349  C CB  . SER B  1 147 ? 6.712   -35.973  86.856  1.00 28.98 ? 153  SER B CB  1 
ATOM   4350  O OG  . SER B  1 147 ? 5.697   -36.318  87.785  1.00 30.85 ? 153  SER B OG  1 
ATOM   4351  N N   . GLY B  1 148 ? 6.552   -39.300  87.233  1.00 24.24 ? 154  GLY B N   1 
ATOM   4352  C CA  . GLY B  1 148 ? 6.578   -40.349  88.234  1.00 21.91 ? 154  GLY B CA  1 
ATOM   4353  C C   . GLY B  1 148 ? 6.123   -39.945  89.631  1.00 25.78 ? 154  GLY B C   1 
ATOM   4354  O O   . GLY B  1 148 ? 6.374   -40.659  90.603  1.00 28.59 ? 154  GLY B O   1 
ATOM   4355  N N   . ALA B  1 149 ? 5.435   -38.813  89.742  1.00 25.47 ? 155  ALA B N   1 
ATOM   4356  C CA  . ALA B  1 149 ? 4.956   -38.346  91.041  1.00 22.42 ? 155  ALA B CA  1 
ATOM   4357  C C   . ALA B  1 149 ? 3.887   -39.262  91.638  1.00 20.50 ? 155  ALA B C   1 
ATOM   4358  O O   . ALA B  1 149 ? 3.231   -40.024  90.924  1.00 20.48 ? 155  ALA B O   1 
ATOM   4359  C CB  . ALA B  1 149 ? 4.415   -36.936  90.920  1.00 22.04 ? 155  ALA B CB  1 
ATOM   4360  N N   . ASP B  1 150 ? 3.721   -39.177  92.954  1.00 20.21 ? 156  ASP B N   1 
ATOM   4361  C CA  . ASP B  1 150 ? 2.612   -39.834  93.638  1.00 21.65 ? 156  ASP B CA  1 
ATOM   4362  C C   . ASP B  1 150 ? 1.343   -39.010  93.476  1.00 22.49 ? 156  ASP B C   1 
ATOM   4363  O O   . ASP B  1 150 ? 0.260   -39.552  93.263  1.00 27.96 ? 156  ASP B O   1 
ATOM   4364  C CB  . ASP B  1 150 ? 2.909   -40.014  95.125  1.00 25.14 ? 156  ASP B CB  1 
ATOM   4365  C CG  . ASP B  1 150 ? 4.060   -40.952  95.380  1.00 29.10 ? 156  ASP B CG  1 
ATOM   4366  O OD1 . ASP B  1 150 ? 4.159   -41.969  94.665  1.00 26.63 ? 156  ASP B OD1 1 
ATOM   4367  O OD2 . ASP B  1 150 ? 4.857   -40.673  96.304  1.00 29.98 ? 156  ASP B OD2 1 
ATOM   4368  N N   . VAL B  1 151 ? 1.487   -37.696  93.607  1.00 19.02 ? 157  VAL B N   1 
ATOM   4369  C CA  . VAL B  1 151 ? 0.375   -36.772  93.417  1.00 21.92 ? 157  VAL B CA  1 
ATOM   4370  C C   . VAL B  1 151 ? 0.860   -35.540  92.681  1.00 21.98 ? 157  VAL B C   1 
ATOM   4371  O O   . VAL B  1 151 ? 1.869   -34.945  93.047  1.00 26.70 ? 157  VAL B O   1 
ATOM   4372  C CB  . VAL B  1 151 ? -0.281  -36.345  94.760  1.00 29.16 ? 157  VAL B CB  1 
ATOM   4373  C CG1 . VAL B  1 151 ? 0.756   -36.007  95.785  1.00 23.41 ? 157  VAL B CG1 1 
ATOM   4374  C CG2 . VAL B  1 151 ? -1.167  -35.147  94.561  1.00 31.52 ? 157  VAL B CG2 1 
ATOM   4375  N N   . THR B  1 152 ? 0.152   -35.178  91.623  1.00 21.50 ? 158  THR B N   1 
ATOM   4376  C CA  . THR B  1 152 ? 0.369   -33.905  90.963  1.00 19.22 ? 158  THR B CA  1 
ATOM   4377  C C   . THR B  1 152 ? -0.715  -32.945  91.460  1.00 17.22 ? 158  THR B C   1 
ATOM   4378  O O   . THR B  1 152 ? -1.893  -33.303  91.509  1.00 18.15 ? 158  THR B O   1 
ATOM   4379  C CB  . THR B  1 152 ? 0.337   -34.048  89.428  1.00 18.23 ? 158  THR B CB  1 
ATOM   4380  O OG1 . THR B  1 152 ? 1.440   -34.855  89.008  1.00 20.44 ? 158  THR B OG1 1 
ATOM   4381  C CG2 . THR B  1 152 ? 0.463   -32.705  88.756  1.00 21.38 ? 158  THR B CG2 1 
ATOM   4382  N N   . ILE B  1 153 ? -0.317  -31.744  91.869  1.00 14.76 ? 159  ILE B N   1 
ATOM   4383  C CA  . ILE B  1 153 ? -1.273  -30.798  92.435  1.00 20.64 ? 159  ILE B CA  1 
ATOM   4384  C C   . ILE B  1 153 ? -1.335  -29.539  91.593  1.00 20.09 ? 159  ILE B C   1 
ATOM   4385  O O   . ILE B  1 153 ? -0.320  -28.952  91.259  1.00 21.62 ? 159  ILE B O   1 
ATOM   4386  C CB  . ILE B  1 153 ? -0.925  -30.432  93.895  1.00 22.49 ? 159  ILE B CB  1 
ATOM   4387  C CG1 . ILE B  1 153 ? -0.696  -31.711  94.710  1.00 27.79 ? 159  ILE B CG1 1 
ATOM   4388  C CG2 . ILE B  1 153 ? -2.025  -29.570  94.509  1.00 19.23 ? 159  ILE B CG2 1 
ATOM   4389  C CD1 . ILE B  1 153 ? -0.506  -31.503  96.195  1.00 25.75 ? 159  ILE B CD1 1 
ATOM   4390  N N   . GLY B  1 154 ? -2.545  -29.146  91.224  1.00 22.48 ? 160  GLY B N   1 
ATOM   4391  C CA  . GLY B  1 154 ? -2.729  -27.950  90.431  1.00 19.75 ? 160  GLY B CA  1 
ATOM   4392  C C   . GLY B  1 154 ? -2.566  -26.724  91.301  1.00 16.80 ? 160  GLY B C   1 
ATOM   4393  O O   . GLY B  1 154 ? -3.167  -26.623  92.364  1.00 20.83 ? 160  GLY B O   1 
ATOM   4394  N N   . CYS B  1 155 ? -1.739  -25.798  90.834  1.00 20.22 ? 161  CYS B N   1 
ATOM   4395  C CA  . CYS B  1 155 ? -1.335  -24.645  91.622  1.00 18.02 ? 161  CYS B CA  1 
ATOM   4396  C C   . CYS B  1 155 ? -1.470  -23.349  90.850  1.00 21.46 ? 161  CYS B C   1 
ATOM   4397  O O   . CYS B  1 155 ? -1.051  -23.250  89.693  1.00 22.38 ? 161  CYS B O   1 
ATOM   4398  C CB  . CYS B  1 155 ? 0.116   -24.815  92.097  1.00 15.26 ? 161  CYS B CB  1 
ATOM   4399  S SG  . CYS B  1 155 ? 0.319   -26.092  93.346  1.00 24.97 ? 161  CYS B SG  1 
ATOM   4400  N N   . LEU B  1 156 ? -2.071  -22.359  91.505  1.00 18.09 ? 162  LEU B N   1 
ATOM   4401  C CA  . LEU B  1 156 ? -2.061  -20.987  91.023  1.00 20.84 ? 162  LEU B CA  1 
ATOM   4402  C C   . LEU B  1 156 ? -0.748  -20.311  91.398  1.00 23.10 ? 162  LEU B C   1 
ATOM   4403  O O   . LEU B  1 156 ? -0.310  -20.396  92.547  1.00 24.17 ? 162  LEU B O   1 
ATOM   4404  C CB  . LEU B  1 156 ? -3.220  -20.190  91.622  1.00 20.51 ? 162  LEU B CB  1 
ATOM   4405  C CG  . LEU B  1 156 ? -4.628  -20.659  91.302  1.00 19.50 ? 162  LEU B CG  1 
ATOM   4406  C CD1 . LEU B  1 156 ? -5.617  -19.780  92.031  1.00 20.43 ? 162  LEU B CD1 1 
ATOM   4407  C CD2 . LEU B  1 156 ? -4.844  -20.613  89.799  1.00 19.40 ? 162  LEU B CD2 1 
ATOM   4408  N N   . GLU B  1 157 ? -0.137  -19.627  90.438  1.00 21.98 ? 163  GLU B N   1 
ATOM   4409  C CA  . GLU B  1 157 ? 1.053   -18.829  90.713  1.00 25.84 ? 163  GLU B CA  1 
ATOM   4410  C C   . GLU B  1 157 ? 0.639   -17.388  90.992  1.00 28.40 ? 163  GLU B C   1 
ATOM   4411  O O   . GLU B  1 157 ? 0.435   -16.609  90.064  1.00 34.56 ? 163  GLU B O   1 
ATOM   4412  C CB  . GLU B  1 157 ? 2.037   -18.898  89.540  1.00 28.58 ? 163  GLU B CB  1 
ATOM   4413  C CG  . GLU B  1 157 ? 3.307   -18.095  89.762  1.00 38.22 ? 163  GLU B CG  1 
ATOM   4414  C CD  . GLU B  1 157 ? 4.427   -18.482  88.810  1.00 47.03 ? 163  GLU B CD  1 
ATOM   4415  O OE1 . GLU B  1 157 ? 4.288   -19.525  88.131  1.00 50.43 ? 163  GLU B OE1 1 
ATOM   4416  O OE2 . GLU B  1 157 ? 5.446   -17.751  88.747  1.00 46.71 ? 163  GLU B OE2 1 
ATOM   4417  N N   . VAL B  1 158 ? 0.494   -17.040  92.269  1.00 26.56 ? 164  VAL B N   1 
ATOM   4418  C CA  . VAL B  1 158 ? 0.000   -15.714  92.644  1.00 28.13 ? 164  VAL B CA  1 
ATOM   4419  C C   . VAL B  1 158 ? 1.016   -14.939  93.493  1.00 33.68 ? 164  VAL B C   1 
ATOM   4420  O O   . VAL B  1 158 ? 1.836   -15.543  94.188  1.00 35.00 ? 164  VAL B O   1 
ATOM   4421  C CB  . VAL B  1 158 ? -1.340  -15.798  93.426  1.00 31.70 ? 164  VAL B CB  1 
ATOM   4422  C CG1 . VAL B  1 158 ? -2.379  -16.572  92.629  1.00 33.95 ? 164  VAL B CG1 1 
ATOM   4423  C CG2 . VAL B  1 158 ? -1.136  -16.417  94.800  1.00 26.22 ? 164  VAL B CG2 1 
ATOM   4424  N N   . PRO B  1 159 ? 0.970   -13.595  93.428  1.00 32.19 ? 165  PRO B N   1 
ATOM   4425  C CA  . PRO B  1 159 ? 1.816   -12.778  94.302  1.00 26.42 ? 165  PRO B CA  1 
ATOM   4426  C C   . PRO B  1 159 ? 1.565   -13.129  95.759  1.00 28.23 ? 165  PRO B C   1 
ATOM   4427  O O   . PRO B  1 159 ? 0.425   -13.435  96.119  1.00 31.47 ? 165  PRO B O   1 
ATOM   4428  C CB  . PRO B  1 159 ? 1.373   -11.349  93.985  1.00 29.68 ? 165  PRO B CB  1 
ATOM   4429  C CG  . PRO B  1 159 ? 0.835   -11.420  92.611  1.00 30.80 ? 165  PRO B CG  1 
ATOM   4430  C CD  . PRO B  1 159 ? 0.164   -12.761  92.519  1.00 32.67 ? 165  PRO B CD  1 
ATOM   4431  N N   . ARG B  1 160 ? 2.607   -13.085  96.585  1.00 25.62 ? 166  ARG B N   1 
ATOM   4432  C CA  . ARG B  1 160 ? 2.527   -13.643  97.930  1.00 26.11 ? 166  ARG B CA  1 
ATOM   4433  C C   . ARG B  1 160 ? 1.492   -13.011  98.842  1.00 28.79 ? 166  ARG B C   1 
ATOM   4434  O O   . ARG B  1 160 ? 0.988   -13.663  99.758  1.00 33.83 ? 166  ARG B O   1 
ATOM   4435  C CB  . ARG B  1 160 ? 3.890   -13.567  98.590  1.00 28.94 ? 166  ARG B CB  1 
ATOM   4436  C CG  . ARG B  1 160 ? 4.940   -14.163  97.712  1.00 26.65 ? 166  ARG B CG  1 
ATOM   4437  C CD  . ARG B  1 160 ? 6.249   -14.361  98.433  1.00 32.72 ? 166  ARG B CD  1 
ATOM   4438  N NE  . ARG B  1 160 ? 6.762   -13.126  99.003  1.00 30.23 ? 166  ARG B NE  1 
ATOM   4439  C CZ  . ARG B  1 160 ? 7.112   -12.989  100.273 1.00 36.57 ? 166  ARG B CZ  1 
ATOM   4440  N NH1 . ARG B  1 160 ? 7.047   -14.027  101.095 1.00 37.61 ? 166  ARG B NH1 1 
ATOM   4441  N NH2 . ARG B  1 160 ? 7.567   -11.823  100.711 1.00 39.92 ? 166  ARG B NH2 1 
ATOM   4442  N N   . MET B  1 161 ? 1.164   -11.753  98.602  1.00 27.12 ? 167  MET B N   1 
ATOM   4443  C CA  . MET B  1 161 ? 0.149   -11.112  99.411  1.00 27.43 ? 167  MET B CA  1 
ATOM   4444  C C   . MET B  1 161 ? -1.233  -11.750  99.198  1.00 32.20 ? 167  MET B C   1 
ATOM   4445  O O   . MET B  1 161 ? -2.060  -11.761  100.114 1.00 31.45 ? 167  MET B O   1 
ATOM   4446  C CB  . MET B  1 161 ? 0.104   -9.615   99.120  1.00 31.85 ? 167  MET B CB  1 
ATOM   4447  C CG  . MET B  1 161 ? -0.934  -8.884   99.943  1.00 37.03 ? 167  MET B CG  1 
ATOM   4448  S SD  . MET B  1 161 ? -0.243  -7.438   100.751 1.00 34.44 ? 167  MET B SD  1 
ATOM   4449  C CE  . MET B  1 161 ? -1.642  -6.877   101.718 1.00 17.79 ? 167  MET B CE  1 
ATOM   4450  N N   . GLU B  1 162 ? -1.476  -12.293  98.003  1.00 35.34 ? 168  GLU B N   1 
ATOM   4451  C CA  . GLU B  1 162 ? -2.750  -12.970  97.715  1.00 35.16 ? 168  GLU B CA  1 
ATOM   4452  C C   . GLU B  1 162 ? -2.775  -14.398  98.259  1.00 28.96 ? 168  GLU B C   1 
ATOM   4453  O O   . GLU B  1 162 ? -3.835  -14.929  98.575  1.00 29.37 ? 168  GLU B O   1 
ATOM   4454  C CB  . GLU B  1 162 ? -3.039  -13.003  96.205  1.00 39.84 ? 168  GLU B CB  1 
ATOM   4455  C CG  . GLU B  1 162 ? -4.356  -13.717  95.845  1.00 44.26 ? 168  GLU B CG  1 
ATOM   4456  C CD  . GLU B  1 162 ? -4.665  -13.744  94.349  1.00 49.19 ? 168  GLU B CD  1 
ATOM   4457  O OE1 . GLU B  1 162 ? -3.815  -13.306  93.543  1.00 51.80 ? 168  GLU B OE1 1 
ATOM   4458  O OE2 . GLU B  1 162 ? -5.764  -14.213  93.980  1.00 49.99 ? 168  GLU B OE2 1 
ATOM   4459  N N   . ALA B  1 163 ? -1.604  -15.014  98.375  1.00 24.99 ? 169  ALA B N   1 
ATOM   4460  C CA  . ALA B  1 163 ? -1.523  -16.425  98.723  1.00 24.71 ? 169  ALA B CA  1 
ATOM   4461  C C   . ALA B  1 163 ? -1.881  -16.673  100.175 1.00 27.46 ? 169  ALA B C   1 
ATOM   4462  O O   . ALA B  1 163 ? -1.958  -17.819  100.616 1.00 29.23 ? 169  ALA B O   1 
ATOM   4463  C CB  . ALA B  1 163 ? -0.134  -16.959  98.432  1.00 24.12 ? 169  ALA B CB  1 
ATOM   4464  N N   . THR B  1 164 ? -2.105  -15.599  100.919 1.00 27.56 ? 170  THR B N   1 
ATOM   4465  C CA  . THR B  1 164 ? -2.283  -15.716  102.357 1.00 27.30 ? 170  THR B CA  1 
ATOM   4466  C C   . THR B  1 164 ? -3.613  -16.367  102.714 1.00 29.56 ? 170  THR B C   1 
ATOM   4467  O O   . THR B  1 164 ? -3.767  -16.907  103.809 1.00 31.34 ? 170  THR B O   1 
ATOM   4468  C CB  . THR B  1 164 ? -2.169  -14.342  103.046 1.00 27.64 ? 170  THR B CB  1 
ATOM   4469  O OG1 . THR B  1 164 ? -3.302  -13.537  102.714 1.00 31.36 ? 170  THR B OG1 1 
ATOM   4470  C CG2 . THR B  1 164 ? -0.884  -13.631  102.612 1.00 25.44 ? 170  THR B CG2 1 
ATOM   4471  N N   . GLY B  1 165 ? -4.566  -16.334  101.786 1.00 27.97 ? 171  GLY B N   1 
ATOM   4472  C CA  . GLY B  1 165 ? -5.852  -16.978  101.994 1.00 26.27 ? 171  GLY B CA  1 
ATOM   4473  C C   . GLY B  1 165 ? -5.942  -18.358  101.363 1.00 23.66 ? 171  GLY B C   1 
ATOM   4474  O O   . GLY B  1 165 ? -6.985  -19.004  101.391 1.00 28.22 ? 171  GLY B O   1 
ATOM   4475  N N   . PHE B  1 166 ? -4.830  -18.814  100.804 1.00 22.31 ? 172  PHE B N   1 
ATOM   4476  C CA  . PHE B  1 166 ? -4.774  -20.092  100.117 1.00 19.65 ? 172  PHE B CA  1 
ATOM   4477  C C   . PHE B  1 166 ? -4.009  -21.139  100.912 1.00 24.81 ? 172  PHE B C   1 
ATOM   4478  O O   . PHE B  1 166 ? -3.289  -20.811  101.854 1.00 23.97 ? 172  PHE B O   1 
ATOM   4479  C CB  . PHE B  1 166 ? -4.099  -19.925  98.759  1.00 20.12 ? 172  PHE B CB  1 
ATOM   4480  C CG  . PHE B  1 166 ? -4.943  -19.236  97.728  1.00 22.91 ? 172  PHE B CG  1 
ATOM   4481  C CD1 . PHE B  1 166 ? -5.700  -19.977  96.829  1.00 24.25 ? 172  PHE B CD1 1 
ATOM   4482  C CD2 . PHE B  1 166 ? -4.968  -17.857  97.641  1.00 26.25 ? 172  PHE B CD2 1 
ATOM   4483  C CE1 . PHE B  1 166 ? -6.473  -19.351  95.871  1.00 24.07 ? 172  PHE B CE1 1 
ATOM   4484  C CE2 . PHE B  1 166 ? -5.742  -17.222  96.686  1.00 25.37 ? 172  PHE B CE2 1 
ATOM   4485  C CZ  . PHE B  1 166 ? -6.494  -17.969  95.801  1.00 25.85 ? 172  PHE B CZ  1 
ATOM   4486  N N   . GLY B  1 167 ? -4.161  -22.401  100.517 1.00 24.18 ? 173  GLY B N   1 
ATOM   4487  C CA  . GLY B  1 167 ? -3.212  -23.435  100.893 1.00 22.07 ? 173  GLY B CA  1 
ATOM   4488  C C   . GLY B  1 167 ? -2.026  -23.277  99.958  1.00 19.19 ? 173  GLY B C   1 
ATOM   4489  O O   . GLY B  1 167 ? -2.195  -23.168  98.747  1.00 21.44 ? 173  GLY B O   1 
ATOM   4490  N N   . VAL B  1 168 ? -0.818  -23.245  100.506 1.00 22.64 ? 174  VAL B N   1 
ATOM   4491  C CA  . VAL B  1 168 ? 0.352   -22.921  99.691  1.00 21.95 ? 174  VAL B CA  1 
ATOM   4492  C C   . VAL B  1 168 ? 1.369   -24.061  99.657  1.00 23.59 ? 174  VAL B C   1 
ATOM   4493  O O   . VAL B  1 168 ? 1.717   -24.649  100.683 1.00 24.59 ? 174  VAL B O   1 
ATOM   4494  C CB  . VAL B  1 168 ? 1.040   -21.627  100.195 1.00 20.13 ? 174  VAL B CB  1 
ATOM   4495  C CG1 . VAL B  1 168 ? 2.301   -21.340  99.407  1.00 19.83 ? 174  VAL B CG1 1 
ATOM   4496  C CG2 . VAL B  1 168 ? 0.079   -20.460  100.085 1.00 20.64 ? 174  VAL B CG2 1 
ATOM   4497  N N   . MET B  1 169 ? 1.843   -24.377  98.459  1.00 23.81 ? 175  MET B N   1 
ATOM   4498  C CA  . MET B  1 169 ? 2.843   -25.423  98.292  1.00 28.18 ? 175  MET B CA  1 
ATOM   4499  C C   . MET B  1 169 ? 4.217   -24.782  98.210  1.00 33.80 ? 175  MET B C   1 
ATOM   4500  O O   . MET B  1 169 ? 4.399   -23.835  97.453  1.00 31.65 ? 175  MET B O   1 
ATOM   4501  C CB  . MET B  1 169 ? 2.564   -26.246  97.019  1.00 24.79 ? 175  MET B CB  1 
ATOM   4502  C CG  . MET B  1 169 ? 1.221   -26.961  96.989  1.00 23.66 ? 175  MET B CG  1 
ATOM   4503  S SD  . MET B  1 169 ? 0.886   -27.998  98.436  1.00 32.91 ? 175  MET B SD  1 
ATOM   4504  C CE  . MET B  1 169 ? -0.808  -28.490  98.109  1.00 55.88 ? 175  MET B CE  1 
ATOM   4505  N N   . HIS B  1 170 ? 5.184   -25.280  98.974  1.00 37.39 ? 176  HIS B N   1 
ATOM   4506  C CA  . HIS B  1 170 ? 6.542   -24.806  98.791  1.00 34.53 ? 176  HIS B CA  1 
ATOM   4507  C C   . HIS B  1 170 ? 7.279   -25.575  97.721  1.00 33.57 ? 176  HIS B C   1 
ATOM   4508  O O   . HIS B  1 170 ? 7.265   -26.791  97.676  1.00 41.48 ? 176  HIS B O   1 
ATOM   4509  C CB  . HIS B  1 170 ? 7.343   -24.881  100.073 1.00 41.84 ? 176  HIS B CB  1 
ATOM   4510  C CG  . HIS B  1 170 ? 8.476   -23.893  100.140 1.00 45.96 ? 176  HIS B CG  1 
ATOM   4511  N ND1 . HIS B  1 170 ? 9.162   -23.460  99.022  1.00 52.14 ? 176  HIS B ND1 1 
ATOM   4512  C CD2 . HIS B  1 170 ? 9.057   -23.271  101.193 1.00 46.61 ? 176  HIS B CD2 1 
ATOM   4513  C CE1 . HIS B  1 170 ? 10.096  -22.598  99.382  1.00 52.77 ? 176  HIS B CE1 1 
ATOM   4514  N NE2 . HIS B  1 170 ? 10.065  -22.476  100.696 1.00 50.56 ? 176  HIS B NE2 1 
ATOM   4515  N N   . VAL B  1 171 ? 7.975   -24.805  96.906  1.00 34.30 ? 177  VAL B N   1 
ATOM   4516  C CA  . VAL B  1 171 ? 8.611   -25.228  95.678  1.00 39.57 ? 177  VAL B CA  1 
ATOM   4517  C C   . VAL B  1 171 ? 10.114  -25.417  95.831  1.00 41.42 ? 177  VAL B C   1 
ATOM   4518  O O   . VAL B  1 171 ? 10.751  -24.645  96.537  1.00 40.81 ? 177  VAL B O   1 
ATOM   4519  C CB  . VAL B  1 171 ? 8.363   -24.156  94.605  1.00 43.79 ? 177  VAL B CB  1 
ATOM   4520  C CG1 . VAL B  1 171 ? 8.697   -24.671  93.241  1.00 46.41 ? 177  VAL B CG1 1 
ATOM   4521  C CG2 . VAL B  1 171 ? 6.939   -23.668  94.674  1.00 48.53 ? 177  VAL B CG2 1 
ATOM   4522  N N   . ASN B  1 172 ? 10.686  -26.430  95.185  1.00 38.61 ? 178  ASN B N   1 
ATOM   4523  C CA  . ASN B  1 172 ? 12.130  -26.418  94.986  1.00 38.72 ? 178  ASN B CA  1 
ATOM   4524  C C   . ASN B  1 172 ? 12.447  -26.022  93.553  1.00 41.81 ? 178  ASN B C   1 
ATOM   4525  O O   . ASN B  1 172 ? 11.588  -25.503  92.841  1.00 47.53 ? 178  ASN B O   1 
ATOM   4526  C CB  . ASN B  1 172 ? 12.780  -27.765  95.361  1.00 36.94 ? 178  ASN B CB  1 
ATOM   4527  C CG  . ASN B  1 172 ? 12.478  -28.909  94.376  1.00 38.05 ? 178  ASN B CG  1 
ATOM   4528  O OD1 . ASN B  1 172 ? 12.155  -28.709  93.209  1.00 35.61 ? 178  ASN B OD1 1 
ATOM   4529  N ND2 . ASN B  1 172 ? 12.611  -30.135  94.872  1.00 38.43 ? 178  ASN B ND2 1 
ATOM   4530  N N   . GLU B  1 173 ? 13.674  -26.277  93.127  1.00 39.29 ? 179  GLU B N   1 
ATOM   4531  C CA  . GLU B  1 173 ? 14.098  -25.945  91.777  1.00 38.66 ? 179  GLU B CA  1 
ATOM   4532  C C   . GLU B  1 173 ? 13.312  -26.693  90.699  1.00 32.44 ? 179  GLU B C   1 
ATOM   4533  O O   . GLU B  1 173 ? 13.093  -26.167  89.613  1.00 32.74 ? 179  GLU B O   1 
ATOM   4534  C CB  . GLU B  1 173 ? 15.590  -26.239  91.626  1.00 46.14 ? 179  GLU B CB  1 
ATOM   4535  C CG  . GLU B  1 173 ? 15.909  -27.714  91.816  1.00 55.20 ? 179  GLU B CG  1 
ATOM   4536  C CD  . GLU B  1 173 ? 17.209  -28.127  91.179  1.00 61.62 ? 179  GLU B CD  1 
ATOM   4537  O OE1 . GLU B  1 173 ? 17.597  -27.501  90.169  1.00 63.12 ? 179  GLU B OE1 1 
ATOM   4538  O OE2 . GLU B  1 173 ? 17.832  -29.089  91.678  1.00 64.43 ? 179  GLU B OE2 1 
ATOM   4539  N N   . LYS B  1 174 ? 12.882  -27.915  91.004  1.00 29.63 ? 180  LYS B N   1 
ATOM   4540  C CA  . LYS B  1 174 ? 12.245  -28.775  90.006  1.00 33.20 ? 180  LYS B CA  1 
ATOM   4541  C C   . LYS B  1 174 ? 10.723  -28.852  90.178  1.00 32.02 ? 180  LYS B C   1 
ATOM   4542  O O   . LYS B  1 174 ? 10.080  -29.772  89.676  1.00 30.69 ? 180  LYS B O   1 
ATOM   4543  C CB  . LYS B  1 174 ? 12.850  -30.184  90.067  1.00 37.94 ? 180  LYS B CB  1 
ATOM   4544  C CG  . LYS B  1 174 ? 14.358  -30.224  89.824  1.00 43.82 ? 180  LYS B CG  1 
ATOM   4545  C CD  . LYS B  1 174 ? 14.934  -31.600  90.125  1.00 50.03 ? 180  LYS B CD  1 
ATOM   4546  C CE  . LYS B  1 174 ? 15.805  -31.580  91.378  1.00 55.92 ? 180  LYS B CE  1 
ATOM   4547  N NZ  . LYS B  1 174 ? 15.868  -32.909  92.068  1.00 58.60 ? 180  LYS B NZ  1 
ATOM   4548  N N   . ASP B  1 175 ? 10.163  -27.881  90.891  1.00 30.56 ? 181  ASP B N   1 
ATOM   4549  C CA  . ASP B  1 175 ? 8.733   -27.820  91.182  1.00 30.04 ? 181  ASP B CA  1 
ATOM   4550  C C   . ASP B  1 175 ? 8.214   -29.033  91.946  1.00 28.61 ? 181  ASP B C   1 
ATOM   4551  O O   . ASP B  1 175 ? 7.021   -29.322  91.921  1.00 29.82 ? 181  ASP B O   1 
ATOM   4552  C CB  . ASP B  1 175 ? 7.925   -27.641  89.893  1.00 31.14 ? 181  ASP B CB  1 
ATOM   4553  C CG  . ASP B  1 175 ? 7.588   -26.186  89.619  1.00 36.62 ? 181  ASP B CG  1 
ATOM   4554  O OD1 . ASP B  1 175 ? 8.117   -25.320  90.341  1.00 41.75 ? 181  ASP B OD1 1 
ATOM   4555  O OD2 . ASP B  1 175 ? 6.800   -25.903  88.690  1.00 34.65 ? 181  ASP B OD2 1 
ATOM   4556  N N   . GLU B  1 176 ? 9.105   -29.745  92.625  1.00 27.88 ? 182  GLU B N   1 
ATOM   4557  C CA  . GLU B  1 176 ? 8.678   -30.779  93.555  1.00 25.32 ? 182  GLU B CA  1 
ATOM   4558  C C   . GLU B  1 176 ? 8.258   -30.099  94.847  1.00 22.81 ? 182  GLU B C   1 
ATOM   4559  O O   . GLU B  1 176 ? 8.951   -29.215  95.342  1.00 24.77 ? 182  GLU B O   1 
ATOM   4560  C CB  . GLU B  1 176 ? 9.794   -31.782  93.812  1.00 31.38 ? 182  GLU B CB  1 
ATOM   4561  C CG  . GLU B  1 176 ? 10.615  -32.094  92.585  1.00 42.56 ? 182  GLU B CG  1 
ATOM   4562  C CD  . GLU B  1 176 ? 11.842  -32.926  92.904  1.00 50.85 ? 182  GLU B CD  1 
ATOM   4563  O OE1 . GLU B  1 176 ? 11.781  -33.761  93.831  1.00 51.28 ? 182  GLU B OE1 1 
ATOM   4564  O OE2 . GLU B  1 176 ? 12.873  -32.735  92.234  1.00 56.26 ? 182  GLU B OE2 1 
ATOM   4565  N N   . ILE B  1 177 ? 7.112   -30.489  95.384  1.00 24.74 ? 183  ILE B N   1 
ATOM   4566  C CA  . ILE B  1 177 ? 6.588   -29.837  96.578  1.00 26.46 ? 183  ILE B CA  1 
ATOM   4567  C C   . ILE B  1 177 ? 7.305   -30.363  97.813  1.00 32.00 ? 183  ILE B C   1 
ATOM   4568  O O   . ILE B  1 177 ? 7.360   -31.572  98.041  1.00 31.53 ? 183  ILE B O   1 
ATOM   4569  C CB  . ILE B  1 177 ? 5.072   -30.047  96.713  1.00 25.97 ? 183  ILE B CB  1 
ATOM   4570  C CG1 . ILE B  1 177 ? 4.350   -29.411  95.524  1.00 21.98 ? 183  ILE B CG1 1 
ATOM   4571  C CG2 . ILE B  1 177 ? 4.565   -29.454  98.020  1.00 25.13 ? 183  ILE B CG2 1 
ATOM   4572  C CD1 . ILE B  1 177 ? 2.935   -29.912  95.339  1.00 23.42 ? 183  ILE B CD1 1 
ATOM   4573  N N   . ILE B  1 178 ? 7.863   -29.448  98.603  1.00 34.60 ? 184  ILE B N   1 
ATOM   4574  C CA  . ILE B  1 178 ? 8.684   -29.843  99.736  1.00 35.96 ? 184  ILE B CA  1 
ATOM   4575  C C   . ILE B  1 178 ? 8.002   -29.595  101.085 1.00 35.93 ? 184  ILE B C   1 
ATOM   4576  O O   . ILE B  1 178 ? 8.423   -30.158  102.090 1.00 38.64 ? 184  ILE B O   1 
ATOM   4577  C CB  . ILE B  1 178 ? 10.054  -29.137  99.689  1.00 38.00 ? 184  ILE B CB  1 
ATOM   4578  C CG1 . ILE B  1 178 ? 9.942   -27.676  100.115 1.00 37.40 ? 184  ILE B CG1 1 
ATOM   4579  C CG2 . ILE B  1 178 ? 10.665  -29.251  98.291  1.00 37.60 ? 184  ILE B CG2 1 
ATOM   4580  C CD1 . ILE B  1 178 ? 11.281  -26.954  100.106 1.00 33.44 ? 184  ILE B CD1 1 
ATOM   4581  N N   . ASP B  1 179 ? 6.964   -28.759  101.108 1.00 34.91 ? 185  ASP B N   1 
ATOM   4582  C CA  . ASP B  1 179 ? 5.988   -28.779  102.206 1.00 39.98 ? 185  ASP B CA  1 
ATOM   4583  C C   . ASP B  1 179 ? 4.696   -28.037  101.824 1.00 36.56 ? 185  ASP B C   1 
ATOM   4584  O O   . ASP B  1 179 ? 4.587   -27.479  100.728 1.00 31.46 ? 185  ASP B O   1 
ATOM   4585  C CB  . ASP B  1 179 ? 6.584   -28.207  103.507 1.00 51.05 ? 185  ASP B CB  1 
ATOM   4586  C CG  . ASP B  1 179 ? 6.457   -26.701  103.618 1.00 58.93 ? 185  ASP B CG  1 
ATOM   4587  O OD1 . ASP B  1 179 ? 6.801   -25.998  102.655 1.00 61.45 ? 185  ASP B OD1 1 
ATOM   4588  O OD2 . ASP B  1 179 ? 6.023   -26.220  104.686 1.00 62.16 ? 185  ASP B OD2 1 
ATOM   4589  N N   . PHE B  1 180 ? 3.713   -28.064  102.722 1.00 34.68 ? 186  PHE B N   1 
ATOM   4590  C CA  . PHE B  1 180 ? 2.403   -27.470  102.465 1.00 33.68 ? 186  PHE B CA  1 
ATOM   4591  C C   . PHE B  1 180 ? 1.905   -26.681  103.671 1.00 34.16 ? 186  PHE B C   1 
ATOM   4592  O O   . PHE B  1 180 ? 1.849   -27.211  104.778 1.00 37.71 ? 186  PHE B O   1 
ATOM   4593  C CB  . PHE B  1 180 ? 1.382   -28.552  102.108 1.00 31.65 ? 186  PHE B CB  1 
ATOM   4594  C CG  . PHE B  1 180 ? -0.047  -28.126  102.309 1.00 31.83 ? 186  PHE B CG  1 
ATOM   4595  C CD1 . PHE B  1 180 ? -0.676  -27.315  101.382 1.00 31.56 ? 186  PHE B CD1 1 
ATOM   4596  C CD2 . PHE B  1 180 ? -0.758  -28.530  103.431 1.00 32.38 ? 186  PHE B CD2 1 
ATOM   4597  C CE1 . PHE B  1 180 ? -1.995  -26.913  101.562 1.00 35.22 ? 186  PHE B CE1 1 
ATOM   4598  C CE2 . PHE B  1 180 ? -2.070  -28.135  103.619 1.00 33.08 ? 186  PHE B CE2 1 
ATOM   4599  C CZ  . PHE B  1 180 ? -2.692  -27.324  102.682 1.00 34.81 ? 186  PHE B CZ  1 
ATOM   4600  N N   . ILE B  1 181 ? 1.522   -25.426  103.456 1.00 30.30 ? 187  ILE B N   1 
ATOM   4601  C CA  . ILE B  1 181 ? 1.057   -24.578  104.551 1.00 24.58 ? 187  ILE B CA  1 
ATOM   4602  C C   . ILE B  1 181 ? -0.329  -24.026  104.290 1.00 24.29 ? 187  ILE B C   1 
ATOM   4603  O O   . ILE B  1 181 ? -0.603  -23.467  103.232 1.00 28.42 ? 187  ILE B O   1 
ATOM   4604  C CB  . ILE B  1 181 ? 2.005   -23.388  104.801 1.00 28.11 ? 187  ILE B CB  1 
ATOM   4605  C CG1 . ILE B  1 181 ? 3.448   -23.868  104.947 1.00 30.76 ? 187  ILE B CG1 1 
ATOM   4606  C CG2 . ILE B  1 181 ? 1.560   -22.590  106.023 1.00 23.51 ? 187  ILE B CG2 1 
ATOM   4607  C CD1 . ILE B  1 181 ? 4.308   -23.571  103.739 1.00 33.54 ? 187  ILE B CD1 1 
ATOM   4608  N N   . GLU B  1 182 ? -1.203  -24.165  105.273 1.00 24.66 ? 188  GLU B N   1 
ATOM   4609  C CA  . GLU B  1 182 ? -2.557  -23.679  105.130 1.00 28.43 ? 188  GLU B CA  1 
ATOM   4610  C C   . GLU B  1 182 ? -2.676  -22.235  105.607 1.00 33.09 ? 188  GLU B C   1 
ATOM   4611  O O   . GLU B  1 182 ? -2.530  -21.947  106.795 1.00 35.91 ? 188  GLU B O   1 
ATOM   4612  C CB  . GLU B  1 182 ? -3.528  -24.591  105.885 1.00 32.01 ? 188  GLU B CB  1 
ATOM   4613  C CG  . GLU B  1 182 ? -4.975  -24.187  105.716 1.00 45.44 ? 188  GLU B CG  1 
ATOM   4614  C CD  . GLU B  1 182 ? -5.363  -23.953  104.254 1.00 55.40 ? 188  GLU B CD  1 
ATOM   4615  O OE1 . GLU B  1 182 ? -4.924  -24.727  103.373 1.00 61.80 ? 188  GLU B OE1 1 
ATOM   4616  O OE2 . GLU B  1 182 ? -6.101  -22.983  103.982 1.00 53.74 ? 188  GLU B OE2 1 
ATOM   4617  N N   . LYS B  1 183 ? -2.943  -21.337  104.663 1.00 29.39 ? 189  LYS B N   1 
ATOM   4618  C CA  . LYS B  1 183 ? -3.028  -19.903  104.923 1.00 28.92 ? 189  LYS B CA  1 
ATOM   4619  C C   . LYS B  1 183 ? -1.798  -19.347  105.651 1.00 33.06 ? 189  LYS B C   1 
ATOM   4620  O O   . LYS B  1 183 ? -1.891  -18.933  106.803 1.00 36.50 ? 189  LYS B O   1 
ATOM   4621  C CB  . LYS B  1 183 ? -4.297  -19.587  105.716 1.00 23.44 ? 189  LYS B CB  1 
ATOM   4622  C CG  . LYS B  1 183 ? -5.591  -19.949  105.006 1.00 25.87 ? 189  LYS B CG  1 
ATOM   4623  C CD  . LYS B  1 183 ? -6.788  -19.634  105.887 1.00 27.94 ? 189  LYS B CD  1 
ATOM   4624  C CE  . LYS B  1 183 ? -8.108  -19.719  105.137 1.00 35.69 ? 189  LYS B CE  1 
ATOM   4625  N NZ  . LYS B  1 183 ? -8.409  -21.101  104.688 1.00 41.32 ? 189  LYS B NZ  1 
ATOM   4626  N N   . PRO B  1 184 ? -0.636  -19.332  104.977 1.00 34.35 ? 190  PRO B N   1 
ATOM   4627  C CA  . PRO B  1 184 ? 0.576   -18.778  105.588 1.00 35.16 ? 190  PRO B CA  1 
ATOM   4628  C C   . PRO B  1 184 ? 0.540   -17.254  105.701 1.00 37.55 ? 190  PRO B C   1 
ATOM   4629  O O   . PRO B  1 184 ? 0.228   -16.578  104.719 1.00 39.65 ? 190  PRO B O   1 
ATOM   4630  C CB  . PRO B  1 184 ? 1.683   -19.224  104.631 1.00 36.35 ? 190  PRO B CB  1 
ATOM   4631  C CG  . PRO B  1 184 ? 1.019   -19.310  103.327 1.00 35.74 ? 190  PRO B CG  1 
ATOM   4632  C CD  . PRO B  1 184 ? -0.377  -19.812  103.611 1.00 33.91 ? 190  PRO B CD  1 
ATOM   4633  N N   . ALA B  1 185 ? 0.871   -16.730  106.880 1.00 37.42 ? 191  ALA B N   1 
ATOM   4634  C CA  . ALA B  1 185 ? 0.898   -15.282  107.119 1.00 34.51 ? 191  ALA B CA  1 
ATOM   4635  C C   . ALA B  1 185 ? 1.864   -14.580  106.176 1.00 26.43 ? 191  ALA B C   1 
ATOM   4636  O O   . ALA B  1 185 ? 1.576   -13.494  105.676 1.00 27.43 ? 191  ALA B O   1 
ATOM   4637  C CB  . ALA B  1 185 ? 1.271   -14.995  108.558 1.00 34.18 ? 191  ALA B CB  1 
ATOM   4638  N N   . ASP B  1 186 ? 3.012   -15.207  105.948 1.00 23.85 ? 192  ASP B N   1 
ATOM   4639  C CA  . ASP B  1 186 ? 3.961   -14.718  104.961 1.00 28.34 ? 192  ASP B CA  1 
ATOM   4640  C C   . ASP B  1 186 ? 4.351   -15.893  104.084 1.00 28.11 ? 192  ASP B C   1 
ATOM   4641  O O   . ASP B  1 186 ? 5.272   -16.636  104.410 1.00 27.89 ? 192  ASP B O   1 
ATOM   4642  C CB  . ASP B  1 186 ? 5.190   -14.094  105.627 1.00 36.71 ? 192  ASP B CB  1 
ATOM   4643  C CG  . ASP B  1 186 ? 6.103   -13.388  104.632 1.00 41.28 ? 192  ASP B CG  1 
ATOM   4644  O OD1 . ASP B  1 186 ? 5.591   -12.819  103.641 1.00 38.45 ? 192  ASP B OD1 1 
ATOM   4645  O OD2 . ASP B  1 186 ? 7.336   -13.396  104.844 1.00 46.59 ? 192  ASP B OD2 1 
ATOM   4646  N N   . PRO B  1 187 ? 3.629   -16.076  102.972 1.00 30.29 ? 193  PRO B N   1 
ATOM   4647  C CA  . PRO B  1 187 ? 3.799   -17.240  102.098 1.00 29.28 ? 193  PRO B CA  1 
ATOM   4648  C C   . PRO B  1 187 ? 5.222   -17.438  101.581 1.00 28.39 ? 193  PRO B C   1 
ATOM   4649  O O   . PRO B  1 187 ? 5.867   -16.486  101.131 1.00 27.26 ? 193  PRO B O   1 
ATOM   4650  C CB  . PRO B  1 187 ? 2.844   -16.943  100.940 1.00 30.99 ? 193  PRO B CB  1 
ATOM   4651  C CG  . PRO B  1 187 ? 1.792   -16.079  101.543 1.00 32.95 ? 193  PRO B CG  1 
ATOM   4652  C CD  . PRO B  1 187 ? 2.519   -15.214  102.533 1.00 31.74 ? 193  PRO B CD  1 
ATOM   4653  N N   . PRO B  1 188 ? 5.716   -18.683  101.654 1.00 30.30 ? 194  PRO B N   1 
ATOM   4654  C CA  . PRO B  1 188 ? 6.961   -19.053  100.974 1.00 29.84 ? 194  PRO B CA  1 
ATOM   4655  C C   . PRO B  1 188 ? 6.873   -18.781  99.478  1.00 30.08 ? 194  PRO B C   1 
ATOM   4656  O O   . PRO B  1 188 ? 5.787   -18.831  98.903  1.00 36.76 ? 194  PRO B O   1 
ATOM   4657  C CB  . PRO B  1 188 ? 7.094   -20.552  101.265 1.00 27.55 ? 194  PRO B CB  1 
ATOM   4658  C CG  . PRO B  1 188 ? 5.733   -20.990  101.757 1.00 28.39 ? 194  PRO B CG  1 
ATOM   4659  C CD  . PRO B  1 188 ? 5.158   -19.799  102.436 1.00 30.90 ? 194  PRO B CD  1 
ATOM   4660  N N   . GLY B  1 189 ? 8.003   -18.483  98.855  1.00 28.93 ? 195  GLY B N   1 
ATOM   4661  C CA  . GLY B  1 189 ? 8.004   -18.109  97.457  1.00 24.98 ? 195  GLY B CA  1 
ATOM   4662  C C   . GLY B  1 189 ? 8.594   -19.157  96.530  1.00 26.36 ? 195  GLY B C   1 
ATOM   4663  O O   . GLY B  1 189 ? 9.208   -20.127  96.975  1.00 30.69 ? 195  GLY B O   1 
ATOM   4664  N N   . ILE B  1 190 ? 8.397   -18.941  95.233  1.00 24.55 ? 196  ILE B N   1 
ATOM   4665  C CA  . ILE B  1 190 ? 8.953   -19.772  94.171  1.00 31.36 ? 196  ILE B CA  1 
ATOM   4666  C C   . ILE B  1 190 ? 10.421  -19.449  93.906  1.00 38.92 ? 196  ILE B C   1 
ATOM   4667  O O   . ILE B  1 190 ? 10.757  -18.312  93.588  1.00 40.71 ? 196  ILE B O   1 
ATOM   4668  C CB  . ILE B  1 190 ? 8.167   -19.585  92.860  1.00 28.92 ? 196  ILE B CB  1 
ATOM   4669  C CG1 . ILE B  1 190 ? 6.723   -20.049  93.040  1.00 28.50 ? 196  ILE B CG1 1 
ATOM   4670  C CG2 . ILE B  1 190 ? 8.832   -20.319  91.696  1.00 25.57 ? 196  ILE B CG2 1 
ATOM   4671  C CD1 . ILE B  1 190 ? 5.813   -19.539  91.967  1.00 27.65 ? 196  ILE B CD1 1 
ATOM   4672  N N   . PRO B  1 191 ? 11.304  -20.454  94.048  1.00 39.88 ? 197  PRO B N   1 
ATOM   4673  C CA  . PRO B  1 191 ? 12.715  -20.349  93.649  1.00 40.02 ? 197  PRO B CA  1 
ATOM   4674  C C   . PRO B  1 191 ? 12.893  -19.777  92.244  1.00 43.69 ? 197  PRO B C   1 
ATOM   4675  O O   . PRO B  1 191 ? 12.280  -20.281  91.310  1.00 45.05 ? 197  PRO B O   1 
ATOM   4676  C CB  . PRO B  1 191 ? 13.197  -21.803  93.705  1.00 42.73 ? 197  PRO B CB  1 
ATOM   4677  C CG  . PRO B  1 191 ? 12.346  -22.431  94.762  1.00 43.75 ? 197  PRO B CG  1 
ATOM   4678  C CD  . PRO B  1 191 ? 11.007  -21.750  94.687  1.00 39.85 ? 197  PRO B CD  1 
ATOM   4679  N N   . GLY B  1 192 ? 13.719  -18.745  92.098  1.00 48.46 ? 198  GLY B N   1 
ATOM   4680  C CA  . GLY B  1 192 ? 13.965  -18.151  90.792  1.00 53.66 ? 198  GLY B CA  1 
ATOM   4681  C C   . GLY B  1 192 ? 13.236  -16.834  90.643  1.00 58.24 ? 198  GLY B C   1 
ATOM   4682  O O   . GLY B  1 192 ? 13.834  -15.805  90.343  1.00 61.06 ? 198  GLY B O   1 
ATOM   4683  N N   . ASN B  1 193 ? 11.931  -16.868  90.854  1.00 58.84 ? 199  ASN B N   1 
ATOM   4684  C CA  . ASN B  1 193 ? 11.202  -15.633  90.988  1.00 58.44 ? 199  ASN B CA  1 
ATOM   4685  C C   . ASN B  1 193 ? 10.480  -15.661  92.315  1.00 54.01 ? 199  ASN B C   1 
ATOM   4686  O O   . ASN B  1 193 ? 9.400   -16.240  92.442  1.00 53.10 ? 199  ASN B O   1 
ATOM   4687  C CB  . ASN B  1 193 ? 10.241  -15.436  89.818  1.00 61.80 ? 199  ASN B CB  1 
ATOM   4688  C CG  . ASN B  1 193 ? 9.271   -14.288  90.027  1.00 63.95 ? 199  ASN B CG  1 
ATOM   4689  O OD1 . ASN B  1 193 ? 8.468   -14.288  90.948  1.00 62.05 ? 199  ASN B OD1 1 
ATOM   4690  N ND2 . ASN B  1 193 ? 9.376   -13.273  89.171  1.00 66.24 ? 199  ASN B ND2 1 
ATOM   4691  N N   . GLU B  1 194 ? 11.123  -15.064  93.311  1.00 49.67 ? 200  GLU B N   1 
ATOM   4692  C CA  . GLU B  1 194 ? 10.497  -14.754  94.584  1.00 42.94 ? 200  GLU B CA  1 
ATOM   4693  C C   . GLU B  1 194 ? 9.508   -13.646  94.255  1.00 42.46 ? 200  GLU B C   1 
ATOM   4694  O O   . GLU B  1 194 ? 9.613   -13.017  93.200  1.00 46.60 ? 200  GLU B O   1 
ATOM   4695  C CB  . GLU B  1 194 ? 11.560  -14.331  95.626  1.00 45.14 ? 200  GLU B CB  1 
ATOM   4696  C CG  . GLU B  1 194 ? 11.238  -14.508  97.125  1.00 43.04 ? 200  GLU B CG  1 
ATOM   4697  C CD  . GLU B  1 194 ? 11.607  -15.880  97.665  1.00 40.97 ? 200  GLU B CD  1 
ATOM   4698  O OE1 . GLU B  1 194 ? 12.403  -16.576  97.010  1.00 37.04 ? 200  GLU B OE1 1 
ATOM   4699  O OE2 . GLU B  1 194 ? 11.101  -16.276  98.740  1.00 43.98 ? 200  GLU B OE2 1 
ATOM   4700  N N   . GLY B  1 195 ? 8.533   -13.404  95.114  1.00 34.68 ? 201  GLY B N   1 
ATOM   4701  C CA  . GLY B  1 195 ? 7.502   -12.449  94.755  1.00 33.45 ? 201  GLY B CA  1 
ATOM   4702  C C   . GLY B  1 195 ? 6.198   -13.139  94.406  1.00 34.29 ? 201  GLY B C   1 
ATOM   4703  O O   . GLY B  1 195 ? 5.134   -12.524  94.447  1.00 35.33 ? 201  GLY B O   1 
ATOM   4704  N N   . PHE B  1 196 ? 6.276   -14.425  94.077  1.00 29.98 ? 202  PHE B N   1 
ATOM   4705  C CA  . PHE B  1 196 ? 5.080   -15.210  93.817  1.00 25.43 ? 202  PHE B CA  1 
ATOM   4706  C C   . PHE B  1 196 ? 5.032   -16.448  94.688  1.00 25.65 ? 202  PHE B C   1 
ATOM   4707  O O   . PHE B  1 196 ? 6.036   -16.858  95.256  1.00 30.12 ? 202  PHE B O   1 
ATOM   4708  C CB  . PHE B  1 196 ? 5.008   -15.593  92.348  1.00 25.40 ? 202  PHE B CB  1 
ATOM   4709  C CG  . PHE B  1 196 ? 4.642   -14.450  91.450  1.00 33.51 ? 202  PHE B CG  1 
ATOM   4710  C CD1 . PHE B  1 196 ? 3.316   -14.179  91.161  1.00 31.90 ? 202  PHE B CD1 1 
ATOM   4711  C CD2 . PHE B  1 196 ? 5.620   -13.632  90.913  1.00 38.73 ? 202  PHE B CD2 1 
ATOM   4712  C CE1 . PHE B  1 196 ? 2.973   -13.128  90.340  1.00 33.12 ? 202  PHE B CE1 1 
ATOM   4713  C CE2 . PHE B  1 196 ? 5.282   -12.576  90.092  1.00 39.11 ? 202  PHE B CE2 1 
ATOM   4714  C CZ  . PHE B  1 196 ? 3.957   -12.325  89.806  1.00 36.60 ? 202  PHE B CZ  1 
ATOM   4715  N N   . ALA B  1 197 ? 3.849   -17.034  94.801  1.00 23.32 ? 203  ALA B N   1 
ATOM   4716  C CA  . ALA B  1 197 ? 3.680   -18.265  95.547  1.00 24.27 ? 203  ALA B CA  1 
ATOM   4717  C C   . ALA B  1 197 ? 2.806   -19.230  94.745  1.00 24.10 ? 203  ALA B C   1 
ATOM   4718  O O   . ALA B  1 197 ? 2.112   -18.829  93.812  1.00 22.73 ? 203  ALA B O   1 
ATOM   4719  C CB  . ALA B  1 197 ? 3.074   -17.988  96.912  1.00 24.01 ? 203  ALA B CB  1 
ATOM   4720  N N   . LEU B  1 198 ? 2.870   -20.507  95.093  1.00 23.70 ? 204  LEU B N   1 
ATOM   4721  C CA  . LEU B  1 198 ? 2.042   -21.505  94.439  1.00 18.39 ? 204  LEU B CA  1 
ATOM   4722  C C   . LEU B  1 198 ? 0.891   -21.872  95.353  1.00 20.44 ? 204  LEU B C   1 
ATOM   4723  O O   . LEU B  1 198 ? 1.088   -22.524  96.382  1.00 26.27 ? 204  LEU B O   1 
ATOM   4724  C CB  . LEU B  1 198 ? 2.861   -22.742  94.074  1.00 19.73 ? 204  LEU B CB  1 
ATOM   4725  C CG  . LEU B  1 198 ? 3.775   -22.637  92.849  1.00 19.09 ? 204  LEU B CG  1 
ATOM   4726  C CD1 . LEU B  1 198 ? 4.285   -24.000  92.489  1.00 22.92 ? 204  LEU B CD1 1 
ATOM   4727  C CD2 . LEU B  1 198 ? 3.056   -22.046  91.660  1.00 20.01 ? 204  LEU B CD2 1 
ATOM   4728  N N   . ALA B  1 199 ? -0.309  -21.440  94.971  1.00 16.49 ? 205  ALA B N   1 
ATOM   4729  C CA  . ALA B  1 199 ? -1.512  -21.653  95.768  1.00 15.28 ? 205  ALA B CA  1 
ATOM   4730  C C   . ALA B  1 199 ? -2.348  -22.818  95.216  1.00 16.35 ? 205  ALA B C   1 
ATOM   4731  O O   . ALA B  1 199 ? -2.638  -22.875  94.025  1.00 14.03 ? 205  ALA B O   1 
ATOM   4732  C CB  . ALA B  1 199 ? -2.337  -20.388  95.813  1.00 15.26 ? 205  ALA B CB  1 
ATOM   4733  N N   . SER B  1 200 ? -2.729  -23.737  96.098  1.00 18.22 ? 206  SER B N   1 
ATOM   4734  C CA  . SER B  1 200 ? -3.396  -24.975  95.702  1.00 17.52 ? 206  SER B CA  1 
ATOM   4735  C C   . SER B  1 200 ? -4.783  -24.706  95.144  1.00 16.92 ? 206  SER B C   1 
ATOM   4736  O O   . SER B  1 200 ? -5.557  -23.935  95.718  1.00 19.30 ? 206  SER B O   1 
ATOM   4737  C CB  . SER B  1 200 ? -3.479  -25.935  96.895  1.00 18.32 ? 206  SER B CB  1 
ATOM   4738  O OG  . SER B  1 200 ? -4.085  -27.170  96.544  1.00 18.38 ? 206  SER B OG  1 
ATOM   4739  N N   . MET B  1 201 ? -5.098  -25.349  94.025  1.00 14.99 ? 207  MET B N   1 
ATOM   4740  C CA  . MET B  1 201 ? -6.413  -25.210  93.412  1.00 13.59 ? 207  MET B CA  1 
ATOM   4741  C C   . MET B  1 201 ? -7.395  -26.254  93.926  1.00 15.72 ? 207  MET B C   1 
ATOM   4742  O O   . MET B  1 201 ? -8.583  -26.193  93.635  1.00 21.87 ? 207  MET B O   1 
ATOM   4743  C CB  . MET B  1 201 ? -6.307  -25.320  91.894  1.00 19.40 ? 207  MET B CB  1 
ATOM   4744  C CG  . MET B  1 201 ? -5.321  -24.365  91.260  1.00 19.88 ? 207  MET B CG  1 
ATOM   4745  S SD  . MET B  1 201 ? -5.168  -24.685  89.499  1.00 20.38 ? 207  MET B SD  1 
ATOM   4746  C CE  . MET B  1 201 ? -6.827  -24.281  88.971  1.00 11.15 ? 207  MET B CE  1 
ATOM   4747  N N   . GLY B  1 202 ? -6.896  -27.223  94.681  1.00 20.57 ? 208  GLY B N   1 
ATOM   4748  C CA  . GLY B  1 202 ? -7.720  -28.345  95.102  1.00 21.99 ? 208  GLY B CA  1 
ATOM   4749  C C   . GLY B  1 202 ? -7.980  -29.293  93.942  1.00 19.39 ? 208  GLY B C   1 
ATOM   4750  O O   . GLY B  1 202 ? -9.054  -29.873  93.825  1.00 20.29 ? 208  GLY B O   1 
ATOM   4751  N N   . ILE B  1 203 ? -6.982  -29.417  93.074  1.00 16.72 ? 209  ILE B N   1 
ATOM   4752  C CA  . ILE B  1 203 ? -6.986  -30.348  91.950  1.00 13.17 ? 209  ILE B CA  1 
ATOM   4753  C C   . ILE B  1 203 ? -5.860  -31.352  92.133  1.00 19.16 ? 209  ILE B C   1 
ATOM   4754  O O   . ILE B  1 203 ? -4.702  -30.956  92.193  1.00 20.55 ? 209  ILE B O   1 
ATOM   4755  C CB  . ILE B  1 203 ? -6.779  -29.626  90.610  1.00 13.88 ? 209  ILE B CB  1 
ATOM   4756  C CG1 . ILE B  1 203 ? -7.887  -28.606  90.356  1.00 11.99 ? 209  ILE B CG1 1 
ATOM   4757  C CG2 . ILE B  1 203 ? -6.664  -30.624  89.476  1.00 16.29 ? 209  ILE B CG2 1 
ATOM   4758  C CD1 . ILE B  1 203 ? -7.628  -27.766  89.139  1.00 14.69 ? 209  ILE B CD1 1 
ATOM   4759  N N   . TYR B  1 204 ? -6.182  -32.642  92.213  1.00 19.77 ? 210  TYR B N   1 
ATOM   4760  C CA  . TYR B  1 204 ? -5.166  -33.664  92.473  1.00 16.40 ? 210  TYR B CA  1 
ATOM   4761  C C   . TYR B  1 204 ? -5.274  -34.820  91.495  1.00 19.90 ? 210  TYR B C   1 
ATOM   4762  O O   . TYR B  1 204 ? -6.344  -35.390  91.347  1.00 19.81 ? 210  TYR B O   1 
ATOM   4763  C CB  . TYR B  1 204 ? -5.290  -34.217  93.897  1.00 17.97 ? 210  TYR B CB  1 
ATOM   4764  C CG  . TYR B  1 204 ? -5.616  -33.202  94.958  1.00 19.87 ? 210  TYR B CG  1 
ATOM   4765  C CD1 . TYR B  1 204 ? -4.688  -32.256  95.345  1.00 19.90 ? 210  TYR B CD1 1 
ATOM   4766  C CD2 . TYR B  1 204 ? -6.845  -33.207  95.589  1.00 18.89 ? 210  TYR B CD2 1 
ATOM   4767  C CE1 . TYR B  1 204 ? -4.977  -31.334  96.327  1.00 22.18 ? 210  TYR B CE1 1 
ATOM   4768  C CE2 . TYR B  1 204 ? -7.144  -32.292  96.567  1.00 22.94 ? 210  TYR B CE2 1 
ATOM   4769  C CZ  . TYR B  1 204 ? -6.204  -31.356  96.934  1.00 23.50 ? 210  TYR B CZ  1 
ATOM   4770  O OH  . TYR B  1 204 ? -6.492  -30.434  97.909  1.00 21.93 ? 210  TYR B OH  1 
ATOM   4771  N N   . VAL B  1 205 ? -4.168  -35.172  90.846  1.00 19.58 ? 211  VAL B N   1 
ATOM   4772  C CA  . VAL B  1 205 ? -4.128  -36.297  89.916  1.00 15.09 ? 211  VAL B CA  1 
ATOM   4773  C C   . VAL B  1 205 ? -3.376  -37.459  90.541  1.00 18.57 ? 211  VAL B C   1 
ATOM   4774  O O   . VAL B  1 205 ? -2.260  -37.281  91.014  1.00 19.80 ? 211  VAL B O   1 
ATOM   4775  C CB  . VAL B  1 205 ? -3.452  -35.913  88.584  1.00 15.14 ? 211  VAL B CB  1 
ATOM   4776  C CG1 . VAL B  1 205 ? -3.259  -37.138  87.715  1.00 18.62 ? 211  VAL B CG1 1 
ATOM   4777  C CG2 . VAL B  1 205 ? -4.269  -34.852  87.856  1.00 19.35 ? 211  VAL B CG2 1 
ATOM   4778  N N   . PHE B  1 206 ? -4.006  -38.629  90.587  1.00 19.27 ? 212  PHE B N   1 
ATOM   4779  C CA  . PHE B  1 206 ? -3.395  -39.836  91.133  1.00 15.76 ? 212  PHE B CA  1 
ATOM   4780  C C   . PHE B  1 206 ? -3.331  -40.940  90.076  1.00 21.44 ? 212  PHE B C   1 
ATOM   4781  O O   . PHE B  1 206 ? -4.081  -40.901  89.097  1.00 20.77 ? 212  PHE B O   1 
ATOM   4782  C CB  . PHE B  1 206 ? -4.197  -40.383  92.318  1.00 16.22 ? 212  PHE B CB  1 
ATOM   4783  C CG  . PHE B  1 206 ? -4.302  -39.455  93.491  1.00 17.43 ? 212  PHE B CG  1 
ATOM   4784  C CD1 . PHE B  1 206 ? -5.362  -38.568  93.595  1.00 16.75 ? 212  PHE B CD1 1 
ATOM   4785  C CD2 . PHE B  1 206 ? -3.371  -39.508  94.520  1.00 20.64 ? 212  PHE B CD2 1 
ATOM   4786  C CE1 . PHE B  1 206 ? -5.477  -37.733  94.685  1.00 16.10 ? 212  PHE B CE1 1 
ATOM   4787  C CE2 . PHE B  1 206 ? -3.479  -38.675  95.618  1.00 20.57 ? 212  PHE B CE2 1 
ATOM   4788  C CZ  . PHE B  1 206 ? -4.529  -37.784  95.700  1.00 19.89 ? 212  PHE B CZ  1 
ATOM   4789  N N   . HIS B  1 207 ? -2.457  -41.926  90.288  1.00 20.35 ? 213  HIS B N   1 
ATOM   4790  C CA  . HIS B  1 207 ? -2.706  -43.267  89.760  1.00 19.92 ? 213  HIS B CA  1 
ATOM   4791  C C   . HIS B  1 207 ? -3.780  -43.874  90.649  1.00 17.51 ? 213  HIS B C   1 
ATOM   4792  O O   . HIS B  1 207 ? -3.666  -43.827  91.865  1.00 21.77 ? 213  HIS B O   1 
ATOM   4793  C CB  . HIS B  1 207 ? -1.450  -44.142  89.761  1.00 23.82 ? 213  HIS B CB  1 
ATOM   4794  C CG  . HIS B  1 207 ? -0.531  -43.882  88.609  1.00 26.93 ? 213  HIS B CG  1 
ATOM   4795  N ND1 . HIS B  1 207 ? 0.709   -43.300  88.763  1.00 26.73 ? 213  HIS B ND1 1 
ATOM   4796  C CD2 . HIS B  1 207 ? -0.676  -44.113  87.282  1.00 26.49 ? 213  HIS B CD2 1 
ATOM   4797  C CE1 . HIS B  1 207 ? 1.290   -43.188  87.582  1.00 25.70 ? 213  HIS B CE1 1 
ATOM   4798  N NE2 . HIS B  1 207 ? 0.471   -43.674  86.666  1.00 25.93 ? 213  HIS B NE2 1 
ATOM   4799  N N   . THR B  1 208 ? -4.823  -44.430  90.042  1.00 22.41 ? 214  THR B N   1 
ATOM   4800  C CA  . THR B  1 208 ? -5.999  -44.880  90.782  1.00 20.19 ? 214  THR B CA  1 
ATOM   4801  C C   . THR B  1 208 ? -5.679  -45.865  91.905  1.00 20.35 ? 214  THR B C   1 
ATOM   4802  O O   . THR B  1 208 ? -6.188  -45.737  93.013  1.00 19.55 ? 214  THR B O   1 
ATOM   4803  C CB  . THR B  1 208 ? -7.009  -45.522  89.836  1.00 17.25 ? 214  THR B CB  1 
ATOM   4804  O OG1 . THR B  1 208 ? -7.414  -44.558  88.855  1.00 18.69 ? 214  THR B OG1 1 
ATOM   4805  C CG2 . THR B  1 208 ? -8.222  -46.018  90.596  1.00 19.25 ? 214  THR B CG2 1 
ATOM   4806  N N   . LYS B  1 209 ? -4.829  -46.842  91.622  1.00 23.32 ? 215  LYS B N   1 
ATOM   4807  C CA  . LYS B  1 209 ? -4.475  -47.839  92.625  1.00 23.69 ? 215  LYS B CA  1 
ATOM   4808  C C   . LYS B  1 209 ? -3.806  -47.183  93.830  1.00 24.88 ? 215  LYS B C   1 
ATOM   4809  O O   . LYS B  1 209 ? -4.128  -47.497  94.977  1.00 28.83 ? 215  LYS B O   1 
ATOM   4810  C CB  . LYS B  1 209 ? -3.563  -48.914  92.021  1.00 20.08 ? 215  LYS B CB  1 
ATOM   4811  C CG  . LYS B  1 209 ? -3.004  -49.891  93.055  1.00 28.87 ? 215  LYS B CG  1 
ATOM   4812  C CD  . LYS B  1 209 ? -2.098  -50.944  92.428  1.00 31.15 ? 215  LYS B CD  1 
ATOM   4813  C CE  . LYS B  1 209 ? -1.267  -51.665  93.488  1.00 34.63 ? 215  LYS B CE  1 
ATOM   4814  N NZ  . LYS B  1 209 ? -2.103  -52.306  94.546  1.00 38.71 ? 215  LYS B NZ  1 
ATOM   4815  N N   . PHE B  1 210 ? -2.872  -46.277  93.559  1.00 22.76 ? 216  PHE B N   1 
ATOM   4816  C CA  . PHE B  1 210 ? -2.211  -45.504  94.604  1.00 24.05 ? 216  PHE B CA  1 
ATOM   4817  C C   . PHE B  1 210 ? -3.238  -44.776  95.461  1.00 30.12 ? 216  PHE B C   1 
ATOM   4818  O O   . PHE B  1 210 ? -3.142  -44.765  96.692  1.00 31.89 ? 216  PHE B O   1 
ATOM   4819  C CB  . PHE B  1 210 ? -1.237  -44.493  93.996  1.00 20.98 ? 216  PHE B CB  1 
ATOM   4820  C CG  . PHE B  1 210 ? -0.471  -43.702  95.016  1.00 22.70 ? 216  PHE B CG  1 
ATOM   4821  C CD1 . PHE B  1 210 ? 0.694   -44.205  95.564  1.00 21.74 ? 216  PHE B CD1 1 
ATOM   4822  C CD2 . PHE B  1 210 ? -0.917  -42.455  95.428  1.00 22.74 ? 216  PHE B CD2 1 
ATOM   4823  C CE1 . PHE B  1 210 ? 1.397   -43.482  96.504  1.00 25.16 ? 216  PHE B CE1 1 
ATOM   4824  C CE2 . PHE B  1 210 ? -0.220  -41.729  96.369  1.00 25.73 ? 216  PHE B CE2 1 
ATOM   4825  C CZ  . PHE B  1 210 ? 0.936   -42.240  96.909  1.00 26.57 ? 216  PHE B CZ  1 
ATOM   4826  N N   . LEU B  1 211 ? -4.222  -44.172  94.801  1.00 28.47 ? 217  LEU B N   1 
ATOM   4827  C CA  . LEU B  1 211 ? -5.214  -43.371  95.499  1.00 26.12 ? 217  LEU B CA  1 
ATOM   4828  C C   . LEU B  1 211 ? -6.079  -44.222  96.421  1.00 27.32 ? 217  LEU B C   1 
ATOM   4829  O O   . LEU B  1 211 ? -6.395  -43.809  97.531  1.00 25.57 ? 217  LEU B O   1 
ATOM   4830  C CB  . LEU B  1 211 ? -6.088  -42.618  94.500  1.00 21.26 ? 217  LEU B CB  1 
ATOM   4831  C CG  . LEU B  1 211 ? -7.124  -41.701  95.153  1.00 25.03 ? 217  LEU B CG  1 
ATOM   4832  C CD1 . LEU B  1 211 ? -6.466  -40.741  96.152  1.00 22.57 ? 217  LEU B CD1 1 
ATOM   4833  C CD2 . LEU B  1 211 ? -7.917  -40.932  94.104  1.00 25.75 ? 217  LEU B CD2 1 
ATOM   4834  N N   . MET B  1 212 ? -6.461  -45.407  95.953  1.00 28.08 ? 218  MET B N   1 
ATOM   4835  C CA  . MET B  1 212 ? -7.311  -46.303  96.730  1.00 28.92 ? 218  MET B CA  1 
ATOM   4836  C C   . MET B  1 212 ? -6.643  -46.684  98.044  1.00 29.32 ? 218  MET B C   1 
ATOM   4837  O O   . MET B  1 212 ? -7.292  -46.745  99.090  1.00 29.51 ? 218  MET B O   1 
ATOM   4838  C CB  . MET B  1 212 ? -7.638  -47.563  95.925  1.00 31.11 ? 218  MET B CB  1 
ATOM   4839  C CG  . MET B  1 212 ? -8.403  -47.318  94.626  1.00 33.67 ? 218  MET B CG  1 
ATOM   4840  S SD  . MET B  1 212 ? -10.042 -46.591  94.837  1.00 43.27 ? 218  MET B SD  1 
ATOM   4841  C CE  . MET B  1 212 ? -9.720  -44.848  94.518  1.00 27.77 ? 218  MET B CE  1 
ATOM   4842  N N   . GLU B  1 213 ? -5.340  -46.936  97.986  1.00 30.21 ? 219  GLU B N   1 
ATOM   4843  C CA  . GLU B  1 213 ? -4.597  -47.323  99.179  1.00 31.55 ? 219  GLU B CA  1 
ATOM   4844  C C   . GLU B  1 213 ? -4.571  -46.174  100.171 1.00 32.05 ? 219  GLU B C   1 
ATOM   4845  O O   . GLU B  1 213 ? -4.753  -46.385  101.369 1.00 36.42 ? 219  GLU B O   1 
ATOM   4846  C CB  . GLU B  1 213 ? -3.175  -47.761  98.819  1.00 38.08 ? 219  GLU B CB  1 
ATOM   4847  C CG  . GLU B  1 213 ? -2.646  -48.895  99.692  1.00 49.01 ? 219  GLU B CG  1 
ATOM   4848  C CD  . GLU B  1 213 ? -1.614  -49.760  98.981  1.00 59.65 ? 219  GLU B CD  1 
ATOM   4849  O OE1 . GLU B  1 213 ? -1.295  -49.471  97.804  1.00 60.58 ? 219  GLU B OE1 1 
ATOM   4850  O OE2 . GLU B  1 213 ? -1.122  -50.731  99.600  1.00 64.99 ? 219  GLU B OE2 1 
ATOM   4851  N N   . ALA B  1 214 ? -4.370  -44.959  99.671  1.00 29.00 ? 220  ALA B N   1 
ATOM   4852  C CA  . ALA B  1 214 ? -4.334  -43.781  100.535 1.00 28.46 ? 220  ALA B CA  1 
ATOM   4853  C C   . ALA B  1 214 ? -5.623  -43.649  101.336 1.00 28.23 ? 220  ALA B C   1 
ATOM   4854  O O   . ALA B  1 214 ? -5.605  -43.591  102.564 1.00 28.64 ? 220  ALA B O   1 
ATOM   4855  C CB  . ALA B  1 214 ? -4.094  -42.529  99.716  1.00 24.42 ? 220  ALA B CB  1 
ATOM   4856  N N   . LEU B  1 215 ? -6.747  -43.622  100.635 1.00 23.45 ? 221  LEU B N   1 
ATOM   4857  C CA  . LEU B  1 215 ? -8.024  -43.394  101.284 1.00 20.01 ? 221  LEU B CA  1 
ATOM   4858  C C   . LEU B  1 215 ? -8.413  -44.525  102.230 1.00 22.07 ? 221  LEU B C   1 
ATOM   4859  O O   . LEU B  1 215 ? -9.144  -44.300  103.190 1.00 24.39 ? 221  LEU B O   1 
ATOM   4860  C CB  . LEU B  1 215 ? -9.081  -43.177  100.217 1.00 24.55 ? 221  LEU B CB  1 
ATOM   4861  C CG  . LEU B  1 215 ? -8.466  -42.141  99.283  1.00 28.63 ? 221  LEU B CG  1 
ATOM   4862  C CD1 . LEU B  1 215 ? -9.164  -42.149  97.976  1.00 40.64 ? 221  LEU B CD1 1 
ATOM   4863  C CD2 . LEU B  1 215 ? -8.534  -40.770  99.887  1.00 32.11 ? 221  LEU B CD2 1 
ATOM   4864  N N   . ARG B  1 216 ? -7.916  -45.734  101.973 1.00 23.93 ? 222  ARG B N   1 
ATOM   4865  C CA  . ARG B  1 216 ? -8.087  -46.834  102.919 1.00 25.13 ? 222  ARG B CA  1 
ATOM   4866  C C   . ARG B  1 216 ? -7.248  -46.572  104.172 1.00 25.11 ? 222  ARG B C   1 
ATOM   4867  O O   . ARG B  1 216 ? -7.706  -46.780  105.296 1.00 22.79 ? 222  ARG B O   1 
ATOM   4868  C CB  . ARG B  1 216 ? -7.690  -48.173  102.296 1.00 23.23 ? 222  ARG B CB  1 
ATOM   4869  C CG  . ARG B  1 216 ? -8.577  -48.638  101.159 1.00 27.41 ? 222  ARG B CG  1 
ATOM   4870  C CD  . ARG B  1 216 ? -7.953  -49.837  100.442 1.00 35.80 ? 222  ARG B CD  1 
ATOM   4871  N NE  . ARG B  1 216 ? -8.637  -50.164  99.193  1.00 42.13 ? 222  ARG B NE  1 
ATOM   4872  C CZ  . ARG B  1 216 ? -9.725  -50.922  99.118  1.00 40.21 ? 222  ARG B CZ  1 
ATOM   4873  N NH1 . ARG B  1 216 ? -10.253 -51.429  100.224 1.00 47.61 ? 222  ARG B NH1 1 
ATOM   4874  N NH2 . ARG B  1 216 ? -10.288 -51.170  97.946  1.00 31.35 ? 222  ARG B NH2 1 
ATOM   4875  N N   . ARG B  1 217 ? -6.017  -46.115  103.953 1.00 23.53 ? 223  ARG B N   1 
ATOM   4876  C CA  . ARG B  1 217 ? -5.092  -45.769  105.025 1.00 23.64 ? 223  ARG B CA  1 
ATOM   4877  C C   . ARG B  1 217 ? -5.630  -44.609  105.844 1.00 29.74 ? 223  ARG B C   1 
ATOM   4878  O O   . ARG B  1 217 ? -5.528  -44.593  107.073 1.00 33.10 ? 223  ARG B O   1 
ATOM   4879  C CB  . ARG B  1 217 ? -3.721  -45.409  104.447 1.00 29.91 ? 223  ARG B CB  1 
ATOM   4880  C CG  . ARG B  1 217 ? -2.670  -45.014  105.480 1.00 38.76 ? 223  ARG B CG  1 
ATOM   4881  C CD  . ARG B  1 217 ? -1.446  -44.390  104.811 1.00 45.09 ? 223  ARG B CD  1 
ATOM   4882  N NE  . ARG B  1 217 ? -1.043  -45.104  103.600 1.00 53.27 ? 223  ARG B NE  1 
ATOM   4883  C CZ  . ARG B  1 217 ? -0.467  -44.525  102.552 1.00 58.37 ? 223  ARG B CZ  1 
ATOM   4884  N NH1 . ARG B  1 217 ? -0.238  -43.220  102.561 1.00 61.45 ? 223  ARG B NH1 1 
ATOM   4885  N NH2 . ARG B  1 217 ? -0.131  -45.244  101.489 1.00 59.19 ? 223  ARG B NH2 1 
ATOM   4886  N N   . ASP B  1 218 ? -6.204  -43.633  105.154 1.00 28.46 ? 224  ASP B N   1 
ATOM   4887  C CA  . ASP B  1 218 ? -6.802  -42.485  105.817 1.00 25.40 ? 224  ASP B CA  1 
ATOM   4888  C C   . ASP B  1 218 ? -8.025  -42.901  106.623 1.00 25.92 ? 224  ASP B C   1 
ATOM   4889  O O   . ASP B  1 218 ? -8.275  -42.388  107.711 1.00 29.31 ? 224  ASP B O   1 
ATOM   4890  C CB  . ASP B  1 218 ? -7.177  -41.423  104.790 1.00 23.64 ? 224  ASP B CB  1 
ATOM   4891  C CG  . ASP B  1 218 ? -7.853  -40.225  105.412 1.00 29.66 ? 224  ASP B CG  1 
ATOM   4892  O OD1 . ASP B  1 218 ? -7.138  -39.354  105.951 1.00 31.26 ? 224  ASP B OD1 1 
ATOM   4893  O OD2 . ASP B  1 218 ? -9.099  -40.147  105.349 1.00 32.81 ? 224  ASP B OD2 1 
ATOM   4894  N N   . ALA B  1 219 ? -8.790  -43.834  106.074 1.00 28.80 ? 225  ALA B N   1 
ATOM   4895  C CA  . ALA B  1 219 ? -9.972  -44.328  106.752 1.00 27.72 ? 225  ALA B CA  1 
ATOM   4896  C C   . ALA B  1 219 ? -9.598  -45.055  108.033 1.00 34.89 ? 225  ALA B C   1 
ATOM   4897  O O   . ALA B  1 219 ? -10.328 -44.997  109.018 1.00 39.32 ? 225  ALA B O   1 
ATOM   4898  C CB  . ALA B  1 219 ? -10.763 -45.243  105.839 1.00 25.53 ? 225  ALA B CB  1 
ATOM   4899  N N   . ALA B  1 220 ? -8.455  -45.733  108.018 1.00 33.56 ? 226  ALA B N   1 
ATOM   4900  C CA  . ALA B  1 220 ? -8.026  -46.541  109.155 1.00 30.22 ? 226  ALA B CA  1 
ATOM   4901  C C   . ALA B  1 220 ? -7.292  -45.722  110.227 1.00 33.39 ? 226  ALA B C   1 
ATOM   4902  O O   . ALA B  1 220 ? -6.963  -46.239  111.298 1.00 31.57 ? 226  ALA B O   1 
ATOM   4903  C CB  . ALA B  1 220 ? -7.153  -47.677  108.669 1.00 24.19 ? 226  ALA B CB  1 
ATOM   4904  N N   . ASP B  1 221 ? -7.043  -44.449  109.933 1.00 35.00 ? 227  ASP B N   1 
ATOM   4905  C CA  . ASP B  1 221 ? -6.398  -43.536  110.875 1.00 35.72 ? 227  ASP B CA  1 
ATOM   4906  C C   . ASP B  1 221 ? -7.424  -42.797  111.721 1.00 35.89 ? 227  ASP B C   1 
ATOM   4907  O O   . ASP B  1 221 ? -8.147  -41.943  111.215 1.00 39.49 ? 227  ASP B O   1 
ATOM   4908  C CB  . ASP B  1 221 ? -5.520  -42.530  110.132 1.00 37.78 ? 227  ASP B CB  1 
ATOM   4909  C CG  . ASP B  1 221 ? -5.034  -41.401  111.023 1.00 41.61 ? 227  ASP B CG  1 
ATOM   4910  O OD1 . ASP B  1 221 ? -4.974  -41.580  112.259 1.00 39.70 ? 227  ASP B OD1 1 
ATOM   4911  O OD2 . ASP B  1 221 ? -4.707  -40.328  110.479 1.00 46.34 ? 227  ASP B OD2 1 
ATOM   4912  N N   . PRO B  1 222 ? -7.456  -43.097  113.025 1.00 35.79 ? 228  PRO B N   1 
ATOM   4913  C CA  . PRO B  1 222 ? -8.442  -42.571  113.972 1.00 31.51 ? 228  PRO B CA  1 
ATOM   4914  C C   . PRO B  1 222 ? -8.271  -41.089  114.277 1.00 26.59 ? 228  PRO B C   1 
ATOM   4915  O O   . PRO B  1 222 ? -9.203  -40.478  114.791 1.00 30.03 ? 228  PRO B O   1 
ATOM   4916  C CB  . PRO B  1 222 ? -8.197  -43.407  115.233 1.00 33.30 ? 228  PRO B CB  1 
ATOM   4917  C CG  . PRO B  1 222 ? -7.356  -44.566  114.790 1.00 33.20 ? 228  PRO B CG  1 
ATOM   4918  C CD  . PRO B  1 222 ? -6.529  -44.029  113.681 1.00 35.68 ? 228  PRO B CD  1 
ATOM   4919  N N   . THR B  1 223 ? -7.112  -40.514  113.978 1.00 23.88 ? 229  THR B N   1 
ATOM   4920  C CA  . THR B  1 223 ? -6.924  -39.084  114.213 1.00 29.34 ? 229  THR B CA  1 
ATOM   4921  C C   . THR B  1 223 ? -6.978  -38.257  112.928 1.00 33.63 ? 229  THR B C   1 
ATOM   4922  O O   . THR B  1 223 ? -6.621  -37.078  112.921 1.00 31.15 ? 229  THR B O   1 
ATOM   4923  C CB  . THR B  1 223 ? -5.595  -38.806  114.913 1.00 34.98 ? 229  THR B CB  1 
ATOM   4924  O OG1 . THR B  1 223 ? -4.514  -39.148  114.037 1.00 39.63 ? 229  THR B OG1 1 
ATOM   4925  C CG2 . THR B  1 223 ? -5.493  -39.613  116.205 1.00 33.61 ? 229  THR B CG2 1 
ATOM   4926  N N   . SER B  1 224 ? -7.424  -38.873  111.839 1.00 38.42 ? 230  SER B N   1 
ATOM   4927  C CA  . SER B  1 224 ? -7.543  -38.155  110.575 1.00 33.20 ? 230  SER B CA  1 
ATOM   4928  C C   . SER B  1 224 ? -8.861  -37.413  110.484 1.00 28.92 ? 230  SER B C   1 
ATOM   4929  O O   . SER B  1 224 ? -9.883  -37.899  110.967 1.00 29.05 ? 230  SER B O   1 
ATOM   4930  C CB  . SER B  1 224 ? -7.419  -39.105  109.390 1.00 33.13 ? 230  SER B CB  1 
ATOM   4931  O OG  . SER B  1 224 ? -7.672  -38.401  108.186 1.00 36.58 ? 230  SER B OG  1 
ATOM   4932  N N   . SER B  1 225 ? -8.836  -36.242  109.855 1.00 27.06 ? 231  SER B N   1 
ATOM   4933  C CA  . SER B  1 225 ? -10.055 -35.462  109.658 1.00 30.54 ? 231  SER B CA  1 
ATOM   4934  C C   . SER B  1 225 ? -10.727 -35.839  108.336 1.00 25.82 ? 231  SER B C   1 
ATOM   4935  O O   . SER B  1 225 ? -11.790 -35.312  107.992 1.00 21.40 ? 231  SER B O   1 
ATOM   4936  C CB  . SER B  1 225 ? -9.755  -33.960  109.695 1.00 35.62 ? 231  SER B CB  1 
ATOM   4937  O OG  . SER B  1 225 ? -8.774  -33.606  108.739 1.00 41.83 ? 231  SER B OG  1 
ATOM   4938  N N   . ARG B  1 226 ? -10.082 -36.751  107.611 1.00 25.10 ? 232  ARG B N   1 
ATOM   4939  C CA  . ARG B  1 226 ? -10.633 -37.385  106.410 1.00 26.84 ? 232  ARG B CA  1 
ATOM   4940  C C   . ARG B  1 226 ? -10.702 -36.460  105.184 1.00 27.45 ? 232  ARG B C   1 
ATOM   4941  O O   . ARG B  1 226 ? -11.564 -36.638  104.327 1.00 28.86 ? 232  ARG B O   1 
ATOM   4942  C CB  . ARG B  1 226 ? -12.027 -37.959  106.707 1.00 23.50 ? 232  ARG B CB  1 
ATOM   4943  C CG  . ARG B  1 226 ? -12.098 -38.817  107.963 1.00 25.34 ? 232  ARG B CG  1 
ATOM   4944  C CD  . ARG B  1 226 ? -11.209 -40.041  107.835 1.00 25.05 ? 232  ARG B CD  1 
ATOM   4945  N NE  . ARG B  1 226 ? -11.431 -40.710  106.558 1.00 28.51 ? 232  ARG B NE  1 
ATOM   4946  C CZ  . ARG B  1 226 ? -12.476 -41.488  106.288 1.00 27.48 ? 232  ARG B CZ  1 
ATOM   4947  N NH1 . ARG B  1 226 ? -13.406 -41.710  107.208 1.00 30.63 ? 232  ARG B NH1 1 
ATOM   4948  N NH2 . ARG B  1 226 ? -12.593 -42.047  105.092 1.00 24.22 ? 232  ARG B NH2 1 
