data_5W6J
# 
_entry.id   5W6J 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.387 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   5W6J         pdb_00005w6j 10.2210/pdb5w6j/pdb 
WWPDB D_1000228492 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-11-14 
2 'Structure model' 1 1 2018-11-21 
3 'Structure model' 1 2 2019-02-20 
4 'Structure model' 1 3 2019-11-27 
5 'Structure model' 1 4 2024-03-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'            
2 2 'Structure model' 'Database references'        
3 3 'Structure model' 'Author supporting evidence' 
4 3 'Structure model' 'Data collection'            
5 4 'Structure model' 'Author supporting evidence' 
6 4 'Structure model' 'Database references'        
7 5 'Structure model' Advisory                     
8 5 'Structure model' 'Data collection'            
9 5 'Structure model' 'Database references'        
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                     
2 2 'Structure model' citation_author              
3 3 'Structure model' pdbx_audit_support           
4 4 'Structure model' citation                     
5 4 'Structure model' pdbx_audit_support           
6 5 'Structure model' chem_comp_atom               
7 5 'Structure model' chem_comp_bond               
8 5 'Structure model' database_2                   
9 5 'Structure model' pdbx_unobs_or_zero_occ_atoms 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.journal_abbrev'                 
2  2 'Structure model' '_citation.pdbx_database_id_DOI'           
3  2 'Structure model' '_citation.pdbx_database_id_PubMed'        
4  2 'Structure model' '_citation.title'                          
5  2 'Structure model' '_citation_author.identifier_ORCID'        
6  2 'Structure model' '_citation_author.name'                    
7  3 'Structure model' '_pdbx_audit_support.funding_organization' 
8  4 'Structure model' '_citation.journal_volume'                 
9  4 'Structure model' '_citation.page_first'                     
10 4 'Structure model' '_citation.page_last'                      
11 4 'Structure model' '_citation.year'                           
12 4 'Structure model' '_pdbx_audit_support.funding_organization' 
13 5 'Structure model' '_database_2.pdbx_DOI'                     
14 5 'Structure model' '_database_2.pdbx_database_accession'      
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'The distance between residues ARG C101 and GLU C104 is large (13.44 Angstrom)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5W6J 
_pdbx_database_status.recvd_initial_deposition_date   2017-06-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Mascarenhas, R.N.' 1 ? 
'Hill, B.L.'        2 ? 
'Wu, R.'            3 ? 
'Ballicora, M.A.'   4 ? 
'Liu, D.'           5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Biol. Chem.' 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            294 
_citation.language                  ? 
_citation.page_first                1338 
_citation.page_last                 1348 
_citation.title                     
'Structural analysis reveals a pyruvate-binding activator site in theAgrobacterium tumefaciensADP-glucose pyrophosphorylase.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA118.004246 
_citation.pdbx_database_id_PubMed   30401744 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hill, B.L.'          1 ?                   
primary 'Mascarenhas, R.'     2 ?                   
primary 'Patel, H.P.'         3 ?                   
primary 'Asencion Diez, M.D.' 4 ?                   
primary 'Wu, R.'              5 ?                   
primary 'Iglesias, A.A.'      6 ?                   
primary 'Liu, D.'             7 0000-0002-7587-703X 
primary 'Ballicora, M.A.'     8 ?                   
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucose-1-phosphate adenylyltransferase' 47101.156 20    2.7.7.27 ? ? ? 
2 non-polymer syn 'SULFATE ION'                             96.063    42    ?        ? ? ? 
3 water       nat water                                     18.015    11196 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ADP-glucose pyrophosphorylase,ADPGlc PPase,ADP-glucose synthase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSEKRVQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRG
WDFFRPERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKMDYEYMLQQHVDSGADVTIGC
LEVPRMEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEALRRDAADPTSSRDFGKDIIPY
IVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIWTYAEITPPAKFVHDDEDRRG
SAVSSVVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHGVVIPEGLIVGEDPELDAKRF
RRTESGICLITQSMIDKLDL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSEKRVQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRG
WDFFRPERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKMDYEYMLQQHVDSGADVTIGC
LEVPRMEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEALRRDAADPTSSRDFGKDIIPY
IVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIWTYAEITPPAKFVHDDEDRRG
SAVSSVVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHGVVIPEGLIVGEDPELDAKRF
RRTESGICLITQSMIDKLDL
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,H,I,J,K,L,N,O,P,Q,R,F,G,M,T,U 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLU n 
1 4   LYS n 
1 5   ARG n 
1 6   VAL n 
1 7   GLN n 
1 8   PRO n 
1 9   LEU n 
1 10  ALA n 
1 11  ARG n 
1 12  ASP n 
1 13  ALA n 
1 14  MET n 
1 15  ALA n 
1 16  TYR n 
1 17  VAL n 
1 18  LEU n 
1 19  ALA n 
1 20  GLY n 
1 21  GLY n 
1 22  ARG n 
1 23  GLY n 
1 24  SER n 
1 25  ARG n 
1 26  LEU n 
1 27  LYS n 
1 28  GLU n 
1 29  LEU n 
1 30  THR n 
1 31  ASP n 
1 32  ARG n 
1 33  ARG n 
1 34  ALA n 
1 35  LYS n 