ATOM   4949  N N   . ASP B  1 227 ? -9.786  -35.497  105.087 1.00 25.60 ? 233  ASP B N   1 
ATOM   4950  C CA  . ASP B  1 227 ? -9.767  -34.573  103.950 1.00 25.70 ? 233  ASP B CA  1 
ATOM   4951  C C   . ASP B  1 227 ? -8.488  -34.702  103.134 1.00 23.42 ? 233  ASP B C   1 
ATOM   4952  O O   . ASP B  1 227 ? -7.445  -35.064  103.666 1.00 23.02 ? 233  ASP B O   1 
ATOM   4953  C CB  . ASP B  1 227 ? -9.922  -33.120  104.421 1.00 32.48 ? 233  ASP B CB  1 
ATOM   4954  C CG  . ASP B  1 227 ? -11.263 -32.855  105.083 1.00 45.09 ? 233  ASP B CG  1 
ATOM   4955  O OD1 . ASP B  1 227 ? -12.279 -32.709  104.366 1.00 47.57 ? 233  ASP B OD1 1 
ATOM   4956  O OD2 . ASP B  1 227 ? -11.308 -32.788  106.328 1.00 51.31 ? 233  ASP B OD2 1 
ATOM   4957  N N   . PHE B  1 228 ? -8.567  -34.412  101.839 1.00 20.53 ? 234  PHE B N   1 
ATOM   4958  C CA  . PHE B  1 228 ? -7.361  -34.361  101.019 1.00 22.74 ? 234  PHE B CA  1 
ATOM   4959  C C   . PHE B  1 228 ? -6.430  -33.253  101.491 1.00 21.86 ? 234  PHE B C   1 
ATOM   4960  O O   . PHE B  1 228 ? -5.251  -33.484  101.722 1.00 22.85 ? 234  PHE B O   1 
ATOM   4961  C CB  . PHE B  1 228 ? -7.696  -34.139  99.539  1.00 23.45 ? 234  PHE B CB  1 
ATOM   4962  C CG  . PHE B  1 228 ? -8.197  -35.366  98.836  1.00 22.93 ? 234  PHE B CG  1 
ATOM   4963  C CD1 . PHE B  1 228 ? -7.312  -36.242  98.234  1.00 24.40 ? 234  PHE B CD1 1 
ATOM   4964  C CD2 . PHE B  1 228 ? -9.552  -35.635  98.762  1.00 14.47 ? 234  PHE B CD2 1 
ATOM   4965  C CE1 . PHE B  1 228 ? -7.771  -37.370  97.583  1.00 20.40 ? 234  PHE B CE1 1 
ATOM   4966  C CE2 . PHE B  1 228 ? -10.011 -36.761  98.110  1.00 14.52 ? 234  PHE B CE2 1 
ATOM   4967  C CZ  . PHE B  1 228 ? -9.122  -37.627  97.526  1.00 16.03 ? 234  PHE B CZ  1 
ATOM   4968  N N   . GLY B  1 229 ? -6.969  -32.046  101.616 1.00 22.57 ? 235  GLY B N   1 
ATOM   4969  C CA  . GLY B  1 229 ? -6.180  -30.887  101.982 1.00 25.05 ? 235  GLY B CA  1 
ATOM   4970  C C   . GLY B  1 229 ? -5.413  -31.045  103.283 1.00 28.81 ? 235  GLY B C   1 
ATOM   4971  O O   . GLY B  1 229 ? -4.220  -30.768  103.337 1.00 29.05 ? 235  GLY B O   1 
ATOM   4972  N N   . LYS B  1 230 ? -6.096  -31.498  104.331 1.00 32.76 ? 236  LYS B N   1 
ATOM   4973  C CA  . LYS B  1 230 ? -5.489  -31.575  105.653 1.00 34.04 ? 236  LYS B CA  1 
ATOM   4974  C C   . LYS B  1 230 ? -4.781  -32.902  105.900 1.00 40.40 ? 236  LYS B C   1 
ATOM   4975  O O   . LYS B  1 230 ? -3.724  -32.927  106.526 1.00 44.17 ? 236  LYS B O   1 
ATOM   4976  C CB  . LYS B  1 230 ? -6.538  -31.369  106.750 1.00 32.44 ? 236  LYS B CB  1 
ATOM   4977  C CG  . LYS B  1 230 ? -7.485  -30.193  106.564 1.00 33.72 ? 236  LYS B CG  1 
ATOM   4978  C CD  . LYS B  1 230 ? -8.475  -30.133  107.729 1.00 36.57 ? 236  LYS B CD  1 
ATOM   4979  C CE  . LYS B  1 230 ? -9.496  -29.031  107.558 1.00 39.62 ? 236  LYS B CE  1 
ATOM   4980  N NZ  . LYS B  1 230 ? -10.294 -29.230  106.317 1.00 41.80 ? 236  LYS B NZ  1 
ATOM   4981  N N   . ASP B  1 231 ? -5.369  -34.001  105.426 1.00 38.89 ? 237  ASP B N   1 
ATOM   4982  C CA  . ASP B  1 231 ? -4.874  -35.334  105.778 1.00 38.66 ? 237  ASP B CA  1 
ATOM   4983  C C   . ASP B  1 231 ? -4.080  -36.021  104.654 1.00 35.20 ? 237  ASP B C   1 
ATOM   4984  O O   . ASP B  1 231 ? -2.877  -36.232  104.792 1.00 37.85 ? 237  ASP B O   1 
ATOM   4985  C CB  . ASP B  1 231 ? -6.037  -36.239  106.221 1.00 41.45 ? 237  ASP B CB  1 
ATOM   4986  C CG  . ASP B  1 231 ? -6.814  -35.670  107.412 1.00 41.75 ? 237  ASP B CG  1 
ATOM   4987  O OD1 . ASP B  1 231 ? -6.393  -35.873  108.574 1.00 38.89 ? 237  ASP B OD1 1 
ATOM   4988  O OD2 . ASP B  1 231 ? -7.865  -35.036  107.181 1.00 39.85 ? 237  ASP B OD2 1 
ATOM   4989  N N   . ILE B  1 232 ? -4.742  -36.374  103.555 1.00 24.86 ? 238  ILE B N   1 
ATOM   4990  C CA  . ILE B  1 232 ? -4.091  -37.147  102.501 1.00 27.32 ? 238  ILE B CA  1 
ATOM   4991  C C   . ILE B  1 232 ? -2.838  -36.457  101.957 1.00 30.83 ? 238  ILE B C   1 
ATOM   4992  O O   . ILE B  1 232 ? -1.754  -37.042  101.940 1.00 29.88 ? 238  ILE B O   1 
ATOM   4993  C CB  . ILE B  1 232 ? -5.044  -37.414  101.318 1.00 23.95 ? 238  ILE B CB  1 
ATOM   4994  C CG1 . ILE B  1 232 ? -6.290  -38.153  101.793 1.00 21.59 ? 238  ILE B CG1 1 
ATOM   4995  C CG2 . ILE B  1 232 ? -4.334  -38.228  100.242 1.00 20.05 ? 238  ILE B CG2 1 
ATOM   4996  C CD1 . ILE B  1 232 ? -6.029  -39.571  102.123 1.00 20.92 ? 238  ILE B CD1 1 
ATOM   4997  N N   . ILE B  1 233 ? -2.993  -35.212  101.519 1.00 28.23 ? 239  ILE B N   1 
ATOM   4998  C CA  . ILE B  1 233 ? -1.935  -34.526  100.786 1.00 28.84 ? 239  ILE B CA  1 
ATOM   4999  C C   . ILE B  1 233 ? -0.698  -34.238  101.643 1.00 33.16 ? 239  ILE B C   1 
ATOM   5000  O O   . ILE B  1 233 ? 0.418   -34.484  101.193 1.00 32.20 ? 239  ILE B O   1 
ATOM   5001  C CB  . ILE B  1 233 ? -2.454  -33.212  100.160 1.00 27.30 ? 239  ILE B CB  1 
ATOM   5002  C CG1 . ILE B  1 233 ? -3.419  -33.529  99.017  1.00 29.49 ? 239  ILE B CG1 1 
ATOM   5003  C CG2 . ILE B  1 233 ? -1.306  -32.353  99.659  1.00 26.77 ? 239  ILE B CG2 1 
ATOM   5004  C CD1 . ILE B  1 233 ? -2.784  -34.241  97.852  1.00 26.29 ? 239  ILE B CD1 1 
ATOM   5005  N N   . PRO B  1 234 ? -0.875  -33.727  102.876 1.00 34.70 ? 240  PRO B N   1 
ATOM   5006  C CA  . PRO B  1 234 ? 0.336   -33.526  103.680 1.00 34.84 ? 240  PRO B CA  1 
ATOM   5007  C C   . PRO B  1 234 ? 1.137   -34.808  103.913 1.00 33.80 ? 240  PRO B C   1 
ATOM   5008  O O   . PRO B  1 234 ? 2.368   -34.751  103.990 1.00 30.99 ? 240  PRO B O   1 
ATOM   5009  C CB  . PRO B  1 234 ? -0.219  -32.981  104.997 1.00 32.33 ? 240  PRO B CB  1 
ATOM   5010  C CG  . PRO B  1 234 ? -1.428  -32.246  104.590 1.00 33.51 ? 240  PRO B CG  1 
ATOM   5011  C CD  . PRO B  1 234 ? -2.051  -33.126  103.533 1.00 34.09 ? 240  PRO B CD  1 
ATOM   5012  N N   . TYR B  1 235 ? 0.447   -35.942  103.997 1.00 31.73 ? 241  TYR B N   1 
ATOM   5013  C CA  . TYR B  1 235 ? 1.104   -37.236  104.154 1.00 32.06 ? 241  TYR B CA  1 
ATOM   5014  C C   . TYR B  1 235 ? 2.048   -37.553  102.991 1.00 31.84 ? 241  TYR B C   1 
ATOM   5015  O O   . TYR B  1 235 ? 3.160   -38.029  103.204 1.00 33.84 ? 241  TYR B O   1 
ATOM   5016  C CB  . TYR B  1 235 ? 0.064   -38.349  104.295 1.00 35.85 ? 241  TYR B CB  1 
ATOM   5017  C CG  . TYR B  1 235 ? 0.627   -39.657  104.814 1.00 41.90 ? 241  TYR B CG  1 
ATOM   5018  C CD1 . TYR B  1 235 ? 1.316   -40.524  103.974 1.00 44.67 ? 241  TYR B CD1 1 
ATOM   5019  C CD2 . TYR B  1 235 ? 0.462   -40.029  106.141 1.00 43.83 ? 241  TYR B CD2 1 
ATOM   5020  C CE1 . TYR B  1 235 ? 1.833   -41.716  104.445 1.00 47.66 ? 241  TYR B CE1 1 
ATOM   5021  C CE2 . TYR B  1 235 ? 0.973   -41.223  106.620 1.00 46.33 ? 241  TYR B CE2 1 
ATOM   5022  C CZ  . TYR B  1 235 ? 1.657   -42.063  105.767 1.00 47.31 ? 241  TYR B CZ  1 
ATOM   5023  O OH  . TYR B  1 235 ? 2.169   -43.252  106.237 1.00 47.53 ? 241  TYR B OH  1 
ATOM   5024  N N   . ILE B  1 236 ? 1.610   -37.298  101.765 1.00 28.95 ? 242  ILE B N   1 
ATOM   5025  C CA  . ILE B  1 236 ? 2.428   -37.627  100.596 1.00 29.78 ? 242  ILE B CA  1 
ATOM   5026  C C   . ILE B  1 236 ? 3.575   -36.632  100.410 1.00 34.84 ? 242  ILE B C   1 
ATOM   5027  O O   . ILE B  1 236 ? 4.699   -37.036  100.106 1.00 35.37 ? 242  ILE B O   1 
ATOM   5028  C CB  . ILE B  1 236 ? 1.597   -37.667  99.301  1.00 21.36 ? 242  ILE B CB  1 
ATOM   5029  C CG1 . ILE B  1 236 ? 0.574   -38.806  99.347  1.00 24.15 ? 242  ILE B CG1 1 
ATOM   5030  C CG2 . ILE B  1 236 ? 2.498   -37.859  98.107  1.00 21.17 ? 242  ILE B CG2 1 
ATOM   5031  C CD1 . ILE B  1 236 ? -0.610  -38.609  98.399  1.00 19.84 ? 242  ILE B CD1 1 
ATOM   5032  N N   . VAL B  1 237 ? 3.286   -35.341  100.592 1.00 33.56 ? 243  VAL B N   1 
ATOM   5033  C CA  . VAL B  1 237 ? 4.291   -34.290  100.441 1.00 33.34 ? 243  VAL B CA  1 
ATOM   5034  C C   . VAL B  1 237 ? 5.544   -34.645  101.235 1.00 40.16 ? 243  VAL B C   1 
ATOM   5035  O O   . VAL B  1 237 ? 6.667   -34.517  100.738 1.00 41.93 ? 243  VAL B O   1 
ATOM   5036  C CB  . VAL B  1 237 ? 3.768   -32.912  100.910 1.00 30.56 ? 243  VAL B CB  1 
ATOM   5037  C CG1 . VAL B  1 237 ? 4.894   -31.893  100.905 1.00 31.05 ? 243  VAL B CG1 1 
ATOM   5038  C CG2 . VAL B  1 237 ? 2.630   -32.434  100.032 1.00 29.79 ? 243  VAL B CG2 1 
ATOM   5039  N N   . GLU B  1 238 ? 5.331   -35.120  102.461 1.00 42.38 ? 244  GLU B N   1 
ATOM   5040  C CA  . GLU B  1 238 ? 6.414   -35.573  103.326 1.00 48.20 ? 244  GLU B CA  1 
ATOM   5041  C C   . GLU B  1 238 ? 6.947   -36.947  102.917 1.00 50.11 ? 244  GLU B C   1 
ATOM   5042  O O   . GLU B  1 238 ? 8.102   -37.084  102.503 1.00 51.14 ? 244  GLU B O   1 
ATOM   5043  C CB  . GLU B  1 238 ? 5.944   -35.616  104.783 1.00 52.27 ? 244  GLU B CB  1 
ATOM   5044  C CG  . GLU B  1 238 ? 7.047   -35.354  105.803 1.00 61.17 ? 244  GLU B CG  1 
ATOM   5045  C CD  . GLU B  1 238 ? 6.618   -34.402  106.909 1.00 70.39 ? 244  GLU B CD  1 
ATOM   5046  O OE1 . GLU B  1 238 ? 5.487   -34.552  107.419 1.00 76.00 ? 244  GLU B OE1 1 
ATOM   5047  O OE2 . GLU B  1 238 ? 7.413   -33.507  107.276 1.00 71.55 ? 244  GLU B OE2 1 
ATOM   5048  N N   . HIS B  1 239 ? 6.087   -37.956  103.019 1.00 47.77 ? 245  HIS B N   1 
ATOM   5049  C CA  . HIS B  1 239 ? 6.507   -39.350  102.927 1.00 44.15 ? 245  HIS B CA  1 
ATOM   5050  C C   . HIS B  1 239 ? 6.339   -39.946  101.550 1.00 44.18 ? 245  HIS B C   1 
ATOM   5051  O O   . HIS B  1 239 ? 6.372   -41.164  101.385 1.00 49.28 ? 245  HIS B O   1 
ATOM   5052  C CB  . HIS B  1 239 ? 5.732   -40.192  103.931 1.00 45.69 ? 245  HIS B CB  1 
ATOM   5053  C CG  . HIS B  1 239 ? 6.002   -39.816  105.350 1.00 53.55 ? 245  HIS B CG  1 
ATOM   5054  N ND1 . HIS B  1 239 ? 5.439   -40.483  106.416 1.00 57.94 ? 245  HIS B ND1 1 
ATOM   5055  C CD2 . HIS B  1 239 ? 6.777   -38.841  105.881 1.00 55.67 ? 245  HIS B CD2 1 
ATOM   5056  C CE1 . HIS B  1 239 ? 5.856   -39.934  107.544 1.00 58.54 ? 245  HIS B CE1 1 
ATOM   5057  N NE2 . HIS B  1 239 ? 6.667   -38.934  107.247 1.00 58.05 ? 245  HIS B NE2 1 
ATOM   5058  N N   . GLY B  1 240 ? 6.157   -39.098  100.553 1.00 39.71 ? 246  GLY B N   1 
ATOM   5059  C CA  . GLY B  1 240 ? 6.063   -39.590  99.197  1.00 32.92 ? 246  GLY B CA  1 
ATOM   5060  C C   . GLY B  1 240 ? 6.549   -38.526  98.258  1.00 30.16 ? 246  GLY B C   1 
ATOM   5061  O O   . GLY B  1 240 ? 7.297   -37.637  98.662  1.00 35.06 ? 246  GLY B O   1 
ATOM   5062  N N   . LYS B  1 241 ? 6.133   -38.603  97.002  1.00 27.59 ? 247  LYS B N   1 
ATOM   5063  C CA  . LYS B  1 241 ? 6.562   -37.590  96.056  1.00 30.18 ? 247  LYS B CA  1 
ATOM   5064  C C   . LYS B  1 241 ? 5.407   -36.761  95.502  1.00 27.64 ? 247  LYS B C   1 
ATOM   5065  O O   . LYS B  1 241 ? 4.599   -37.241  94.702  1.00 30.17 ? 247  LYS B O   1 
ATOM   5066  C CB  . LYS B  1 241 ? 7.340   -38.209  94.901  1.00 33.44 ? 247  LYS B CB  1 
ATOM   5067  C CG  . LYS B  1 241 ? 7.915   -37.126  94.023  1.00 39.00 ? 247  LYS B CG  1 
ATOM   5068  C CD  . LYS B  1 241 ? 8.668   -37.640  92.812  1.00 47.81 ? 247  LYS B CD  1 
ATOM   5069  C CE  . LYS B  1 241 ? 9.055   -36.487  91.891  1.00 51.18 ? 247  LYS B CE  1 
ATOM   5070  N NZ  . LYS B  1 241 ? 9.794   -36.974  90.708  1.00 53.37 ? 247  LYS B NZ  1 
ATOM   5071  N N   . ALA B  1 242 ? 5.341   -35.508  95.945  1.00 22.75 ? 248  ALA B N   1 
ATOM   5072  C CA  . ALA B  1 242 ? 4.327   -34.580  95.474  1.00 20.42 ? 248  ALA B CA  1 
ATOM   5073  C C   . ALA B  1 242 ? 4.968   -33.563  94.548  1.00 24.53 ? 248  ALA B C   1 
ATOM   5074  O O   . ALA B  1 242 ? 6.058   -33.081  94.816  1.00 25.30 ? 248  ALA B O   1 
ATOM   5075  C CB  . ALA B  1 242 ? 3.648   -33.890  96.642  1.00 22.23 ? 248  ALA B CB  1 
ATOM   5076  N N   . VAL B  1 243 ? 4.292   -33.243  93.452  1.00 22.93 ? 249  VAL B N   1 
ATOM   5077  C CA  . VAL B  1 243 ? 4.815   -32.301  92.471  1.00 22.14 ? 249  VAL B CA  1 
ATOM   5078  C C   . VAL B  1 243 ? 3.735   -31.286  92.087  1.00 24.67 ? 249  VAL B C   1 
ATOM   5079  O O   . VAL B  1 243 ? 2.548   -31.616  92.027  1.00 24.29 ? 249  VAL B O   1 
ATOM   5080  C CB  . VAL B  1 243 ? 5.335   -33.042  91.221  1.00 27.08 ? 249  VAL B CB  1 
ATOM   5081  C CG1 . VAL B  1 243 ? 5.832   -32.066  90.172  1.00 28.71 ? 249  VAL B CG1 1 
ATOM   5082  C CG2 . VAL B  1 243 ? 6.452   -34.011  91.612  1.00 26.59 ? 249  VAL B CG2 1 
ATOM   5083  N N   . ALA B  1 244 ? 4.133   -30.043  91.858  1.00 20.35 ? 250  ALA B N   1 
ATOM   5084  C CA  . ALA B  1 244 ? 3.159   -29.023  91.518  1.00 25.43 ? 250  ALA B CA  1 
ATOM   5085  C C   . ALA B  1 244 ? 3.001   -28.869  90.016  1.00 25.69 ? 250  ALA B C   1 
ATOM   5086  O O   . ALA B  1 244 ? 3.979   -28.875  89.272  1.00 30.57 ? 250  ALA B O   1 
ATOM   5087  C CB  . ALA B  1 244 ? 3.549   -27.702  92.138  1.00 30.42 ? 250  ALA B CB  1 
ATOM   5088  N N   . HIS B  1 245 ? 1.753   -28.744  89.575  1.00 20.93 ? 251  HIS B N   1 
ATOM   5089  C CA  . HIS B  1 245 ? 1.466   -28.396  88.196  1.00 19.45 ? 251  HIS B CA  1 
ATOM   5090  C C   . HIS B  1 245 ? 1.045   -26.930  88.131  1.00 24.40 ? 251  HIS B C   1 
ATOM   5091  O O   . HIS B  1 245 ? 0.259   -26.471  88.956  1.00 26.82 ? 251  HIS B O   1 
ATOM   5092  C CB  . HIS B  1 245 ? 0.376   -29.305  87.615  1.00 15.23 ? 251  HIS B CB  1 
ATOM   5093  C CG  . HIS B  1 245 ? -0.051  -28.915  86.238  1.00 18.32 ? 251  HIS B CG  1 
ATOM   5094  N ND1 . HIS B  1 245 ? 0.634   -29.302  85.108  1.00 18.25 ? 251  HIS B ND1 1 
ATOM   5095  C CD2 . HIS B  1 245 ? -1.077  -28.145  85.810  1.00 17.08 ? 251  HIS B CD2 1 
ATOM   5096  C CE1 . HIS B  1 245 ? 0.043   -28.799  84.042  1.00 18.71 ? 251  HIS B CE1 1 
ATOM   5097  N NE2 . HIS B  1 245 ? -0.997  -28.089  84.441  1.00 18.92 ? 251  HIS B NE2 1 
ATOM   5098  N N   . ARG B  1 246 ? 1.567   -26.198  87.151  1.00 30.18 ? 252  ARG B N   1 
ATOM   5099  C CA  . ARG B  1 246 ? 1.282   -24.768  87.020  1.00 31.79 ? 252  ARG B CA  1 
ATOM   5100  C C   . ARG B  1 246 ? 0.033   -24.513  86.194  1.00 23.22 ? 252  ARG B C   1 
ATOM   5101  O O   . ARG B  1 246 ? -0.043  -24.897  85.020  1.00 24.45 ? 252  ARG B O   1 
ATOM   5102  C CB  . ARG B  1 246 ? 2.466   -24.026  86.379  1.00 36.68 ? 252  ARG B CB  1 
ATOM   5103  C CG  . ARG B  1 246 ? 3.793   -24.139  87.113  1.00 35.96 ? 252  ARG B CG  1 
ATOM   5104  C CD  . ARG B  1 246 ? 4.033   -22.964  88.028  1.00 37.57 ? 252  ARG B CD  1 
ATOM   5105  N NE  . ARG B  1 246 ? 5.396   -22.954  88.550  1.00 44.25 ? 252  ARG B NE  1 
ATOM   5106  C CZ  . ARG B  1 246 ? 6.438   -22.400  87.933  1.00 48.61 ? 252  ARG B CZ  1 
ATOM   5107  N NH1 . ARG B  1 246 ? 6.286   -21.806  86.756  1.00 50.33 ? 252  ARG B NH1 1 
ATOM   5108  N NH2 . ARG B  1 246 ? 7.638   -22.441  88.497  1.00 49.45 ? 252  ARG B NH2 1 
ATOM   5109  N N   . PHE B  1 247 ? -0.934  -23.829  86.794  1.00 20.94 ? 253  PHE B N   1 
ATOM   5110  C CA  . PHE B  1 247 ? -2.196  -23.552  86.116  1.00 15.66 ? 253  PHE B CA  1 
ATOM   5111  C C   . PHE B  1 247 ? -1.970  -22.899  84.759  1.00 19.79 ? 253  PHE B C   1 
ATOM   5112  O O   . PHE B  1 247 ? -2.653  -23.219  83.794  1.00 18.45 ? 253  PHE B O   1 
ATOM   5113  C CB  . PHE B  1 247 ? -3.093  -22.673  86.996  1.00 21.39 ? 253  PHE B CB  1 
ATOM   5114  C CG  . PHE B  1 247 ? -4.404  -22.287  86.351  1.00 22.06 ? 253  PHE B CG  1 
ATOM   5115  C CD1 . PHE B  1 247 ? -5.229  -23.243  85.792  1.00 24.53 ? 253  PHE B CD1 1 
ATOM   5116  C CD2 . PHE B  1 247 ? -4.834  -20.969  86.351  1.00 21.24 ? 253  PHE B CD2 1 
ATOM   5117  C CE1 . PHE B  1 247 ? -6.439  -22.884  85.214  1.00 18.18 ? 253  PHE B CE1 1 
ATOM   5118  C CE2 . PHE B  1 247 ? -6.041  -20.616  85.781  1.00 16.04 ? 253  PHE B CE2 1 
ATOM   5119  C CZ  . PHE B  1 247 ? -6.841  -21.579  85.216  1.00 15.61 ? 253  PHE B CZ  1 
ATOM   5120  N N   . ALA B  1 248 ? -0.978  -22.019  84.676  1.00 26.41 ? 254  ALA B N   1 
ATOM   5121  C CA  . ALA B  1 248 ? -0.715  -21.296  83.434  1.00 29.71 ? 254  ALA B CA  1 
ATOM   5122  C C   . ALA B  1 248 ? -0.365  -22.238  82.281  1.00 31.63 ? 254  ALA B C   1 
ATOM   5123  O O   . ALA B  1 248 ? -0.646  -21.943  81.117  1.00 34.40 ? 254  ALA B O   1 
ATOM   5124  C CB  . ALA B  1 248 ? 0.402   -20.283  83.644  1.00 31.84 ? 254  ALA B CB  1 
ATOM   5125  N N   . ASP B  1 249 ? 0.239   -23.376  82.613  1.00 27.67 ? 255  ASP B N   1 
ATOM   5126  C CA  . ASP B  1 249 ? 0.675   -24.333  81.603  1.00 27.97 ? 255  ASP B CA  1 
ATOM   5127  C C   . ASP B  1 249 ? -0.489  -25.112  80.977  1.00 30.46 ? 255  ASP B C   1 
ATOM   5128  O O   . ASP B  1 249 ? -0.378  -25.591  79.850  1.00 31.01 ? 255  ASP B O   1 
ATOM   5129  C CB  . ASP B  1 249 ? 1.693   -25.307  82.208  1.00 32.08 ? 255  ASP B CB  1 
ATOM   5130  C CG  . ASP B  1 249 ? 2.945   -24.604  82.739  1.00 40.92 ? 255  ASP B CG  1 
ATOM   5131  O OD1 . ASP B  1 249 ? 3.280   -23.501  82.252  1.00 39.59 ? 255  ASP B OD1 1 
ATOM   5132  O OD2 . ASP B  1 249 ? 3.610   -25.171  83.635  1.00 44.09 ? 255  ASP B OD2 1 
ATOM   5133  N N   . SER B  1 250 ? -1.604  -25.231  81.699  1.00 27.64 ? 256  SER B N   1 
ATOM   5134  C CA  . SER B  1 250 ? -2.755  -26.023  81.235  1.00 21.58 ? 256  SER B CA  1 
ATOM   5135  C C   . SER B  1 250 ? -3.992  -25.196  80.976  1.00 20.61 ? 256  SER B C   1 
ATOM   5136  O O   . SER B  1 250 ? -4.956  -25.678  80.375  1.00 17.84 ? 256  SER B O   1 
ATOM   5137  C CB  . SER B  1 250 ? -3.121  -27.090  82.258  1.00 23.19 ? 256  SER B CB  1 
ATOM   5138  O OG  . SER B  1 250 ? -2.389  -28.266  82.044  1.00 32.88 ? 256  SER B OG  1 
ATOM   5139  N N   . CYS B  1 251 ? -3.976  -23.968  81.474  1.00 17.02 ? 257  CYS B N   1 
ATOM   5140  C CA  . CYS B  1 251 ? -5.112  -23.076  81.348  1.00 19.80 ? 257  CYS B CA  1 
ATOM   5141  C C   . CYS B  1 251 ? -5.502  -22.931  79.889  1.00 21.97 ? 257  CYS B C   1 
ATOM   5142  O O   . CYS B  1 251 ? -4.643  -22.821  79.019  1.00 23.75 ? 257  CYS B O   1 
ATOM   5143  C CB  . CYS B  1 251 ? -4.794  -21.707  81.948  1.00 21.25 ? 257  CYS B CB  1 
ATOM   5144  S SG  . CYS B  1 251 ? -6.150  -20.532  81.794  1.00 27.89 ? 257  CYS B SG  1 
ATOM   5145  N N   . VAL B  1 252 ? -6.798  -22.958  79.618  1.00 18.20 ? 258  VAL B N   1 
ATOM   5146  C CA  . VAL B  1 252 ? -7.272  -22.771  78.261  1.00 19.98 ? 258  VAL B CA  1 
ATOM   5147  C C   . VAL B  1 252 ? -7.731  -21.330  78.066  1.00 26.58 ? 258  VAL B C   1 
ATOM   5148  O O   . VAL B  1 252 ? -8.857  -20.983  78.403  1.00 31.05 ? 258  VAL B O   1 
ATOM   5149  C CB  . VAL B  1 252 ? -8.426  -23.737  77.931  1.00 20.24 ? 258  VAL B CB  1 
ATOM   5150  C CG1 . VAL B  1 252 ? -8.828  -23.607  76.464  1.00 19.79 ? 258  VAL B CG1 1 
ATOM   5151  C CG2 . VAL B  1 252 ? -8.031  -25.170  78.261  1.00 21.21 ? 258  VAL B CG2 1 
ATOM   5152  N N   . ARG B  1 253 ? -6.859  -20.480  77.530  1.00 28.00 ? 259  ARG B N   1 
ATOM   5153  C CA  . ARG B  1 253 ? -7.236  -19.088  77.283  1.00 30.06 ? 259  ARG B CA  1 
ATOM   5154  C C   . ARG B  1 253 ? -7.747  -18.849  75.867  1.00 33.79 ? 259  ARG B C   1 
ATOM   5155  O O   . ARG B  1 253 ? -7.115  -19.246  74.888  1.00 37.30 ? 259  ARG B O   1 
ATOM   5156  C CB  . ARG B  1 253 ? -6.061  -18.142  77.538  1.00 28.94 ? 259  ARG B CB  1 
ATOM   5157  C CG  . ARG B  1 253 ? -5.535  -18.137  78.949  1.00 28.03 ? 259  ARG B CG  1 
ATOM   5158  C CD  . ARG B  1 253 ? -4.726  -16.882  79.201  1.00 30.66 ? 259  ARG B CD  1 
ATOM   5159  N NE  . ARG B  1 253 ? -4.576  -16.076  77.993  1.00 34.82 ? 259  ARG B NE  1 
ATOM   5160  C CZ  . ARG B  1 253 ? -3.432  -15.918  77.336  1.00 38.84 ? 259  ARG B CZ  1 
ATOM   5161  N NH1 . ARG B  1 253 ? -2.332  -16.513  77.772  1.00 40.37 ? 259  ARG B NH1 1 
ATOM   5162  N NH2 . ARG B  1 253 ? -3.390  -15.163  76.246  1.00 38.47 ? 259  ARG B NH2 1 
ATOM   5163  N N   . SER B  1 254 ? -8.894  -18.191  75.768  1.00 32.82 ? 260  SER B N   1 
ATOM   5164  C CA  . SER B  1 254 ? -9.338  -17.609  74.513  1.00 32.02 ? 260  SER B CA  1 
ATOM   5165  C C   . SER B  1 254 ? -8.303  -16.569  74.105  1.00 34.53 ? 260  SER B C   1 
ATOM   5166  O O   . SER B  1 254 ? -7.545  -16.088  74.946  1.00 33.66 ? 260  SER B O   1 
ATOM   5167  C CB  . SER B  1 254 ? -10.728 -16.986  74.681  1.00 35.79 ? 260  SER B CB  1 
ATOM   5168  O OG  . SER B  1 254 ? -11.010 -16.018  73.686  1.00 38.30 ? 260  SER B OG  1 
ATOM   5169  N N   . ASP B  1 255 ? -8.239  -16.203  72.833  1.00 36.33 ? 261  ASP B N   1 
ATOM   5170  C CA  . ASP B  1 255 ? -7.308  -15.135  72.492  1.00 40.51 ? 261  ASP B CA  1 
ATOM   5171  C C   . ASP B  1 255 ? -7.941  -13.779  72.793  1.00 38.74 ? 261  ASP B C   1 
ATOM   5172  O O   . ASP B  1 255 ? -7.382  -12.733  72.475  1.00 41.37 ? 261  ASP B O   1 
ATOM   5173  C CB  . ASP B  1 255 ? -6.856  -15.227  71.039  1.00 47.37 ? 261  ASP B CB  1 
ATOM   5174  C CG  . ASP B  1 255 ? -5.520  -15.943  70.896  1.00 51.94 ? 261  ASP B CG  1 
ATOM   5175  O OD1 . ASP B  1 255 ? -5.280  -16.931  71.629  1.00 51.29 ? 261  ASP B OD1 1 
ATOM   5176  O OD2 . ASP B  1 255 ? -4.698  -15.506  70.065  1.00 56.28 ? 261  ASP B OD2 1 
ATOM   5177  N N   . PHE B  1 256 ? -9.105  -13.812  73.433  1.00 34.62 ? 262  PHE B N   1 
ATOM   5178  C CA  . PHE B  1 256 ? -9.748  -12.610  73.942  1.00 28.25 ? 262  PHE B CA  1 
ATOM   5179  C C   . PHE B  1 256 ? -9.602  -12.512  75.469  1.00 30.42 ? 262  PHE B C   1 
ATOM   5180  O O   . PHE B  1 256 ? -10.188 -11.632  76.097  1.00 35.63 ? 262  PHE B O   1 
ATOM   5181  C CB  . PHE B  1 256 ? -11.226 -12.591  73.552  1.00 30.67 ? 262  PHE B CB  1 
ATOM   5182  C CG  . PHE B  1 256 ? -11.472 -12.482  72.070  1.00 35.39 ? 262  PHE B CG  1 
ATOM   5183  C CD1 . PHE B  1 256 ? -11.764 -11.258  71.491  1.00 39.03 ? 262  PHE B CD1 1 
ATOM   5184  C CD2 . PHE B  1 256 ? -11.436 -13.602  71.261  1.00 39.13 ? 262  PHE B CD2 1 
ATOM   5185  C CE1 . PHE B  1 256 ? -12.009 -11.154  70.131  1.00 41.19 ? 262  PHE B CE1 1 
ATOM   5186  C CE2 . PHE B  1 256 ? -11.677 -13.503  69.895  1.00 40.07 ? 262  PHE B CE2 1 
ATOM   5187  C CZ  . PHE B  1 256 ? -11.962 -12.280  69.333  1.00 40.52 ? 262  PHE B CZ  1 
ATOM   5188  N N   . GLU B  1 257 ? -8.829  -13.420  76.064  1.00 26.09 ? 263  GLU B N   1 
ATOM   5189  C CA  . GLU B  1 257 ? -8.597  -13.411  77.509  1.00 25.54 ? 263  GLU B CA  1 
ATOM   5190  C C   . GLU B  1 257 ? -7.149  -13.036  77.821  1.00 29.03 ? 263  GLU B C   1 
ATOM   5191  O O   . GLU B  1 257 ? -6.218  -13.775  77.493  1.00 27.32 ? 263  GLU B O   1 
ATOM   5192  C CB  . GLU B  1 257 ? -8.947  -14.769  78.113  1.00 21.45 ? 263  GLU B CB  1 
ATOM   5193  C CG  . GLU B  1 257 ? -10.440 -15.081  78.018  1.00 23.02 ? 263  GLU B CG  1 
ATOM   5194  C CD  . GLU B  1 257 ? -10.782 -16.522  78.373  1.00 26.82 ? 263  GLU B CD  1 
ATOM   5195  O OE1 . GLU B  1 257 ? -9.851  -17.318  78.610  1.00 27.88 ? 263  GLU B OE1 1 
ATOM   5196  O OE2 . GLU B  1 257 ? -11.991 -16.858  78.415  1.00 24.92 ? 263  GLU B OE2 1 
ATOM   5197  N N   . HIS B  1 258 ? -6.968  -11.886  78.464  1.00 29.04 ? 264  HIS B N   1 
ATOM   5198  C CA  . HIS B  1 258 ? -5.646  -11.283  78.571  1.00 31.73 ? 264  HIS B CA  1 
ATOM   5199  C C   . HIS B  1 258 ? -4.740  -12.047  79.533  1.00 32.43 ? 264  HIS B C   1 
ATOM   5200  O O   . HIS B  1 258 ? -3.516  -11.932  79.467  1.00 36.92 ? 264  HIS B O   1 
ATOM   5201  C CB  . HIS B  1 258 ? -5.770  -9.808   78.989  1.00 32.84 ? 264  HIS B CB  1 
ATOM   5202  C CG  . HIS B  1 258 ? -6.076  -9.604   80.441  1.00 34.52 ? 264  HIS B CG  1 
ATOM   5203  N ND1 . HIS B  1 258 ? -7.342  -9.746   80.965  1.00 35.30 ? 264  HIS B ND1 1 
ATOM   5204  C CD2 . HIS B  1 258 ? -5.278  -9.254   81.478  1.00 35.93 ? 264  HIS B CD2 1 
ATOM   5205  C CE1 . HIS B  1 258 ? -7.310  -9.504   82.264  1.00 31.76 ? 264  HIS B CE1 1 
ATOM   5206  N NE2 . HIS B  1 258 ? -6.070  -9.202   82.600  1.00 35.79 ? 264  HIS B NE2 1 
ATOM   5207  N N   . GLU B  1 259 ? -5.346  -12.847  80.401  1.00 31.50 ? 265  GLU B N   1 
ATOM   5208  C CA  . GLU B  1 259 ? -4.618  -13.595  81.423  1.00 28.73 ? 265  GLU B CA  1 
ATOM   5209  C C   . GLU B  1 259 ? -5.382  -14.868  81.785  1.00 27.01 ? 265  GLU B C   1 
ATOM   5210  O O   . GLU B  1 259 ? -6.583  -14.965  81.519  1.00 30.45 ? 265  GLU B O   1 
ATOM   5211  C CB  . GLU B  1 259 ? -4.409  -12.733  82.674  1.00 32.26 ? 265  GLU B CB  1 
ATOM   5212  C CG  . GLU B  1 259 ? -5.687  -12.500  83.468  1.00 34.61 ? 265  GLU B CG  1 
ATOM   5213  C CD  . GLU B  1 259 ? -5.485  -11.601  84.672  1.00 39.60 ? 265  GLU B CD  1 
ATOM   5214  O OE1 . GLU B  1 259 ? -4.325  -11.228  84.958  1.00 43.35 ? 265  GLU B OE1 1 
ATOM   5215  O OE2 . GLU B  1 259 ? -6.489  -11.268  85.336  1.00 35.45 ? 265  GLU B OE2 1 
ATOM   5216  N N   . PRO B  1 260 ? -4.689  -15.856  82.378  1.00 22.59 ? 266  PRO B N   1 
ATOM   5217  C CA  . PRO B  1 260 ? -5.373  -17.074  82.831  1.00 18.35 ? 266  PRO B CA  1 
ATOM   5218  C C   . PRO B  1 260 ? -6.447  -16.756  83.857  1.00 21.32 ? 266  PRO B C   1 
ATOM   5219  O O   . PRO B  1 260 ? -6.178  -16.112  84.866  1.00 23.50 ? 266  PRO B O   1 
ATOM   5220  C CB  . PRO B  1 260 ? -4.248  -17.899  83.454  1.00 20.79 ? 266  PRO B CB  1 
ATOM   5221  C CG  . PRO B  1 260 ? -3.037  -17.472  82.708  1.00 22.39 ? 266  PRO B CG  1 
ATOM   5222  C CD  . PRO B  1 260 ? -3.225  -15.992  82.461  1.00 21.13 ? 266  PRO B CD  1 
ATOM   5223  N N   . TYR B  1 261 ? -7.659  -17.219  83.590  1.00 19.01 ? 267  TYR B N   1 
ATOM   5224  C CA  . TYR B  1 261 ? -8.806  -16.872  84.407  1.00 16.76 ? 267  TYR B CA  1 
ATOM   5225  C C   . TYR B  1 261 ? -9.092  -17.932  85.453  1.00 17.74 ? 267  TYR B C   1 
ATOM   5226  O O   . TYR B  1 261 ? -9.238  -19.109  85.144  1.00 19.86 ? 267  TYR B O   1 
ATOM   5227  C CB  . TYR B  1 261 ? -10.017 -16.671  83.509  1.00 14.92 ? 267  TYR B CB  1 
ATOM   5228  C CG  . TYR B  1 261 ? -11.264 -16.178  84.197  1.00 18.52 ? 267  TYR B CG  1 
ATOM   5229  C CD1 . TYR B  1 261 ? -12.119 -17.062  84.850  1.00 15.90 ? 267  TYR B CD1 1 
ATOM   5230  C CD2 . TYR B  1 261 ? -11.606 -14.835  84.166  1.00 19.35 ? 267  TYR B CD2 1 
ATOM   5231  C CE1 . TYR B  1 261 ? -13.277 -16.621  85.465  1.00 17.34 ? 267  TYR B CE1 1 
ATOM   5232  C CE2 . TYR B  1 261 ? -12.761 -14.383  84.775  1.00 18.39 ? 267  TYR B CE2 1 
ATOM   5233  C CZ  . TYR B  1 261 ? -13.593 -15.281  85.419  1.00 17.86 ? 267  TYR B CZ  1 
ATOM   5234  O OH  . TYR B  1 261 ? -14.743 -14.837  86.027  1.00 16.62 ? 267  TYR B OH  1 
ATOM   5235  N N   . TRP B  1 262 ? -9.169  -17.510  86.699  1.00 14.39 ? 268  TRP B N   1 
ATOM   5236  C CA  . TRP B  1 262 ? -9.610  -18.399  87.756  1.00 12.89 ? 268  TRP B CA  1 
ATOM   5237  C C   . TRP B  1 262 ? -10.263 -17.548  88.816  1.00 12.36 ? 268  TRP B C   1 
ATOM   5238  O O   . TRP B  1 262 ? -9.675  -16.567  89.257  1.00 16.08 ? 268  TRP B O   1 
ATOM   5239  C CB  . TRP B  1 262 ? -8.437  -19.200  88.324  1.00 12.51 ? 268  TRP B CB  1 
ATOM   5240  C CG  . TRP B  1 262 ? -8.812  -20.157  89.421  1.00 13.39 ? 268  TRP B CG  1 
ATOM   5241  C CD1 . TRP B  1 262 ? -9.055  -21.495  89.296  1.00 14.92 ? 268  TRP B CD1 1 
ATOM   5242  C CD2 . TRP B  1 262 ? -8.974  -19.850  90.810  1.00 15.35 ? 268  TRP B CD2 1 
ATOM   5243  N NE1 . TRP B  1 262 ? -9.356  -22.038  90.520  1.00 16.16 ? 268  TRP B NE1 1 
ATOM   5244  C CE2 . TRP B  1 262 ? -9.319  -21.047  91.464  1.00 16.00 ? 268  TRP B CE2 1 
ATOM   5245  C CE3 . TRP B  1 262 ? -8.859  -18.679  91.564  1.00 17.01 ? 268  TRP B CE3 1 
ATOM   5246  C CZ2 . TRP B  1 262 ? -9.547  -21.108  92.835  1.00 19.19 ? 268  TRP B CZ2 1 
ATOM   5247  C CZ3 . TRP B  1 262 ? -9.088  -18.740  92.924  1.00 18.97 ? 268  TRP B CZ3 1 
ATOM   5248  C CH2 . TRP B  1 262 ? -9.426  -19.947  93.546  1.00 18.98 ? 268  TRP B CH2 1 
ATOM   5249  N N   . ARG B  1 263 ? -11.487 -17.902  89.208  1.00 12.92 ? 269  ARG B N   1 
ATOM   5250  C CA  . ARG B  1 263 ? -12.205 -17.169  90.245  1.00 14.58 ? 269  ARG B CA  1 
ATOM   5251  C C   . ARG B  1 263 ? -12.817 -18.104  91.271  1.00 17.17 ? 269  ARG B C   1 
ATOM   5252  O O   . ARG B  1 263 ? -13.404 -19.130  90.928  1.00 16.88 ? 269  ARG B O   1 
ATOM   5253  C CB  . ARG B  1 263 ? -13.312 -16.301  89.651  1.00 16.90 ? 269  ARG B CB  1 
ATOM   5254  C CG  . ARG B  1 263 ? -12.855 -15.280  88.646  1.00 17.34 ? 269  ARG B CG  1 
ATOM   5255  C CD  . ARG B  1 263 ? -12.333 -14.025  89.297  1.00 17.39 ? 269  ARG B CD  1 
ATOM   5256  N NE  . ARG B  1 263 ? -12.088 -12.994  88.291  1.00 21.12 ? 269  ARG B NE  1 
ATOM   5257  C CZ  . ARG B  1 263 ? -11.012 -12.940  87.511  1.00 22.03 ? 269  ARG B CZ  1 
ATOM   5258  N NH1 . ARG B  1 263 ? -10.067 -13.868  87.607  1.00 21.43 ? 269  ARG B NH1 1 
ATOM   5259  N NH2 . ARG B  1 263 ? -10.883 -11.961  86.622  1.00 20.42 ? 269  ARG B NH2 1 
ATOM   5260  N N   . ASP B  1 264 ? -12.704 -17.711  92.533  1.00 17.38 ? 270  ASP B N   1 
ATOM   5261  C CA  . ASP B  1 264 ? -13.244 -18.461  93.656  1.00 21.19 ? 270  ASP B CA  1 
ATOM   5262  C C   . ASP B  1 264 ? -14.684 -18.049  94.006  1.00 18.12 ? 270  ASP B C   1 
ATOM   5263  O O   . ASP B  1 264 ? -15.434 -18.829  94.592  1.00 15.38 ? 270  ASP B O   1 
ATOM   5264  C CB  . ASP B  1 264 ? -12.313 -18.266  94.866  1.00 28.03 ? 270  ASP B CB  1 
ATOM   5265  C CG  . ASP B  1 264 ? -12.712 -19.098  96.057  1.00 32.87 ? 270  ASP B CG  1 
ATOM   5266  O OD1 . ASP B  1 264 ? -13.256 -20.203  95.860  1.00 39.17 ? 270  ASP B OD1 1 
ATOM   5267  O OD2 . ASP B  1 264 ? -12.478 -18.647  97.196  1.00 33.30 ? 270  ASP B OD2 1 
ATOM   5268  N N   . VAL B  1 265 ? -15.061 -16.833  93.604  1.00 21.98 ? 271  VAL B N   1 
ATOM   5269  C CA  . VAL B  1 265 ? -16.267 -16.128  94.075  1.00 18.74 ? 271  VAL B CA  1 
ATOM   5270  C C   . VAL B  1 265 ? -16.657 -16.514  95.508  1.00 16.96 ? 271  VAL B C   1 
ATOM   5271  O O   . VAL B  1 265 ? -17.778 -16.932  95.762  1.00 18.94 ? 271  VAL B O   1 
ATOM   5272  C CB  . VAL B  1 265 ? -17.503 -16.340  93.125  1.00 19.27 ? 271  VAL B CB  1 
ATOM   5273  C CG1 . VAL B  1 265 ? -17.350 -15.529  91.845  1.00 20.82 ? 271  VAL B CG1 1 
ATOM   5274  C CG2 . VAL B  1 265 ? -17.747 -17.808  92.795  1.00 17.99 ? 271  VAL B CG2 1 
ATOM   5275  N N   . GLY B  1 266 ? -15.721 -16.370  96.443  1.00 16.47 ? 272  GLY B N   1 
ATOM   5276  C CA  . GLY B  1 266 ? -15.953 -16.782  97.816  1.00 19.16 ? 272  GLY B CA  1 
ATOM   5277  C C   . GLY B  1 266 ? -16.769 -15.820  98.664  1.00 20.36 ? 272  GLY B C   1 
ATOM   5278  O O   . GLY B  1 266 ? -17.182 -16.163  99.768  1.00 21.35 ? 272  GLY B O   1 
ATOM   5279  N N   . THR B  1 267 ? -16.992 -14.614  98.148  1.00 20.90 ? 273  THR B N   1 
ATOM   5280  C CA  . THR B  1 267 ? -17.754 -13.584  98.850  1.00 21.28 ? 273  THR B CA  1 
ATOM   5281  C C   . THR B  1 267 ? -18.800 -12.968  97.930  1.00 20.19 ? 273  THR B C   1 
ATOM   5282  O O   . THR B  1 267 ? -18.758 -13.152  96.718  1.00 18.13 ? 273  THR B O   1 
ATOM   5283  C CB  . THR B  1 267 ? -16.856 -12.447  99.370  1.00 17.30 ? 273  THR B CB  1 
ATOM   5284  O OG1 . THR B  1 267 ? -16.303 -11.736  98.256  1.00 16.19 ? 273  THR B OG1 1 
ATOM   5285  C CG2 . THR B  1 267 ? -15.728 -12.985  100.243 1.00 21.82 ? 273  THR B CG2 1 
ATOM   5286  N N   . ILE B  1 268 ? -19.727 -12.221  98.509  1.00 21.06 ? 274  ILE B N   1 
ATOM   5287  C CA  . ILE B  1 268 ? -20.764 -11.573  97.725  1.00 16.22 ? 274  ILE B CA  1 
ATOM   5288  C C   . ILE B  1 268 ? -20.168 -10.490  96.806  1.00 19.60 ? 274  ILE B C   1 
ATOM   5289  O O   . ILE B  1 268 ? -20.528 -10.403  95.633  1.00 18.50 ? 274  ILE B O   1 
ATOM   5290  C CB  . ILE B  1 268 ? -21.837 -11.000  98.646  1.00 13.53 ? 274  ILE B CB  1 
ATOM   5291  C CG1 . ILE B  1 268 ? -22.553 -12.154  99.350  1.00 11.09 ? 274  ILE B CG1 1 
ATOM   5292  C CG2 . ILE B  1 268 ? -22.818 -10.153  97.867  1.00 15.76 ? 274  ILE B CG2 1 
ATOM   5293  C CD1 . ILE B  1 268 ? -23.392 -11.740  100.530 1.00 13.84 ? 274  ILE B CD1 1 
ATOM   5294  N N   . ASP B  1 269 ? -19.239 -9.687   97.313  1.00 18.51 ? 275  ASP B N   1 
ATOM   5295  C CA  . ASP B  1 269 ? -18.505 -8.773   96.439  1.00 19.04 ? 275  ASP B CA  1 
ATOM   5296  C C   . ASP B  1 269 ? -17.824 -9.482   95.268  1.00 16.49 ? 275  ASP B C   1 
ATOM   5297  O O   . ASP B  1 269 ? -17.919 -9.036   94.140  1.00 17.55 ? 275  ASP B O   1 
ATOM   5298  C CB  . ASP B  1 269 ? -17.431 -7.997   97.208  1.00 25.86 ? 275  ASP B CB  1 
ATOM   5299  C CG  . ASP B  1 269 ? -18.009 -6.983   98.143  1.00 31.76 ? 275  ASP B CG  1 
ATOM   5300  O OD1 . ASP B  1 269 ? -19.202 -6.661   97.993  1.00 33.16 ? 275  ASP B OD1 1 
ATOM   5301  O OD2 . ASP B  1 269 ? -17.263 -6.491   99.011  1.00 35.79 ? 275  ASP B OD2 1 
ATOM   5302  N N   . ALA B  1 270 ? -17.108 -10.563  95.556  1.00 17.42 ? 276  ALA B N   1 
ATOM   5303  C CA  . ALA B  1 270 ? -16.420 -11.329  94.523  1.00 19.33 ? 276  ALA B CA  1 
ATOM   5304  C C   . ALA B  1 270 ? -17.422 -11.918  93.541  1.00 16.28 ? 276  ALA B C   1 
ATOM   5305  O O   . ALA B  1 270 ? -17.207 -11.896  92.329  1.00 19.85 ? 276  ALA B O   1 
ATOM   5306  C CB  . ALA B  1 270 ? -15.577 -12.434  95.148  1.00 18.12 ? 276  ALA B CB  1 
ATOM   5307  N N   . TYR B  1 271 ? -18.515 -12.451  94.074  1.00 14.39 ? 277  TYR B N   1 
ATOM   5308  C CA  . TYR B  1 271 ? -19.587 -12.989  93.246  1.00 13.38 ? 277  TYR B CA  1 
ATOM   5309  C C   . TYR B  1 271 ? -20.173 -11.915  92.345  1.00 15.88 ? 277  TYR B C   1 
ATOM   5310  O O   . TYR B  1 271 ? -20.272 -12.083  91.131  1.00 17.55 ? 277  TYR B O   1 
ATOM   5311  C CB  . TYR B  1 271 ? -20.683 -13.586  94.114  1.00 14.22 ? 277  TYR B CB  1 
ATOM   5312  C CG  . TYR B  1 271 ? -21.823 -14.155  93.314  1.00 13.57 ? 277  TYR B CG  1 
ATOM   5313  C CD1 . TYR B  1 271 ? -21.675 -15.353  92.633  1.00 15.82 ? 277  TYR B CD1 1 
ATOM   5314  C CD2 . TYR B  1 271 ? -23.048 -13.506  93.239  1.00 14.54 ? 277  TYR B CD2 1 
ATOM   5315  C CE1 . TYR B  1 271 ? -22.704 -15.887  91.891  1.00 13.57 ? 277  TYR B CE1 1 
ATOM   5316  C CE2 . TYR B  1 271 ? -24.091 -14.041  92.504  1.00 15.49 ? 277  TYR B CE2 1 
ATOM   5317  C CZ  . TYR B  1 271 ? -23.911 -15.239  91.836  1.00 14.46 ? 277  TYR B CZ  1 
ATOM   5318  O OH  . TYR B  1 271 ? -24.928 -15.804  91.102  1.00 19.13 ? 277  TYR B OH  1 
ATOM   5319  N N   . TRP B  1 272 ? -20.562 -10.805  92.951  1.00 15.62 ? 278  TRP B N   1 
ATOM   5320  C CA  . TRP B  1 272 ? -21.080 -9.685   92.199  1.00 17.92 ? 278  TRP B CA  1 
ATOM   5321  C C   . TRP B  1 272 ? -20.044 -9.216   91.182  1.00 15.33 ? 278  TRP B C   1 
ATOM   5322  O O   . TRP B  1 272 ? -20.362 -9.015   90.010  1.00 17.80 ? 278  TRP B O   1 
ATOM   5323  C CB  . TRP B  1 272 ? -21.469 -8.553   93.155  1.00 20.20 ? 278  TRP B CB  1 
ATOM   5324  C CG  . TRP B  1 272 ? -21.933 -7.321   92.486  1.00 18.40 ? 278  TRP B CG  1 
ATOM   5325  C CD1 . TRP B  1 272 ? -23.207 -7.022   92.114  1.00 19.35 ? 278  TRP B CD1 1 
ATOM   5326  C CD2 . TRP B  1 272 ? -21.132 -6.195   92.115  1.00 19.64 ? 278  TRP B CD2 1 
ATOM   5327  N NE1 . TRP B  1 272 ? -23.252 -5.781   91.528  1.00 18.94 ? 278  TRP B NE1 1 
ATOM   5328  C CE2 . TRP B  1 272 ? -21.990 -5.253   91.517  1.00 17.35 ? 278  TRP B CE2 1 
ATOM   5329  C CE3 . TRP B  1 272 ? -19.773 -5.890   92.237  1.00 20.49 ? 278  TRP B CE3 1 
ATOM   5330  C CZ2 . TRP B  1 272 ? -21.534 -4.035   91.038  1.00 20.55 ? 278  TRP B CZ2 1 
ATOM   5331  C CZ3 . TRP B  1 272 ? -19.321 -4.679   91.755  1.00 22.02 ? 278  TRP B CZ3 1 
ATOM   5332  C CH2 . TRP B  1 272 ? -20.198 -3.768   91.163  1.00 21.67 ? 278  TRP B CH2 1 
ATOM   5333  N N   . GLN B  1 273 ? -18.797 -9.064   91.617  1.00 17.74 ? 279  GLN B N   1 
ATOM   5334  C CA  . GLN B  1 273 ? -17.769 -8.522   90.735  1.00 18.86 ? 279  GLN B CA  1 
ATOM   5335  C C   . GLN B  1 273 ? -17.504 -9.431   89.526  1.00 22.23 ? 279  GLN B C   1 
ATOM   5336  O O   . GLN B  1 273 ? -17.356 -8.945   88.410  1.00 20.07 ? 279  GLN B O   1 
ATOM   5337  C CB  . GLN B  1 273 ? -16.470 -8.282   91.502  1.00 21.35 ? 279  GLN B CB  1 
ATOM   5338  C CG  . GLN B  1 273 ? -15.478 -7.461   90.733  1.00 25.28 ? 279  GLN B CG  1 
ATOM   5339  C CD  . GLN B  1 273 ? -15.874 -6.001   90.666  1.00 31.08 ? 279  GLN B CD  1 
ATOM   5340  O OE1 . GLN B  1 273 ? -15.981 -5.332   91.698  1.00 32.36 ? 279  GLN B OE1 1 
ATOM   5341  N NE2 . GLN B  1 273 ? -16.113 -5.500   89.452  1.00 28.40 ? 279  GLN B NE2 1 
ATOM   5342  N N   . ALA B  1 274 ? -17.470 -10.745  89.736  1.00 22.30 ? 280  ALA B N   1 
ATOM   5343  C CA  . ALA B  1 274 ? -17.174 -11.668  88.641  1.00 22.09 ? 280  ALA B CA  1 
ATOM   5344  C C   . ALA B  1 274 ? -18.267 -11.670  87.568  1.00 19.00 ? 280  ALA B C   1 
ATOM   5345  O O   . ALA B  1 274 ? -17.980 -11.794  86.377  1.00 21.79 ? 280  ALA B O   1 
ATOM   5346  C CB  . ALA B  1 274 ? -16.964 -13.072  89.177  1.00 23.28 ? 280  ALA B CB  1 
ATOM   5347  N N   . ASN B  1 275 ? -19.520 -11.534  87.989  1.00 15.03 ? 281  ASN B N   1 
ATOM   5348  C CA  . ASN B  1 275 ? -20.640 -11.491  87.054  1.00 12.79 ? 281  ASN B CA  1 
ATOM   5349  C C   . ASN B  1 275 ? -20.711 -10.157  86.329  1.00 14.26 ? 281  ASN B C   1 
ATOM   5350  O O   . ASN B  1 275 ? -20.813 -10.103  85.111  1.00 12.67 ? 281  ASN B O   1 
ATOM   5351  C CB  . ASN B  1 275 ? -21.956 -11.765  87.786  1.00 12.41 ? 281  ASN B CB  1 
ATOM   5352  C CG  . ASN B  1 275 ? -22.145 -13.236  88.109  1.00 16.77 ? 281  ASN B CG  1 
ATOM   5353  O OD1 . ASN B  1 275 ? -22.535 -14.022  87.254  1.00 18.99 ? 281  ASN B OD1 1 
ATOM   5354  N ND2 . ASN B  1 275 ? -21.871 -13.609  89.347  1.00 20.19 ? 281  ASN B ND2 1 
ATOM   5355  N N   . ILE B  1 276 ? -20.635 -9.070   87.082  1.00 16.39 ? 282  ILE B N   1 
ATOM   5356  C CA  . ILE B  1 276 ? -20.796 -7.764   86.486  1.00 17.60 ? 282  ILE B CA  1 
ATOM   5357  C C   . ILE B  1 276 ? -19.627 -7.458   85.528  1.00 16.42 ? 282  ILE B C   1 
ATOM   5358  O O   . ILE B  1 276 ? -19.798 -6.737   84.555  1.00 16.75 ? 282  ILE B O   1 
ATOM   5359  C CB  . ILE B  1 276 ? -20.945 -6.687   87.584  1.00 20.32 ? 282  ILE B CB  1 
ATOM   5360  C CG1 . ILE B  1 276 ? -22.134 -5.782   87.280  1.00 22.69 ? 282  ILE B CG1 1 
ATOM   5361  C CG2 . ILE B  1 276 ? -19.672 -5.888   87.763  1.00 25.02 ? 282  ILE B CG2 1 
ATOM   5362  C CD1 . ILE B  1 276 ? -23.431 -6.526   87.206  1.00 22.11 ? 282  ILE B CD1 1 
ATOM   5363  N N   . ASP B  1 277 ? -18.460 -8.046   85.775  1.00 13.45 ? 283  ASP B N   1 
ATOM   5364  C CA  . ASP B  1 277 ? -17.317 -7.886   84.876  1.00 17.18 ? 283  ASP B CA  1 
ATOM   5365  C C   . ASP B  1 277 ? -17.611 -8.432   83.475  1.00 15.87 ? 283  ASP B C   1 
ATOM   5366  O O   . ASP B  1 277 ? -16.992 -8.019   82.492  1.00 12.99 ? 283  ASP B O   1 
ATOM   5367  C CB  . ASP B  1 277 ? -16.078 -8.574   85.456  1.00 21.11 ? 283  ASP B CB  1 
ATOM   5368  C CG  . ASP B  1 277 ? -15.410 -7.764   86.582  1.00 27.90 ? 283  ASP B CG  1 
ATOM   5369  O OD1 . ASP B  1 277 ? -15.729 -6.562   86.765  1.00 27.51 ? 283  ASP B OD1 1 
ATOM   5370  O OD2 . ASP B  1 277 ? -14.551 -8.341   87.289  1.00 27.87 ? 283  ASP B OD2 1 
ATOM   5371  N N   . LEU B  1 278 ? -18.570 -9.347   83.374  1.00 16.60 ? 284  LEU B N   1 
ATOM   5372  C CA  . LEU B  1 278 ? -18.939 -9.904   82.073  1.00 13.45 ? 284  LEU B CA  1 
ATOM   5373  C C   . LEU B  1 278 ? -19.609 -8.865   81.181  1.00 16.25 ? 284  LEU B C   1 
ATOM   5374  O O   . LEU B  1 278 ? -19.766 -9.088   79.973  1.00 18.46 ? 284  LEU B O   1 
ATOM   5375  C CB  . LEU B  1 278 ? -19.856 -11.125  82.238  1.00 13.00 ? 284  LEU B CB  1 
ATOM   5376  C CG  . LEU B  1 278 ? -19.189 -12.342  82.895  1.00 14.77 ? 284  LEU B CG  1 
ATOM   5377  C CD1 . LEU B  1 278 ? -20.178 -13.463  83.097  1.00 10.11 ? 284  LEU B CD1 1 
ATOM   5378  C CD2 . LEU B  1 278 ? -18.017 -12.826  82.061  1.00 17.82 ? 284  LEU B CD2 1 
ATOM   5379  N N   . THR B  1 279 ? -20.003 -7.733   81.758  1.00 15.42 ? 285  THR B N   1 
ATOM   5380  C CA  . THR B  1 279 ? -20.640 -6.691   80.960  1.00 17.16 ? 285  THR B CA  1 
ATOM   5381  C C   . THR B  1 279 ? -19.607 -5.766   80.284  1.00 20.14 ? 285  THR B C   1 
ATOM   5382  O O   . THR B  1 279 ? -19.976 -4.928   79.462  1.00 21.30 ? 285  THR B O   1 
ATOM   5383  C CB  . THR B  1 279 ? -21.635 -5.835   81.810  1.00 13.75 ? 285  THR B CB  1 
ATOM   5384  O OG1 . THR B  1 279 ? -20.922 -5.019   82.741  1.00 14.47 ? 285  THR B OG1 1 
ATOM   5385  C CG2 . THR B  1 279 ? -22.601 -6.721   82.563  1.00 11.79 ? 285  THR B CG2 1 
ATOM   5386  N N   . ASP B  1 280 ? -18.323 -5.929   80.605  1.00 17.92 ? 286  ASP B N   1 
ATOM   5387  C CA  . ASP B  1 280 ? -17.277 -5.099   79.981  1.00 22.59 ? 286  ASP B CA  1 
ATOM   5388  C C   . ASP B  1 280 ? -17.217 -5.297   78.469  1.00 20.06 ? 286  ASP B C   1 
ATOM   5389  O O   . ASP B  1 280 ? -17.673 -6.318   77.949  1.00 19.52 ? 286  ASP B O   1 
ATOM   5390  C CB  . ASP B  1 280 ? -15.890 -5.398   80.566  1.00 20.31 ? 286  ASP B CB  1 
ATOM   5391  C CG  . ASP B  1 280 ? -15.783 -5.075   82.042  1.00 26.20 ? 286  ASP B CG  1 
ATOM   5392  O OD1 . ASP B  1 280 ? -16.615 -4.305   82.563  1.00 24.71 ? 286  ASP B OD1 1 
ATOM   5393  O OD2 . ASP B  1 280 ? -14.837 -5.580   82.682  1.00 29.09 ? 286  ASP B OD2 1 
ATOM   5394  N N   . VAL B  1 281 ? -16.634 -4.325   77.772  1.00 24.91 ? 287  VAL B N   1 
ATOM   5395  C CA  . VAL B  1 281 ? -16.381 -4.462   76.342  1.00 22.00 ? 287  VAL B CA  1 
ATOM   5396  C C   . VAL B  1 281 ? -15.385 -5.588   76.098  1.00 26.70 ? 287  VAL B C   1 
ATOM   5397  O O   . VAL B  1 281 ? -15.537 -6.374   75.169  1.00 30.60 ? 287  VAL B O   1 
ATOM   5398  C CB  . VAL B  1 281 ? -15.835 -3.162   75.717  1.00 19.84 ? 287  VAL B CB  1 
ATOM   5399  C CG1 . VAL B  1 281 ? -15.745 -3.309   74.213  1.00 19.10 ? 287  VAL B CG1 1 
ATOM   5400  C CG2 . VAL B  1 281 ? -16.722 -1.988   76.075  1.00 16.39 ? 287  VAL B CG2 1 
ATOM   5401  N N   . VAL B  1 282 ? -14.365 -5.660   76.946  1.00 26.28 ? 288  VAL B N   1 
ATOM   5402  C CA  . VAL B  1 282 ? -13.395 -6.751   76.896  1.00 24.96 ? 288  VAL B CA  1 
ATOM   5403  C C   . VAL B  1 282 ? -13.344 -7.434   78.255  1.00 18.82 ? 288  VAL B C   1 
ATOM   5404  O O   . VAL B  1 282 ? -12.573 -7.052   79.121  1.00 20.05 ? 288  VAL B O   1 
ATOM   5405  C CB  . VAL B  1 282 ? -11.988 -6.253   76.512  1.00 30.10 ? 288  VAL B CB  1 
ATOM   5406  C CG1 . VAL B  1 282 ? -11.019 -7.423   76.388  1.00 31.08 ? 288  VAL B CG1 1 
ATOM   5407  C CG2 . VAL B  1 282 ? -12.047 -5.459   75.220  1.00 31.64 ? 288  VAL B CG2 1 
ATOM   5408  N N   . PRO B  1 283 ? -14.201 -8.432   78.462  1.00 17.20 ? 289  PRO B N   1 
ATOM   5409  C CA  . PRO B  1 283 ? -14.195 -9.077   79.775  1.00 16.02 ? 289  PRO B CA  1 
ATOM   5410  C C   . PRO B  1 283 ? -13.019 -10.033  79.929  1.00 18.54 ? 289  PRO B C   1 
ATOM   5411  O O   . PRO B  1 283 ? -12.491 -10.555  78.943  1.00 20.32 ? 289  PRO B O   1 
ATOM   5412  C CB  . PRO B  1 283 ? -15.529 -9.845   79.812  1.00 11.70 ? 289  PRO B CB  1 
ATOM   5413  C CG  . PRO B  1 283 ? -16.297 -9.386   78.583  1.00 13.02 ? 289  PRO B CG  1 
ATOM   5414  C CD  . PRO B  1 283 ? -15.266 -8.949   77.590  1.00 13.68 ? 289  PRO B CD  1 
ATOM   5415  N N   . ASP B  1 284 ? -12.635 -10.265  81.176  1.00 17.86 ? 290  ASP B N   1 
ATOM   5416  C CA  . ASP B  1 284 ? -11.556 -11.183  81.504  1.00 17.97 ? 290  ASP B CA  1 
ATOM   5417  C C   . ASP B  1 284 ? -11.896 -12.620  81.122  1.00 17.61 ? 290  ASP B C   1 
ATOM   5418  O O   . ASP B  1 284 ? -11.009 -13.394  80.763  1.00 18.84 ? 290  ASP B O   1 
ATOM   5419  C CB  . ASP B  1 284 ? -11.249 -11.088  82.988  1.00 16.97 ? 290  ASP B CB  1 
ATOM   5420  C CG  . ASP B  1 284 ? -10.886 -9.683   83.406  1.00 25.33 ? 290  ASP B CG  1 
ATOM   5421  O OD1 . ASP B  1 284 ? -10.246 -8.972   82.593  1.00 23.11 ? 290  ASP B OD1 1 
ATOM   5422  O OD2 . ASP B  1 284 ? -11.256 -9.289   84.536  1.00 27.46 ? 290  ASP B OD2 1 
ATOM   5423  N N   . LEU B  1 285 ? -13.181 -12.968  81.215  1.00 15.03 ? 291  LEU B N   1 
ATOM   5424  C CA  . LEU B  1 285 ? -13.674 -14.273  80.784  1.00 12.61 ? 291  LEU B CA  1 
ATOM   5425  C C   . LEU B  1 285 ? -14.409 -14.145  79.463  1.00 19.05 ? 291  LEU B C   1 
ATOM   5426  O O   . LEU B  1 285 ? -15.332 -13.341  79.339  1.00 20.01 ? 291  LEU B O   1 
ATOM   5427  C CB  . LEU B  1 285 ? -14.599 -14.884  81.840  1.00 14.03 ? 291  LEU B CB  1 
ATOM   5428  C CG  . LEU B  1 285 ? -15.162 -16.277  81.542  1.00 11.30 ? 291  LEU B CG  1 
ATOM   5429  C CD1 . LEU B  1 285 ? -14.053 -17.303  81.473  1.00 10.90 ? 291  LEU B CD1 1 
ATOM   5430  C CD2 . LEU B  1 285 ? -16.180 -16.675  82.603  1.00 15.18 ? 291  LEU B CD2 1 
ATOM   5431  N N   . ASP B  1 286 ? -14.000 -14.935  78.476  1.00 17.92 ? 292  ASP B N   1 
ATOM   5432  C CA  . ASP B  1 286 ? -14.635 -14.900  77.164  1.00 21.71 ? 292  ASP B CA  1 
ATOM   5433  C C   . ASP B  1 286 ? -15.727 -15.966  77.070  1.00 24.65 ? 292  ASP B C   1 
ATOM   5434  O O   . ASP B  1 286 ? -15.421 -17.140  76.899  1.00 23.35 ? 292  ASP B O   1 
ATOM   5435  C CB  . ASP B  1 286 ? -13.586 -15.099  76.066  1.00 24.42 ? 292  ASP B CB  1 
ATOM   5436  C CG  . ASP B  1 286 ? -14.191 -15.166  74.676  1.00 26.82 ? 292  ASP B CG  1 
ATOM   5437  O OD1 . ASP B  1 286 ? -15.314 -14.659  74.480  1.00 27.57 ? 292  ASP B OD1 1 
ATOM   5438  O OD2 . ASP B  1 286 ? -13.526 -15.719  73.774  1.00 30.41 ? 292  ASP B OD2 1 
ATOM   5439  N N   . ILE B  1 287 ? -16.994 -15.567  77.186  1.00 29.87 ? 293  ILE B N   1 
ATOM   5440  C CA  . ILE B  1 287 ? -18.076 -16.553  77.151  1.00 32.21 ? 293  ILE B CA  1 
ATOM   5441  C C   . ILE B  1 287 ? -18.548 -16.808  75.718  1.00 32.63 ? 293  ILE B C   1 
ATOM   5442  O O   . ILE B  1 287 ? -19.312 -17.745  75.474  1.00 30.50 ? 293  ILE B O   1 
ATOM   5443  C CB  . ILE B  1 287 ? -19.291 -16.137  78.040  1.00 26.96 ? 293  ILE B CB  1 
ATOM   5444  C CG1 . ILE B  1 287 ? -20.102 -15.002  77.398  1.00 27.87 ? 293  ILE B CG1 1 
ATOM   5445  C CG2 . ILE B  1 287 ? -18.820 -15.792  79.457  1.00 20.81 ? 293  ILE B CG2 1 
ATOM   5446  C CD1 . ILE B  1 287 ? -21.409 -14.664  78.139  1.00 27.89 ? 293  ILE B CD1 1 
ATOM   5447  N N   . TYR B  1 288 ? -18.085 -15.992  74.772  1.00 26.77 ? 294  TYR B N   1 
ATOM   5448  C CA  . TYR B  1 288 ? -18.452 -16.176  73.369  1.00 24.60 ? 294  TYR B CA  1 
ATOM   5449  C C   . TYR B  1 288 ? -17.437 -17.059  72.650  1.00 24.76 ? 294  TYR B C   1 
ATOM   5450  O O   . TYR B  1 288 ? -17.437 -17.145  71.421  1.00 32.40 ? 294  TYR B O   1 
ATOM   5451  C CB  . TYR B  1 288 ? -18.601 -14.818  72.676  1.00 18.45 ? 294  TYR B CB  1 
ATOM   5452  C CG  . TYR B  1 288 ? -19.799 -14.083  73.208  1.00 21.15 ? 294  TYR B CG  1 
ATOM   5453  C CD1 . TYR B  1 288 ? -19.705 -13.301  74.354  1.00 22.78 ? 294  TYR B CD1 1 
ATOM   5454  C CD2 . TYR B  1 288 ? -21.037 -14.218  72.609  1.00 16.18 ? 294  TYR B CD2 1 
ATOM   5455  C CE1 . TYR B  1 288 ? -20.809 -12.653  74.872  1.00 21.10 ? 294  TYR B CE1 1 
ATOM   5456  C CE2 . TYR B  1 288 ? -22.151 -13.575  73.122  1.00 20.03 ? 294  TYR B CE2 1 
ATOM   5457  C CZ  . TYR B  1 288 ? -22.028 -12.795  74.253  1.00 21.51 ? 294  TYR B CZ  1 
ATOM   5458  O OH  . TYR B  1 288 ? -23.124 -12.153  74.768  1.00 26.81 ? 294  TYR B OH  1 
ATOM   5459  N N   . ASP B  1 289 ? -16.586 -17.728  73.422  1.00 24.96 ? 295  ASP B N   1 
ATOM   5460  C CA  . ASP B  1 289 ? -15.634 -18.685  72.859  1.00 27.32 ? 295  ASP B CA  1 
ATOM   5461  C C   . ASP B  1 289 ? -16.290 -20.046  72.601  1.00 28.91 ? 295  ASP B C   1 
ATOM   5462  O O   . ASP B  1 289 ? -17.194 -20.465  73.336  1.00 28.51 ? 295  ASP B O   1 
ATOM   5463  C CB  . ASP B  1 289 ? -14.425 -18.867  73.780  1.00 31.69 ? 295  ASP B CB  1 
ATOM   5464  C CG  . ASP B  1 289 ? -13.686 -20.177  73.523  1.00 40.60 ? 295  ASP B CG  1 
ATOM   5465  O OD1 . ASP B  1 289 ? -13.342 -20.462  72.355  1.00 43.97 ? 295  ASP B OD1 1 
ATOM   5466  O OD2 . ASP B  1 289 ? -13.474 -20.940  74.486  1.00 43.32 ? 295  ASP B OD2 1 
ATOM   5467  N N   . LYS B  1 290 ? -15.807 -20.729  71.562  1.00 22.76 ? 296  LYS B N   1 
ATOM   5468  C CA  . LYS B  1 290 ? -16.343 -22.012  71.139  1.00 22.53 ? 296  LYS B CA  1 
ATOM   5469  C C   . LYS B  1 290 ? -15.312 -23.132  71.156  1.00 22.39 ? 296  LYS B C   1 
ATOM   5470  O O   . LYS B  1 290 ? -15.669 -24.300  70.979  1.00 23.58 ? 296  LYS B O   1 
ATOM   5471  C CB  . LYS B  1 290 ? -16.934 -21.908  69.732  1.00 21.83 ? 296  LYS B CB  1 
ATOM   5472  C CG  . LYS B  1 290 ? -18.192 -21.078  69.656  1.00 25.10 ? 296  LYS B CG  1 
ATOM   5473  C CD  . LYS B  1 290 ? -18.854 -21.164  68.288  1.00 29.01 ? 296  LYS B CD  1 
ATOM   5474  C CE  . LYS B  1 290 ? -19.888 -20.068  68.141  1.00 33.84 ? 296  LYS B CE  1 
ATOM   5475  N NZ  . LYS B  1 290 ? -19.979 -19.575  66.742  1.00 41.52 ? 296  LYS B NZ  1 
ATOM   5476  N N   . SER B  1 291 ? -14.042 -22.788  71.347  1.00 20.65 ? 297  SER B N   1 
ATOM   5477  C CA  . SER B  1 291 ? -12.984 -23.797  71.292  1.00 23.49 ? 297  SER B CA  1 
ATOM   5478  C C   . SER B  1 291 ? -12.852 -24.527  72.629  1.00 23.88 ? 297  SER B C   1 
ATOM   5479  O O   . SER B  1 291 ? -12.110 -25.502  72.742  1.00 24.09 ? 297  SER B O   1 
ATOM   5480  C CB  . SER B  1 291 ? -11.635 -23.170  70.893  1.00 25.24 ? 297  SER B CB  1 
ATOM   5481  O OG  . SER B  1 291 ? -11.066 -22.408  71.951  1.00 27.46 ? 297  SER B OG  1 
ATOM   5482  N N   . TRP B  1 292 ? -13.563 -24.049  73.647  1.00 19.05 ? 298  TRP B N   1 
ATOM   5483  C CA  . TRP B  1 292 ? -13.599 -24.741  74.937  1.00 16.36 ? 298  TRP B CA  1 
ATOM   5484  C C   . TRP B  1 292 ? -14.922 -24.448  75.615  1.00 12.79 ? 298  TRP B C   1 
ATOM   5485  O O   . TRP B  1 292 ? -14.970 -23.719  76.598  1.00 17.20 ? 298  TRP B O   1 
ATOM   5486  C CB  . TRP B  1 292 ? -12.434 -24.319  75.829  1.00 10.57 ? 298  TRP B CB  1 
ATOM   5487  C CG  . TRP B  1 292 ? -12.115 -25.301  76.932  1.00 11.42 ? 298  TRP B CG  1 
ATOM   5488  C CD1 . TRP B  1 292 ? -12.538 -25.244  78.224  1.00 12.34 ? 298  TRP B CD1 1 
ATOM   5489  C CD2 . TRP B  1 292 ? -11.299 -26.472  76.830  1.00 13.63 ? 298  TRP B CD2 1 
ATOM   5490  N NE1 . TRP B  1 292 ? -12.032 -26.302  78.939  1.00 11.80 ? 298  TRP B NE1 1 
ATOM   5491  C CE2 . TRP B  1 292 ? -11.270 -27.074  78.103  1.00 14.36 ? 298  TRP B CE2 1 
ATOM   5492  C CE3 . TRP B  1 292 ? -10.590 -27.071  75.786  1.00 14.10 ? 298  TRP B CE3 1 
ATOM   5493  C CZ2 . TRP B  1 292 ? -10.560 -28.241  78.362  1.00 13.40 ? 298  TRP B CZ2 1 
ATOM   5494  C CZ3 . TRP B  1 292 ? -9.890  -28.236  76.043  1.00 13.18 ? 298  TRP B CZ3 1 
ATOM   5495  C CH2 . TRP B  1 292 ? -9.882  -28.809  77.322  1.00 12.97 ? 298  TRP B CH2 1 
ATOM   5496  N N   . PRO B  1 293 ? -16.006 -25.019  75.079  1.00 14.85 ? 299  PRO B N   1 
ATOM   5497  C CA  . PRO B  1 293 ? -17.351 -24.601  75.457  1.00 13.98 ? 299  PRO B CA  1 
ATOM   5498  C C   . PRO B  1 293 ? -17.746 -25.095  76.836  1.00 11.34 ? 299  PRO B C   1 
ATOM   5499  O O   . PRO B  1 293 ? -17.258 -26.134  77.290  1.00 12.25 ? 299  PRO B O   1 
ATOM   5500  C CB  . PRO B  1 293 ? -18.222 -25.240  74.377  1.00 14.07 ? 299  PRO B CB  1 
ATOM   5501  C CG  . PRO B  1 293 ? -17.494 -26.455  74.024  1.00 16.54 ? 299  PRO B CG  1 
ATOM   5502  C CD  . PRO B  1 293 ? -16.039 -26.110  74.090  1.00 16.28 ? 299  PRO B CD  1 
ATOM   5503  N N   . ILE B  1 294 ? -18.619 -24.339  77.493  1.00 12.15 ? 300  ILE B N   1 
ATOM   5504  C CA  . ILE B  1 294 ? -19.133 -24.712  78.801  1.00 10.90 ? 300  ILE B CA  1 
ATOM   5505  C C   . ILE B  1 294 ? -20.539 -25.267  78.617  1.00 12.44 ? 300  ILE B C   1 
ATOM   5506  O O   . ILE B  1 294 ? -21.446 -24.553  78.196  1.00 13.65 ? 300  ILE B O   1 
ATOM   5507  C CB  . ILE B  1 294 ? -19.141 -23.517  79.774  1.00 11.01 ? 300  ILE B CB  1 
ATOM   5508  C CG1 . ILE B  1 294 ? -17.742 -22.898  79.872  1.00 11.53 ? 300  ILE B CG1 1 
ATOM   5509  C CG2 . ILE B  1 294 ? -19.655 -23.941  81.154  1.00 18.10 ? 300  ILE B CG2 1 
ATOM   5510  C CD1 . ILE B  1 294 ? -16.643 -23.891  80.163  1.00 8.97  ? 300  ILE B CD1 1 
ATOM   5511  N N   . TRP B  1 295 ? -20.703 -26.558  78.876  1.00 7.52  ? 301  TRP B N   1 
ATOM   5512  C CA  . TRP B  1 295 ? -22.014 -27.179  78.777  1.00 7.18  ? 301  TRP B CA  1 
ATOM   5513  C C   . TRP B  1 295 ? -22.802 -26.884  80.054  1.00 9.49  ? 301  TRP B C   1 
ATOM   5514  O O   . TRP B  1 295 ? -22.224 -26.789  81.128  1.00 12.92 ? 301  TRP B O   1 
ATOM   5515  C CB  . TRP B  1 295 ? -21.880 -28.688  78.557  1.00 7.98  ? 301  TRP B CB  1 
ATOM   5516  C CG  . TRP B  1 295 ? -23.191 -29.373  78.451  1.00 10.75 ? 301  TRP B CG  1 
ATOM   5517  C CD1 . TRP B  1 295 ? -23.864 -30.010  79.455  1.00 11.35 ? 301  TRP B CD1 1 
ATOM   5518  C CD2 . TRP B  1 295 ? -24.025 -29.468  77.288  1.00 10.94 ? 301  TRP B CD2 1 
ATOM   5519  N NE1 . TRP B  1 295 ? -25.055 -30.498  78.989  1.00 12.43 ? 301  TRP B NE1 1 
ATOM   5520  C CE2 . TRP B  1 295 ? -25.181 -30.180  77.664  1.00 11.16 ? 301  TRP B CE2 1 
ATOM   5521  C CE3 . TRP B  1 295 ? -23.907 -29.028  75.967  1.00 10.04 ? 301  TRP B CE3 1 
ATOM   5522  C CZ2 . TRP B  1 295 ? -26.204 -30.469  76.769  1.00 15.18 ? 301  TRP B CZ2 1 
ATOM   5523  C CZ3 . TRP B  1 295 ? -24.932 -29.315  75.081  1.00 10.40 ? 301  TRP B CZ3 1 
ATOM   5524  C CH2 . TRP B  1 295 ? -26.060 -30.023  75.484  1.00 13.40 ? 301  TRP B CH2 1 
ATOM   5525  N N   . THR B  1 296 ? -24.116 -26.748  79.945  1.00 13.66 ? 302  THR B N   1 
ATOM   5526  C CA  . THR B  1 296 ? -24.949 -26.577  81.131  1.00 12.61 ? 302  THR B CA  1 
ATOM   5527  C C   . THR B  1 296 ? -26.358 -27.085  80.851  1.00 13.73 ? 302  THR B C   1 
ATOM   5528  O O   . THR B  1 296 ? -26.640 -27.592  79.755  1.00 10.36 ? 302  THR B O   1 
ATOM   5529  C CB  . THR B  1 296 ? -25.003 -25.091  81.589  1.00 13.02 ? 302  THR B CB  1 
ATOM   5530  O OG1 . THR B  1 296 ? -25.748 -24.977  82.811  1.00 12.49 ? 302  THR B OG1 1 
ATOM   5531  C CG2 . THR B  1 296 ? -25.641 -24.221  80.518  1.00 13.03 ? 302  THR B CG2 1 
ATOM   5532  N N   . TYR B  1 297 ? -27.231 -26.980  81.850  1.00 12.25 ? 303  TYR B N   1 
ATOM   5533  C CA  . TYR B  1 297 ? -28.645 -27.230  81.632  1.00 10.58 ? 303  TYR B CA  1 
ATOM   5534  C C   . TYR B  1 297 ? -29.281 -25.970  81.088  1.00 8.03  ? 303  TYR B C   1 
ATOM   5535  O O   . TYR B  1 297 ? -29.260 -24.930  81.737  1.00 10.43 ? 303  TYR B O   1 
ATOM   5536  C CB  . TYR B  1 297 ? -29.362 -27.660  82.913  1.00 8.91  ? 303  TYR B CB  1 
ATOM   5537  C CG  . TYR B  1 297 ? -30.830 -27.916  82.661  1.00 10.65 ? 303  TYR B CG  1 
ATOM   5538  C CD1 . TYR B  1 297 ? -31.232 -28.894  81.758  1.00 10.33 ? 303  TYR B CD1 1 
ATOM   5539  C CD2 . TYR B  1 297 ? -31.808 -27.187  83.319  1.00 13.58 ? 303  TYR B CD2 1 
ATOM   5540  C CE1 . TYR B  1 297 ? -32.570 -29.131  81.509  1.00 12.85 ? 303  TYR B CE1 1 
ATOM   5541  C CE2 . TYR B  1 297 ? -33.157 -27.424  83.074  1.00 14.99 ? 303  TYR B CE2 1 
ATOM   5542  C CZ  . TYR B  1 297 ? -33.524 -28.398  82.166  1.00 10.75 ? 303  TYR B CZ  1 
ATOM   5543  O OH  . TYR B  1 297 ? -34.856 -28.643  81.918  1.00 13.57 ? 303  TYR B OH  1 
ATOM   5544  N N   . ALA B  1 298 ? -29.842 -26.082  79.892  1.00 9.47  ? 304  ALA B N   1 
ATOM   5545  C CA  . ALA B  1 298 ? -30.453 -24.965  79.200  1.00 13.33 ? 304  ALA B CA  1 
ATOM   5546  C C   . ALA B  1 298 ? -31.755 -25.413  78.571  1.00 14.74 ? 304  ALA B C   1 
ATOM   5547  O O   . ALA B  1 298 ? -31.835 -26.498  78.012  1.00 20.27 ? 304  ALA B O   1 
ATOM   5548  C CB  . ALA B  1 298 ? -29.533 -24.427  78.142  1.00 16.75 ? 304  ALA B CB  1 
ATOM   5549  N N   . GLU B  1 299 ? -32.781 -24.580  78.660  1.00 13.70 ? 305  GLU B N   1 
ATOM   5550  C CA  . GLU B  1 299 ? -34.037 -24.922  78.029  1.00 12.72 ? 305  GLU B CA  1 
ATOM   5551  C C   . GLU B  1 299 ? -34.282 -24.007  76.857  1.00 16.29 ? 305  GLU B C   1 
ATOM   5552  O O   . GLU B  1 299 ? -33.771 -22.892  76.811  1.00 16.49 ? 305  GLU B O   1 
ATOM   5553  C CB  . GLU B  1 299 ? -35.188 -24.835  79.015  1.00 15.01 ? 305  GLU B CB  1 
ATOM   5554  C CG  . GLU B  1 299 ? -35.318 -26.059  79.910  1.00 17.32 ? 305  GLU B CG  1 
ATOM   5555  C CD  . GLU B  1 299 ? -36.328 -25.857  81.017  1.00 23.90 ? 305  GLU B CD  1 
ATOM   5556  O OE1 . GLU B  1 299 ? -37.067 -24.850  80.957  1.00 23.42 ? 305  GLU B OE1 1 
ATOM   5557  O OE2 . GLU B  1 299 ? -36.379 -26.698  81.947  1.00 22.90 ? 305  GLU B OE2 1 
ATOM   5558  N N   . ILE B  1 300 ? -35.059 -24.494  75.904  1.00 16.61 ? 306  ILE B N   1 
ATOM   5559  C CA  . ILE B  1 300 ? -35.448 -23.689  74.767  1.00 17.18 ? 306  ILE B CA  1 
ATOM   5560  C C   . ILE B  1 300 ? -36.309 -22.553  75.279  1.00 15.02 ? 306  ILE B C   1 
ATOM   5561  O O   . ILE B  1 300 ? -37.286 -22.771  75.984  1.00 16.27 ? 306  ILE B O   1 
ATOM   5562  C CB  . ILE B  1 300 ? -36.193 -24.532  73.721  1.00 16.26 ? 306  ILE B CB  1 
ATOM   5563  C CG1 . ILE B  1 300 ? -35.258 -25.625  73.208  1.00 13.32 ? 306  ILE B CG1 1 
ATOM   5564  C CG2 . ILE B  1 300 ? -36.701 -23.662  72.583  1.00 17.85 ? 306  ILE B CG2 1 
ATOM   5565  C CD1 . ILE B  1 300 ? -35.799 -26.382  72.048  1.00 10.25 ? 306  ILE B CD1 1 
ATOM   5566  N N   . THR B  1 301 ? -35.921 -21.327  74.964  1.00 16.63 ? 307  THR B N   1 
ATOM   5567  C CA  . THR B  1 301 ? -36.658 -20.179  75.460  1.00 18.88 ? 307  THR B CA  1 
ATOM   5568  C C   . THR B  1 301 ? -36.976 -19.219  74.332  1.00 17.76 ? 307  THR B C   1 
ATOM   5569  O O   . THR B  1 301 ? -36.295 -19.206  73.308  1.00 14.49 ? 307  THR B O   1 
ATOM   5570  C CB  . THR B  1 301 ? -35.869 -19.425  76.551  1.00 19.49 ? 307  THR B CB  1 
ATOM   5571  O OG1 . THR B  1 301 ? -34.642 -18.947  75.996  1.00 16.65 ? 307  THR B OG1 1 
ATOM   5572  C CG2 . THR B  1 301 ? -35.578 -20.335  77.742  1.00 18.56 ? 307  THR B CG2 1 
ATOM   5573  N N   . PRO B  1 302 ? -38.032 -18.422  74.504  1.00 15.81 ? 308  PRO B N   1 
ATOM   5574  C CA  . PRO B  1 302 ? -38.221 -17.326  73.558  1.00 18.37 ? 308  PRO B CA  1 
ATOM   5575  C C   . PRO B  1 302 ? -37.096 -16.309  73.747  1.00 17.69 ? 308  PRO B C   1 
ATOM   5576  O O   . PRO B  1 302 ? -36.401 -16.353  74.763  1.00 18.02 ? 308  PRO B O   1 
ATOM   5577  C CB  . PRO B  1 302 ? -39.597 -16.762  73.926  1.00 20.65 ? 308  PRO B CB  1 
ATOM   5578  C CG  . PRO B  1 302 ? -39.945 -17.353  75.243  1.00 21.04 ? 308  PRO B CG  1 
ATOM   5579  C CD  . PRO B  1 302 ? -39.163 -18.590  75.431  1.00 19.10 ? 308  PRO B CD  1 
ATOM   5580  N N   . PRO B  1 303 ? -36.877 -15.431  72.756  1.00 19.32 ? 309  PRO B N   1 
ATOM   5581  C CA  . PRO B  1 303 ? -35.760 -14.481  72.852  1.00 14.95 ? 309  PRO B CA  1 
ATOM   5582  C C   . PRO B  1 303 ? -35.981 -13.392  73.909  1.00 10.65 ? 309  PRO B C   1 
ATOM   5583  O O   . PRO B  1 303 ? -36.976 -13.434  74.638  1.00 15.53 ? 309  PRO B O   1 
ATOM   5584  C CB  . PRO B  1 303 ? -35.685 -13.885  71.437  1.00 15.24 ? 309  PRO B CB  1 
ATOM   5585  C CG  . PRO B  1 303 ? -37.010 -14.183  70.821  1.00 19.37 ? 309  PRO B CG  1 
ATOM   5586  C CD  . PRO B  1 303 ? -37.520 -15.420  71.431  1.00 15.33 ? 309  PRO B CD  1 
ATOM   5587  N N   . ALA B  1 304 ? -35.038 -12.459  74.013  1.00 10.46 ? 310  ALA B N   1 
ATOM   5588  C CA  . ALA B  1 304 ? -35.206 -11.286  74.860  1.00 10.22 ? 310  ALA B CA  1 
ATOM   5589  C C   . ALA B  1 304 ? -36.041 -10.230  74.123  1.00 15.97 ? 310  ALA B C   1 
ATOM   5590  O O   . ALA B  1 304 ? -35.951 -10.080  72.900  1.00 15.10 ? 310  ALA B O   1 
ATOM   5591  C CB  . ALA B  1 304 ? -33.846 -10.721  75.283  1.00 9.31  ? 310  ALA B CB  1 
ATOM   5592  N N   . LYS B  1 305 ? -36.873 -9.516   74.871  1.00 12.39 ? 311  LYS B N   1 
ATOM   5593  C CA  . LYS B  1 305 ? -37.785 -8.542   74.291  1.00 13.34 ? 311  LYS B CA  1 
ATOM   5594  C C   . LYS B  1 305 ? -37.648 -7.227   75.025  1.00 11.71 ? 311  LYS B C   1 
ATOM   5595  O O   . LYS B  1 305 ? -37.584 -7.208   76.250  1.00 13.52 ? 311  LYS B O   1 
ATOM   5596  C CB  . LYS B  1 305 ? -39.223 -9.064   74.356  1.00 11.82 ? 311  LYS B CB  1 
ATOM   5597  C CG  . LYS B  1 305 ? -40.272 -8.228   73.633  1.00 13.12 ? 311  LYS B CG  1 
ATOM   5598  C CD  . LYS B  1 305 ? -41.591 -8.990   73.580  1.00 17.65 ? 311  LYS B CD  1 
ATOM   5599  C CE  . LYS B  1 305 ? -42.776 -8.105   73.232  1.00 20.69 ? 311  LYS B CE  1 
ATOM   5600  N NZ  . LYS B  1 305 ? -42.788 -7.662   71.824  1.00 18.63 ? 311  LYS B NZ  1 
ATOM   5601  N N   . PHE B  1 306 ? -37.594 -6.136   74.262  1.00 11.33 ? 312  PHE B N   1 
ATOM   5602  C CA  . PHE B  1 306 ? -37.478 -4.785   74.795  1.00 9.70  ? 312  PHE B CA  1 
ATOM   5603  C C   . PHE B  1 306 ? -38.633 -3.967   74.271  1.00 14.51 ? 312  PHE B C   1 
ATOM   5604  O O   . PHE B  1 306 ? -38.878 -3.927   73.070  1.00 12.87 ? 312  PHE B O   1 
ATOM   5605  C CB  . PHE B  1 306 ? -36.147 -4.150   74.397  1.00 12.91 ? 312  PHE B CB  1 
ATOM   5606  C CG  . PHE B  1 306 ? -34.958 -4.932   74.850  1.00 12.24 ? 312  PHE B CG  1 
ATOM   5607  C CD1 . PHE B  1 306 ? -34.476 -5.988   74.086  1.00 13.47 ? 312  PHE B CD1 1 
ATOM   5608  C CD2 . PHE B  1 306 ? -34.338 -4.638   76.054  1.00 11.09 ? 312  PHE B CD2 1 
ATOM   5609  C CE1 . PHE B  1 306 ? -33.394 -6.729   74.512  1.00 13.78 ? 312  PHE B CE1 1 
ATOM   5610  C CE2 . PHE B  1 306 ? -33.249 -5.366   76.482  1.00 12.55 ? 312  PHE B CE2 1 
ATOM   5611  C CZ  . PHE B  1 306 ? -32.775 -6.414   75.711  1.00 15.68 ? 312  PHE B CZ  1 
ATOM   5612  N N   . VAL B  1 307 ? -39.367 -3.310   75.154  1.00 16.62 ? 313  VAL B N   1 
ATOM   5613  C CA  . VAL B  1 307 ? -40.546 -2.620   74.666  1.00 21.01 ? 313  VAL B CA  1 
ATOM   5614  C C   . VAL B  1 307 ? -40.776 -1.290   75.400  1.00 17.49 ? 313  VAL B C   1 
ATOM   5615  O O   . VAL B  1 307 ? -40.208 -1.061   76.467  1.00 16.18 ? 313  VAL B O   1 
ATOM   5616  C CB  . VAL B  1 307 ? -41.767 -3.576   74.758  1.00 20.18 ? 313  VAL B CB  1 
ATOM   5617  C CG1 . VAL B  1 307 ? -42.163 -3.825   76.185  1.00 13.78 ? 313  VAL B CG1 1 
ATOM   5618  C CG2 . VAL B  1 307 ? -42.926 -3.086   73.932  1.00 23.79 ? 313  VAL B CG2 1 
ATOM   5619  N N   . HIS B  1 308 ? -41.576 -0.431   74.771  1.00 13.76 ? 314  HIS B N   1 
ATOM   5620  C CA  . HIS B  1 308 ? -41.921 0.923    75.186  1.00 10.42 ? 314  HIS B CA  1 
ATOM   5621  C C   . HIS B  1 308 ? -40.800 1.853    74.836  1.00 15.92 ? 314  HIS B C   1 
ATOM   5622  O O   . HIS B  1 308 ? -39.617 1.532    74.982  1.00 16.66 ? 314  HIS B O   1 
ATOM   5623  C CB  . HIS B  1 308 ? -42.258 1.017    76.671  1.00 13.97 ? 314  HIS B CB  1 
ATOM   5624  C CG  . HIS B  1 308 ? -43.483 0.252    77.046  1.00 14.04 ? 314  HIS B CG  1 
ATOM   5625  N ND1 . HIS B  1 308 ? -44.719 0.512    76.493  1.00 14.26 ? 314  HIS B ND1 1 
ATOM   5626  C CD2 . HIS B  1 308 ? -43.660 -0.783   77.899  1.00 9.91  ? 314  HIS B CD2 1 
ATOM   5627  C CE1 . HIS B  1 308 ? -45.605 -0.325   77.000  1.00 15.16 ? 314  HIS B CE1 1 
ATOM   5628  N NE2 . HIS B  1 308 ? -44.990 -1.116   77.860  1.00 11.85 ? 314  HIS B NE2 1 
ATOM   5629  N N   . ASP B  1 309 ? -41.198 3.017    74.353  1.00 14.48 ? 315  ASP B N   1 
ATOM   5630  C CA  . ASP B  1 309 ? -40.274 3.959    73.778  1.00 19.70 ? 315  ASP B CA  1 
ATOM   5631  C C   . ASP B  1 309 ? -40.966 5.312    73.756  1.00 25.63 ? 315  ASP B C   1 
ATOM   5632  O O   . ASP B  1 309 ? -41.143 5.919    72.704  1.00 34.58 ? 315  ASP B O   1 
ATOM   5633  C CB  . ASP B  1 309 ? -39.868 3.493    72.372  1.00 21.26 ? 315  ASP B CB  1 
ATOM   5634  C CG  . ASP B  1 309 ? -38.812 4.364    71.742  1.00 31.45 ? 315  ASP B CG  1 
ATOM   5635  O OD1 . ASP B  1 309 ? -38.081 5.061    72.483  1.00 40.53 ? 315  ASP B OD1 1 
ATOM   5636  O OD2 . ASP B  1 309 ? -38.708 4.335    70.496  1.00 29.22 ? 315  ASP B OD2 1 
ATOM   5637  N N   . ASP B  1 310 ? -41.404 5.771    74.918  1.00 25.61 ? 316  ASP B N   1 
ATOM   5638  C CA  . ASP B  1 310 ? -42.073 7.055    74.950  1.00 24.74 ? 316  ASP B CA  1 
ATOM   5639  C C   . ASP B  1 310 ? -41.335 8.010    75.863  1.00 29.50 ? 316  ASP B C   1 
ATOM   5640  O O   . ASP B  1 310 ? -40.177 7.785    76.230  1.00 29.59 ? 316  ASP B O   1 
ATOM   5641  C CB  . ASP B  1 310 ? -43.547 6.909    75.361  1.00 18.84 ? 316  ASP B CB  1 
ATOM   5642  C CG  . ASP B  1 310 ? -43.735 6.391    76.785  1.00 27.71 ? 316  ASP B CG  1 
ATOM   5643  O OD1 . ASP B  1 310 ? -42.942 6.746    77.676  1.00 34.86 ? 316  ASP B OD1 1 
ATOM   5644  O OD2 . ASP B  1 310 ? -44.707 5.641    77.026  1.00 25.30 ? 316  ASP B OD2 1 
ATOM   5645  N N   . GLU B  1 311 ? -42.030 9.075    76.224  1.00 35.38 ? 317  GLU B N   1 
ATOM   5646  C CA  . GLU B  1 311 ? -41.462 10.146   77.012  1.00 42.53 ? 317  GLU B CA  1 
ATOM   5647  C C   . GLU B  1 311 ? -41.019 9.626    78.365  1.00 39.70 ? 317  GLU B C   1 
ATOM   5648  O O   . GLU B  1 311 ? -39.946 9.963    78.857  1.00 44.21 ? 317  GLU B O   1 
ATOM   5649  C CB  . GLU B  1 311 ? -42.489 11.275   77.180  1.00 52.86 ? 317  GLU B CB  1 
ATOM   5650  C CG  . GLU B  1 311 ? -43.461 11.436   76.002  1.00 60.26 ? 317  GLU B CG  1 
ATOM   5651  C CD  . GLU B  1 311 ? -44.673 10.497   76.060  1.00 63.19 ? 317  GLU B CD  1 
ATOM   5652  O OE1 . GLU B  1 311 ? -44.690 9.569    76.898  1.00 64.19 ? 317  GLU B OE1 1 
ATOM   5653  O OE2 . GLU B  1 311 ? -45.613 10.691   75.258  1.00 63.38 ? 317  GLU B OE2 1 
ATOM   5654  N N   . ASP B  1 312 ? -41.853 8.783    78.955  1.00 35.45 ? 318  ASP B N   1 
ATOM   5655  C CA  . ASP B  1 312 ? -41.683 8.401    80.341  1.00 33.22 ? 318  ASP B CA  1 
ATOM   5656  C C   . ASP B  1 312 ? -40.912 7.098    80.507  1.00 32.06 ? 318  ASP B C   1 
ATOM   5657  O O   . ASP B  1 312 ? -40.290 6.873    81.551  1.00 26.87 ? 318  ASP B O   1 
ATOM   5658  C CB  . ASP B  1 312 ? -43.047 8.267    81.015  1.00 38.46 ? 318  ASP B CB  1 
ATOM   5659  C CG  . ASP B  1 312 ? -43.932 9.485    80.812  1.00 49.12 ? 318  ASP B CG  1 
ATOM   5660  O OD1 . ASP B  1 312 ? -43.749 10.480   81.553  1.00 53.73 ? 318  ASP B OD1 1 
ATOM   5661  O OD2 . ASP B  1 312 ? -44.826 9.435    79.930  1.00 49.98 ? 318  ASP B OD2 1 
ATOM   5662  N N   . ARG B  1 313 ? -40.956 6.239    79.487  1.00 27.98 ? 319  ARG B N   1 
ATOM   5663  C CA  . ARG B  1 313 ? -40.432 4.884    79.633  1.00 23.51 ? 319  ARG B CA  1 
ATOM   5664  C C   . ARG B  1 313 ? -39.857 4.295    78.359  1.00 22.43 ? 319  ARG B C   1 
ATOM   5665  O O   . ARG B  1 313 ? -40.454 4.378    77.288  1.00 27.19 ? 319  ARG B O   1 
ATOM   5666  C CB  . ARG B  1 313 ? -41.523 3.954    80.151  1.00 17.52 ? 319  ARG B CB  1 
ATOM   5667  C CG  . ARG B  1 313 ? -42.792 4.018    79.341  1.00 17.57 ? 319  ARG B CG  1 
ATOM   5668  C CD  . ARG B  1 313 ? -43.709 2.884    79.682  1.00 17.10 ? 319  ARG B CD  1 
ATOM   5669  N NE  . ARG B  1 313 ? -45.034 3.110    79.129  1.00 19.58 ? 319  ARG B NE  1 
ATOM   5670  C CZ  . ARG B  1 313 ? -46.079 2.319    79.342  1.00 20.94 ? 319  ARG B CZ  1 
ATOM   5671  N NH1 . ARG B  1 313 ? -45.952 1.232    80.088  1.00 20.32 ? 319  ARG B NH1 1 
ATOM   5672  N NH2 . ARG B  1 313 ? -47.250 2.617    78.804  1.00 21.67 ? 319  ARG B NH2 1 
ATOM   5673  N N   . ARG B  1 314 ? -38.694 3.678    78.502  1.00 19.68 ? 320  ARG B N   1 
ATOM   5674  C CA  . ARG B  1 314 ? -38.027 3.012    77.392  1.00 17.98 ? 320  ARG B CA  1 
ATOM   5675  C C   . ARG B  1 314 ? -37.428 1.709    77.886  1.00 14.47 ? 320  ARG B C   1 
ATOM   5676  O O   . ARG B  1 314 ? -36.561 1.712    78.755  1.00 16.71 ? 320  ARG B O   1 
ATOM   5677  C CB  . ARG B  1 314 ? -36.943 3.912    76.788  1.00 19.97 ? 320  ARG B CB  1 
ATOM   5678  C CG  . ARG B  1 314 ? -36.204 3.318    75.594  1.00 20.85 ? 320  ARG B CG  1 
ATOM   5679  C CD  . ARG B  1 314 ? -35.280 4.341    74.949  1.00 28.15 ? 320  ARG B CD  1 
ATOM   5680  N NE  . ARG B  1 314 ? -34.094 4.603    75.761  1.00 36.42 ? 320  ARG B NE  1 
ATOM   5681  C CZ  . ARG B  1 314 ? -33.269 5.633    75.580  1.00 46.14 ? 320  ARG B CZ  1 
ATOM   5682  N NH1 . ARG B  1 314 ? -33.494 6.511    74.608  1.00 45.86 ? 320  ARG B NH1 1 
ATOM   5683  N NH2 . ARG B  1 314 ? -32.216 5.789    76.375  1.00 51.07 ? 320  ARG B NH2 1 
ATOM   5684  N N   . GLY B  1 315 ? -37.910 0.591    77.357  1.00 15.60 ? 321  GLY B N   1 
ATOM   5685  C CA  . GLY B  1 315 ? -37.325 -0.695   77.689  1.00 14.00 ? 321  GLY B CA  1 
ATOM   5686  C C   . GLY B  1 315 ? -36.013 -0.849   76.943  1.00 15.43 ? 321  GLY B C   1 
ATOM   5687  O O   . GLY B  1 315 ? -35.995 -0.967   75.720  1.00 21.90 ? 321  GLY B O   1 
ATOM   5688  N N   . SER B  1 316 ? -34.904 -0.844   77.669  1.00 13.02 ? 322  SER B N   1 
ATOM   5689  C CA  . SER B  1 316 ? -33.615 -0.903   77.007  1.00 11.59 ? 322  SER B CA  1 
ATOM   5690  C C   . SER B  1 316 ? -32.498 -1.363   77.924  1.00 16.15 ? 322  SER B C   1 
ATOM   5691  O O   . SER B  1 316 ? -32.518 -1.098   79.123  1.00 15.83 ? 322  SER B O   1 
ATOM   5692  C CB  . SER B  1 316 ? -33.264 0.463    76.437  1.00 21.84 ? 322  SER B CB  1 
ATOM   5693  O OG  . SER B  1 316 ? -32.987 1.367    77.492  1.00 30.47 ? 322  SER B OG  1 
ATOM   5694  N N   . ALA B  1 317 ? -31.511 -2.038   77.339  1.00 17.19 ? 323  ALA B N   1 
ATOM   5695  C CA  . ALA B  1 317 ? -30.345 -2.502   78.078  1.00 14.73 ? 323  ALA B CA  1 
ATOM   5696  C C   . ALA B  1 317 ? -29.075 -1.884   77.501  1.00 19.88 ? 323  ALA B C   1 
ATOM   5697  O O   . ALA B  1 317 ? -28.805 -1.975   76.308  1.00 21.34 ? 323  ALA B O   1 
ATOM   5698  C CB  . ALA B  1 317 ? -30.260 -4.002   78.046  1.00 12.58 ? 323  ALA B CB  1 
ATOM   5699  N N   . VAL B  1 318 ? -28.300 -1.254   78.364  1.00 18.86 ? 324  VAL B N   1 
ATOM   5700  C CA  . VAL B  1 318 ? -27.082 -0.580   77.954  1.00 19.58 ? 324  VAL B CA  1 
ATOM   5701  C C   . VAL B  1 318 ? -25.912 -1.129   78.764  1.00 15.49 ? 324  VAL B C   1 
ATOM   5702  O O   . VAL B  1 318 ? -26.021 -1.259   79.984  1.00 17.86 ? 324  VAL B O   1 
ATOM   5703  C CB  . VAL B  1 318 ? -27.215 0.949    78.150  1.00 23.47 ? 324  VAL B CB  1 
ATOM   5704  C CG1 . VAL B  1 318 ? -25.868 1.617    78.084  1.00 26.07 ? 324  VAL B CG1 1 
ATOM   5705  C CG2 . VAL B  1 318 ? -28.157 1.527    77.114  1.00 25.61 ? 324  VAL B CG2 1 
ATOM   5706  N N   . SER B  1 319 ? -24.808 -1.448   78.084  1.00 15.66 ? 325  SER B N   1 
ATOM   5707  C CA  . SER B  1 319 ? -23.632 -2.061   78.708  1.00 13.89 ? 325  SER B CA  1 
ATOM   5708  C C   . SER B  1 319 ? -24.052 -3.216   79.576  1.00 11.27 ? 325  SER B C   1 
ATOM   5709  O O   . SER B  1 319 ? -23.655 -3.301   80.739  1.00 12.56 ? 325  SER B O   1 
ATOM   5710  C CB  . SER B  1 319 ? -22.848 -1.052   79.548  1.00 18.53 ? 325  SER B CB  1 
ATOM   5711  O OG  . SER B  1 319 ? -22.518 0.095    78.793  1.00 20.18 ? 325  SER B OG  1 
ATOM   5712  N N   . SER B  1 320 ? -24.879 -4.086   79.012  1.00 12.19 ? 326  SER B N   1 
ATOM   5713  C CA  . SER B  1 320 ? -25.539 -5.137   79.779  1.00 12.76 ? 326  SER B CA  1 
ATOM   5714  C C   . SER B  1 320 ? -25.563 -6.463   79.041  1.00 15.79 ? 326  SER B C   1 
ATOM   5715  O O   . SER B  1 320 ? -25.365 -6.521   77.822  1.00 16.65 ? 326  SER B O   1 
ATOM   5716  C CB  . SER B  1 320 ? -26.972 -4.726   80.121  1.00 14.41 ? 326  SER B CB  1 
ATOM   5717  O OG  . SER B  1 320 ? -26.998 -3.737   81.135  1.00 16.74 ? 326  SER B OG  1 
ATOM   5718  N N   . VAL B  1 321 ? -25.816 -7.523   79.802  1.00 13.40 ? 327  VAL B N   1 
ATOM   5719  C CA  . VAL B  1 321 ? -25.988 -8.861   79.266  1.00 10.24 ? 327  VAL B CA  1 
ATOM   5720  C C   . VAL B  1 321 ? -27.387 -9.358   79.653  1.00 13.25 ? 327  VAL B C   1 
ATOM   5721  O O   . VAL B  1 321 ? -27.786 -9.240   80.812  1.00 14.66 ? 327  VAL B O   1 
ATOM   5722  C CB  . VAL B  1 321 ? -24.914 -9.813   79.796  1.00 10.89 ? 327  VAL B CB  1 
ATOM   5723  C CG1 . VAL B  1 321 ? -25.211 -11.230  79.358  1.00 14.85 ? 327  VAL B CG1 1 
ATOM   5724  C CG2 . VAL B  1 321 ? -23.525 -9.377   79.348  1.00 11.31 ? 327  VAL B CG2 1 
ATOM   5725  N N   . VAL B  1 322 ? -28.145 -9.872   78.686  1.00 14.29 ? 328  VAL B N   1 
ATOM   5726  C CA  . VAL B  1 322 ? -29.547 -10.235  78.916  1.00 14.46 ? 328  VAL B CA  1 
ATOM   5727  C C   . VAL B  1 322 ? -29.851 -11.589  78.290  1.00 16.05 ? 328  VAL B C   1 
ATOM   5728  O O   . VAL B  1 322 ? -29.498 -11.832  77.143  1.00 15.73 ? 328  VAL B O   1 
ATOM   5729  C CB  . VAL B  1 322 ? -30.521 -9.169   78.335  1.00 9.07  ? 328  VAL B CB  1 
ATOM   5730  C CG1 . VAL B  1 322 ? -31.980 -9.580   78.540  1.00 9.84  ? 328  VAL B CG1 1 
ATOM   5731  C CG2 . VAL B  1 322 ? -30.266 -7.807   78.964  1.00 10.23 ? 328  VAL B CG2 1 
ATOM   5732  N N   . SER B  1 323 ? -30.516 -12.463  79.037  1.00 14.98 ? 329  SER B N   1 
ATOM   5733  C CA  . SER B  1 323 ? -30.733 -13.840  78.603  1.00 14.16 ? 329  SER B CA  1 
ATOM   5734  C C   . SER B  1 323 ? -32.089 -14.078  77.953  1.00 17.08 ? 329  SER B C   1 
ATOM   5735  O O   . SER B  1 323 ? -32.890 -13.166  77.788  1.00 17.08 ? 329  SER B O   1 
ATOM   5736  C CB  . SER B  1 323 ? -30.587 -14.784  79.787  1.00 12.33 ? 329  SER B CB  1 
ATOM   5737  O OG  . SER B  1 323 ? -29.437 -14.449  80.523  1.00 19.42 ? 329  SER B OG  1 
ATOM   5738  N N   . GLY B  1 324 ? -32.344 -15.329  77.592  1.00 18.11 ? 330  GLY B N   1 
ATOM   5739  C CA  . GLY B  1 324 ? -33.610 -15.688  76.986  1.00 13.08 ? 330  GLY B CA  1 
ATOM   5740  C C   . GLY B  1 324 ? -34.759 -15.547  77.957  1.00 10.43 ? 330  GLY B C   1 
ATOM   5741  O O   . GLY B  1 324 ? -34.554 -15.537  79.168  1.00 11.11 ? 330  GLY B O   1 
ATOM   5742  N N   . ASP B  1 325 ? -35.967 -15.424  77.410  1.00 11.96 ? 331  ASP B N   1 
ATOM   5743  C CA  . ASP B  1 325 ? -37.194 -15.321  78.193  1.00 12.27 ? 331  ASP B CA  1 
ATOM   5744  C C   . ASP B  1 325 ? -37.187 -14.100  79.120  1.00 13.68 ? 331  ASP B C   1 
ATOM   5745  O O   . ASP B  1 325 ? -37.843 -14.092  80.148  1.00 17.05 ? 331  ASP B O   1 
ATOM   5746  C CB  . ASP B  1 325 ? -37.408 -16.604  78.999  1.00 16.54 ? 331  ASP B CB  1 
ATOM   5747  C CG  . ASP B  1 325 ? -38.849 -16.796  79.431  1.00 24.84 ? 331  ASP B CG  1 
ATOM   5748  O OD1 . ASP B  1 325 ? -39.758 -16.134  78.880  1.00 19.83 ? 331  ASP B OD1 1 
ATOM   5749  O OD2 . ASP B  1 325 ? -39.069 -17.623  80.335  1.00 29.68 ? 331  ASP B OD2 1 
ATOM   5750  N N   . CYS B  1 326 ? -36.436 -13.069  78.756  1.00 15.74 ? 332  CYS B N   1 
ATOM   5751  C CA  . CYS B  1 326 ? -36.471 -11.819  79.505  1.00 13.69 ? 332  CYS B CA  1 
ATOM   5752  C C   . CYS B  1 326 ? -37.368 -10.836  78.801  1.00 10.19 ? 332  CYS B C   1 
ATOM   5753  O O   . CYS B  1 326 ? -37.278 -10.685  77.594  1.00 12.65 ? 332  CYS B O   1 
ATOM   5754  C CB  . CYS B  1 326 ? -35.074 -11.221  79.653  1.00 12.89 ? 332  CYS B CB  1 
ATOM   5755  S SG  . CYS B  1 326 ? -34.012 -12.081  80.768  1.00 15.63 ? 332  CYS B SG  1 
ATOM   5756  N N   . ILE B  1 327 ? -38.236 -10.169  79.547  1.00 12.33 ? 333  ILE B N   1 
ATOM   5757  C CA  . ILE B  1 327 ? -39.065 -9.117   78.976  1.00 13.18 ? 333  ILE B CA  1 
ATOM   5758  C C   . ILE B  1 327 ? -38.784 -7.829   79.704  1.00 14.13 ? 333  ILE B C   1 
ATOM   5759  O O   . ILE B  1 327 ? -39.083 -7.691   80.887  1.00 16.05 ? 333  ILE B O   1 
ATOM   5760  C CB  . ILE B  1 327 ? -40.545 -9.431   79.056  1.00 13.17 ? 333  ILE B CB  1 
ATOM   5761  C CG1 . ILE B  1 327 ? -40.836 -10.744  78.340  1.00 11.62 ? 333  ILE B CG1 1 
ATOM   5762  C CG2 . ILE B  1 327 ? -41.353 -8.296   78.432  1.00 17.00 ? 333  ILE B CG2 1 
ATOM   5763  C CD1 . ILE B  1 327 ? -42.273 -11.179  78.472  1.00 10.26 ? 333  ILE B CD1 1 
ATOM   5764  N N   . ILE B  1 328 ? -38.175 -6.903   78.977  1.00 12.64 ? 334  ILE B N   1 
ATOM   5765  C CA  . ILE B  1 328 ? -37.701 -5.640   79.507  1.00 12.26 ? 334  ILE B CA  1 
ATOM   5766  C C   . ILE B  1 328 ? -38.716 -4.579   79.088  1.00 16.15 ? 334  ILE B C   1 
ATOM   5767  O O   . ILE B  1 328 ? -38.601 -3.969   78.023  1.00 13.28 ? 334  ILE B O   1 
ATOM   5768  C CB  . ILE B  1 328 ? -36.283 -5.313   78.979  1.00 11.17 ? 334  ILE B CB  1 
ATOM   5769  C CG1 . ILE B  1 328 ? -35.354 -6.509   79.193  1.00 8.80  ? 334  ILE B CG1 1 
ATOM   5770  C CG2 . ILE B  1 328 ? -35.720 -4.048   79.627  1.00 13.55 ? 334  ILE B CG2 1 
ATOM   5771  C CD1 . ILE B  1 328 ? -35.372 -7.037   80.616  1.00 10.95 ? 334  ILE B CD1 1 
ATOM   5772  N N   . SER B  1 329 ? -39.736 -4.392   79.921  1.00 14.10 ? 335  SER B N   1 
ATOM   5773  C CA  . SER B  1 329 ? -40.890 -3.594   79.549  1.00 11.49 ? 335  SER B CA  1 
ATOM   5774  C C   . SER B  1 329 ? -40.843 -2.208   80.177  1.00 12.63 ? 335  SER B C   1 
ATOM   5775  O O   . SER B  1 329 ? -41.191 -2.051   81.325  1.00 13.69 ? 335  SER B O   1 
ATOM   5776  C CB  . SER B  1 329 ? -42.173 -4.317   79.969  1.00 14.14 ? 335  SER B CB  1 
ATOM   5777  O OG  . SER B  1 329 ? -43.327 -3.665   79.461  1.00 17.61 ? 335  SER B OG  1 
ATOM   5778  N N   . GLY B  1 330 ? -40.406 -1.208   79.425  1.00 12.84 ? 336  GLY B N   1 
ATOM   5779  C CA  . GLY B  1 330 ? -40.343 0.151    79.934  1.00 12.01 ? 336  GLY B CA  1 
ATOM   5780  C C   . GLY B  1 330 ? -39.301 0.337    81.022  1.00 16.03 ? 336  GLY B C   1 
ATOM   5781  O O   . GLY B  1 330 ? -39.311 1.343    81.729  1.00 17.88 ? 336  GLY B O   1 
ATOM   5782  N N   . ALA B  1 331 ? -38.396 -0.628   81.152  1.00 13.13 ? 337  ALA B N   1 
ATOM   5783  C CA  . ALA B  1 331 ? -37.379 -0.600   82.196  1.00 13.22 ? 337  ALA B CA  1 
ATOM   5784  C C   . ALA B  1 331 ? -36.009 -0.247   81.636  1.00 18.81 ? 337  ALA B C   1 
ATOM   5785  O O   . ALA B  1 331 ? -35.613 -0.741   80.581  1.00 22.87 ? 337  ALA B O   1 
ATOM   5786  C CB  . ALA B  1 331 ? -37.308 -1.944   82.909  1.00 11.48 ? 337  ALA B CB  1 
ATOM   5787  N N   . ALA B  1 332 ? -35.282 0.597    82.358  1.00 16.64 ? 338  ALA B N   1 
ATOM   5788  C CA  . ALA B  1 332 ? -33.914 0.937    81.996  1.00 20.43 ? 338  ALA B CA  1 
ATOM   5789  C C   . ALA B  1 332 ? -32.924 -0.021   82.643  1.00 17.67 ? 338  ALA B C   1 
ATOM   5790  O O   . ALA B  1 332 ? -32.906 -0.175   83.865  1.00 17.60 ? 338  ALA B O   1 
ATOM   5791  C CB  . ALA B  1 332 ? -33.599 2.364    82.403  1.00 24.21 ? 338  ALA B CB  1 
ATOM   5792  N N   . LEU B  1 333 ? -32.112 -0.672   81.816  1.00 18.55 ? 339  LEU B N   1 
ATOM   5793  C CA  . LEU B  1 333 ? -31.022 -1.502   82.317  1.00 14.95 ? 339  LEU B CA  1 
ATOM   5794  C C   . LEU B  1 333 ? -29.685 -0.888   81.972  1.00 14.68 ? 339  LEU B C   1 
ATOM   5795  O O   . LEU B  1 333 ? -29.436 -0.537   80.824  1.00 16.62 ? 339  LEU B O   1 
ATOM   5796  C CB  . LEU B  1 333 ? -31.076 -2.909   81.741  1.00 13.70 ? 339  LEU B CB  1 
ATOM   5797  C CG  . LEU B  1 333 ? -32.365 -3.692   81.921  1.00 20.85 ? 339  LEU B CG  1 
ATOM   5798  C CD1 . LEU B  1 333 ? -32.158 -5.108   81.435  1.00 18.58 ? 339  LEU B CD1 1 
ATOM   5799  C CD2 . LEU B  1 333 ? -32.795 -3.669   83.349  1.00 19.20 ? 339  LEU B CD2 1 
ATOM   5800  N N   . ASN B  1 334 ? -28.825 -0.780   82.972  1.00 15.59 ? 340  ASN B N   1 
ATOM   5801  C CA  . ASN B  1 334 ? -27.490 -0.263   82.781  1.00 18.07 ? 340  ASN B CA  1 
ATOM   5802  C C   . ASN B  1 334 ? -26.501 -1.084   83.585  1.00 13.25 ? 340  ASN B C   1 
ATOM   5803  O O   . ASN B  1 334 ? -26.731 -1.345   84.750  1.00 15.06 ? 340  ASN B O   1 
ATOM   5804  C CB  . ASN B  1 334 ? -27.416 1.204    83.197  1.00 26.65 ? 340  ASN B CB  1 
ATOM   5805  C CG  . ASN B  1 334 ? -26.169 1.881    82.685  1.00 35.64 ? 340  ASN B CG  1 
ATOM   5806  O OD1 . ASN B  1 334 ? -26.003 2.054    81.479  1.00 39.94 ? 340  ASN B OD1 1 
ATOM   5807  N ND2 . ASN B  1 334 ? -25.275 2.253    83.593  1.00 37.84 ? 340  ASN B ND2 1 
ATOM   5808  N N   . ARG B  1 335 ? -25.409 -1.490   82.951  1.00 13.04 ? 341  ARG B N   1 
ATOM   5809  C CA  . ARG B  1 335 ? -24.384 -2.291   83.603  1.00 14.92 ? 341  ARG B CA  1 
ATOM   5810  C C   . ARG B  1 335 ? -24.983 -3.412   84.448  1.00 14.10 ? 341  ARG B C   1 
ATOM   5811  O O   . ARG B  1 335 ? -24.714 -3.522   85.633  1.00 13.96 ? 341  ARG B O   1 
ATOM   5812  C CB  . ARG B  1 335 ? -23.478 -1.404   84.457  1.00 19.48 ? 341  ARG B CB  1 
ATOM   5813  C CG  . ARG B  1 335 ? -22.171 -2.088   84.794  1.00 27.60 ? 341  ARG B CG  1 
ATOM   5814  C CD  . ARG B  1 335 ? -21.049 -1.119   85.020  1.00 38.12 ? 341  ARG B CD  1 
ATOM   5815  N NE  . ARG B  1 335 ? -19.776 -1.825   85.155  1.00 43.99 ? 341  ARG B NE  1 
ATOM   5816  C CZ  . ARG B  1 335 ? -19.228 -2.163   86.317  1.00 45.53 ? 341  ARG B CZ  1 
ATOM   5817  N NH1 . ARG B  1 335 ? -19.837 -1.855   87.453  1.00 46.84 ? 341  ARG B NH1 1 
ATOM   5818  N NH2 . ARG B  1 335 ? -18.066 -2.801   86.346  1.00 46.44 ? 341  ARG B NH2 1 
ATOM   5819  N N   . SER B  1 336 ? -25.807 -4.245   83.828  1.00 15.42 ? 342  SER B N   1 
ATOM   5820  C CA  . SER B  1 336 ? -26.449 -5.319   84.561  1.00 14.15 ? 342  SER B CA  1 
ATOM   5821  C C   . SER B  1 336 ? -26.340 -6.645   83.825  1.00 11.27 ? 342  SER B C   1 
ATOM   5822  O O   . SER B  1 336 ? -26.136 -6.694   82.614  1.00 15.54 ? 342  SER B O   1 
ATOM   5823  C CB  . SER B  1 336 ? -27.917 -4.983   84.825  1.00 14.13 ? 342  SER B CB  1 
ATOM   5824  O OG  . SER B  1 336 ? -28.042 -3.801   85.602  1.00 16.69 ? 342  SER B OG  1 
ATOM   5825  N N   . LEU B  1 337 ? -26.461 -7.723   84.585  1.00 13.01 ? 343  LEU B N   1 
ATOM   5826  C CA  . LEU B  1 337 ? -26.416 -9.072   84.049  1.00 13.04 ? 343  LEU B CA  1 
ATOM   5827  C C   . LEU B  1 337 ? -27.722 -9.772   84.402  1.00 11.38 ? 343  LEU B C   1 
ATOM   5828  O O   . LEU B  1 337 ? -27.988 -10.020  85.569  1.00 12.74 ? 343  LEU B O   1 
ATOM   5829  C CB  . LEU B  1 337 ? -25.220 -9.836   84.627  1.00 13.58 ? 343  LEU B CB  1 
ATOM   5830  C CG  . LEU B  1 337 ? -25.166 -11.327  84.293  1.00 14.73 ? 343  LEU B CG  1 
ATOM   5831  C CD1 . LEU B  1 337 ? -24.812 -11.453  82.865  1.00 15.80 ? 343  LEU B CD1 1 
ATOM   5832  C CD2 . LEU B  1 337 ? -24.161 -12.084  85.129  1.00 15.49 ? 343  LEU B CD2 1 
ATOM   5833  N N   . LEU B  1 338 ? -28.547 -10.071  83.402  1.00 12.23 ? 344  LEU B N   1 
ATOM   5834  C CA  . LEU B  1 338 ? -29.831 -10.723  83.655  1.00 12.43 ? 344  LEU B CA  1 
ATOM   5835  C C   . LEU B  1 338 ? -29.812 -12.174  83.227  1.00 12.58 ? 344  LEU B C   1 
ATOM   5836  O O   . LEU B  1 338 ? -29.486 -12.487  82.086  1.00 10.65 ? 344  LEU B O   1 
ATOM   5837  C CB  . LEU B  1 338 ? -30.960 -10.000  82.926  1.00 11.99 ? 344  LEU B CB  1 
ATOM   5838  C CG  . LEU B  1 338 ? -31.656 -8.864   83.672  1.00 13.24 ? 344  LEU B CG  1 
ATOM   5839  C CD1 . LEU B  1 338 ? -30.697 -7.773   84.134  1.00 10.04 ? 344  LEU B CD1 1 
ATOM   5840  C CD2 . LEU B  1 338 ? -32.726 -8.283   82.791  1.00 13.98 ? 344  LEU B CD2 1 
ATOM   5841  N N   . PHE B  1 339 ? -30.178 -13.058  84.146  1.00 10.33 ? 345  PHE B N   1 
ATOM   5842  C CA  . PHE B  1 339 ? -30.323 -14.472  83.837  1.00 10.11 ? 345  PHE B CA  1 
ATOM   5843  C C   . PHE B  1 339 ? -31.667 -14.753  83.172  1.00 11.20 ? 345  PHE B C   1 
ATOM   5844  O O   . PHE B  1 339 ? -32.470 -13.859  82.959  1.00 11.13 ? 345  PHE B O   1 
ATOM   5845  C CB  . PHE B  1 339 ? -30.182 -15.317  85.103  1.00 12.23 ? 345  PHE B CB  1 
ATOM   5846  C CG  . PHE B  1 339 ? -28.759 -15.464  85.593  1.00 17.77 ? 345  PHE B CG  1 
ATOM   5847  C CD1 . PHE B  1 339 ? -28.065 -14.377  86.108  1.00 14.50 ? 345  PHE B CD1 1 
ATOM   5848  C CD2 . PHE B  1 339 ? -28.130 -16.701  85.569  1.00 17.57 ? 345  PHE B CD2 1 
ATOM   5849  C CE1 . PHE B  1 339 ? -26.767 -14.512  86.570  1.00 15.63 ? 345  PHE B CE1 1 
ATOM   5850  C CE2 . PHE B  1 339 ? -26.826 -16.841  86.027  1.00 18.70 ? 345  PHE B CE2 1 
ATOM   5851  C CZ  . PHE B  1 339 ? -26.148 -15.740  86.534  1.00 15.38 ? 345  PHE B CZ  1 
ATOM   5852  N N   . THR B  1 340 ? -31.910 -16.017  82.863  1.00 16.38 ? 346  THR B N   1 
ATOM   5853  C CA  A THR B  1 340 ? -33.117 -16.453  82.168  0.31 16.02 ? 346  THR B CA  1 
ATOM   5854  C CA  B THR B  1 340 ? -33.113 -16.389  82.135  0.69 17.56 ? 346  THR B CA  1 
ATOM   5855  C C   . THR B  1 340 ? -34.405 -16.067  82.892  1.00 13.34 ? 346  THR B C   1 
ATOM   5856  O O   . THR B  1 340 ? -34.504 -16.229  84.103  1.00 13.84 ? 346  THR B O   1 
ATOM   5857  C CB  A THR B  1 340 ? -33.105 -17.986  81.989  0.31 19.45 ? 346  THR B CB  1 
ATOM   5858  C CB  B THR B  1 340 ? -33.099 -17.889  81.782  0.69 19.55 ? 346  THR B CB  1 
ATOM   5859  O OG1 A THR B  1 340 ? -31.756 -18.438  81.814  0.31 19.75 ? 346  THR B OG1 1 
ATOM   5860  O OG1 B THR B  1 340 ? -34.324 -18.234  81.130  0.69 23.24 ? 346  THR B OG1 1 
ATOM   5861  C CG2 A THR B  1 340 ? -33.946 -18.398  80.792  0.31 21.80 ? 346  THR B CG2 1 
ATOM   5862  C CG2 B THR B  1 340 ? -32.944 -18.732  83.025  0.69 16.97 ? 346  THR B CG2 1 
ATOM   5863  N N   . GLY B  1 341 ? -35.398 -15.581  82.159  1.00 10.66 ? 347  GLY B N   1 
ATOM   5864  C CA  . GLY B  1 341 ? -36.718 -15.408  82.734  1.00 9.29  ? 347  GLY B CA  1 
ATOM   5865  C C   . GLY B  1 341 ? -37.043 -14.167  83.549  1.00 9.91  ? 347  GLY B C   1 
ATOM   5866  O O   . GLY B  1 341 ? -38.051 -14.151  84.256  1.00 17.32 ? 347  GLY B O   1 
ATOM   5867  N N   . VAL B  1 342 ? -36.229 -13.123  83.451  1.00 10.99 ? 348  VAL B N   1 
ATOM   5868  C CA  . VAL B  1 342 ? -36.503 -11.891  84.186  1.00 12.31 ? 348  VAL B CA  1 
ATOM   5869  C C   . VAL B  1 342 ? -37.610 -11.071  83.530  1.00 14.63 ? 348  VAL B C   1 
ATOM   5870  O O   . VAL B  1 342 ? -37.684 -10.983  82.307  1.00 19.03 ? 348  VAL B O   1 
ATOM   5871  C CB  . VAL B  1 342 ? -35.240 -11.042  84.313  1.00 13.92 ? 348  VAL B CB  1 
ATOM   5872  C CG1 . VAL B  1 342 ? -35.526 -9.760   85.081  1.00 15.11 ? 348  VAL B CG1 1 
ATOM   5873  C CG2 . VAL B  1 342 ? -34.144 -11.844  84.991  1.00 10.81 ? 348  VAL B CG2 1 
ATOM   5874  N N   . ARG B  1 343 ? -38.486 -10.496  84.346  1.00 13.61 ? 349  ARG B N   1 
ATOM   5875  C CA  . ARG B  1 343 ? -39.555 -9.616   83.865  1.00 14.79 ? 349  ARG B CA  1 
ATOM   5876  C C   . ARG B  1 343 ? -39.400 -8.258   84.535  1.00 17.02 ? 349  ARG B C   1 
ATOM   5877  O O   . ARG B  1 343 ? -39.769 -8.100   85.686  1.00 21.59 ? 349  ARG B O   1 
ATOM   5878  C CB  . ARG B  1 343 ? -40.941 -10.194  84.178  1.00 15.58 ? 349  ARG B CB  1 
ATOM   5879  C CG  . ARG B  1 343 ? -41.301 -11.527  83.500  1.00 21.57 ? 349  ARG B CG  1 
ATOM   5880  C CD  . ARG B  1 343 ? -42.050 -11.337  82.172  1.00 25.50 ? 349  ARG B CD  1 
ATOM   5881  N NE  . ARG B  1 343 ? -42.436 -12.599  81.524  1.00 23.28 ? 349  ARG B NE  1 
ATOM   5882  C CZ  . ARG B  1 343 ? -41.576 -13.440  80.957  1.00 22.62 ? 349  ARG B CZ  1 
ATOM   5883  N NH1 . ARG B  1 343 ? -41.996 -14.565  80.382  1.00 20.71 ? 349  ARG B NH1 1 
ATOM   5884  N NH2 . ARG B  1 343 ? -40.285 -13.153  80.972  1.00 26.36 ? 349  ARG B NH2 1 
ATOM   5885  N N   . ALA B  1 344 ? -38.826 -7.288   83.834  1.00 15.05 ? 350  ALA B N   1 
ATOM   5886  C CA  . ALA B  1 344 ? -38.621 -5.962   84.398  1.00 11.98 ? 350  ALA B CA  1 
ATOM   5887  C C   . ALA B  1 344 ? -39.684 -5.031   83.865  1.00 12.71 ? 350  ALA B C   1 
ATOM   5888  O O   . ALA B  1 344 ? -39.859 -4.914   82.654  1.00 11.28 ? 350  ALA B O   1 
ATOM   5889  C CB  . ALA B  1 344 ? -37.237 -5.443   84.068  1.00 12.22 ? 350  ALA B CB  1 
ATOM   5890  N N   . ASN B  1 345 ? -40.395 -4.361   84.767  1.00 15.28 ? 351  ASN B N   1 
ATOM   5891  C CA  . ASN B  1 345 ? -41.625 -3.683   84.384  1.00 16.88 ? 351  ASN B CA  1 
ATOM   5892  C C   . ASN B  1 345 ? -41.492 -2.168   84.322  1.00 16.71 ? 351  ASN B C   1 
ATOM   5893  O O   . ASN B  1 345 ? -40.460 -1.620   84.719  1.00 13.85 ? 351  ASN B O   1 
ATOM   5894  C CB  . ASN B  1 345 ? -42.746 -4.109   85.329  1.00 15.56 ? 351  ASN B CB  1 
ATOM   5895  C CG  . ASN B  1 345 ? -43.182 -5.535   85.073  1.00 20.22 ? 351  ASN B CG  1 
ATOM   5896  O OD1 . ASN B  1 345 ? -43.475 -5.898   83.944  1.00 25.40 ? 351  ASN B OD1 1 
ATOM   5897  N ND2 . ASN B  1 345 ? -43.174 -6.358   86.103  1.00 22.28 ? 351  ASN B ND2 1 
ATOM   5898  N N   . SER B  1 346 ? -42.531 -1.507   83.798  1.00 13.70 ? 352  SER B N   1 
ATOM   5899  C CA  . SER B  1 346 ? -42.440 -0.103   83.385  1.00 15.90 ? 352  SER B CA  1 
ATOM   5900  C C   . SER B  1 346 ? -41.985 0.869    84.472  1.00 15.91 ? 352  SER B C   1 
ATOM   5901  O O   . SER B  1 346 ? -42.421 0.785    85.606  1.00 18.78 ? 352  SER B O   1 
ATOM   5902  C CB  . SER B  1 346 ? -43.779 0.368    82.828  1.00 18.09 ? 352  SER B CB  1 
ATOM   5903  O OG  . SER B  1 346 ? -44.005 -0.129   81.529  1.00 17.50 ? 352  SER B OG  1 
ATOM   5904  N N   . TYR B  1 347 ? -41.101 1.786    84.078  1.00 14.88 ? 353  TYR B N   1 
ATOM   5905  C CA  . TYR B  1 347 ? -40.547 2.855    84.920  1.00 15.59 ? 353  TYR B CA  1 
ATOM   5906  C C   . TYR B  1 347 ? -39.526 2.348    85.938  1.00 17.57 ? 353  TYR B C   1 
ATOM   5907  O O   . TYR B  1 347 ? -39.005 3.129    86.729  1.00 22.21 ? 353  TYR B O   1 
ATOM   5908  C CB  . TYR B  1 347 ? -41.669 3.639    85.631  1.00 15.66 ? 353  TYR B CB  1 
ATOM   5909  C CG  . TYR B  1 347 ? -42.753 4.066    84.673  1.00 17.93 ? 353  TYR B CG  1 
ATOM   5910  C CD1 . TYR B  1 347 ? -42.524 5.088    83.761  1.00 19.17 ? 353  TYR B CD1 1 
ATOM   5911  C CD2 . TYR B  1 347 ? -43.987 3.428    84.651  1.00 15.98 ? 353  TYR B CD2 1 
ATOM   5912  C CE1 . TYR B  1 347 ? -43.489 5.467    82.858  1.00 19.74 ? 353  TYR B CE1 1 
ATOM   5913  C CE2 . TYR B  1 347 ? -44.964 3.803    83.746  1.00 14.80 ? 353  TYR B CE2 1 
ATOM   5914  C CZ  . TYR B  1 347 ? -44.706 4.823    82.849  1.00 18.81 ? 353  TYR B CZ  1 
ATOM   5915  O OH  . TYR B  1 347 ? -45.662 5.215    81.936  1.00 23.56 ? 353  TYR B OH  1 
ATOM   5916  N N   . SER B  1 348 ? -39.215 1.055    85.911  1.00 17.05 ? 354  SER B N   1 
ATOM   5917  C CA  . SER B  1 348 ? -38.213 0.536    86.827  1.00 13.47 ? 354  SER B CA  1 
ATOM   5918  C C   . SER B  1 348 ? -36.821 0.837    86.290  1.00 15.93 ? 354  SER B C   1 
ATOM   5919  O O   . SER B  1 348 ? -36.662 1.178    85.113  1.00 19.30 ? 354  SER B O   1 
ATOM   5920  C CB  . SER B  1 348 ? -38.390 -0.962   87.065  1.00 14.70 ? 354  SER B CB  1 
ATOM   5921  O OG  . SER B  1 348 ? -38.399 -1.691   85.850  1.00 20.16 ? 354  SER B OG  1 
ATOM   5922  N N   . ARG B  1 349 ? -35.824 0.743    87.166  1.00 13.01 ? 355  ARG B N   1 
ATOM   5923  C CA  . ARG B  1 349 ? -34.432 0.984    86.802  1.00 16.82 ? 355  ARG B CA  1 
ATOM   5924  C C   . ARG B  1 349 ? -33.497 -0.011   87.484  1.00 18.11 ? 355  ARG B C   1 
ATOM   5925  O O   . ARG B  1 349 ? -33.663 -0.310   88.665  1.00 19.36 ? 355  ARG B O   1 
ATOM   5926  C CB  . ARG B  1 349 ? -34.005 2.394    87.185  1.00 21.89 ? 355  ARG B CB  1 
ATOM   5927  C CG  . ARG B  1 349 ? -34.953 3.493    86.761  1.00 32.89 ? 355  ARG B CG  1 
ATOM   5928  C CD  . ARG B  1 349 ? -34.290 4.836    86.966  1.00 40.66 ? 355  ARG B CD  1 
ATOM   5929  N NE  . ARG B  1 349 ? -32.987 4.844    86.302  1.00 46.88 ? 355  ARG B NE  1 
ATOM   5930  C CZ  . ARG B  1 349 ? -32.820 5.000    84.990  1.00 51.36 ? 355  ARG B CZ  1 
ATOM   5931  N NH1 . ARG B  1 349 ? -33.874 5.178    84.202  1.00 52.63 ? 355  ARG B NH1 1 
ATOM   5932  N NH2 . ARG B  1 349 ? -31.600 4.990    84.464  1.00 51.37 ? 355  ARG B NH2 1 
ATOM   5933  N N   . LEU B  1 350 ? -32.510 -0.506   86.738  1.00 17.77 ? 356  LEU B N   1 
ATOM   5934  C CA  . LEU B  1 350 ? -31.481 -1.396   87.273  1.00 17.19 ? 356  LEU B CA  1 
ATOM   5935  C C   . LEU B  1 350 ? -30.092 -0.920   86.862  1.00 16.81 ? 356  LEU B C   1 
ATOM   5936  O O   . LEU B  1 350 ? -29.827 -0.739   85.675  1.00 17.26 ? 356  LEU B O   1 
ATOM   5937  C CB  . LEU B  1 350 ? -31.686 -2.828   86.781  1.00 19.51 ? 356  LEU B CB  1 
ATOM   5938  C CG  . LEU B  1 350 ? -32.929 -3.587   87.220  1.00 23.67 ? 356  LEU B CG  1 
ATOM   5939  C CD1 . LEU B  1 350 ? -32.887 -5.000   86.663  1.00 24.09 ? 356  LEU B CD1 1 
ATOM   5940  C CD2 . LEU B  1 350 ? -32.993 -3.615   88.723  1.00 20.84 ? 356  LEU B CD2 1 
ATOM   5941  N N   . GLU B  1 351 ? -29.212 -0.715   87.839  1.00 16.93 ? 357  GLU B N   1 
ATOM   5942  C CA  . GLU B  1 351 ? -27.828 -0.345   87.563  1.00 15.77 ? 357  GLU B CA  1 
ATOM   5943  C C   . GLU B  1 351 ? -26.907 -1.202   88.407  1.00 15.54 ? 357  GLU B C   1 
ATOM   5944  O O   . GLU B  1 351 ? -27.173 -1.398   89.585  1.00 17.41 ? 357  GLU B O   1 
ATOM   5945  C CB  . GLU B  1 351 ? -27.569 1.138    87.855  1.00 20.18 ? 357  GLU B CB  1 
ATOM   5946  C CG  . GLU B  1 351 ? -28.469 2.108    87.098  1.00 30.84 ? 357  GLU B CG  1 
ATOM   5947  C CD  . GLU B  1 351 ? -27.703 3.045    86.162  1.00 38.70 ? 357  GLU B CD  1 
ATOM   5948  O OE1 . GLU B  1 351 ? -26.455 3.075    86.214  1.00 39.64 ? 357  GLU B OE1 1 
ATOM   5949  O OE2 . GLU B  1 351 ? -28.355 3.753    85.367  1.00 40.53 ? 357  GLU B OE2 1 
ATOM   5950  N N   . ASN B  1 352 ? -25.832 -1.708   87.805  1.00 16.57 ? 358  ASN B N   1 
ATOM   5951  C CA  . ASN B  1 352 ? -24.854 -2.523   88.528  1.00 16.63 ? 358  ASN B CA  1 
ATOM   5952  C C   . ASN B  1 352 ? -25.517 -3.693   89.233  1.00 17.23 ? 358  ASN B C   1 
ATOM   5953  O O   . ASN B  1 352 ? -25.231 -3.960   90.392  1.00 16.04 ? 358  ASN B O   1 
ATOM   5954  C CB  . ASN B  1 352 ? -24.079 -1.674   89.548  1.00 13.85 ? 358  ASN B CB  1 
ATOM   5955  C CG  . ASN B  1 352 ? -23.054 -0.751   88.899  1.00 14.87 ? 358  ASN B CG  1 
ATOM   5956  O OD1 . ASN B  1 352 ? -22.943 -0.682   87.680  1.00 17.97 ? 358  ASN B OD1 1 
ATOM   5957  N ND2 . ASN B  1 352 ? -22.291 -0.042   89.725  1.00 18.72 ? 358  ASN B ND2 1 
ATOM   5958  N N   . ALA B  1 353 ? -26.411 -4.380   88.528  1.00 15.24 ? 359  ALA B N   1 
ATOM   5959  C CA  . ALA B  1 353 ? -27.191 -5.464   89.121  1.00 13.24 ? 359  ALA B CA  1 
ATOM   5960  C C   . ALA B  1 353 ? -26.870 -6.828   88.521  1.00 13.52 ? 359  ALA B C   1 
ATOM   5961  O O   . ALA B  1 353 ? -26.780 -6.977   87.301  1.00 16.14 ? 359  ALA B O   1 
ATOM   5962  C CB  . ALA B  1 353 ? -28.669 -5.181   88.960  1.00 15.50 ? 359  ALA B CB  1 
ATOM   5963  N N   . VAL B  1 354 ? -26.703 -7.821   89.381  1.00 15.52 ? 360  VAL B N   1 
ATOM   5964  C CA  . VAL B  1 354 ? -26.710 -9.204   88.938  1.00 14.38 ? 360  VAL B CA  1 
ATOM   5965  C C   . VAL B  1 354 ? -28.061 -9.787   89.325  1.00 14.04 ? 360  VAL B C   1 
ATOM   5966  O O   . VAL B  1 354 ? -28.414 -9.829   90.502  1.00 13.68 ? 360  VAL B O   1 
ATOM   5967  C CB  . VAL B  1 354 ? -25.563 -10.009  89.553  1.00 12.58 ? 360  VAL B CB  1 
ATOM   5968  C CG1 . VAL B  1 354 ? -25.575 -11.418  89.026  1.00 12.16 ? 360  VAL B CG1 1 
ATOM   5969  C CG2 . VAL B  1 354 ? -24.239 -9.349   89.236  1.00 14.88 ? 360  VAL B CG2 1 
ATOM   5970  N N   . VAL B  1 355 ? -28.835 -10.192  88.326  1.00 13.14 ? 361  VAL B N   1 
ATOM   5971  C CA  . VAL B  1 355 ? -30.228 -10.561  88.546  1.00 11.42 ? 361  VAL B CA  1 
ATOM   5972  C C   . VAL B  1 355 ? -30.453 -12.016  88.136  1.00 11.27 ? 361  VAL B C   1 
ATOM   5973  O O   . VAL B  1 355 ? -30.443 -12.332  86.960  1.00 10.05 ? 361  VAL B O   1 
ATOM   5974  C CB  . VAL B  1 355 ? -31.187 -9.631   87.757  1.00 12.54 ? 361  VAL B CB  1 
ATOM   5975  C CG1 . VAL B  1 355 ? -32.629 -9.970   88.040  1.00 9.58  ? 361  VAL B CG1 1 
ATOM   5976  C CG2 . VAL B  1 355 ? -30.935 -8.180   88.098  1.00 16.57 ? 361  VAL B CG2 1 
ATOM   5977  N N   . LEU B  1 356 ? -30.673 -12.884  89.117  1.00 12.34 ? 362  LEU B N   1 
ATOM   5978  C CA  . LEU B  1 356 ? -30.716 -14.335  88.916  1.00 12.57 ? 362  LEU B CA  1 
ATOM   5979  C C   . LEU B  1 356 ? -32.040 -14.765  88.268  1.00 10.26 ? 362  LEU B C   1 
ATOM   5980  O O   . LEU B  1 356 ? -32.912 -13.926  88.076  1.00 13.23 ? 362  LEU B O   1 
ATOM   5981  C CB  . LEU B  1 356 ? -30.474 -15.028  90.266  1.00 11.08 ? 362  LEU B CB  1 
ATOM   5982  C CG  . LEU B  1 356 ? -29.000 -15.337  90.566  1.00 15.70 ? 362  LEU B CG  1 
ATOM   5983  C CD1 . LEU B  1 356 ? -28.079 -14.149  90.322  1.00 13.66 ? 362  LEU B CD1 1 
ATOM   5984  C CD2 . LEU B  1 356 ? -28.850 -15.810  91.986  1.00 15.51 ? 362  LEU B CD2 1 
ATOM   5985  N N   . PRO B  1 357 ? -32.196 -16.058  87.900  1.00 11.04 ? 363  PRO B N   1 
ATOM   5986  C CA  . PRO B  1 357 ? -33.361 -16.364  87.056  1.00 11.51 ? 363  PRO B CA  1 
ATOM   5987  C C   . PRO B  1 357 ? -34.744 -16.071  87.650  1.00 13.11 ? 363  PRO B C   1 
ATOM   5988  O O   . PRO B  1 357 ? -34.963 -16.191  88.846  1.00 17.46 ? 363  PRO B O   1 
ATOM   5989  C CB  . PRO B  1 357 ? -33.217 -17.867  86.804  1.00 10.49 ? 363  PRO B CB  1 
ATOM   5990  C CG  . PRO B  1 357 ? -31.772 -18.094  86.843  1.00 11.29 ? 363  PRO B CG  1 
ATOM   5991  C CD  . PRO B  1 357 ? -31.272 -17.203  87.953  1.00 10.75 ? 363  PRO B CD  1 
ATOM   5992  N N   . SER B  1 358 ? -35.656 -15.668  86.768  1.00 14.04 ? 364  SER B N   1 
ATOM   5993  C CA  . SER B  1 358 ? -37.080 -15.538  87.059  1.00 15.16 ? 364  SER B CA  1 
ATOM   5994  C C   . SER B  1 358 ? -37.444 -14.404  88.019  1.00 16.90 ? 364  SER B C   1 
ATOM   5995  O O   . SER B  1 358 ? -38.550 -14.384  88.551  1.00 16.73 ? 364  SER B O   1 
ATOM   5996  C CB  . SER B  1 358 ? -37.621 -16.860  87.606  1.00 17.98 ? 364  SER B CB  1 
ATOM   5997  O OG  . SER B  1 358 ? -37.280 -17.936  86.750  1.00 21.40 ? 364  SER B OG  1 
ATOM   5998  N N   . VAL B  1 359 ? -36.528 -13.465  88.227  1.00 14.22 ? 365  VAL B N   1 
ATOM   5999  C CA  . VAL B  1 359 ? -36.813 -12.295  89.045  1.00 11.66 ? 365  VAL B CA  1 
ATOM   6000  C C   . VAL B  1 359 ? -37.889 -11.458  88.355  1.00 12.45 ? 365  VAL B C   1 
ATOM   6001  O O   . VAL B  1 359 ? -37.960 -11.431  87.134  1.00 12.18 ? 365  VAL B O   1 
ATOM   6002  C CB  . VAL B  1 359 ? -35.534 -11.473  89.290  1.00 13.52 ? 365  VAL B CB  1 
ATOM   6003  C CG1 . VAL B  1 359 ? -35.839 -10.123  89.911  1.00 16.86 ? 365  VAL B CG1 1 
ATOM   6004  C CG2 . VAL B  1 359 ? -34.594 -12.245  90.180  1.00 14.27 ? 365  VAL B CG2 1 
ATOM   6005  N N   . LYS B  1 360 ? -38.765 -10.837  89.137  1.00 12.16 ? 366  LYS B N   1 
ATOM   6006  C CA  . LYS B  1 360 ? -39.710 -9.869   88.606  1.00 13.44 ? 366  LYS B CA  1 
ATOM   6007  C C   . LYS B  1 360 ? -39.451 -8.507   89.237  1.00 12.31 ? 366  LYS B C   1 
ATOM   6008  O O   . LYS B  1 360 ? -39.425 -8.383   90.457  1.00 15.06 ? 366  LYS B O   1 
ATOM   6009  C CB  . LYS B  1 360 ? -41.147 -10.328  88.863  1.00 18.20 ? 366  LYS B CB  1 
ATOM   6010  C CG  . LYS B  1 360 ? -41.319 -11.852  88.751  1.00 31.50 ? 366  LYS B CG  1 
ATOM   6011  C CD  . LYS B  1 360 ? -42.774 -12.316  88.952  1.00 37.98 ? 366  LYS B CD  1 
ATOM   6012  C CE  . LYS B  1 360 ? -43.583 -12.321  87.640  1.00 36.16 ? 366  LYS B CE  1 
ATOM   6013  N NZ  . LYS B  1 360 ? -43.074 -13.289  86.623  1.00 32.31 ? 366  LYS B NZ  1 
ATOM   6014  N N   . ILE B  1 361 ? -39.245 -7.491   88.406  1.00 12.17 ? 367  ILE B N   1 
ATOM   6015  C CA  . ILE B  1 361 ? -39.010 -6.139   88.894  1.00 11.82 ? 367  ILE B CA  1 
ATOM   6016  C C   . ILE B  1 361 ? -40.258 -5.290   88.708  1.00 15.89 ? 367  ILE B C   1 
ATOM   6017  O O   . ILE B  1 361 ? -40.594 -4.923   87.589  1.00 17.84 ? 367  ILE B O   1 
ATOM   6018  C CB  . ILE B  1 361 ? -37.848 -5.448   88.157  1.00 14.99 ? 367  ILE B CB  1 
ATOM   6019  C CG1 . ILE B  1 361 ? -36.635 -6.372   88.045  1.00 19.11 ? 367  ILE B CG1 1 
ATOM   6020  C CG2 . ILE B  1 361 ? -37.504 -4.137   88.832  1.00 14.34 ? 367  ILE B CG2 1 
ATOM   6021  C CD1 . ILE B  1 361 ? -35.940 -6.592   89.328  1.00 23.31 ? 367  ILE B CD1 1 
ATOM   6022  N N   . GLY B  1 362 ? -40.937 -4.966   89.805  1.00 17.48 ? 368  GLY B N   1 
ATOM   6023  C CA  . GLY B  1 362 ? -42.166 -4.203   89.723  1.00 14.92 ? 368  GLY B CA  1 
ATOM   6024  C C   . GLY B  1 362 ? -41.991 -2.793   89.192  1.00 15.82 ? 368  GLY B C   1 
ATOM   6025  O O   . GLY B  1 362 ? -40.920 -2.202   89.309  1.00 19.26 ? 368  GLY B O   1 
ATOM   6026  N N   . ARG B  1 363 ? -43.057 -2.249   88.613  1.00 11.99 ? 369  ARG B N   1 
ATOM   6027  C CA  . ARG B  1 363 ? -43.044 -0.875   88.142  1.00 11.36 ? 369  ARG B CA  1 
ATOM   6028  C C   . ARG B  1 363 ? -42.447 0.088    89.153  1.00 13.84 ? 369  ARG B C   1 
ATOM   6029  O O   . ARG B  1 363 ? -42.660 -0.056   90.354  1.00 16.11 ? 369  ARG B O   1 
ATOM   6030  C CB  . ARG B  1 363 ? -44.455 -0.419   87.798  1.00 14.44 ? 369  ARG B CB  1 
ATOM   6031  C CG  . ARG B  1 363 ? -45.049 -1.068   86.582  1.00 17.43 ? 369  ARG B CG  1 
ATOM   6032  C CD  . ARG B  1 363 ? -46.409 -0.477   86.337  1.00 19.24 ? 369  ARG B CD  1 
ATOM   6033  N NE  . ARG B  1 363 ? -46.861 -0.757   84.992  1.00 19.15 ? 369  ARG B NE  1 
ATOM   6034  C CZ  . ARG B  1 363 ? -47.559 0.095    84.259  1.00 21.30 ? 369  ARG B CZ  1 
ATOM   6035  N NH1 . ARG B  1 363 ? -47.882 1.281    84.754  1.00 24.90 ? 369  ARG B NH1 1 
ATOM   6036  N NH2 . ARG B  1 363 ? -47.933 -0.240   83.037  1.00 23.08 ? 369  ARG B NH2 1 
ATOM   6037  N N   . HIS B  1 364 ? -41.674 1.043    88.642  1.00 15.87 ? 370  HIS B N   1 
ATOM   6038  C CA  . HIS B  1 364 ? -41.106 2.145    89.416  1.00 16.90 ? 370  HIS B CA  1 
ATOM   6039  C C   . HIS B  1 364 ? -39.977 1.759    90.359  1.00 19.36 ? 370  HIS B C   1 
ATOM   6040  O O   . HIS B  1 364 ? -39.367 2.637    90.961  1.00 27.39 ? 370  HIS B O   1 
ATOM   6041  C CB  . HIS B  1 364 ? -42.206 2.856    90.220  1.00 19.05 ? 370  HIS B CB  1 
ATOM   6042  C CG  . HIS B  1 364 ? -43.295 3.425    89.370  1.00 17.07 ? 370  HIS B CG  1 
ATOM   6043  N ND1 . HIS B  1 364 ? -43.159 4.614    88.685  1.00 17.13 ? 370  HIS B ND1 1 
ATOM   6044  C CD2 . HIS B  1 364 ? -44.538 2.969    89.092  1.00 16.90 ? 370  HIS B CD2 1 
ATOM   6045  C CE1 . HIS B  1 364 ? -44.268 4.860    88.013  1.00 18.09 ? 370  HIS B CE1 1 
ATOM   6046  N NE2 . HIS B  1 364 ? -45.123 3.880    88.246  1.00 19.06 ? 370  HIS B NE2 1 
ATOM   6047  N N   . ALA B  1 365 ? -39.676 0.470    90.489  1.00 17.08 ? 371  ALA B N   1 
ATOM   6048  C CA  . ALA B  1 365 ? -38.627 0.059    91.419  1.00 16.75 ? 371  ALA B CA  1 
ATOM   6049  C C   . ALA B  1 365 ? -37.272 0.522    90.909  1.00 16.89 ? 371  ALA B C   1 
ATOM   6050  O O   . ALA B  1 365 ? -37.016 0.482    89.711  1.00 17.10 ? 371  ALA B O   1 
ATOM   6051  C CB  . ALA B  1 365 ? -38.637 -1.447   91.617  1.00 16.43 ? 371  ALA B CB  1 
ATOM   6052  N N   . GLN B  1 366 ? -36.415 0.984    91.811  1.00 14.40 ? 372  GLN B N   1 
ATOM   6053  C CA  . GLN B  1 366 ? -35.080 1.416    91.428  1.00 21.28 ? 372  GLN B CA  1 
ATOM   6054  C C   . GLN B  1 366 ? -34.015 0.737    92.281  1.00 21.31 ? 372  GLN B C   1 
ATOM   6055  O O   . GLN B  1 366 ? -33.944 0.955    93.487  1.00 18.56 ? 372  GLN B O   1 
ATOM   6056  C CB  . GLN B  1 366 ? -34.957 2.928    91.544  1.00 23.01 ? 372  GLN B CB  1 
ATOM   6057  C CG  . GLN B  1 366 ? -35.965 3.691    90.720  1.00 22.96 ? 372  GLN B CG  1 
ATOM   6058  C CD  . GLN B  1 366 ? -35.798 5.180    90.878  1.00 31.38 ? 372  GLN B CD  1 
ATOM   6059  O OE1 . GLN B  1 366 ? -34.920 5.641    91.606  1.00 32.26 ? 372  GLN B OE1 1 
ATOM   6060  N NE2 . GLN B  1 366 ? -36.648 5.944    90.211  1.00 38.02 ? 372  GLN B NE2 1 
ATOM   6061  N N   . LEU B  1 367 ? -33.188 -0.089   91.645  1.00 18.60 ? 373  LEU B N   1 
ATOM   6062  C CA  . LEU B  1 367 ? -32.192 -0.876   92.364  1.00 17.87 ? 373  LEU B CA  1 
ATOM   6063  C C   . LEU B  1 367 ? -30.783 -0.653   91.817  1.00 20.53 ? 373  LEU B C   1 
ATOM   6064  O O   . LEU B  1 367 ? -30.564 -0.726   90.606  1.00 19.78 ? 373  LEU B O   1 
ATOM   6065  C CB  . LEU B  1 367 ? -32.541 -2.365   92.291  1.00 19.05 ? 373  LEU B CB  1 
ATOM   6066  C CG  . LEU B  1 367 ? -33.970 -2.788   92.636  1.00 22.77 ? 373  LEU B CG  1 
ATOM   6067  C CD1 . LEU B  1 367 ? -34.067 -4.293   92.645  1.00 25.64 ? 373  LEU B CD1 1 
ATOM   6068  C CD2 . LEU B  1 367 ? -34.397 -2.243   93.971  1.00 23.78 ? 373  LEU B CD2 1 
ATOM   6069  N N   . SER B  1 368 ? -29.831 -0.382   92.706  1.00 20.68 ? 374  SER B N   1 
ATOM   6070  C CA  . SER B  1 368 ? -28.436 -0.206   92.304  1.00 20.92 ? 374  SER B CA  1 
ATOM   6071  C C   . SER B  1 368 ? -27.499 -1.009   93.187  1.00 17.44 ? 374  SER B C   1 
ATOM   6072  O O   . SER B  1 368 ? -27.709 -1.087   94.399  1.00 15.09 ? 374  SER B O   1 
ATOM   6073  C CB  . SER B  1 368 ? -28.044 1.268    92.340  1.00 22.10 ? 374  SER B CB  1 
ATOM   6074  O OG  . SER B  1 368 ? -28.843 2.001    91.434  1.00 28.67 ? 374  SER B OG  1 
ATOM   6075  N N   . ASN B  1 369 ? -26.469 -1.593   92.560  1.00 20.23 ? 375  ASN B N   1 
ATOM   6076  C CA  . ASN B  1 369 ? -25.422 -2.373   93.234  1.00 20.41 ? 375  ASN B CA  1 
ATOM   6077  C C   . ASN B  1 369 ? -25.978 -3.551   94.005  1.00 19.12 ? 375  ASN B C   1 
ATOM   6078  O O   . ASN B  1 369 ? -25.816 -3.649   95.223  1.00 20.78 ? 375  ASN B O   1 
ATOM   6079  C CB  . ASN B  1 369 ? -24.601 -1.488   94.175  1.00 24.12 ? 375  ASN B CB  1 
ATOM   6080  C CG  . ASN B  1 369 ? -23.720 -0.519   93.427  1.00 23.67 ? 375  ASN B CG  1 
ATOM   6081  O OD1 . ASN B  1 369 ? -22.815 -0.929   92.709  1.00 26.95 ? 375  ASN B OD1 1 
ATOM   6082  N ND2 . ASN B  1 369 ? -23.975 0.772    93.592  1.00 28.20 ? 375  ASN B ND2 1 
ATOM   6083  N N   . VAL B  1 370 ? -26.628 -4.449   93.280  1.00 18.91 ? 376  VAL B N   1 
ATOM   6084  C CA  . VAL B  1 370 ? -27.370 -5.530   93.903  1.00 16.89 ? 376  VAL B CA  1 
ATOM   6085  C C   . VAL B  1 370 ? -27.121 -6.886   93.268  1.00 12.10 ? 376  VAL B C   1 
ATOM   6086  O O   . VAL B  1 370 ? -26.736 -6.996   92.104  1.00 11.42 ? 376  VAL B O   1 
ATOM   6087  C CB  . VAL B  1 370 ? -28.898 -5.284   93.862  1.00 20.36 ? 376  VAL B CB  1 
ATOM   6088  C CG1 . VAL B  1 370 ? -29.313 -4.230   94.879  1.00 26.65 ? 376  VAL B CG1 1 
ATOM   6089  C CG2 . VAL B  1 370 ? -29.345 -4.907   92.460  1.00 20.58 ? 376  VAL B CG2 1 
ATOM   6090  N N   . VAL B  1 371 ? -27.348 -7.904   94.085  1.00 12.79 ? 377  VAL B N   1 
ATOM   6091  C CA  . VAL B  1 371 ? -27.516 -9.267   93.641  1.00 14.78 ? 377  VAL B CA  1 
ATOM   6092  C C   . VAL B  1 371 ? -28.916 -9.664   94.071  1.00 18.86 ? 377  VAL B C   1 
ATOM   6093  O O   . VAL B  1 371 ? -29.250 -9.567   95.247  1.00 20.50 ? 377  VAL B O   1 
ATOM   6094  C CB  . VAL B  1 371 ? -26.499 -10.214  94.268  1.00 14.02 ? 377  VAL B CB  1 
ATOM   6095  C CG1 . VAL B  1 371 ? -26.781 -11.649  93.824  1.00 15.64 ? 377  VAL B CG1 1 
ATOM   6096  C CG2 . VAL B  1 371 ? -25.080 -9.774   93.938  1.00 13.99 ? 377  VAL B CG2 1 
ATOM   6097  N N   . ILE B  1 372 ? -29.747 -10.074  93.121  1.00 17.19 ? 378  ILE B N   1 
ATOM   6098  C CA  . ILE B  1 372 ? -31.114 -10.465  93.429  1.00 13.89 ? 378  ILE B CA  1 
ATOM   6099  C C   . ILE B  1 372 ? -31.239 -11.967  93.268  1.00 15.04 ? 378  ILE B C   1 
ATOM   6100  O O   . ILE B  1 372 ? -30.950 -12.492  92.201  1.00 16.69 ? 378  ILE B O   1 
ATOM   6101  C CB  . ILE B  1 372 ? -32.119 -9.756   92.516  1.00 16.32 ? 378  ILE B CB  1 
ATOM   6102  C CG1 . ILE B  1 372 ? -31.885 -8.246   92.537  1.00 19.74 ? 378  ILE B CG1 1 
ATOM   6103  C CG2 . ILE B  1 372 ? -33.535 -10.061  92.947  1.00 19.54 ? 378  ILE B CG2 1 
ATOM   6104  C CD1 . ILE B  1 372 ? -32.823 -7.489   91.633  1.00 14.58 ? 378  ILE B CD1 1 
ATOM   6105  N N   . ASP B  1 373 ? -31.651 -12.647  94.336  1.00 14.89 ? 379  ASP B N   1 
ATOM   6106  C CA  . ASP B  1 373 ? -31.754 -14.106  94.373  1.00 16.53 ? 379  ASP B CA  1 
ATOM   6107  C C   . ASP B  1 373 ? -32.751 -14.664  93.339  1.00 16.20 ? 379  ASP B C   1 
ATOM   6108  O O   . ASP B  1 373 ? -33.639 -13.965  92.859  1.00 18.39 ? 379  ASP B O   1 
ATOM   6109  C CB  . ASP B  1 373 ? -32.150 -14.549  95.791  1.00 20.33 ? 379  ASP B CB  1 
ATOM   6110  C CG  . ASP B  1 373 ? -31.940 -16.040  96.039  1.00 20.18 ? 379  ASP B CG  1 
ATOM   6111  O OD1 . ASP B  1 373 ? -30.995 -16.626  95.456  1.00 18.41 ? 379  ASP B OD1 1 
ATOM   6112  O OD2 . ASP B  1 373 ? -32.728 -16.620  96.824  1.00 17.69 ? 379  ASP B OD2 1 
ATOM   6113  N N   . HIS B  1 374 ? -32.573 -15.932  93.005  1.00 13.18 ? 380  HIS B N   1 
ATOM   6114  C CA  . HIS B  1 374 ? -33.488 -16.686  92.157  1.00 16.44 ? 380  HIS B CA  1 
ATOM   6115  C C   . HIS B  1 374 ? -34.978 -16.530  92.511  1.00 18.41 ? 380  HIS B C   1 
ATOM   6116  O O   . HIS B  1 374 ? -35.388 -16.886  93.602  1.00 15.61 ? 380  HIS B O   1 
ATOM   6117  C CB  . HIS B  1 374 ? -33.100 -18.160  92.236  1.00 17.54 ? 380  HIS B CB  1 
ATOM   6118  C CG  . HIS B  1 374 ? -33.942 -19.057  91.389  1.00 21.05 ? 380  HIS B CG  1 
ATOM   6119  N ND1 . HIS B  1 374 ? -35.122 -19.609  91.831  1.00 25.13 ? 380  HIS B ND1 1 
ATOM   6120  C CD2 . HIS B  1 374 ? -33.766 -19.507  90.127  1.00 20.66 ? 380  HIS B CD2 1 
ATOM   6121  C CE1 . HIS B  1 374 ? -35.639 -20.360  90.875  1.00 20.76 ? 380  HIS B CE1 1 
ATOM   6122  N NE2 . HIS B  1 374 ? -34.836 -20.312  89.830  1.00 17.89 ? 380  HIS B NE2 1 
ATOM   6123  N N   . GLY B  1 375 ? -35.782 -16.006  91.585  1.00 13.52 ? 381  GLY B N   1 
ATOM   6124  C CA  . GLY B  1 375 ? -37.229 -16.022  91.733  1.00 12.22 ? 381  GLY B CA  1 
ATOM   6125  C C   . GLY B  1 375 ? -37.848 -14.883  92.529  1.00 12.31 ? 381  GLY B C   1 
ATOM   6126  O O   . GLY B  1 375 ? -39.067 -14.815  92.674  1.00 18.01 ? 381  GLY B O   1 
ATOM   6127  N N   . VAL B  1 376 ? -37.017 -13.981  93.036  1.00 11.57 ? 382  VAL B N   1 
ATOM   6128  C CA  . VAL B  1 376 ? -37.481 -12.869  93.861  1.00 13.23 ? 382  VAL B CA  1 
ATOM   6129  C C   . VAL B  1 376 ? -38.462 -11.958  93.123  1.00 17.64 ? 382  VAL B C   1 
ATOM   6130  O O   . VAL B  1 376 ? -38.261 -11.613  91.960  1.00 14.04 ? 382  VAL B O   1 
ATOM   6131  C CB  . VAL B  1 376 ? -36.285 -12.037  94.365  1.00 13.22 ? 382  VAL B CB  1 
ATOM   6132  C CG1 . VAL B  1 376 ? -36.750 -10.779  95.064  1.00 15.73 ? 382  VAL B CG1 1 
ATOM   6133  C CG2 . VAL B  1 376 ? -35.433 -12.865  95.298  1.00 16.59 ? 382  VAL B CG2 1 
ATOM   6134  N N   . VAL B  1 377 ? -39.542 -11.583  93.801  1.00 17.55 ? 383  VAL B N   1 
ATOM   6135  C CA  . VAL B  1 377 ? -40.500 -10.642  93.241  1.00 16.78 ? 383  VAL B CA  1 
ATOM   6136  C C   . VAL B  1 377 ? -40.313 -9.297   93.915  1.00 18.09 ? 383  VAL B C   1 
ATOM   6137  O O   . VAL B  1 377 ? -40.735 -9.099   95.050  1.00 19.27 ? 383  VAL B O   1 
ATOM   6138  C CB  . VAL B  1 377 ? -41.948 -11.141  93.408  1.00 13.68 ? 383  VAL B CB  1 
ATOM   6139  C CG1 . VAL B  1 377 ? -42.932 -10.089  92.979  1.00 12.40 ? 383  VAL B CG1 1 
ATOM   6140  C CG2 . VAL B  1 377 ? -42.152 -12.398  92.590  1.00 14.52 ? 383  VAL B CG2 1 
ATOM   6141  N N   . ILE B  1 378 ? -39.641 -8.388   93.219  1.00 19.38 ? 384  ILE B N   1 
ATOM   6142  C CA  . ILE B  1 378 ? -39.382 -7.049   93.723  1.00 16.72 ? 384  ILE B CA  1 
ATOM   6143  C C   . ILE B  1 378 ? -40.674 -6.248   93.729  1.00 20.73 ? 384  ILE B C   1 
ATOM   6144  O O   . ILE B  1 378 ? -41.267 -6.021   92.677  1.00 22.82 ? 384  ILE B O   1 
ATOM   6145  C CB  . ILE B  1 378 ? -38.329 -6.305   92.872  1.00 18.80 ? 384  ILE B CB  1 
ATOM   6146  C CG1 . ILE B  1 378 ? -36.998 -7.065   92.871  1.00 15.52 ? 384  ILE B CG1 1 
ATOM   6147  C CG2 . ILE B  1 378 ? -38.170 -4.871   93.366  1.00 19.56 ? 384  ILE B CG2 1 
ATOM   6148  C CD1 . ILE B  1 378 ? -36.414 -7.262   94.231  1.00 13.80 ? 384  ILE B CD1 1 
ATOM   6149  N N   . PRO B  1 379 ? -41.126 -5.826   94.917  1.00 22.62 ? 385  PRO B N   1 
ATOM   6150  C CA  . PRO B  1 379 ? -42.382 -5.073   94.947  1.00 21.89 ? 385  PRO B CA  1 
ATOM   6151  C C   . PRO B  1 379 ? -42.252 -3.712   94.277  1.00 17.31 ? 385  PRO B C   1 
ATOM   6152  O O   . PRO B  1 379 ? -41.176 -3.113   94.245  1.00 20.49 ? 385  PRO B O   1 
ATOM   6153  C CB  . PRO B  1 379 ? -42.682 -4.934   96.445  1.00 21.24 ? 385  PRO B CB  1 
ATOM   6154  C CG  . PRO B  1 379 ? -41.412 -5.208   97.135  1.00 23.17 ? 385  PRO B CG  1 
ATOM   6155  C CD  . PRO B  1 379 ? -40.615 -6.125   96.264  1.00 20.10 ? 385  PRO B CD  1 
ATOM   6156  N N   . GLU B  1 380 ? -43.360 -3.245   93.723  1.00 15.06 ? 386  GLU B N   1 
ATOM   6157  C CA  . GLU B  1 380 ? -43.405 -1.977   93.017  1.00 21.52 ? 386  GLU B CA  1 
ATOM   6158  C C   . GLU B  1 380 ? -42.867 -0.810   93.840  1.00 22.10 ? 386  GLU B C   1 
ATOM   6159  O O   . GLU B  1 380 ? -43.084 -0.737   95.047  1.00 25.59 ? 386  GLU B O   1 
ATOM   6160  C CB  . GLU B  1 380 ? -44.837 -1.705   92.566  1.00 21.47 ? 386  GLU B CB  1 
ATOM   6161  C CG  . GLU B  1 380 ? -45.360 -2.808   91.657  1.00 26.02 ? 386  GLU B CG  1 
ATOM   6162  C CD  . GLU B  1 380 ? -46.788 -2.595   91.223  1.00 31.87 ? 386  GLU B CD  1 
ATOM   6163  O OE1 . GLU B  1 380 ? -47.626 -2.226   92.070  1.00 38.14 ? 386  GLU B OE1 1 
ATOM   6164  O OE2 . GLU B  1 380 ? -47.074 -2.796   90.029  1.00 32.98 ? 386  GLU B OE2 1 
ATOM   6165  N N   . GLY B  1 381 ? -42.130 0.077    93.177  1.00 21.15 ? 387  GLY B N   1 
ATOM   6166  C CA  . GLY B  1 381 ? -41.599 1.279    93.792  1.00 19.45 ? 387  GLY B CA  1 
ATOM   6167  C C   . GLY B  1 381 ? -40.441 1.127    94.762  1.00 23.82 ? 387  GLY B C   1 
ATOM   6168  O O   . GLY B  1 381 ? -39.983 2.129    95.320  1.00 25.83 ? 387  GLY B O   1 
ATOM   6169  N N   . LEU B  1 382 ? -39.957 -0.097   94.972  1.00 19.97 ? 388  LEU B N   1 
ATOM   6170  C CA  . LEU B  1 382 ? -38.866 -0.306   95.927  1.00 19.79 ? 388  LEU B CA  1 
ATOM   6171  C C   . LEU B  1 382 ? -37.615 0.443    95.494  1.00 21.87 ? 388  LEU B C   1 
ATOM   6172  O O   . LEU B  1 382 ? -37.284 0.463    94.310  1.00 21.95 ? 388  LEU B O   1 
ATOM   6173  C CB  . LEU B  1 382 ? -38.547 -1.790   96.092  1.00 20.04 ? 388  LEU B CB  1 
ATOM   6174  C CG  . LEU B  1 382 ? -37.418 -2.125   97.083  1.00 20.28 ? 388  LEU B CG  1 
ATOM   6175  C CD1 . LEU B  1 382 ? -37.872 -1.885   98.513  1.00 20.31 ? 388  LEU B CD1 1 
ATOM   6176  C CD2 . LEU B  1 382 ? -36.916 -3.551   96.920  1.00 16.53 ? 388  LEU B CD2 1 
ATOM   6177  N N   . ILE B  1 383 ? -36.934 1.074    96.449  1.00 20.81 ? 389  ILE B N   1 
ATOM   6178  C CA  . ILE B  1 383 ? -35.678 1.761    96.165  1.00 19.33 ? 389  ILE B CA  1 
ATOM   6179  C C   . ILE B  1 383 ? -34.527 1.135    96.941  1.00 19.12 ? 389  ILE B C   1 
ATOM   6180  O O   . ILE B  1 383 ? -34.622 0.940    98.151  1.00 20.68 ? 389  ILE B O   1 
ATOM   6181  C CB  . ILE B  1 383 ? -35.748 3.252    96.506  1.00 21.14 ? 389  ILE B CB  1 
ATOM   6182  C CG1 . ILE B  1 383 ? -36.989 3.885    95.877  1.00 19.09 ? 389  ILE B CG1 1 
ATOM   6183  C CG2 . ILE B  1 383 ? -34.492 3.954    96.035  1.00 20.48 ? 389  ILE B CG2 1 
ATOM   6184  C CD1 . ILE B  1 383 ? -36.935 3.984    94.386  1.00 16.76 ? 389  ILE B CD1 1 
ATOM   6185  N N   . VAL B  1 384 ? -33.453 0.801    96.228  1.00 20.94 ? 390  VAL B N   1 
ATOM   6186  C CA  . VAL B  1 384 ? -32.243 0.248    96.833  1.00 15.54 ? 390  VAL B CA  1 
ATOM   6187  C C   . VAL B  1 384 ? -31.018 0.893    96.194  1.00 15.53 ? 390  VAL B C   1 
ATOM   6188  O O   . VAL B  1 384 ? -30.954 1.062    94.977  1.00 20.11 ? 390  VAL B O   1 
ATOM   6189  C CB  . VAL B  1 384 ? -32.163 -1.293   96.680  1.00 19.67 ? 390  VAL B CB  1 
ATOM   6190  C CG1 . VAL B  1 384 ? -30.828 -1.820   97.198  1.00 18.85 ? 390  VAL B CG1 1 
ATOM   6191  C CG2 . VAL B  1 384 ? -33.318 -1.976   97.405  1.00 19.48 ? 390  VAL B CG2 1 
ATOM   6192  N N   . GLY B  1 385 ? -30.054 1.273    97.022  1.00 17.32 ? 391  GLY B N   1 
ATOM   6193  C CA  . GLY B  1 385 ? -28.792 1.776    96.526  1.00 22.16 ? 391  GLY B CA  1 
ATOM   6194  C C   . GLY B  1 385 ? -28.653 3.241    96.830  1.00 27.55 ? 391  GLY B C   1 
ATOM   6195  O O   . GLY B  1 385 ? -27.732 3.905    96.364  1.00 30.40 ? 391  GLY B O   1 
ATOM   6196  N N   . GLU B  1 386 ? -29.577 3.743    97.635  1.00 33.20 ? 392  GLU B N   1 
ATOM   6197  C CA  . GLU B  1 386 ? -29.672 5.174    97.872  1.00 35.71 ? 392  GLU B CA  1 
ATOM   6198  C C   . GLU B  1 386 ? -29.525 5.512    99.349  1.00 32.93 ? 392  GLU B C   1 
ATOM   6199  O O   . GLU B  1 386 ? -28.830 6.457    99.706  1.00 36.03 ? 392  GLU B O   1 
ATOM   6200  C CB  . GLU B  1 386 ? -30.999 5.685    97.326  1.00 38.01 ? 392  GLU B CB  1 
ATOM   6201  C CG  . GLU B  1 386 ? -31.564 6.858    98.064  1.00 45.29 ? 392  GLU B CG  1 
ATOM   6202  C CD  . GLU B  1 386 ? -32.859 7.321    97.450  1.00 53.79 ? 392  GLU B CD  1 
ATOM   6203  O OE1 . GLU B  1 386 ? -33.889 7.343    98.163  1.00 50.60 ? 392  GLU B OE1 1 
ATOM   6204  O OE2 . GLU B  1 386 ? -32.843 7.644    96.242  1.00 60.50 ? 392  GLU B OE2 1 
ATOM   6205  N N   . ASP B  1 387 ? -30.171 4.724    100.200 1.00 29.70 ? 393  ASP B N   1 
ATOM   6206  C CA  . ASP B  1 387 ? -30.106 4.908    101.646 1.00 28.13 ? 393  ASP B CA  1 
ATOM   6207  C C   . ASP B  1 387 ? -29.369 3.742    102.287 1.00 25.23 ? 393  ASP B C   1 
ATOM   6208  O O   . ASP B  1 387 ? -29.996 2.759    102.687 1.00 26.91 ? 393  ASP B O   1 
ATOM   6209  C CB  . ASP B  1 387 ? -31.514 5.031    102.226 1.00 31.59 ? 393  ASP B CB  1 
ATOM   6210  C CG  . ASP B  1 387 ? -31.519 5.400    103.700 1.00 37.59 ? 393  ASP B CG  1 
ATOM   6211  O OD1 . ASP B  1 387 ? -30.447 5.377    104.340 1.00 39.12 ? 393  ASP B OD1 1 
ATOM   6212  O OD2 . ASP B  1 387 ? -32.612 5.698    104.228 1.00 39.10 ? 393  ASP B OD2 1 
ATOM   6213  N N   . PRO B  1 388 ? -28.036 3.854    102.393 1.00 25.37 ? 394  PRO B N   1 
ATOM   6214  C CA  . PRO B  1 388 ? -27.167 2.769    102.861 1.00 24.84 ? 394  PRO B CA  1 
ATOM   6215  C C   . PRO B  1 388 ? -27.602 2.170    104.192 1.00 29.07 ? 394  PRO B C   1 
ATOM   6216  O O   . PRO B  1 388 ? -27.575 0.951    104.340 1.00 31.93 ? 394  PRO B O   1 
ATOM   6217  C CB  . PRO B  1 388 ? -25.804 3.450    102.996 1.00 28.04 ? 394  PRO B CB  1 
ATOM   6218  C CG  . PRO B  1 388 ? -25.847 4.570    102.009 1.00 25.09 ? 394  PRO B CG  1 
ATOM   6219  C CD  . PRO B  1 388 ? -27.267 5.059    102.037 1.00 22.87 ? 394  PRO B CD  1 
ATOM   6220  N N   . GLU B  1 389 ? -28.005 3.009    105.140 1.00 31.27 ? 395  GLU B N   1 
ATOM   6221  C CA  . GLU B  1 389 ? -28.387 2.522    106.464 1.00 32.44 ? 395  GLU B CA  1 
ATOM   6222  C C   . GLU B  1 389 ? -29.724 1.800    106.407 1.00 26.49 ? 395  GLU B C   1 
ATOM   6223  O O   . GLU B  1 389 ? -29.921 0.771    107.059 1.00 26.93 ? 395  GLU B O   1 
ATOM   6224  C CB  . GLU B  1 389 ? -28.436 3.674    107.474 1.00 36.59 ? 395  GLU B CB  1 
ATOM   6225  C CG  . GLU B  1 389 ? -27.071 4.324    107.726 1.00 38.85 ? 395  GLU B CG  1 
ATOM   6226  C CD  . GLU B  1 389 ? -26.679 5.313    106.647 1.00 40.55 ? 395  GLU B CD  1 
ATOM   6227  O OE1 . GLU B  1 389 ? -27.587 5.906    106.029 1.00 41.08 ? 395  GLU B OE1 1 
ATOM   6228  O OE2 . GLU B  1 389 ? -25.466 5.492    106.406 1.00 41.12 ? 395  GLU B OE2 1 
ATOM   6229  N N   . LEU B  1 390 ? -30.641 2.343    105.620 1.00 26.07 ? 396  LEU B N   1 
ATOM   6230  C CA  . LEU B  1 390 ? -31.890 1.658    105.345 1.00 28.54 ? 396  LEU B CA  1 
ATOM   6231  C C   . LEU B  1 390 ? -31.590 0.440    104.481 1.00 29.10 ? 396  LEU B C   1 
ATOM   6232  O O   . LEU B  1 390 ? -32.195 -0.617   104.656 1.00 31.97 ? 396  LEU B O   1 
ATOM   6233  C CB  . LEU B  1 390 ? -32.877 2.590    104.653 1.00 29.52 ? 396  LEU B CB  1 
ATOM   6234  C CG  . LEU B  1 390 ? -34.198 2.013    104.154 1.00 33.04 ? 396  LEU B CG  1 
ATOM   6235  C CD1 . LEU B  1 390 ? -35.104 1.625    105.318 1.00 33.99 ? 396  LEU B CD1 1 
ATOM   6236  C CD2 . LEU B  1 390 ? -34.881 2.994    103.210 1.00 30.97 ? 396  LEU B CD2 1 
ATOM   6237  N N   . ASP B  1 391 ? -30.641 0.587    103.559 1.00 28.28 ? 397  ASP B N   1 
ATOM   6238  C CA  . ASP B  1 391 ? -30.253 -0.532   102.705 1.00 30.40 ? 397  ASP B CA  1 
ATOM   6239  C C   . ASP B  1 391 ? -29.563 -1.613   103.524 1.00 33.15 ? 397  ASP B C   1 
ATOM   6240  O O   . ASP B  1 391 ? -29.769 -2.798   103.267 1.00 36.57 ? 397  ASP B O   1 
ATOM   6241  C CB  . ASP B  1 391 ? -29.356 -0.078   101.552 1.00 30.26 ? 397  ASP B CB  1 
ATOM   6242  C CG  . ASP B  1 391 ? -30.134 0.643    100.463 1.00 28.51 ? 397  ASP B CG  1 
ATOM   6243  O OD1 . ASP B  1 391 ? -31.380 0.679    100.551 1.00 26.55 ? 397  ASP B OD1 1 
ATOM   6244  O OD2 . ASP B  1 391 ? -29.504 1.166    99.519  1.00 27.99 ? 397  ASP B OD2 1 
ATOM   6245  N N   . ALA B  1 392 ? -28.781 -1.222   104.526 1.00 31.70 ? 398  ALA B N   1 
ATOM   6246  C CA  . ALA B  1 392 ? -28.184 -2.204   105.427 1.00 30.69 ? 398  ALA B CA  1 
ATOM   6247  C C   . ALA B  1 392 ? -29.242 -2.833   106.329 1.00 30.16 ? 398  ALA B C   1 
ATOM   6248  O O   . ALA B  1 392 ? -29.097 -3.971   106.763 1.00 32.69 ? 398  ALA B O   1 
ATOM   6249  C CB  . ALA B  1 392 ? -27.094 -1.571   106.260 1.00 31.11 ? 398  ALA B CB  1 
ATOM   6250  N N   . LYS B  1 393 ? -30.314 -2.096   106.594 1.00 31.65 ? 399  LYS B N   1 
ATOM   6251  C CA  . LYS B  1 393 ? -31.348 -2.560   107.516 1.00 33.34 ? 399  LYS B CA  1 
ATOM   6252  C C   . LYS B  1 393 ? -32.188 -3.734   106.989 1.00 36.38 ? 399  LYS B C   1 
ATOM   6253  O O   . LYS B  1 393 ? -32.369 -4.727   107.698 1.00 38.19 ? 399  LYS B O   1 
ATOM   6254  C CB  . LYS B  1 393 ? -32.269 -1.395   107.890 1.00 35.20 ? 399  LYS B CB  1 
ATOM   6255  N N   . ARG B  1 394 ? -32.705 -3.624   105.762 1.00 33.79 ? 400  ARG B N   1 
ATOM   6256  C CA  . ARG B  1 394 ? -33.627 -4.633   105.219 1.00 30.30 ? 400  ARG B CA  1 
ATOM   6257  C C   . ARG B  1 394 ? -32.916 -5.795   104.516 1.00 25.79 ? 400  ARG B C   1 
ATOM   6258  O O   . ARG B  1 394 ? -33.483 -6.878   104.386 1.00 23.61 ? 400  ARG B O   1 
ATOM   6259  C CB  . ARG B  1 394 ? -34.611 -4.004   104.222 1.00 32.54 ? 400  ARG B CB  1 
ATOM   6260  C CG  . ARG B  1 394 ? -35.143 -2.632   104.594 1.00 32.90 ? 400  ARG B CG  1 
ATOM   6261  C CD  . ARG B  1 394 ? -35.456 -1.812   103.344 1.00 30.68 ? 400  ARG B CD  1 
ATOM   6262  N NE  . ARG B  1 394 ? -36.602 -0.930   103.540 1.00 31.40 ? 400  ARG B NE  1 
ATOM   6263  C CZ  . ARG B  1 394 ? -37.025 -0.033   102.656 1.00 32.55 ? 400  ARG B CZ  1 
ATOM   6264  N NH1 . ARG B  1 394 ? -36.394 0.116    101.499 1.00 36.20 ? 400  ARG B NH1 1 
ATOM   6265  N NH2 . ARG B  1 394 ? -38.081 0.718    102.930 1.00 30.00 ? 400  ARG B NH2 1 
ATOM   6266  N N   . PHE B  1 395 ? -31.687 -5.577   104.060 1.00 22.21 ? 401  PHE B N   1 
ATOM   6267  C CA  . PHE B  1 395 ? -31.002 -6.586   103.257 1.00 22.93 ? 401  PHE B CA  1 
ATOM   6268  C C   . PHE B  1 395 ? -29.613 -6.933   103.775 1.00 26.93 ? 401  PHE B C   1 
ATOM   6269  O O   . PHE B  1 395 ? -29.072 -6.242   104.627 1.00 30.56 ? 401  PHE B O   1 
ATOM   6270  C CB  . PHE B  1 395 ? -30.910 -6.099   101.812 1.00 22.29 ? 401  PHE B CB  1 
ATOM   6271  C CG  . PHE B  1 395 ? -32.234 -5.674   101.245 1.00 22.82 ? 401  PHE B CG  1 
ATOM   6272  C CD1 . PHE B  1 395 ? -33.276 -6.577   101.168 1.00 23.51 ? 401  PHE B CD1 1 
ATOM   6273  C CD2 . PHE B  1 395 ? -32.440 -4.386   100.794 1.00 21.27 ? 401  PHE B CD2 1 
ATOM   6274  C CE1 . PHE B  1 395 ? -34.500 -6.202   100.660 1.00 22.40 ? 401  PHE B CE1 1 
ATOM   6275  C CE2 . PHE B  1 395 ? -33.669 -4.005   100.281 1.00 21.50 ? 401  PHE B CE2 1 
ATOM   6276  C CZ  . PHE B  1 395 ? -34.696 -4.915   100.215 1.00 20.88 ? 401  PHE B CZ  1 
ATOM   6277  N N   . ARG B  1 396 ? -29.042 -8.014   103.265 1.00 22.33 ? 402  ARG B N   1 
ATOM   6278  C CA  . ARG B  1 396 ? -27.620 -8.264   103.442 1.00 23.76 ? 402  ARG B CA  1 
ATOM   6279  C C   . ARG B  1 396 ? -26.813 -7.201   102.706 1.00 23.14 ? 402  ARG B C   1 
ATOM   6280  O O   . ARG B  1 396 ? -26.898 -7.092   101.493 1.00 27.72 ? 402  ARG B O   1 
ATOM   6281  C CB  . ARG B  1 396 ? -27.271 -9.657   102.928 1.00 22.90 ? 402  ARG B CB  1 
ATOM   6282  C CG  . ARG B  1 396 ? -25.807 -9.881   102.651 1.00 22.46 ? 402  ARG B CG  1 
ATOM   6283  C CD  . ARG B  1 396 ? -25.084 -10.239  103.907 1.00 21.64 ? 402  ARG B CD  1 
ATOM   6284  N NE  . ARG B  1 396 ? -25.757 -11.288  104.658 1.00 24.01 ? 402  ARG B NE  1 
ATOM   6285  C CZ  . ARG B  1 396 ? -25.340 -11.717  105.841 1.00 24.34 ? 402  ARG B CZ  1 
ATOM   6286  N NH1 . ARG B  1 396 ? -24.273 -11.158  106.395 1.00 21.67 ? 402  ARG B NH1 1 
ATOM   6287  N NH2 . ARG B  1 396 ? -26.002 -12.677  106.475 1.00 27.12 ? 402  ARG B NH2 1 
ATOM   6288  N N   . ARG B  1 397 ? -26.038 -6.396   103.415 1.00 22.08 ? 403  ARG B N   1 
ATOM   6289  C CA  . ARG B  1 397 ? -25.278 -5.374   102.705 1.00 21.65 ? 403  ARG B CA  1 
ATOM   6290  C C   . ARG B  1 397 ? -23.788 -5.469   103.014 1.00 23.88 ? 403  ARG B C   1 
ATOM   6291  O O   . ARG B  1 397 ? -23.391 -5.504   104.175 1.00 29.08 ? 403  ARG B O   1 
ATOM   6292  C CB  . ARG B  1 397 ? -25.812 -3.972   103.027 1.00 19.61 ? 403  ARG B CB  1 
ATOM   6293  C CG  . ARG B  1 397 ? -25.265 -2.876   102.115 1.00 16.05 ? 403  ARG B CG  1 
ATOM   6294  C CD  . ARG B  1 397 ? -25.680 -1.485   102.601 1.00 20.16 ? 403  ARG B CD  1 
ATOM   6295  N NE  . ARG B  1 397 ? -25.471 -0.451   101.588 1.00 23.00 ? 403  ARG B NE  1 
ATOM   6296  C CZ  . ARG B  1 397 ? -24.457 0.407    101.575 1.00 26.76 ? 403  ARG B CZ  1 
ATOM   6297  N NH1 . ARG B  1 397 ? -23.538 0.379    102.529 1.00 29.25 ? 403  ARG B NH1 1 
ATOM   6298  N NH2 . ARG B  1 397 ? -24.359 1.300    100.599 1.00 30.49 ? 403  ARG B NH2 1 
ATOM   6299  N N   . THR B  1 398 ? -22.972 -5.528   101.961 1.00 19.03 ? 404  THR B N   1 
ATOM   6300  C CA  . THR B  1 398 ? -21.521 -5.641   102.119 1.00 20.93 ? 404  THR B CA  1 
ATOM   6301  C C   . THR B  1 398 ? -20.870 -4.281   102.339 1.00 26.20 ? 404  THR B C   1 
ATOM   6302  O O   . THR B  1 398 ? -21.440 -3.242   102.003 1.00 22.39 ? 404  THR B O   1 
ATOM   6303  C CB  . THR B  1 398 ? -20.841 -6.302   100.896 1.00 22.77 ? 404  THR B CB  1 
ATOM   6304  O OG1 . THR B  1 398 ? -20.809 -5.385   99.798  1.00 18.65 ? 404  THR B OG1 1 
ATOM   6305  C CG2 . THR B  1 398 ? -21.582 -7.556   100.472 1.00 23.22 ? 404  THR B CG2 1 
ATOM   6306  N N   . GLU B  1 399 ? -19.658 -4.301   102.884 1.00 29.40 ? 405  GLU B N   1 
ATOM   6307  C CA  . GLU B  1 399 ? -18.935 -3.074   103.184 1.00 32.24 ? 405  GLU B CA  1 
ATOM   6308  C C   . GLU B  1 399 ? -18.785 -2.177   101.953 1.00 28.63 ? 405  GLU B C   1 
ATOM   6309  O O   . GLU B  1 399 ? -18.911 -0.956   102.059 1.00 30.00 ? 405  GLU B O   1 
ATOM   6310  C CB  . GLU B  1 399 ? -17.560 -3.401   103.768 1.00 38.55 ? 405  GLU B CB  1 
ATOM   6311  C CG  . GLU B  1 399 ? -17.293 -2.740   105.105 1.00 46.65 ? 405  GLU B CG  1 
ATOM   6312  C CD  . GLU B  1 399 ? -17.492 -1.241   105.064 1.00 55.01 ? 405  GLU B CD  1 
ATOM   6313  O OE1 . GLU B  1 399 ? -16.947 -0.591   104.144 1.00 57.88 ? 405  GLU B OE1 1 
ATOM   6314  O OE2 . GLU B  1 399 ? -18.199 -0.712   105.952 1.00 57.21 ? 405  GLU B OE2 1 
ATOM   6315  N N   . SER B  1 400 ? -18.543 -2.782   100.793 1.00 25.70 ? 406  SER B N   1 
ATOM   6316  C CA  . SER B  1 400 ? -18.399 -2.037   99.538  1.00 30.07 ? 406  SER B CA  1 
ATOM   6317  C C   . SER B  1 400 ? -19.728 -1.543   98.962  1.00 28.56 ? 406  SER B C   1 
ATOM   6318  O O   . SER B  1 400 ? -19.753 -0.888   97.923  1.00 28.93 ? 406  SER B O   1 
ATOM   6319  C CB  . SER B  1 400 ? -17.682 -2.896   98.496  1.00 36.99 ? 406  SER B CB  1 
ATOM   6320  O OG  . SER B  1 400 ? -18.118 -2.607   97.176  1.00 43.10 ? 406  SER B OG  1 
ATOM   6321  N N   . GLY B  1 401 ? -20.829 -1.872   99.625  1.00 22.19 ? 407  GLY B N   1 
ATOM   6322  C CA  . GLY B  1 401 ? -22.121 -1.322   99.263  1.00 20.65 ? 407  GLY B CA  1 
ATOM   6323  C C   . GLY B  1 401 ? -22.979 -2.171   98.340  1.00 19.34 ? 407  GLY B C   1 
ATOM   6324  O O   . GLY B  1 401 ? -23.866 -1.657   97.664  1.00 18.68 ? 407  GLY B O   1 
ATOM   6325  N N   . ILE B  1 402 ? -22.706 -3.468   98.296  1.00 17.29 ? 408  ILE B N   1 
ATOM   6326  C CA  . ILE B  1 402 ? -23.488 -4.391   97.489  1.00 17.48 ? 408  ILE B CA  1 
ATOM   6327  C C   . ILE B  1 402 ? -24.663 -4.881   98.308  1.00 17.46 ? 408  ILE B C   1 
ATOM   6328  O O   . ILE B  1 402 ? -24.475 -5.218   99.456  1.00 23.27 ? 408  ILE B O   1 
ATOM   6329  C CB  . ILE B  1 402 ? -22.642 -5.592   97.019  1.00 16.33 ? 408  ILE B CB  1 
ATOM   6330  C CG1 . ILE B  1 402 ? -21.556 -5.125   96.053  1.00 19.20 ? 408  ILE B CG1 1 
ATOM   6331  C CG2 . ILE B  1 402 ? -23.525 -6.630   96.352  1.00 22.65 ? 408  ILE B CG2 1 
ATOM   6332  C CD1 . ILE B  1 402 ? -22.104 -4.325   94.897  1.00 20.51 ? 408  ILE B CD1 1 
ATOM   6333  N N   . CYS B  1 403 ? -25.868 -4.898   97.743  1.00 16.55 ? 409  CYS B N   1 
ATOM   6334  C CA  . CYS B  1 403 ? -27.006 -5.475   98.451  1.00 17.15 ? 409  CYS B CA  1 
ATOM   6335  C C   . CYS B  1 403 ? -27.411 -6.825   97.849  1.00 18.09 ? 409  CYS B C   1 
ATOM   6336  O O   . CYS B  1 403 ? -27.744 -6.915   96.675  1.00 21.94 ? 409  CYS B O   1 
ATOM   6337  C CB  . CYS B  1 403 ? -28.181 -4.534   98.433  1.00 22.16 ? 409  CYS B CB  1 
ATOM   6338  S SG  . CYS B  1 403 ? -28.025 -3.104   99.530  1.00 24.60 ? 409  CYS B SG  1 
ATOM   6339  N N   . LEU B  1 404 ? -27.372 -7.871   98.664  1.00 19.62 ? 410  LEU B N   1 
ATOM   6340  C CA  . LEU B  1 404 ? -27.959 -9.146   98.282  1.00 19.53 ? 410  LEU B CA  1 
ATOM   6341  C C   . LEU B  1 404 ? -29.405 -9.191   98.738  1.00 20.20 ? 410  LEU B C   1 
ATOM   6342  O O   . LEU B  1 404 ? -29.688 -8.984   99.910  1.00 25.55 ? 410  LEU B O   1 
ATOM   6343  C CB  . LEU B  1 404 ? -27.165 -10.298  98.884  1.00 20.52 ? 410  LEU B CB  1 
ATOM   6344  C CG  . LEU B  1 404 ? -27.848 -11.670  99.010  1.00 19.78 ? 410  LEU B CG  1 
ATOM   6345  C CD1 . LEU B  1 404 ? -28.206 -12.208  97.652  1.00 19.92 ? 410  LEU B CD1 1 
ATOM   6346  C CD2 . LEU B  1 404 ? -26.934 -12.632  99.737  1.00 15.89 ? 410  LEU B CD2 1 
ATOM   6347  N N   . ILE B  1 405 ? -30.317 -9.477   97.814  1.00 18.25 ? 411  ILE B N   1 
ATOM   6348  C CA  . ILE B  1 405 ? -31.748 -9.437   98.097  1.00 15.84 ? 411  ILE B CA  1 
ATOM   6349  C C   . ILE B  1 405 ? -32.434 -10.786  97.929  1.00 17.53 ? 411  ILE B C   1 
ATOM   6350  O O   . ILE B  1 405 ? -32.467 -11.331  96.837  1.00 19.97 ? 411  ILE B O   1 
ATOM   6351  C CB  . ILE B  1 405 ? -32.454 -8.428   97.175  1.00 17.88 ? 411  ILE B CB  1 
ATOM   6352  C CG1 . ILE B  1 405 ? -31.881 -7.028   97.398  1.00 21.42 ? 411  ILE B CG1 1 
ATOM   6353  C CG2 . ILE B  1 405 ? -33.965 -8.472   97.379  1.00 15.87 ? 411  ILE B CG2 1 
ATOM   6354  C CD1 . ILE B  1 405 ? -32.290 -6.024   96.354  1.00 20.52 ? 411  ILE B CD1 1 
ATOM   6355  N N   . THR B  1 406 ? -32.997 -11.306  99.016  1.00 20.65 ? 412  THR B N   1 
ATOM   6356  C CA  A THR B  1 406 ? -33.714 -12.575  99.029  0.11 20.06 ? 412  THR B CA  1 
ATOM   6357  C CA  B THR B  1 406 ? -33.743 -12.561  98.942  0.89 18.87 ? 412  THR B CA  1 
ATOM   6358  C C   . THR B  1 406 ? -35.219 -12.324  99.191  1.00 18.64 ? 412  THR B C   1 
ATOM   6359  O O   . THR B  1 406 ? -35.623 -11.251  99.623  1.00 22.48 ? 412  THR B O   1 
ATOM   6360  C CB  A THR B  1 406 ? -33.204 -13.470  100.177 0.11 21.20 ? 412  THR B CB  1 
ATOM   6361  C CB  B THR B  1 406 ? -33.246 -13.593  99.949  0.89 20.64 ? 412  THR B CB  1 
ATOM   6362  O OG1 A THR B  1 406 ? -31.859 -13.099  100.500 0.11 20.75 ? 412  THR B OG1 1 
ATOM   6363  O OG1 B THR B  1 406 ? -33.663 -13.208  101.261 0.89 23.57 ? 412  THR B OG1 1 
ATOM   6364  C CG2 A THR B  1 406 ? -33.224 -14.931  99.788  0.11 21.24 ? 412  THR B CG2 1 
ATOM   6365  C CG2 B THR B  1 406 ? -31.742 -13.694  99.896  0.89 21.26 ? 412  THR B CG2 1 
ATOM   6366  N N   . GLN B  1 407 ? -36.039 -13.320  98.885  1.00 18.01 ? 413  GLN B N   1 
ATOM   6367  C CA  . GLN B  1 407 ? -37.472 -13.156  99.033  1.00 18.99 ? 413  GLN B CA  1 
ATOM   6368  C C   . GLN B  1 407 ? -37.837 -13.095  100.498 1.00 25.26 ? 413  GLN B C   1 
ATOM   6369  O O   . GLN B  1 407 ? -38.737 -12.357  100.894 1.00 24.14 ? 413  GLN B O   1 
ATOM   6370  C CB  . GLN B  1 407 ? -38.228 -14.287  98.360  1.00 20.78 ? 413  GLN B CB  1 
ATOM   6371  C CG  . GLN B  1 407 ? -39.728 -14.118  98.432  1.00 23.93 ? 413  GLN B CG  1 
ATOM   6372  C CD  . GLN B  1 407 ? -40.214 -12.958  97.589  1.00 25.48 ? 413  GLN B CD  1 
ATOM   6373  O OE1 . GLN B  1 407 ? -39.779 -12.789  96.454  1.00 26.92 ? 413  GLN B OE1 1 
ATOM   6374  N NE2 . GLN B  1 407 ? -41.124 -12.156  98.135  1.00 24.72 ? 413  GLN B NE2 1 
ATOM   6375  N N   . SER B  1 408 ? -37.130 -13.868  101.309 1.00 26.57 ? 414  SER B N   1 
ATOM   6376  C CA  . SER B  1 408 ? -37.361 -13.832  102.744 1.00 30.71 ? 414  SER B CA  1 
ATOM   6377  C C   . SER B  1 408 ? -37.081 -12.434  103.300 1.00 28.96 ? 414  SER B C   1 
ATOM   6378  O O   . SER B  1 408 ? -37.747 -11.999  104.229 1.00 32.60 ? 414  SER B O   1 
ATOM   6379  C CB  . SER B  1 408 ? -36.507 -14.882  103.454 1.00 35.69 ? 414  SER B CB  1 
ATOM   6380  O OG  . SER B  1 408 ? -35.136 -14.545  103.373 1.00 42.92 ? 414  SER B OG  1 
ATOM   6381  N N   . MET B  1 409 ? -36.113 -11.723  102.724 1.00 25.79 ? 415  MET B N   1 
ATOM   6382  C CA  . MET B  1 409 ? -35.864 -10.331  103.104 1.00 19.99 ? 415  MET B CA  1 
ATOM   6383  C C   . MET B  1 409 ? -37.031 -9.440   102.699 1.00 26.75 ? 415  MET B C   1 
ATOM   6384  O O   . MET B  1 409 ? -37.491 -8.615   103.484 1.00 31.24 ? 415  MET B O   1 
ATOM   6385  C CB  . MET B  1 409 ? -34.581 -9.802   102.465 1.00 18.46 ? 415  MET B CB  1 
ATOM   6386  C CG  . MET B  1 409 ? -33.324 -10.475  102.940 1.00 17.78 ? 415  MET B CG  1 
ATOM   6387  S SD  . MET B  1 409 ? -31.904 -9.883   102.013 1.00 23.65 ? 415  MET B SD  1 
ATOM   6388  C CE  . MET B  1 409 ? -30.639 -11.026  102.558 1.00 22.16 ? 415  MET B CE  1 
ATOM   6389  N N   . ILE B  1 410 ? -37.504 -9.607   101.467 1.00 24.50 ? 416  ILE B N   1 
ATOM   6390  C CA  . ILE B  1 410 ? -38.633 -8.836   100.956 1.00 26.23 ? 416  ILE B CA  1 
ATOM   6391  C C   . ILE B  1 410 ? -39.908 -9.077   101.778 1.00 27.71 ? 416  ILE B C   1 
ATOM   6392  O O   . ILE B  1 410 ? -40.645 -8.139   102.077 1.00 23.20 ? 416  ILE B O   1 
ATOM   6393  C CB  . ILE B  1 410 ? -38.915 -9.175   99.473  1.00 26.65 ? 416  ILE B CB  1 
ATOM   6394  C CG1 . ILE B  1 410 ? -37.737 -8.749   98.586  1.00 23.48 ? 416  ILE B CG1 1 
ATOM   6395  C CG2 . ILE B  1 410 ? -40.208 -8.513   98.992  1.00 26.17 ? 416  ILE B CG2 1 
ATOM   6396  C CD1 . ILE B  1 410 ? -37.597 -7.259   98.425  1.00 21.14 ? 416  ILE B CD1 1 
ATOM   6397  N N   . ASP B  1 411 ? -40.158 -10.335  102.135 1.00 29.37 ? 417  ASP B N   1 
ATOM   6398  C CA  . ASP B  1 411 ? -41.348 -10.711  102.899 1.00 28.41 ? 417  ASP B CA  1 
ATOM   6399  C C   . ASP B  1 411 ? -41.421 -9.959   104.219 1.00 33.39 ? 417  ASP B C   1 
ATOM   6400  O O   . ASP B  1 411 ? -42.507 -9.676   104.716 1.00 31.93 ? 417  ASP B O   1 
ATOM   6401  C CB  . ASP B  1 411 ? -41.366 -12.215  103.183 1.00 28.51 ? 417  ASP B CB  1 
ATOM   6402  C CG  . ASP B  1 411 ? -41.524 -13.053  101.930 1.00 32.27 ? 417  ASP B CG  1 
ATOM   6403  O OD1 . ASP B  1 411 ? -41.913 -12.505  100.876 1.00 31.49 ? 417  ASP B OD1 1 
ATOM   6404  O OD2 . ASP B  1 411 ? -41.274 -14.274  102.008 1.00 36.61 ? 417  ASP B OD2 1 
ATOM   6405  N N   . LYS B  1 412 ? -40.255 -9.639   104.778 1.00 37.74 ? 418  LYS B N   1 
ATOM   6406  C CA  . LYS B  1 412 ? -40.161 -8.962   106.071 1.00 39.75 ? 418  LYS B CA  1 
ATOM   6407  C C   . LYS B  1 412 ? -40.435 -7.468   105.970 1.00 41.32 ? 418  LYS B C   1 
ATOM   6408  O O   . LYS B  1 412 ? -40.545 -6.785   106.981 1.00 44.40 ? 418  LYS B O   1 
ATOM   6409  C CB  . LYS B  1 412 ? -38.778 -9.178   106.691 1.00 37.39 ? 418  LYS B CB  1 
ATOM   6410  C CG  . LYS B  1 412 ? -38.488 -10.614  107.078 1.00 41.04 ? 418  LYS B CG  1 
ATOM   6411  C CD  . LYS B  1 412 ? -37.222 -10.718  107.924 1.00 46.08 ? 418  LYS B CD  1 
ATOM   6412  C CE  . LYS B  1 412 ? -36.880 -12.172  108.240 1.00 47.61 ? 418  LYS B CE  1 
ATOM   6413  N NZ  . LYS B  1 412 ? -35.724 -12.287  109.172 1.00 47.36 ? 418  LYS B NZ  1 
ATOM   6414  N N   . LEU B  1 413 ? -40.552 -6.965   104.748 1.00 43.29 ? 419  LEU B N   1 
ATOM   6415  C CA  . LEU B  1 413 ? -40.612 -5.529   104.524 1.00 43.55 ? 419  LEU B CA  1 
ATOM   6416  C C   . LEU B  1 413 ? -41.921 -4.896   104.967 1.00 46.19 ? 419  LEU B C   1 
ATOM   6417  O O   . LEU B  1 413 ? -42.999 -5.256   104.500 1.00 43.00 ? 419  LEU B O   1 
ATOM   6418  C CB  . LEU B  1 413 ? -40.376 -5.210   103.050 1.00 43.68 ? 419  LEU B CB  1 
ATOM   6419  C CG  . LEU B  1 413 ? -39.413 -4.055   102.797 1.00 44.48 ? 419  LEU B CG  1 
ATOM   6420  C CD1 . LEU B  1 413 ? -38.017 -4.440   103.255 1.00 44.23 ? 419  LEU B CD1 1 
ATOM   6421  C CD2 . LEU B  1 413 ? -39.424 -3.668   101.326 1.00 45.66 ? 419  LEU B CD2 1 
ATOM   6422  N N   . ASP B  1 414 ? -41.799 -3.948   105.884 1.00 55.24 ? 420  ASP B N   1 
ATOM   6423  C CA  . ASP B  1 414 ? -42.894 -3.074   106.270 1.00 66.40 ? 420  ASP B CA  1 
ATOM   6424  C C   . ASP B  1 414 ? -42.256 -1.730   106.596 1.00 68.03 ? 420  ASP B C   1 
ATOM   6425  O O   . ASP B  1 414 ? -42.928 -0.702   106.688 1.00 70.97 ? 420  ASP B O   1 
ATOM   6426  C CB  . ASP B  1 414 ? -43.675 -3.632   107.464 1.00 74.50 ? 420  ASP B CB  1 
ATOM   6427  C CG  . ASP B  1 414 ? -45.076 -3.045   107.576 1.00 79.15 ? 420  ASP B CG  1 
ATOM   6428  O OD1 . ASP B  1 414 ? -45.278 -1.882   107.165 1.00 80.17 ? 420  ASP B OD1 1 
ATOM   6429  O OD2 . ASP B  1 414 ? -45.979 -3.753   108.074 1.00 79.61 ? 420  ASP B OD2 1 
ATOM   6430  N N   . LEU B  1 415 ? -40.936 -1.758   106.758 1.00 63.22 ? 421  LEU B N   1 
ATOM   6431  C CA  . LEU B  1 415 ? -40.156 -0.554   106.995 1.00 57.78 ? 421  LEU B CA  1 
ATOM   6432  C C   . LEU B  1 415 ? -38.819 -0.626   106.279 1.00 46.20 ? 421  LEU B C   1 
ATOM   6433  O O   . LEU B  1 415 ? -38.109 -1.615   106.403 1.00 41.76 ? 421  LEU B O   1 
ATOM   6434  C CB  . LEU B  1 415 ? -39.947 -0.340   108.492 1.00 61.91 ? 421  LEU B CB  1 
ATOM   6435  C CG  . LEU B  1 415 ? -40.299 1.053    109.017 1.00 65.51 ? 421  LEU B CG  1 
ATOM   6436  C CD1 . LEU B  1 415 ? -41.571 1.578    108.368 1.00 65.46 ? 421  LEU B CD1 1 
ATOM   6437  C CD2 . LEU B  1 415 ? -40.432 1.032    110.535 1.00 67.46 ? 421  LEU B CD2 1 
ATOM   6438  N N   . VAL C  1 1   ? -63.889 -32.992  75.445  1.00 38.74 ? 7    VAL C N   1 
ATOM   6439  C CA  . VAL C  1 1   ? -62.992 -33.172  74.302  1.00 38.48 ? 7    VAL C CA  1 
ATOM   6440  C C   . VAL C  1 1   ? -61.553 -33.441  74.735  1.00 39.50 ? 7    VAL C C   1 
ATOM   6441  O O   . VAL C  1 1   ? -60.923 -34.393  74.268  1.00 38.30 ? 7    VAL C O   1 
ATOM   6442  C CB  . VAL C  1 1   ? -62.992 -31.940  73.363  1.00 35.82 ? 7    VAL C CB  1 
ATOM   6443  C CG1 . VAL C  1 1   ? -61.887 -32.066  72.305  1.00 26.97 ? 7    VAL C CG1 1 
ATOM   6444  C CG2 . VAL C  1 1   ? -64.362 -31.753  72.714  1.00 36.94 ? 7    VAL C CG2 1 
ATOM   6445  N N   . GLN C  1 2   ? -61.038 -32.600  75.628  1.00 37.71 ? 8    GLN C N   1 
ATOM   6446  C CA  . GLN C  1 2   ? -59.630 -32.663  76.014  1.00 39.01 ? 8    GLN C CA  1 
ATOM   6447  C C   . GLN C  1 2   ? -59.352 -33.731  77.064  1.00 33.60 ? 8    GLN C C   1 
ATOM   6448  O O   . GLN C  1 2   ? -59.936 -33.699  78.149  1.00 35.24 ? 8    GLN C O   1 
ATOM   6449  C CB  . GLN C  1 2   ? -59.164 -31.300  76.523  1.00 38.97 ? 8    GLN C CB  1 
ATOM   6450  C CG  . GLN C  1 2   ? -59.381 -30.198  75.509  1.00 40.56 ? 8    GLN C CG  1 
ATOM   6451  C CD  . GLN C  1 2   ? -58.568 -28.967  75.817  1.00 42.84 ? 8    GLN C CD  1 
ATOM   6452  O OE1 . GLN C  1 2   ? -57.772 -28.957  76.756  1.00 46.31 ? 8    GLN C OE1 1 
ATOM   6453  N NE2 . GLN C  1 2   ? -58.755 -27.920  75.022  1.00 41.19 ? 8    GLN C NE2 1 
ATOM   6454  N N   . PRO C  1 3   ? -58.460 -34.683  76.731  1.00 27.04 ? 9    PRO C N   1 
ATOM   6455  C CA  . PRO C  1 3   ? -58.048 -35.754  77.642  1.00 20.05 ? 9    PRO C CA  1 
ATOM   6456  C C   . PRO C  1 3   ? -57.540 -35.178  78.954  1.00 21.03 ? 9    PRO C C   1 
ATOM   6457  O O   . PRO C  1 3   ? -56.759 -34.219  78.959  1.00 18.70 ? 9    PRO C O   1 
ATOM   6458  C CB  . PRO C  1 3   ? -56.936 -36.477  76.877  1.00 21.88 ? 9    PRO C CB  1 
ATOM   6459  C CG  . PRO C  1 3   ? -56.646 -35.645  75.685  1.00 22.89 ? 9    PRO C CG  1 
ATOM   6460  C CD  . PRO C  1 3   ? -57.842 -34.825  75.405  1.00 25.21 ? 9    PRO C CD  1 
ATOM   6461  N N   . LEU C  1 4   ? -57.997 -35.754  80.058  1.00 16.89 ? 10   LEU C N   1 
ATOM   6462  C CA  . LEU C  1 4   ? -57.727 -35.183  81.361  1.00 16.20 ? 10   LEU C CA  1 
ATOM   6463  C C   . LEU C  1 4   ? -56.278 -35.407  81.749  1.00 17.79 ? 10   LEU C C   1 
ATOM   6464  O O   . LEU C  1 4   ? -55.721 -34.670  82.565  1.00 18.45 ? 10   LEU C O   1 
ATOM   6465  C CB  . LEU C  1 4   ? -58.661 -35.778  82.405  1.00 18.55 ? 10   LEU C CB  1 
ATOM   6466  C CG  . LEU C  1 4   ? -60.160 -35.560  82.152  1.00 21.74 ? 10   LEU C CG  1 
ATOM   6467  C CD1 . LEU C  1 4   ? -60.962 -36.370  83.138  1.00 18.03 ? 10   LEU C CD1 1 
ATOM   6468  C CD2 . LEU C  1 4   ? -60.548 -34.094  82.236  1.00 22.84 ? 10   LEU C CD2 1 
ATOM   6469  N N   . ALA C  1 5   ? -55.673 -36.421  81.136  1.00 14.40 ? 11   ALA C N   1 
ATOM   6470  C CA  . ALA C  1 5   ? -54.290 -36.776  81.411  1.00 18.05 ? 11   ALA C CA  1 
ATOM   6471  C C   . ALA C  1 5   ? -53.336 -35.618  81.153  1.00 19.55 ? 11   ALA C C   1 
ATOM   6472  O O   . ALA C  1 5   ? -52.315 -35.502  81.839  1.00 14.94 ? 11   ALA C O   1 
ATOM   6473  C CB  . ALA C  1 5   ? -53.869 -38.000  80.591  1.00 16.08 ? 11   ALA C CB  1 
ATOM   6474  N N   . ARG C  1 6   ? -53.667 -34.757  80.190  1.00 20.06 ? 12   ARG C N   1 
ATOM   6475  C CA  . ARG C  1 6   ? -52.879 -33.554  79.936  1.00 16.67 ? 12   ARG C CA  1 
ATOM   6476  C C   . ARG C  1 6   ? -52.769 -32.692  81.181  1.00 13.63 ? 12   ARG C C   1 
ATOM   6477  O O   . ARG C  1 6   ? -51.842 -31.924  81.342  1.00 18.09 ? 12   ARG C O   1 
ATOM   6478  C CB  . ARG C  1 6   ? -53.510 -32.730  78.794  1.00 13.81 ? 12   ARG C CB  1 
ATOM   6479  C CG  . ARG C  1 6   ? -53.483 -33.342  77.394  1.00 13.80 ? 12   ARG C CG  1 
ATOM   6480  C CD  . ARG C  1 6   ? -53.975 -32.343  76.360  1.00 16.71 ? 12   ARG C CD  1 
ATOM   6481  N NE  . ARG C  1 6   ? -54.282 -32.926  75.053  1.00 19.35 ? 12   ARG C NE  1 
ATOM   6482  C CZ  . ARG C  1 6   ? -54.894 -32.265  74.068  1.00 20.91 ? 12   ARG C CZ  1 
ATOM   6483  N NH1 . ARG C  1 6   ? -55.275 -31.005  74.227  1.00 21.19 ? 12   ARG C NH1 1 
ATOM   6484  N NH2 . ARG C  1 6   ? -55.135 -32.860  72.914  1.00 20.76 ? 12   ARG C NH2 1 
ATOM   6485  N N   . ASP C  1 7   ? -53.736 -32.827  82.066  1.00 17.67 ? 13   ASP C N   1 
ATOM   6486  C CA  . ASP C  1 7   ? -53.825 -31.953  83.233  1.00 22.06 ? 13   ASP C CA  1 
ATOM   6487  C C   . ASP C  1 7   ? -53.459 -32.658  84.536  1.00 21.15 ? 13   ASP C C   1 
ATOM   6488  O O   . ASP C  1 7   ? -53.651 -32.122  85.628  1.00 21.96 ? 13   ASP C O   1 
ATOM   6489  C CB  . ASP C  1 7   ? -55.240 -31.362  83.358  1.00 25.14 ? 13   ASP C CB  1 
ATOM   6490  C CG  . ASP C  1 7   ? -55.395 -30.032  82.638  1.00 32.66 ? 13   ASP C CG  1 
ATOM   6491  O OD1 . ASP C  1 7   ? -54.499 -29.185  82.766  1.00 36.11 ? 13   ASP C OD1 1 
ATOM   6492  O OD2 . ASP C  1 7   ? -56.425 -29.829  81.963  1.00 36.37 ? 13   ASP C OD2 1 
ATOM   6493  N N   . ALA C  1 8   ? -52.909 -33.857  84.423  1.00 20.23 ? 14   ALA C N   1 
ATOM   6494  C CA  . ALA C  1 8   ? -52.629 -34.657  85.608  1.00 15.42 ? 14   ALA C CA  1 
ATOM   6495  C C   . ALA C  1 8   ? -51.131 -34.836  85.837  1.00 15.24 ? 14   ALA C C   1 
ATOM   6496  O O   . ALA C  1 8   ? -50.334 -34.819  84.903  1.00 18.97 ? 14   ALA C O   1 
ATOM   6497  C CB  . ALA C  1 8   ? -53.297 -36.004  85.493  1.00 11.68 ? 14   ALA C CB  1 
ATOM   6498  N N   . MET C  1 9   ? -50.749 -34.972  87.093  1.00 16.61 ? 15   MET C N   1 
ATOM   6499  C CA  . MET C  1 9   ? -49.400 -35.364  87.455  1.00 14.82 ? 15   MET C CA  1 
ATOM   6500  C C   . MET C  1 9   ? -49.486 -36.707  88.170  1.00 20.61 ? 15   MET C C   1 
ATOM   6501  O O   . MET C  1 9   ? -50.310 -36.869  89.068  1.00 16.91 ? 15   MET C O   1 
ATOM   6502  C CB  . MET C  1 9   ? -48.766 -34.318  88.358  1.00 10.75 ? 15   MET C CB  1 
ATOM   6503  C CG  . MET C  1 9   ? -47.403 -34.653  88.868  1.00 12.55 ? 15   MET C CG  1 
ATOM   6504  S SD  . MET C  1 9   ? -46.930 -33.347  89.996  1.00 22.84 ? 15   MET C SD  1 
ATOM   6505  C CE  . MET C  1 9   ? -45.183 -33.653  90.241  1.00 22.82 ? 15   MET C CE  1 
ATOM   6506  N N   . ALA C  1 10  ? -48.668 -37.671  87.758  1.00 18.46 ? 16   ALA C N   1 
ATOM   6507  C CA  . ALA C  1 10  ? -48.577 -38.937  88.468  1.00 13.92 ? 16   ALA C CA  1 
ATOM   6508  C C   . ALA C  1 10  ? -47.576 -38.771  89.587  1.00 14.56 ? 16   ALA C C   1 
ATOM   6509  O O   . ALA C  1 10  ? -46.537 -38.146  89.400  1.00 15.74 ? 16   ALA C O   1 
ATOM   6510  C CB  . ALA C  1 10  ? -48.174 -40.051  87.548  1.00 11.36 ? 16   ALA C CB  1 
ATOM   6511  N N   . TYR C  1 11  ? -47.896 -39.308  90.761  1.00 11.03 ? 17   TYR C N   1 
ATOM   6512  C CA  . TYR C  1 11  ? -47.016 -39.203  91.913  1.00 10.60 ? 17   TYR C CA  1 
ATOM   6513  C C   . TYR C  1 11  ? -46.815 -40.599  92.474  1.00 14.19 ? 17   TYR C C   1 
ATOM   6514  O O   . TYR C  1 11  ? -47.748 -41.194  93.011  1.00 14.79 ? 17   TYR C O   1 
ATOM   6515  C CB  . TYR C  1 11  ? -47.594 -38.249  92.958  1.00 10.88 ? 17   TYR C CB  1 
ATOM   6516  C CG  . TYR C  1 11  ? -46.574 -37.722  93.945  1.00 11.90 ? 17   TYR C CG  1 
ATOM   6517  C CD1 . TYR C  1 11  ? -46.263 -38.425  95.098  1.00 13.33 ? 17   TYR C CD1 1 
ATOM   6518  C CD2 . TYR C  1 11  ? -45.918 -36.516  93.715  1.00 14.61 ? 17   TYR C CD2 1 
ATOM   6519  C CE1 . TYR C  1 11  ? -45.328 -37.940  95.999  1.00 15.10 ? 17   TYR C CE1 1 
ATOM   6520  C CE2 . TYR C  1 11  ? -44.990 -36.025  94.602  1.00 19.62 ? 17   TYR C CE2 1 
ATOM   6521  C CZ  . TYR C  1 11  ? -44.699 -36.737  95.745  1.00 20.82 ? 17   TYR C CZ  1 
ATOM   6522  O OH  . TYR C  1 11  ? -43.765 -36.248  96.624  1.00 24.94 ? 17   TYR C OH  1 
ATOM   6523  N N   . VAL C  1 12  ? -45.599 -41.117  92.324  1.00 13.62 ? 18   VAL C N   1 
ATOM   6524  C CA  . VAL C  1 12  ? -45.299 -42.512  92.632  1.00 15.63 ? 18   VAL C CA  1 
ATOM   6525  C C   . VAL C  1 12  ? -44.629 -42.680  93.989  1.00 17.01 ? 18   VAL C C   1 
ATOM   6526  O O   . VAL C  1 12  ? -43.532 -42.159  94.230  1.00 16.09 ? 18   VAL C O   1 
ATOM   6527  C CB  . VAL C  1 12  ? -44.393 -43.134  91.553  1.00 19.47 ? 18   VAL C CB  1 
ATOM   6528  C CG1 . VAL C  1 12  ? -44.092 -44.577  91.885  1.00 27.61 ? 18   VAL C CG1 1 
ATOM   6529  C CG2 . VAL C  1 12  ? -45.049 -43.029  90.194  1.00 17.22 ? 18   VAL C CG2 1 
ATOM   6530  N N   . LEU C  1 13  ? -45.296 -43.417  94.874  1.00 17.21 ? 19   LEU C N   1 
ATOM   6531  C CA  . LEU C  1 13  ? -44.757 -43.714  96.193  1.00 16.98 ? 19   LEU C CA  1 
ATOM   6532  C C   . LEU C  1 13  ? -43.837 -44.924  96.056  1.00 17.56 ? 19   LEU C C   1 
ATOM   6533  O O   . LEU C  1 13  ? -44.299 -46.062  95.949  1.00 16.22 ? 19   LEU C O   1 
ATOM   6534  C CB  . LEU C  1 13  ? -45.888 -43.971  97.189  1.00 14.56 ? 19   LEU C CB  1 
ATOM   6535  C CG  . LEU C  1 13  ? -47.006 -42.920  97.143  1.00 16.37 ? 19   LEU C CG  1 
ATOM   6536  C CD1 . LEU C  1 13  ? -48.253 -43.369  97.938  1.00 15.93 ? 19   LEU C CD1 1 
ATOM   6537  C CD2 . LEU C  1 13  ? -46.504 -41.569  97.635  1.00 20.17 ? 19   LEU C CD2 1 
ATOM   6538  N N   . ALA C  1 14  ? -42.535 -44.671  96.015  1.00 13.43 ? 20   ALA C N   1 
ATOM   6539  C CA  . ALA C  1 14  ? -41.572 -45.723  95.720  1.00 14.37 ? 20   ALA C CA  1 
ATOM   6540  C C   . ALA C  1 14  ? -40.693 -45.972  96.933  1.00 18.33 ? 20   ALA C C   1 
ATOM   6541  O O   . ALA C  1 14  ? -39.471 -46.098  96.822  1.00 15.14 ? 20   ALA C O   1 
ATOM   6542  C CB  . ALA C  1 14  ? -40.741 -45.352  94.502  1.00 12.29 ? 20   ALA C CB  1 
ATOM   6543  N N   . GLY C  1 15  ? -41.337 -46.047  98.098  1.00 18.19 ? 21   GLY C N   1 
ATOM   6544  C CA  . GLY C  1 15  ? -40.633 -46.213  99.353  1.00 20.71 ? 21   GLY C CA  1 
ATOM   6545  C C   . GLY C  1 15  ? -40.843 -47.565  100.005 1.00 26.13 ? 21   GLY C C   1 
ATOM   6546  O O   . GLY C  1 15  ? -40.442 -47.769  101.148 1.00 34.83 ? 21   GLY C O   1 
ATOM   6547  N N   . GLY C  1 16  ? -41.465 -48.492  99.281  1.00 26.35 ? 22   GLY C N   1 
ATOM   6548  C CA  . GLY C  1 16  ? -41.731 -49.822  99.807  1.00 27.29 ? 22   GLY C CA  1 
ATOM   6549  C C   . GLY C  1 16  ? -40.451 -50.549  100.167 1.00 23.81 ? 22   GLY C C   1 
ATOM   6550  O O   . GLY C  1 16  ? -39.494 -50.528  99.405  1.00 18.11 ? 22   GLY C O   1 
ATOM   6551  N N   . ARG C  1 17  ? -40.430 -51.191  101.333 1.00 23.55 ? 23   ARG C N   1 
ATOM   6552  C CA  . ARG C  1 17  ? -39.210 -51.815  101.832 1.00 23.85 ? 23   ARG C CA  1 
ATOM   6553  C C   . ARG C  1 17  ? -39.105 -53.260  101.383 1.00 18.79 ? 23   ARG C C   1 
ATOM   6554  O O   . ARG C  1 17  ? -38.004 -53.775  101.195 1.00 21.78 ? 23   ARG C O   1 
ATOM   6555  C CB  . ARG C  1 17  ? -39.149 -51.727  103.359 1.00 29.28 ? 23   ARG C CB  1 
ATOM   6556  C CG  . ARG C  1 17  ? -39.534 -50.354  103.890 1.00 36.88 ? 23   ARG C CG  1 
ATOM   6557  C CD  . ARG C  1 17  ? -39.466 -50.269  105.412 1.00 41.93 ? 23   ARG C CD  1 
ATOM   6558  N NE  . ARG C  1 17  ? -40.454 -49.328  105.932 1.00 45.03 ? 23   ARG C NE  1 
ATOM   6559  C CZ  . ARG C  1 17  ? -40.477 -48.872  107.179 1.00 47.65 ? 23   ARG C CZ  1 
ATOM   6560  N NH1 . ARG C  1 17  ? -39.554 -49.262  108.047 1.00 48.65 ? 23   ARG C NH1 1 
ATOM   6561  N NH2 . ARG C  1 17  ? -41.422 -48.021  107.557 1.00 48.00 ? 23   ARG C NH2 1 
ATOM   6562  N N   . GLY C  1 18  ? -40.254 -53.906  101.204 1.00 18.52 ? 24   GLY C N   1 
ATOM   6563  C CA  . GLY C  1 18  ? -40.288 -55.289  100.769 1.00 20.23 ? 24   GLY C CA  1 
ATOM   6564  C C   . GLY C  1 18  ? -39.628 -56.156  101.820 1.00 22.39 ? 24   GLY C C   1 
ATOM   6565  O O   . GLY C  1 18  ? -38.730 -56.954  101.533 1.00 21.33 ? 24   GLY C O   1 
ATOM   6566  N N   . SER C  1 19  ? -40.075 -55.984  103.056 1.00 26.18 ? 25   SER C N   1 
ATOM   6567  C CA  . SER C  1 19  ? -39.452 -56.651  104.184 1.00 26.71 ? 25   SER C CA  1 
ATOM   6568  C C   . SER C  1 19  ? -39.502 -58.169  104.056 1.00 21.41 ? 25   SER C C   1 
ATOM   6569  O O   . SER C  1 19  ? -38.498 -58.840  104.293 1.00 24.10 ? 25   SER C O   1 
ATOM   6570  C CB  . SER C  1 19  ? -40.117 -56.204  105.488 1.00 35.52 ? 25   SER C CB  1 
ATOM   6571  O OG  . SER C  1 19  ? -39.522 -55.007  105.967 1.00 39.67 ? 25   SER C OG  1 
ATOM   6572  N N   . ARG C  1 20  ? -40.654 -58.703  103.663 1.00 18.56 ? 26   ARG C N   1 
ATOM   6573  C CA  . ARG C  1 20  ? -40.824 -60.147  103.531 1.00 22.60 ? 26   ARG C CA  1 
ATOM   6574  C C   . ARG C  1 20  ? -40.013 -60.744  102.376 1.00 24.96 ? 26   ARG C C   1 
ATOM   6575  O O   . ARG C  1 20  ? -39.897 -61.967  102.269 1.00 26.14 ? 26   ARG C O   1 
ATOM   6576  C CB  . ARG C  1 20  ? -42.303 -60.500  103.351 1.00 21.96 ? 26   ARG C CB  1 
ATOM   6577  C CG  . ARG C  1 20  ? -43.131 -60.465  104.636 1.00 20.51 ? 26   ARG C CG  1 
ATOM   6578  C CD  . ARG C  1 20  ? -44.624 -60.537  104.333 1.00 26.73 ? 26   ARG C CD  1 
ATOM   6579  N NE  . ARG C  1 20  ? -44.988 -59.544  103.328 1.00 32.46 ? 26   ARG C NE  1 
ATOM   6580  C CZ  . ARG C  1 20  ? -45.920 -59.717  102.399 1.00 32.68 ? 26   ARG C CZ  1 
ATOM   6581  N NH1 . ARG C  1 20  ? -46.607 -60.847  102.342 1.00 38.53 ? 26   ARG C NH1 1 
ATOM   6582  N NH2 . ARG C  1 20  ? -46.166 -58.754  101.529 1.00 33.26 ? 26   ARG C NH2 1 
ATOM   6583  N N   . LEU C  1 21  ? -39.460 -59.892  101.514 1.00 22.83 ? 27   LEU C N   1 
ATOM   6584  C CA  . LEU C  1 21  ? -38.569 -60.360  100.451 1.00 19.48 ? 27   LEU C CA  1 
ATOM   6585  C C   . LEU C  1 21  ? -37.180 -60.614  101.016 1.00 19.88 ? 27   LEU C C   1 
ATOM   6586  O O   . LEU C  1 21  ? -36.301 -61.126  100.325 1.00 20.71 ? 27   LEU C O   1 
ATOM   6587  C CB  . LEU C  1 21  ? -38.498 -59.350  99.300  1.00 17.85 ? 27   LEU C CB  1 
ATOM   6588  C CG  . LEU C  1 21  ? -39.756 -59.178  98.451  1.00 15.41 ? 27   LEU C CG  1 
ATOM   6589  C CD1 . LEU C  1 21  ? -39.510 -58.162  97.344  1.00 17.45 ? 27   LEU C CD1 1 
ATOM   6590  C CD2 . LEU C  1 21  ? -40.184 -60.509  97.873  1.00 17.12 ? 27   LEU C CD2 1 
ATOM   6591  N N   . LYS C  1 22  ? -36.990 -60.234  102.276 1.00 13.85 ? 28   LYS C N   1 
ATOM   6592  C CA  . LYS C  1 22  ? -35.758 -60.522  102.997 1.00 15.24 ? 28   LYS C CA  1 
ATOM   6593  C C   . LYS C  1 22  ? -34.503 -59.997  102.304 1.00 18.02 ? 28   LYS C C   1 
ATOM   6594  O O   . LYS C  1 22  ? -34.419 -58.822  101.987 1.00 19.70 ? 28   LYS C O   1 
ATOM   6595  C CB  . LYS C  1 22  ? -35.662 -62.022  103.231 1.00 22.41 ? 28   LYS C CB  1 
ATOM   6596  C CG  . LYS C  1 22  ? -36.897 -62.545  103.931 1.00 29.56 ? 28   LYS C CG  1 
ATOM   6597  C CD  . LYS C  1 22  ? -36.972 -61.946  105.327 1.00 33.45 ? 28   LYS C CD  1 
ATOM   6598  C CE  . LYS C  1 22  ? -38.367 -61.996  105.959 1.00 39.65 ? 28   LYS C CE  1 
ATOM   6599  N NZ  . LYS C  1 22  ? -39.162 -63.231  105.676 1.00 38.55 ? 28   LYS C NZ  1 
ATOM   6600  N N   . GLU C  1 23  ? -33.528 -60.861  102.060 1.00 18.62 ? 29   GLU C N   1 
ATOM   6601  C CA  . GLU C  1 23  ? -32.229 -60.392  101.588 1.00 17.98 ? 29   GLU C CA  1 
ATOM   6602  C C   . GLU C  1 23  ? -32.307 -59.722  100.210 1.00 19.80 ? 29   GLU C C   1 
ATOM   6603  O O   . GLU C  1 23  ? -31.441 -58.918  99.848  1.00 18.93 ? 29   GLU C O   1 
ATOM   6604  C CB  . GLU C  1 23  ? -31.229 -61.547  101.552 1.00 17.09 ? 29   GLU C CB  1 
ATOM   6605  C CG  . GLU C  1 23  ? -30.776 -62.018  102.932 1.00 23.08 ? 29   GLU C CG  1 
ATOM   6606  C CD  . GLU C  1 23  ? -31.714 -63.030  103.559 1.00 24.96 ? 29   GLU C CD  1 
ATOM   6607  O OE1 . GLU C  1 23  ? -32.724 -63.397  102.927 1.00 22.19 ? 29   GLU C OE1 1 
ATOM   6608  O OE2 . GLU C  1 23  ? -31.427 -63.470  104.689 1.00 28.81 ? 29   GLU C OE2 1 
ATOM   6609  N N   . LEU C  1 24  ? -33.353 -60.048  99.456  1.00 17.21 ? 30   LEU C N   1 
ATOM   6610  C CA  . LEU C  1 24  ? -33.563 -59.459  98.137  1.00 17.24 ? 30   LEU C CA  1 
ATOM   6611  C C   . LEU C  1 24  ? -33.632 -57.939  98.212  1.00 19.87 ? 30   LEU C C   1 
ATOM   6612  O O   . LEU C  1 24  ? -33.250 -57.239  97.272  1.00 20.35 ? 30   LEU C O   1 
ATOM   6613  C CB  . LEU C  1 24  ? -34.838 -60.015  97.521  1.00 15.84 ? 30   LEU C CB  1 
ATOM   6614  C CG  . LEU C  1 24  ? -35.049 -59.974  96.019  1.00 20.28 ? 30   LEU C CG  1 
ATOM   6615  C CD1 . LEU C  1 24  ? -33.751 -60.248  95.269  1.00 19.06 ? 30   LEU C CD1 1 
ATOM   6616  C CD2 . LEU C  1 24  ? -36.080 -61.040  95.704  1.00 22.42 ? 30   LEU C CD2 1 
ATOM   6617  N N   . THR C  1 25  ? -34.104 -57.427  99.344  1.00 17.07 ? 31   THR C N   1 
ATOM   6618  C CA  . THR C  1 25  ? -34.229 -55.986  99.510  1.00 18.70 ? 31   THR C CA  1 
ATOM   6619  C C   . THR C  1 25  ? -33.391 -55.436  100.653 1.00 19.72 ? 31   THR C C   1 
ATOM   6620  O O   . THR C  1 25  ? -33.708 -54.382  101.190 1.00 19.86 ? 31   THR C O   1 
ATOM   6621  C CB  . THR C  1 25  ? -35.682 -55.576  99.754  1.00 18.34 ? 31   THR C CB  1 
ATOM   6622  O OG1 . THR C  1 25  ? -36.186 -56.295  100.878 1.00 19.68 ? 31   THR C OG1 1 
ATOM   6623  C CG2 . THR C  1 25  ? -36.538 -55.881  98.532  1.00 17.41 ? 31   THR C CG2 1 
ATOM   6624  N N   . ASP C  1 26  ? -32.326 -56.142  101.019 1.00 21.11 ? 32   ASP C N   1 
ATOM   6625  C CA  . ASP C  1 26  ? -31.446 -55.666  102.076 1.00 22.33 ? 32   ASP C CA  1 
ATOM   6626  C C   . ASP C  1 26  ? -30.633 -54.454  101.632 1.00 21.75 ? 32   ASP C C   1 
ATOM   6627  O O   . ASP C  1 26  ? -30.191 -53.670  102.465 1.00 20.28 ? 32   ASP C O   1 
ATOM   6628  C CB  . ASP C  1 26  ? -30.521 -56.785  102.552 1.00 23.02 ? 32   ASP C CB  1 
ATOM   6629  C CG  . ASP C  1 26  ? -31.202 -57.720  103.536 1.00 25.92 ? 32   ASP C CG  1 
ATOM   6630  O OD1 . ASP C  1 26  ? -32.323 -57.403  103.991 1.00 26.35 ? 32   ASP C OD1 1 
ATOM   6631  O OD2 . ASP C  1 26  ? -30.612 -58.768  103.866 1.00 28.41 ? 32   ASP C OD2 1 
ATOM   6632  N N   . ARG C  1 27  ? -30.454 -54.279  100.325 1.00 18.47 ? 33   ARG C N   1 
ATOM   6633  C CA  . ARG C  1 27  ? -29.709 -53.122  99.846  1.00 18.93 ? 33   ARG C CA  1 
ATOM   6634  C C   . ARG C  1 27  ? -30.444 -52.353  98.747  1.00 20.98 ? 33   ARG C C   1 
ATOM   6635  O O   . ARG C  1 27  ? -29.942 -51.355  98.240  1.00 20.96 ? 33   ARG C O   1 
ATOM   6636  C CB  . ARG C  1 27  ? -28.333 -53.555  99.359  1.00 20.28 ? 33   ARG C CB  1 
ATOM   6637  C CG  . ARG C  1 27  ? -27.349 -53.814  100.498 1.00 26.86 ? 33   ARG C CG  1 
ATOM   6638  C CD  . ARG C  1 27  ? -26.242 -54.743  100.053 1.00 35.67 ? 33   ARG C CD  1 
ATOM   6639  N NE  . ARG C  1 27  ? -26.792 -56.011  99.584  1.00 46.79 ? 33   ARG C NE  1 
ATOM   6640  C CZ  . ARG C  1 27  ? -26.235 -56.775  98.649  1.00 55.97 ? 33   ARG C CZ  1 
ATOM   6641  N NH1 . ARG C  1 27  ? -25.101 -56.404  98.064  1.00 54.96 ? 33   ARG C NH1 1 
ATOM   6642  N NH2 . ARG C  1 27  ? -26.820 -57.912  98.293  1.00 60.81 ? 33   ARG C NH2 1 
ATOM   6643  N N   . ARG C  1 28  ? -31.634 -52.808  98.389  1.00 18.43 ? 34   ARG C N   1 
ATOM   6644  C CA  . ARG C  1 28  ? -32.443 -52.093  97.403  1.00 16.77 ? 34   ARG C CA  1 
ATOM   6645  C C   . ARG C  1 28  ? -33.868 -51.989  97.913  1.00 12.90 ? 34   ARG C C   1 
ATOM   6646  O O   . ARG C  1 28  ? -34.336 -52.865  98.641  1.00 15.50 ? 34   ARG C O   1 
ATOM   6647  C CB  . ARG C  1 28  ? -32.403 -52.796  96.038  1.00 15.07 ? 34   ARG C CB  1 
ATOM   6648  C CG  . ARG C  1 28  ? -33.000 -54.189  96.056  1.00 17.94 ? 34   ARG C CG  1 
ATOM   6649  C CD  . ARG C  1 28  ? -32.998 -54.841  94.684  1.00 16.95 ? 34   ARG C CD  1 
ATOM   6650  N NE  . ARG C  1 28  ? -31.654 -55.072  94.155  1.00 17.29 ? 34   ARG C NE  1 
ATOM   6651  C CZ  . ARG C  1 28  ? -30.956 -56.192  94.326  1.00 19.97 ? 34   ARG C CZ  1 
ATOM   6652  N NH1 . ARG C  1 28  ? -31.460 -57.196  95.032  1.00 14.94 ? 34   ARG C NH1 1 
ATOM   6653  N NH2 . ARG C  1 28  ? -29.745 -56.304  93.792  1.00 21.36 ? 34   ARG C NH2 1 
ATOM   6654  N N   . ALA C  1 29  ? -34.562 -50.915  97.555  1.00 11.85 ? 35   ALA C N   1 
ATOM   6655  C CA  . ALA C  1 29  ? -35.978 -50.813  97.873  1.00 12.06 ? 35   ALA C CA  1 
ATOM   6656  C C   . ALA C  1 29  ? -36.781 -51.736  96.951  1.00 14.72 ? 35   ALA C C   1 
ATOM   6657  O O   . ALA C  1 29  ? -36.300 -52.136  95.885  1.00 14.55 ? 35   ALA C O   1 
ATOM   6658  C CB  . ALA C  1 29  ? -36.455 -49.374  97.750  1.00 14.51 ? 35   ALA C CB  1 
ATOM   6659  N N   . LYS C  1 30  ? -37.999 -52.086  97.353  1.00 10.34 ? 36   LYS C N   1 
ATOM   6660  C CA  . LYS C  1 30  ? -38.806 -53.002  96.553  1.00 12.34 ? 36   LYS C CA  1 
ATOM   6661  C C   . LYS C  1 30  ? -39.060 -52.513  95.112  1.00 9.62  ? 36   LYS C C   1 
ATOM   6662  O O   . LYS C  1 30  ? -38.998 -53.313  94.182  1.00 11.89 ? 36   LYS C O   1 
ATOM   6663  C CB  . LYS C  1 30  ? -40.144 -53.288  97.249  1.00 15.09 ? 36   LYS C CB  1 
ATOM   6664  C CG  . LYS C  1 30  ? -40.980 -54.328  96.523  1.00 14.42 ? 36   LYS C CG  1 
ATOM   6665  C CD  . LYS C  1 30  ? -42.243 -54.681  97.286  1.00 15.76 ? 36   LYS C CD  1 
ATOM   6666  C CE  . LYS C  1 30  ? -43.195 -55.490  96.425  1.00 15.52 ? 36   LYS C CE  1 
ATOM   6667  N NZ  . LYS C  1 30  ? -44.573 -55.463  96.972  1.00 17.10 ? 36   LYS C NZ  1 
ATOM   6668  N N   . PRO C  1 31  ? -39.343 -51.209  94.913  1.00 13.75 ? 37   PRO C N   1 
ATOM   6669  C CA  . PRO C  1 31  ? -39.547 -50.802  93.514  1.00 12.77 ? 37   PRO C CA  1 
ATOM   6670  C C   . PRO C  1 31  ? -38.332 -51.014  92.601  1.00 14.47 ? 37   PRO C C   1 
ATOM   6671  O O   . PRO C  1 31  ? -38.519 -51.087  91.392  1.00 10.55 ? 37   PRO C O   1 
ATOM   6672  C CB  . PRO C  1 31  ? -39.882 -49.310  93.631  1.00 11.76 ? 37   PRO C CB  1 
ATOM   6673  C CG  . PRO C  1 31  ? -40.464 -49.161  95.006  1.00 12.29 ? 37   PRO C CG  1 
ATOM   6674  C CD  . PRO C  1 31  ? -39.651 -50.107  95.845  1.00 14.67 ? 37   PRO C CD  1 
ATOM   6675  N N   . ALA C  1 32  ? -37.132 -51.137  93.165  1.00 12.67 ? 38   ALA C N   1 
ATOM   6676  C CA  . ALA C  1 32  ? -35.912 -51.359  92.391  1.00 11.39 ? 38   ALA C CA  1 
ATOM   6677  C C   . ALA C  1 32  ? -35.659 -52.841  92.077  1.00 10.08 ? 38   ALA C C   1 
ATOM   6678  O O   . ALA C  1 32  ? -34.723 -53.178  91.376  1.00 13.94 ? 38   ALA C O   1 
ATOM   6679  C CB  . ALA C  1 32  ? -34.710 -50.774  93.129  1.00 10.31 ? 38   ALA C CB  1 
ATOM   6680  N N   . VAL C  1 33  ? -36.487 -53.728  92.606  1.00 10.60 ? 39   VAL C N   1 
ATOM   6681  C CA  . VAL C  1 33  ? -36.287 -55.146  92.392  1.00 9.09  ? 39   VAL C CA  1 
ATOM   6682  C C   . VAL C  1 33  ? -36.536 -55.517  90.921  1.00 7.18  ? 39   VAL C C   1 
ATOM   6683  O O   . VAL C  1 33  ? -37.470 -55.040  90.299  1.00 11.02 ? 39   VAL C O   1 
ATOM   6684  C CB  . VAL C  1 33  ? -37.200 -55.967  93.333  1.00 13.46 ? 39   VAL C CB  1 
ATOM   6685  C CG1 . VAL C  1 33  ? -37.276 -57.406  92.893  1.00 15.94 ? 39   VAL C CG1 1 
ATOM   6686  C CG2 . VAL C  1 33  ? -36.688 -55.876  94.774  1.00 11.81 ? 39   VAL C CG2 1 
ATOM   6687  N N   . TYR C  1 34  ? -35.670 -56.357  90.377  1.00 9.23  ? 40   TYR C N   1 
ATOM   6688  C CA  . TYR C  1 34  ? -35.756 -56.804  88.994  1.00 12.01 ? 40   TYR C CA  1 
ATOM   6689  C C   . TYR C  1 34  ? -36.956 -57.668  88.670  1.00 9.65  ? 40   TYR C C   1 
ATOM   6690  O O   . TYR C  1 34  ? -37.320 -58.553  89.438  1.00 11.44 ? 40   TYR C O   1 
ATOM   6691  C CB  . TYR C  1 34  ? -34.496 -57.583  88.645  1.00 12.18 ? 40   TYR C CB  1 
ATOM   6692  C CG  . TYR C  1 34  ? -33.255 -56.776  88.860  1.00 12.94 ? 40   TYR C CG  1 
ATOM   6693  C CD1 . TYR C  1 34  ? -32.742 -55.991  87.839  1.00 15.24 ? 40   TYR C CD1 1 
ATOM   6694  C CD2 . TYR C  1 34  ? -32.598 -56.786  90.080  1.00 14.15 ? 40   TYR C CD2 1 
ATOM   6695  C CE1 . TYR C  1 34  ? -31.608 -55.239  88.018  1.00 16.89 ? 40   TYR C CE1 1 
ATOM   6696  C CE2 . TYR C  1 34  ? -31.460 -56.042  90.273  1.00 16.28 ? 40   TYR C CE2 1 
ATOM   6697  C CZ  . TYR C  1 34  ? -30.972 -55.266  89.238  1.00 16.94 ? 40   TYR C CZ  1 
ATOM   6698  O OH  . TYR C  1 34  ? -29.837 -54.523  89.443  1.00 19.92 ? 40   TYR C OH  1 
ATOM   6699  N N   . PHE C  1 35  ? -37.557 -57.442  87.513  1.00 6.79  ? 41   PHE C N   1 
ATOM   6700  C CA  . PHE C  1 35  ? -38.642 -58.318  87.097  1.00 11.33 ? 41   PHE C CA  1 
ATOM   6701  C C   . PHE C  1 35  ? -38.661 -58.594  85.607  1.00 11.61 ? 41   PHE C C   1 
ATOM   6702  O O   . PHE C  1 35  ? -38.592 -57.672  84.791  1.00 15.12 ? 41   PHE C O   1 
ATOM   6703  C CB  . PHE C  1 35  ? -40.005 -57.755  87.486  1.00 13.76 ? 41   PHE C CB  1 
ATOM   6704  C CG  . PHE C  1 35  ? -41.138 -58.627  87.035  1.00 17.56 ? 41   PHE C CG  1 
ATOM   6705  C CD1 . PHE C  1 35  ? -41.507 -59.728  87.783  1.00 21.63 ? 41   PHE C CD1 1 
ATOM   6706  C CD2 . PHE C  1 35  ? -41.793 -58.385  85.834  1.00 16.40 ? 41   PHE C CD2 1 
ATOM   6707  C CE1 . PHE C  1 35  ? -42.534 -60.551  87.359  1.00 23.71 ? 41   PHE C CE1 1 
ATOM   6708  C CE2 . PHE C  1 35  ? -42.806 -59.205  85.406  1.00 13.28 ? 41   PHE C CE2 1 
ATOM   6709  C CZ  . PHE C  1 35  ? -43.180 -60.288  86.168  1.00 19.63 ? 41   PHE C CZ  1 
ATOM   6710  N N   . GLY C  1 36  ? -38.770 -59.871  85.263  1.00 8.93  ? 42   GLY C N   1 
ATOM   6711  C CA  . GLY C  1 36  ? -39.109 -60.267  83.914  1.00 14.02 ? 42   GLY C CA  1 
ATOM   6712  C C   . GLY C  1 36  ? -37.955 -60.438  82.952  1.00 17.19 ? 42   GLY C C   1 
ATOM   6713  O O   . GLY C  1 36  ? -38.165 -60.810  81.802  1.00 22.31 ? 42   GLY C O   1 
ATOM   6714  N N   . GLY C  1 37  ? -36.741 -60.168  83.409  1.00 17.10 ? 43   GLY C N   1 
ATOM   6715  C CA  . GLY C  1 37  ? -35.569 -60.333  82.570  1.00 20.45 ? 43   GLY C CA  1 
ATOM   6716  C C   . GLY C  1 37  ? -34.819 -59.049  82.278  1.00 16.83 ? 43   GLY C C   1 
ATOM   6717  O O   . GLY C  1 37  ? -33.614 -59.064  82.065  1.00 19.13 ? 43   GLY C O   1 
ATOM   6718  N N   . LYS C  1 38  ? -35.526 -57.927  82.279  1.00 16.00 ? 44   LYS C N   1 
ATOM   6719  C CA  . LYS C  1 38  ? -34.915 -56.662  81.887  1.00 16.89 ? 44   LYS C CA  1 
ATOM   6720  C C   . LYS C  1 38  ? -35.289 -55.503  82.818  1.00 14.52 ? 44   LYS C C   1 
ATOM   6721  O O   . LYS C  1 38  ? -34.437 -54.708  83.187  1.00 19.31 ? 44   LYS C O   1 
ATOM   6722  C CB  . LYS C  1 38  ? -35.308 -56.316  80.445  1.00 22.60 ? 44   LYS C CB  1 
ATOM   6723  C CG  . LYS C  1 38  ? -35.162 -57.459  79.456  1.00 25.12 ? 44   LYS C CG  1 
ATOM   6724  C CD  . LYS C  1 38  ? -34.122 -57.163  78.416  1.00 24.95 ? 44   LYS C CD  1 
ATOM   6725  C CE  . LYS C  1 38  ? -33.924 -58.309  77.464  1.00 20.07 ? 44   LYS C CE  1 
ATOM   6726  N NZ  . LYS C  1 38  ? -33.356 -57.827  76.199  1.00 18.57 ? 44   LYS C NZ  1 
ATOM   6727  N N   . ALA C  1 39  ? -36.554 -55.429  83.226  1.00 13.41 ? 45   ALA C N   1 
ATOM   6728  C CA  . ALA C  1 39  ? -37.070 -54.235  83.890  1.00 7.66  ? 45   ALA C CA  1 
ATOM   6729  C C   . ALA C  1 39  ? -36.940 -54.288  85.396  1.00 8.45  ? 45   ALA C C   1 
ATOM   6730  O O   . ALA C  1 39  ? -36.383 -55.235  85.945  1.00 9.98  ? 45   ALA C O   1 
ATOM   6731  C CB  . ALA C  1 39  ? -38.527 -54.018  83.513  1.00 10.67 ? 45   ALA C CB  1 
ATOM   6732  N N   . ARG C  1 40  ? -37.447 -53.252  86.055  1.00 6.22  ? 46   ARG C N   1 
ATOM   6733  C CA  . ARG C  1 40  ? -37.579 -53.244  87.498  1.00 5.17  ? 46   ARG C CA  1 
ATOM   6734  C C   . ARG C  1 40  ? -39.043 -52.995  87.811  1.00 6.57  ? 46   ARG C C   1 
ATOM   6735  O O   . ARG C  1 40  ? -39.773 -52.509  86.957  1.00 8.63  ? 46   ARG C O   1 
ATOM   6736  C CB  . ARG C  1 40  ? -36.696 -52.174  88.136  1.00 7.47  ? 46   ARG C CB  1 
ATOM   6737  C CG  . ARG C  1 40  ? -35.198 -52.358  87.878  1.00 8.20  ? 46   ARG C CG  1 
ATOM   6738  C CD  . ARG C  1 40  ? -34.428 -51.415  88.761  1.00 8.90  ? 46   ARG C CD  1 
ATOM   6739  N NE  . ARG C  1 40  ? -33.001 -51.314  88.448  1.00 11.65 ? 46   ARG C NE  1 
ATOM   6740  C CZ  . ARG C  1 40  ? -32.018 -51.695  89.260  1.00 9.09  ? 46   ARG C CZ  1 
ATOM   6741  N NH1 . ARG C  1 40  ? -32.285 -52.258  90.432  1.00 8.10  ? 46   ARG C NH1 1 
ATOM   6742  N NH2 . ARG C  1 40  ? -30.758 -51.514  88.887  1.00 10.82 ? 46   ARG C NH2 1 
ATOM   6743  N N   . ILE C  1 41  ? -39.468 -53.311  89.029  1.00 10.71 ? 47   ILE C N   1 
ATOM   6744  C CA  . ILE C  1 41  ? -40.887 -53.225  89.381  1.00 10.51 ? 47   ILE C CA  1 
ATOM   6745  C C   . ILE C  1 41  ? -41.450 -51.823  89.152  1.00 9.61  ? 47   ILE C C   1 
ATOM   6746  O O   . ILE C  1 41  ? -42.531 -51.673  88.591  1.00 10.49 ? 47   ILE C O   1 
ATOM   6747  C CB  . ILE C  1 41  ? -41.125 -53.647  90.841  1.00 12.89 ? 47   ILE C CB  1 
ATOM   6748  C CG1 . ILE C  1 41  ? -40.784 -55.128  91.019  1.00 14.43 ? 47   ILE C CG1 1 
ATOM   6749  C CG2 . ILE C  1 41  ? -42.567 -53.409  91.224  1.00 8.61  ? 47   ILE C CG2 1 
ATOM   6750  C CD1 . ILE C  1 41  ? -40.902 -55.621  92.446  1.00 17.09 ? 47   ILE C CD1 1 
ATOM   6751  N N   . ILE C  1 42  ? -40.700 -50.799  89.545  1.00 10.20 ? 48   ILE C N   1 
ATOM   6752  C CA  . ILE C  1 42  ? -41.148 -49.420  89.370  1.00 8.35  ? 48   ILE C CA  1 
ATOM   6753  C C   . ILE C  1 42  ? -41.494 -49.065  87.909  1.00 8.72  ? 48   ILE C C   1 
ATOM   6754  O O   . ILE C  1 42  ? -42.279 -48.167  87.669  1.00 8.03  ? 48   ILE C O   1 
ATOM   6755  C CB  . ILE C  1 42  ? -40.095 -48.409  89.908  1.00 8.19  ? 48   ILE C CB  1 
ATOM   6756  C CG1 . ILE C  1 42  ? -40.743 -47.038  90.127  1.00 10.04 ? 48   ILE C CG1 1 
ATOM   6757  C CG2 . ILE C  1 42  ? -38.899 -48.314  88.981  1.00 8.55  ? 48   ILE C CG2 1 
ATOM   6758  C CD1 . ILE C  1 42  ? -39.864 -46.045  90.773  1.00 16.63 ? 48   ILE C CD1 1 
ATOM   6759  N N   . ASP C  1 43  ? -40.942 -49.781  86.936  1.00 9.05  ? 49   ASP C N   1 
ATOM   6760  C CA  . ASP C  1 43  ? -41.156 -49.445  85.533  1.00 7.19  ? 49   ASP C CA  1 
ATOM   6761  C C   . ASP C  1 43  ? -42.582 -49.675  85.051  1.00 10.22 ? 49   ASP C C   1 
ATOM   6762  O O   . ASP C  1 43  ? -42.960 -49.208  83.983  1.00 11.81 ? 49   ASP C O   1 
ATOM   6763  C CB  . ASP C  1 43  ? -40.209 -50.244  84.652  1.00 7.99  ? 49   ASP C CB  1 
ATOM   6764  C CG  . ASP C  1 43  ? -38.773 -49.825  84.825  1.00 10.24 ? 49   ASP C CG  1 
ATOM   6765  O OD1 . ASP C  1 43  ? -38.525 -48.608  84.995  1.00 10.55 ? 49   ASP C OD1 1 
ATOM   6766  O OD2 . ASP C  1 43  ? -37.906 -50.718  84.796  1.00 11.81 ? 49   ASP C OD2 1 
ATOM   6767  N N   . PHE C  1 44  ? -43.372 -50.401  85.833  1.00 9.27  ? 50   PHE C N   1 
ATOM   6768  C CA  . PHE C  1 44  ? -44.747 -50.660  85.439  1.00 8.70  ? 50   PHE C CA  1 
ATOM   6769  C C   . PHE C  1 44  ? -45.611 -49.454  85.753  1.00 7.09  ? 50   PHE C C   1 
ATOM   6770  O O   . PHE C  1 44  ? -46.286 -48.946  84.865  1.00 8.13  ? 50   PHE C O   1 
ATOM   6771  C CB  . PHE C  1 44  ? -45.248 -51.951  86.100  1.00 9.75  ? 50   PHE C CB  1 
ATOM   6772  C CG  . PHE C  1 44  ? -44.662 -53.180  85.468  1.00 12.91 ? 50   PHE C CG  1 
ATOM   6773  C CD1 . PHE C  1 44  ? -43.381 -53.604  85.800  1.00 14.17 ? 50   PHE C CD1 1 
ATOM   6774  C CD2 . PHE C  1 44  ? -45.353 -53.857  84.474  1.00 11.27 ? 50   PHE C CD2 1 
ATOM   6775  C CE1 . PHE C  1 44  ? -42.815 -54.708  85.190  1.00 12.85 ? 50   PHE C CE1 1 
ATOM   6776  C CE2 . PHE C  1 44  ? -44.795 -54.961  83.862  1.00 12.35 ? 50   PHE C CE2 1 
ATOM   6777  C CZ  . PHE C  1 44  ? -43.523 -55.382  84.210  1.00 9.86  ? 50   PHE C CZ  1 
ATOM   6778  N N   . ALA C  1 45  ? -45.558 -48.952  86.982  1.00 6.90  ? 51   ALA C N   1 
ATOM   6779  C CA  . ALA C  1 45  ? -46.310 -47.739  87.305  1.00 10.53 ? 51   ALA C CA  1 
ATOM   6780  C C   . ALA C  1 45  ? -45.882 -46.577  86.412  1.00 12.21 ? 51   ALA C C   1 
ATOM   6781  O O   . ALA C  1 45  ? -46.730 -45.844  85.915  1.00 14.17 ? 51   ALA C O   1 
ATOM   6782  C CB  . ALA C  1 45  ? -46.146 -47.364  88.756  1.00 11.43 ? 51   ALA C CB  1 
ATOM   6783  N N   . LEU C  1 46  ? -44.580 -46.417  86.188  1.00 9.18  ? 52   LEU C N   1 
ATOM   6784  C CA  . LEU C  1 46  ? -44.092 -45.318  85.348  1.00 8.74  ? 52   LEU C CA  1 
ATOM   6785  C C   . LEU C  1 46  ? -44.543 -45.457  83.900  1.00 8.35  ? 52   LEU C C   1 
ATOM   6786  O O   . LEU C  1 46  ? -44.942 -44.484  83.277  1.00 11.51 ? 52   LEU C O   1 
ATOM   6787  C CB  . LEU C  1 46  ? -42.568 -45.226  85.394  1.00 8.66  ? 52   LEU C CB  1 
ATOM   6788  C CG  . LEU C  1 46  ? -41.958 -44.949  86.764  1.00 7.08  ? 52   LEU C CG  1 
ATOM   6789  C CD1 . LEU C  1 46  ? -40.443 -44.961  86.678  1.00 9.61  ? 52   LEU C CD1 1 
ATOM   6790  C CD2 . LEU C  1 46  ? -42.470 -43.629  87.300  1.00 11.57 ? 52   LEU C CD2 1 
ATOM   6791  N N   . SER C  1 47  ? -44.486 -46.665  83.363  1.00 9.00  ? 53   SER C N   1 
ATOM   6792  C CA  . SER C  1 47  ? -44.899 -46.851  81.984  1.00 6.82  ? 53   SER C CA  1 
ATOM   6793  C C   . SER C  1 47  ? -46.405 -46.733  81.852  1.00 11.57 ? 53   SER C C   1 
ATOM   6794  O O   . SER C  1 47  ? -46.897 -46.299  80.806  1.00 9.76  ? 53   SER C O   1 
ATOM   6795  C CB  . SER C  1 47  ? -44.437 -48.193  81.458  1.00 6.98  ? 53   SER C CB  1 
ATOM   6796  O OG  . SER C  1 47  ? -43.041 -48.300  81.554  1.00 9.27  ? 53   SER C OG  1 
ATOM   6797  N N   . ASN C  1 48  ? -47.143 -47.107  82.899  1.00 10.24 ? 54   ASN C N   1 
ATOM   6798  C CA  . ASN C  1 48  ? -48.586 -46.858  82.890  1.00 13.93 ? 54   ASN C CA  1 
ATOM   6799  C C   . ASN C  1 48  ? -48.877 -45.363  82.812  1.00 12.27 ? 54   ASN C C   1 
ATOM   6800  O O   . ASN C  1 48  ? -49.732 -44.930  82.039  1.00 10.19 ? 54   ASN C O   1 
ATOM   6801  C CB  . ASN C  1 48  ? -49.260 -47.457  84.122  1.00 13.12 ? 54   ASN C CB  1 
ATOM   6802  C CG  . ASN C  1 48  ? -49.330 -48.954  84.067  1.00 11.18 ? 54   ASN C CG  1 
ATOM   6803  O OD1 . ASN C  1 48  ? -49.337 -49.541  82.994  1.00 7.89  ? 54   ASN C OD1 1 
ATOM   6804  N ND2 . ASN C  1 48  ? -49.395 -49.582  85.227  1.00 12.44 ? 54   ASN C ND2 1 
ATOM   6805  N N   . ALA C  1 49  ? -48.156 -44.566  83.596  1.00 12.47 ? 55   ALA C N   1 
ATOM   6806  C CA  . ALA C  1 49  ? -48.399 -43.130  83.582  1.00 9.72  ? 55   ALA C CA  1 
ATOM   6807  C C   . ALA C  1 49  ? -48.110 -42.567  82.190  1.00 8.70  ? 55   ALA C C   1 
ATOM   6808  O O   . ALA C  1 49  ? -48.899 -41.807  81.636  1.00 9.30  ? 55   ALA C O   1 
ATOM   6809  C CB  . ALA C  1 49  ? -47.564 -42.433  84.635  1.00 7.72  ? 55   ALA C CB  1 
ATOM   6810  N N   . LEU C  1 50  ? -46.981 -42.972  81.626  1.00 12.75 ? 56   LEU C N   1 
ATOM   6811  C CA  . LEU C  1 50  ? -46.559 -42.533  80.306  1.00 13.31 ? 56   LEU C CA  1 
ATOM   6812  C C   . LEU C  1 50  ? -47.533 -42.954  79.189  1.00 15.11 ? 56   LEU C C   1 
ATOM   6813  O O   . LEU C  1 50  ? -47.895 -42.144  78.332  1.00 11.83 ? 56   LEU C O   1 
ATOM   6814  C CB  . LEU C  1 50  ? -45.160 -43.080  80.028  1.00 16.98 ? 56   LEU C CB  1 
ATOM   6815  C CG  . LEU C  1 50  ? -44.517 -42.721  78.701  1.00 21.49 ? 56   LEU C CG  1 
ATOM   6816  C CD1 . LEU C  1 50  ? -44.386 -41.222  78.648  1.00 22.15 ? 56   LEU C CD1 1 
ATOM   6817  C CD2 . LEU C  1 50  ? -43.158 -43.382  78.590  1.00 21.17 ? 56   LEU C CD2 1 
ATOM   6818  N N   . ASN C  1 51  ? -47.954 -44.216  79.201  1.00 13.23 ? 57   ASN C N   1 
ATOM   6819  C CA  . ASN C  1 51  ? -48.888 -44.731  78.196  1.00 13.64 ? 57   ASN C CA  1 
ATOM   6820  C C   . ASN C  1 51  ? -50.284 -44.136  78.329  1.00 13.93 ? 57   ASN C C   1 
ATOM   6821  O O   . ASN C  1 51  ? -51.036 -44.083  77.361  1.00 14.83 ? 57   ASN C O   1 
ATOM   6822  C CB  . ASN C  1 51  ? -48.968 -46.264  78.272  1.00 9.67  ? 57   ASN C CB  1 
ATOM   6823  C CG  . ASN C  1 51  ? -47.662 -46.945  77.888  1.00 15.03 ? 57   ASN C CG  1 
ATOM   6824  O OD1 . ASN C  1 51  ? -46.795 -46.346  77.259  1.00 19.44 ? 57   ASN C OD1 1 
ATOM   6825  N ND2 . ASN C  1 51  ? -47.513 -48.199  78.281  1.00 12.65 ? 57   ASN C ND2 1 
ATOM   6826  N N   . SER C  1 52  ? -50.633 -43.691  79.529  1.00 13.21 ? 58   SER C N   1 
ATOM   6827  C CA  . SER C  1 52  ? -51.915 -43.028  79.751  1.00 10.26 ? 58   SER C CA  1 
ATOM   6828  C C   . SER C  1 52  ? -51.861 -41.560  79.355  1.00 11.14 ? 58   SER C C   1 
ATOM   6829  O O   . SER C  1 52  ? -52.874 -40.878  79.412  1.00 17.99 ? 58   SER C O   1 
ATOM   6830  C CB  . SER C  1 52  ? -52.340 -43.135  81.212  1.00 10.08 ? 58   SER C CB  1 
ATOM   6831  O OG  . SER C  1 52  ? -52.526 -44.482  81.593  1.00 17.52 ? 58   SER C OG  1 
ATOM   6832  N N   . GLY C  1 53  ? -50.674 -41.075  78.991  1.00 12.75 ? 59   GLY C N   1 
ATOM   6833  C CA  . GLY C  1 53  ? -50.515 -39.709  78.527  1.00 13.90 ? 59   GLY C CA  1 
ATOM   6834  C C   . GLY C  1 53  ? -50.208 -38.707  79.618  1.00 10.42 ? 59   GLY C C   1 
ATOM   6835  O O   . GLY C  1 53  ? -50.297 -37.509  79.403  1.00 11.98 ? 59   GLY C O   1 
ATOM   6836  N N   . ILE C  1 54  ? -49.863 -39.196  80.800  1.00 10.35 ? 60   ILE C N   1 
ATOM   6837  C CA  . ILE C  1 54  ? -49.455 -38.315  81.884  1.00 12.34 ? 60   ILE C CA  1 
ATOM   6838  C C   . ILE C  1 54  ? -47.999 -37.882  81.673  1.00 16.98 ? 60   ILE C C   1 
ATOM   6839  O O   . ILE C  1 54  ? -47.094 -38.709  81.666  1.00 21.84 ? 60   ILE C O   1 
ATOM   6840  C CB  . ILE C  1 54  ? -49.621 -38.999  83.238  1.00 12.56 ? 60   ILE C CB  1 
ATOM   6841  C CG1 . ILE C  1 54  ? -51.096 -39.325  83.475  1.00 11.43 ? 60   ILE C CG1 1 
ATOM   6842  C CG2 . ILE C  1 54  ? -49.099 -38.114  84.361  1.00 14.46 ? 60   ILE C CG2 1 
ATOM   6843  C CD1 . ILE C  1 54  ? -51.333 -40.084  84.747  1.00 11.07 ? 60   ILE C CD1 1 
ATOM   6844  N N   . ARG C  1 55  ? -47.793 -36.583  81.489  1.00 16.93 ? 61   ARG C N   1 
ATOM   6845  C CA  . ARG C  1 55  ? -46.491 -36.025  81.125  1.00 22.83 ? 61   ARG C CA  1 
ATOM   6846  C C   . ARG C  1 55  ? -45.671 -35.545  82.319  1.00 18.49 ? 61   ARG C C   1 
ATOM   6847  O O   . ARG C  1 55  ? -44.472 -35.288  82.188  1.00 15.84 ? 61   ARG C O   1 
ATOM   6848  C CB  . ARG C  1 55  ? -46.671 -34.853  80.151  1.00 16.45 ? 61   ARG C CB  1 
ATOM   6849  N N   . ARG C  1 56  ? -46.317 -35.386  83.468  1.00 15.88 ? 62   ARG C N   1 
ATOM   6850  C CA  . ARG C  1 56  ? -45.608 -35.005  84.681  1.00 8.71  ? 62   ARG C CA  1 
ATOM   6851  C C   . ARG C  1 56  ? -45.647 -36.139  85.698  1.00 11.78 ? 62   ARG C C   1 
ATOM   6852  O O   . ARG C  1 56  ? -46.723 -36.637  86.052  1.00 12.10 ? 62   ARG C O   1 
ATOM   6853  C CB  . ARG C  1 56  ? -46.203 -33.740  85.273  1.00 8.57  ? 62   ARG C CB  1 
ATOM   6854  C CG  . ARG C  1 56  ? -46.358 -32.632  84.263  1.00 12.25 ? 62   ARG C CG  1 
ATOM   6855  C CD  . ARG C  1 56  ? -46.468 -31.317  84.972  1.00 13.04 ? 62   ARG C CD  1 
ATOM   6856  N NE  . ARG C  1 56  ? -46.537 -30.181  84.063  1.00 15.10 ? 62   ARG C NE  1 
ATOM   6857  C CZ  . ARG C  1 56  ? -45.478 -29.599  83.510  1.00 15.30 ? 62   ARG C CZ  1 
ATOM   6858  N NH1 . ARG C  1 56  ? -44.257 -30.054  83.751  1.00 13.16 ? 62   ARG C NH1 1 
ATOM   6859  N NH2 . ARG C  1 56  ? -45.640 -28.557  82.709  1.00 13.46 ? 62   ARG C NH2 1 
ATOM   6860  N N   . ILE C  1 57  ? -44.463 -36.550  86.141  1.00 11.48 ? 63   ILE C N   1 
ATOM   6861  C CA  . ILE C  1 57  ? -44.303 -37.669  87.055  1.00 14.17 ? 63   ILE C CA  1 
ATOM   6862  C C   . ILE C  1 57  ? -43.336 -37.285  88.174  1.00 13.02 ? 63   ILE C C   1 
ATOM   6863  O O   . ILE C  1 57  ? -42.288 -36.709  87.915  1.00 11.66 ? 63   ILE C O   1 
ATOM   6864  C CB  . ILE C  1 57  ? -43.788 -38.936  86.311  1.00 12.25 ? 63   ILE C CB  1 
ATOM   6865  C CG1 . ILE C  1 57  ? -44.778 -39.373  85.234  1.00 8.01  ? 63   ILE C CG1 1 
ATOM   6866  C CG2 . ILE C  1 57  ? -43.517 -40.076  87.286  1.00 13.81 ? 63   ILE C CG2 1 
ATOM   6867  C CD1 . ILE C  1 57  ? -44.298 -40.547  84.445  1.00 12.97 ? 63   ILE C CD1 1 
ATOM   6868  N N   . GLY C  1 58  ? -43.707 -37.579  89.417  1.00 12.28 ? 64   GLY C N   1 
ATOM   6869  C CA  . GLY C  1 58  ? -42.799 -37.459  90.551  1.00 13.49 ? 64   GLY C CA  1 
ATOM   6870  C C   . GLY C  1 58  ? -42.600 -38.802  91.227  1.00 10.82 ? 64   GLY C C   1 
ATOM   6871  O O   . GLY C  1 58  ? -43.522 -39.611  91.284  1.00 16.63 ? 64   GLY C O   1 
ATOM   6872  N N   . VAL C  1 59  ? -41.394 -39.067  91.709  1.00 12.26 ? 65   VAL C N   1 
ATOM   6873  C CA  . VAL C  1 59  ? -41.136 -40.305  92.432  1.00 11.60 ? 65   VAL C CA  1 
ATOM   6874  C C   . VAL C  1 59  ? -40.563 -39.997  93.795  1.00 11.60 ? 65   VAL C C   1 
ATOM   6875  O O   . VAL C  1 59  ? -39.501 -39.396  93.897  1.00 13.68 ? 65   VAL C O   1 
ATOM   6876  C CB  . VAL C  1 59  ? -40.164 -41.236  91.679  1.00 11.71 ? 65   VAL C CB  1 
ATOM   6877  C CG1 . VAL C  1 59  ? -39.924 -42.498  92.481  1.00 11.49 ? 65   VAL C CG1 1 
ATOM   6878  C CG2 . VAL C  1 59  ? -40.727 -41.589  90.312  1.00 10.65 ? 65   VAL C CG2 1 
ATOM   6879  N N   . ALA C  1 60  ? -41.280 -40.420  94.834  1.00 10.77 ? 66   ALA C N   1 
ATOM   6880  C CA  . ALA C  1 60  ? -40.877 -40.195  96.209  1.00 12.51 ? 66   ALA C CA  1 
ATOM   6881  C C   . ALA C  1 60  ? -40.233 -41.458  96.761  1.00 13.92 ? 66   ALA C C   1 
ATOM   6882  O O   . ALA C  1 60  ? -40.864 -42.506  96.830  1.00 16.98 ? 66   ALA C O   1 
ATOM   6883  C CB  . ALA C  1 60  ? -42.073 -39.783  97.054  1.00 15.45 ? 66   ALA C CB  1 
ATOM   6884  N N   . THR C  1 61  ? -38.969 -41.363  97.141  1.00 13.57 ? 67   THR C N   1 
ATOM   6885  C CA  . THR C  1 61  ? -38.266 -42.529  97.640  1.00 16.79 ? 67   THR C CA  1 
ATOM   6886  C C   . THR C  1 61  ? -37.939 -42.367  99.123  1.00 21.84 ? 67   THR C C   1 
ATOM   6887  O O   . THR C  1 61  ? -38.003 -41.269  99.674  1.00 22.02 ? 67   THR C O   1 
ATOM   6888  C CB  . THR C  1 61  ? -36.967 -42.799  96.861  1.00 14.04 ? 67   THR C CB  1 
ATOM   6889  O OG1 . THR C  1 61  ? -36.057 -41.718  97.061  1.00 17.47 ? 67   THR C OG1 1 
ATOM   6890  C CG2 . THR C  1 61  ? -37.246 -42.943  95.382  1.00 14.39 ? 67   THR C CG2 1 
ATOM   6891  N N   . GLN C  1 62  ? -37.581 -43.477  99.751  1.00 22.09 ? 68   GLN C N   1 
ATOM   6892  C CA  . GLN C  1 62  ? -37.361 -43.518  101.187 1.00 22.94 ? 68   GLN C CA  1 
ATOM   6893  C C   . GLN C  1 62  ? -36.093 -44.303  101.485 1.00 21.35 ? 68   GLN C C   1 
ATOM   6894  O O   . GLN C  1 62  ? -34.994 -43.801  101.302 1.00 22.97 ? 68   GLN C O   1 
ATOM   6895  C CB  . GLN C  1 62  ? -38.562 -44.145  101.895 1.00 26.13 ? 68   GLN C CB  1 
ATOM   6896  C CG  . GLN C  1 62  ? -38.573 -43.963  103.420 1.00 34.68 ? 68   GLN C CG  1 
ATOM   6897  C CD  . GLN C  1 62  ? -39.207 -42.660  103.870 1.00 39.85 ? 68   GLN C CD  1 
ATOM   6898  O OE1 . GLN C  1 62  ? -40.428 -42.549  103.955 1.00 46.89 ? 68   GLN C OE1 1 
ATOM   6899  N NE2 . GLN C  1 62  ? -38.381 -41.663  104.136 1.00 39.97 ? 68   GLN C NE2 1 
ATOM   6900  N N   . TYR C  1 63  ? -36.236 -45.547  101.920 1.00 22.56 ? 69   TYR C N   1 
ATOM   6901  C CA  . TYR C  1 63  ? -35.067 -46.292  102.366 1.00 25.67 ? 69   TYR C CA  1 
ATOM   6902  C C   . TYR C  1 63  ? -34.401 -47.058  101.229 1.00 21.37 ? 69   TYR C C   1 
ATOM   6903  O O   . TYR C  1 63  ? -35.057 -47.453  100.271 1.00 24.17 ? 69   TYR C O   1 
ATOM   6904  C CB  . TYR C  1 63  ? -35.444 -47.238  103.512 1.00 33.58 ? 69   TYR C CB  1 
ATOM   6905  C CG  . TYR C  1 63  ? -36.019 -46.505  104.712 1.00 40.13 ? 69   TYR C CG  1 
ATOM   6906  C CD1 . TYR C  1 63  ? -35.285 -45.518  105.360 1.00 38.74 ? 69   TYR C CD1 1 
ATOM   6907  C CD2 . TYR C  1 63  ? -37.299 -46.792  105.187 1.00 45.21 ? 69   TYR C CD2 1 
ATOM   6908  C CE1 . TYR C  1 63  ? -35.802 -44.837  106.446 1.00 44.21 ? 69   TYR C CE1 1 
ATOM   6909  C CE2 . TYR C  1 63  ? -37.824 -46.118  106.281 1.00 48.89 ? 69   TYR C CE2 1 
ATOM   6910  C CZ  . TYR C  1 63  ? -37.069 -45.139  106.905 1.00 50.26 ? 69   TYR C CZ  1 
ATOM   6911  O OH  . TYR C  1 63  ? -37.577 -44.456  107.989 1.00 54.13 ? 69   TYR C OH  1 
ATOM   6912  N N   . LYS C  1 64  ? -33.082 -47.211  101.341 1.00 22.13 ? 70   LYS C N   1 
ATOM   6913  C CA  . LYS C  1 64  ? -32.261 -48.007  100.421 1.00 22.18 ? 70   LYS C CA  1 
ATOM   6914  C C   . LYS C  1 64  ? -32.461 -47.628  98.944  1.00 20.77 ? 70   LYS C C   1 
ATOM   6915  O O   . LYS C  1 64  ? -32.409 -48.485  98.052  1.00 14.83 ? 70   LYS C O   1 
ATOM   6916  C CB  . LYS C  1 64  ? -32.554 -49.487  100.630 1.00 25.20 ? 70   LYS C CB  1 
ATOM   6917  C CG  . LYS C  1 64  ? -32.544 -49.908  102.099 1.00 29.78 ? 70   LYS C CG  1 
ATOM   6918  C CD  . LYS C  1 64  ? -33.064 -51.331  102.255 1.00 33.49 ? 70   LYS C CD  1 
ATOM   6919  C CE  . LYS C  1 64  ? -33.388 -51.660  103.699 1.00 30.81 ? 70   LYS C CE  1 
ATOM   6920  N NZ  . LYS C  1 64  ? -34.137 -52.931  103.806 1.00 31.43 ? 70   LYS C NZ  1 
ATOM   6921  N N   . ALA C  1 65  ? -32.656 -46.334  98.702  1.00 20.43 ? 71   ALA C N   1 
ATOM   6922  C CA  . ALA C  1 65  ? -33.113 -45.839  97.405  1.00 14.95 ? 71   ALA C CA  1 
ATOM   6923  C C   . ALA C  1 65  ? -31.973 -45.538  96.435  1.00 17.11 ? 71   ALA C C   1 
ATOM   6924  O O   . ALA C  1 65  ? -32.208 -44.989  95.358  1.00 14.61 ? 71   ALA C O   1 
ATOM   6925  C CB  . ALA C  1 65  ? -33.965 -44.601  97.605  1.00 14.42 ? 71   ALA C CB  1 
ATOM   6926  N N   . HIS C  1 66  ? -30.746 -45.894  96.810  1.00 17.56 ? 72   HIS C N   1 
ATOM   6927  C CA  . HIS C  1 66  ? -29.580 -45.627  95.970  1.00 21.64 ? 72   HIS C CA  1 
ATOM   6928  C C   . HIS C  1 66  ? -29.719 -46.183  94.555  1.00 13.72 ? 72   HIS C C   1 
ATOM   6929  O O   . HIS C  1 66  ? -29.648 -45.433  93.577  1.00 14.88 ? 72   HIS C O   1 
ATOM   6930  C CB  . HIS C  1 66  ? -28.324 -46.206  96.616  1.00 37.05 ? 72   HIS C CB  1 
ATOM   6931  C CG  . HIS C  1 66  ? -27.094 -46.106  95.762  1.00 52.76 ? 72   HIS C CG  1 
ATOM   6932  N ND1 . HIS C  1 66  ? -26.606 -47.167  95.027  1.00 58.03 ? 72   HIS C ND1 1 
ATOM   6933  C CD2 . HIS C  1 66  ? -26.239 -45.077  95.547  1.00 56.99 ? 72   HIS C CD2 1 
ATOM   6934  C CE1 . HIS C  1 66  ? -25.513 -46.792  94.386  1.00 59.05 ? 72   HIS C CE1 1 
ATOM   6935  N NE2 . HIS C  1 66  ? -25.267 -45.529  94.688  1.00 59.92 ? 72   HIS C NE2 1 
ATOM   6936  N N   . SER C  1 67  ? -29.925 -47.491  94.436  1.00 12.73 ? 73   SER C N   1 
ATOM   6937  C CA  . SER C  1 67  ? -29.948 -48.107  93.115  1.00 14.76 ? 73   SER C CA  1 
ATOM   6938  C C   . SER C  1 67  ? -31.233 -47.736  92.377  1.00 10.77 ? 73   SER C C   1 
ATOM   6939  O O   . SER C  1 67  ? -31.248 -47.684  91.154  1.00 10.02 ? 73   SER C O   1 
ATOM   6940  C CB  . SER C  1 67  ? -29.775 -49.633  93.209  1.00 14.42 ? 73   SER C CB  1 
ATOM   6941  O OG  . SER C  1 67  ? -30.846 -50.257  93.899  1.00 16.23 ? 73   SER C OG  1 
ATOM   6942  N N   . LEU C  1 68  ? -32.292 -47.440  93.126  1.00 11.59 ? 74   LEU C N   1 
ATOM   6943  C CA  . LEU C  1 68  ? -33.543 -46.979  92.531  1.00 12.76 ? 74   LEU C CA  1 
ATOM   6944  C C   . LEU C  1 68  ? -33.352 -45.627  91.880  1.00 10.22 ? 74   LEU C C   1 
ATOM   6945  O O   . LEU C  1 68  ? -33.765 -45.407  90.740  1.00 8.70  ? 74   LEU C O   1 
ATOM   6946  C CB  . LEU C  1 68  ? -34.658 -46.893  93.575  1.00 15.01 ? 74   LEU C CB  1 
ATOM   6947  C CG  . LEU C  1 68  ? -36.012 -46.374  93.062  1.00 11.73 ? 74   LEU C CG  1 
ATOM   6948  C CD1 . LEU C  1 68  ? -36.531 -47.217  91.905  1.00 9.13  ? 74   LEU C CD1 1 
ATOM   6949  C CD2 . LEU C  1 68  ? -37.028 -46.367  94.185  1.00 9.80  ? 74   LEU C CD2 1 
ATOM   6950  N N   . ILE C  1 69  ? -32.709 -44.721  92.603  1.00 11.03 ? 75   ILE C N   1 
ATOM   6951  C CA  . ILE C  1 69  ? -32.499 -43.375  92.098  1.00 13.55 ? 75   ILE C CA  1 
ATOM   6952  C C   . ILE C  1 69  ? -31.617 -43.397  90.852  1.00 15.78 ? 75   ILE C C   1 
ATOM   6953  O O   . ILE C  1 69  ? -31.904 -42.712  89.873  1.00 14.42 ? 75   ILE C O   1 
ATOM   6954  C CB  . ILE C  1 69  ? -31.908 -42.489  93.207  1.00 14.88 ? 75   ILE C CB  1 
ATOM   6955  C CG1 . ILE C  1 69  ? -33.032 -42.052  94.150  1.00 9.05  ? 75   ILE C CG1 1 
ATOM   6956  C CG2 . ILE C  1 69  ? -31.194 -41.278  92.630  1.00 15.88 ? 75   ILE C CG2 1 
ATOM   6957  C CD1 . ILE C  1 69  ? -32.543 -41.309  95.386  1.00 10.89 ? 75   ILE C CD1 1 
ATOM   6958  N N   . ARG C  1 70  ? -30.578 -44.230  90.880  1.00 15.40 ? 76   ARG C N   1 
ATOM   6959  C CA  . ARG C  1 70  ? -29.674 -44.433  89.748  1.00 12.74 ? 76   ARG C CA  1 
ATOM   6960  C C   . ARG C  1 70  ? -30.423 -44.916  88.491  1.00 11.26 ? 76   ARG C C   1 
ATOM   6961  O O   . ARG C  1 70  ? -30.217 -44.394  87.399  1.00 11.19 ? 76   ARG C O   1 
ATOM   6962  C CB  . ARG C  1 70  ? -28.589 -45.439  90.150  1.00 8.43  ? 76   ARG C CB  1 
ATOM   6963  C CG  . ARG C  1 70  ? -27.367 -45.548  89.248  1.00 20.90 ? 76   ARG C CG  1 
ATOM   6964  C CD  . ARG C  1 70  ? -26.389 -46.585  89.839  1.00 29.50 ? 76   ARG C CD  1 
ATOM   6965  N NE  . ARG C  1 70  ? -25.022 -46.428  89.343  1.00 41.28 ? 76   ARG C NE  1 
ATOM   6966  C CZ  . ARG C  1 70  ? -23.939 -46.953  89.922  1.00 39.10 ? 76   ARG C CZ  1 
ATOM   6967  N NH1 . ARG C  1 70  ? -24.065 -47.682  91.030  1.00 31.99 ? 76   ARG C NH1 1 
ATOM   6968  N NH2 . ARG C  1 70  ? -22.728 -46.751  89.390  1.00 30.46 ? 76   ARG C NH2 1 
ATOM   6969  N N   . HIS C  1 71  ? -31.288 -45.914  88.662  1.00 10.77 ? 77   HIS C N   1 
ATOM   6970  C CA  . HIS C  1 71  ? -32.150 -46.426  87.584  1.00 9.68  ? 77   HIS C CA  1 
ATOM   6971  C C   . HIS C  1 71  ? -33.030 -45.336  86.976  1.00 9.53  ? 77   HIS C C   1 
ATOM   6972  O O   . HIS C  1 71  ? -33.148 -45.218  85.754  1.00 11.85 ? 77   HIS C O   1 
ATOM   6973  C CB  . HIS C  1 71  ? -33.026 -47.567  88.122  1.00 9.77  ? 77   HIS C CB  1 
ATOM   6974  C CG  . HIS C  1 71  ? -34.065 -48.061  87.160  1.00 6.91  ? 77   HIS C CG  1 
ATOM   6975  N ND1 . HIS C  1 71  ? -33.802 -49.014  86.204  1.00 8.09  ? 77   HIS C ND1 1 
ATOM   6976  C CD2 . HIS C  1 71  ? -35.383 -47.769  87.046  1.00 7.95  ? 77   HIS C CD2 1 
ATOM   6977  C CE1 . HIS C  1 71  ? -34.905 -49.270  85.523  1.00 9.86  ? 77   HIS C CE1 1 
ATOM   6978  N NE2 . HIS C  1 71  ? -35.880 -48.527  86.014  1.00 8.71  ? 77   HIS C NE2 1 
ATOM   6979  N N   . LEU C  1 72  ? -33.642 -44.538  87.833  1.00 9.51  ? 78   LEU C N   1 
ATOM   6980  C CA  . LEU C  1 72  ? -34.523 -43.481  87.381  1.00 10.21 ? 78   LEU C CA  1 
ATOM   6981  C C   . LEU C  1 72  ? -33.741 -42.413  86.632  1.00 14.08 ? 78   LEU C C   1 
ATOM   6982  O O   . LEU C  1 72  ? -34.244 -41.832  85.666  1.00 13.51 ? 78   LEU C O   1 
ATOM   6983  C CB  . LEU C  1 72  ? -35.280 -42.875  88.567  1.00 10.94 ? 78   LEU C CB  1 
ATOM   6984  C CG  . LEU C  1 72  ? -36.225 -43.825  89.319  1.00 9.55  ? 78   LEU C CG  1 
ATOM   6985  C CD1 . LEU C  1 72  ? -36.834 -43.151  90.542  1.00 12.37 ? 78   LEU C CD1 1 
ATOM   6986  C CD2 . LEU C  1 72  ? -37.322 -44.321  88.401  1.00 9.15  ? 78   LEU C CD2 1 
ATOM   6987  N N   . GLN C  1 73  ? -32.507 -42.164  87.069  1.00 13.62 ? 79   GLN C N   1 
ATOM   6988  C CA  . GLN C  1 73  ? -31.652 -41.154  86.442  1.00 15.40 ? 79   GLN C CA  1 
ATOM   6989  C C   . GLN C  1 73  ? -31.248 -41.535  85.020  1.00 11.58 ? 79   GLN C C   1 
ATOM   6990  O O   . GLN C  1 73  ? -31.204 -40.696  84.127  1.00 16.16 ? 79   GLN C O   1 
ATOM   6991  C CB  . GLN C  1 73  ? -30.394 -40.927  87.291  1.00 15.23 ? 79   GLN C CB  1 
ATOM   6992  C CG  . GLN C  1 73  ? -30.585 -39.938  88.435  1.00 27.23 ? 79   GLN C CG  1 
ATOM   6993  C CD  . GLN C  1 73  ? -29.439 -39.975  89.448  1.00 37.26 ? 79   GLN C CD  1 
ATOM   6994  O OE1 . GLN C  1 73  ? -28.393 -40.571  89.199  1.00 45.55 ? 79   GLN C OE1 1 
ATOM   6995  N NE2 . GLN C  1 73  ? -29.634 -39.324  90.584  1.00 40.03 ? 79   GLN C NE2 1 
ATOM   6996  N N   . ARG C  1 74  ? -30.937 -42.809  84.822  1.00 11.26 ? 80   ARG C N   1 
ATOM   6997  C CA  . ARG C  1 74  ? -30.431 -43.290  83.541  1.00 8.84  ? 80   ARG C CA  1 
ATOM   6998  C C   . ARG C  1 74  ? -31.520 -43.783  82.611  1.00 11.24 ? 80   ARG C C   1 
ATOM   6999  O O   . ARG C  1 74  ? -31.377 -43.706  81.399  1.00 12.07 ? 80   ARG C O   1 
ATOM   7000  C CB  . ARG C  1 74  ? -29.435 -44.420  83.757  1.00 10.03 ? 80   ARG C CB  1 
ATOM   7001  C CG  . ARG C  1 74  ? -28.228 -44.025  84.554  1.00 15.68 ? 80   ARG C CG  1 
ATOM   7002  C CD  . ARG C  1 74  ? -27.416 -45.247  84.893  1.00 23.31 ? 80   ARG C CD  1 
ATOM   7003  N NE  . ARG C  1 74  ? -26.185 -44.884  85.576  1.00 31.76 ? 80   ARG C NE  1 
ATOM   7004  C CZ  . ARG C  1 74  ? -25.311 -45.764  86.042  1.00 34.77 ? 80   ARG C CZ  1 
ATOM   7005  N NH1 . ARG C  1 74  ? -25.538 -47.064  85.897  1.00 36.57 ? 80   ARG C NH1 1 
ATOM   7006  N NH2 . ARG C  1 74  ? -24.213 -45.332  86.652  1.00 30.95 ? 80   ARG C NH2 1 
ATOM   7007  N N   . GLY C  1 75  ? -32.593 -44.318  83.179  1.00 8.50  ? 81   GLY C N   1 
ATOM   7008  C CA  . GLY C  1 75  ? -33.676 -44.852  82.375  1.00 8.80  ? 81   GLY C CA  1 
ATOM   7009  C C   . GLY C  1 75  ? -34.757 -43.843  82.021  1.00 10.70 ? 81   GLY C C   1 
ATOM   7010  O O   . GLY C  1 75  ? -35.237 -43.814  80.891  1.00 13.50 ? 81   GLY C O   1 
ATOM   7011  N N   . TRP C  1 76  ? -35.144 -43.010  82.979  1.00 12.32 ? 82   TRP C N   1 
ATOM   7012  C CA  . TRP C  1 76  ? -36.277 -42.112  82.769  1.00 13.10 ? 82   TRP C CA  1 
ATOM   7013  C C   . TRP C  1 76  ? -35.824 -40.657  82.575  1.00 14.46 ? 82   TRP C C   1 
ATOM   7014  O O   . TRP C  1 76  ? -36.267 -39.749  83.277  1.00 15.01 ? 82   TRP C O   1 
ATOM   7015  C CB  . TRP C  1 76  ? -37.263 -42.269  83.928  1.00 9.41  ? 82   TRP C CB  1 
ATOM   7016  C CG  . TRP C  1 76  ? -37.902 -43.628  83.859  1.00 8.27  ? 82   TRP C CG  1 
ATOM   7017  C CD1 . TRP C  1 76  ? -37.421 -44.790  84.384  1.00 12.83 ? 82   TRP C CD1 1 
ATOM   7018  C CD2 . TRP C  1 76  ? -39.099 -43.974  83.158  1.00 5.50  ? 82   TRP C CD2 1 
ATOM   7019  N NE1 . TRP C  1 76  ? -38.261 -45.832  84.085  1.00 9.17  ? 82   TRP C NE1 1 
ATOM   7020  C CE2 . TRP C  1 76  ? -39.292 -45.358  83.317  1.00 7.20  ? 82   TRP C CE2 1 
ATOM   7021  C CE3 . TRP C  1 76  ? -40.027 -43.246  82.413  1.00 8.83  ? 82   TRP C CE3 1 
ATOM   7022  C CZ2 . TRP C  1 76  ? -40.380 -46.025  82.769  1.00 6.43  ? 82   TRP C CZ2 1 
ATOM   7023  C CZ3 . TRP C  1 76  ? -41.116 -43.918  81.864  1.00 11.50 ? 82   TRP C CZ3 1 
ATOM   7024  C CH2 . TRP C  1 76  ? -41.283 -45.286  82.053  1.00 6.69  ? 82   TRP C CH2 1 
ATOM   7025  N N   . ASP C  1 77  ? -34.971 -40.461  81.568  1.00 14.86 ? 83   ASP C N   1 
ATOM   7026  C CA  . ASP C  1 77  ? -34.226 -39.217  81.391  1.00 10.41 ? 83   ASP C CA  1 
ATOM   7027  C C   . ASP C  1 77  ? -34.644 -38.422  80.158  1.00 11.09 ? 83   ASP C C   1 
ATOM   7028  O O   . ASP C  1 77  ? -33.933 -37.513  79.736  1.00 12.26 ? 83   ASP C O   1 
ATOM   7029  C CB  . ASP C  1 77  ? -32.724 -39.523  81.321  1.00 12.73 ? 83   ASP C CB  1 
ATOM   7030  C CG  . ASP C  1 77  ? -32.330 -40.294  80.066  1.00 17.03 ? 83   ASP C CG  1 
ATOM   7031  O OD1 . ASP C  1 77  ? -33.223 -40.800  79.353  1.00 22.33 ? 83   ASP C OD1 1 
ATOM   7032  O OD2 . ASP C  1 77  ? -31.117 -40.408  79.798  1.00 16.44 ? 83   ASP C OD2 1 
ATOM   7033  N N   . PHE C  1 78  ? -35.792 -38.759  79.582  1.00 9.59  ? 84   PHE C N   1 
ATOM   7034  C CA  . PHE C  1 78  ? -36.200 -38.155  78.324  1.00 12.60 ? 84   PHE C CA  1 
ATOM   7035  C C   . PHE C  1 78  ? -37.343 -37.126  78.418  1.00 14.18 ? 84   PHE C C   1 
ATOM   7036  O O   . PHE C  1 78  ? -37.857 -36.692  77.393  1.00 18.06 ? 84   PHE C O   1 
ATOM   7037  C CB  . PHE C  1 78  ? -36.584 -39.261  77.330  1.00 12.08 ? 84   PHE C CB  1 
ATOM   7038  C CG  . PHE C  1 78  ? -37.596 -40.240  77.859  1.00 10.29 ? 84   PHE C CG  1 
ATOM   7039  C CD1 . PHE C  1 78  ? -37.194 -41.376  78.539  1.00 10.53 ? 84   PHE C CD1 1 
ATOM   7040  C CD2 . PHE C  1 78  ? -38.957 -40.024  77.670  1.00 9.96  ? 84   PHE C CD2 1 
ATOM   7041  C CE1 . PHE C  1 78  ? -38.122 -42.279  79.024  1.00 8.63  ? 84   PHE C CE1 1 
ATOM   7042  C CE2 . PHE C  1 78  ? -39.892 -40.923  78.147  1.00 11.13 ? 84   PHE C CE2 1 
ATOM   7043  C CZ  . PHE C  1 78  ? -39.475 -42.054  78.825  1.00 9.87  ? 84   PHE C CZ  1 
ATOM   7044  N N   . PHE C  1 79  ? -37.733 -36.715  79.620  1.00 10.62 ? 85   PHE C N   1 
ATOM   7045  C CA  . PHE C  1 79  ? -38.774 -35.684  79.753  1.00 10.35 ? 85   PHE C CA  1 
ATOM   7046  C C   . PHE C  1 79  ? -38.150 -34.288  79.639  1.00 15.94 ? 85   PHE C C   1 
ATOM   7047  O O   . PHE C  1 79  ? -37.114 -34.027  80.249  1.00 16.66 ? 85   PHE C O   1 
ATOM   7048  C CB  . PHE C  1 79  ? -39.515 -35.806  81.096  1.00 12.33 ? 85   PHE C CB  1 
ATOM   7049  C CG  . PHE C  1 79  ? -40.413 -37.017  81.213  1.00 17.67 ? 85   PHE C CG  1 
ATOM   7050  C CD1 . PHE C  1 79  ? -39.912 -38.302  81.051  1.00 20.95 ? 85   PHE C CD1 1 
ATOM   7051  C CD2 . PHE C  1 79  ? -41.742 -36.871  81.554  1.00 16.52 ? 85   PHE C CD2 1 
ATOM   7052  C CE1 . PHE C  1 79  ? -40.739 -39.404  81.176  1.00 17.89 ? 85   PHE C CE1 1 
ATOM   7053  C CE2 . PHE C  1 79  ? -42.569 -37.968  81.683  1.00 17.52 ? 85   PHE C CE2 1 
ATOM   7054  C CZ  . PHE C  1 79  ? -42.065 -39.234  81.493  1.00 21.21 ? 85   PHE C CZ  1 
ATOM   7055  N N   . ARG C  1 80  ? -38.763 -33.391  78.867  1.00 13.09 ? 86   ARG C N   1 
ATOM   7056  C CA  . ARG C  1 80  ? -38.281 -32.009  78.802  1.00 8.29  ? 86   ARG C CA  1 
ATOM   7057  C C   . ARG C  1 80  ? -39.361 -31.021  79.253  1.00 8.02  ? 86   ARG C C   1 
ATOM   7058  O O   . ARG C  1 80  ? -40.475 -31.035  78.739  1.00 8.32  ? 86   ARG C O   1 
ATOM   7059  C CB  . ARG C  1 80  ? -37.807 -31.657  77.394  1.00 10.54 ? 86   ARG C CB  1 
ATOM   7060  C CG  . ARG C  1 80  ? -36.526 -32.354  76.969  1.00 9.43  ? 86   ARG C CG  1 
ATOM   7061  C CD  . ARG C  1 80  ? -35.327 -31.894  77.769  1.00 11.47 ? 86   ARG C CD  1 
ATOM   7062  N NE  . ARG C  1 80  ? -35.129 -30.451  77.672  1.00 12.73 ? 86   ARG C NE  1 
ATOM   7063  C CZ  . ARG C  1 80  ? -33.964 -29.828  77.859  1.00 16.83 ? 86   ARG C CZ  1 
ATOM   7064  N NH1 . ARG C  1 80  ? -32.865 -30.511  78.147  1.00 17.71 ? 86   ARG C NH1 1 
ATOM   7065  N NH2 . ARG C  1 80  ? -33.891 -28.512  77.731  1.00 17.57 ? 86   ARG C NH2 1 
ATOM   7066  N N   . PRO C  1 81  ? -39.034 -30.167  80.229  1.00 10.85 ? 87   PRO C N   1 
ATOM   7067  C CA  . PRO C  1 81  ? -40.015 -29.230  80.793  1.00 11.45 ? 87   PRO C CA  1 
ATOM   7068  C C   . PRO C  1 81  ? -40.589 -28.200  79.818  1.00 12.93 ? 87   PRO C C   1 
ATOM   7069  O O   . PRO C  1 81  ? -41.724 -27.755  80.010  1.00 14.02 ? 87   PRO C O   1 
ATOM   7070  C CB  . PRO C  1 81  ? -39.220 -28.546  81.903  1.00 13.73 ? 87   PRO C CB  1 
ATOM   7071  C CG  . PRO C  1 81  ? -38.275 -29.614  82.357  1.00 15.23 ? 87   PRO C CG  1 
ATOM   7072  C CD  . PRO C  1 81  ? -37.839 -30.279  81.081  1.00 12.94 ? 87   PRO C CD  1 
ATOM   7073  N N   . GLU C  1 82  ? -39.846 -27.825  78.787  1.00 11.27 ? 88   GLU C N   1 
ATOM   7074  C CA  . GLU C  1 82  ? -40.379 -26.821  77.891  1.00 12.39 ? 88   GLU C CA  1 
ATOM   7075  C C   . GLU C  1 82  ? -41.423 -27.454  76.943  1.00 12.70 ? 88   GLU C C   1 
ATOM   7076  O O   . GLU C  1 82  ? -42.192 -26.735  76.320  1.00 11.63 ? 88   GLU C O   1 
ATOM   7077  C CB  . GLU C  1 82  ? -39.240 -26.102  77.141  1.00 15.06 ? 88   GLU C CB  1 
ATOM   7078  C CG  . GLU C  1 82  ? -38.336 -26.979  76.327  1.00 15.44 ? 88   GLU C CG  1 
ATOM   7079  C CD  . GLU C  1 82  ? -37.081 -27.438  77.054  1.00 14.20 ? 88   GLU C CD  1 
ATOM   7080  O OE1 . GLU C  1 82  ? -37.221 -28.169  78.043  1.00 17.88 ? 88   GLU C OE1 1 
ATOM   7081  O OE2 . GLU C  1 82  ? -35.953 -27.114  76.600  1.00 12.59 ? 88   GLU C OE2 1 
ATOM   7082  N N   . ARG C  1 83  ? -41.493 -28.789  76.887  1.00 10.50 ? 89   ARG C N   1 
ATOM   7083  C CA  . ARG C  1 83  ? -42.613 -29.484  76.228  1.00 11.84 ? 89   ARG C CA  1 
ATOM   7084  C C   . ARG C  1 83  ? -43.726 -29.862  77.223  1.00 13.46 ? 89   ARG C C   1 
ATOM   7085  O O   . ARG C  1 83  ? -44.539 -30.742  76.943  1.00 14.53 ? 89   ARG C O   1 
ATOM   7086  C CB  . ARG C  1 83  ? -42.127 -30.751  75.507  1.00 12.70 ? 89   ARG C CB  1 
ATOM   7087  C CG  . ARG C  1 83  ? -41.054 -30.520  74.464  1.00 14.62 ? 89   ARG C CG  1 
ATOM   7088  C CD  . ARG C  1 83  ? -40.854 -31.741  73.570  1.00 12.67 ? 89   ARG C CD  1 
ATOM   7089  N NE  . ARG C  1 83  ? -40.305 -32.899  74.273  1.00 12.13 ? 89   ARG C NE  1 
ATOM   7090  C CZ  . ARG C  1 83  ? -39.028 -33.262  74.243  1.00 12.93 ? 89   ARG C CZ  1 
ATOM   7091  N NH1 . ARG C  1 83  ? -38.150 -32.550  73.546  1.00 12.17 ? 89   ARG C NH1 1 
ATOM   7092  N NH2 . ARG C  1 83  ? -38.624 -34.337  74.911  1.00 14.70 ? 89   ARG C NH2 1 
ATOM   7093  N N   . ASN C  1 84  ? -43.755 -29.182  78.370  1.00 11.60 ? 90   ASN C N   1 
ATOM   7094  C CA  . ASN C  1 84  ? -44.650 -29.489  79.495  1.00 13.38 ? 90   ASN C CA  1 
ATOM   7095  C C   . ASN C  1 84  ? -44.597 -30.948  79.951  1.00 14.50 ? 90   ASN C C   1 
ATOM   7096  O O   . ASN C  1 84  ? -45.618 -31.616  80.085  1.00 21.69 ? 90   ASN C O   1 
ATOM   7097  C CB  . ASN C  1 84  ? -46.082 -29.092  79.151  1.00 13.68 ? 90   ASN C CB  1 
ATOM   7098  C CG  . ASN C  1 84  ? -46.290 -27.604  79.251  1.00 12.01 ? 90   ASN C CG  1 
ATOM   7099  O OD1 . ASN C  1 84  ? -45.677 -26.949  80.086  1.00 12.07 ? 90   ASN C OD1 1 
ATOM   7100  N ND2 . ASN C  1 84  ? -47.141 -27.060  78.401  1.00 14.94 ? 90   ASN C ND2 1 
ATOM   7101  N N   . GLU C  1 85  ? -43.381 -31.425  80.178  1.00 8.34  ? 91   GLU C N   1 
ATOM   7102  C CA  . GLU C  1 85  ? -43.142 -32.754  80.687  1.00 12.36 ? 91   GLU C CA  1 
ATOM   7103  C C   . GLU C  1 85  ? -42.189 -32.586  81.831  1.00 12.52 ? 91   GLU C C   1 
ATOM   7104  O O   . GLU C  1 85  ? -41.391 -31.666  81.826  1.00 15.42 ? 91   GLU C O   1 
ATOM   7105  C CB  . GLU C  1 85  ? -42.528 -33.665  79.634  1.00 14.56 ? 91   GLU C CB  1 
ATOM   7106  C CG  . GLU C  1 85  ? -43.284 -33.749  78.358  1.00 14.68 ? 91   GLU C CG  1 
ATOM   7107  C CD  . GLU C  1 85  ? -42.384 -34.121  77.215  1.00 22.11 ? 91   GLU C CD  1 
ATOM   7108  O OE1 . GLU C  1 85  ? -41.162 -34.295  77.440  1.00 22.16 ? 91   GLU C OE1 1 
ATOM   7109  O OE2 . GLU C  1 85  ? -42.893 -34.217  76.081  1.00 24.68 ? 91   GLU C OE2 1 
ATOM   7110  N N   . SER C  1 86  ? -42.238 -33.467  82.813  1.00 12.36 ? 92   SER C N   1 
ATOM   7111  C CA  . SER C  1 86  ? -41.281 -33.360  83.901  1.00 12.37 ? 92   SER C CA  1 
ATOM   7112  C C   . SER C  1 86  ? -41.171 -34.672  84.636  1.00 7.71  ? 92   SER C C   1 
ATOM   7113  O O   . SER C  1 86  ? -42.148 -35.397  84.772  1.00 8.51  ? 92   SER C O   1 
ATOM   7114  C CB  . SER C  1 86  ? -41.671 -32.242  84.874  1.00 11.29 ? 92   SER C CB  1 
ATOM   7115  O OG  . SER C  1 86  ? -43.002 -32.386  85.315  1.00 12.57 ? 92   SER C OG  1 
ATOM   7116  N N   . PHE C  1 87  ? -39.966 -34.966  85.098  1.00 8.85  ? 93   PHE C N   1 
ATOM   7117  C CA  . PHE C  1 87  ? -39.720 -36.151  85.896  1.00 14.00 ? 93   PHE C CA  1 
ATOM   7118  C C   . PHE C  1 87  ? -38.891 -35.719  87.097  1.00 12.96 ? 93   PHE C C   1 
ATOM   7119  O O   . PHE C  1 87  ? -37.727 -35.365  86.957  1.00 12.42 ? 93   PHE C O   1 
ATOM   7120  C CB  . PHE C  1 87  ? -39.010 -37.233  85.066  1.00 16.15 ? 93   PHE C CB  1 
ATOM   7121  C CG  . PHE C  1 87  ? -39.091 -38.614  85.662  1.00 14.75 ? 93   PHE C CG  1 
ATOM   7122  C CD1 . PHE C  1 87  ? -38.253 -38.987  86.715  1.00 13.76 ? 93   PHE C CD1 1 
ATOM   7123  C CD2 . PHE C  1 87  ? -39.979 -39.549  85.151  1.00 11.88 ? 93   PHE C CD2 1 
ATOM   7124  C CE1 . PHE C  1 87  ? -38.315 -40.257  87.265  1.00 11.05 ? 93   PHE C CE1 1 
ATOM   7125  C CE2 . PHE C  1 87  ? -40.049 -40.828  85.701  1.00 15.77 ? 93   PHE C CE2 1 
ATOM   7126  C CZ  . PHE C  1 87  ? -39.215 -41.178  86.761  1.00 12.25 ? 93   PHE C CZ  1 
ATOM   7127  N N   . ASP C  1 88  ? -39.514 -35.704  88.269  1.00 11.45 ? 94   ASP C N   1 
ATOM   7128  C CA  . ASP C  1 88  ? -38.840 -35.286  89.492  1.00 11.91 ? 94   ASP C CA  1 
ATOM   7129  C C   . ASP C  1 88  ? -38.562 -36.469  90.391  1.00 13.66 ? 94   ASP C C   1 
ATOM   7130  O O   . ASP C  1 88  ? -39.472 -37.212  90.750  1.00 17.18 ? 94   ASP C O   1 
ATOM   7131  C CB  . ASP C  1 88  ? -39.670 -34.251  90.252  1.00 11.04 ? 94   ASP C CB  1 
ATOM   7132  C CG  . ASP C  1 88  ? -39.774 -32.926  89.511  1.00 16.43 ? 94   ASP C CG  1 
ATOM   7133  O OD1 . ASP C  1 88  ? -38.759 -32.200  89.444  1.00 18.38 ? 94   ASP C OD1 1 
ATOM   7134  O OD2 . ASP C  1 88  ? -40.871 -32.612  89.003  1.00 22.14 ? 94   ASP C OD2 1 
ATOM   7135  N N   . ILE C  1 89  ? -37.296 -36.641  90.743  1.00 14.87 ? 95   ILE C N   1 
ATOM   7136  C CA  . ILE C  1 89  ? -36.907 -37.651  91.711  1.00 14.87 ? 95   ILE C CA  1 
ATOM   7137  C C   . ILE C  1 89  ? -36.809 -36.953  93.064  1.00 19.91 ? 95   ILE C C   1 
ATOM   7138  O O   . ILE C  1 89  ? -36.042 -36.003  93.228  1.00 18.01 ? 95   ILE C O   1 
ATOM   7139  C CB  . ILE C  1 89  ? -35.583 -38.322  91.315  1.00 15.39 ? 95   ILE C CB  1 
ATOM   7140  C CG1 . ILE C  1 89  ? -35.715 -38.904  89.900  1.00 16.00 ? 95   ILE C CG1 1 
ATOM   7141  C CG2 . ILE C  1 89  ? -35.202 -39.382  92.335  1.00 14.49 ? 95   ILE C CG2 1 
ATOM   7142  C CD1 . ILE C  1 89  ? -34.426 -39.421  89.295  1.00 16.16 ? 95   ILE C CD1 1 
ATOM   7143  N N   . LEU C  1 90  ? -37.614 -37.401  94.022  1.00 19.84 ? 96   LEU C N   1 
ATOM   7144  C CA  . LEU C  1 90  ? -37.767 -36.689  95.286  1.00 16.30 ? 96   LEU C CA  1 
ATOM   7145  C C   . LEU C  1 90  ? -37.379 -37.555  96.468  1.00 16.59 ? 96   LEU C C   1 
ATOM   7146  O O   . LEU C  1 90  ? -38.241 -38.111  97.147  1.00 15.37 ? 96   LEU C O   1 
ATOM   7147  C CB  . LEU C  1 90  ? -39.202 -36.206  95.437  1.00 17.72 ? 96   LEU C CB  1 
ATOM   7148  C CG  . LEU C  1 90  ? -39.656 -35.436  94.200  1.00 17.95 ? 96   LEU C CG  1 
ATOM   7149  C CD1 . LEU C  1 90  ? -41.164 -35.388  94.106  1.00 14.39 ? 96   LEU C CD1 1 
ATOM   7150  C CD2 . LEU C  1 90  ? -39.052 -34.040  94.226  1.00 21.89 ? 96   LEU C CD2 1 
ATOM   7151  N N   . PRO C  1 91  ? -36.071 -37.675  96.714  1.00 20.45 ? 97   PRO C N   1 
ATOM   7152  C CA  . PRO C  1 91  ? -35.570 -38.537  97.781  1.00 21.19 ? 97   PRO C CA  1 
ATOM   7153  C C   . PRO C  1 91  ? -35.927 -37.955  99.121  1.00 28.40 ? 97   PRO C C   1 
ATOM   7154  O O   . PRO C  1 91  ? -36.043 -36.734  99.246  1.00 27.72 ? 97   PRO C O   1 
ATOM   7155  C CB  . PRO C  1 91  ? -34.049 -38.531  97.575  1.00 21.28 ? 97   PRO C CB  1 
ATOM   7156  C CG  . PRO C  1 91  ? -33.812 -37.815  96.308  1.00 22.35 ? 97   PRO C CG  1 
ATOM   7157  C CD  . PRO C  1 91  ? -34.984 -36.916  96.090  1.00 18.62 ? 97   PRO C CD  1 
ATOM   7158  N N   . ALA C  1 92  ? -36.074 -38.821  100.117 1.00 32.29 ? 98   ALA C N   1 
ATOM   7159  C CA  . ALA C  1 92  ? -36.496 -38.411  101.443 1.00 34.27 ? 98   ALA C CA  1 
ATOM   7160  C C   . ALA C  1 92  ? -35.527 -37.435  102.093 1.00 40.57 ? 98   ALA C C   1 
ATOM   7161  O O   . ALA C  1 92  ? -35.756 -37.007  103.209 1.00 52.09 ? 98   ALA C O   1 
ATOM   7162  C CB  . ALA C  1 92  ? -36.671 -39.635  102.331 1.00 31.78 ? 98   ALA C CB  1 
ATOM   7163  N N   . SER C  1 93  ? -34.454 -37.078  101.403 1.00 39.74 ? 99   SER C N   1 
ATOM   7164  C CA  . SER C  1 93  ? -33.406 -36.291  102.022 1.00 45.02 ? 99   SER C CA  1 
ATOM   7165  C C   . SER C  1 93  ? -32.678 -35.356  101.066 1.00 54.48 ? 99   SER C C   1 
ATOM   7166  O O   . SER C  1 93  ? -31.518 -35.599  100.753 1.00 61.32 ? 99   SER C O   1 
ATOM   7167  C CB  . SER C  1 93  ? -32.389 -37.229  102.668 1.00 43.90 ? 99   SER C CB  1 
ATOM   7168  N N   . GLN C  1 94  ? -33.350 -34.293  100.624 1.00 57.34 ? 100  GLN C N   1 
ATOM   7169  C CA  . GLN C  1 94  ? -32.739 -33.245  99.795  1.00 56.99 ? 100  GLN C CA  1 
ATOM   7170  C C   . GLN C  1 94  ? -31.856 -33.787  98.677  1.00 63.39 ? 100  GLN C C   1 
ATOM   7171  O O   . GLN C  1 94  ? -30.631 -33.835  98.815  1.00 67.84 ? 100  GLN C O   1 
ATOM   7172  C CB  . GLN C  1 94  ? -31.915 -32.290  100.662 1.00 55.69 ? 100  GLN C CB  1 
ATOM   7173  N N   . GLU C  1 98  ? -30.706 -39.289  105.840 1.00 78.66 ? 104  GLU C N   1 
ATOM   7174  C CA  . GLU C  1 98  ? -30.025 -38.718  106.999 1.00 78.97 ? 104  GLU C CA  1 
ATOM   7175  C C   . GLU C  1 98  ? -31.005 -38.369  108.115 1.00 76.79 ? 104  GLU C C   1 
ATOM   7176  O O   . GLU C  1 98  ? -31.277 -39.190  108.995 1.00 74.20 ? 104  GLU C O   1 
ATOM   7177  C CB  . GLU C  1 98  ? -29.230 -37.471  106.597 1.00 79.67 ? 104  GLU C CB  1 
ATOM   7178  N N   . THR C  1 99  ? -31.530 -37.145  108.069 1.00 78.11 ? 105  THR C N   1 
ATOM   7179  C CA  . THR C  1 99  ? -32.449 -36.650  109.094 1.00 76.27 ? 105  THR C CA  1 
ATOM   7180  C C   . THR C  1 99  ? -33.886 -36.637  108.594 1.00 69.07 ? 105  THR C C   1 
ATOM   7181  O O   . THR C  1 99  ? -34.796 -37.133  109.255 1.00 68.49 ? 105  THR C O   1 
ATOM   7182  C CB  . THR C  1 99  ? -32.075 -35.226  109.555 1.00 75.90 ? 105  THR C CB  1 
ATOM   7183  N N   . GLN C  1 100 ? -34.088 -36.054  107.421 1.00 61.43 ? 106  GLN C N   1 
ATOM   7184  C CA  . GLN C  1 100 ? -35.402 -36.065  106.824 1.00 56.72 ? 106  GLN C CA  1 
ATOM   7185  C C   . GLN C  1 100 ? -35.681 -37.492  106.373 1.00 44.95 ? 106  GLN C C   1 
ATOM   7186  O O   . GLN C  1 100 ? -34.946 -38.078  105.574 1.00 42.02 ? 106  GLN C O   1 
ATOM   7187  C CB  . GLN C  1 100 ? -35.503 -35.079  105.651 1.00 63.69 ? 106  GLN C CB  1 
ATOM   7188  C CG  . GLN C  1 100 ? -36.936 -34.609  105.345 1.00 66.21 ? 106  GLN C CG  1 
ATOM   7189  C CD  . GLN C  1 100 ? -37.260 -34.547  103.859 1.00 66.51 ? 106  GLN C CD  1 
ATOM   7190  O OE1 . GLN C  1 100 ? -36.565 -33.894  103.080 1.00 65.82 ? 106  GLN C OE1 1 
ATOM   7191  N NE2 . GLN C  1 100 ? -38.326 -35.232  103.462 1.00 67.12 ? 106  GLN C NE2 1 
ATOM   7192  N N   . TRP C  1 101 ? -36.709 -38.077  106.958 1.00 39.90 ? 107  TRP C N   1 
ATOM   7193  C CA  . TRP C  1 101 ? -37.356 -39.224  106.367 1.00 37.12 ? 107  TRP C CA  1 
ATOM   7194  C C   . TRP C  1 101 ? -38.796 -38.796  106.272 1.00 34.99 ? 107  TRP C C   1 
ATOM   7195  O O   . TRP C  1 101 ? -39.260 -38.000  107.091 1.00 34.35 ? 107  TRP C O   1 
ATOM   7196  C CB  . TRP C  1 101 ? -37.179 -40.484  107.204 1.00 42.83 ? 107  TRP C CB  1 
ATOM   7197  C CG  . TRP C  1 101 ? -35.764 -40.954  107.230 1.00 52.87 ? 107  TRP C CG  1 
ATOM   7198  C CD1 . TRP C  1 101 ? -34.899 -40.890  108.284 1.00 56.29 ? 107  TRP C CD1 1 
ATOM   7199  C CD2 . TRP C  1 101 ? -35.031 -41.542  106.144 1.00 57.51 ? 107  TRP C CD2 1 
ATOM   7200  N NE1 . TRP C  1 101 ? -33.678 -41.408  107.925 1.00 58.63 ? 107  TRP C NE1 1 
ATOM   7201  C CE2 . TRP C  1 101 ? -33.733 -41.815  106.617 1.00 59.86 ? 107  TRP C CE2 1 
ATOM   7202  C CE3 . TRP C  1 101 ? -35.349 -41.866  104.821 1.00 56.57 ? 107  TRP C CE3 1 
ATOM   7203  C CZ2 . TRP C  1 101 ? -32.750 -42.396  105.811 1.00 60.12 ? 107  TRP C CZ2 1 
ATOM   7204  C CZ3 . TRP C  1 101 ? -34.376 -42.444  104.026 1.00 56.94 ? 107  TRP C CZ3 1 
ATOM   7205  C CH2 . TRP C  1 101 ? -33.092 -42.701  104.522 1.00 58.55 ? 107  TRP C CH2 1 
ATOM   7206  N N   . TYR C  1 102 ? -39.489 -39.247  105.239 1.00 27.89 ? 108  TYR C N   1 
ATOM   7207  C CA  . TYR C  1 102 ? -40.903 -38.961  105.145 1.00 23.26 ? 108  TYR C CA  1 
ATOM   7208  C C   . TYR C  1 102 ? -41.574 -39.665  106.316 1.00 23.88 ? 108  TYR C C   1 
ATOM   7209  O O   . TYR C  1 102 ? -41.141 -40.744  106.718 1.00 20.30 ? 108  TYR C O   1 
ATOM   7210  C CB  . TYR C  1 102 ? -41.461 -39.419  103.803 1.00 18.81 ? 108  TYR C CB  1 
ATOM   7211  C CG  . TYR C  1 102 ? -40.919 -38.637  102.616 1.00 20.78 ? 108  TYR C CG  1 
ATOM   7212  C CD1 . TYR C  1 102 ? -40.927 -37.244  102.611 1.00 20.77 ? 108  TYR C CD1 1 
ATOM   7213  C CD2 . TYR C  1 102 ? -40.401 -39.293  101.502 1.00 20.02 ? 108  TYR C CD2 1 
ATOM   7214  C CE1 . TYR C  1 102 ? -40.437 -36.524  101.519 1.00 22.18 ? 108  TYR C CE1 1 
ATOM   7215  C CE2 . TYR C  1 102 ? -39.910 -38.581  100.401 1.00 20.49 ? 108  TYR C CE2 1 
ATOM   7216  C CZ  . TYR C  1 102 ? -39.932 -37.199  100.416 1.00 18.32 ? 108  TYR C CZ  1 
ATOM   7217  O OH  . TYR C  1 102 ? -39.455 -36.483  99.340  1.00 16.53 ? 108  TYR C OH  1 
ATOM   7218  N N   . GLU C  1 103 ? -42.596 -39.034  106.887 1.00 27.09 ? 109  GLU C N   1 
ATOM   7219  C CA  . GLU C  1 103 ? -43.291 -39.593  108.039 1.00 27.36 ? 109  GLU C CA  1 
ATOM   7220  C C   . GLU C  1 103 ? -44.330 -40.602  107.597 1.00 24.27 ? 109  GLU C C   1 
ATOM   7221  O O   . GLU C  1 103 ? -44.822 -41.406  108.394 1.00 25.56 ? 109  GLU C O   1 
ATOM   7222  C CB  . GLU C  1 103 ? -43.945 -38.488  108.871 1.00 34.19 ? 109  GLU C CB  1 
ATOM   7223  C CG  . GLU C  1 103 ? -42.979 -37.786  109.805 1.00 48.32 ? 109  GLU C CG  1 
ATOM   7224  C CD  . GLU C  1 103 ? -43.678 -36.868  110.787 1.00 65.25 ? 109  GLU C CD  1 
ATOM   7225  O OE1 . GLU C  1 103 ? -44.873 -37.107  111.083 1.00 70.16 ? 109  GLU C OE1 1 
ATOM   7226  O OE2 . GLU C  1 103 ? -43.028 -35.914  111.270 1.00 71.92 ? 109  GLU C OE2 1 
ATOM   7227  N N   . GLY C  1 104 ? -44.651 -40.556  106.313 1.00 21.30 ? 110  GLY C N   1 
ATOM   7228  C CA  . GLY C  1 104 ? -45.577 -41.491  105.711 1.00 18.61 ? 110  GLY C CA  1 
ATOM   7229  C C   . GLY C  1 104 ? -45.822 -41.098  104.267 1.00 21.50 ? 110  GLY C C   1 
ATOM   7230  O O   . GLY C  1 104 ? -45.257 -40.124  103.776 1.00 21.39 ? 110  GLY C O   1 
ATOM   7231  N N   . THR C  1 105 ? -46.677 -41.846  103.585 1.00 23.36 ? 111  THR C N   1 
ATOM   7232  C CA  . THR C  1 105 ? -46.940 -41.598  102.173 1.00 25.37 ? 111  THR C CA  1 
ATOM   7233  C C   . THR C  1 105 ? -47.601 -40.246  101.959 1.00 23.42 ? 111  THR C C   1 
ATOM   7234  O O   . THR C  1 105 ? -47.475 -39.653  100.896 1.00 22.22 ? 111  THR C O   1 
ATOM   7235  C CB  . THR C  1 105 ? -47.834 -42.688  101.568 1.00 22.00 ? 111  THR C CB  1 
ATOM   7236  O OG1 . THR C  1 105 ? -49.002 -42.842  102.381 1.00 20.44 ? 111  THR C OG1 1 
ATOM   7237  C CG2 . THR C  1 105 ? -47.081 -44.011  101.493 1.00 20.53 ? 111  THR C CG2 1 
ATOM   7238  N N   . ALA C  1 106 ? -48.311 -39.760  102.967 1.00 24.15 ? 112  ALA C N   1 
ATOM   7239  C CA  . ALA C  1 106 ? -48.932 -38.449  102.863 1.00 20.90 ? 112  ALA C CA  1 
ATOM   7240  C C   . ALA C  1 106 ? -47.889 -37.351  103.071 1.00 23.11 ? 112  ALA C C   1 
ATOM   7241  O O   . ALA C  1 106 ? -47.931 -36.325  102.411 1.00 27.07 ? 112  ALA C O   1 
ATOM   7242  C CB  . ALA C  1 106 ? -50.061 -38.313  103.859 1.00 18.37 ? 112  ALA C CB  1 
ATOM   7243  N N   . ASP C  1 107 ? -46.943 -37.567  103.975 1.00 18.49 ? 113  ASP C N   1 
ATOM   7244  C CA  . ASP C  1 107 ? -45.873 -36.600  104.157 1.00 16.74 ? 113  ASP C CA  1 
ATOM   7245  C C   . ASP C  1 107 ? -45.015 -36.522  102.889 1.00 23.12 ? 113  ASP C C   1 
ATOM   7246  O O   . ASP C  1 107 ? -44.384 -35.503  102.624 1.00 25.72 ? 113  ASP C O   1 
ATOM   7247  C CB  . ASP C  1 107 ? -45.008 -36.964  105.363 1.00 17.32 ? 113  ASP C CB  1 
ATOM   7248  C CG  . ASP C  1 107 ? -44.060 -35.845  105.765 1.00 23.82 ? 113  ASP C CG  1 
ATOM   7249  O OD1 . ASP C  1 107 ? -44.450 -34.663  105.679 1.00 28.47 ? 113  ASP C OD1 1 
ATOM   7250  O OD2 . ASP C  1 107 ? -42.923 -36.146  106.180 1.00 30.24 ? 113  ASP C OD2 1 
ATOM   7251  N N   . ALA C  1 108 ? -45.001 -37.599  102.107 1.00 20.56 ? 114  ALA C N   1 
ATOM   7252  C CA  . ALA C  1 108 ? -44.192 -37.653  100.892 1.00 25.72 ? 114  ALA C CA  1 
ATOM   7253  C C   . ALA C  1 108 ? -44.667 -36.636  99.869  1.00 24.38 ? 114  ALA C C   1 
ATOM   7254  O O   . ALA C  1 108 ? -43.890 -36.139  99.064  1.00 25.84 ? 114  ALA C O   1 
ATOM   7255  C CB  . ALA C  1 108 ? -44.225 -39.045  100.289 1.00 28.67 ? 114  ALA C CB  1 
ATOM   7256  N N   . VAL C  1 109 ? -45.957 -36.339  99.887  1.00 21.74 ? 115  VAL C N   1 
ATOM   7257  C CA  . VAL C  1 109 ? -46.496 -35.332  98.993  1.00 18.30 ? 115  VAL C CA  1 
ATOM   7258  C C   . VAL C  1 109 ? -46.353 -33.956  99.653  1.00 17.34 ? 115  VAL C C   1 
ATOM   7259  O O   . VAL C  1 109 ? -45.795 -33.028  99.064  1.00 15.79 ? 115  VAL C O   1 
ATOM   7260  C CB  . VAL C  1 109 ? -47.969 -35.645  98.626  1.00 14.83 ? 115  VAL C CB  1 
ATOM   7261  C CG1 . VAL C  1 109 ? -48.565 -34.561  97.767  1.00 15.67 ? 115  VAL C CG1 1 
ATOM   7262  C CG2 . VAL C  1 109 ? -48.072 -36.985  97.930  1.00 14.02 ? 115  VAL C CG2 1 
ATOM   7263  N N   . TYR C  1 110 ? -46.804 -33.851  100.901 1.00 21.42 ? 116  TYR C N   1 
ATOM   7264  C CA  . TYR C  1 110 ? -46.811 -32.586  101.621 1.00 20.93 ? 116  TYR C CA  1 
ATOM   7265  C C   . TYR C  1 110 ? -45.454 -31.881  101.590 1.00 23.79 ? 116  TYR C C   1 
ATOM   7266  O O   . TYR C  1 110 ? -45.385 -30.673  101.371 1.00 22.92 ? 116  TYR C O   1 
ATOM   7267  C CB  . TYR C  1 110 ? -47.256 -32.817  103.066 1.00 19.40 ? 116  TYR C CB  1 
ATOM   7268  C CG  . TYR C  1 110 ? -47.100 -31.611  103.951 1.00 19.53 ? 116  TYR C CG  1 
ATOM   7269  C CD1 . TYR C  1 110 ? -48.090 -30.642  104.009 1.00 23.44 ? 116  TYR C CD1 1 
ATOM   7270  C CD2 . TYR C  1 110 ? -45.964 -31.444  104.737 1.00 20.11 ? 116  TYR C CD2 1 
ATOM   7271  C CE1 . TYR C  1 110 ? -47.952 -29.525  104.815 1.00 27.86 ? 116  TYR C CE1 1 
ATOM   7272  C CE2 . TYR C  1 110 ? -45.813 -30.332  105.542 1.00 27.56 ? 116  TYR C CE2 1 
ATOM   7273  C CZ  . TYR C  1 110 ? -46.814 -29.375  105.579 1.00 31.47 ? 116  TYR C CZ  1 
ATOM   7274  O OH  . TYR C  1 110 ? -46.676 -28.264  106.382 1.00 33.62 ? 116  TYR C OH  1 
ATOM   7275  N N   . GLN C  1 111 ? -44.379 -32.634  101.797 1.00 14.15 ? 117  GLN C N   1 
ATOM   7276  C CA  . GLN C  1 111 ? -43.040 -32.061  101.766 1.00 14.64 ? 117  GLN C CA  1 
ATOM   7277  C C   . GLN C  1 111 ? -42.663 -31.532  100.388 1.00 18.35 ? 117  GLN C C   1 
ATOM   7278  O O   . GLN C  1 111 ? -41.721 -30.767  100.253 1.00 23.87 ? 117  GLN C O   1 
ATOM   7279  C CB  . GLN C  1 111 ? -42.002 -33.092  102.214 1.00 15.77 ? 117  GLN C CB  1 
ATOM   7280  C CG  . GLN C  1 111 ? -42.180 -33.575  103.653 1.00 17.41 ? 117  GLN C CG  1 
ATOM   7281  C CD  . GLN C  1 111 ? -41.863 -32.497  104.675 1.00 25.95 ? 117  GLN C CD  1 
ATOM   7282  O OE1 . GLN C  1 111 ? -41.093 -31.574  104.402 1.00 29.38 ? 117  GLN C OE1 1 
ATOM   7283  N NE2 . GLN C  1 111 ? -42.456 -32.608  105.861 1.00 27.79 ? 117  GLN C NE2 1 
ATOM   7284  N N   . ASN C  1 112 ? -43.395 -31.931  99.361  1.00 19.44 ? 118  ASN C N   1 
ATOM   7285  C CA  . ASN C  1 112 ? -43.000 -31.582  98.003  1.00 17.90 ? 118  ASN C CA  1 
ATOM   7286  C C   . ASN C  1 112 ? -44.026 -30.730  97.276  1.00 20.96 ? 118  ASN C C   1 
ATOM   7287  O O   . ASN C  1 112 ? -43.996 -30.618  96.052  1.00 22.37 ? 118  ASN C O   1 
ATOM   7288  C CB  . ASN C  1 112 ? -42.717 -32.852  97.212  1.00 17.41 ? 118  ASN C CB  1 
ATOM   7289  C CG  . ASN C  1 112 ? -41.451 -33.529  97.663  1.00 18.19 ? 118  ASN C CG  1 
ATOM   7290  O OD1 . ASN C  1 112 ? -40.383 -32.915  97.672  1.00 19.27 ? 118  ASN C OD1 1 
ATOM   7291  N ND2 . ASN C  1 112 ? -41.559 -34.791  98.073  1.00 19.44 ? 118  ASN C ND2 1 
ATOM   7292  N N   . ILE C  1 113 ? -44.923 -30.123  98.042  1.00 23.21 ? 119  ILE C N   1 
ATOM   7293  C CA  . ILE C  1 113 ? -45.901 -29.191  97.505  1.00 19.91 ? 119  ILE C CA  1 
ATOM   7294  C C   . ILE C  1 113 ? -45.219 -28.141  96.634  1.00 21.68 ? 119  ILE C C   1 
ATOM   7295  O O   . ILE C  1 113 ? -45.721 -27.778  95.576  1.00 22.43 ? 119  ILE C O   1 
ATOM   7296  C CB  . ILE C  1 113 ? -46.682 -28.516  98.646  1.00 21.37 ? 119  ILE C CB  1 
ATOM   7297  C CG1 . ILE C  1 113 ? -47.672 -29.515  99.261  1.00 20.81 ? 119  ILE C CG1 1 
ATOM   7298  C CG2 . ILE C  1 113 ? -47.404 -27.278  98.150  1.00 21.10 ? 119  ILE C CG2 1 
ATOM   7299  C CD1 . ILE C  1 113 ? -48.398 -29.002  100.503 1.00 21.18 ? 119  ILE C CD1 1 
ATOM   7300  N N   . ASP C  1 114 ? -44.047 -27.682  97.051  1.00 20.63 ? 120  ASP C N   1 
ATOM   7301  C CA  . ASP C  1 114 ? -43.376 -26.632  96.301  1.00 23.64 ? 120  ASP C CA  1 
ATOM   7302  C C   . ASP C  1 114 ? -42.728 -27.164  95.022  1.00 20.80 ? 120  ASP C C   1 
ATOM   7303  O O   . ASP C  1 114 ? -42.111 -26.413  94.278  1.00 23.24 ? 120  ASP C O   1 
ATOM   7304  C CB  . ASP C  1 114 ? -42.335 -25.928  97.174  1.00 31.07 ? 120  ASP C CB  1 
ATOM   7305  C CG  . ASP C  1 114 ? -41.292 -26.874  97.730  1.00 36.18 ? 120  ASP C CG  1 
ATOM   7306  O OD1 . ASP C  1 114 ? -41.546 -28.094  97.764  1.00 40.29 ? 120  ASP C OD1 1 
ATOM   7307  O OD2 . ASP C  1 114 ? -40.211 -26.392  98.137  1.00 37.58 ? 120  ASP C OD2 1 
ATOM   7308  N N   . ILE C  1 115 ? -42.864 -28.460  94.774  1.00 17.32 ? 121  ILE C N   1 
ATOM   7309  C CA  . ILE C  1 115 ? -42.467 -29.038  93.495  1.00 17.16 ? 121  ILE C CA  1 
ATOM   7310  C C   . ILE C  1 115 ? -43.698 -29.141  92.606  1.00 22.37 ? 121  ILE C C   1 
ATOM   7311  O O   . ILE C  1 115 ? -43.639 -28.919  91.399  1.00 23.43 ? 121  ILE C O   1 
ATOM   7312  C CB  . ILE C  1 115 ? -41.824 -30.433  93.662  1.00 19.90 ? 121  ILE C CB  1 
ATOM   7313  C CG1 . ILE C  1 115 ? -40.498 -30.321  94.406  1.00 25.01 ? 121  ILE C CG1 1 
ATOM   7314  C CG2 . ILE C  1 115 ? -41.574 -31.084  92.312  1.00 19.74 ? 121  ILE C CG2 1 
ATOM   7315  C CD1 . ILE C  1 115 ? -39.429 -29.633  93.599  1.00 29.47 ? 121  ILE C CD1 1 
ATOM   7316  N N   . ILE C  1 116 ? -44.823 -29.463  93.231  1.00 21.09 ? 122  ILE C N   1 
ATOM   7317  C CA  . ILE C  1 116 ? -46.080 -29.669  92.529  1.00 20.68 ? 122  ILE C CA  1 
ATOM   7318  C C   . ILE C  1 116 ? -46.798 -28.383  92.137  1.00 20.76 ? 122  ILE C C   1 
ATOM   7319  O O   . ILE C  1 116 ? -47.230 -28.240  91.008  1.00 21.01 ? 122  ILE C O   1 
ATOM   7320  C CB  . ILE C  1 116 ? -47.048 -30.504  93.387  1.00 22.34 ? 122  ILE C CB  1 
ATOM   7321  C CG1 . ILE C  1 116 ? -46.382 -31.815  93.819  1.00 19.79 ? 122  ILE C CG1 1 
ATOM   7322  C CG2 . ILE C  1 116 ? -48.357 -30.746  92.635  1.00 22.30 ? 122  ILE C CG2 1 
ATOM   7323  C CD1 . ILE C  1 116 ? -47.110 -32.532  94.941  1.00 21.17 ? 122  ILE C CD1 1 
ATOM   7324  N N   . GLU C  1 117 ? -46.948 -27.449  93.065  1.00 22.20 ? 123  GLU C N   1 
ATOM   7325  C CA  . GLU C  1 117 ? -47.794 -26.291  92.789  1.00 29.64 ? 123  GLU C CA  1 
ATOM   7326  C C   . GLU C  1 117 ? -47.279 -25.398  91.649  1.00 32.71 ? 123  GLU C C   1 
ATOM   7327  O O   . GLU C  1 117 ? -48.088 -24.870  90.887  1.00 35.10 ? 123  GLU C O   1 
ATOM   7328  C CB  . GLU C  1 117 ? -48.007 -25.476  94.069  1.00 36.69 ? 123  GLU C CB  1 
ATOM   7329  C CG  . GLU C  1 117 ? -49.104 -26.075  94.966  1.00 39.81 ? 123  GLU C CG  1 
ATOM   7330  C CD  . GLU C  1 117 ? -49.406 -25.241  96.205  1.00 42.53 ? 123  GLU C CD  1 
ATOM   7331  O OE1 . GLU C  1 117 ? -48.591 -24.361  96.561  1.00 44.99 ? 123  GLU C OE1 1 
ATOM   7332  O OE2 . GLU C  1 117 ? -50.464 -25.472  96.831  1.00 43.92 ? 123  GLU C OE2 1 
ATOM   7333  N N   . PRO C  1 118 ? -45.948 -25.228  91.512  1.00 31.99 ? 124  PRO C N   1 
ATOM   7334  C CA  . PRO C  1 118 ? -45.439 -24.548  90.312  1.00 24.84 ? 124  PRO C CA  1 
ATOM   7335  C C   . PRO C  1 118 ? -45.941 -25.107  88.980  1.00 20.96 ? 124  PRO C C   1 
ATOM   7336  O O   . PRO C  1 118 ? -46.144 -24.332  88.049  1.00 21.62 ? 124  PRO C O   1 
ATOM   7337  C CB  . PRO C  1 118 ? -43.931 -24.739  90.435  1.00 27.80 ? 124  PRO C CB  1 
ATOM   7338  C CG  . PRO C  1 118 ? -43.698 -24.674  91.896  1.00 30.17 ? 124  PRO C CG  1 
ATOM   7339  C CD  . PRO C  1 118 ? -44.898 -25.327  92.546  1.00 34.74 ? 124  PRO C CD  1 
ATOM   7340  N N   . TYR C  1 119 ? -46.138 -26.417  88.883  1.00 20.70 ? 125  TYR C N   1 
ATOM   7341  C CA  . TYR C  1 119 ? -46.674 -27.016  87.662  1.00 17.87 ? 125  TYR C CA  1 
ATOM   7342  C C   . TYR C  1 119 ? -48.187 -26.820  87.563  1.00 22.78 ? 125  TYR C C   1 
ATOM   7343  O O   . TYR C  1 119 ? -48.770 -26.943  86.481  1.00 24.99 ? 125  TYR C O   1 
ATOM   7344  C CB  . TYR C  1 119 ? -46.374 -28.512  87.598  1.00 17.59 ? 125  TYR C CB  1 
ATOM   7345  C CG  . TYR C  1 119 ? -44.919 -28.934  87.625  1.00 17.92 ? 125  TYR C CG  1 
ATOM   7346  C CD1 . TYR C  1 119 ? -43.988 -28.396  86.747  1.00 14.70 ? 125  TYR C CD1 1 
ATOM   7347  C CD2 . TYR C  1 119 ? -44.497 -29.918  88.508  1.00 17.78 ? 125  TYR C CD2 1 
ATOM   7348  C CE1 . TYR C  1 119 ? -42.662 -28.814  86.775  1.00 19.24 ? 125  TYR C CE1 1 
ATOM   7349  C CE2 . TYR C  1 119 ? -43.193 -30.337  88.543  1.00 19.74 ? 125  TYR C CE2 1 
ATOM   7350  C CZ  . TYR C  1 119 ? -42.277 -29.788  87.683  1.00 21.81 ? 125  TYR C CZ  1 
ATOM   7351  O OH  . TYR C  1 119 ? -40.978 -30.234  87.747  1.00 22.57 ? 125  TYR C OH  1 
ATOM   7352  N N   . ALA C  1 120 ? -48.802 -26.541  88.708  1.00 20.75 ? 126  ALA C N   1 
ATOM   7353  C CA  . ALA C  1 120 ? -50.245 -26.398  88.848  1.00 22.36 ? 126  ALA C CA  1 
ATOM   7354  C C   . ALA C  1 120 ? -51.044 -27.428  88.061  1.00 20.46 ? 126  ALA C C   1 
ATOM   7355  O O   . ALA C  1 120 ? -51.887 -27.055  87.261  1.00 19.27 ? 126  ALA C O   1 
ATOM   7356  C CB  . ALA C  1 120 ? -50.670 -25.006  88.436  1.00 24.15 ? 126  ALA C CB  1 
ATOM   7357  N N   . PRO C  1 121 ? -50.786 -28.728  88.281  1.00 18.87 ? 127  PRO C N   1 
ATOM   7358  C CA  . PRO C  1 121 ? -51.652 -29.677  87.582  1.00 16.86 ? 127  PRO C CA  1 
ATOM   7359  C C   . PRO C  1 121 ? -53.047 -29.614  88.165  1.00 17.22 ? 127  PRO C C   1 
ATOM   7360  O O   . PRO C  1 121 ? -53.185 -29.255  89.331  1.00 19.47 ? 127  PRO C O   1 
ATOM   7361  C CB  . PRO C  1 121 ? -50.999 -31.026  87.865  1.00 15.70 ? 127  PRO C CB  1 
ATOM   7362  C CG  . PRO C  1 121 ? -50.387 -30.846  89.213  1.00 14.64 ? 127  PRO C CG  1 
ATOM   7363  C CD  . PRO C  1 121 ? -49.897 -29.405  89.238  1.00 16.62 ? 127  PRO C CD  1 
ATOM   7364  N N   . GLU C  1 122 ? -54.058 -29.947  87.372  1.00 14.19 ? 128  GLU C N   1 
ATOM   7365  C CA  . GLU C  1 122 ? -55.428 -29.986  87.864  1.00 13.30 ? 128  GLU C CA  1 
ATOM   7366  C C   . GLU C  1 122 ? -55.695 -31.264  88.666  1.00 18.60 ? 128  GLU C C   1 
ATOM   7367  O O   . GLU C  1 122 ? -56.454 -31.253  89.636  1.00 17.87 ? 128  GLU C O   1 
ATOM   7368  C CB  . GLU C  1 122 ? -56.407 -29.879  86.697  1.00 17.71 ? 128  GLU C CB  1 
ATOM   7369  C CG  . GLU C  1 122 ? -57.881 -29.841  87.098  1.00 29.22 ? 128  GLU C CG  1 
ATOM   7370  C CD  . GLU C  1 122 ? -58.312 -28.516  87.723  1.00 30.94 ? 128  GLU C CD  1 
ATOM   7371  O OE1 . GLU C  1 122 ? -57.466 -27.598  87.873  1.00 30.58 ? 128  GLU C OE1 1 
ATOM   7372  O OE2 . GLU C  1 122 ? -59.510 -28.398  88.065  1.00 27.13 ? 128  GLU C OE2 1 
ATOM   7373  N N   . TYR C  1 123 ? -55.054 -32.358  88.265  1.00 20.32 ? 129  TYR C N   1 
ATOM   7374  C CA  . TYR C  1 123 ? -55.280 -33.660  88.888  1.00 20.76 ? 129  TYR C CA  1 
ATOM   7375  C C   . TYR C  1 123 ? -53.988 -34.258  89.424  1.00 21.11 ? 129  TYR C C   1 
ATOM   7376  O O   . TYR C  1 123 ? -52.918 -34.092  88.828  1.00 16.62 ? 129  TYR C O   1 
ATOM   7377  C CB  . TYR C  1 123 ? -55.934 -34.618  87.881  1.00 14.49 ? 129  TYR C CB  1 
ATOM   7378  C CG  . TYR C  1 123 ? -57.090 -33.971  87.157  1.00 20.07 ? 129  TYR C CG  1 
ATOM   7379  C CD1 . TYR C  1 123 ? -58.286 -33.704  87.820  1.00 19.30 ? 129  TYR C CD1 1 
ATOM   7380  C CD2 . TYR C  1 123 ? -56.979 -33.591  85.821  1.00 22.10 ? 129  TYR C CD2 1 
ATOM   7381  C CE1 . TYR C  1 123 ? -59.345 -33.090  87.167  1.00 20.19 ? 129  TYR C CE1 1 
ATOM   7382  C CE2 . TYR C  1 123 ? -58.031 -32.971  85.160  1.00 23.20 ? 129  TYR C CE2 1 
ATOM   7383  C CZ  . TYR C  1 123 ? -59.213 -32.727  85.838  1.00 24.51 ? 129  TYR C CZ  1 
ATOM   7384  O OH  . TYR C  1 123 ? -60.262 -32.120  85.183  1.00 26.77 ? 129  TYR C OH  1 
ATOM   7385  N N   . MET C  1 124 ? -54.092 -34.933  90.564  1.00 18.59 ? 130  MET C N   1 
ATOM   7386  C CA  . MET C  1 124 ? -53.002 -35.758  91.062  1.00 14.70 ? 130  MET C CA  1 
ATOM   7387  C C   . MET C  1 124 ? -53.430 -37.214  90.954  1.00 18.71 ? 130  MET C C   1 
ATOM   7388  O O   . MET C  1 124 ? -54.570 -37.550  91.264  1.00 20.37 ? 130  MET C O   1 
ATOM   7389  C CB  . MET C  1 124 ? -52.654 -35.420  92.510  1.00 17.96 ? 130  MET C CB  1 
ATOM   7390  C CG  . MET C  1 124 ? -52.148 -34.008  92.751  1.00 22.30 ? 130  MET C CG  1 
ATOM   7391  S SD  . MET C  1 124 ? -50.429 -33.771  92.267  1.00 29.32 ? 130  MET C SD  1 
ATOM   7392  C CE  . MET C  1 124 ? -49.618 -35.098  93.143  1.00 22.83 ? 130  MET C CE  1 
ATOM   7393  N N   . VAL C  1 125 ? -52.521 -38.068  90.494  1.00 18.55 ? 131  VAL C N   1 
ATOM   7394  C CA  . VAL C  1 125 ? -52.726 -39.511  90.508  1.00 16.44 ? 131  VAL C CA  1 
ATOM   7395  C C   . VAL C  1 125 ? -51.650 -40.134  91.392  1.00 16.49 ? 131  VAL C C   1 
ATOM   7396  O O   . VAL C  1 125 ? -50.474 -40.197  91.001  1.00 14.24 ? 131  VAL C O   1 
ATOM   7397  C CB  . VAL C  1 125 ? -52.669 -40.113  89.085  1.00 17.35 ? 131  VAL C CB  1 
ATOM   7398  C CG1 . VAL C  1 125 ? -53.048 -41.578  89.104  1.00 16.11 ? 131  VAL C CG1 1 
ATOM   7399  C CG2 . VAL C  1 125 ? -53.578 -39.347  88.145  1.00 16.10 ? 131  VAL C CG2 1 
ATOM   7400  N N   . ILE C  1 126 ? -52.049 -40.572  92.588  1.00 11.94 ? 132  ILE C N   1 
ATOM   7401  C CA  . ILE C  1 126 ? -51.119 -41.170  93.541  1.00 13.03 ? 132  ILE C CA  1 
ATOM   7402  C C   . ILE C  1 126 ? -50.988 -42.667  93.278  1.00 17.58 ? 132  ILE C C   1 
ATOM   7403  O O   . ILE C  1 126 ? -51.987 -43.371  93.245  1.00 18.02 ? 132  ILE C O   1 
ATOM   7404  C CB  . ILE C  1 126 ? -51.569 -40.942  94.997  1.00 14.82 ? 132  ILE C CB  1 
ATOM   7405  C CG1 . ILE C  1 126 ? -51.860 -39.466  95.247  1.00 16.58 ? 132  ILE C CG1 1 
ATOM   7406  C CG2 . ILE C  1 126 ? -50.507 -41.435  95.958  1.00 16.13 ? 132  ILE C CG2 1 
ATOM   7407  C CD1 . ILE C  1 126 ? -50.713 -38.539  94.883  1.00 15.09 ? 132  ILE C CD1 1 
ATOM   7408  N N   . LEU C  1 127 ? -49.761 -43.147  93.080  1.00 14.26 ? 133  LEU C N   1 
ATOM   7409  C CA  . LEU C  1 127 ? -49.536 -44.541  92.704  1.00 14.02 ? 133  LEU C CA  1 
ATOM   7410  C C   . LEU C  1 127 ? -48.561 -45.224  93.641  1.00 13.08 ? 133  LEU C C   1 
ATOM   7411  O O   . LEU C  1 127 ? -47.584 -44.617  94.062  1.00 14.60 ? 133  LEU C O   1 
ATOM   7412  C CB  . LEU C  1 127 ? -48.992 -44.638  91.275  1.00 14.35 ? 133  LEU C CB  1 
ATOM   7413  C CG  . LEU C  1 127 ? -49.827 -44.113  90.114  1.00 17.13 ? 133  LEU C CG  1 
ATOM   7414  C CD1 . LEU C  1 127 ? -49.045 -44.233  88.812  1.00 15.22 ? 133  LEU C CD1 1 
ATOM   7415  C CD2 . LEU C  1 127 ? -51.129 -44.889  90.035  1.00 17.82 ? 133  LEU C CD2 1 
ATOM   7416  N N   . ALA C  1 128 ? -48.825 -46.486  93.969  1.00 13.34 ? 134  ALA C N   1 
ATOM   7417  C CA  . ALA C  1 128 ? -47.823 -47.305  94.643  1.00 14.80 ? 134  ALA C CA  1 
ATOM   7418  C C   . ALA C  1 128 ? -46.824 -47.750  93.580  1.00 14.60 ? 134  ALA C C   1 
ATOM   7419  O O   . ALA C  1 128 ? -47.233 -48.144  92.496  1.00 17.02 ? 134  ALA C O   1 
ATOM   7420  C CB  . ALA C  1 128 ? -48.475 -48.502  95.340  1.00 15.26 ? 134  ALA C CB  1 
ATOM   7421  N N   . GLY C  1 129 ? -45.525 -47.669  93.864  1.00 11.66 ? 135  GLY C N   1 
ATOM   7422  C CA  . GLY C  1 129 ? -44.524 -48.055  92.882  1.00 14.42 ? 135  GLY C CA  1 
ATOM   7423  C C   . GLY C  1 129 ? -43.965 -49.466  93.036  1.00 15.51 ? 135  GLY C C   1 
ATOM   7424  O O   . GLY C  1 129 ? -42.894 -49.765  92.520  1.00 16.37 ? 135  GLY C O   1 
ATOM   7425  N N   . ASP C  1 130 ? -44.684 -50.346  93.727  1.00 14.66 ? 136  ASP C N   1 
ATOM   7426  C CA  . ASP C  1 130 ? -44.156 -51.681  93.980  1.00 12.46 ? 136  ASP C CA  1 
ATOM   7427  C C   . ASP C  1 130 ? -45.066 -52.827  93.541  1.00 12.17 ? 136  ASP C C   1 
ATOM   7428  O O   . ASP C  1 130 ? -44.889 -53.955  94.002  1.00 14.56 ? 136  ASP C O   1 
ATOM   7429  C CB  . ASP C  1 130 ? -43.831 -51.839  95.473  1.00 16.82 ? 136  ASP C CB  1 
ATOM   7430  C CG  . ASP C  1 130 ? -45.073 -51.800  96.353  1.00 24.63 ? 136  ASP C CG  1 
ATOM   7431  O OD1 . ASP C  1 130 ? -46.001 -51.020  96.043  1.00 27.82 ? 136  ASP C OD1 1 
ATOM   7432  O OD2 . ASP C  1 130 ? -45.128 -52.557  97.352  1.00 20.54 ? 136  ASP C OD2 1 
ATOM   7433  N N   . HIS C  1 131 ? -46.017 -52.550  92.648  1.00 12.78 ? 137  HIS C N   1 
ATOM   7434  C CA  . HIS C  1 131 ? -46.882 -53.590  92.074  1.00 10.62 ? 137  HIS C CA  1 
ATOM   7435  C C   . HIS C  1 131 ? -46.602 -53.744  90.582  1.00 12.81 ? 137  HIS C C   1 
ATOM   7436  O O   . HIS C  1 131 ? -46.147 -52.812  89.933  1.00 12.56 ? 137  HIS C O   1 
ATOM   7437  C CB  . HIS C  1 131 ? -48.369 -53.266  92.286  1.00 12.13 ? 137  HIS C CB  1 
ATOM   7438  C CG  . HIS C  1 131 ? -48.760 -53.088  93.723  1.00 14.37 ? 137  HIS C CG  1 
ATOM   7439  N ND1 . HIS C  1 131 ? -49.724 -52.188  94.123  1.00 17.29 ? 137  HIS C ND1 1 
ATOM   7440  C CD2 . HIS C  1 131 ? -48.315 -53.688  94.853  1.00 16.50 ? 137  HIS C CD2 1 
ATOM   7441  C CE1 . HIS C  1 131 ? -49.854 -52.240  95.438  1.00 24.29 ? 137  HIS C CE1 1 
ATOM   7442  N NE2 . HIS C  1 131 ? -49.011 -53.144  95.905  1.00 21.38 ? 137  HIS C NE2 1 
ATOM   7443  N N   . ILE C  1 132 ? -46.874 -54.924  90.044  1.00 12.04 ? 138  ILE C N   1 
ATOM   7444  C CA  . ILE C  1 132 ? -46.696 -55.194  88.623  1.00 11.77 ? 138  ILE C CA  1 
ATOM   7445  C C   . ILE C  1 132 ? -48.056 -55.302  87.944  1.00 12.83 ? 138  ILE C C   1 
ATOM   7446  O O   . ILE C  1 132 ? -48.802 -56.226  88.228  1.00 15.67 ? 138  ILE C O   1 
ATOM   7447  C CB  . ILE C  1 132 ? -45.897 -56.489  88.402  1.00 12.19 ? 138  ILE C CB  1 
ATOM   7448  C CG1 . ILE C  1 132 ? -44.536 -56.379  89.088  1.00 13.54 ? 138  ILE C CG1 1 
ATOM   7449  C CG2 . ILE C  1 132 ? -45.720 -56.765  86.914  1.00 11.26 ? 138  ILE C CG2 1 
ATOM   7450  C CD1 . ILE C  1 132 ? -43.858 -57.701  89.320  1.00 13.63 ? 138  ILE C CD1 1 
ATOM   7451  N N   . TYR C  1 133 ? -48.380 -54.356  87.064  1.00 8.93  ? 139  TYR C N   1 
ATOM   7452  C CA  . TYR C  1 133 ? -49.712 -54.293  86.453  1.00 10.77 ? 139  TYR C CA  1 
ATOM   7453  C C   . TYR C  1 133 ? -49.749 -53.289  85.309  1.00 13.00 ? 139  TYR C C   1 
ATOM   7454  O O   . TYR C  1 133 ? -48.930 -52.381  85.264  1.00 14.24 ? 139  TYR C O   1 
ATOM   7455  C CB  . TYR C  1 133 ? -50.778 -53.913  87.495  1.00 12.33 ? 139  TYR C CB  1 
ATOM   7456  C CG  . TYR C  1 133 ? -50.687 -52.473  87.959  1.00 13.06 ? 139  TYR C CG  1 
ATOM   7457  C CD1 . TYR C  1 133 ? -49.709 -52.076  88.870  1.00 15.32 ? 139  TYR C CD1 1 
ATOM   7458  C CD2 . TYR C  1 133 ? -51.568 -51.508  87.484  1.00 11.97 ? 139  TYR C CD2 1 
ATOM   7459  C CE1 . TYR C  1 133 ? -49.612 -50.758  89.288  1.00 11.87 ? 139  TYR C CE1 1 
ATOM   7460  C CE2 . TYR C  1 133 ? -51.480 -50.199  87.900  1.00 9.44  ? 139  TYR C CE2 1 
ATOM   7461  C CZ  . TYR C  1 133 ? -50.503 -49.827  88.797  1.00 10.89 ? 139  TYR C CZ  1 
ATOM   7462  O OH  . TYR C  1 133 ? -50.415 -48.522  89.214  1.00 13.81 ? 139  TYR C OH  1 
ATOM   7463  N N   . LYS C  1 134 ? -50.707 -53.449  84.396  1.00 9.64  ? 140  LYS C N   1 
ATOM   7464  C CA  . LYS C  1 134 ? -50.940 -52.474  83.339  1.00 11.07 ? 140  LYS C CA  1 
ATOM   7465  C C   . LYS C  1 134 ? -52.355 -51.890  83.441  1.00 13.94 ? 140  LYS C C   1 
ATOM   7466  O O   . LYS C  1 134 ? -53.337 -52.618  83.600  1.00 14.39 ? 140  LYS C O   1 
ATOM   7467  C CB  . LYS C  1 134 ? -50.708 -53.111  81.973  1.00 9.85  ? 140  LYS C CB  1 
ATOM   7468  C CG  . LYS C  1 134 ? -49.306 -53.647  81.809  1.00 11.28 ? 140  LYS C CG  1 
ATOM   7469  C CD  . LYS C  1 134 ? -49.096 -54.255  80.459  1.00 15.24 ? 140  LYS C CD  1 
ATOM   7470  C CE  . LYS C  1 134 ? -49.697 -55.627  80.416  1.00 25.66 ? 140  LYS C CE  1 
ATOM   7471  N NZ  . LYS C  1 134 ? -49.257 -56.364  79.211  1.00 28.65 ? 140  LYS C NZ  1 
ATOM   7472  N N   . MET C  1 135 ? -52.445 -50.570  83.361  1.00 12.08 ? 141  MET C N   1 
ATOM   7473  C CA  . MET C  1 135 ? -53.700 -49.857  83.591  1.00 12.72 ? 141  MET C CA  1 
ATOM   7474  C C   . MET C  1 135 ? -53.665 -48.489  82.909  1.00 16.58 ? 141  MET C C   1 
ATOM   7475  O O   . MET C  1 135 ? -52.633 -47.809  82.928  1.00 15.52 ? 141  MET C O   1 
ATOM   7476  C CB  . MET C  1 135 ? -53.931 -49.710  85.095  1.00 14.71 ? 141  MET C CB  1 
ATOM   7477  C CG  . MET C  1 135 ? -55.191 -48.991  85.534  1.00 14.82 ? 141  MET C CG  1 
ATOM   7478  S SD  . MET C  1 135 ? -55.196 -48.946  87.341  1.00 19.34 ? 141  MET C SD  1 
ATOM   7479  C CE  . MET C  1 135 ? -56.591 -47.878  87.681  1.00 21.29 ? 141  MET C CE  1 
ATOM   7480  N N   . ASP C  1 136 ? -54.788 -48.093  82.315  1.00 13.19 ? 142  ASP C N   1 
ATOM   7481  C CA  . ASP C  1 136 ? -54.927 -46.815  81.622  1.00 15.03 ? 142  ASP C CA  1 
ATOM   7482  C C   . ASP C  1 136 ? -55.588 -45.801  82.547  1.00 17.36 ? 142  ASP C C   1 
ATOM   7483  O O   . ASP C  1 136 ? -56.793 -45.852  82.759  1.00 22.39 ? 142  ASP C O   1 
ATOM   7484  C CB  . ASP C  1 136 ? -55.754 -47.017  80.351  1.00 15.69 ? 142  ASP C CB  1 
ATOM   7485  C CG  . ASP C  1 136 ? -55.841 -45.781  79.487  1.00 18.28 ? 142  ASP C CG  1 
ATOM   7486  O OD1 . ASP C  1 136 ? -55.480 -44.673  79.941  1.00 15.29 ? 142  ASP C OD1 1 
ATOM   7487  O OD2 . ASP C  1 136 ? -56.299 -45.924  78.332  1.00 18.87 ? 142  ASP C OD2 1 
ATOM   7488  N N   . TYR C  1 137 ? -54.816 -44.869  83.091  1.00 16.07 ? 143  TYR C N   1 
ATOM   7489  C CA  . TYR C  1 137 ? -55.344 -44.009  84.149  1.00 15.71 ? 143  TYR C CA  1 
ATOM   7490  C C   . TYR C  1 137 ? -56.368 -42.968  83.669  1.00 14.41 ? 143  TYR C C   1 
ATOM   7491  O O   . TYR C  1 137 ? -56.988 -42.291  84.486  1.00 14.69 ? 143  TYR C O   1 
ATOM   7492  C CB  . TYR C  1 137 ? -54.196 -43.297  84.872  1.00 17.24 ? 143  TYR C CB  1 
ATOM   7493  C CG  . TYR C  1 137 ? -53.175 -44.232  85.483  1.00 18.21 ? 143  TYR C CG  1 
ATOM   7494  C CD1 . TYR C  1 137 ? -53.542 -45.198  86.419  1.00 14.52 ? 143  TYR C CD1 1 
ATOM   7495  C CD2 . TYR C  1 137 ? -51.828 -44.137  85.131  1.00 16.96 ? 143  TYR C CD2 1 
ATOM   7496  C CE1 . TYR C  1 137 ? -52.585 -46.056  86.983  1.00 17.22 ? 143  TYR C CE1 1 
ATOM   7497  C CE2 . TYR C  1 137 ? -50.877 -44.976  85.686  1.00 14.65 ? 143  TYR C CE2 1 
ATOM   7498  C CZ  . TYR C  1 137 ? -51.252 -45.938  86.605  1.00 13.34 ? 143  TYR C CZ  1 
ATOM   7499  O OH  . TYR C  1 137 ? -50.281 -46.769  87.139  1.00 12.41 ? 143  TYR C OH  1 
ATOM   7500  N N   . GLU C  1 138 ? -56.544 -42.829  82.360  1.00 12.21 ? 144  GLU C N   1 
ATOM   7501  C CA  . GLU C  1 138 ? -57.497 -41.843  81.847  1.00 17.14 ? 144  GLU C CA  1 
ATOM   7502  C C   . GLU C  1 138 ? -58.906 -42.244  82.278  1.00 18.02 ? 144  GLU C C   1 
ATOM   7503  O O   . GLU C  1 138 ? -59.750 -41.392  82.566  1.00 18.07 ? 144  GLU C O   1 
ATOM   7504  C CB  . GLU C  1 138 ? -57.410 -41.709  80.321  1.00 18.25 ? 144  GLU C CB  1 
ATOM   7505  C CG  . GLU C  1 138 ? -58.488 -40.784  79.715  1.00 21.76 ? 144  GLU C CG  1 
ATOM   7506  C CD  . GLU C  1 138 ? -58.107 -39.298  79.704  1.00 19.76 ? 144  GLU C CD  1 
ATOM   7507  O OE1 . GLU C  1 138 ? -56.922 -38.965  79.876  1.00 18.13 ? 144  GLU C OE1 1 
ATOM   7508  O OE2 . GLU C  1 138 ? -59.002 -38.452  79.532  1.00 16.06 ? 144  GLU C OE2 1 
ATOM   7509  N N   . TYR C  1 139 ? -59.142 -43.550  82.361  1.00 14.46 ? 145  TYR C N   1 
ATOM   7510  C CA  . TYR C  1 139 ? -60.440 -44.047  82.780  1.00 13.93 ? 145  TYR C CA  1 
ATOM   7511  C C   . TYR C  1 139 ? -60.766 -43.614  84.197  1.00 16.02 ? 145  TYR C C   1 
ATOM   7512  O O   . TYR C  1 139 ? -61.897 -43.233  84.499  1.00 16.40 ? 145  TYR C O   1 
ATOM   7513  C CB  . TYR C  1 139 ? -60.488 -45.565  82.655  1.00 17.21 ? 145  TYR C CB  1 
ATOM   7514  C CG  . TYR C  1 139 ? -60.631 -46.010  81.223  1.00 21.50 ? 145  TYR C CG  1 
ATOM   7515  C CD1 . TYR C  1 139 ? -61.883 -46.209  80.663  1.00 27.49 ? 145  TYR C CD1 1 
ATOM   7516  C CD2 . TYR C  1 139 ? -59.521 -46.201  80.423  1.00 20.32 ? 145  TYR C CD2 1 
ATOM   7517  C CE1 . TYR C  1 139 ? -62.020 -46.606  79.347  1.00 28.23 ? 145  TYR C CE1 1 
ATOM   7518  C CE2 . TYR C  1 139 ? -59.647 -46.596  79.110  1.00 22.00 ? 145  TYR C CE2 1 
ATOM   7519  C CZ  . TYR C  1 139 ? -60.899 -46.795  78.576  1.00 25.03 ? 145  TYR C CZ  1 
ATOM   7520  O OH  . TYR C  1 139 ? -61.027 -47.182  77.266  1.00 23.10 ? 145  TYR C OH  1 
ATOM   7521  N N   . MET C  1 140 ? -59.762 -43.645  85.060  1.00 16.11 ? 146  MET C N   1 
ATOM   7522  C CA  . MET C  1 140 ? -59.964 -43.290  86.453  1.00 16.43 ? 146  MET C CA  1 
ATOM   7523  C C   . MET C  1 140 ? -60.157 -41.785  86.627  1.00 15.73 ? 146  MET C C   1 
ATOM   7524  O O   . MET C  1 140 ? -60.955 -41.350  87.457  1.00 17.82 ? 146  MET C O   1 
ATOM   7525  C CB  . MET C  1 140 ? -58.788 -43.778  87.286  1.00 20.00 ? 146  MET C CB  1 
ATOM   7526  C CG  . MET C  1 140 ? -59.058 -43.829  88.759  1.00 25.88 ? 146  MET C CG  1 
ATOM   7527  S SD  . MET C  1 140 ? -57.752 -44.722  89.624  1.00 26.01 ? 146  MET C SD  1 
ATOM   7528  C CE  . MET C  1 140 ? -58.139 -44.314  91.311  1.00 22.36 ? 146  MET C CE  1 
ATOM   7529  N N   . LEU C  1 141 ? -59.411 -41.003  85.851  1.00 13.96 ? 147  LEU C N   1 
ATOM   7530  C CA  . LEU C  1 141 ? -59.550 -39.549  85.817  1.00 14.27 ? 147  LEU C CA  1 
ATOM   7531  C C   . LEU C  1 141 ? -60.961 -39.144  85.425  1.00 16.65 ? 147  LEU C C   1 
ATOM   7532  O O   . LEU C  1 141 ? -61.603 -38.349  86.108  1.00 17.48 ? 147  LEU C O   1 
ATOM   7533  C CB  . LEU C  1 141 ? -58.546 -38.936  84.831  1.00 14.54 ? 147  LEU C CB  1 
ATOM   7534  C CG  . LEU C  1 141 ? -57.089 -38.990  85.275  1.00 12.12 ? 147  LEU C CG  1 
ATOM   7535  C CD1 . LEU C  1 141 ? -56.163 -38.571  84.149  1.00 11.22 ? 147  LEU C CD1 1 
ATOM   7536  C CD2 . LEU C  1 141 ? -56.916 -38.103  86.480  1.00 12.64 ? 147  LEU C CD2 1 
ATOM   7537  N N   . GLN C  1 142 ? -61.438 -39.691  84.315  1.00 14.52 ? 148  GLN C N   1 
ATOM   7538  C CA  . GLN C  1 142 ? -62.780 -39.369  83.856  1.00 17.06 ? 148  GLN C CA  1 
ATOM   7539  C C   . GLN C  1 142 ? -63.819 -39.684  84.922  1.00 21.87 ? 148  GLN C C   1 
ATOM   7540  O O   . GLN C  1 142 ? -64.666 -38.845  85.221  1.00 25.91 ? 148  GLN C O   1 
ATOM   7541  C CB  . GLN C  1 142 ? -63.104 -40.122  82.571  1.00 19.89 ? 148  GLN C CB  1 
ATOM   7542  C CG  . GLN C  1 142 ? -62.389 -39.589  81.353  1.00 24.31 ? 148  GLN C CG  1 
ATOM   7543  C CD  . GLN C  1 142 ? -62.991 -38.302  80.813  1.00 36.33 ? 148  GLN C CD  1 
ATOM   7544  O OE1 . GLN C  1 142 ? -63.947 -37.755  81.369  1.00 42.85 ? 148  GLN C OE1 1 
ATOM   7545  N NE2 . GLN C  1 142 ? -62.430 -37.812  79.717  1.00 42.40 ? 148  GLN C NE2 1 
ATOM   7546  N N   . GLN C  1 143 ? -63.745 -40.879  85.507  1.00 17.97 ? 149  GLN C N   1 
ATOM   7547  C CA  . GLN C  1 143 ? -64.702 -41.272  86.536  1.00 17.53 ? 149  GLN C CA  1 
ATOM   7548  C C   . GLN C  1 143 ? -64.675 -40.287  87.695  1.00 20.08 ? 149  GLN C C   1 
ATOM   7549  O O   . GLN C  1 143 ? -65.717 -39.930  88.249  1.00 22.51 ? 149  GLN C O   1 
ATOM   7550  C CB  . GLN C  1 143 ? -64.423 -42.683  87.053  1.00 15.24 ? 149  GLN C CB  1 
ATOM   7551  C CG  . GLN C  1 143 ? -65.344 -43.063  88.212  1.00 17.30 ? 149  GLN C CG  1 
ATOM   7552  C CD  . GLN C  1 143 ? -64.992 -44.389  88.849  1.00 21.68 ? 149  GLN C CD  1 
ATOM   7553  O OE1 . GLN C  1 143 ? -64.433 -45.276  88.200  1.00 27.52 ? 149  GLN C OE1 1 
ATOM   7554  N NE2 . GLN C  1 143 ? -65.313 -44.531  90.134  1.00 22.20 ? 149  GLN C NE2 1 
ATOM   7555  N N   . HIS C  1 144 ? -63.475 -39.840  88.049  1.00 17.90 ? 150  HIS C N   1 
ATOM   7556  C CA  . HIS C  1 144 ? -63.316 -38.894  89.147  1.00 18.26 ? 150  HIS C CA  1 
ATOM   7557  C C   . HIS C  1 144 ? -64.059 -37.576  88.868  1.00 21.35 ? 150  HIS C C   1 
ATOM   7558  O O   . HIS C  1 144 ? -64.805 -37.077  89.723  1.00 21.62 ? 150  HIS C O   1 
ATOM   7559  C CB  . HIS C  1 144 ? -61.828 -38.639  89.405  1.00 15.49 ? 150  HIS C CB  1 
ATOM   7560  C CG  . HIS C  1 144 ? -61.555 -37.773  90.593  1.00 13.75 ? 150  HIS C CG  1 
ATOM   7561  N ND1 . HIS C  1 144 ? -61.730 -38.207  91.889  1.00 16.93 ? 150  HIS C ND1 1 
ATOM   7562  C CD2 . HIS C  1 144 ? -61.104 -36.498  90.680  1.00 17.03 ? 150  HIS C CD2 1 
ATOM   7563  C CE1 . HIS C  1 144 ? -61.410 -37.234  92.723  1.00 20.82 ? 150  HIS C CE1 1 
ATOM   7564  N NE2 . HIS C  1 144 ? -61.025 -36.186  92.015  1.00 19.66 ? 150  HIS C NE2 1 
ATOM   7565  N N   . VAL C  1 145 ? -63.873 -37.018  87.673  1.00 25.06 ? 151  VAL C N   1 
ATOM   7566  C CA  . VAL C  1 145 ? -64.505 -35.743  87.368  1.00 27.84 ? 151  VAL C CA  1 
ATOM   7567  C C   . VAL C  1 145 ? -66.003 -35.946  87.187  1.00 27.48 ? 151  VAL C C   1 
ATOM   7568  O O   . VAL C  1 145 ? -66.784 -35.099  87.600  1.00 35.33 ? 151  VAL C O   1 
ATOM   7569  C CB  . VAL C  1 145 ? -63.894 -35.036  86.114  1.00 27.01 ? 151  VAL C CB  1 
ATOM   7570  C CG1 . VAL C  1 145 ? -62.385 -34.903  86.255  1.00 21.85 ? 151  VAL C CG1 1 
ATOM   7571  C CG2 . VAL C  1 145 ? -64.254 -35.746  84.822  1.00 34.99 ? 151  VAL C CG2 1 
ATOM   7572  N N   . ASP C  1 146 ? -66.413 -37.070  86.609  1.00 23.89 ? 152  ASP C N   1 
ATOM   7573  C CA  . ASP C  1 146 ? -67.841 -37.329  86.433  1.00 24.14 ? 152  ASP C CA  1 
ATOM   7574  C C   . ASP C  1 146 ? -68.536 -37.547  87.774  1.00 28.60 ? 152  ASP C C   1 
ATOM   7575  O O   . ASP C  1 146 ? -69.641 -37.061  87.993  1.00 27.48 ? 152  ASP C O   1 
ATOM   7576  C CB  . ASP C  1 146 ? -68.085 -38.546  85.539  1.00 27.14 ? 152  ASP C CB  1 
ATOM   7577  C CG  . ASP C  1 146 ? -67.680 -38.308  84.103  1.00 36.27 ? 152  ASP C CG  1 
ATOM   7578  O OD1 . ASP C  1 146 ? -67.434 -37.138  83.739  1.00 42.15 ? 152  ASP C OD1 1 
ATOM   7579  O OD2 . ASP C  1 146 ? -67.614 -39.295  83.334  1.00 36.38 ? 152  ASP C OD2 1 
ATOM   7580  N N   . SER C  1 147 ? -67.889 -38.279  88.671  1.00 25.75 ? 153  SER C N   1 
ATOM   7581  C CA  . SER C  1 147 ? -68.537 -38.681  89.918  1.00 27.50 ? 153  SER C CA  1 
ATOM   7582  C C   . SER C  1 147 ? -68.622 -37.541  90.925  1.00 28.92 ? 153  SER C C   1 
ATOM   7583  O O   . SER C  1 147 ? -69.388 -37.615  91.887  1.00 28.54 ? 153  SER C O   1 
ATOM   7584  C CB  . SER C  1 147 ? -67.795 -39.861  90.547  1.00 24.30 ? 153  SER C CB  1 
ATOM   7585  O OG  . SER C  1 147 ? -66.611 -39.423  91.188  1.00 25.29 ? 153  SER C OG  1 
ATOM   7586  N N   . GLY C  1 148 ? -67.832 -36.494  90.703  1.00 22.67 ? 154  GLY C N   1 
ATOM   7587  C CA  . GLY C  1 148 ? -67.730 -35.397  91.646  1.00 22.97 ? 154  GLY C CA  1 
ATOM   7588  C C   . GLY C  1 148 ? -67.083 -35.753  92.979  1.00 26.82 ? 154  GLY C C   1 
ATOM   7589  O O   . GLY C  1 148 ? -67.174 -34.991  93.944  1.00 28.12 ? 154  GLY C O   1 
ATOM   7590  N N   . ALA C  1 149 ? -66.411 -36.898  93.036  1.00 24.11 ? 155  ALA C N   1 
ATOM   7591  C CA  . ALA C  1 149 ? -65.846 -37.387  94.287  1.00 23.91 ? 155  ALA C CA  1 
ATOM   7592  C C   . ALA C  1 149 ? -64.666 -36.559  94.805  1.00 26.16 ? 155  ALA C C   1 
ATOM   7593  O O   . ALA C  1 149 ? -64.064 -35.776  94.064  1.00 29.45 ? 155  ALA C O   1 
ATOM   7594  C CB  . ALA C  1 149 ? -65.428 -38.809  94.120  1.00 26.63 ? 155  ALA C CB  1 
ATOM   7595  N N   . ASP C  1 150 ? -64.347 -36.735  96.084  1.00 21.15 ? 156  ASP C N   1 
ATOM   7596  C CA  . ASP C  1 150 ? -63.186 -36.087  96.683  1.00 22.50 ? 156  ASP C CA  1 
ATOM   7597  C C   . ASP C  1 150 ? -61.928 -36.932  96.475  1.00 24.07 ? 156  ASP C C   1 
ATOM   7598  O O   . ASP C  1 150 ? -60.810 -36.404  96.442  1.00 18.45 ? 156  ASP C O   1 
ATOM   7599  C CB  . ASP C  1 150 ? -63.409 -35.842  98.174  1.00 24.39 ? 156  ASP C CB  1 
ATOM   7600  C CG  . ASP C  1 150 ? -64.574 -34.913  98.449  1.00 30.45 ? 156  ASP C CG  1 
ATOM   7601  O OD1 . ASP C  1 150 ? -64.677 -33.858  97.778  1.00 32.92 ? 156  ASP C OD1 1 
ATOM   7602  O OD2 . ASP C  1 150 ? -65.387 -35.247  99.334  1.00 22.81 ? 156  ASP C OD2 1 
ATOM   7603  N N   . VAL C  1 151 ? -62.118 -38.245  96.358  1.00 21.68 ? 157  VAL C N   1 
ATOM   7604  C CA  . VAL C  1 151 ? -61.034 -39.154  95.985  1.00 17.94 ? 157  VAL C CA  1 
ATOM   7605  C C   . VAL C  1 151 ? -61.605 -40.365  95.280  1.00 17.65 ? 157  VAL C C   1 
ATOM   7606  O O   . VAL C  1 151 ? -62.639 -40.896  95.676  1.00 22.64 ? 157  VAL C O   1 
ATOM   7607  C CB  . VAL C  1 151 ? -60.190 -39.606  97.207  1.00 18.35 ? 157  VAL C CB  1 
ATOM   7608  C CG1 . VAL C  1 151 ? -61.021 -40.456  98.180  1.00 19.30 ? 157  VAL C CG1 1 
ATOM   7609  C CG2 . VAL C  1 151 ? -58.956 -40.383  96.748  1.00 18.18 ? 157  VAL C CG2 1 
ATOM   7610  N N   . THR C  1 152 ? -60.946 -40.777  94.205  1.00 15.53 ? 158  THR C N   1 
ATOM   7611  C CA  . THR C  1 152 ? -61.286 -42.023  93.535  1.00 16.33 ? 158  THR C CA  1 
ATOM   7612  C C   . THR C  1 152 ? -60.223 -43.053  93.865  1.00 17.46 ? 158  THR C C   1 
ATOM   7613  O O   . THR C  1 152 ? -59.022 -42.759  93.817  1.00 16.92 ? 158  THR C O   1 
ATOM   7614  C CB  . THR C  1 152 ? -61.419 -41.835  92.013  1.00 21.36 ? 158  THR C CB  1 
ATOM   7615  O OG1 . THR C  1 152 ? -62.544 -40.991  91.749  1.00 23.53 ? 158  THR C OG1 1 
ATOM   7616  C CG2 . THR C  1 152 ? -61.663 -43.151  91.325  1.00 19.63 ? 158  THR C CG2 1 
ATOM   7617  N N   . ILE C  1 153 ? -60.662 -44.255  94.231  1.00 15.62 ? 159  ILE C N   1 
ATOM   7618  C CA  . ILE C  1 153 ? -59.720 -45.266  94.681  1.00 19.84 ? 159  ILE C CA  1 
ATOM   7619  C C   . ILE C  1 153 ? -59.766 -46.503  93.797  1.00 20.95 ? 159  ILE C C   1 
ATOM   7620  O O   . ILE C  1 153 ? -60.833 -47.059  93.553  1.00 24.95 ? 159  ILE C O   1 
ATOM   7621  C CB  . ILE C  1 153 ? -59.980 -45.659  96.136  1.00 15.23 ? 159  ILE C CB  1 
ATOM   7622  C CG1 . ILE C  1 153 ? -60.108 -44.397  96.989  1.00 16.00 ? 159  ILE C CG1 1 
ATOM   7623  C CG2 . ILE C  1 153 ? -58.788 -46.423  96.652  1.00 15.26 ? 159  ILE C CG2 1 
ATOM   7624  C CD1 . ILE C  1 153 ? -60.168 -44.657  98.462  1.00 17.25 ? 159  ILE C CD1 1 
ATOM   7625  N N   . GLY C  1 154 ? -58.597 -46.912  93.309  1.00 15.95 ? 160  GLY C N   1 
ATOM   7626  C CA  . GLY C  1 154 ? -58.485 -48.049  92.414  1.00 16.11 ? 160  GLY C CA  1 
ATOM   7627  C C   . GLY C  1 154 ? -58.503 -49.359  93.170  1.00 15.09 ? 160  GLY C C   1 
ATOM   7628  O O   . GLY C  1 154 ? -57.733 -49.552  94.120  1.00 19.30 ? 160  GLY C O   1 
ATOM   7629  N N   . CYS C  1 155 ? -59.359 -50.271  92.724  1.00 15.61 ? 161  CYS C N   1 
ATOM   7630  C CA  . CYS C  1 155 ? -59.670 -51.468  93.493  1.00 13.90 ? 161  CYS C CA  1 
ATOM   7631  C C   . CYS C  1 155 ? -59.650 -52.746  92.663  1.00 15.53 ? 161  CYS C C   1 
ATOM   7632  O O   . CYS C  1 155 ? -60.152 -52.772  91.542  1.00 15.23 ? 161  CYS C O   1 
ATOM   7633  C CB  . CYS C  1 155 ? -61.049 -51.303  94.165  1.00 15.01 ? 161  CYS C CB  1 
ATOM   7634  S SG  . CYS C  1 155 ? -61.075 -50.191  95.586  1.00 23.04 ? 161  CYS C SG  1 
ATOM   7635  N N   . LEU C  1 156 ? -59.076 -53.804  93.228  1.00 16.98 ? 162  LEU C N   1 
ATOM   7636  C CA  . LEU C  1 156 ? -59.145 -55.118  92.618  1.00 17.72 ? 162  LEU C CA  1 
ATOM   7637  C C   . LEU C  1 156 ? -60.480 -55.727  92.964  1.00 19.03 ? 162  LEU C C   1 
ATOM   7638  O O   . LEU C  1 156 ? -61.055 -55.411  93.993  1.00 19.31 ? 162  LEU C O   1 
ATOM   7639  C CB  . LEU C  1 156 ? -58.028 -56.024  93.124  1.00 19.39 ? 162  LEU C CB  1 
ATOM   7640  C CG  . LEU C  1 156 ? -56.607 -55.543  92.875  1.00 21.68 ? 162  LEU C CG  1 
ATOM   7641  C CD1 . LEU C  1 156 ? -55.652 -56.361  93.715  1.00 22.37 ? 162  LEU C CD1 1 
ATOM   7642  C CD2 . LEU C  1 156 ? -56.244 -55.623  91.396  1.00 23.23 ? 162  LEU C CD2 1 
ATOM   7643  N N   . GLU C  1 157 ? -60.961 -56.617  92.112  1.00 16.64 ? 163  GLU C N   1 
ATOM   7644  C CA  . GLU C  1 157 ? -62.101 -57.450  92.463  1.00 18.64 ? 163  GLU C CA  1 
ATOM   7645  C C   . GLU C  1 157 ? -61.577 -58.824  92.834  1.00 23.28 ? 163  GLU C C   1 
ATOM   7646  O O   . GLU C  1 157 ? -61.130 -59.567  91.962  1.00 24.16 ? 163  GLU C O   1 
ATOM   7647  C CB  . GLU C  1 157 ? -63.078 -57.547  91.303  1.00 19.19 ? 163  GLU C CB  1 
ATOM   7648  C CG  . GLU C  1 157 ? -64.508 -57.577  91.727  1.00 25.52 ? 163  GLU C CG  1 
ATOM   7649  C CD  . GLU C  1 157 ? -65.445 -57.608  90.544  1.00 37.10 ? 163  GLU C CD  1 
ATOM   7650  O OE1 . GLU C  1 157 ? -65.801 -58.718  90.094  1.00 45.33 ? 163  GLU C OE1 1 
ATOM   7651  O OE2 . GLU C  1 157 ? -65.813 -56.521  90.054  1.00 37.07 ? 163  GLU C OE2 1 
ATOM   7652  N N   . VAL C  1 158 ? -61.599 -59.151  94.126  1.00 23.27 ? 164  VAL C N   1 
ATOM   7653  C CA  . VAL C  1 158 ? -61.000 -60.398  94.597  1.00 18.36 ? 164  VAL C CA  1 
ATOM   7654  C C   . VAL C  1 158 ? -62.017 -61.250  95.364  1.00 21.98 ? 164  VAL C C   1 
ATOM   7655  O O   . VAL C  1 158 ? -62.899 -60.716  96.034  1.00 22.06 ? 164  VAL C O   1 
ATOM   7656  C CB  . VAL C  1 158 ? -59.765 -60.132  95.491  1.00 20.47 ? 164  VAL C CB  1 
ATOM   7657  C CG1 . VAL C  1 158 ? -58.795 -59.163  94.803  1.00 20.31 ? 164  VAL C CG1 1 
ATOM   7658  C CG2 . VAL C  1 158 ? -60.172 -59.566  96.810  1.00 19.48 ? 164  VAL C CG2 1 
ATOM   7659  N N   . PRO C  1 159 ? -61.912 -62.584  95.241  1.00 21.03 ? 165  PRO C N   1 
ATOM   7660  C CA  . PRO C  1 159 ? -62.808 -63.463  95.993  1.00 19.65 ? 165  PRO C CA  1 
ATOM   7661  C C   . PRO C  1 159 ? -62.622 -63.222  97.485  1.00 25.18 ? 165  PRO C C   1 
ATOM   7662  O O   . PRO C  1 159 ? -61.493 -62.967  97.905  1.00 30.67 ? 165  PRO C O   1 
ATOM   7663  C CB  . PRO C  1 159 ? -62.356 -64.861  95.577  1.00 21.31 ? 165  PRO C CB  1 
ATOM   7664  C CG  . PRO C  1 159 ? -61.736 -64.664  94.238  1.00 25.37 ? 165  PRO C CG  1 
ATOM   7665  C CD  . PRO C  1 159 ? -61.042 -63.342  94.327  1.00 20.77 ? 165  PRO C CD  1 
ATOM   7666  N N   . ARG C  1 160 ? -63.695 -63.293  98.270  1.00 22.87 ? 166  ARG C N   1 
ATOM   7667  C CA  . ARG C  1 160 ? -63.669 -62.741  99.623  1.00 21.78 ? 166  ARG C CA  1 
ATOM   7668  C C   . ARG C  1 160 ? -62.633 -63.372  100.531 1.00 24.45 ? 166  ARG C C   1 
ATOM   7669  O O   . ARG C  1 160 ? -62.044 -62.694  101.368 1.00 29.54 ? 166  ARG C O   1 
ATOM   7670  C CB  . ARG C  1 160 ? -65.058 -62.846  100.268 1.00 26.95 ? 166  ARG C CB  1 
ATOM   7671  C CG  . ARG C  1 160 ? -66.091 -62.079  99.478  1.00 32.21 ? 166  ARG C CG  1 
ATOM   7672  C CD  . ARG C  1 160 ? -67.230 -61.580  100.333 1.00 33.29 ? 166  ARG C CD  1 
ATOM   7673  N NE  . ARG C  1 160 ? -67.877 -62.665  101.043 1.00 32.11 ? 166  ARG C NE  1 
ATOM   7674  C CZ  . ARG C  1 160 ? -69.017 -62.533  101.703 1.00 39.86 ? 166  ARG C CZ  1 
ATOM   7675  N NH1 . ARG C  1 160 ? -69.631 -61.357  101.740 1.00 35.34 ? 166  ARG C NH1 1 
ATOM   7676  N NH2 . ARG C  1 160 ? -69.536 -63.582  102.329 1.00 48.57 ? 166  ARG C NH2 1 
ATOM   7677  N N   . MET C  1 161 ? -62.384 -64.661  100.369 1.00 22.35 ? 167  MET C N   1 
ATOM   7678  C CA  . MET C  1 161 ? -61.435 -65.301  101.262 1.00 29.66 ? 167  MET C CA  1 
ATOM   7679  C C   . MET C  1 161 ? -59.989 -64.903  100.957 1.00 28.34 ? 167  MET C C   1 
ATOM   7680  O O   . MET C  1 161 ? -59.104 -65.077  101.795 1.00 28.54 ? 167  MET C O   1 
ATOM   7681  C CB  . MET C  1 161 ? -61.587 -66.810  101.201 1.00 30.91 ? 167  MET C CB  1 
ATOM   7682  C CG  . MET C  1 161 ? -60.942 -67.522  102.368 1.00 32.58 ? 167  MET C CG  1 
ATOM   7683  S SD  . MET C  1 161 ? -60.910 -69.257  101.990 1.00 49.85 ? 167  MET C SD  1 
ATOM   7684  C CE  . MET C  1 161 ? -60.660 -69.163  100.215 1.00 44.16 ? 167  MET C CE  1 
ATOM   7685  N N   . GLU C  1 162 ? -59.747 -64.368  99.762  1.00 32.13 ? 168  GLU C N   1 
ATOM   7686  C CA  . GLU C  1 162 ? -58.425 -63.847  99.433  1.00 32.91 ? 168  GLU C CA  1 
ATOM   7687  C C   . GLU C  1 162 ? -58.381 -62.379  99.842  1.00 29.18 ? 168  GLU C C   1 
ATOM   7688  O O   . GLU C  1 162 ? -57.315 -61.813  100.082 1.00 33.80 ? 168  GLU C O   1 
ATOM   7689  C CB  . GLU C  1 162 ? -58.107 -64.023  97.943  1.00 40.30 ? 168  GLU C CB  1 
ATOM   7690  C CG  . GLU C  1 162 ? -56.999 -63.104  97.422  1.00 51.52 ? 168  GLU C CG  1 
ATOM   7691  C CD  . GLU C  1 162 ? -57.043 -62.890  95.920  1.00 59.87 ? 168  GLU C CD  1 
ATOM   7692  O OE1 . GLU C  1 162 ? -58.124 -63.069  95.320  1.00 63.60 ? 168  GLU C OE1 1 
ATOM   7693  O OE2 . GLU C  1 162 ? -55.991 -62.534  95.338  1.00 59.44 ? 168  GLU C OE2 1 
ATOM   7694  N N   . ALA C  1 163 ? -59.557 -61.776  99.955  1.00 25.36 ? 169  ALA C N   1 
ATOM   7695  C CA  . ALA C  1 163 ? -59.669 -60.380  100.352 1.00 22.76 ? 169  ALA C CA  1 
ATOM   7696  C C   . ALA C  1 163 ? -59.213 -60.132  101.790 1.00 22.59 ? 169  ALA C C   1 
ATOM   7697  O O   . ALA C  1 163 ? -58.920 -58.998  102.159 1.00 21.39 ? 169  ALA C O   1 
ATOM   7698  C CB  . ALA C  1 163 ? -61.093 -59.905  100.174 1.00 23.16 ? 169  ALA C CB  1 
ATOM   7699  N N   . THR C  1 164 ? -59.154 -61.186  102.599 1.00 22.11 ? 170  THR C N   1 
ATOM   7700  C CA  . THR C  1 164 ? -58.763 -61.049  104.001 1.00 23.16 ? 170  THR C CA  1 
ATOM   7701  C C   . THR C  1 164 ? -57.366 -60.443  104.161 1.00 24.41 ? 170  THR C C   1 
ATOM   7702  O O   . THR C  1 164 ? -57.045 -59.873  105.206 1.00 23.48 ? 170  THR C O   1 
ATOM   7703  C CB  . THR C  1 164 ? -58.803 -62.403  104.732 1.00 22.17 ? 170  THR C CB  1 
ATOM   7704  O OG1 . THR C  1 164 ? -57.942 -63.331  104.064 1.00 26.65 ? 170  THR C OG1 1 
ATOM   7705  C CG2 . THR C  1 164 ? -60.224 -62.965  104.760 1.00 16.68 ? 170  THR C CG2 1 
ATOM   7706  N N   . GLY C  1 165 ? -56.549 -60.552  103.118 1.00 22.87 ? 171  GLY C N   1 
ATOM   7707  C CA  . GLY C  1 165 ? -55.177 -60.076  103.173 1.00 23.60 ? 171  GLY C CA  1 
ATOM   7708  C C   . GLY C  1 165 ? -54.994 -58.640  102.725 1.00 21.24 ? 171  GLY C C   1 
ATOM   7709  O O   . GLY C  1 165 ? -53.868 -58.154  102.656 1.00 21.18 ? 171  GLY C O   1 
ATOM   7710  N N   . PHE C  1 166 ? -56.099 -57.953  102.442 1.00 19.25 ? 172  PHE C N   1 
ATOM   7711  C CA  . PHE C  1 166 ? -56.062 -56.618  101.845 1.00 18.70 ? 172  PHE C CA  1 
ATOM   7712  C C   . PHE C  1 166 ? -56.713 -55.526  102.683 1.00 21.60 ? 172  PHE C C   1 
ATOM   7713  O O   . PHE C  1 166 ? -57.434 -55.800  103.640 1.00 22.09 ? 172  PHE C O   1 
ATOM   7714  C CB  . PHE C  1 166 ? -56.756 -56.627  100.482 1.00 21.03 ? 172  PHE C CB  1 
ATOM   7715  C CG  . PHE C  1 166 ? -55.974 -57.300  99.395  1.00 19.34 ? 172  PHE C CG  1 
ATOM   7716  C CD1 . PHE C  1 166 ? -55.102 -56.574  98.598  1.00 21.10 ? 172  PHE C CD1 1 
ATOM   7717  C CD2 . PHE C  1 166 ? -56.133 -58.649  99.148  1.00 20.25 ? 172  PHE C CD2 1 
ATOM   7718  C CE1 . PHE C  1 166 ? -54.399 -57.189  97.576  1.00 23.17 ? 172  PHE C CE1 1 
ATOM   7719  C CE2 . PHE C  1 166 ? -55.431 -59.273  98.131  1.00 22.84 ? 172  PHE C CE2 1 
ATOM   7720  C CZ  . PHE C  1 166 ? -54.561 -58.542  97.343  1.00 23.30 ? 172  PHE C CZ  1 
ATOM   7721  N N   . GLY C  1 167 ? -56.468 -54.281  102.291 1.00 22.68 ? 173  GLY C N   1 
ATOM   7722  C CA  . GLY C  1 167 ? -57.245 -53.166  102.790 1.00 21.48 ? 173  GLY C CA  1 
ATOM   7723  C C   . GLY C  1 167 ? -58.516 -53.157  101.971 1.00 21.28 ? 173  GLY C C   1 
ATOM   7724  O O   . GLY C  1 167 ? -58.455 -53.016  100.757 1.00 22.66 ? 173  GLY C O   1 
ATOM   7725  N N   . VAL C  1 168 ? -59.667 -53.334  102.617 1.00 22.44 ? 174  VAL C N   1 
ATOM   7726  C CA  . VAL C  1 168 ? -60.923 -53.514  101.887 1.00 20.36 ? 174  VAL C CA  1 
ATOM   7727  C C   . VAL C  1 168 ? -61.868 -52.323  102.071 1.00 24.48 ? 174  VAL C C   1 
ATOM   7728  O O   . VAL C  1 168 ? -62.045 -51.852  103.179 1.00 27.75 ? 174  VAL C O   1 
ATOM   7729  C CB  . VAL C  1 168 ? -61.628 -54.828  102.323 1.00 17.94 ? 174  VAL C CB  1 
ATOM   7730  C CG1 . VAL C  1 168 ? -63.008 -54.927  101.676 1.00 14.64 ? 174  VAL C CG1 1 
ATOM   7731  C CG2 . VAL C  1 168 ? -60.789 -56.042  101.963 1.00 22.45 ? 174  VAL C CG2 1 
ATOM   7732  N N   . MET C  1 169 ? -62.460 -51.844  100.981 1.00 22.17 ? 175  MET C N   1 
ATOM   7733  C CA  . MET C  1 169 ? -63.407 -50.748  100.996 1.00 25.88 ? 175  MET C CA  1 
ATOM   7734  C C   . MET C  1 169 ? -64.821 -51.307  101.049 1.00 29.27 ? 175  MET C C   1 
ATOM   7735  O O   . MET C  1 169 ? -65.148 -52.167  100.250 1.00 27.75 ? 175  MET C O   1 
ATOM   7736  C CB  . MET C  1 169 ? -63.275 -49.905  99.717  1.00 21.47 ? 175  MET C CB  1 
ATOM   7737  C CG  . MET C  1 169 ? -61.887 -49.247  99.546  1.00 17.84 ? 175  MET C CG  1 
ATOM   7738  S SD  . MET C  1 169 ? -61.431 -48.058  100.796 1.00 30.83 ? 175  MET C SD  1 
ATOM   7739  C CE  . MET C  1 169 ? -59.674 -47.847  100.541 1.00 12.12 ? 175  MET C CE  1 
ATOM   7740  N N   . HIS C  1 170 ? -65.697 -50.794  101.915 1.00 27.49 ? 176  HIS C N   1 
ATOM   7741  C CA  . HIS C  1 170 ? -67.075 -51.323  101.866 1.00 31.55 ? 176  HIS C CA  1 
ATOM   7742  C C   . HIS C  1 170 ? -67.634 -50.552  100.664 1.00 26.32 ? 176  HIS C C   1 
ATOM   7743  O O   . HIS C  1 170 ? -67.397 -49.337  100.574 1.00 33.52 ? 176  HIS C O   1 
ATOM   7744  C CB  . HIS C  1 170 ? -68.036 -50.983  103.007 1.00 37.47 ? 176  HIS C CB  1 
ATOM   7745  C CG  . HIS C  1 170 ? -69.160 -51.932  103.115 1.00 39.23 ? 176  HIS C CG  1 
ATOM   7746  N ND1 . HIS C  1 170 ? -70.388 -51.526  103.524 1.00 41.82 ? 176  HIS C ND1 1 
ATOM   7747  C CD2 . HIS C  1 170 ? -69.153 -53.268  103.117 1.00 38.81 ? 176  HIS C CD2 1 
ATOM   7748  C CE1 . HIS C  1 170 ? -71.175 -52.578  103.593 1.00 39.90 ? 176  HIS C CE1 1 
ATOM   7749  N NE2 . HIS C  1 170 ? -70.440 -53.648  103.408 1.00 39.38 ? 176  HIS C NE2 1 
ATOM   7750  N N   . VAL C  1 171 ? -68.504 -51.133  99.850  1.00 18.47 ? 177  VAL C N   1 
ATOM   7751  C CA  . VAL C  1 171 ? -69.079 -50.362  98.772  1.00 19.97 ? 177  VAL C CA  1 
ATOM   7752  C C   . VAL C  1 171 ? -70.611 -50.455  98.755  1.00 28.65 ? 177  VAL C C   1 
ATOM   7753  O O   . VAL C  1 171 ? -71.196 -51.466  99.176  1.00 25.50 ? 177  VAL C O   1 
ATOM   7754  C CB  . VAL C  1 171 ? -68.449 -50.822  97.440  1.00 24.46 ? 177  VAL C CB  1 
ATOM   7755  C CG1 . VAL C  1 171 ? -69.458 -51.305  96.460  1.00 21.18 ? 177  VAL C CG1 1 
ATOM   7756  C CG2 . VAL C  1 171 ? -67.611 -49.687  96.866  1.00 18.58 ? 177  VAL C CG2 1 
ATOM   7757  N N   . ASN C  1 172 ? -71.261 -49.380  98.311  1.00 28.04 ? 178  ASN C N   1 
ATOM   7758  C CA  . ASN C  1 172 ? -72.685 -49.440  98.056  1.00 26.26 ? 178  ASN C CA  1 
ATOM   7759  C C   . ASN C  1 172 ? -72.961 -49.667  96.569  1.00 27.05 ? 178  ASN C C   1 
ATOM   7760  O O   . ASN C  1 172 ? -72.046 -49.873  95.776  1.00 24.86 ? 178  ASN C O   1 
ATOM   7761  C CB  . ASN C  1 172 ? -73.409 -48.188  98.597  1.00 25.31 ? 178  ASN C CB  1 
ATOM   7762  C CG  . ASN C  1 172 ? -73.273 -46.937  97.713  1.00 25.44 ? 178  ASN C CG  1 
ATOM   7763  O OD1 . ASN C  1 172 ? -73.024 -47.000  96.508  1.00 25.05 ? 178  ASN C OD1 1 
ATOM   7764  N ND2 . ASN C  1 172 ? -73.524 -45.783  98.325  1.00 25.87 ? 178  ASN C ND2 1 
ATOM   7765  N N   . GLU C  1 173 ? -74.231 -49.610  96.190  1.00 27.10 ? 179  GLU C N   1 
ATOM   7766  C CA  . GLU C  1 173 ? -74.640 -49.980  94.841  1.00 28.72 ? 179  GLU C CA  1 
ATOM   7767  C C   . GLU C  1 173 ? -74.130 -49.004  93.787  1.00 28.48 ? 179  GLU C C   1 
ATOM   7768  O O   . GLU C  1 173 ? -74.199 -49.286  92.589  1.00 28.81 ? 179  GLU C O   1 
ATOM   7769  C CB  . GLU C  1 173 ? -76.167 -50.070  94.754  1.00 34.27 ? 179  GLU C CB  1 
ATOM   7770  C CG  . GLU C  1 173 ? -76.830 -50.808  95.909  1.00 39.94 ? 179  GLU C CG  1 
ATOM   7771  C CD  . GLU C  1 173 ? -77.543 -52.082  95.474  1.00 46.11 ? 179  GLU C CD  1 
ATOM   7772  O OE1 . GLU C  1 173 ? -77.145 -52.674  94.447  1.00 49.13 ? 179  GLU C OE1 1 
ATOM   7773  O OE2 . GLU C  1 173 ? -78.506 -52.491  96.162  1.00 44.01 ? 179  GLU C OE2 1 
ATOM   7774  N N   . LYS C  1 174 ? -73.637 -47.853  94.238  1.00 28.62 ? 180  LYS C N   1 
ATOM   7775  C CA  . LYS C  1 174 ? -73.098 -46.834  93.344  1.00 27.77 ? 180  LYS C CA  1 
ATOM   7776  C C   . LYS C  1 174 ? -71.565 -46.820  93.362  1.00 26.15 ? 180  LYS C C   1 
ATOM   7777  O O   . LYS C  1 174 ? -70.941 -45.882  92.866  1.00 25.85 ? 180  LYS C O   1 
ATOM   7778  C CB  . LYS C  1 174 ? -73.641 -45.460  93.733  1.00 32.87 ? 180  LYS C CB  1 
ATOM   7779  C CG  . LYS C  1 174 ? -75.161 -45.416  93.780  1.00 41.09 ? 180  LYS C CG  1 
ATOM   7780  C CD  . LYS C  1 174 ? -75.693 -44.064  94.238  1.00 44.53 ? 180  LYS C CD  1 
ATOM   7781  C CE  . LYS C  1 174 ? -76.080 -44.076  95.706  1.00 44.05 ? 180  LYS C CE  1 
ATOM   7782  N NZ  . LYS C  1 174 ? -76.413 -42.709  96.196  1.00 41.54 ? 180  LYS C NZ  1 
ATOM   7783  N N   . ASP C  1 175 ? -70.985 -47.875  93.930  1.00 21.08 ? 181  ASP C N   1 
ATOM   7784  C CA  . ASP C  1 175 ? -69.547 -48.001  94.142  1.00 21.18 ? 181  ASP C CA  1 
ATOM   7785  C C   . ASP C  1 175 ? -69.010 -46.882  95.021  1.00 21.95 ? 181  ASP C C   1 
ATOM   7786  O O   . ASP C  1 175 ? -67.834 -46.552  94.962  1.00 23.77 ? 181  ASP C O   1 
ATOM   7787  C CB  . ASP C  1 175 ? -68.796 -48.049  92.810  1.00 20.94 ? 181  ASP C CB  1 
ATOM   7788  C CG  . ASP C  1 175 ? -68.627 -49.469  92.293  1.00 26.11 ? 181  ASP C CG  1 
ATOM   7789  O OD1 . ASP C  1 175 ? -69.183 -50.393  92.928  1.00 27.23 ? 181  ASP C OD1 1 
ATOM   7790  O OD2 . ASP C  1 175 ? -67.934 -49.669  91.269  1.00 23.31 ? 181  ASP C OD2 1 
ATOM   7791  N N   . GLU C  1 176 ? -69.876 -46.312  95.852  1.00 23.53 ? 182  GLU C N   1 
ATOM   7792  C CA  . GLU C  1 176 ? -69.456 -45.285  96.799  1.00 22.21 ? 182  GLU C CA  1 
ATOM   7793  C C   . GLU C  1 176 ? -68.981 -45.972  98.074  1.00 19.89 ? 182  GLU C C   1 
ATOM   7794  O O   . GLU C  1 176 ? -69.633 -46.881  98.578  1.00 21.05 ? 182  GLU C O   1 
ATOM   7795  C CB  . GLU C  1 176 ? -70.599 -44.299  97.083  1.00 24.58 ? 182  GLU C CB  1 
ATOM   7796  C CG  . GLU C  1 176 ? -71.191 -43.668  95.821  1.00 28.65 ? 182  GLU C CG  1 
ATOM   7797  C CD  . GLU C  1 176 ? -72.467 -42.859  96.077  1.00 38.80 ? 182  GLU C CD  1 
ATOM   7798  O OE1 . GLU C  1 176 ? -73.062 -42.978  97.174  1.00 33.64 ? 182  GLU C OE1 1 
ATOM   7799  O OE2 . GLU C  1 176 ? -72.877 -42.101  95.168  1.00 44.19 ? 182  GLU C OE2 1 
ATOM   7800  N N   . ILE C  1 177 ? -67.836 -45.541  98.588  1.00 16.37 ? 183  ILE C N   1 
ATOM   7801  C CA  . ILE C  1 177 ? -67.188 -46.250  99.678  1.00 18.96 ? 183  ILE C CA  1 
ATOM   7802  C C   . ILE C  1 177 ? -67.691 -45.789  101.045 1.00 25.13 ? 183  ILE C C   1 
ATOM   7803  O O   . ILE C  1 177 ? -67.437 -44.663  101.471 1.00 24.27 ? 183  ILE C O   1 
ATOM   7804  C CB  . ILE C  1 177 ? -65.665 -46.091  99.600  1.00 19.44 ? 183  ILE C CB  1 
ATOM   7805  C CG1 . ILE C  1 177 ? -65.158 -46.721  98.298  1.00 15.88 ? 183  ILE C CG1 1 
ATOM   7806  C CG2 . ILE C  1 177 ? -65.006 -46.720  100.818 1.00 13.94 ? 183  ILE C CG2 1 
ATOM   7807  C CD1 . ILE C  1 177 ? -63.708 -46.385  97.959  1.00 14.50 ? 183  ILE C CD1 1 
ATOM   7808  N N   . ILE C  1 178 ? -68.404 -46.677  101.730 1.00 24.51 ? 184  ILE C N   1 
ATOM   7809  C CA  . ILE C  1 178 ? -69.019 -46.318  102.996 1.00 27.01 ? 184  ILE C CA  1 
ATOM   7810  C C   . ILE C  1 178 ? -68.157 -46.719  104.194 1.00 29.24 ? 184  ILE C C   1 
ATOM   7811  O O   . ILE C  1 178 ? -68.370 -46.255  105.312 1.00 29.95 ? 184  ILE C O   1 
ATOM   7812  C CB  . ILE C  1 178 ? -70.398 -46.945  103.143 1.00 25.83 ? 184  ILE C CB  1 
ATOM   7813  C CG1 . ILE C  1 178 ? -70.325 -48.368  103.642 1.00 24.77 ? 184  ILE C CG1 1 
ATOM   7814  C CG2 . ILE C  1 178 ? -71.145 -46.936  101.800 1.00 24.24 ? 184  ILE C CG2 1 
ATOM   7815  C CD1 . ILE C  1 178 ? -71.693 -48.920  103.634 1.00 26.36 ? 184  ILE C CD1 1 
ATOM   7816  N N   . ASP C  1 179 ? -67.162 -47.559  103.950 1.00 30.25 ? 185  ASP C N   1 
ATOM   7817  C CA  . ASP C  1 179 ? -66.275 -47.991  105.016 1.00 28.72 ? 185  ASP C CA  1 
ATOM   7818  C C   . ASP C  1 179 ? -64.996 -48.571  104.426 1.00 26.22 ? 185  ASP C C   1 
ATOM   7819  O O   . ASP C  1 179 ? -64.983 -49.075  103.301 1.00 24.01 ? 185  ASP C O   1 
ATOM   7820  C CB  . ASP C  1 179 ? -66.990 -49.015  105.919 1.00 31.24 ? 185  ASP C CB  1 
ATOM   7821  C CG  . ASP C  1 179 ? -66.221 -49.328  107.195 1.00 36.61 ? 185  ASP C CG  1 
ATOM   7822  O OD1 . ASP C  1 179 ? -65.485 -48.456  107.705 1.00 34.33 ? 185  ASP C OD1 1 
ATOM   7823  O OD2 . ASP C  1 179 ? -66.370 -50.459  107.703 1.00 40.70 ? 185  ASP C OD2 1 
ATOM   7824  N N   . PHE C  1 180 ? -63.919 -48.477  105.188 1.00 22.42 ? 186  PHE C N   1 
ATOM   7825  C CA  . PHE C  1 180 ? -62.655 -49.081  104.812 1.00 23.02 ? 186  PHE C CA  1 
ATOM   7826  C C   . PHE C  1 180 ? -62.171 -49.993  105.933 1.00 28.03 ? 186  PHE C C   1 
ATOM   7827  O O   . PHE C  1 180 ? -62.125 -49.575  107.087 1.00 31.69 ? 186  PHE C O   1 
ATOM   7828  C CB  . PHE C  1 180 ? -61.609 -48.012  104.513 1.00 19.12 ? 186  PHE C CB  1 
ATOM   7829  C CG  . PHE C  1 180 ? -60.215 -48.550  104.461 1.00 28.36 ? 186  PHE C CG  1 
ATOM   7830  C CD1 . PHE C  1 180 ? -59.867 -49.510  103.527 1.00 26.02 ? 186  PHE C CD1 1 
ATOM   7831  C CD2 . PHE C  1 180 ? -59.255 -48.119  105.358 1.00 35.16 ? 186  PHE C CD2 1 
ATOM   7832  C CE1 . PHE C  1 180 ? -58.589 -50.020  103.482 1.00 25.81 ? 186  PHE C CE1 1 
ATOM   7833  C CE2 . PHE C  1 180 ? -57.969 -48.631  105.316 1.00 34.04 ? 186  PHE C CE2 1 
ATOM   7834  C CZ  . PHE C  1 180 ? -57.640 -49.584  104.378 1.00 29.19 ? 186  PHE C CZ  1 
ATOM   7835  N N   . ILE C  1 181 ? -61.810 -51.230  105.602 1.00 27.47 ? 187  ILE C N   1 
ATOM   7836  C CA  . ILE C  1 181 ? -61.357 -52.185  106.614 1.00 24.61 ? 187  ILE C CA  1 
ATOM   7837  C C   . ILE C  1 181 ? -60.002 -52.776  106.262 1.00 26.84 ? 187  ILE C C   1 
ATOM   7838  O O   . ILE C  1 181 ? -59.834 -53.372  105.197 1.00 27.66 ? 187  ILE C O   1 
ATOM   7839  C CB  . ILE C  1 181 ? -62.354 -53.372  106.809 1.00 26.56 ? 187  ILE C CB  1 
ATOM   7840  C CG1 . ILE C  1 181 ? -63.808 -52.899  106.874 1.00 30.00 ? 187  ILE C CG1 1 
ATOM   7841  C CG2 . ILE C  1 181 ? -61.997 -54.162  108.055 1.00 27.87 ? 187  ILE C CG2 1 
ATOM   7842  C CD1 . ILE C  1 181 ? -64.541 -52.999  105.554 1.00 33.10 ? 187  ILE C CD1 1 
ATOM   7843  N N   . GLU C  1 182 ? -59.044 -52.630  107.170 1.00 27.37 ? 188  GLU C N   1 
ATOM   7844  C CA  . GLU C  1 182 ? -57.726 -53.217  106.987 1.00 28.67 ? 188  GLU C CA  1 
ATOM   7845  C C   . GLU C  1 182 ? -57.730 -54.689  107.381 1.00 28.98 ? 188  GLU C C   1 
ATOM   7846  O O   . GLU C  1 182 ? -57.934 -55.031  108.542 1.00 28.51 ? 188  GLU C O   1 
ATOM   7847  C CB  . GLU C  1 182 ? -56.688 -52.443  107.796 1.00 35.94 ? 188  GLU C CB  1 
ATOM   7848  C CG  . GLU C  1 182 ? -56.608 -50.980  107.396 1.00 43.71 ? 188  GLU C CG  1 
ATOM   7849  C CD  . GLU C  1 182 ? -55.998 -50.090  108.460 1.00 50.05 ? 188  GLU C CD  1 
ATOM   7850  O OE1 . GLU C  1 182 ? -55.575 -50.603  109.517 1.00 52.43 ? 188  GLU C OE1 1 
ATOM   7851  O OE2 . GLU C  1 182 ? -55.960 -48.864  108.243 1.00 52.52 ? 188  GLU C OE2 1 
ATOM   7852  N N   . LYS C  1 183 ? -57.521 -55.550  106.392 1.00 27.84 ? 189  LYS C N   1 
ATOM   7853  C CA  . LYS C  1 183 ? -57.480 -56.999  106.584 1.00 24.94 ? 189  LYS C CA  1 
ATOM   7854  C C   . LYS C  1 183 ? -58.674 -57.578  107.356 1.00 24.43 ? 189  LYS C C   1 
ATOM   7855  O O   . LYS C  1 183 ? -58.492 -58.215  108.389 1.00 25.89 ? 189  LYS C O   1 
ATOM   7856  C CB  . LYS C  1 183 ? -56.182 -57.382  107.286 1.00 27.69 ? 189  LYS C CB  1 
ATOM   7857  C CG  . LYS C  1 183 ? -54.951 -57.069  106.460 1.00 31.94 ? 189  LYS C CG  1 
ATOM   7858  C CD  . LYS C  1 183 ? -53.761 -57.872  106.923 1.00 37.17 ? 189  LYS C CD  1 
ATOM   7859  C CE  . LYS C  1 183 ? -52.740 -57.994  105.804 1.00 42.35 ? 189  LYS C CE  1 
ATOM   7860  N NZ  . LYS C  1 183 ? -51.864 -59.193  105.968 1.00 48.51 ? 189  LYS C NZ  1 
ATOM   7861  N N   . PRO C  1 184 ? -59.894 -57.382  106.836 1.00 19.48 ? 190  PRO C N   1 
ATOM   7862  C CA  . PRO C  1 184 ? -61.093 -57.917  107.488 1.00 21.38 ? 190  PRO C CA  1 
ATOM   7863  C C   . PRO C  1 184 ? -61.082 -59.441  107.560 1.00 23.51 ? 190  PRO C C   1 
ATOM   7864  O O   . PRO C  1 184 ? -60.793 -60.071  106.546 1.00 23.58 ? 190  PRO C O   1 
ATOM   7865  C CB  . PRO C  1 184 ? -62.220 -57.433  106.582 1.00 19.20 ? 190  PRO C CB  1 
ATOM   7866  C CG  . PRO C  1 184 ? -61.583 -57.295  105.249 1.00 15.27 ? 190  PRO C CG  1 
ATOM   7867  C CD  . PRO C  1 184 ? -60.201 -56.812  105.513 1.00 14.87 ? 190  PRO C CD  1 
ATOM   7868  N N   . ALA C  1 185 ? -61.382 -60.019  108.726 1.00 23.57 ? 191  ALA C N   1 
ATOM   7869  C CA  . ALA C  1 185 ? -61.507 -61.471  108.834 1.00 20.42 ? 191  ALA C CA  1 
ATOM   7870  C C   . ALA C  1 185 ? -62.655 -61.948  107.942 1.00 17.61 ? 191  ALA C C   1 
ATOM   7871  O O   . ALA C  1 185 ? -62.592 -63.014  107.328 1.00 20.65 ? 191  ALA C O   1 
ATOM   7872  C CB  . ALA C  1 185 ? -61.728 -61.888  110.272 1.00 20.78 ? 191  ALA C CB  1 
ATOM   7873  N N   . ASP C  1 186 ? -63.698 -61.134  107.865 1.00 23.58 ? 192  ASP C N   1 
ATOM   7874  C CA  . ASP C  1 186 ? -64.789 -61.374  106.938 1.00 22.13 ? 192  ASP C CA  1 
ATOM   7875  C C   . ASP C  1 186 ? -65.033 -60.130  106.092 1.00 24.74 ? 192  ASP C C   1 
ATOM   7876  O O   . ASP C  1 186 ? -65.772 -59.230  106.493 1.00 27.42 ? 192  ASP C O   1 
ATOM   7877  C CB  . ASP C  1 186 ? -66.062 -61.770  107.682 1.00 24.62 ? 192  ASP C CB  1 
ATOM   7878  C CG  . ASP C  1 186 ? -67.123 -62.312  106.750 1.00 29.74 ? 192  ASP C CG  1 
ATOM   7879  O OD1 . ASP C  1 186 ? -66.764 -62.687  105.610 1.00 29.09 ? 192  ASP C OD1 1 
ATOM   7880  O OD2 . ASP C  1 186 ? -68.305 -62.372  107.155 1.00 35.66 ? 192  ASP C OD2 1 
ATOM   7881  N N   . PRO C  1 187 ? -64.390 -60.073  104.920 1.00 26.16 ? 193  PRO C N   1 
ATOM   7882  C CA  . PRO C  1 187 ? -64.453 -58.928  104.006 1.00 23.80 ? 193  PRO C CA  1 
ATOM   7883  C C   . PRO C  1 187 ? -65.849 -58.703  103.477 1.00 24.17 ? 193  PRO C C   1 
ATOM   7884  O O   . PRO C  1 187 ? -66.457 -59.628  102.950 1.00 26.96 ? 193  PRO C O   1 
ATOM   7885  C CB  . PRO C  1 187 ? -63.510 -59.327  102.867 1.00 24.61 ? 193  PRO C CB  1 
ATOM   7886  C CG  . PRO C  1 187 ? -62.653 -60.413  103.433 1.00 23.99 ? 193  PRO C CG  1 
ATOM   7887  C CD  . PRO C  1 187 ? -63.505 -61.135  104.417 1.00 23.69 ? 193  PRO C CD  1 
ATOM   7888  N N   . PRO C  1 188 ? -66.360 -57.484  103.608 1.00 24.30 ? 194  PRO C N   1 
ATOM   7889  C CA  . PRO C  1 188 ? -67.692 -57.282  103.053 1.00 23.48 ? 194  PRO C CA  1 
ATOM   7890  C C   . PRO C  1 188 ? -67.719 -57.495  101.556 1.00 24.42 ? 194  PRO C C   1 
ATOM   7891  O O   . PRO C  1 188 ? -66.796 -57.070  100.866 1.00 27.93 ? 194  PRO C O   1 
ATOM   7892  C CB  . PRO C  1 188 ? -67.981 -55.850  103.386 1.00 21.42 ? 194  PRO C CB  1 
ATOM   7893  C CG  . PRO C  1 188 ? -66.654 -55.218  103.705 1.00 25.42 ? 194  PRO C CG  1 
ATOM   7894  C CD  . PRO C  1 188 ? -65.842 -56.288  104.289 1.00 27.60 ? 194  PRO C CD  1 
ATOM   7895  N N   . GLY C  1 189 ? -68.758 -58.153  101.064 1.00 18.54 ? 195  GLY C N   1 
ATOM   7896  C CA  . GLY C  1 189 ? -68.833 -58.453  99.652  1.00 18.17 ? 195  GLY C CA  1 
ATOM   7897  C C   . GLY C  1 189 ? -69.391 -57.268  98.906  1.00 21.60 ? 195  GLY C C   1 
ATOM   7898  O O   . GLY C  1 189 ? -69.852 -56.305  99.514  1.00 23.72 ? 195  GLY C O   1 
ATOM   7899  N N   . ILE C  1 190 ? -69.343 -57.340  97.584  1.00 20.68 ? 196  ILE C N   1 
ATOM   7900  C CA  . ILE C  1 190 ? -69.944 -56.326  96.731  1.00 21.21 ? 196  ILE C CA  1 
ATOM   7901  C C   . ILE C  1 190 ? -71.454 -56.546  96.700  1.00 20.93 ? 196  ILE C C   1 
ATOM   7902  O O   . ILE C  1 190 ? -71.893 -57.681  96.571  1.00 20.76 ? 196  ILE C O   1 
ATOM   7903  C CB  . ILE C  1 190 ? -69.358 -56.397  95.306  1.00 20.13 ? 196  ILE C CB  1 
ATOM   7904  C CG1 . ILE C  1 190 ? -67.853 -56.095  95.347  1.00 19.94 ? 196  ILE C CG1 1 
ATOM   7905  C CG2 . ILE C  1 190 ? -70.088 -55.450  94.361  1.00 20.31 ? 196  ILE C CG2 1 
ATOM   7906  C CD1 . ILE C  1 190 ? -67.110 -56.558  94.127  1.00 15.61 ? 196  ILE C CD1 1 
ATOM   7907  N N   . PRO C  1 191 ? -72.253 -55.471  96.846  1.00 22.69 ? 197  PRO C N   1 
ATOM   7908  C CA  . PRO C  1 191 ? -73.710 -55.621  96.727  1.00 24.18 ? 197  PRO C CA  1 
ATOM   7909  C C   . PRO C  1 191 ? -74.113 -56.229  95.387  1.00 22.80 ? 197  PRO C C   1 
ATOM   7910  O O   . PRO C  1 191 ? -73.737 -55.703  94.347  1.00 26.15 ? 197  PRO C O   1 
ATOM   7911  C CB  . PRO C  1 191 ? -74.224 -54.184  96.837  1.00 26.20 ? 197  PRO C CB  1 
ATOM   7912  C CG  . PRO C  1 191 ? -73.163 -53.451  97.543  1.00 26.65 ? 197  PRO C CG  1 
ATOM   7913  C CD  . PRO C  1 191 ? -71.869 -54.081  97.140  1.00 22.41 ? 197  PRO C CD  1 
ATOM   7914  N N   . GLY C  1 192 ? -74.865 -57.324  95.410  1.00 26.34 ? 198  GLY C N   1 
ATOM   7915  C CA  . GLY C  1 192 ? -75.281 -57.976  94.181  1.00 22.04 ? 198  GLY C CA  1 
ATOM   7916  C C   . GLY C  1 192 ? -74.194 -58.888  93.648  1.00 25.84 ? 198  GLY C C   1 
ATOM   7917  O O   . GLY C  1 192 ? -74.421 -59.690  92.741  1.00 28.59 ? 198  GLY C O   1 
ATOM   7918  N N   . ASN C  1 193 ? -72.999 -58.765  94.216  1.00 23.59 ? 199  ASN C N   1 
ATOM   7919  C CA  . ASN C  1 193 ? -71.880 -59.595  93.808  1.00 21.76 ? 199  ASN C CA  1 
ATOM   7920  C C   . ASN C  1 193 ? -71.064 -60.032  95.027  1.00 25.58 ? 199  ASN C C   1 
ATOM   7921  O O   . ASN C  1 193 ? -69.865 -59.787  95.113  1.00 26.97 ? 199  ASN C O   1 
ATOM   7922  C CB  . ASN C  1 193 ? -71.015 -58.843  92.793  1.00 19.22 ? 199  ASN C CB  1 
ATOM   7923  C CG  . ASN C  1 193 ? -69.976 -59.723  92.149  1.00 21.67 ? 199  ASN C CG  1 
ATOM   7924  O OD1 . ASN C  1 193 ? -70.032 -60.947  92.256  1.00 25.14 ? 199  ASN C OD1 1 
ATOM   7925  N ND2 . ASN C  1 193 ? -69.021 -59.103  91.455  1.00 21.67 ? 199  ASN C ND2 1 
ATOM   7926  N N   . GLU C  1 194 ? -71.738 -60.671  95.979  1.00 22.92 ? 200  GLU C N   1 
ATOM   7927  C CA  . GLU C  1 194 ? -71.075 -61.262  97.127  1.00 20.38 ? 200  GLU C CA  1 
ATOM   7928  C C   . GLU C  1 194 ? -70.122 -62.323  96.611  1.00 24.91 ? 200  GLU C C   1 
ATOM   7929  O O   . GLU C  1 194 ? -70.171 -62.707  95.447  1.00 33.80 ? 200  GLU C O   1 
ATOM   7930  C CB  . GLU C  1 194 ? -72.088 -61.872  98.095  1.00 23.69 ? 200  GLU C CB  1 
ATOM   7931  C CG  . GLU C  1 194 ? -73.394 -61.122  98.163  1.00 29.97 ? 200  GLU C CG  1 
ATOM   7932  C CD  . GLU C  1 194 ? -73.255 -59.788  98.845  1.00 39.75 ? 200  GLU C CD  1 
ATOM   7933  O OE1 . GLU C  1 194 ? -72.329 -59.635  99.666  1.00 42.84 ? 200  GLU C OE1 1 
ATOM   7934  O OE2 . GLU C  1 194 ? -74.073 -58.889  98.564  1.00 47.12 ? 200  GLU C OE2 1 
ATOM   7935  N N   . GLY C  1 195 ? -69.251 -62.819  97.462  1.00 20.87 ? 201  GLY C N   1 
ATOM   7936  C CA  . GLY C  1 195 ? -68.246 -63.726  96.956  1.00 21.52 ? 201  GLY C CA  1 
ATOM   7937  C C   . GLY C  1 195 ? -67.050 -62.968  96.412  1.00 16.15 ? 201  GLY C C   1 
ATOM   7938  O O   . GLY C  1 195 ? -65.968 -63.533  96.322  1.00 18.86 ? 201  GLY C O   1 
ATOM   7939  N N   . PHE C  1 196 ? -67.247 -61.699  96.045  1.00 17.88 ? 202  PHE C N   1 
ATOM   7940  C CA  . PHE C  1 196 ? -66.135 -60.804  95.679  1.00 17.99 ? 202  PHE C CA  1 
ATOM   7941  C C   . PHE C  1 196 ? -66.132 -59.546  96.529  1.00 20.50 ? 202  PHE C C   1 
ATOM   7942  O O   . PHE C  1 196 ? -67.187 -59.062  96.947  1.00 17.51 ? 202  PHE C O   1 
ATOM   7943  C CB  . PHE C  1 196 ? -66.192 -60.420  94.197  1.00 16.45 ? 202  PHE C CB  1 
ATOM   7944  C CG  . PHE C  1 196 ? -65.786 -61.527  93.281  1.00 18.34 ? 202  PHE C CG  1 
ATOM   7945  C CD1 . PHE C  1 196 ? -64.445 -61.760  93.011  1.00 18.13 ? 202  PHE C CD1 1 
ATOM   7946  C CD2 . PHE C  1 196 ? -66.738 -62.354  92.712  1.00 23.34 ? 202  PHE C CD2 1 
ATOM   7947  C CE1 . PHE C  1 196 ? -64.059 -62.783  92.177  1.00 18.45 ? 202  PHE C CE1 1 
ATOM   7948  C CE2 . PHE C  1 196 ? -66.360 -63.385  91.876  1.00 23.15 ? 202  PHE C CE2 1 
ATOM   7949  C CZ  . PHE C  1 196 ? -65.014 -63.595  91.605  1.00 20.98 ? 202  PHE C CZ  1 
ATOM   7950  N N   . ALA C  1 197 ? -64.933 -59.034  96.791  1.00 15.87 ? 203  ALA C N   1 
ATOM   7951  C CA  . ALA C  1 197 ? -64.749 -57.826  97.580  1.00 17.00 ? 203  ALA C CA  1 
ATOM   7952  C C   . ALA C  1 197 ? -63.791 -56.882  96.843  1.00 15.94 ? 203  ALA C C   1 
ATOM   7953  O O   . ALA C  1 197 ? -63.039 -57.311  95.972  1.00 21.10 ? 203  ALA C O   1 
ATOM   7954  C CB  . ALA C  1 197 ? -64.213 -58.163  98.959  1.00 17.54 ? 203  ALA C CB  1 
ATOM   7955  N N   . LEU C  1 198 ? -63.818 -55.603  97.193  1.00 12.53 ? 204  LEU C N   1 
ATOM   7956  C CA  . LEU C  1 198 ? -62.930 -54.632  96.559  1.00 12.22 ? 204  LEU C CA  1 
ATOM   7957  C C   . LEU C  1 198 ? -61.711 -54.353  97.425  1.00 14.72 ? 204  LEU C C   1 
ATOM   7958  O O   . LEU C  1 198 ? -61.819 -53.840  98.535  1.00 17.23 ? 204  LEU C O   1 
ATOM   7959  C CB  . LEU C  1 198 ? -63.688 -53.341  96.257  1.00 15.31 ? 204  LEU C CB  1 
ATOM   7960  C CG  . LEU C  1 198 ? -64.823 -53.516  95.247  1.00 14.80 ? 204  LEU C CG  1 
ATOM   7961  C CD1 . LEU C  1 198 ? -65.606 -52.233  95.133  1.00 14.43 ? 204  LEU C CD1 1 
ATOM   7962  C CD2 . LEU C  1 198 ? -64.280 -53.934  93.889  1.00 12.36 ? 204  LEU C CD2 1 
ATOM   7963  N N   . ALA C  1 199 ? -60.547 -54.720  96.908  1.00 15.95 ? 205  ALA C N   1 
ATOM   7964  C CA  . ALA C  1 199 ? -59.303 -54.492  97.611  1.00 14.09 ? 205  ALA C CA  1 
ATOM   7965  C C   . ALA C  1 199 ? -58.603 -53.257  97.036  1.00 13.81 ? 205  ALA C C   1 
ATOM   7966  O O   . ALA C  1 199 ? -58.439 -53.142  95.827  1.00 13.66 ? 205  ALA C O   1 
ATOM   7967  C CB  . ALA C  1 199 ? -58.416 -55.720  97.507  1.00 18.21 ? 205  ALA C CB  1 
ATOM   7968  N N   . SER C  1 200 ? -58.217 -52.330  97.905  1.00 15.56 ? 206  SER C N   1 
ATOM   7969  C CA  . SER C  1 200 ? -57.515 -51.130  97.477  1.00 14.15 ? 206  SER C CA  1 
ATOM   7970  C C   . SER C  1 200 ? -56.183 -51.463  96.828  1.00 16.42 ? 206  SER C C   1 
ATOM   7971  O O   . SER C  1 200 ? -55.439 -52.309  97.313  1.00 17.95 ? 206  SER C O   1 
ATOM   7972  C CB  . SER C  1 200 ? -57.280 -50.193  98.654  1.00 16.37 ? 206  SER C CB  1 
ATOM   7973  O OG  . SER C  1 200 ? -56.537 -49.059  98.238  1.00 20.25 ? 206  SER C OG  1 
ATOM   7974  N N   . MET C  1 201 ? -55.888 -50.774  95.734  1.00 15.95 ? 207  MET C N   1 
ATOM   7975  C CA  . MET C  1 201 ? -54.608 -50.907  95.064  1.00 17.81 ? 207  MET C CA  1 
ATOM   7976  C C   . MET C  1 201 ? -53.633 -49.832  95.513  1.00 13.12 ? 207  MET C C   1 
ATOM   7977  O O   . MET C  1 201 ? -52.502 -49.773  95.049  1.00 13.87 ? 207  MET C O   1 
ATOM   7978  C CB  . MET C  1 201 ? -54.787 -50.827  93.559  1.00 15.23 ? 207  MET C CB  1 
ATOM   7979  C CG  . MET C  1 201 ? -55.670 -51.883  93.000  1.00 14.39 ? 207  MET C CG  1 
ATOM   7980  S SD  . MET C  1 201 ? -55.997 -51.509  91.282  1.00 18.64 ? 207  MET C SD  1 
ATOM   7981  C CE  . MET C  1 201 ? -54.358 -51.704  90.578  1.00 16.64 ? 207  MET C CE  1 
ATOM   7982  N N   . GLY C  1 202 ? -54.069 -48.967  96.410  1.00 13.87 ? 208  GLY C N   1 
ATOM   7983  C CA  . GLY C  1 202 ? -53.206 -47.890  96.844  1.00 15.58 ? 208  GLY C CA  1 
ATOM   7984  C C   . GLY C  1 202 ? -53.003 -46.901  95.718  1.00 16.79 ? 208  GLY C C   1 
ATOM   7985  O O   . GLY C  1 202 ? -51.963 -46.252  95.630  1.00 16.32 ? 208  GLY C O   1 
ATOM   7986  N N   . ILE C  1 203 ? -54.013 -46.814  94.856  1.00 16.41 ? 209  ILE C N   1 
ATOM   7987  C CA  . ILE C  1 203 ? -54.067 -45.875  93.745  1.00 15.13 ? 209  ILE C CA  1 
ATOM   7988  C C   . ILE C  1 203 ? -55.191 -44.873  93.994  1.00 19.26 ? 209  ILE C C   1 
ATOM   7989  O O   . ILE C  1 203 ? -56.345 -45.267  94.182  1.00 18.83 ? 209  ILE C O   1 
ATOM   7990  C CB  . ILE C  1 203 ? -54.310 -46.596  92.413  1.00 13.76 ? 209  ILE C CB  1 
ATOM   7991  C CG1 . ILE C  1 203 ? -53.096 -47.440  92.042  1.00 12.97 ? 209  ILE C CG1 1 
ATOM   7992  C CG2 . ILE C  1 203 ? -54.618 -45.605  91.304  1.00 17.81 ? 209  ILE C CG2 1 
ATOM   7993  C CD1 . ILE C  1 203 ? -53.301 -48.235  90.771  1.00 14.81 ? 209  ILE C CD1 1 
ATOM   7994  N N   . TYR C  1 204 ? -54.860 -43.584  94.007  1.00 18.93 ? 210  TYR C N   1 
ATOM   7995  C CA  . TYR C  1 204 ? -55.833 -42.553  94.355  1.00 14.91 ? 210  TYR C CA  1 
ATOM   7996  C C   . TYR C  1 204 ? -55.773 -41.381  93.406  1.00 20.43 ? 210  TYR C C   1 
ATOM   7997  O O   . TYR C  1 204 ? -54.702 -40.843  93.154  1.00 19.96 ? 210  TYR C O   1 
ATOM   7998  C CB  . TYR C  1 204 ? -55.593 -42.044  95.769  1.00 16.27 ? 210  TYR C CB  1 
ATOM   7999  C CG  . TYR C  1 204 ? -55.199 -43.113  96.738  1.00 18.43 ? 210  TYR C CG  1 
ATOM   8000  C CD1 . TYR C  1 204 ? -56.079 -44.131  97.075  1.00 18.49 ? 210  TYR C CD1 1 
ATOM   8001  C CD2 . TYR C  1 204 ? -53.940 -43.118  97.304  1.00 18.81 ? 210  TYR C CD2 1 
ATOM   8002  C CE1 . TYR C  1 204 ? -55.717 -45.116  97.956  1.00 22.03 ? 210  TYR C CE1 1 
ATOM   8003  C CE2 . TYR C  1 204 ? -53.570 -44.095  98.181  1.00 18.89 ? 210  TYR C CE2 1 
ATOM   8004  C CZ  . TYR C  1 204 ? -54.460 -45.095  98.500  1.00 23.33 ? 210  TYR C CZ  1 
ATOM   8005  O OH  . TYR C  1 204 ? -54.074 -46.065  99.397  1.00 25.74 ? 210  TYR C OH  1 
ATOM   8006  N N   . VAL C  1 205 ? -56.930 -40.978  92.895  1.00 20.89 ? 211  VAL C N   1 
ATOM   8007  C CA  . VAL C  1 205 ? -57.044 -39.781  92.068  1.00 16.25 ? 211  VAL C CA  1 
ATOM   8008  C C   . VAL C  1 205 ? -57.702 -38.653  92.865  1.00 19.38 ? 211  VAL C C   1 
ATOM   8009  O O   . VAL C  1 205 ? -58.754 -38.855  93.470  1.00 13.97 ? 211  VAL C O   1 
ATOM   8010  C CB  . VAL C  1 205 ? -57.846 -40.071  90.789  1.00 15.59 ? 211  VAL C CB  1 
ATOM   8011  C CG1 . VAL C  1 205 ? -58.149 -38.791  90.037  1.00 16.06 ? 211  VAL C CG1 1 
ATOM   8012  C CG2 . VAL C  1 205 ? -57.071 -41.024  89.905  1.00 18.65 ? 211  VAL C CG2 1 
ATOM   8013  N N   . PHE C  1 206 ? -57.050 -37.489  92.902  1.00 18.18 ? 212  PHE C N   1 
ATOM   8014  C CA  . PHE C  1 206 ? -57.593 -36.277  93.523  1.00 16.02 ? 212  PHE C CA  1 
ATOM   8015  C C   . PHE C  1 206 ? -57.598 -35.105  92.560  1.00 18.14 ? 212  PHE C C   1 
ATOM   8016  O O   . PHE C  1 206 ? -56.839 -35.106  91.595  1.00 17.75 ? 212  PHE C O   1 
ATOM   8017  C CB  . PHE C  1 206 ? -56.766 -35.815  94.722  1.00 18.36 ? 212  PHE C CB  1 
ATOM   8018  C CG  . PHE C  1 206 ? -56.571 -36.827  95.784  1.00 16.03 ? 212  PHE C CG  1 
ATOM   8019  C CD1 . PHE C  1 206 ? -55.520 -37.724  95.717  1.00 12.12 ? 212  PHE C CD1 1 
ATOM   8020  C CD2 . PHE C  1 206 ? -57.403 -36.837  96.893  1.00 16.61 ? 212  PHE C CD2 1 
ATOM   8021  C CE1 . PHE C  1 206 ? -55.321 -38.638  96.725  1.00 12.07 ? 212  PHE C CE1 1 
ATOM   8022  C CE2 . PHE C  1 206 ? -57.211 -37.741  97.910  1.00 15.31 ? 212  PHE C CE2 1 
ATOM   8023  C CZ  . PHE C  1 206 ? -56.176 -38.651  97.827  1.00 13.36 ? 212  PHE C CZ  1 
ATOM   8024  N N   . HIS C  1 207 ? -58.391 -34.073  92.857  1.00 16.83 ? 213  HIS C N   1 
ATOM   8025  C CA  . HIS C  1 207 ? -58.086 -32.759  92.302  1.00 17.08 ? 213  HIS C CA  1 
ATOM   8026  C C   . HIS C  1 207 ? -56.910 -32.244  93.125  1.00 16.32 ? 213  HIS C C   1 
ATOM   8027  O O   . HIS C  1 207 ? -56.851 -32.468  94.329  1.00 15.02 ? 213  HIS C O   1 
ATOM   8028  C CB  . HIS C  1 207 ? -59.263 -31.775  92.363  1.00 19.04 ? 213  HIS C CB  1 
ATOM   8029  C CG  . HIS C  1 207 ? -60.425 -32.128  91.485  1.00 23.12 ? 213  HIS C CG  1 
ATOM   8030  N ND1 . HIS C  1 207 ? -61.224 -33.226  91.711  1.00 33.89 ? 213  HIS C ND1 1 
ATOM   8031  C CD2 . HIS C  1 207 ? -60.907 -31.540  90.364  1.00 19.45 ? 213  HIS C CD2 1 
ATOM   8032  C CE1 . HIS C  1 207 ? -62.165 -33.284  90.786  1.00 30.19 ? 213  HIS C CE1 1 
ATOM   8033  N NE2 . HIS C  1 207 ? -61.989 -32.278  89.950  1.00 24.75 ? 213  HIS C NE2 1 
ATOM   8034  N N   . THR C  1 208 ? -55.970 -31.565  92.490  1.00 16.04 ? 214  THR C N   1 
ATOM   8035  C CA  . THR C  1 208 ? -54.781 -31.119  93.198  1.00 18.28 ? 214  THR C CA  1 
ATOM   8036  C C   . THR C  1 208 ? -55.107 -30.161  94.355  1.00 20.29 ? 214  THR C C   1 
ATOM   8037  O O   . THR C  1 208 ? -54.525 -30.266  95.433  1.00 21.44 ? 214  THR C O   1 
ATOM   8038  C CB  . THR C  1 208 ? -53.799 -30.455  92.221  1.00 18.79 ? 214  THR C CB  1 
ATOM   8039  O OG1 . THR C  1 208 ? -53.476 -31.394  91.192  1.00 18.89 ? 214  THR C OG1 1 
ATOM   8040  C CG2 . THR C  1 208 ? -52.512 -30.042  92.920  1.00 19.17 ? 214  THR C CG2 1 
ATOM   8041  N N   . LYS C  1 209 ? -56.050 -29.249  94.143  1.00 20.71 ? 215  LYS C N   1 
ATOM   8042  C CA  . LYS C  1 209 ? -56.404 -28.278  95.184  1.00 21.22 ? 215  LYS C CA  1 
ATOM   8043  C C   . LYS C  1 209 ? -56.945 -28.962  96.440  1.00 17.18 ? 215  LYS C C   1 
ATOM   8044  O O   . LYS C  1 209 ? -56.595 -28.587  97.557  1.00 24.75 ? 215  LYS C O   1 
ATOM   8045  C CB  . LYS C  1 209 ? -57.426 -27.270  94.648  1.00 22.37 ? 215  LYS C CB  1 
ATOM   8046  C CG  . LYS C  1 209 ? -57.812 -26.186  95.634  1.00 28.60 ? 215  LYS C CG  1 
ATOM   8047  C CD  . LYS C  1 209 ? -59.062 -25.470  95.163  1.00 33.60 ? 215  LYS C CD  1 
ATOM   8048  C CE  . LYS C  1 209 ? -59.271 -24.155  95.874  1.00 33.02 ? 215  LYS C CE  1 
ATOM   8049  N NZ  . LYS C  1 209 ? -60.410 -23.424  95.263  1.00 31.80 ? 215  LYS C NZ  1 
ATOM   8050  N N   . PHE C  1 210 ? -57.790 -29.972  96.252  1.00 17.11 ? 216  PHE C N   1 
ATOM   8051  C CA  . PHE C  1 210 ? -58.319 -30.766  97.364  1.00 17.80 ? 216  PHE C CA  1 
ATOM   8052  C C   . PHE C  1 210 ? -57.237 -31.542  98.099  1.00 20.25 ? 216  PHE C C   1 
ATOM   8053  O O   . PHE C  1 210 ? -57.250 -31.634  99.331  1.00 21.32 ? 216  PHE C O   1 
ATOM   8054  C CB  . PHE C  1 210 ? -59.382 -31.742  96.863  1.00 19.20 ? 216  PHE C CB  1 
ATOM   8055  C CG  . PHE C  1 210 ? -59.952 -32.611  97.939  1.00 24.03 ? 216  PHE C CG  1 
ATOM   8056  C CD1 . PHE C  1 210 ? -61.014 -32.170  98.715  1.00 27.08 ? 216  PHE C CD1 1 
ATOM   8057  C CD2 . PHE C  1 210 ? -59.427 -33.870  98.183  1.00 27.02 ? 216  PHE C CD2 1 
ATOM   8058  C CE1 . PHE C  1 210 ? -61.543 -32.966  99.712  1.00 28.95 ? 216  PHE C CE1 1 
ATOM   8059  C CE2 . PHE C  1 210 ? -59.947 -34.669  99.183  1.00 29.64 ? 216  PHE C CE2 1 
ATOM   8060  C CZ  . PHE C  1 210 ? -61.006 -34.213  99.950  1.00 30.20 ? 216  PHE C CZ  1 
ATOM   8061  N N   . LEU C  1 211 ? -56.318 -32.127  97.337  1.00 17.48 ? 217  LEU C N   1 
ATOM   8062  C CA  . LEU C  1 211 ? -55.261 -32.930  97.916  1.00 16.29 ? 217  LEU C CA  1 
ATOM   8063  C C   . LEU C  1 211 ? -54.303 -32.064  98.726  1.00 15.48 ? 217  LEU C C   1 
ATOM   8064  O O   . LEU C  1 211 ? -53.852 -32.473  99.791  1.00 18.26 ? 217  LEU C O   1 
ATOM   8065  C CB  . LEU C  1 211 ? -54.493 -33.684  96.827  1.00 17.96 ? 217  LEU C CB  1 
ATOM   8066  C CG  . LEU C  1 211 ? -53.436 -34.655  97.356  1.00 16.09 ? 217  LEU C CG  1 
ATOM   8067  C CD1 . LEU C  1 211 ? -54.121 -35.712  98.214  1.00 16.84 ? 217  LEU C CD1 1 
ATOM   8068  C CD2 . LEU C  1 211 ? -52.653 -35.302  96.229  1.00 16.95 ? 217  LEU C CD2 1 
ATOM   8069  N N   . MET C  1 212 ? -53.984 -30.874  98.228  1.00 17.01 ? 218  MET C N   1 
ATOM   8070  C CA  . MET C  1 212 ? -53.091 -29.997  98.972  1.00 18.52 ? 218  MET C CA  1 
ATOM   8071  C C   . MET C  1 212 ? -53.778 -29.597  100.279 1.00 20.31 ? 218  MET C C   1 
ATOM   8072  O O   . MET C  1 212 ? -53.136 -29.538  101.332 1.00 21.76 ? 218  MET C O   1 
ATOM   8073  C CB  . MET C  1 212 ? -52.697 -28.764  98.152  1.00 17.14 ? 218  MET C CB  1 
ATOM   8074  C CG  . MET C  1 212 ? -52.004 -29.084  96.827  1.00 15.35 ? 218  MET C CG  1 
ATOM   8075  S SD  . MET C  1 212 ? -50.535 -30.132  96.965  1.00 32.80 ? 218  MET C SD  1 
ATOM   8076  C CE  . MET C  1 212 ? -51.182 -31.713  96.425  1.00 26.16 ? 218  MET C CE  1 
ATOM   8077  N N   . GLU C  1 213 ? -55.085 -29.354  100.201 1.00 19.13 ? 219  GLU C N   1 
ATOM   8078  C CA  . GLU C  1 213 ? -55.903 -29.088  101.383 1.00 22.88 ? 219  GLU C CA  1 
ATOM   8079  C C   . GLU C  1 213 ? -55.793 -30.212  102.412 1.00 23.34 ? 219  GLU C C   1 
ATOM   8080  O O   . GLU C  1 213 ? -55.465 -29.978  103.572 1.00 28.51 ? 219  GLU C O   1 
ATOM   8081  C CB  . GLU C  1 213 ? -57.374 -28.908  100.997 1.00 25.15 ? 219  GLU C CB  1 
ATOM   8082  C CG  . GLU C  1 213 ? -57.730 -27.598  100.307 1.00 30.59 ? 219  GLU C CG  1 
ATOM   8083  C CD  . GLU C  1 213 ? -59.220 -27.504  99.978  1.00 37.03 ? 219  GLU C CD  1 
ATOM   8084  O OE1 . GLU C  1 213 ? -60.041 -27.955  100.808 1.00 41.02 ? 219  GLU C OE1 1 
ATOM   8085  O OE2 . GLU C  1 213 ? -59.567 -26.995  98.887  1.00 37.80 ? 219  GLU C OE2 1 
ATOM   8086  N N   . ALA C  1 214 ? -56.075 -31.431  101.971 1.00 17.96 ? 220  ALA C N   1 
ATOM   8087  C CA  . ALA C  1 214 ? -56.024 -32.600  102.835 1.00 18.79 ? 220  ALA C CA  1 
ATOM   8088  C C   . ALA C  1 214 ? -54.631 -32.794  103.414 1.00 18.67 ? 220  ALA C C   1 
ATOM   8089  O O   . ALA C  1 214 ? -54.472 -33.109  104.582 1.00 22.56 ? 220  ALA C O   1 
ATOM   8090  C CB  . ALA C  1 214 ? -56.456 -33.834  102.074 1.00 16.41 ? 220  ALA C CB  1 
ATOM   8091  N N   . LEU C  1 215 ? -53.613 -32.595  102.596 1.00 20.55 ? 221  LEU C N   1 
ATOM   8092  C CA  . LEU C  1 215 ? -52.261 -32.799  103.075 1.00 20.22 ? 221  LEU C CA  1 
ATOM   8093  C C   . LEU C  1 215 ? -51.821 -31.769  104.089 1.00 26.39 ? 221  LEU C C   1 
ATOM   8094  O O   . LEU C  1 215 ? -50.994 -32.060  104.963 1.00 24.88 ? 221  LEU C O   1 
ATOM   8095  C CB  . LEU C  1 215 ? -51.283 -32.810  101.917 1.00 21.79 ? 221  LEU C CB  1 
ATOM   8096  C CG  . LEU C  1 215 ? -51.093 -34.288  101.681 1.00 17.01 ? 221  LEU C CG  1 
ATOM   8097  C CD1 . LEU C  1 215 ? -52.147 -34.817  100.807 1.00 19.50 ? 221  LEU C CD1 1 
ATOM   8098  C CD2 . LEU C  1 215 ? -49.795 -34.483  101.089 1.00 28.82 ? 221  LEU C CD2 1 
ATOM   8099  N N   . ARG C  1 216 ? -52.358 -30.562  103.973 1.00 27.32 ? 222  ARG C N   1 
ATOM   8100  C CA  . ARG C  1 216 ? -52.030 -29.522  104.933 1.00 27.51 ? 222  ARG C CA  1 
ATOM   8101  C C   . ARG C  1 216 ? -52.816 -29.738  106.227 1.00 26.55 ? 222  ARG C C   1 
ATOM   8102  O O   . ARG C  1 216 ? -52.331 -29.419  107.309 1.00 30.30 ? 222  ARG C O   1 
ATOM   8103  C CB  . ARG C  1 216 ? -52.288 -28.139  104.334 1.00 22.55 ? 222  ARG C CB  1 
ATOM   8104  C CG  . ARG C  1 216 ? -51.300 -27.779  103.233 1.00 22.02 ? 222  ARG C CG  1 
ATOM   8105  C CD  . ARG C  1 216 ? -51.531 -26.382  102.688 1.00 24.29 ? 222  ARG C CD  1 
ATOM   8106  N NE  . ARG C  1 216 ? -50.410 -25.900  101.877 1.00 29.05 ? 222  ARG C NE  1 
ATOM   8107  C CZ  . ARG C  1 216 ? -50.471 -25.650  100.568 1.00 27.07 ? 222  ARG C CZ  1 
ATOM   8108  N NH1 . ARG C  1 216 ? -51.600 -25.829  99.897  1.00 28.24 ? 222  ARG C NH1 1 
ATOM   8109  N NH2 . ARG C  1 216 ? -49.401 -25.215  99.930  1.00 27.39 ? 222  ARG C NH2 1 
ATOM   8110  N N   . ARG C  1 217 ? -54.013 -30.307  106.123 1.00 23.18 ? 223  ARG C N   1 
ATOM   8111  C CA  . ARG C  1 217 ? -54.779 -30.644  107.316 1.00 25.17 ? 223  ARG C CA  1 
ATOM   8112  C C   . ARG C  1 217 ? -54.118 -31.788  108.073 1.00 33.75 ? 223  ARG C C   1 
ATOM   8113  O O   . ARG C  1 217 ? -54.107 -31.816  109.306 1.00 40.67 ? 223  ARG C O   1 
ATOM   8114  C CB  . ARG C  1 217 ? -56.216 -31.027  106.959 1.00 26.66 ? 223  ARG C CB  1 
ATOM   8115  C CG  . ARG C  1 217 ? -57.041 -31.501  108.160 1.00 31.34 ? 223  ARG C CG  1 
ATOM   8116  C CD  . ARG C  1 217 ? -58.430 -31.964  107.756 1.00 33.37 ? 223  ARG C CD  1 
ATOM   8117  N NE  . ARG C  1 217 ? -58.366 -33.066  106.805 1.00 39.30 ? 223  ARG C NE  1 
ATOM   8118  C CZ  . ARG C  1 217 ? -59.094 -33.137  105.696 1.00 45.03 ? 223  ARG C CZ  1 
ATOM   8119  N NH1 . ARG C  1 217 ? -59.951 -32.171  105.401 1.00 47.14 ? 223  ARG C NH1 1 
ATOM   8120  N NH2 . ARG C  1 217 ? -58.970 -34.178  104.884 1.00 46.32 ? 223  ARG C NH2 1 
ATOM   8121  N N   . ASP C  1 218 ? -53.564 -32.734  107.326 1.00 29.82 ? 224  ASP C N   1 
ATOM   8122  C CA  . ASP C  1 218 ? -52.957 -33.908  107.921 1.00 24.08 ? 224  ASP C CA  1 
ATOM   8123  C C   . ASP C  1 218 ? -51.671 -33.574  108.662 1.00 26.40 ? 224  ASP C C   1 
ATOM   8124  O O   . ASP C  1 218 ? -51.413 -34.106  109.742 1.00 29.79 ? 224  ASP C O   1 
ATOM   8125  C CB  . ASP C  1 218 ? -52.690 -34.950  106.845 1.00 21.56 ? 224  ASP C CB  1 
ATOM   8126  C CG  . ASP C  1 218 ? -52.048 -36.196  107.394 1.00 24.98 ? 224  ASP C CG  1 
ATOM   8127  O OD1 . ASP C  1 218 ? -52.762 -36.995  108.040 1.00 24.47 ? 224  ASP C OD1 1 
ATOM   8128  O OD2 . ASP C  1 218 ? -50.827 -36.377  107.184 1.00 27.81 ? 224  ASP C OD2 1 
ATOM   8129  N N   . ALA C  1 219 ? -50.864 -32.693  108.083 1.00 24.04 ? 225  ALA C N   1 
ATOM   8130  C CA  . ALA C  1 219 ? -49.573 -32.347  108.674 1.00 27.35 ? 225  ALA C CA  1 
ATOM   8131  C C   . ALA C  1 219 ? -49.712 -31.632  110.015 1.00 31.38 ? 225  ALA C C   1 
ATOM   8132  O O   . ALA C  1 219 ? -48.837 -31.737  110.868 1.00 33.44 ? 225  ALA C O   1 
ATOM   8133  C CB  . ALA C  1 219 ? -48.769 -31.490  107.716 1.00 28.14 ? 225  ALA C CB  1 
ATOM   8134  N N   . ALA C  1 220 ? -50.804 -30.900  110.194 1.00 31.53 ? 226  ALA C N   1 
ATOM   8135  C CA  . ALA C  1 220 ? -51.000 -30.129  111.412 1.00 34.64 ? 226  ALA C CA  1 
ATOM   8136  C C   . ALA C  1 220 ? -51.727 -30.951  112.482 1.00 39.91 ? 226  ALA C C   1 
ATOM   8137  O O   . ALA C  1 220 ? -51.934 -30.482  113.603 1.00 41.22 ? 226  ALA C O   1 
ATOM   8138  C CB  . ALA C  1 220 ? -51.758 -28.854  111.107 1.00 34.06 ? 226  ALA C CB  1 
ATOM   8139  N N   . ASP C  1 221 ? -52.109 -32.174  112.124 1.00 37.98 ? 227  ASP C N   1 
ATOM   8140  C CA  . ASP C  1 221 ? -52.736 -33.105  113.055 1.00 36.29 ? 227  ASP C CA  1 
ATOM   8141  C C   . ASP C  1 221 ? -51.699 -34.052  113.662 1.00 40.92 ? 227  ASP C C   1 
ATOM   8142  O O   . ASP C  1 221 ? -51.302 -35.032  113.033 1.00 41.36 ? 227  ASP C O   1 
ATOM   8143  C CB  . ASP C  1 221 ? -53.825 -33.897  112.340 1.00 36.57 ? 227  ASP C CB  1 
ATOM   8144  C CG  . ASP C  1 221 ? -54.393 -35.007  113.190 1.00 45.79 ? 227  ASP C CG  1 
ATOM   8145  O OD1 . ASP C  1 221 ? -54.151 -35.024  114.416 1.00 47.27 ? 227  ASP C OD1 1 
ATOM   8146  O OD2 . ASP C  1 221 ? -55.099 -35.867  112.628 1.00 51.88 ? 227  ASP C OD2 1 
ATOM   8147  N N   . PRO C  1 222 ? -51.289 -33.785  114.911 1.00 42.70 ? 228  PRO C N   1 
ATOM   8148  C CA  . PRO C  1 222 ? -50.168 -34.493  115.543 1.00 39.92 ? 228  PRO C CA  1 
ATOM   8149  C C   . PRO C  1 222 ? -50.456 -35.960  115.829 1.00 34.38 ? 228  PRO C C   1 
ATOM   8150  O O   . PRO C  1 222 ? -49.542 -36.698  116.180 1.00 37.13 ? 228  PRO C O   1 
ATOM   8151  C CB  . PRO C  1 222 ? -49.960 -33.727  116.857 1.00 42.40 ? 228  PRO C CB  1 
ATOM   8152  C CG  . PRO C  1 222 ? -50.726 -32.443  116.697 1.00 43.15 ? 228  PRO C CG  1 
ATOM   8153  C CD  . PRO C  1 222 ? -51.879 -32.788  115.816 1.00 42.06 ? 228  PRO C CD  1 
ATOM   8154  N N   . THR C  1 223 ? -51.707 -36.375  115.684 1.00 32.11 ? 229  THR C N   1 
ATOM   8155  C CA  . THR C  1 223 ? -52.073 -37.760  115.942 1.00 39.78 ? 229  THR C CA  1 
ATOM   8156  C C   . THR C  1 223 ? -51.897 -38.605  114.690 1.00 38.38 ? 229  THR C C   1 
ATOM   8157  O O   . THR C  1 223 ? -51.790 -39.831  114.760 1.00 32.77 ? 229  THR C O   1 
ATOM   8158  C CB  . THR C  1 223 ? -53.528 -37.887  116.410 1.00 44.62 ? 229  THR C CB  1 
ATOM   8159  O OG1 . THR C  1 223 ? -54.392 -37.940  115.266 1.00 48.93 ? 229  THR C OG1 1 
ATOM   8160  C CG2 . THR C  1 223 ? -53.912 -36.709  117.292 1.00 44.88 ? 229  THR C CG2 1 
ATOM   8161  N N   . SER C  1 224 ? -51.877 -37.933  113.545 1.00 41.69 ? 230  SER C N   1 
ATOM   8162  C CA  . SER C  1 224 ? -51.817 -38.601  112.249 1.00 36.99 ? 230  SER C CA  1 
ATOM   8163  C C   . SER C  1 224 ? -50.525 -39.388  112.053 1.00 29.12 ? 230  SER C C   1 
ATOM   8164  O O   . SER C  1 224 ? -49.438 -38.933  112.424 1.00 27.43 ? 230  SER C O   1 
ATOM   8165  C CB  . SER C  1 224 ? -51.973 -37.573  111.124 1.00 37.96 ? 230  SER C CB  1 
ATOM   8166  O OG  . SER C  1 224 ? -51.954 -38.197  109.853 1.00 37.73 ? 230  SER C OG  1 
ATOM   8167  N N   . SER C  1 225 ? -50.649 -40.572  111.463 1.00 23.88 ? 231  SER C N   1 
ATOM   8168  C CA  . SER C  1 225 ? -49.477 -41.342  111.060 1.00 29.04 ? 231  SER C CA  1 
ATOM   8169  C C   . SER C  1 225 ? -49.000 -40.884  109.687 1.00 31.68 ? 231  SER C C   1 
ATOM   8170  O O   . SER C  1 225 ? -48.088 -41.471  109.097 1.00 33.99 ? 231  SER C O   1 
ATOM   8171  C CB  . SER C  1 225 ? -49.785 -42.841  111.062 1.00 30.94 ? 231  SER C CB  1 
ATOM   8172  O OG  . SER C  1 225 ? -51.033 -43.103  110.455 1.00 36.90 ? 231  SER C OG  1 
ATOM   8173  N N   . ARG C  1 226 ? -49.639 -39.832  109.186 1.00 29.57 ? 232  ARG C N   1 
ATOM   8174  C CA  . ARG C  1 226 ? -49.221 -39.170  107.951 1.00 22.64 ? 232  ARG C CA  1 
ATOM   8175  C C   . ARG C  1 226 ? -49.200 -40.109  106.751 1.00 23.49 ? 232  ARG C C   1 
ATOM   8176  O O   . ARG C  1 226 ? -48.386 -39.945  105.837 1.00 28.02 ? 232  ARG C O   1 
ATOM   8177  C CB  . ARG C  1 226 ? -47.838 -38.533  108.133 1.00 20.31 ? 232  ARG C CB  1 
ATOM   8178  C CG  . ARG C  1 226 ? -47.660 -37.736  109.420 1.00 19.76 ? 232  ARG C CG  1 
ATOM   8179  C CD  . ARG C  1 226 ? -48.522 -36.498  109.414 1.00 19.95 ? 232  ARG C CD  1 
ATOM   8180  N NE  . ARG C  1 226 ? -48.419 -35.770  108.147 1.00 21.23 ? 232  ARG C NE  1 
ATOM   8181  C CZ  . ARG C  1 226 ? -47.380 -35.019  107.797 1.00 26.53 ? 232  ARG C CZ  1 
ATOM   8182  N NH1 . ARG C  1 226 ? -46.347 -34.896  108.619 1.00 31.03 ? 232  ARG C NH1 1 
ATOM   8183  N NH2 . ARG C  1 226 ? -47.369 -34.392  106.624 1.00 23.87 ? 232  ARG C NH2 1 
ATOM   8184  N N   . ASP C  1 227 ? -50.091 -41.097  106.758 1.00 23.22 ? 233  ASP C N   1 
ATOM   8185  C CA  . ASP C  1 227 ? -50.205 -42.026  105.630 1.00 25.18 ? 233  ASP C CA  1 
ATOM   8186  C C   . ASP C  1 227 ? -51.507 -41.800  104.866 1.00 23.84 ? 233  ASP C C   1 
ATOM   8187  O O   . ASP C  1 227 ? -52.495 -41.368  105.447 1.00 23.55 ? 233  ASP C O   1 
ATOM   8188  C CB  . ASP C  1 227 ? -50.128 -43.474  106.102 1.00 31.75 ? 233  ASP C CB  1 
ATOM   8189  C CG  . ASP C  1 227 ? -48.696 -43.974  106.261 1.00 42.35 ? 233  ASP C CG  1 
ATOM   8190  O OD1 . ASP C  1 227 ? -47.828 -43.534  105.496 1.00 41.12 ? 233  ASP C OD1 1 
ATOM   8191  O OD2 . ASP C  1 227 ? -48.442 -44.825  107.152 1.00 46.86 ? 233  ASP C OD2 1 
ATOM   8192  N N   . PHE C  1 228 ? -51.502 -42.062  103.560 1.00 23.14 ? 234  PHE C N   1 
ATOM   8193  C CA  . PHE C  1 228 ? -52.746 -42.052  102.790 1.00 20.15 ? 234  PHE C CA  1 
ATOM   8194  C C   . PHE C  1 228 ? -53.672 -43.155  103.288 1.00 23.98 ? 234  PHE C C   1 
ATOM   8195  O O   . PHE C  1 228 ? -54.871 -42.952  103.461 1.00 28.41 ? 234  PHE C O   1 
ATOM   8196  C CB  . PHE C  1 228 ? -52.472 -42.231  101.298 1.00 19.39 ? 234  PHE C CB  1 
ATOM   8197  C CG  . PHE C  1 228 ? -52.116 -40.954  100.594 1.00 22.04 ? 234  PHE C CG  1 
ATOM   8198  C CD1 . PHE C  1 228 ? -53.111 -40.113  100.138 1.00 22.63 ? 234  PHE C CD1 1 
ATOM   8199  C CD2 . PHE C  1 228 ? -50.788 -40.589  100.396 1.00 23.90 ? 234  PHE C CD2 1 
ATOM   8200  C CE1 . PHE C  1 228 ? -52.801 -38.936  99.495  1.00 20.45 ? 234  PHE C CE1 1 
ATOM   8201  C CE2 . PHE C  1 228 ? -50.467 -39.403  99.753  1.00 21.95 ? 234  PHE C CE2 1 
ATOM   8202  C CZ  . PHE C  1 228 ? -51.480 -38.577  99.300  1.00 19.90 ? 234  PHE C CZ  1 
ATOM   8203  N N   . GLY C  1 229 ? -53.091 -44.323  103.535 1.00 24.16 ? 235  GLY C N   1 
ATOM   8204  C CA  . GLY C  1 229 ? -53.836 -45.494  103.967 1.00 26.67 ? 235  GLY C CA  1 
ATOM   8205  C C   . GLY C  1 229 ? -54.482 -45.416  105.332 1.00 25.63 ? 235  GLY C C   1 
ATOM   8206  O O   . GLY C  1 229 ? -55.686 -45.591  105.461 1.00 29.23 ? 235  GLY C O   1 
ATOM   8207  N N   . LYS C  1 230 ? -53.684 -45.173  106.362 1.00 29.31 ? 236  LYS C N   1 
ATOM   8208  C CA  . LYS C  1 230 ? -54.219 -45.124  107.709 1.00 30.72 ? 236  LYS C CA  1 
ATOM   8209  C C   . LYS C  1 230 ? -54.987 -43.830  107.969 1.00 32.20 ? 236  LYS C C   1 
ATOM   8210  O O   . LYS C  1 230 ? -55.996 -43.827  108.671 1.00 40.44 ? 236  LYS C O   1 
ATOM   8211  C CB  . LYS C  1 230 ? -53.096 -45.265  108.732 1.00 36.93 ? 236  LYS C CB  1 
ATOM   8212  C CG  . LYS C  1 230 ? -52.264 -46.524  108.601 1.00 43.65 ? 236  LYS C CG  1 
ATOM   8213  C CD  . LYS C  1 230 ? -53.092 -47.789  108.752 1.00 52.99 ? 236  LYS C CD  1 
ATOM   8214  C CE  . LYS C  1 230 ? -52.203 -49.027  108.719 1.00 56.74 ? 236  LYS C CE  1 
ATOM   8215  N NZ  . LYS C  1 230 ? -52.932 -50.325  108.772 1.00 57.28 ? 236  LYS C NZ  1 
ATOM   8216  N N   . ASP C  1 231 ? -54.512 -42.721  107.419 1.00 27.06 ? 237  ASP C N   1 
ATOM   8217  C CA  . ASP C  1 231 ? -55.058 -41.432  107.827 1.00 27.28 ? 237  ASP C CA  1 
ATOM   8218  C C   . ASP C  1 231 ? -55.932 -40.738  106.779 1.00 24.44 ? 237  ASP C C   1 
ATOM   8219  O O   . ASP C  1 231 ? -57.132 -40.590  106.992 1.00 26.62 ? 237  ASP C O   1 
ATOM   8220  C CB  . ASP C  1 231 ? -53.919 -40.507  108.255 1.00 29.59 ? 237  ASP C CB  1 
ATOM   8221  C CG  . ASP C  1 231 ? -52.970 -41.171  109.236 1.00 36.79 ? 237  ASP C CG  1 
ATOM   8222  O OD1 . ASP C  1 231 ? -53.326 -41.259  110.433 1.00 37.37 ? 237  ASP C OD1 1 
ATOM   8223  O OD2 . ASP C  1 231 ? -51.860 -41.593  108.818 1.00 36.48 ? 237  ASP C OD2 1 
ATOM   8224  N N   . ILE C  1 232 ? -55.346 -40.314  105.661 1.00 21.43 ? 238  ILE C N   1 
ATOM   8225  C CA  . ILE C  1 232 ? -56.056 -39.462  104.702 1.00 22.45 ? 238  ILE C CA  1 
ATOM   8226  C C   . ILE C  1 232 ? -57.324 -40.080  104.121 1.00 24.06 ? 238  ILE C C   1 
ATOM   8227  O O   . ILE C  1 232 ? -58.396 -39.476  104.167 1.00 25.24 ? 238  ILE C O   1 
ATOM   8228  C CB  . ILE C  1 232 ? -55.128 -39.062  103.538 1.00 23.75 ? 238  ILE C CB  1 
ATOM   8229  C CG1 . ILE C  1 232 ? -54.122 -38.025  104.029 1.00 24.03 ? 238  ILE C CG1 1 
ATOM   8230  C CG2 . ILE C  1 232 ? -55.933 -38.547  102.337 1.00 22.42 ? 238  ILE C CG2 1 
ATOM   8231  C CD1 . ILE C  1 232 ? -53.555 -37.197  102.950 1.00 28.74 ? 238  ILE C CD1 1 
ATOM   8232  N N   . ILE C  1 233 ? -57.205 -41.284  103.580 1.00 25.66 ? 239  ILE C N   1 
ATOM   8233  C CA  . ILE C  1 233 ? -58.335 -41.931  102.925 1.00 24.67 ? 239  ILE C CA  1 
ATOM   8234  C C   . ILE C  1 233 ? -59.471 -42.268  103.890 1.00 24.96 ? 239  ILE C C   1 
ATOM   8235  O O   . ILE C  1 233 ? -60.631 -42.000  103.575 1.00 24.89 ? 239  ILE C O   1 
ATOM   8236  C CB  . ILE C  1 233 ? -57.899 -43.212  102.187 1.00 26.09 ? 239  ILE C CB  1 
ATOM   8237  C CG1 . ILE C  1 233 ? -57.006 -42.849  101.002 1.00 25.72 ? 239  ILE C CG1 1 
ATOM   8238  C CG2 . ILE C  1 233 ? -59.118 -44.008  101.748 1.00 26.33 ? 239  ILE C CG2 1 
ATOM   8239  C CD1 . ILE C  1 233 ? -57.656 -41.889  100.059 1.00 23.64 ? 239  ILE C CD1 1 
ATOM   8240  N N   . PRO C  1 234 ? -59.156 -42.847  105.068 1.00 30.22 ? 240  PRO C N   1 
ATOM   8241  C CA  . PRO C  1 234 ? -60.281 -43.136  105.965 1.00 31.14 ? 240  PRO C CA  1 
ATOM   8242  C C   . PRO C  1 234 ? -61.023 -41.884  106.441 1.00 30.39 ? 240  PRO C C   1 
ATOM   8243  O O   . PRO C  1 234 ? -62.214 -41.959  106.733 1.00 24.81 ? 240  PRO C O   1 
ATOM   8244  C CB  . PRO C  1 234 ? -59.610 -43.856  107.140 1.00 31.03 ? 240  PRO C CB  1 
ATOM   8245  C CG  . PRO C  1 234 ? -58.377 -44.452  106.552 1.00 31.42 ? 240  PRO C CG  1 
ATOM   8246  C CD  . PRO C  1 234 ? -57.898 -43.418  105.588 1.00 29.14 ? 240  PRO C CD  1 
ATOM   8247  N N   . TYR C  1 235 ? -60.334 -40.751  106.512 1.00 35.53 ? 241  TYR C N   1 
ATOM   8248  C CA  . TYR C  1 235 ? -60.990 -39.513  106.912 1.00 33.80 ? 241  TYR C CA  1 
ATOM   8249  C C   . TYR C  1 235 ? -61.987 -39.074  105.851 1.00 31.89 ? 241  TYR C C   1 
ATOM   8250  O O   . TYR C  1 235 ? -63.083 -38.633  106.171 1.00 35.29 ? 241  TYR C O   1 
ATOM   8251  C CB  . TYR C  1 235 ? -59.971 -38.404  107.165 1.00 37.68 ? 241  TYR C CB  1 
ATOM   8252  C CG  . TYR C  1 235 ? -60.588 -37.080  107.590 1.00 41.90 ? 241  TYR C CG  1 
ATOM   8253  C CD1 . TYR C  1 235 ? -60.681 -36.732  108.933 1.00 43.64 ? 241  TYR C CD1 1 
ATOM   8254  C CD2 . TYR C  1 235 ? -61.066 -36.175  106.646 1.00 42.03 ? 241  TYR C CD2 1 
ATOM   8255  C CE1 . TYR C  1 235 ? -61.238 -35.524  109.318 1.00 47.39 ? 241  TYR C CE1 1 
ATOM   8256  C CE2 . TYR C  1 235 ? -61.626 -34.972  107.022 1.00 44.02 ? 241  TYR C CE2 1 
ATOM   8257  C CZ  . TYR C  1 235 ? -61.710 -34.648  108.355 1.00 49.16 ? 241  TYR C CZ  1 
ATOM   8258  O OH  . TYR C  1 235 ? -62.269 -33.441  108.718 1.00 52.31 ? 241  TYR C OH  1 
ATOM   8259  N N   . ILE C  1 236 ? -61.606 -39.178  104.586 1.00 26.42 ? 242  ILE C N   1 
ATOM   8260  C CA  . ILE C  1 236 ? -62.518 -38.809  103.514 1.00 24.18 ? 242  ILE C CA  1 
ATOM   8261  C C   . ILE C  1 236 ? -63.646 -39.828  103.428 1.00 23.73 ? 242  ILE C C   1 
ATOM   8262  O O   . ILE C  1 236 ? -64.764 -39.498  103.047 1.00 25.23 ? 242  ILE C O   1 
ATOM   8263  C CB  . ILE C  1 236 ? -61.795 -38.708  102.144 1.00 34.30 ? 242  ILE C CB  1 
ATOM   8264  C CG1 . ILE C  1 236 ? -60.577 -37.781  102.243 1.00 30.38 ? 242  ILE C CG1 1 
ATOM   8265  C CG2 . ILE C  1 236 ? -62.756 -38.235  101.059 1.00 32.81 ? 242  ILE C CG2 1 
ATOM   8266  C CD1 . ILE C  1 236 ? -59.689 -37.768  100.998 1.00 27.57 ? 242  ILE C CD1 1 
ATOM   8267  N N   . VAL C  1 237 ? -63.363 -41.070  103.799 1.00 24.30 ? 243  VAL C N   1 
ATOM   8268  C CA  . VAL C  1 237 ? -64.380 -42.116  103.693 1.00 26.80 ? 243  VAL C CA  1 
ATOM   8269  C C   . VAL C  1 237 ? -65.577 -41.810  104.591 1.00 33.60 ? 243  VAL C C   1 
ATOM   8270  O O   . VAL C  1 237 ? -66.723 -41.937  104.167 1.00 40.31 ? 243  VAL C O   1 
ATOM   8271  C CB  . VAL C  1 237 ? -63.816 -43.506  104.039 1.00 21.79 ? 243  VAL C CB  1 
ATOM   8272  C CG1 . VAL C  1 237 ? -64.928 -44.467  104.359 1.00 21.74 ? 243  VAL C CG1 1 
ATOM   8273  C CG2 . VAL C  1 237 ? -62.985 -44.040  102.874 1.00 24.84 ? 243  VAL C CG2 1 
ATOM   8274  N N   . GLU C  1 238 ? -65.317 -41.368  105.814 1.00 33.97 ? 244  GLU C N   1 
ATOM   8275  C CA  . GLU C  1 238 ? -66.406 -41.093  106.745 1.00 36.67 ? 244  GLU C CA  1 
ATOM   8276  C C   . GLU C  1 238 ? -66.974 -39.690  106.594 1.00 36.39 ? 244  GLU C C   1 
ATOM   8277  O O   . GLU C  1 238 ? -68.173 -39.498  106.721 1.00 38.91 ? 244  GLU C O   1 
ATOM   8278  C CB  . GLU C  1 238 ? -65.937 -41.306  108.185 1.00 43.46 ? 244  GLU C CB  1 
ATOM   8279  C CG  . GLU C  1 238 ? -66.937 -40.911  109.252 1.00 49.50 ? 244  GLU C CG  1 
ATOM   8280  C CD  . GLU C  1 238 ? -66.284 -40.642  110.589 1.00 55.85 ? 244  GLU C CD  1 
ATOM   8281  O OE1 . GLU C  1 238 ? -65.079 -40.927  110.723 1.00 60.57 ? 244  GLU C OE1 1 
ATOM   8282  O OE2 . GLU C  1 238 ? -66.969 -40.142  111.507 1.00 55.51 ? 244  GLU C OE2 1 
ATOM   8283  N N   . HIS C  1 239 ? -66.111 -38.716  106.319 1.00 36.15 ? 245  HIS C N   1 
ATOM   8284  C CA  . HIS C  1 239 ? -66.498 -37.301  106.307 1.00 37.16 ? 245  HIS C CA  1 
ATOM   8285  C C   . HIS C  1 239 ? -66.760 -36.701  104.916 1.00 38.31 ? 245  HIS C C   1 
ATOM   8286  O O   . HIS C  1 239 ? -67.365 -35.636  104.790 1.00 37.14 ? 245  HIS C O   1 
ATOM   8287  C CB  . HIS C  1 239 ? -65.417 -36.471  107.003 1.00 37.85 ? 245  HIS C CB  1 
ATOM   8288  C CG  . HIS C  1 239 ? -65.196 -36.849  108.433 1.00 44.35 ? 245  HIS C CG  1 
ATOM   8289  N ND1 . HIS C  1 239 ? -65.449 -35.986  109.477 1.00 49.81 ? 245  HIS C ND1 1 
ATOM   8290  C CD2 . HIS C  1 239 ? -64.755 -37.999  108.994 1.00 43.44 ? 245  HIS C CD2 1 
ATOM   8291  C CE1 . HIS C  1 239 ? -65.168 -36.586  110.619 1.00 50.00 ? 245  HIS C CE1 1 
ATOM   8292  N NE2 . HIS C  1 239 ? -64.744 -37.809  110.354 1.00 46.61 ? 245  HIS C NE2 1 
ATOM   8293  N N   . GLY C  1 240 ? -66.295 -37.368  103.870 1.00 38.18 ? 246  GLY C N   1 
ATOM   8294  C CA  . GLY C  1 240 ? -66.426 -36.825  102.532 1.00 33.89 ? 246  GLY C CA  1 
ATOM   8295  C C   . GLY C  1 240 ? -66.948 -37.836  101.537 1.00 31.37 ? 246  GLY C C   1 
ATOM   8296  O O   . GLY C  1 240 ? -67.723 -38.725  101.892 1.00 34.22 ? 246  GLY C O   1 
ATOM   8297  N N   . LYS C  1 241 ? -66.515 -37.700  100.288 1.00 28.60 ? 247  LYS C N   1 
ATOM   8298  C CA  . LYS C  1 241 ? -66.986 -38.572  99.228  1.00 24.33 ? 247  LYS C CA  1 
ATOM   8299  C C   . LYS C  1 241 ? -65.841 -39.356  98.576  1.00 24.63 ? 247  LYS C C   1 
ATOM   8300  O O   . LYS C  1 241 ? -65.017 -38.800  97.846  1.00 23.52 ? 247  LYS C O   1 
ATOM   8301  C CB  . LYS C  1 241 ? -67.742 -37.764  98.177  1.00 26.14 ? 247  LYS C CB  1 
ATOM   8302  C CG  . LYS C  1 241 ? -68.369 -38.633  97.114  1.00 32.43 ? 247  LYS C CG  1 
ATOM   8303  C CD  . LYS C  1 241 ? -69.244 -37.837  96.178  1.00 37.52 ? 247  LYS C CD  1 
ATOM   8304  C CE  . LYS C  1 241 ? -69.732 -38.727  95.052  1.00 41.12 ? 247  LYS C CE  1 
ATOM   8305  N NZ  . LYS C  1 241 ? -70.107 -40.070  95.572  1.00 42.92 ? 247  LYS C NZ  1 
ATOM   8306  N N   . ALA C  1 242 ? -65.788 -40.652  98.874  1.00 24.72 ? 248  ALA C N   1 
ATOM   8307  C CA  . ALA C  1 242 ? -64.860 -41.571  98.231  1.00 23.09 ? 248  ALA C CA  1 
ATOM   8308  C C   . ALA C  1 242 ? -65.648 -42.533  97.353  1.00 24.96 ? 248  ALA C C   1 
ATOM   8309  O O   . ALA C  1 242 ? -66.717 -43.009  97.739  1.00 24.48 ? 248  ALA C O   1 
ATOM   8310  C CB  . ALA C  1 242 ? -64.048 -42.322  99.266  1.00 21.04 ? 248  ALA C CB  1 
ATOM   8311  N N   . VAL C  1 243 ? -65.139 -42.793  96.158  1.00 23.34 ? 249  VAL C N   1 
ATOM   8312  C CA  . VAL C  1 243 ? -65.770 -43.752  95.262  1.00 25.87 ? 249  VAL C CA  1 
ATOM   8313  C C   . VAL C  1 243 ? -64.710 -44.723  94.764  1.00 24.60 ? 249  VAL C C   1 
ATOM   8314  O O   . VAL C  1 243 ? -63.565 -44.337  94.533  1.00 20.35 ? 249  VAL C O   1 
ATOM   8315  C CB  . VAL C  1 243 ? -66.468 -43.051  94.073  1.00 28.32 ? 249  VAL C CB  1 
ATOM   8316  C CG1 . VAL C  1 243 ? -67.014 -44.056  93.068  1.00 25.85 ? 249  VAL C CG1 1 
ATOM   8317  C CG2 . VAL C  1 243 ? -67.562 -42.125  94.574  1.00 32.33 ? 249  VAL C CG2 1 
ATOM   8318  N N   . ALA C  1 244 ? -65.084 -45.991  94.627  1.00 21.07 ? 250  ALA C N   1 
ATOM   8319  C CA  . ALA C  1 244 ? -64.153 -47.001  94.155  1.00 20.69 ? 250  ALA C CA  1 
ATOM   8320  C C   . ALA C  1 244 ? -64.139 -47.007  92.639  1.00 20.89 ? 250  ALA C C   1 
ATOM   8321  O O   . ALA C  1 244 ? -65.164 -46.740  92.009  1.00 21.46 ? 250  ALA C O   1 
ATOM   8322  C CB  . ALA C  1 244 ? -64.530 -48.382  94.699  1.00 20.09 ? 250  ALA C CB  1 
ATOM   8323  N N   . HIS C  1 245 ? -62.974 -47.284  92.057  1.00 15.52 ? 251  HIS C N   1 
ATOM   8324  C CA  . HIS C  1 245 ? -62.856 -47.471  90.617  1.00 14.95 ? 251  HIS C CA  1 
ATOM   8325  C C   . HIS C  1 245 ? -62.379 -48.898  90.324  1.00 19.73 ? 251  HIS C C   1 
ATOM   8326  O O   . HIS C  1 245 ? -61.437 -49.366  90.955  1.00 17.67 ? 251  HIS C O   1 
ATOM   8327  C CB  . HIS C  1 245 ? -61.887 -46.451  90.005  1.00 14.68 ? 251  HIS C CB  1 
ATOM   8328  C CG  . HIS C  1 245 ? -61.557 -46.736  88.576  1.00 14.75 ? 251  HIS C CG  1 
ATOM   8329  N ND1 . HIS C  1 245 ? -62.456 -46.532  87.553  1.00 19.83 ? 251  HIS C ND1 1 
ATOM   8330  C CD2 . HIS C  1 245 ? -60.456 -47.275  88.005  1.00 17.60 ? 251  HIS C CD2 1 
ATOM   8331  C CE1 . HIS C  1 245 ? -61.913 -46.904  86.409  1.00 17.06 ? 251  HIS C CE1 1 
ATOM   8332  N NE2 . HIS C  1 245 ? -60.700 -47.361  86.657  1.00 19.44 ? 251  HIS C NE2 1 
ATOM   8333  N N   . ARG C  1 246 ? -63.006 -49.577  89.360  1.00 15.80 ? 252  ARG C N   1 
ATOM   8334  C CA  . ARG C  1 246 ? -62.736 -50.998  89.135  1.00 15.50 ? 252  ARG C CA  1 
ATOM   8335  C C   . ARG C  1 246 ? -61.550 -51.229  88.218  1.00 14.83 ? 252  ARG C C   1 
ATOM   8336  O O   . ARG C  1 246 ? -61.564 -50.808  87.067  1.00 20.02 ? 252  ARG C O   1 
ATOM   8337  C CB  . ARG C  1 246 ? -63.968 -51.701  88.555  1.00 18.79 ? 252  ARG C CB  1 
ATOM   8338  C CG  . ARG C  1 246 ? -65.243 -51.560  89.397  1.00 23.78 ? 252  ARG C CG  1 
ATOM   8339  C CD  . ARG C  1 246 ? -65.225 -52.427  90.652  1.00 23.93 ? 252  ARG C CD  1 
ATOM   8340  N NE  . ARG C  1 246 ? -66.423 -52.234  91.481  1.00 28.12 ? 252  ARG C NE  1 
ATOM   8341  C CZ  . ARG C  1 246 ? -67.461 -53.068  91.509  1.00 26.88 ? 252  ARG C CZ  1 
ATOM   8342  N NH1 . ARG C  1 246 ? -67.454 -54.152  90.756  1.00 28.90 ? 252  ARG C NH1 1 
ATOM   8343  N NH2 . ARG C  1 246 ? -68.512 -52.822  92.284  1.00 24.47 ? 252  ARG C NH2 1 
ATOM   8344  N N   . PHE C  1 247 ? -60.538 -51.921  88.740  1.00 17.98 ? 253  PHE C N   1 
ATOM   8345  C CA  . PHE C  1 247 ? -59.333 -52.256  87.979  1.00 12.43 ? 253  PHE C CA  1 
ATOM   8346  C C   . PHE C  1 247 ? -59.693 -52.935  86.666  1.00 13.44 ? 253  PHE C C   1 
ATOM   8347  O O   . PHE C  1 247 ? -59.129 -52.625  85.622  1.00 16.58 ? 253  PHE C O   1 
ATOM   8348  C CB  . PHE C  1 247 ? -58.411 -53.154  88.815  1.00 12.84 ? 253  PHE C CB  1 
ATOM   8349  C CG  . PHE C  1 247 ? -57.162 -53.589  88.094  1.00 16.55 ? 253  PHE C CG  1 
ATOM   8350  C CD1 . PHE C  1 247 ? -56.203 -52.664  87.735  1.00 18.75 ? 253  PHE C CD1 1 
ATOM   8351  C CD2 . PHE C  1 247 ? -56.938 -54.925  87.794  1.00 20.25 ? 253  PHE C CD2 1 
ATOM   8352  C CE1 . PHE C  1 247 ? -55.050 -53.055  87.067  1.00 17.51 ? 253  PHE C CE1 1 
ATOM   8353  C CE2 . PHE C  1 247 ? -55.773 -55.323  87.127  1.00 20.37 ? 253  PHE C CE2 1 
ATOM   8354  C CZ  . PHE C  1 247 ? -54.832 -54.385  86.770  1.00 14.10 ? 253  PHE C CZ  1 
ATOM   8355  N N   . ALA C  1 248 ? -60.664 -53.841  86.721  1.00 19.86 ? 254  ALA C N   1 
ATOM   8356  C CA  . ALA C  1 248 ? -61.107 -54.565  85.532  1.00 23.60 ? 254  ALA C CA  1 
ATOM   8357  C C   . ALA C  1 248 ? -61.484 -53.613  84.387  1.00 23.51 ? 254  ALA C C   1 
ATOM   8358  O O   . ALA C  1 248 ? -61.243 -53.912  83.212  1.00 23.80 ? 254  ALA C O   1 
ATOM   8359  C CB  . ALA C  1 248 ? -62.277 -55.465  85.883  1.00 23.97 ? 254  ALA C CB  1 
ATOM   8360  N N   . ASP C  1 249 ? -62.040 -52.455  84.744  1.00 19.89 ? 255  ASP C N   1 
ATOM   8361  C CA  . ASP C  1 249 ? -62.467 -51.456  83.765  1.00 22.55 ? 255  ASP C CA  1 
ATOM   8362  C C   . ASP C  1 249 ? -61.302 -50.706  83.089  1.00 22.27 ? 255  ASP C C   1 
ATOM   8363  O O   . ASP C  1 249 ? -61.439 -50.249  81.952  1.00 23.67 ? 255  ASP C O   1 
ATOM   8364  C CB  . ASP C  1 249 ? -63.415 -50.448  84.430  1.00 24.46 ? 255  ASP C CB  1 
ATOM   8365  C CG  . ASP C  1 249 ? -64.725 -51.090  84.888  1.00 33.83 ? 255  ASP C CG  1 
ATOM   8366  O OD1 . ASP C  1 249 ? -65.054 -52.185  84.381  1.00 31.48 ? 255  ASP C OD1 1 
ATOM   8367  O OD2 . ASP C  1 249 ? -65.431 -50.501  85.746  1.00 36.14 ? 255  ASP C OD2 1 
ATOM   8368  N N   . SER C  1 250 ? -60.166 -50.595  83.780  1.00 19.02 ? 256  SER C N   1 
ATOM   8369  C CA  . SER C  1 250 ? -59.033 -49.776  83.326  1.00 19.40 ? 256  SER C CA  1 
ATOM   8370  C C   . SER C  1 250 ? -57.829 -50.592  82.900  1.00 18.10 ? 256  SER C C   1 
ATOM   8371  O O   . SER C  1 250 ? -56.967 -50.112  82.161  1.00 16.15 ? 256  SER C O   1 
ATOM   8372  C CB  . SER C  1 250 ? -58.590 -48.833  84.437  1.00 20.94 ? 256  SER C CB  1 
ATOM   8373  O OG  . SER C  1 250 ? -59.708 -48.321  85.112  1.00 33.47 ? 256  SER C OG  1 
ATOM   8374  N N   . CYS C  1 251 ? -57.741 -51.808  83.418  1.00 15.34 ? 257  CYS C N   1 
ATOM   8375  C CA  . CYS C  1 251 ? -56.610 -52.678  83.122  1.00 15.36 ? 257  CYS C CA  1 
ATOM   8376  C C   . CYS C  1 251 ? -56.448 -52.836  81.627  1.00 17.61 ? 257  CYS C C   1 
ATOM   8377  O O   . CYS C  1 251 ? -57.435 -52.961  80.904  1.00 18.16 ? 257  CYS C O   1 
ATOM   8378  C CB  . CYS C  1 251 ? -56.793 -54.042  83.777  1.00 15.43 ? 257  CYS C CB  1 
ATOM   8379  S SG  . CYS C  1 251 ? -55.654 -55.292  83.161  1.00 37.29 ? 257  CYS C SG  1 
ATOM   8380  N N   . VAL C  1 252 ? -55.205 -52.791  81.162  1.00 15.62 ? 258  VAL C N   1 
ATOM   8381  C CA  . VAL C  1 252 ? -54.929 -52.961  79.746  1.00 14.77 ? 258  VAL C CA  1 
ATOM   8382  C C   . VAL C  1 252 ? -54.512 -54.401  79.486  1.00 17.26 ? 258  VAL C C   1 
ATOM   8383  O O   . VAL C  1 252 ? -53.329 -54.745  79.542  1.00 20.10 ? 258  VAL C O   1 
ATOM   8384  C CB  . VAL C  1 252 ? -53.844 -51.982  79.249  1.00 15.72 ? 258  VAL C CB  1 
ATOM   8385  C CG1 . VAL C  1 252 ? -53.683 -52.088  77.741  1.00 11.68 ? 258  VAL C CG1 1 
ATOM   8386  C CG2 . VAL C  1 252 ? -54.208 -50.548  79.630  1.00 12.39 ? 258  VAL C CG2 1 
ATOM   8387  N N   . ARG C  1 253 ? -55.504 -55.244  79.223  1.00 18.19 ? 259  ARG C N   1 
ATOM   8388  C CA  . ARG C  1 253 ? -55.276 -56.668  78.996  1.00 24.57 ? 259  ARG C CA  1 
ATOM   8389  C C   . ARG C  1 253 ? -54.931 -56.957  77.537  1.00 28.56 ? 259  ARG C C   1 
ATOM   8390  O O   . ARG C  1 253 ? -55.644 -56.538  76.628  1.00 29.86 ? 259  ARG C O   1 
ATOM   8391  C CB  . ARG C  1 253 ? -56.512 -57.476  79.413  1.00 27.43 ? 259  ARG C CB  1 
ATOM   8392  C CG  . ARG C  1 253 ? -56.266 -58.972  79.544  1.00 31.37 ? 259  ARG C CG  1 
ATOM   8393  C CD  . ARG C  1 253 ? -57.525 -59.726  79.913  1.00 34.35 ? 259  ARG C CD  1 
ATOM   8394  N NE  . ARG C  1 253 ? -58.528 -58.849  80.498  1.00 44.89 ? 259  ARG C NE  1 
ATOM   8395  C CZ  . ARG C  1 253 ? -59.785 -59.215  80.733  1.00 53.11 ? 259  ARG C CZ  1 
ATOM   8396  N NH1 . ARG C  1 253 ? -60.178 -60.444  80.421  1.00 55.64 ? 259  ARG C NH1 1 
ATOM   8397  N NH2 . ARG C  1 253 ? -60.648 -58.353  81.268  1.00 53.42 ? 259  ARG C NH2 1 
ATOM   8398  N N   . SER C  1 254 ? -53.833 -57.674  77.319  1.00 30.10 ? 260  SER C N   1 
ATOM   8399  C CA  . SER C  1 254 ? -53.436 -58.089  75.977  1.00 33.69 ? 260  SER C CA  1 
ATOM   8400  C C   . SER C  1 254 ? -54.355 -59.194  75.472  1.00 35.96 ? 260  SER C C   1 
ATOM   8401  O O   . SER C  1 254 ? -55.040 -59.842  76.263  1.00 35.82 ? 260  SER C O   1 
ATOM   8402  C CB  . SER C  1 254 ? -51.979 -58.564  75.978  1.00 38.78 ? 260  SER C CB  1 
ATOM   8403  O OG  . SER C  1 254 ? -51.744 -59.537  74.974  1.00 42.12 ? 260  SER C OG  1 
ATOM   8404  N N   . ASP C  1 255 ? -54.373 -59.411  74.158  1.00 37.81 ? 261  ASP C N   1 
ATOM   8405  C CA  . ASP C  1 255 ? -55.127 -60.524  73.595  1.00 40.04 ? 261  ASP C CA  1 
ATOM   8406  C C   . ASP C  1 255 ? -54.687 -61.831  74.233  1.00 37.30 ? 261  ASP C C   1 
ATOM   8407  O O   . ASP C  1 255 ? -55.486 -62.750  74.405  1.00 38.05 ? 261  ASP C O   1 
ATOM   8408  C CB  . ASP C  1 255 ? -54.945 -60.605  72.079  1.00 43.66 ? 261  ASP C CB  1 
ATOM   8409  C CG  . ASP C  1 255 ? -55.748 -59.557  71.340  1.00 49.10 ? 261  ASP C CG  1 
ATOM   8410  O OD1 . ASP C  1 255 ? -56.575 -58.877  71.984  1.00 52.84 ? 261  ASP C OD1 1 
ATOM   8411  O OD2 . ASP C  1 255 ? -55.560 -59.421  70.113  1.00 46.12 ? 261  ASP C OD2 1 
ATOM   8412  N N   . PHE C  1 256 ? -53.410 -61.887  74.599  1.00 30.93 ? 262  PHE C N   1 
ATOM   8413  C CA  . PHE C  1 256 ? -52.795 -63.102  75.106  1.00 25.20 ? 262  PHE C CA  1 
ATOM   8414  C C   . PHE C  1 256 ? -52.671 -63.135  76.629  1.00 26.63 ? 262  PHE C C   1 
ATOM   8415  O O   . PHE C  1 256 ? -51.834 -63.860  77.171  1.00 26.80 ? 262  PHE C O   1 
ATOM   8416  C CB  . PHE C  1 256 ? -51.421 -63.269  74.466  1.00 29.10 ? 262  PHE C CB  1 
ATOM   8417  C CG  . PHE C  1 256 ? -51.444 -63.164  72.972  1.00 37.07 ? 262  PHE C CG  1 
ATOM   8418  C CD1 . PHE C  1 256 ? -51.666 -64.284  72.192  1.00 42.48 ? 262  PHE C CD1 1 
ATOM   8419  C CD2 . PHE C  1 256 ? -51.255 -61.947  72.344  1.00 43.15 ? 262  PHE C CD2 1 
ATOM   8420  C CE1 . PHE C  1 256 ? -51.693 -64.194  70.814  1.00 43.86 ? 262  PHE C CE1 1 
ATOM   8421  C CE2 . PHE C  1 256 ? -51.288 -61.849  70.966  1.00 45.55 ? 262  PHE C CE2 1 
ATOM   8422  C CZ  . PHE C  1 256 ? -51.505 -62.973  70.202  1.00 45.46 ? 262  PHE C CZ  1 
ATOM   8423  N N   . GLU C  1 257 ? -53.496 -62.355  77.321  1.00 23.80 ? 263  GLU C N   1 
ATOM   8424  C CA  . GLU C  1 257 ? -53.564 -62.446  78.780  1.00 26.13 ? 263  GLU C CA  1 
ATOM   8425  C C   . GLU C  1 257 ? -54.956 -62.922  79.193  1.00 29.36 ? 263  GLU C C   1 
ATOM   8426  O O   . GLU C  1 257 ? -55.955 -62.269  78.894  1.00 29.11 ? 263  GLU C O   1 
ATOM   8427  C CB  . GLU C  1 257 ? -53.206 -61.101  79.425  1.00 23.29 ? 263  GLU C CB  1 
ATOM   8428  C CG  . GLU C  1 257 ? -51.735 -60.725  79.212  1.00 22.79 ? 263  GLU C CG  1 
ATOM   8429  C CD  . GLU C  1 257 ? -51.383 -59.311  79.653  1.00 22.81 ? 263  GLU C CD  1 
ATOM   8430  O OE1 . GLU C  1 257 ? -52.296 -58.475  79.815  1.00 23.29 ? 263  GLU C OE1 1 
ATOM   8431  O OE2 . GLU C  1 257 ? -50.176 -59.030  79.815  1.00 21.13 ? 263  GLU C OE2 1 
ATOM   8432  N N   . HIS C  1 258 ? -55.016 -64.065  79.877  1.00 24.79 ? 264  HIS C N   1 
ATOM   8433  C CA  . HIS C  1 258 ? -56.292 -64.733  80.131  1.00 27.14 ? 264  HIS C CA  1 
ATOM   8434  C C   . HIS C  1 258 ? -57.167 -64.006  81.162  1.00 31.31 ? 264  HIS C C   1 
ATOM   8435  O O   . HIS C  1 258 ? -58.342 -64.332  81.323  1.00 35.29 ? 264  HIS C O   1 
ATOM   8436  C CB  . HIS C  1 258 ? -56.047 -66.191  80.568  1.00 27.42 ? 264  HIS C CB  1 
ATOM   8437  C CG  . HIS C  1 258 ? -55.800 -66.360  82.038  1.00 31.59 ? 264  HIS C CG  1 
ATOM   8438  N ND1 . HIS C  1 258 ? -54.551 -66.224  82.606  1.00 30.59 ? 264  HIS C ND1 1 
ATOM   8439  C CD2 . HIS C  1 258 ? -56.641 -66.674  83.053  1.00 34.02 ? 264  HIS C CD2 1 
ATOM   8440  C CE1 . HIS C  1 258 ? -54.637 -66.430  83.910  1.00 31.29 ? 264  HIS C CE1 1 
ATOM   8441  N NE2 . HIS C  1 258 ? -55.893 -66.708  84.206  1.00 34.02 ? 264  HIS C NE2 1 
ATOM   8442  N N   . GLU C  1 259 ? -56.603 -63.017  81.847  1.00 29.41 ? 265  GLU C N   1 
ATOM   8443  C CA  . GLU C  1 259 ? -57.341 -62.238  82.839  1.00 27.87 ? 265  GLU C CA  1 
ATOM   8444  C C   . GLU C  1 259 ? -56.562 -60.952  83.130  1.00 27.72 ? 265  GLU C C   1 
ATOM   8445  O O   . GLU C  1 259 ? -55.429 -60.805  82.670  1.00 28.03 ? 265  GLU C O   1 
ATOM   8446  C CB  . GLU C  1 259 ? -57.552 -63.055  84.120  1.00 30.73 ? 265  GLU C CB  1 
ATOM   8447  C CG  . GLU C  1 259 ? -56.249 -63.449  84.807  1.00 34.97 ? 265  GLU C CG  1 
ATOM   8448  C CD  . GLU C  1 259 ? -56.460 -64.308  86.037  1.00 40.65 ? 265  GLU C CD  1 
ATOM   8449  O OE1 . GLU C  1 259 ? -57.630 -64.519  86.430  1.00 39.84 ? 265  GLU C OE1 1 
ATOM   8450  O OE2 . GLU C  1 259 ? -55.449 -64.781  86.606  1.00 44.46 ? 265  GLU C OE2 1 
ATOM   8451  N N   . PRO C  1 260 ? -57.164 -60.011  83.878  1.00 22.82 ? 266  PRO C N   1 
ATOM   8452  C CA  . PRO C  1 260 ? -56.390 -58.838  84.315  1.00 19.56 ? 266  PRO C CA  1 
ATOM   8453  C C   . PRO C  1 260 ? -55.214 -59.215  85.222  1.00 16.91 ? 266  PRO C C   1 
ATOM   8454  O O   . PRO C  1 260 ? -55.401 -59.911  86.213  1.00 18.48 ? 266  PRO C O   1 
ATOM   8455  C CB  . PRO C  1 260 ? -57.419 -58.007  85.083  1.00 20.43 ? 266  PRO C CB  1 
ATOM   8456  C CG  . PRO C  1 260 ? -58.729 -58.386  84.465  1.00 25.55 ? 266  PRO C CG  1 
ATOM   8457  C CD  . PRO C  1 260 ? -58.605 -59.849  84.138  1.00 21.54 ? 266  PRO C CD  1 
ATOM   8458  N N   . TYR C  1 261 ? -54.019 -58.744  84.888  1.00 13.76 ? 267  TYR C N   1 
ATOM   8459  C CA  . TYR C  1 261 ? -52.814 -59.141  85.597  1.00 12.27 ? 267  TYR C CA  1 
ATOM   8460  C C   . TYR C  1 261 ? -52.397 -58.118  86.641  1.00 13.06 ? 267  TYR C C   1 
ATOM   8461  O O   . TYR C  1 261 ? -52.112 -56.976  86.308  1.00 17.17 ? 267  TYR C O   1 
ATOM   8462  C CB  . TYR C  1 261 ? -51.687 -59.354  84.598  1.00 12.35 ? 267  TYR C CB  1 
ATOM   8463  C CG  . TYR C  1 261 ? -50.381 -59.862  85.160  1.00 13.64 ? 267  TYR C CG  1 
ATOM   8464  C CD1 . TYR C  1 261 ? -49.419 -58.992  85.645  1.00 10.67 ? 267  TYR C CD1 1 
ATOM   8465  C CD2 . TYR C  1 261 ? -50.090 -61.221  85.153  1.00 14.69 ? 267  TYR C CD2 1 
ATOM   8466  C CE1 . TYR C  1 261 ? -48.214 -59.472  86.133  1.00 12.32 ? 267  TYR C CE1 1 
ATOM   8467  C CE2 . TYR C  1 261 ? -48.891 -61.703  85.631  1.00 9.46  ? 267  TYR C CE2 1 
ATOM   8468  C CZ  . TYR C  1 261 ? -47.961 -60.827  86.114  1.00 11.43 ? 267  TYR C CZ  1 
ATOM   8469  O OH  . TYR C  1 261 ? -46.766 -61.317  86.592  1.00 15.71 ? 267  TYR C OH  1 
ATOM   8470  N N   . TRP C  1 262 ? -52.354 -58.537  87.899  1.00 12.49 ? 268  TRP C N   1 
ATOM   8471  C CA  . TRP C  1 262 ? -51.809 -57.720  88.970  1.00 14.14 ? 268  TRP C CA  1 
ATOM   8472  C C   . TRP C  1 262 ? -51.047 -58.659  89.908  1.00 17.97 ? 268  TRP C C   1 
ATOM   8473  O O   . TRP C  1 262 ? -51.491 -59.778  90.163  1.00 20.19 ? 268  TRP C O   1 
ATOM   8474  C CB  . TRP C  1 262 ? -52.916 -56.957  89.703  1.00 13.73 ? 268  TRP C CB  1 
ATOM   8475  C CG  . TRP C  1 262 ? -52.448 -56.000  90.773  1.00 12.24 ? 268  TRP C CG  1 
ATOM   8476  C CD1 . TRP C  1 262 ? -52.189 -54.665  90.627  1.00 13.43 ? 268  TRP C CD1 1 
ATOM   8477  C CD2 . TRP C  1 262 ? -52.221 -56.299  92.155  1.00 17.57 ? 268  TRP C CD2 1 
ATOM   8478  N NE1 . TRP C  1 262 ? -51.798 -54.123  91.826  1.00 15.75 ? 268  TRP C NE1 1 
ATOM   8479  C CE2 . TRP C  1 262 ? -51.809 -55.105  92.780  1.00 16.15 ? 268  TRP C CE2 1 
ATOM   8480  C CE3 . TRP C  1 262 ? -52.320 -57.464  92.923  1.00 15.31 ? 268  TRP C CE3 1 
ATOM   8481  C CZ2 . TRP C  1 262 ? -51.502 -55.042  94.140  1.00 18.83 ? 268  TRP C CZ2 1 
ATOM   8482  C CZ3 . TRP C  1 262 ? -52.015 -57.398  94.271  1.00 18.47 ? 268  TRP C CZ3 1 
ATOM   8483  C CH2 . TRP C  1 262 ? -51.607 -56.197  94.864  1.00 16.42 ? 268  TRP C CH2 1 
ATOM   8484  N N   . ARG C  1 263 ? -49.879 -58.219  90.373  1.00 18.00 ? 269  ARG C N   1 
ATOM   8485  C CA  . ARG C  1 263 ? -49.027 -59.000  91.269  1.00 11.45 ? 269  ARG C CA  1 
ATOM   8486  C C   . ARG C  1 263 ? -48.361 -58.073  92.265  1.00 14.65 ? 269  ARG C C   1 
ATOM   8487  O O   . ARG C  1 263 ? -47.796 -57.044  91.895  1.00 14.90 ? 269  ARG C O   1 
ATOM   8488  C CB  . ARG C  1 263 ? -47.943 -59.773  90.501  1.00 13.64 ? 269  ARG C CB  1 
ATOM   8489  C CG  . ARG C  1 263 ? -48.423 -60.804  89.491  1.00 13.22 ? 269  ARG C CG  1 
ATOM   8490  C CD  . ARG C  1 263 ? -48.797 -62.125  90.144  1.00 18.42 ? 269  ARG C CD  1 
ATOM   8491  N NE  . ARG C  1 263 ? -49.113 -63.169  89.162  1.00 20.13 ? 269  ARG C NE  1 
ATOM   8492  C CZ  . ARG C  1 263 ? -50.240 -63.224  88.450  1.00 24.56 ? 269  ARG C CZ  1 
ATOM   8493  N NH1 . ARG C  1 263 ? -51.173 -62.285  88.592  1.00 31.32 ? 269  ARG C NH1 1 
ATOM   8494  N NH2 . ARG C  1 263 ? -50.439 -64.212  87.581  1.00 20.87 ? 269  ARG C NH2 1 
ATOM   8495  N N   . ASP C  1 264 ? -48.424 -58.454  93.532  1.00 14.08 ? 270  ASP C N   1 
ATOM   8496  C CA  . ASP C  1 264 ? -47.778 -57.729  94.615  1.00 16.80 ? 270  ASP C CA  1 
ATOM   8497  C C   . ASP C  1 264 ? -46.297 -58.106  94.718  1.00 14.93 ? 270  ASP C C   1 
ATOM   8498  O O   . ASP C  1 264 ? -45.466 -57.290  95.104  1.00 19.47 ? 270  ASP C O   1 
ATOM   8499  C CB  . ASP C  1 264 ? -48.522 -58.031  95.921  1.00 20.28 ? 270  ASP C CB  1 
ATOM   8500  C CG  . ASP C  1 264 ? -47.901 -57.360  97.127  1.00 32.03 ? 270  ASP C CG  1 
ATOM   8501  O OD1 . ASP C  1 264 ? -47.404 -56.219  96.990  1.00 37.34 ? 270  ASP C OD1 1 
ATOM   8502  O OD2 . ASP C  1 264 ? -47.920 -57.979  98.218  1.00 26.77 ? 270  ASP C OD2 1 
ATOM   8503  N N   . VAL C  1 265 ? -45.985 -59.334  94.301  1.00 14.90 ? 271  VAL C N   1 
ATOM   8504  C CA  . VAL C  1 265 ? -44.727 -60.036  94.600  1.00 15.66 ? 271  VAL C CA  1 
ATOM   8505  C C   . VAL C  1 265 ? -44.178 -59.658  95.985  1.00 17.22 ? 271  VAL C C   1 
ATOM   8506  O O   . VAL C  1 265 ? -43.056 -59.159  96.121  1.00 20.18 ? 271  VAL C O   1 
ATOM   8507  C CB  . VAL C  1 265 ? -43.642 -59.815  93.486  1.00 18.49 ? 271  VAL C CB  1 
ATOM   8508  C CG1 . VAL C  1 265 ? -44.040 -60.559  92.217  1.00 20.80 ? 271  VAL C CG1 1 
ATOM   8509  C CG2 . VAL C  1 265 ? -43.376 -58.331  93.170  1.00 18.29 ? 271  VAL C CG2 1 
ATOM   8510  N N   . GLY C  1 266 ? -44.979 -59.938  97.013  1.00 16.12 ? 272  GLY C N   1 
ATOM   8511  C CA  . GLY C  1 266 ? -44.663 -59.542  98.374  1.00 20.80 ? 272  GLY C CA  1 
ATOM   8512  C C   . GLY C  1 266 ? -43.804 -60.525  99.151  1.00 20.90 ? 272  GLY C C   1 
ATOM   8513  O O   . GLY C  1 266 ? -43.221 -60.179  100.174 1.00 22.80 ? 272  GLY C O   1 
ATOM   8514  N N   . THR C  1 267 ? -43.723 -61.754  98.659  1.00 19.76 ? 273  THR C N   1 
ATOM   8515  C CA  . THR C  1 267 ? -42.940 -62.804  99.296  1.00 19.09 ? 273  THR C CA  1 
ATOM   8516  C C   . THR C  1 267 ? -41.943 -63.377  98.314  1.00 18.69 ? 273  THR C C   1 
ATOM   8517  O O   . THR C  1 267 ? -42.105 -63.223  97.105  1.00 16.91 ? 273  THR C O   1 
ATOM   8518  C CB  . THR C  1 267 ? -43.831 -63.940  99.807  1.00 20.81 ? 273  THR C CB  1 
ATOM   8519  O OG1 . THR C  1 267 ? -44.585 -64.473  98.716  1.00 17.76 ? 273  THR C OG1 1 
ATOM   8520  C CG2 . THR C  1 267 ? -44.794 -63.430  100.865 1.00 21.54 ? 273  THR C CG2 1 
ATOM   8521  N N   . ILE C  1 268 ? -40.915 -64.043  98.823  1.00 15.93 ? 274  ILE C N   1 
ATOM   8522  C CA  . ILE C  1 268 ? -39.930 -64.650  97.945  1.00 11.43 ? 274  ILE C CA  1 
ATOM   8523  C C   . ILE C  1 268 ? -40.580 -65.678  97.033  1.00 14.54 ? 274  ILE C C   1 
ATOM   8524  O O   . ILE C  1 268 ? -40.265 -65.748  95.848  1.00 21.47 ? 274  ILE C O   1 
ATOM   8525  C CB  . ILE C  1 268 ? -38.791 -65.280  98.746  1.00 13.30 ? 274  ILE C CB  1 
ATOM   8526  C CG1 . ILE C  1 268 ? -37.979 -64.177  99.436  1.00 16.68 ? 274  ILE C CG1 1 
ATOM   8527  C CG2 . ILE C  1 268 ? -37.916 -66.142  97.847  1.00 14.85 ? 274  ILE C CG2 1 
ATOM   8528  C CD1 . ILE C  1 268 ? -36.968 -64.685  100.444 1.00 22.94 ? 274  ILE C CD1 1 
ATOM   8529  N N   . ASP C  1 269 ? -41.524 -66.448  97.560  1.00 13.90 ? 275  ASP C N   1 
ATOM   8530  C CA  . ASP C  1 269 ? -42.210 -67.418  96.726  1.00 13.78 ? 275  ASP C CA  1 
ATOM   8531  C C   . ASP C  1 269 ? -42.988 -66.755  95.602  1.00 16.41 ? 275  ASP C C   1 
ATOM   8532  O O   . ASP C  1 269 ? -42.935 -67.200  94.459  1.00 15.05 ? 275  ASP C O   1 
ATOM   8533  C CB  . ASP C  1 269 ? -43.154 -68.277  97.555  1.00 19.09 ? 275  ASP C CB  1 
ATOM   8534  C CG  . ASP C  1 269 ? -43.765 -69.400  96.750  1.00 27.02 ? 275  ASP C CG  1 
ATOM   8535  O OD1 . ASP C  1 269 ? -43.118 -70.463  96.636  1.00 33.45 ? 275  ASP C OD1 1 
ATOM   8536  O OD2 . ASP C  1 269 ? -44.892 -69.228  96.234  1.00 26.90 ? 275  ASP C OD2 1 
ATOM   8537  N N   . ALA C  1 270 ? -43.709 -65.690  95.934  1.00 17.13 ? 276  ALA C N   1 
ATOM   8538  C CA  . ALA C  1 270 ? -44.531 -64.993  94.948  1.00 18.38 ? 276  ALA C CA  1 
ATOM   8539  C C   . ALA C  1 270 ? -43.655 -64.367  93.888  1.00 15.23 ? 276  ALA C C   1 
ATOM   8540  O O   . ALA C  1 270 ? -43.982 -64.400  92.710  1.00 13.74 ? 276  ALA C O   1 
ATOM   8541  C CB  . ALA C  1 270 ? -45.394 -63.933  95.612  1.00 13.85 ? 276  ALA C CB  1 
ATOM   8542  N N   . TYR C  1 271 ? -42.540 -63.795  94.324  1.00 13.99 ? 277  TYR C N   1 
ATOM   8543  C CA  . TYR C  1 271 ? -41.577 -63.207  93.418  1.00 9.78  ? 277  TYR C CA  1 
ATOM   8544  C C   . TYR C  1 271 ? -41.065 -64.264  92.480  1.00 12.45 ? 277  TYR C C   1 
ATOM   8545  O O   . TYR C  1 271 ? -41.089 -64.081  91.274  1.00 13.44 ? 277  TYR C O   1 
ATOM   8546  C CB  . TYR C  1 271 ? -40.422 -62.583  94.189  1.00 12.21 ? 277  TYR C CB  1 
ATOM   8547  C CG  . TYR C  1 271 ? -39.336 -61.999  93.326  1.00 13.81 ? 277  TYR C CG  1 
ATOM   8548  C CD1 . TYR C  1 271 ? -39.549 -60.835  92.596  1.00 15.82 ? 277  TYR C CD1 1 
ATOM   8549  C CD2 . TYR C  1 271 ? -38.094 -62.601  93.244  1.00 14.87 ? 277  TYR C CD2 1 
ATOM   8550  C CE1 . TYR C  1 271 ? -38.552 -60.293  91.807  1.00 13.44 ? 277  TYR C CE1 1 
ATOM   8551  C CE2 . TYR C  1 271 ? -37.089 -62.065  92.467  1.00 15.18 ? 277  TYR C CE2 1 
ATOM   8552  C CZ  . TYR C  1 271 ? -37.324 -60.909  91.758  1.00 15.64 ? 277  TYR C CZ  1 
ATOM   8553  O OH  . TYR C  1 271 ? -36.328 -60.381  90.987  1.00 16.59 ? 277  TYR C OH  1 
ATOM   8554  N N   . TRP C  1 272 ? -40.606 -65.377  93.039  1.00 11.77 ? 278  TRP C N   1 
ATOM   8555  C CA  . TRP C  1 272 ? -40.144 -66.498  92.225  1.00 14.53 ? 278  TRP C CA  1 
ATOM   8556  C C   . TRP C  1 272 ? -41.231 -66.946  91.253  1.00 16.49 ? 278  TRP C C   1 
ATOM   8557  O O   . TRP C  1 272 ? -40.975 -67.123  90.053  1.00 14.55 ? 278  TRP C O   1 
ATOM   8558  C CB  . TRP C  1 272 ? -39.708 -67.671  93.112  1.00 14.61 ? 278  TRP C CB  1 
ATOM   8559  C CG  . TRP C  1 272 ? -39.241 -68.871  92.348  1.00 11.77 ? 278  TRP C CG  1 
ATOM   8560  C CD1 . TRP C  1 272 ? -37.977 -69.112  91.884  1.00 14.29 ? 278  TRP C CD1 1 
ATOM   8561  C CD2 . TRP C  1 272 ? -40.030 -70.002  91.965  1.00 14.26 ? 278  TRP C CD2 1 
ATOM   8562  N NE1 . TRP C  1 272 ? -37.937 -70.320  91.229  1.00 14.90 ? 278  TRP C NE1 1 
ATOM   8563  C CE2 . TRP C  1 272 ? -39.184 -70.885  91.263  1.00 14.55 ? 278  TRP C CE2 1 
ATOM   8564  C CE3 . TRP C  1 272 ? -41.371 -70.351  92.142  1.00 15.39 ? 278  TRP C CE3 1 
ATOM   8565  C CZ2 . TRP C  1 272 ? -39.636 -72.097  90.746  1.00 13.43 ? 278  TRP C CZ2 1 
ATOM   8566  C CZ3 . TRP C  1 272 ? -41.820 -71.556  91.619  1.00 18.37 ? 278  TRP C CZ3 1 
ATOM   8567  C CH2 . TRP C  1 272 ? -40.953 -72.413  90.933  1.00 17.33 ? 278  TRP C CH2 1 
ATOM   8568  N N   . GLN C  1 273 ? -42.448 -67.110  91.767  1.00 17.44 ? 279  GLN C N   1 
ATOM   8569  C CA  . GLN C  1 273 ? -43.545 -67.615  90.951  1.00 19.37 ? 279  GLN C CA  1 
ATOM   8570  C C   . GLN C  1 273 ? -43.867 -66.693  89.772  1.00 16.86 ? 279  GLN C C   1 
ATOM   8571  O O   . GLN C  1 273 ? -44.010 -67.157  88.649  1.00 17.91 ? 279  GLN C O   1 
ATOM   8572  C CB  . GLN C  1 273 ? -44.803 -67.818  91.796  1.00 19.40 ? 279  GLN C CB  1 
ATOM   8573  C CG  . GLN C  1 273 ? -45.849 -68.628  91.087  1.00 16.16 ? 279  GLN C CG  1 
ATOM   8574  C CD  . GLN C  1 273 ? -45.454 -70.081  90.947  1.00 22.58 ? 279  GLN C CD  1 
ATOM   8575  O OE1 . GLN C  1 273 ? -45.309 -70.795  91.943  1.00 28.83 ? 279  GLN C OE1 1 
ATOM   8576  N NE2 . GLN C  1 273 ? -45.269 -70.529  89.711  1.00 19.49 ? 279  GLN C NE2 1 
ATOM   8577  N N   . ALA C  1 274 ? -43.958 -65.392  90.028  1.00 15.27 ? 280  ALA C N   1 
ATOM   8578  C CA  . ALA C  1 274 ? -44.301 -64.436  88.980  1.00 11.74 ? 280  ALA C CA  1 
ATOM   8579  C C   . ALA C  1 274 ? -43.251 -64.372  87.859  1.00 12.69 ? 280  ALA C C   1 
ATOM   8580  O O   . ALA C  1 274 ? -43.597 -64.178  86.689  1.00 15.34 ? 280  ALA C O   1 
ATOM   8581  C CB  . ALA C  1 274 ? -44.514 -63.066  89.582  1.00 12.31 ? 280  ALA C CB  1 
ATOM   8582  N N   . ASN C  1 275 ? -41.976 -64.533  88.198  1.00 12.41 ? 281  ASN C N   1 
ATOM   8583  C CA  . ASN C  1 275 ? -40.937 -64.546  87.170  1.00 10.69 ? 281  ASN C CA  1 
ATOM   8584  C C   . ASN C  1 275 ? -40.916 -65.844  86.380  1.00 11.00 ? 281  ASN C C   1 
ATOM   8585  O O   . ASN C  1 275 ? -40.843 -65.833  85.152  1.00 13.97 ? 281  ASN C O   1 
ATOM   8586  C CB  . ASN C  1 275 ? -39.557 -64.313  87.775  1.00 12.21 ? 281  ASN C CB  1 
ATOM   8587  C CG  . ASN C  1 275 ? -39.287 -62.857  88.063  1.00 15.15 ? 281  ASN C CG  1 
ATOM   8588  O OD1 . ASN C  1 275 ? -38.965 -62.091  87.164  1.00 13.36 ? 281  ASN C OD1 1 
ATOM   8589  N ND2 . ASN C  1 275 ? -39.398 -62.473  89.326  1.00 17.85 ? 281  ASN C ND2 1 
ATOM   8590  N N   . ILE C  1 276 ? -40.969 -66.964  87.086  1.00 9.50  ? 282  ILE C N   1 
ATOM   8591  C CA  . ILE C  1 276 ? -40.867 -68.252  86.430  1.00 9.95  ? 282  ILE C CA  1 
ATOM   8592  C C   . ILE C  1 276 ? -42.077 -68.469  85.509  1.00 10.16 ? 282  ILE C C   1 
ATOM   8593  O O   . ILE C  1 276 ? -41.973 -69.097  84.467  1.00 11.39 ? 282  ILE C O   1 
ATOM   8594  C CB  . ILE C  1 276 ? -40.718 -69.381  87.478  1.00 18.36 ? 282  ILE C CB  1 
ATOM   8595  C CG1 . ILE C  1 276 ? -39.684 -70.406  87.022  1.00 22.25 ? 282  ILE C CG1 1 
ATOM   8596  C CG2 . ILE C  1 276 ? -42.036 -70.049  87.781  1.00 25.05 ? 282  ILE C CG2 1 
ATOM   8597  C CD1 . ILE C  1 276 ? -38.284 -69.879  86.979  1.00 16.93 ? 282  ILE C CD1 1 
ATOM   8598  N N   . ASP C  1 277 ? -43.214 -67.883  85.857  1.00 13.53 ? 283  ASP C N   1 
ATOM   8599  C CA  . ASP C  1 277 ? -44.420 -68.042  85.048  1.00 17.49 ? 283  ASP C CA  1 
ATOM   8600  C C   . ASP C  1 277 ? -44.245 -67.492  83.633  1.00 18.37 ? 283  ASP C C   1 
ATOM   8601  O O   . ASP C  1 277 ? -44.981 -67.863  82.720  1.00 16.56 ? 283  ASP C O   1 
ATOM   8602  C CB  . ASP C  1 277 ? -45.612 -67.364  85.727  1.00 21.50 ? 283  ASP C CB  1 
ATOM   8603  C CG  . ASP C  1 277 ? -46.135 -68.151  86.926  1.00 31.79 ? 283  ASP C CG  1 
ATOM   8604  O OD1 . ASP C  1 277 ? -45.797 -69.352  87.070  1.00 32.87 ? 283  ASP C OD1 1 
ATOM   8605  O OD2 . ASP C  1 277 ? -46.894 -67.564  87.729  1.00 32.79 ? 283  ASP C OD2 1 
ATOM   8606  N N   . LEU C  1 278 ? -43.259 -66.621  83.451  1.00 15.76 ? 284  LEU C N   1 
ATOM   8607  C CA  . LEU C  1 278 ? -42.988 -66.045  82.143  1.00 16.88 ? 284  LEU C CA  1 
ATOM   8608  C C   . LEU C  1 278 ? -42.369 -67.075  81.194  1.00 14.44 ? 284  LEU C C   1 
ATOM   8609  O O   . LEU C  1 278 ? -42.320 -66.854  79.987  1.00 13.32 ? 284  LEU C O   1 
ATOM   8610  C CB  . LEU C  1 278 ? -42.073 -64.817  82.279  1.00 16.51 ? 284  LEU C CB  1 
ATOM   8611  C CG  . LEU C  1 278 ? -42.717 -63.606  82.975  1.00 15.77 ? 284  LEU C CG  1 
ATOM   8612  C CD1 . LEU C  1 278 ? -41.685 -62.592  83.443  1.00 15.01 ? 284  LEU C CD1 1 
ATOM   8613  C CD2 . LEU C  1 278 ? -43.707 -62.940  82.028  1.00 15.33 ? 284  LEU C CD2 1 
ATOM   8614  N N   . THR C  1 279 ? -41.892 -68.196  81.729  1.00 13.83 ? 285  THR C N   1 
ATOM   8615  C CA  . THR C  1 279 ? -41.324 -69.236  80.871  1.00 9.24  ? 285  THR C CA  1 
ATOM   8616  C C   . THR C  1 279 ? -42.417 -70.198  80.374  1.00 12.80 ? 285  THR C C   1 
ATOM   8617  O O   . THR C  1 279 ? -42.126 -71.150  79.654  1.00 15.29 ? 285  THR C O   1 
ATOM   8618  C CB  . THR C  1 279 ? -40.226 -70.055  81.592  1.00 12.33 ? 285  THR C CB  1 
ATOM   8619  O OG1 . THR C  1 279 ? -40.818 -70.820  82.643  1.00 16.34 ? 285  THR C OG1 1 
ATOM   8620  C CG2 . THR C  1 279 ? -39.149 -69.153  82.171  1.00 7.58  ? 285  THR C CG2 1 
ATOM   8621  N N   . ASP C  1 280 ? -43.666 -69.962  80.773  1.00 12.06 ? 286  ASP C N   1 
ATOM   8622  C CA  . ASP C  1 280 ? -44.794 -70.780  80.298  1.00 13.82 ? 286  ASP C CA  1 
ATOM   8623  C C   . ASP C  1 280 ? -45.003 -70.665  78.784  1.00 16.25 ? 286  ASP C C   1 
ATOM   8624  O O   . ASP C  1 280 ? -44.618 -69.671  78.172  1.00 15.85 ? 286  ASP C O   1 
ATOM   8625  C CB  . ASP C  1 280 ? -46.103 -70.379  80.981  1.00 17.48 ? 286  ASP C CB  1 
ATOM   8626  C CG  . ASP C  1 280 ? -46.175 -70.788  82.424  1.00 22.32 ? 286  ASP C CG  1 
ATOM   8627  O OD1 . ASP C  1 280 ? -45.270 -71.487  82.931  1.00 26.67 ? 286  ASP C OD1 1 
ATOM   8628  O OD2 . ASP C  1 280 ? -47.178 -70.408  83.059  1.00 29.60 ? 286  ASP C OD2 1 
ATOM   8629  N N   . VAL C  1 281 ? -45.645 -71.673  78.192  1.00 22.37 ? 287  VAL C N   1 
ATOM   8630  C CA  . VAL C  1 281 ? -46.079 -71.585  76.799  1.00 17.99 ? 287  VAL C CA  1 
ATOM   8631  C C   . VAL C  1 281 ? -47.034 -70.409  76.621  1.00 17.80 ? 287  VAL C C   1 
ATOM   8632  O O   . VAL C  1 281 ? -46.866 -69.607  75.717  1.00 17.48 ? 287  VAL C O   1 
ATOM   8633  C CB  . VAL C  1 281 ? -46.776 -72.877  76.317  1.00 18.79 ? 287  VAL C CB  1 
ATOM   8634  C CG1 . VAL C  1 281 ? -47.198 -72.727  74.878  1.00 21.13 ? 287  VAL C CG1 1 
ATOM   8635  C CG2 . VAL C  1 281 ? -45.858 -74.075  76.458  1.00 22.17 ? 287  VAL C CG2 1 
ATOM   8636  N N   . VAL C  1 282 ? -48.035 -70.306  77.492  1.00 18.33 ? 288  VAL C N   1 
ATOM   8637  C CA  . VAL C  1 282 ? -48.932 -69.151  77.485  1.00 20.31 ? 288  VAL C CA  1 
ATOM   8638  C C   . VAL C  1 282 ? -48.915 -68.423  78.830  1.00 16.77 ? 288  VAL C C   1 
ATOM   8639  O O   . VAL C  1 282 ? -49.704 -68.716  79.723  1.00 18.04 ? 288  VAL C O   1 
ATOM   8640  C CB  . VAL C  1 282 ? -50.371 -69.563  77.156  1.00 23.81 ? 288  VAL C CB  1 
ATOM   8641  C CG1 . VAL C  1 282 ? -51.250 -68.334  77.043  1.00 21.00 ? 288  VAL C CG1 1 
ATOM   8642  C CG2 . VAL C  1 282 ? -50.397 -70.375  75.871  1.00 25.52 ? 288  VAL C CG2 1 
ATOM   8643  N N   . PRO C  1 283 ? -47.995 -67.465  78.981  1.00 17.88 ? 289  PRO C N   1 
ATOM   8644  C CA  . PRO C  1 283 ? -47.864 -66.760  80.259  1.00 15.31 ? 289  PRO C CA  1 
ATOM   8645  C C   . PRO C  1 283 ? -49.088 -65.917  80.599  1.00 16.61 ? 289  PRO C C   1 
ATOM   8646  O O   . PRO C  1 283 ? -49.787 -65.459  79.694  1.00 20.46 ? 289  PRO C O   1 
ATOM   8647  C CB  . PRO C  1 283 ? -46.639 -65.864  80.046  1.00 12.14 ? 289  PRO C CB  1 
ATOM   8648  C CG  . PRO C  1 283 ? -45.923 -66.448  78.887  1.00 16.22 ? 289  PRO C CG  1 
ATOM   8649  C CD  . PRO C  1 283 ? -46.966 -67.063  78.013  1.00 14.06 ? 289  PRO C CD  1 
ATOM   8650  N N   . ASP C  1 284 ? -49.339 -65.722  81.891  1.00 15.06 ? 290  ASP C N   1 
ATOM   8651  C CA  . ASP C  1 284 ? -50.357 -64.779  82.339  1.00 14.88 ? 290  ASP C CA  1 
ATOM   8652  C C   . ASP C  1 284 ? -50.001 -63.354  81.925  1.00 17.82 ? 290  ASP C C   1 
ATOM   8653  O O   . ASP C  1 284 ? -50.880 -62.565  81.623  1.00 19.52 ? 290  ASP C O   1 
ATOM   8654  C CB  . ASP C  1 284 ? -50.524 -64.837  83.849  1.00 15.22 ? 290  ASP C CB  1 
ATOM   8655  C CG  . ASP C  1 284 ? -51.127 -66.138  84.320  1.00 23.27 ? 290  ASP C CG  1 
ATOM   8656  O OD1 . ASP C  1 284 ? -51.692 -66.869  83.480  1.00 25.87 ? 290  ASP C OD1 1 
ATOM   8657  O OD2 . ASP C  1 284 ? -51.039 -66.419  85.534  1.00 26.29 ? 290  ASP C OD2 1 
ATOM   8658  N N   . LEU C  1 285 ? -48.706 -63.032  81.937  1.00 18.57 ? 291  LEU C N   1 
ATOM   8659  C CA  . LEU C  1 285 ? -48.207 -61.723  81.503  1.00 13.76 ? 291  LEU C CA  1 
ATOM   8660  C C   . LEU C  1 285 ? -47.622 -61.794  80.098  1.00 16.10 ? 291  LEU C C   1 
ATOM   8661  O O   . LEU C  1 285 ? -46.673 -62.538  79.852  1.00 17.77 ? 291  LEU C O   1 
ATOM   8662  C CB  . LEU C  1 285 ? -47.137 -61.196  82.465  1.00 13.57 ? 291  LEU C CB  1 
ATOM   8663  C CG  . LEU C  1 285 ? -46.608 -59.804  82.098  1.00 15.08 ? 291  LEU C CG  1 
ATOM   8664  C CD1 . LEU C  1 285 ? -47.751 -58.793  82.060  1.00 13.39 ? 291  LEU C CD1 1 
ATOM   8665  C CD2 . LEU C  1 285 ? -45.520 -59.355  83.058  1.00 12.14 ? 291  LEU C CD2 1 
ATOM   8666  N N   . ASP C  1 286 ? -48.189 -61.023  79.175  1.00 18.33 ? 292  ASP C N   1 
ATOM   8667  C CA  . ASP C  1 286 ? -47.695 -60.985  77.805  1.00 18.90 ? 292  ASP C CA  1 
ATOM   8668  C C   . ASP C  1 286 ? -46.696 -59.855  77.662  1.00 24.32 ? 292  ASP C C   1 
ATOM   8669  O O   . ASP C  1 286 ? -47.089 -58.698  77.528  1.00 26.42 ? 292  ASP C O   1 
ATOM   8670  C CB  . ASP C  1 286 ? -48.841 -60.809  76.809  1.00 21.71 ? 292  ASP C CB  1 
ATOM   8671  C CG  . ASP C  1 286 ? -48.357 -60.689  75.373  1.00 26.59 ? 292  ASP C CG  1 
ATOM   8672  O OD1 . ASP C  1 286 ? -47.256 -61.194  75.065  1.00 26.43 ? 292  ASP C OD1 1 
ATOM   8673  O OD2 . ASP C  1 286 ? -49.078 -60.081  74.553  1.00 30.22 ? 292  ASP C OD2 1 
ATOM   8674  N N   . ILE C  1 287 ? -45.408 -60.201  77.699  1.00 25.29 ? 293  ILE C N   1 
ATOM   8675  C CA  . ILE C  1 287 ? -44.333 -59.214  77.629  1.00 23.35 ? 293  ILE C CA  1 
ATOM   8676  C C   . ILE C  1 287 ? -44.021 -58.819  76.196  1.00 25.62 ? 293  ILE C C   1 
ATOM   8677  O O   . ILE C  1 287 ? -43.274 -57.878  75.967  1.00 25.86 ? 293  ILE C O   1 
ATOM   8678  C CB  . ILE C  1 287 ? -43.018 -59.719  78.294  1.00 25.87 ? 293  ILE C CB  1 
ATOM   8679  C CG1 . ILE C  1 287 ? -42.275 -60.708  77.391  1.00 30.11 ? 293  ILE C CG1 1 
ATOM   8680  C CG2 . ILE C  1 287 ? -43.287 -60.299  79.672  1.00 21.53 ? 293  ILE C CG2 1 
ATOM   8681  C CD1 . ILE C  1 287 ? -41.128 -61.464  78.087  1.00 34.65 ? 293  ILE C CD1 1 
ATOM   8682  N N   . TYR C  1 288 ? -44.596 -59.537  75.237  1.00 28.64 ? 294  TYR C N   1 
ATOM   8683  C CA  . TYR C  1 288 ? -44.314 -59.288  73.821  1.00 29.44 ? 294  TYR C CA  1 
ATOM   8684  C C   . TYR C  1 288 ? -45.299 -58.316  73.211  1.00 27.28 ? 294  TYR C C   1 
ATOM   8685  O O   . TYR C  1 288 ? -45.180 -57.961  72.042  1.00 30.56 ? 294  TYR C O   1 
ATOM   8686  C CB  . TYR C  1 288 ? -44.304 -60.603  73.042  1.00 25.80 ? 294  TYR C CB  1 
ATOM   8687  C CG  . TYR C  1 288 ? -43.122 -61.443  73.422  1.00 26.76 ? 294  TYR C CG  1 
ATOM   8688  C CD1 . TYR C  1 288 ? -43.182 -62.323  74.491  1.00 23.78 ? 294  TYR C CD1 1 
ATOM   8689  C CD2 . TYR C  1 288 ? -41.929 -61.322  72.741  1.00 24.13 ? 294  TYR C CD2 1 
ATOM   8690  C CE1 . TYR C  1 288 ? -42.089 -63.070  74.853  1.00 21.70 ? 294  TYR C CE1 1 
ATOM   8691  C CE2 . TYR C  1 288 ? -40.839 -62.060  73.090  1.00 21.21 ? 294  TYR C CE2 1 
ATOM   8692  C CZ  . TYR C  1 288 ? -40.923 -62.932  74.147  1.00 24.42 ? 294  TYR C CZ  1 
ATOM   8693  O OH  . TYR C  1 288 ? -39.826 -63.665  74.487  1.00 27.48 ? 294  TYR C OH  1 
ATOM   8694  N N   . ASP C  1 289 ? -46.266 -57.898  74.027  1.00 28.91 ? 295  ASP C N   1 
ATOM   8695  C CA  . ASP C  1 289 ? -47.206 -56.832  73.709  1.00 28.52 ? 295  ASP C CA  1 
ATOM   8696  C C   . ASP C  1 289 ? -46.447 -55.573  73.312  1.00 26.69 ? 295  ASP C C   1 
ATOM   8697  O O   . ASP C  1 289 ? -45.406 -55.255  73.891  1.00 23.91 ? 295  ASP C O   1 
ATOM   8698  C CB  . ASP C  1 289 ? -48.108 -56.550  74.920  1.00 37.32 ? 295  ASP C CB  1 
ATOM   8699  C CG  . ASP C  1 289 ? -49.318 -55.690  74.581  1.00 48.49 ? 295  ASP C CG  1 
ATOM   8700  O OD1 . ASP C  1 289 ? -49.370 -55.091  73.484  1.00 52.72 ? 295  ASP C OD1 1 
ATOM   8701  O OD2 . ASP C  1 289 ? -50.228 -55.611  75.435  1.00 53.23 ? 295  ASP C OD2 1 
ATOM   8702  N N   . LYS C  1 290 ? -46.966 -54.858  72.322  1.00 20.39 ? 296  LYS C N   1 
ATOM   8703  C CA  . LYS C  1 290 ? -46.358 -53.610  71.901  1.00 15.29 ? 296  LYS C CA  1 
ATOM   8704  C C   . LYS C  1 290 ? -47.379 -52.490  71.964  1.00 16.87 ? 296  LYS C C   1 
ATOM   8705  O O   . LYS C  1 290 ? -47.062 -51.342  71.666  1.00 21.29 ? 296  LYS C O   1 
ATOM   8706  C CB  . LYS C  1 290 ? -45.790 -53.734  70.492  1.00 15.12 ? 296  LYS C CB  1 
ATOM   8707  C CG  . LYS C  1 290 ? -44.619 -54.686  70.383  1.00 20.35 ? 296  LYS C CG  1 
ATOM   8708  C CD  . LYS C  1 290 ? -44.245 -54.911  68.931  1.00 26.04 ? 296  LYS C CD  1 
ATOM   8709  C CE  . LYS C  1 290 ? -43.542 -53.713  68.334  1.00 31.71 ? 296  LYS C CE  1 
ATOM   8710  N NZ  . LYS C  1 290 ? -42.135 -53.611  68.803  1.00 37.00 ? 296  LYS C NZ  1 
ATOM   8711  N N   . SER C  1 291 ? -48.601 -52.824  72.369  1.00 15.79 ? 297  SER C N   1 
ATOM   8712  C CA  . SER C  1 291 ? -49.671 -51.840  72.421  1.00 21.61 ? 297  SER C CA  1 
ATOM   8713  C C   . SER C  1 291 ? -49.709 -51.101  73.755  1.00 18.36 ? 297  SER C C   1 
ATOM   8714  O O   . SER C  1 291 ? -50.401 -50.094  73.898  1.00 19.68 ? 297  SER C O   1 
ATOM   8715  C CB  . SER C  1 291 ? -51.020 -52.510  72.161  1.00 26.20 ? 297  SER C CB  1 
ATOM   8716  O OG  . SER C  1 291 ? -51.318 -53.447  73.179  1.00 32.73 ? 297  SER C OG  1 
ATOM   8717  N N   . TRP C  1 292 ? -48.981 -51.616  74.738  1.00 11.84 ? 298  TRP C N   1 
ATOM   8718  C CA  . TRP C  1 292 ? -48.866 -50.947  76.028  1.00 11.64 ? 298  TRP C CA  1 
ATOM   8719  C C   . TRP C  1 292 ? -47.491 -51.267  76.575  1.00 14.25 ? 298  TRP C C   1 
ATOM   8720  O O   . TRP C  1 292 ? -47.353 -52.048  77.515  1.00 17.39 ? 298  TRP C O   1 
ATOM   8721  C CB  . TRP C  1 292 ? -49.968 -51.398  76.989  1.00 12.02 ? 298  TRP C CB  1 
ATOM   8722  C CG  . TRP C  1 292 ? -50.148 -50.507  78.182  1.00 11.99 ? 298  TRP C CG  1 
ATOM   8723  C CD1 . TRP C  1 292 ? -49.598 -50.671  79.419  1.00 11.41 ? 298  TRP C CD1 1 
ATOM   8724  C CD2 . TRP C  1 292 ? -50.932 -49.311  78.248  1.00 9.99  ? 298  TRP C CD2 1 
ATOM   8725  N NE1 . TRP C  1 292 ? -49.992 -49.654  80.252  1.00 12.00 ? 298  TRP C NE1 1 
ATOM   8726  C CE2 . TRP C  1 292 ? -50.814 -48.807  79.559  1.00 10.10 ? 298  TRP C CE2 1 
ATOM   8727  C CE3 . TRP C  1 292 ? -51.720 -48.616  77.325  1.00 8.61  ? 298  TRP C CE3 1 
ATOM   8728  C CZ2 . TRP C  1 292 ? -51.456 -47.646  79.973  1.00 10.88 ? 298  TRP C CZ2 1 
ATOM   8729  C CZ3 . TRP C  1 292 ? -52.353 -47.458  77.737  1.00 8.62  ? 298  TRP C CZ3 1 
ATOM   8730  C CH2 . TRP C  1 292 ? -52.216 -46.985  79.052  1.00 13.38 ? 298  TRP C CH2 1 
ATOM   8731  N N   . PRO C  1 293 ? -46.456 -50.674  75.965  1.00 12.24 ? 299  PRO C N   1 
ATOM   8732  C CA  . PRO C  1 293 ? -45.083 -51.080  76.241  1.00 11.30 ? 299  PRO C CA  1 
ATOM   8733  C C   . PRO C  1 293 ? -44.582 -50.633  77.606  1.00 13.16 ? 299  PRO C C   1 
ATOM   8734  O O   . PRO C  1 293 ? -44.994 -49.596  78.123  1.00 14.20 ? 299  PRO C O   1 
ATOM   8735  C CB  . PRO C  1 293 ? -44.295 -50.397  75.126  1.00 13.54 ? 299  PRO C CB  1 
ATOM   8736  C CG  . PRO C  1 293 ? -45.091 -49.222  74.787  1.00 15.12 ? 299  PRO C CG  1 
ATOM   8737  C CD  . PRO C  1 293 ? -46.519 -49.625  74.934  1.00 13.08 ? 299  PRO C CD  1 
ATOM   8738  N N   . ILE C  1 294 ? -43.685 -51.428  78.172  1.00 10.98 ? 300  ILE C N   1 
ATOM   8739  C CA  . ILE C  1 294 ? -43.057 -51.092  79.429  1.00 10.17 ? 300  ILE C CA  1 
ATOM   8740  C C   . ILE C  1 294 ? -41.665 -50.578  79.107  1.00 10.05 ? 300  ILE C C   1 
ATOM   8741  O O   . ILE C  1 294 ? -40.848 -51.300  78.553  1.00 12.38 ? 300  ILE C O   1 
ATOM   8742  C CB  . ILE C  1 294 ? -42.985 -52.310  80.379  1.00 9.60  ? 300  ILE C CB  1 
ATOM   8743  C CG1 . ILE C  1 294 ? -44.383 -52.939  80.551  1.00 9.84  ? 300  ILE C CG1 1 
ATOM   8744  C CG2 . ILE C  1 294 ? -42.371 -51.914  81.719  1.00 6.77  ? 300  ILE C CG2 1 
ATOM   8745  C CD1 . ILE C  1 294 ? -45.421 -52.029  81.175  1.00 10.53 ? 300  ILE C CD1 1 
ATOM   8746  N N   . TRP C  1 295 ? -41.416 -49.315  79.414  1.00 8.06  ? 301  TRP C N   1 
ATOM   8747  C CA  . TRP C  1 295 ? -40.095 -48.733  79.211  1.00 8.48  ? 301  TRP C CA  1 
ATOM   8748  C C   . TRP C  1 295 ? -39.207 -49.059  80.411  1.00 11.07 ? 301  TRP C C   1 
ATOM   8749  O O   . TRP C  1 295 ? -39.706 -49.244  81.514  1.00 12.38 ? 301  TRP C O   1 
ATOM   8750  C CB  . TRP C  1 295 ? -40.216 -47.224  79.012  1.00 9.19  ? 301  TRP C CB  1 
ATOM   8751  C CG  . TRP C  1 295 ? -38.912 -46.549  78.883  1.00 9.17  ? 301  TRP C CG  1 
ATOM   8752  C CD1 . TRP C  1 295 ? -38.204 -45.958  79.880  1.00 7.94  ? 301  TRP C CD1 1 
ATOM   8753  C CD2 . TRP C  1 295 ? -38.134 -46.403  77.695  1.00 8.94  ? 301  TRP C CD2 1 
ATOM   8754  N NE1 . TRP C  1 295 ? -37.028 -45.461  79.389  1.00 10.68 ? 301  TRP C NE1 1 
ATOM   8755  C CE2 . TRP C  1 295 ? -36.969 -45.711  78.046  1.00 10.05 ? 301  TRP C CE2 1 
ATOM   8756  C CE3 . TRP C  1 295 ? -38.313 -46.788  76.363  1.00 8.20  ? 301  TRP C CE3 1 
ATOM   8757  C CZ2 . TRP C  1 295 ? -35.979 -45.394  77.120  1.00 12.17 ? 301  TRP C CZ2 1 
ATOM   8758  C CZ3 . TRP C  1 295 ? -37.329 -46.471  75.450  1.00 12.99 ? 301  TRP C CZ3 1 
ATOM   8759  C CH2 . TRP C  1 295 ? -36.176 -45.789  75.829  1.00 13.36 ? 301  TRP C CH2 1 
ATOM   8760  N N   . THR C  1 296 ? -37.898 -49.139  80.202  1.00 9.57  ? 302  THR C N   1 
ATOM   8761  C CA  . THR C  1 296 ? -36.979 -49.378  81.310  1.00 6.26  ? 302  THR C CA  1 
ATOM   8762  C C   . THR C  1 296 ? -35.598 -48.825  80.968  1.00 10.54 ? 302  THR C C   1 
ATOM   8763  O O   . THR C  1 296 ? -35.408 -48.271  79.888  1.00 11.53 ? 302  THR C O   1 
ATOM   8764  C CB  . THR C  1 296 ? -36.871 -50.887  81.645  1.00 11.05 ? 302  THR C CB  1 
ATOM   8765  O OG1 . THR C  1 296 ? -36.132 -51.054  82.860  1.00 14.49 ? 302  THR C OG1 1 
ATOM   8766  C CG2 . THR C  1 296 ? -36.173 -51.651  80.530  1.00 9.97  ? 302  THR C CG2 1 
ATOM   8767  N N   . TYR C  1 297 ? -34.630 -48.956  81.872  1.00 8.03  ? 303  TYR C N   1 
ATOM   8768  C CA  . TYR C  1 297 ? -33.259 -48.657  81.483  1.00 7.46  ? 303  TYR C CA  1 
ATOM   8769  C C   . TYR C  1 297 ? -32.661 -49.886  80.816  1.00 10.17 ? 303  TYR C C   1 
ATOM   8770  O O   . TYR C  1 297 ? -32.589 -50.951  81.424  1.00 11.15 ? 303  TYR C O   1 
ATOM   8771  C CB  . TYR C  1 297 ? -32.409 -48.243  82.677  1.00 7.58  ? 303  TYR C CB  1 
ATOM   8772  C CG  . TYR C  1 297 ? -30.966 -48.035  82.300  1.00 9.36  ? 303  TYR C CG  1 
ATOM   8773  C CD1 . TYR C  1 297 ? -30.615 -47.152  81.283  1.00 12.25 ? 303  TYR C CD1 1 
ATOM   8774  C CD2 . TYR C  1 297 ? -29.950 -48.724  82.948  1.00 13.07 ? 303  TYR C CD2 1 
ATOM   8775  C CE1 . TYR C  1 297 ? -29.287 -46.964  80.921  1.00 12.05 ? 303  TYR C CE1 1 
ATOM   8776  C CE2 . TYR C  1 297 ? -28.611 -48.534  82.592  1.00 12.33 ? 303  TYR C CE2 1 
ATOM   8777  C CZ  . TYR C  1 297 ? -28.295 -47.654  81.580  1.00 9.39  ? 303  TYR C CZ  1 
ATOM   8778  O OH  . TYR C  1 297 ? -26.977 -47.468  81.218  1.00 13.53 ? 303  TYR C OH  1 
ATOM   8779  N N   . ALA C  1 298 ? -32.243 -49.749  79.564  1.00 10.30 ? 304  ALA C N   1 
ATOM   8780  C CA  . ALA C  1 298 ? -31.600 -50.855  78.869  1.00 16.86 ? 304  ALA C CA  1 
ATOM   8781  C C   . ALA C  1 298 ? -30.351 -50.402  78.135  1.00 16.27 ? 304  ALA C C   1 
ATOM   8782  O O   . ALA C  1 298 ? -30.335 -49.340  77.516  1.00 16.92 ? 304  ALA C O   1 
ATOM   8783  C CB  . ALA C  1 298 ? -32.560 -51.497  77.894  1.00 21.63 ? 304  ALA C CB  1 
ATOM   8784  N N   . GLU C  1 299 ? -29.307 -51.220  78.200  1.00 13.84 ? 305  GLU C N   1 
ATOM   8785  C CA  . GLU C  1 299 ? -28.105 -50.951  77.435  1.00 12.25 ? 305  GLU C CA  1 
ATOM   8786  C C   . GLU C  1 299 ? -27.998 -51.856  76.224  1.00 11.83 ? 305  GLU C C   1 
ATOM   8787  O O   . GLU C  1 299 ? -28.517 -52.964  76.225  1.00 16.94 ? 305  GLU C O   1 
ATOM   8788  C CB  . GLU C  1 299 ? -26.869 -51.104  78.318  1.00 14.77 ? 305  GLU C CB  1 
ATOM   8789  C CG  . GLU C  1 299 ? -26.758 -49.992  79.346  1.00 17.09 ? 305  GLU C CG  1 
ATOM   8790  C CD  . GLU C  1 299 ? -25.699 -50.236  80.401  1.00 20.72 ? 305  GLU C CD  1 
ATOM   8791  O OE1 . GLU C  1 299 ? -24.985 -51.266  80.327  1.00 17.36 ? 305  GLU C OE1 1 
ATOM   8792  O OE2 . GLU C  1 299 ? -25.589 -49.382  81.310  1.00 14.95 ? 305  GLU C OE2 1 
ATOM   8793  N N   . ILE C  1 300 ? -27.337 -51.367  75.179  1.00 12.75 ? 306  ILE C N   1 
ATOM   8794  C CA  . ILE C  1 300 ? -26.985 -52.211  74.043  1.00 15.55 ? 306  ILE C CA  1 
ATOM   8795  C C   . ILE C  1 300 ? -26.067 -53.340  74.524  1.00 14.83 ? 306  ILE C C   1 
ATOM   8796  O O   . ILE C  1 300 ? -25.038 -53.088  75.135  1.00 15.77 ? 306  ILE C O   1 
ATOM   8797  C CB  . ILE C  1 300 ? -26.291 -51.396  72.924  1.00 18.38 ? 306  ILE C CB  1 
ATOM   8798  C CG1 . ILE C  1 300 ? -27.170 -50.223  72.496  1.00 15.75 ? 306  ILE C CG1 1 
ATOM   8799  C CG2 . ILE C  1 300 ? -25.976 -52.270  71.722  1.00 17.38 ? 306  ILE C CG2 1 
ATOM   8800  C CD1 . ILE C  1 300 ? -26.563 -49.390  71.420  1.00 14.17 ? 306  ILE C CD1 1 
ATOM   8801  N N   . THR C  1 301 ? -26.452 -54.582  74.276  1.00 13.49 ? 307  THR C N   1 
ATOM   8802  C CA  . THR C  1 301 ? -25.657 -55.720  74.729  1.00 15.97 ? 307  THR C CA  1 
ATOM   8803  C C   . THR C  1 301 ? -25.426 -56.647  73.553  1.00 13.64 ? 307  THR C C   1 
ATOM   8804  O O   . THR C  1 301 ? -26.149 -56.578  72.564  1.00 15.09 ? 307  THR C O   1 
ATOM   8805  C CB  . THR C  1 301 ? -26.359 -56.523  75.851  1.00 17.55 ? 307  THR C CB  1 
ATOM   8806  O OG1 . THR C  1 301 ? -27.564 -57.079  75.330  1.00 17.63 ? 307  THR C OG1 1 
ATOM   8807  C CG2 . THR C  1 301 ? -26.694 -55.655  77.067  1.00 14.61 ? 307  THR C CG2 1 
ATOM   8808  N N   . PRO C  1 302 ? -24.433 -57.533  73.652  1.00 13.24 ? 308  PRO C N   1 
ATOM   8809  C CA  . PRO C  1 302 ? -24.375 -58.559  72.613  1.00 14.29 ? 308  PRO C CA  1 
ATOM   8810  C C   . PRO C  1 302 ? -25.543 -59.540  72.747  1.00 14.71 ? 308  PRO C C   1 
ATOM   8811  O O   . PRO C  1 302 ? -26.259 -59.516  73.748  1.00 15.17 ? 308  PRO C O   1 
ATOM   8812  C CB  . PRO C  1 302 ? -23.019 -59.237  72.855  1.00 16.88 ? 308  PRO C CB  1 
ATOM   8813  C CG  . PRO C  1 302 ? -22.607 -58.847  74.210  1.00 15.35 ? 308  PRO C CG  1 
ATOM   8814  C CD  . PRO C  1 302 ? -23.276 -57.571  74.560  1.00 15.98 ? 308  PRO C CD  1 
ATOM   8815  N N   . PRO C  1 303 ? -25.768 -60.369  71.725  1.00 11.13 ? 309  PRO C N   1 
ATOM   8816  C CA  . PRO C  1 303 ? -26.861 -61.342  71.810  1.00 12.88 ? 309  PRO C CA  1 
ATOM   8817  C C   . PRO C  1 303 ? -26.581 -62.424  72.852  1.00 10.11 ? 309  PRO C C   1 
ATOM   8818  O O   . PRO C  1 303 ? -25.555 -62.374  73.519  1.00 16.31 ? 309  PRO C O   1 
ATOM   8819  C CB  . PRO C  1 303 ? -26.923 -61.937  70.397  1.00 15.15 ? 309  PRO C CB  1 
ATOM   8820  C CG  . PRO C  1 303 ? -25.652 -61.500  69.717  1.00 14.79 ? 309  PRO C CG  1 
ATOM   8821  C CD  . PRO C  1 303 ? -25.179 -60.279  70.377  1.00 13.12 ? 309  PRO C CD  1 
ATOM   8822  N N   . ALA C  1 304 ? -27.496 -63.365  73.011  1.00 8.89  ? 310  ALA C N   1 
ATOM   8823  C CA  . ALA C  1 304 ? -27.246 -64.527  73.854  1.00 8.01  ? 310  ALA C CA  1 
ATOM   8824  C C   . ALA C  1 304 ? -26.445 -65.549  73.050  1.00 9.21  ? 310  ALA C C   1 
ATOM   8825  O O   . ALA C  1 304 ? -26.645 -65.681  71.847  1.00 16.23 ? 310  ALA C O   1 
ATOM   8826  C CB  . ALA C  1 304 ? -28.555 -65.125  74.347  1.00 10.24 ? 310  ALA C CB  1 
ATOM   8827  N N   . LYS C  1 305 ? -25.540 -66.268  73.704  1.00 8.85  ? 311  LYS C N   1 
ATOM   8828  C CA  . LYS C  1 305 ? -24.696 -67.235  73.012  1.00 6.75  ? 311  LYS C CA  1 
ATOM   8829  C C   . LYS C  1 305 ? -24.755 -68.590  73.693  1.00 11.03 ? 311  LYS C C   1 
ATOM   8830  O O   . LYS C  1 305 ? -24.722 -68.685  74.924  1.00 12.39 ? 311  LYS C O   1 
ATOM   8831  C CB  . LYS C  1 305 ? -23.253 -66.740  72.968  1.00 10.57 ? 311  LYS C CB  1 
ATOM   8832  C CG  . LYS C  1 305 ? -22.277 -67.666  72.288  1.00 7.93  ? 311  LYS C CG  1 
ATOM   8833  C CD  . LYS C  1 305 ? -20.964 -66.934  72.076  1.00 11.41 ? 311  LYS C CD  1 
ATOM   8834  C CE  . LYS C  1 305 ? -19.843 -67.861  71.676  1.00 16.16 ? 311  LYS C CE  1 
ATOM   8835  N NZ  . LYS C  1 305 ? -19.907 -68.181  70.245  1.00 20.13 ? 311  LYS C NZ  1 
ATOM   8836  N N   . PHE C  1 306 ? -24.831 -69.638  72.887  1.00 11.98 ? 312  PHE C N   1 
ATOM   8837  C CA  . PHE C  1 306 ? -24.915 -71.002  73.399  1.00 13.52 ? 312  PHE C CA  1 
ATOM   8838  C C   . PHE C  1 306 ? -23.793 -71.792  72.784  1.00 11.38 ? 312  PHE C C   1 
ATOM   8839  O O   . PHE C  1 306 ? -23.716 -71.887  71.571  1.00 13.28 ? 312  PHE C O   1 
ATOM   8840  C CB  . PHE C  1 306 ? -26.268 -71.627  73.052  1.00 11.44 ? 312  PHE C CB  1 
ATOM   8841  C CG  . PHE C  1 306 ? -27.429 -70.824  73.525  1.00 11.85 ? 312  PHE C CG  1 
ATOM   8842  C CD1 . PHE C  1 306 ? -27.940 -69.788  72.749  1.00 10.11 ? 312  PHE C CD1 1 
ATOM   8843  C CD2 . PHE C  1 306 ? -27.997 -71.081  74.766  1.00 13.63 ? 312  PHE C CD2 1 
ATOM   8844  C CE1 . PHE C  1 306 ? -28.992 -69.035  73.195  1.00 9.66  ? 312  PHE C CE1 1 
ATOM   8845  C CE2 . PHE C  1 306 ? -29.051 -70.330  75.220  1.00 12.56 ? 312  PHE C CE2 1 
ATOM   8846  C CZ  . PHE C  1 306 ? -29.552 -69.303  74.429  1.00 10.39 ? 312  PHE C CZ  1 
ATOM   8847  N N   . VAL C  1 307 ? -22.914 -72.350  73.601  1.00 7.75  ? 313  VAL C N   1 
ATOM   8848  C CA  . VAL C  1 307 ? -21.753 -73.010  73.044  1.00 10.47 ? 313  VAL C CA  1 
ATOM   8849  C C   . VAL C  1 307 ? -21.528 -74.375  73.716  1.00 13.71 ? 313  VAL C C   1 
ATOM   8850  O O   . VAL C  1 307 ? -21.987 -74.605  74.844  1.00 13.45 ? 313  VAL C O   1 
ATOM   8851  C CB  . VAL C  1 307 ? -20.519 -72.052  73.144  1.00 24.37 ? 313  VAL C CB  1 
ATOM   8852  C CG1 . VAL C  1 307 ? -20.364 -71.499  74.536  1.00 20.09 ? 313  VAL C CG1 1 
ATOM   8853  C CG2 . VAL C  1 307 ? -19.246 -72.713  72.705  1.00 30.49 ? 313  VAL C CG2 1 
ATOM   8854  N N   . HIS C  1 308 ? -20.876 -75.275  72.967  1.00 16.24 ? 314  HIS C N   1 
ATOM   8855  C CA  . HIS C  1 308 ? -20.519 -76.658  73.338  1.00 14.71 ? 314  HIS C CA  1 
ATOM   8856  C C   . HIS C  1 308 ? -21.657 -77.607  73.014  1.00 17.73 ? 314  HIS C C   1 
ATOM   8857  O O   . HIS C  1 308 ? -22.830 -77.317  73.252  1.00 16.03 ? 314  HIS C O   1 
ATOM   8858  C CB  . HIS C  1 308 ? -20.119 -76.799  74.817  1.00 12.68 ? 314  HIS C CB  1 
ATOM   8859  C CG  . HIS C  1 308 ? -18.820 -76.137  75.155  1.00 13.65 ? 314  HIS C CG  1 
ATOM   8860  N ND1 . HIS C  1 308 ? -17.635 -76.478  74.545  1.00 12.23 ? 314  HIS C ND1 1 
ATOM   8861  C CD2 . HIS C  1 308 ? -18.524 -75.143  76.023  1.00 12.71 ? 314  HIS C CD2 1 
ATOM   8862  C CE1 . HIS C  1 308 ? -16.661 -75.727  75.024  1.00 11.41 ? 314  HIS C CE1 1 
ATOM   8863  N NE2 . HIS C  1 308 ? -17.175 -74.907  75.923  1.00 14.13 ? 314  HIS C NE2 1 
ATOM   8864  N N   . ASP C  1 309 ? -21.286 -78.758  72.476  1.00 16.82 ? 315  ASP C N   1 
ATOM   8865  C CA  . ASP C  1 309 ? -22.252 -79.722  72.015  1.00 16.92 ? 315  ASP C CA  1 
ATOM   8866  C C   . ASP C  1 309 ? -21.605 -81.103  71.972  1.00 25.38 ? 315  ASP C C   1 
ATOM   8867  O O   . ASP C  1 309 ? -21.953 -81.929  71.132  1.00 30.12 ? 315  ASP C O   1 
ATOM   8868  C CB  . ASP C  1 309 ? -22.771 -79.310  70.636  1.00 12.36 ? 315  ASP C CB  1 
ATOM   8869  C CG  . ASP C  1 309 ? -23.928 -80.146  70.174  1.00 20.91 ? 315  ASP C CG  1 
ATOM   8870  O OD1 . ASP C  1 309 ? -24.533 -80.843  71.014  1.00 29.96 ? 315  ASP C OD1 1 
ATOM   8871  O OD2 . ASP C  1 309 ? -24.244 -80.099  68.969  1.00 20.77 ? 315  ASP C OD2 1 
ATOM   8872  N N   . ASP C  1 310 ? -20.646 -81.347  72.864  1.00 23.06 ? 316  ASP C N   1 
ATOM   8873  C CA  . ASP C  1 310 ? -19.894 -82.594  72.821  1.00 19.54 ? 316  ASP C CA  1 
ATOM   8874  C C   . ASP C  1 310 ? -20.583 -83.653  73.664  1.00 24.26 ? 316  ASP C C   1 
ATOM   8875  O O   . ASP C  1 310 ? -21.715 -83.461  74.100  1.00 27.19 ? 316  ASP C O   1 
ATOM   8876  C CB  . ASP C  1 310 ? -18.439 -82.379  73.255  1.00 18.93 ? 316  ASP C CB  1 
ATOM   8877  C CG  . ASP C  1 310 ? -18.303 -81.774  74.640  1.00 27.61 ? 316  ASP C CG  1 
ATOM   8878  O OD1 . ASP C  1 310 ? -18.896 -82.322  75.591  1.00 35.21 ? 316  ASP C OD1 1 
ATOM   8879  O OD2 . ASP C  1 310 ? -17.566 -80.772  74.784  1.00 25.63 ? 316  ASP C OD2 1 
ATOM   8880  N N   . GLU C  1 311 ? -19.916 -84.781  73.878  1.00 29.83 ? 317  GLU C N   1 
ATOM   8881  C CA  . GLU C  1 311 ? -20.557 -85.902  74.549  1.00 31.05 ? 317  GLU C CA  1 
ATOM   8882  C C   . GLU C  1 311 ? -20.838 -85.586  76.022  1.00 31.42 ? 317  GLU C C   1 
ATOM   8883  O O   . GLU C  1 311 ? -21.767 -86.132  76.615  1.00 36.64 ? 317  GLU C O   1 
ATOM   8884  C CB  . GLU C  1 311 ? -19.701 -87.169  74.420  1.00 33.98 ? 317  GLU C CB  1 
ATOM   8885  C CG  . GLU C  1 311 ? -18.288 -87.050  74.990  1.00 43.45 ? 317  GLU C CG  1 
ATOM   8886  C CD  . GLU C  1 311 ? -17.508 -88.364  74.937  1.00 51.22 ? 317  GLU C CD  1 
ATOM   8887  O OE1 . GLU C  1 311 ? -17.295 -88.884  73.821  1.00 55.55 ? 317  GLU C OE1 1 
ATOM   8888  O OE2 . GLU C  1 311 ? -17.110 -88.880  76.008  1.00 49.28 ? 317  GLU C OE2 1 
ATOM   8889  N N   . ASP C  1 312 ? -20.057 -84.677  76.595  1.00 24.70 ? 318  ASP C N   1 
ATOM   8890  C CA  . ASP C  1 312 ? -20.112 -84.421  78.028  1.00 21.88 ? 318  ASP C CA  1 
ATOM   8891  C C   . ASP C  1 312 ? -20.796 -83.101  78.411  1.00 22.66 ? 318  ASP C C   1 
ATOM   8892  O O   . ASP C  1 312 ? -21.160 -82.911  79.568  1.00 20.83 ? 318  ASP C O   1 
ATOM   8893  C CB  . ASP C  1 312 ? -18.696 -84.434  78.615  1.00 23.33 ? 318  ASP C CB  1 
ATOM   8894  C CG  . ASP C  1 312 ? -17.880 -85.635  78.165  1.00 25.43 ? 318  ASP C CG  1 
ATOM   8895  O OD1 . ASP C  1 312 ? -18.218 -86.755  78.590  1.00 29.41 ? 318  ASP C OD1 1 
ATOM   8896  O OD2 . ASP C  1 312 ? -16.895 -85.461  77.409  1.00 23.24 ? 318  ASP C OD2 1 
ATOM   8897  N N   . ARG C  1 313 ? -20.959 -82.185  77.458  1.00 18.98 ? 319  ARG C N   1 
ATOM   8898  C CA  . ARG C  1 313 ? -21.516 -80.875  77.779  1.00 19.02 ? 319  ARG C CA  1 
ATOM   8899  C C   . ARG C  1 313 ? -22.212 -80.249  76.584  1.00 15.77 ? 319  ARG C C   1 
ATOM   8900  O O   . ARG C  1 313 ? -21.730 -80.319  75.461  1.00 17.12 ? 319  ARG C O   1 
ATOM   8901  C CB  . ARG C  1 313 ? -20.425 -79.919  78.294  1.00 15.71 ? 319  ARG C CB  1 
ATOM   8902  C CG  . ARG C  1 313 ? -19.253 -79.721  77.334  1.00 17.10 ? 319  ARG C CG  1 
ATOM   8903  C CD  . ARG C  1 313 ? -18.186 -78.792  77.903  1.00 18.94 ? 319  ARG C CD  1 
ATOM   8904  N NE  . ARG C  1 313 ? -16.997 -78.766  77.057  1.00 20.20 ? 319  ARG C NE  1 
ATOM   8905  C CZ  . ARG C  1 313 ? -15.926 -78.014  77.284  1.00 18.48 ? 319  ARG C CZ  1 
ATOM   8906  N NH1 . ARG C  1 313 ? -15.877 -77.200  78.324  1.00 15.59 ? 319  ARG C NH1 1 
ATOM   8907  N NH2 . ARG C  1 313 ? -14.899 -78.070  76.453  1.00 26.76 ? 319  ARG C NH2 1 
ATOM   8908  N N   . ARG C  1 314 ? -23.352 -79.629  76.849  1.00 14.36 ? 320  ARG C N   1 
ATOM   8909  C CA  . ARG C  1 314 ? -24.099 -78.917  75.829  1.00 13.01 ? 320  ARG C CA  1 
ATOM   8910  C C   . ARG C  1 314 ? -24.702 -77.662  76.430  1.00 13.26 ? 320  ARG C C   1 
ATOM   8911  O O   . ARG C  1 314 ? -25.433 -77.725  77.415  1.00 16.87 ? 320  ARG C O   1 
ATOM   8912  C CB  . ARG C  1 314 ? -25.192 -79.812  75.237  1.00 15.84 ? 320  ARG C CB  1 
ATOM   8913  C CG  . ARG C  1 314 ? -26.200 -79.080  74.364  1.00 17.73 ? 320  ARG C CG  1 
ATOM   8914  C CD  . ARG C  1 314 ? -26.779 -79.994  73.306  1.00 27.32 ? 320  ARG C CD  1 
ATOM   8915  N NE  . ARG C  1 314 ? -27.994 -80.672  73.731  1.00 34.41 ? 320  ARG C NE  1 
ATOM   8916  C CZ  . ARG C  1 314 ? -28.110 -81.988  73.856  1.00 45.08 ? 320  ARG C CZ  1 
ATOM   8917  N NH1 . ARG C  1 314 ? -27.076 -82.773  73.583  1.00 51.56 ? 320  ARG C NH1 1 
ATOM   8918  N NH2 . ARG C  1 314 ? -29.263 -82.521  74.245  1.00 44.19 ? 320  ARG C NH2 1 
ATOM   8919  N N   . GLY C  1 315 ? -24.380 -76.518  75.849  1.00 12.71 ? 321  GLY C N   1 
ATOM   8920  C CA  . GLY C  1 315 ? -24.994 -75.275  76.264  1.00 11.99 ? 321  GLY C CA  1 
ATOM   8921  C C   . GLY C  1 315 ? -26.283 -75.037  75.489  1.00 12.61 ? 321  GLY C C   1 
ATOM   8922  O O   . GLY C  1 315 ? -26.248 -74.784  74.292  1.00 15.99 ? 321  GLY C O   1 
ATOM   8923  N N   . SER C  1 316 ? -27.420 -75.157  76.166  1.00 13.17 ? 322  SER C N   1 
ATOM   8924  C CA  . SER C  1 316 ? -28.706 -74.765  75.592  1.00 14.26 ? 322  SER C CA  1 
ATOM   8925  C C   . SER C  1 316 ? -29.751 -74.545  76.669  1.00 14.81 ? 322  SER C C   1 
ATOM   8926  O O   . SER C  1 316 ? -29.610 -75.003  77.807  1.00 14.53 ? 322  SER C O   1 
ATOM   8927  C CB  . SER C  1 316 ? -29.225 -75.802  74.596  1.00 25.15 ? 322  SER C CB  1 
ATOM   8928  O OG  . SER C  1 316 ? -29.033 -77.102  75.090  1.00 34.78 ? 322  SER C OG  1 
ATOM   8929  N N   . ALA C  1 317 ? -30.809 -73.839  76.289  1.00 14.18 ? 323  ALA C N   1 
ATOM   8930  C CA  . ALA C  1 317 ? -31.873 -73.489  77.207  1.00 14.14 ? 323  ALA C CA  1 
ATOM   8931  C C   . ALA C  1 317 ? -33.185 -74.052  76.706  1.00 13.87 ? 323  ALA C C   1 
ATOM   8932  O O   . ALA C  1 317 ? -33.525 -73.916  75.540  1.00 15.62 ? 323  ALA C O   1 
ATOM   8933  C CB  . ALA C  1 317 ? -31.965 -71.987  77.358  1.00 15.52 ? 323  ALA C CB  1 
ATOM   8934  N N   . VAL C  1 318 ? -33.917 -74.703  77.595  1.00 16.20 ? 324  VAL C N   1 
ATOM   8935  C CA  . VAL C  1 318 ? -35.202 -75.280  77.242  1.00 14.22 ? 324  VAL C CA  1 
ATOM   8936  C C   . VAL C  1 318 ? -36.243 -74.702  78.188  1.00 12.46 ? 324  VAL C C   1 
ATOM   8937  O O   . VAL C  1 318 ? -35.968 -74.560  79.384  1.00 11.90 ? 324  VAL C O   1 
ATOM   8938  C CB  . VAL C  1 318 ? -35.177 -76.824  77.337  1.00 16.82 ? 324  VAL C CB  1 
ATOM   8939  C CG1 . VAL C  1 318 ? -36.456 -77.387  76.806  1.00 21.56 ? 324  VAL C CG1 1 
ATOM   8940  C CG2 . VAL C  1 318 ? -34.023 -77.380  76.547  1.00 15.51 ? 324  VAL C CG2 1 
ATOM   8941  N N   . SER C  1 319 ? -37.422 -74.366  77.655  1.00 11.79 ? 325  SER C N   1 
ATOM   8942  C CA  . SER C  1 319 ? -38.490 -73.760  78.437  1.00 13.52 ? 325  SER C CA  1 
ATOM   8943  C C   . SER C  1 319 ? -37.943 -72.630  79.284  1.00 12.41 ? 325  SER C C   1 
ATOM   8944  O O   . SER C  1 319 ? -38.207 -72.554  80.472  1.00 11.71 ? 325  SER C O   1 
ATOM   8945  C CB  . SER C  1 319 ? -39.177 -74.799  79.318  1.00 16.83 ? 325  SER C CB  1 
ATOM   8946  O OG  . SER C  1 319 ? -39.840 -75.751  78.513  1.00 18.06 ? 325  SER C OG  1 
ATOM   8947  N N   . SER C  1 320 ? -37.168 -71.755  78.655  1.00 14.89 ? 326  SER C N   1 
ATOM   8948  C CA  . SER C  1 320 ? -36.481 -70.695  79.378  1.00 13.69 ? 326  SER C CA  1 
ATOM   8949  C C   . SER C  1 320 ? -36.511 -69.379  78.627  1.00 13.95 ? 326  SER C C   1 
ATOM   8950  O O   . SER C  1 320 ? -36.764 -69.325  77.417  1.00 14.12 ? 326  SER C O   1 
ATOM   8951  C CB  . SER C  1 320 ? -35.020 -71.081  79.654  1.00 9.40  ? 326  SER C CB  1 
ATOM   8952  O OG  . SER C  1 320 ? -34.934 -72.190  80.509  1.00 9.87  ? 326  SER C OG  1 
ATOM   8953  N N   . VAL C  1 321 ? -36.236 -68.323  79.381  1.00 12.20 ? 327  VAL C N   1 
ATOM   8954  C CA  . VAL C  1 321 ? -36.131 -66.971  78.869  1.00 10.41 ? 327  VAL C CA  1 
ATOM   8955  C C   . VAL C  1 321 ? -34.718 -66.469  79.196  1.00 9.69  ? 327  VAL C C   1 
ATOM   8956  O O   . VAL C  1 321 ? -34.272 -66.583  80.339  1.00 11.91 ? 327  VAL C O   1 
ATOM   8957  C CB  . VAL C  1 321 ? -37.199 -66.073  79.495  1.00 13.47 ? 327  VAL C CB  1 
ATOM   8958  C CG1 . VAL C  1 321 ? -37.077 -64.677  78.984  1.00 15.76 ? 327  VAL C CG1 1 
ATOM   8959  C CG2 . VAL C  1 321 ? -38.605 -66.628  79.209  1.00 13.06 ? 327  VAL C CG2 1 
ATOM   8960  N N   . VAL C  1 322 ? -34.011 -65.961  78.192  1.00 9.35  ? 328  VAL C N   1 
ATOM   8961  C CA  . VAL C  1 322 ? -32.592 -65.601  78.322  1.00 11.24 ? 328  VAL C CA  1 
ATOM   8962  C C   . VAL C  1 322 ? -32.358 -64.218  77.721  1.00 10.67 ? 328  VAL C C   1 
ATOM   8963  O O   . VAL C  1 322 ? -32.793 -63.954  76.607  1.00 10.70 ? 328  VAL C O   1 
ATOM   8964  C CB  . VAL C  1 322 ? -31.668 -66.627  77.616  1.00 11.33 ? 328  VAL C CB  1 
ATOM   8965  C CG1 . VAL C  1 322 ? -30.224 -66.214  77.735  1.00 9.13  ? 328  VAL C CG1 1 
ATOM   8966  C CG2 . VAL C  1 322 ? -31.864 -68.030  78.180  1.00 13.46 ? 328  VAL C CG2 1 
ATOM   8967  N N   . SER C  1 323 ? -31.677 -63.342  78.451  1.00 12.68 ? 329  SER C N   1 
ATOM   8968  C CA  . SER C  1 323 ? -31.441 -61.971  77.995  1.00 13.89 ? 329  SER C CA  1 
ATOM   8969  C C   . SER C  1 323 ? -30.107 -61.796  77.275  1.00 10.32 ? 329  SER C C   1 
ATOM   8970  O O   . SER C  1 323 ? -29.369 -62.755  77.054  1.00 9.94  ? 329  SER C O   1 
ATOM   8971  C CB  . SER C  1 323 ? -31.499 -61.001  79.171  1.00 17.62 ? 329  SER C CB  1 
ATOM   8972  O OG  . SER C  1 323 ? -32.522 -61.369  80.069  1.00 18.68 ? 329  SER C OG  1 
ATOM   8973  N N   . GLY C  1 324 ? -29.809 -60.551  76.914  1.00 11.14 ? 330  GLY C N   1 
ATOM   8974  C CA  . GLY C  1 324 ? -28.583 -60.229  76.207  1.00 8.25  ? 330  GLY C CA  1 
ATOM   8975  C C   . GLY C  1 324 ? -27.372 -60.363  77.094  1.00 8.60  ? 330  GLY C C   1 
ATOM   8976  O O   . GLY C  1 324 ? -27.499 -60.425  78.315  1.00 10.89 ? 330  GLY C O   1 
ATOM   8977  N N   . ASP C  1 325 ? -26.199 -60.422  76.472  1.00 11.00 ? 331  ASP C N   1 
ATOM   8978  C CA  . ASP C  1 325 ? -24.924 -60.577  77.170  1.00 12.16 ? 331  ASP C CA  1 
ATOM   8979  C C   . ASP C  1 325 ? -24.865 -61.864  78.001  1.00 12.18 ? 331  ASP C C   1 
ATOM   8980  O O   . ASP C  1 325 ? -24.046 -61.978  78.906  1.00 16.42 ? 331  ASP C O   1 
ATOM   8981  C CB  . ASP C  1 325 ? -24.649 -59.350  78.052  1.00 10.32 ? 331  ASP C CB  1 
ATOM   8982  C CG  . ASP C  1 325 ? -23.182 -59.222  78.457  1.00 17.90 ? 331  ASP C CG  1 
ATOM   8983  O OD1 . ASP C  1 325 ? -22.308 -59.906  77.871  1.00 16.50 ? 331  ASP C OD1 1 
ATOM   8984  O OD2 . ASP C  1 325 ? -22.901 -58.425  79.372  1.00 19.20 ? 331  ASP C OD2 1 
ATOM   8985  N N   . CYS C  1 326 ? -25.724 -62.837  77.698  1.00 12.22 ? 332  CYS C N   1 
ATOM   8986  C CA  . CYS C  1 326 ? -25.636 -64.135  78.361  1.00 10.14 ? 332  CYS C CA  1 
ATOM   8987  C C   . CYS C  1 326 ? -24.823 -65.125  77.538  1.00 8.67  ? 332  CYS C C   1 
ATOM   8988  O O   . CYS C  1 326 ? -25.037 -65.263  76.346  1.00 8.83  ? 332  CYS C O   1 
ATOM   8989  C CB  . CYS C  1 326 ? -27.017 -64.705  78.627  1.00 12.47 ? 332  CYS C CB  1 
ATOM   8990  S SG  . CYS C  1 326 ? -27.941 -63.850  79.877  1.00 18.56 ? 332  CYS C SG  1 
ATOM   8991  N N   . ILE C  1 327 ? -23.890 -65.813  78.183  1.00 13.16 ? 333  ILE C N   1 
ATOM   8992  C CA  . ILE C  1 327 ? -23.105 -66.838  77.514  1.00 12.85 ? 333  ILE C CA  1 
ATOM   8993  C C   . ILE C  1 327 ? -23.343 -68.152  78.220  1.00 12.69 ? 333  ILE C C   1 
ATOM   8994  O O   . ILE C  1 327 ? -22.922 -68.335  79.364  1.00 13.66 ? 333  ILE C O   1 
ATOM   8995  C CB  . ILE C  1 327 ? -21.599 -66.516  77.504  1.00 12.12 ? 333  ILE C CB  1 
ATOM   8996  C CG1 . ILE C  1 327 ? -21.352 -65.194  76.782  1.00 14.56 ? 333  ILE C CG1 1 
ATOM   8997  C CG2 . ILE C  1 327 ? -20.825 -67.622  76.810  1.00 11.67 ? 333  ILE C CG2 1 
ATOM   8998  C CD1 . ILE C  1 327 ? -19.874 -64.864  76.597  1.00 19.45 ? 333  ILE C CD1 1 
ATOM   8999  N N   . ILE C  1 328 ? -24.038 -69.057  77.540  1.00 9.41  ? 334  ILE C N   1 
ATOM   9000  C CA  . ILE C  1 328 ? -24.396 -70.353  78.107  1.00 10.62 ? 334  ILE C CA  1 
ATOM   9001  C C   . ILE C  1 328 ? -23.416 -71.391  77.584  1.00 11.96 ? 334  ILE C C   1 
ATOM   9002  O O   . ILE C  1 328 ? -23.613 -71.946  76.511  1.00 11.76 ? 334  ILE C O   1 
ATOM   9003  C CB  . ILE C  1 328 ? -25.843 -70.751  77.747  1.00 10.88 ? 334  ILE C CB  1 
ATOM   9004  C CG1 . ILE C  1 328 ? -26.789 -69.555  77.928  1.00 10.70 ? 334  ILE C CG1 1 
ATOM   9005  C CG2 . ILE C  1 328 ? -26.296 -71.979  78.549  1.00 8.81  ? 334  ILE C CG2 1 
ATOM   9006  C CD1 . ILE C  1 328 ? -26.768 -68.953  79.307  1.00 15.55 ? 334  ILE C CD1 1 
ATOM   9007  N N   . SER C  1 329 ? -22.346 -71.617  78.337  1.00 10.21 ? 335  SER C N   1 
ATOM   9008  C CA  . SER C  1 329 ? -21.197 -72.381  77.852  1.00 10.40 ? 335  SER C CA  1 
ATOM   9009  C C   . SER C  1 329 ? -21.189 -73.796  78.394  1.00 12.76 ? 335  SER C C   1 
ATOM   9010  O O   . SER C  1 329 ? -20.727 -74.016  79.500  1.00 13.76 ? 335  SER C O   1 
ATOM   9011  C CB  . SER C  1 329 ? -19.890 -71.688  78.242  1.00 11.73 ? 335  SER C CB  1 
ATOM   9012  O OG  . SER C  1 329 ? -18.772 -72.310  77.628  1.00 11.62 ? 335  SER C OG  1 
ATOM   9013  N N   . GLY C  1 330 ? -21.706 -74.749  77.624  1.00 14.25 ? 336  GLY C N   1 
ATOM   9014  C CA  . GLY C  1 330 ? -21.747 -76.134  78.060  1.00 14.72 ? 336  GLY C CA  1 
ATOM   9015  C C   . GLY C  1 330 ? -22.646 -76.347  79.264  1.00 14.40 ? 336  GLY C C   1 
ATOM   9016  O O   . GLY C  1 330 ? -22.549 -77.367  79.952  1.00 14.37 ? 336  GLY C O   1 
ATOM   9017  N N   . ALA C  1 331 ? -23.526 -75.381  79.513  1.00 14.20 ? 337  ALA C N   1 
ATOM   9018  C CA  . ALA C  1 331 ? -24.446 -75.421  80.644  1.00 11.39 ? 337  ALA C CA  1 
ATOM   9019  C C   . ALA C  1 331 ? -25.891 -75.727  80.215  1.00 15.15 ? 337  ALA C C   1 
ATOM   9020  O O   . ALA C  1 331 ? -26.366 -75.241  79.190  1.00 12.23 ? 337  ALA C O   1 
ATOM   9021  C CB  . ALA C  1 331 ? -24.397 -74.111  81.383  1.00 13.13 ? 337  ALA C CB  1 
ATOM   9022  N N   . ALA C  1 332 ? -26.595 -76.525  81.007  1.00 13.51 ? 338  ALA C N   1 
ATOM   9023  C CA  . ALA C  1 332 ? -27.982 -76.847  80.697  1.00 16.66 ? 338  ALA C CA  1 
ATOM   9024  C C   . ALA C  1 332 ? -28.956 -75.957  81.478  1.00 17.45 ? 338  ALA C C   1 
ATOM   9025  O O   . ALA C  1 332 ? -28.901 -75.900  82.707  1.00 19.63 ? 338  ALA C O   1 
ATOM   9026  C CB  . ALA C  1 332 ? -28.254 -78.318  80.992  1.00 14.75 ? 338  ALA C CB  1 
ATOM   9027  N N   . LEU C  1 333 ? -29.837 -75.256  80.770  1.00 15.47 ? 339  LEU C N   1 
ATOM   9028  C CA  . LEU C  1 333 ? -30.901 -74.504  81.432  1.00 13.76 ? 339  LEU C CA  1 
ATOM   9029  C C   . LEU C  1 333 ? -32.253 -75.121  81.131  1.00 13.38 ? 339  LEU C C   1 
ATOM   9030  O O   . LEU C  1 333 ? -32.541 -75.479  79.994  1.00 16.49 ? 339  LEU C O   1 
ATOM   9031  C CB  . LEU C  1 333 ? -30.911 -73.051  80.994  1.00 14.59 ? 339  LEU C CB  1 
ATOM   9032  C CG  . LEU C  1 333 ? -29.588 -72.311  80.917  1.00 21.62 ? 339  LEU C CG  1 
ATOM   9033  C CD1 . LEU C  1 333 ? -29.805 -70.937  80.305  1.00 19.32 ? 339  LEU C CD1 1 
ATOM   9034  C CD2 . LEU C  1 333 ? -28.980 -72.213  82.270  1.00 18.87 ? 339  LEU C CD2 1 
ATOM   9035  N N   . ASN C  1 334 ? -33.078 -75.242  82.160  1.00 15.56 ? 340  ASN C N   1 
ATOM   9036  C CA  . ASN C  1 334 ? -34.424 -75.766  82.005  1.00 17.09 ? 340  ASN C CA  1 
ATOM   9037  C C   . ASN C  1 334 ? -35.352 -74.981  82.904  1.00 13.08 ? 340  ASN C C   1 
ATOM   9038  O O   . ASN C  1 334 ? -35.069 -74.808  84.081  1.00 14.83 ? 340  ASN C O   1 
ATOM   9039  C CB  . ASN C  1 334 ? -34.478 -77.264  82.344  1.00 19.79 ? 340  ASN C CB  1 
ATOM   9040  C CG  . ASN C  1 334 ? -35.824 -77.899  82.008  1.00 27.77 ? 340  ASN C CG  1 
ATOM   9041  O OD1 . ASN C  1 334 ? -36.395 -77.652  80.951  1.00 28.53 ? 340  ASN C OD1 1 
ATOM   9042  N ND2 . ASN C  1 334 ? -36.339 -78.713  82.922  1.00 30.76 ? 340  ASN C ND2 1 
ATOM   9043  N N   . ARG C  1 335 ? -36.455 -74.509  82.344  1.00 14.47 ? 341  ARG C N   1 
ATOM   9044  C CA  . ARG C  1 335 ? -37.440 -73.719  83.075  1.00 13.30 ? 341  ARG C CA  1 
ATOM   9045  C C   . ARG C  1 335 ? -36.797 -72.634  83.933  1.00 13.28 ? 341  ARG C C   1 
ATOM   9046  O O   . ARG C  1 335 ? -37.023 -72.562  85.135  1.00 13.97 ? 341  ARG C O   1 
ATOM   9047  C CB  . ARG C  1 335 ? -38.332 -74.622  83.929  1.00 18.97 ? 341  ARG C CB  1 
ATOM   9048  C CG  . ARG C  1 335 ? -39.622 -73.929  84.308  1.00 26.39 ? 341  ARG C CG  1 
ATOM   9049  C CD  . ARG C  1 335 ? -40.717 -74.890  84.665  1.00 31.85 ? 341  ARG C CD  1 
ATOM   9050  N NE  . ARG C  1 335 ? -41.861 -74.187  85.242  1.00 34.83 ? 341  ARG C NE  1 
ATOM   9051  C CZ  . ARG C  1 335 ? -42.103 -74.106  86.545  1.00 34.52 ? 341  ARG C CZ  1 
ATOM   9052  N NH1 . ARG C  1 335 ? -41.288 -74.696  87.406  1.00 35.61 ? 341  ARG C NH1 1 
ATOM   9053  N NH2 . ARG C  1 335 ? -43.166 -73.449  86.988  1.00 33.38 ? 341  ARG C NH2 1 
ATOM   9054  N N   . SER C  1 336 ? -36.006 -71.776  83.296  1.00 11.30 ? 342  SER C N   1 
ATOM   9055  C CA  . SER C  1 336 ? -35.307 -70.721  84.006  1.00 12.18 ? 342  SER C CA  1 
ATOM   9056  C C   . SER C  1 336 ? -35.453 -69.382  83.315  1.00 10.98 ? 342  SER C C   1 
ATOM   9057  O O   . SER C  1 336 ? -35.745 -69.322  82.132  1.00 9.24  ? 342  SER C O   1 
ATOM   9058  C CB  . SER C  1 336 ? -33.826 -71.074  84.147  1.00 12.53 ? 342  SER C CB  1 
ATOM   9059  O OG  . SER C  1 336 ? -33.665 -72.254  84.906  1.00 14.83 ? 342  SER C OG  1 
ATOM   9060  N N   . LEU C  1 337 ? -35.237 -68.316  84.074  1.00 8.42  ? 343  LEU C N   1 
ATOM   9061  C CA  . LEU C  1 337 ? -35.298 -66.956  83.564  1.00 9.47  ? 343  LEU C CA  1 
ATOM   9062  C C   . LEU C  1 337 ? -33.983 -66.263  83.905  1.00 13.37 ? 343  LEU C C   1 
ATOM   9063  O O   . LEU C  1 337 ? -33.650 -66.099  85.079  1.00 12.79 ? 343  LEU C O   1 
ATOM   9064  C CB  . LEU C  1 337 ? -36.508 -66.211  84.164  1.00 10.67 ? 343  LEU C CB  1 
ATOM   9065  C CG  . LEU C  1 337 ? -36.700 -64.702  83.963  1.00 13.15 ? 343  LEU C CG  1 
ATOM   9066  C CD1 . LEU C  1 337 ? -36.594 -64.333  82.520  1.00 11.15 ? 343  LEU C CD1 1 
ATOM   9067  C CD2 . LEU C  1 337 ? -38.055 -64.291  84.470  1.00 16.86 ? 343  LEU C CD2 1 
ATOM   9068  N N   . LEU C  1 338 ? -33.225 -65.882  82.880  1.00 11.91 ? 344  LEU C N   1 
ATOM   9069  C CA  . LEU C  1 338 ? -31.933 -65.226  83.084  1.00 9.48  ? 344  LEU C CA  1 
ATOM   9070  C C   . LEU C  1 338 ? -31.987 -63.771  82.651  1.00 11.60 ? 344  LEU C C   1 
ATOM   9071  O O   . LEU C  1 338 ? -32.363 -63.464  81.524  1.00 11.95 ? 344  LEU C O   1 
ATOM   9072  C CB  . LEU C  1 338 ? -30.827 -65.940  82.310  1.00 10.39 ? 344  LEU C CB  1 
ATOM   9073  C CG  . LEU C  1 338 ? -30.170 -67.203  82.872  1.00 10.68 ? 344  LEU C CG  1 
ATOM   9074  C CD1 . LEU C  1 338 ? -31.183 -68.244  83.236  1.00 13.34 ? 344  LEU C CD1 1 
ATOM   9075  C CD2 . LEU C  1 338 ? -29.194 -67.769  81.867  1.00 8.37  ? 344  LEU C CD2 1 
ATOM   9076  N N   . PHE C  1 339 ? -31.596 -62.881  83.557  1.00 13.06 ? 345  PHE C N   1 
ATOM   9077  C CA  . PHE C  1 339 ? -31.452 -61.468  83.249  1.00 9.10  ? 345  PHE C CA  1 
ATOM   9078  C C   . PHE C  1 339 ? -30.154 -61.217  82.486  1.00 10.82 ? 345  PHE C C   1 
ATOM   9079  O O   . PHE C  1 339 ? -29.401 -62.152  82.192  1.00 11.84 ? 345  PHE C O   1 
ATOM   9080  C CB  . PHE C  1 339 ? -31.493 -60.645  84.535  1.00 9.77  ? 345  PHE C CB  1 
ATOM   9081  C CG  . PHE C  1 339 ? -32.861 -60.569  85.175  1.00 11.98 ? 345  PHE C CG  1 
ATOM   9082  C CD1 . PHE C  1 339 ? -33.441 -61.678  85.764  1.00 12.71 ? 345  PHE C CD1 1 
ATOM   9083  C CD2 . PHE C  1 339 ? -33.556 -59.374  85.199  1.00 14.73 ? 345  PHE C CD2 1 
ATOM   9084  C CE1 . PHE C  1 339 ? -34.693 -61.600  86.352  1.00 12.63 ? 345  PHE C CE1 1 
ATOM   9085  C CE2 . PHE C  1 339 ? -34.807 -59.293  85.783  1.00 17.89 ? 345  PHE C CE2 1 
ATOM   9086  C CZ  . PHE C  1 339 ? -35.369 -60.411  86.366  1.00 15.87 ? 345  PHE C CZ  1 
ATOM   9087  N N   . THR C  1 340 ? -29.876 -59.958  82.183  1.00 20.78 ? 346  THR C N   1 
ATOM   9088  C CA  A THR C  1 340 ? -28.712 -59.570  81.393  0.30 28.93 ? 346  THR C CA  1 
ATOM   9089  C CA  B THR C  1 340 ? -28.722 -59.637  81.356  0.70 45.96 ? 346  THR C CA  1 
ATOM   9090  C C   . THR C  1 340 ? -27.388 -60.033  81.999  1.00 23.01 ? 346  THR C C   1 
ATOM   9091  O O   . THR C  1 340 ? -27.202 -59.953  83.204  1.00 12.42 ? 346  THR C O   1 
ATOM   9092  C CB  A THR C  1 340 ? -28.652 -58.037  81.235  0.30 28.74 ? 346  THR C CB  1 
ATOM   9093  C CB  B THR C  1 340 ? -28.682 -58.134  81.010  0.70 30.87 ? 346  THR C CB  1 
ATOM   9094  O OG1 A THR C  1 340 ? -29.977 -57.515  81.079  0.30 30.57 ? 346  THR C OG1 1 
ATOM   9095  O OG1 B THR C  1 340 ? -27.502 -57.848  80.257  0.70 29.45 ? 346  THR C OG1 1 
ATOM   9096  C CG2 A THR C  1 340 ? -27.806 -57.650  80.036  0.30 29.77 ? 346  THR C CG2 1 
ATOM   9097  C CG2 B THR C  1 340 ? -28.670 -57.294  82.256  0.70 25.93 ? 346  THR C CG2 1 
ATOM   9098  N N   . GLY C  1 341 ? -26.467 -60.498  81.165  1.00 12.29 ? 347  GLY C N   1 
ATOM   9099  C CA  . GLY C  1 341 ? -25.100 -60.715  81.588  1.00 13.07 ? 347  GLY C CA  1 
ATOM   9100  C C   . GLY C  1 341 ? -24.769 -61.945  82.401  1.00 12.50 ? 347  GLY C C   1 
ATOM   9101  O O   . GLY C  1 341 ? -23.745 -61.968  83.073  1.00 12.81 ? 347  GLY C O   1 
ATOM   9102  N N   . VAL C  1 342 ? -25.610 -62.970  82.325  1.00 11.71 ? 348  VAL C N   1 
ATOM   9103  C CA  . VAL C  1 342 ? -25.362 -64.203  83.058  1.00 10.65 ? 348  VAL C CA  1 
ATOM   9104  C C   . VAL C  1 342 ? -24.336 -65.073  82.333  1.00 13.94 ? 348  VAL C C   1 
ATOM   9105  O O   . VAL C  1 342 ? -24.433 -65.283  81.129  1.00 16.50 ? 348  VAL C O   1 
ATOM   9106  C CB  . VAL C  1 342 ? -26.661 -64.996  83.259  1.00 13.56 ? 348  VAL C CB  1 
ATOM   9107  C CG1 . VAL C  1 342 ? -26.359 -66.398  83.778  1.00 14.44 ? 348  VAL C CG1 1 
ATOM   9108  C CG2 . VAL C  1 342 ? -27.621 -64.235  84.188  1.00 14.80 ? 348  VAL C CG2 1 
ATOM   9109  N N   . ARG C  1 343 ? -23.347 -65.566  83.067  1.00 9.61  ? 349  ARG C N   1 
ATOM   9110  C CA  . ARG C  1 343 ? -22.356 -66.480  82.510  1.00 14.02 ? 349  ARG C CA  1 
ATOM   9111  C C   . ARG C  1 343 ? -22.495 -67.833  83.181  1.00 14.13 ? 349  ARG C C   1 
ATOM   9112  O O   . ARG C  1 343 ? -22.161 -67.983  84.352  1.00 13.09 ? 349  ARG C O   1 
ATOM   9113  C CB  . ARG C  1 343 ? -20.935 -65.938  82.703  1.00 16.15 ? 349  ARG C CB  1 
ATOM   9114  C CG  . ARG C  1 343 ? -20.658 -64.586  82.029  1.00 20.59 ? 349  ARG C CG  1 
ATOM   9115  C CD  . ARG C  1 343 ? -20.336 -64.773  80.548  1.00 23.67 ? 349  ARG C CD  1 
ATOM   9116  N NE  . ARG C  1 343 ? -19.680 -63.620  79.918  1.00 25.52 ? 349  ARG C NE  1 
ATOM   9117  C CZ  . ARG C  1 343 ? -20.330 -62.546  79.481  1.00 26.93 ? 349  ARG C CZ  1 
ATOM   9118  N NH1 . ARG C  1 343 ? -19.675 -61.549  78.908  1.00 25.21 ? 349  ARG C NH1 1 
ATOM   9119  N NH2 . ARG C  1 343 ? -21.642 -62.469  79.629  1.00 32.99 ? 349  ARG C NH2 1 
ATOM   9120  N N   . ALA C  1 344 ? -22.999 -68.817  82.450  1.00 9.97  ? 350  ALA C N   1 
ATOM   9121  C CA  . ALA C  1 344 ? -23.150 -70.153  83.011  1.00 11.59 ? 350  ALA C CA  1 
ATOM   9122  C C   . ALA C  1 344 ? -22.147 -71.087  82.349  1.00 12.86 ? 350  ALA C C   1 
ATOM   9123  O O   . ALA C  1 344 ? -22.153 -71.228  81.139  1.00 13.10 ? 350  ALA C O   1 
ATOM   9124  C CB  . ALA C  1 344 ? -24.572 -70.656  82.827  1.00 9.90  ? 350  ALA C CB  1 
ATOM   9125  N N   . ASN C  1 345 ? -21.284 -71.723  83.141  1.00 14.93 ? 351  ASN C N   1 
ATOM   9126  C CA  . ASN C  1 345 ? -20.144 -72.448  82.580  1.00 11.50 ? 351  ASN C CA  1 
ATOM   9127  C C   . ASN C  1 345 ? -20.337 -73.966  82.490  1.00 11.45 ? 351  ASN C C   1 
ATOM   9128  O O   . ASN C  1 345 ? -21.352 -74.498  82.935  1.00 13.98 ? 351  ASN C O   1 
ATOM   9129  C CB  . ASN C  1 345 ? -18.885 -72.118  83.386  1.00 12.73 ? 351  ASN C CB  1 
ATOM   9130  C CG  . ASN C  1 345 ? -18.504 -70.637  83.307  1.00 15.42 ? 351  ASN C CG  1 
ATOM   9131  O OD1 . ASN C  1 345 ? -17.983 -70.072  84.262  1.00 22.61 ? 351  ASN C OD1 1 
ATOM   9132  N ND2 . ASN C  1 345 ? -18.755 -70.016  82.164  1.00 13.58 ? 351  ASN C ND2 1 
ATOM   9133  N N   . SER C  1 346 ? -19.355 -74.647  81.901  1.00 12.43 ? 352  SER C N   1 
ATOM   9134  C CA  . SER C  1 346 ? -19.474 -76.055  81.499  1.00 10.64 ? 352  SER C CA  1 
ATOM   9135  C C   . SER C  1 346 ? -19.832 -77.016  82.627  1.00 12.72 ? 352  SER C C   1 
ATOM   9136  O O   . SER C  1 346 ? -19.302 -76.922  83.732  1.00 11.22 ? 352  SER C O   1 
ATOM   9137  C CB  . SER C  1 346 ? -18.176 -76.535  80.837  1.00 12.58 ? 352  SER C CB  1 
ATOM   9138  O OG  . SER C  1 346 ? -17.984 -75.951  79.558  1.00 11.95 ? 352  SER C OG  1 
ATOM   9139  N N   . TYR C  1 347 ? -20.744 -77.932  82.306  1.00 16.12 ? 353  TYR C N   1 
ATOM   9140  C CA  . TYR C  1 347 ? -21.183 -79.031  83.170  1.00 16.05 ? 353  TYR C CA  1 
ATOM   9141  C C   . TYR C  1 347 ? -22.137 -78.556  84.265  1.00 15.03 ? 353  TYR C C   1 
ATOM   9142  O O   . TYR C  1 347 ? -22.592 -79.356  85.074  1.00 16.01 ? 353  TYR C O   1 
ATOM   9143  C CB  . TYR C  1 347 ? -19.970 -79.783  83.764  1.00 16.03 ? 353  TYR C CB  1 
ATOM   9144  C CG  . TYR C  1 347 ? -18.936 -80.108  82.705  1.00 15.50 ? 353  TYR C CG  1 
ATOM   9145  C CD1 . TYR C  1 347 ? -19.234 -80.985  81.675  1.00 17.89 ? 353  TYR C CD1 1 
ATOM   9146  C CD2 . TYR C  1 347 ? -17.685 -79.507  82.707  1.00 15.54 ? 353  TYR C CD2 1 
ATOM   9147  C CE1 . TYR C  1 347 ? -18.313 -81.267  80.690  1.00 17.23 ? 353  TYR C CE1 1 
ATOM   9148  C CE2 . TYR C  1 347 ? -16.756 -79.785  81.715  1.00 15.22 ? 353  TYR C CE2 1 
ATOM   9149  C CZ  . TYR C  1 347 ? -17.084 -80.667  80.713  1.00 16.03 ? 353  TYR C CZ  1 
ATOM   9150  O OH  . TYR C  1 347 ? -16.180 -80.9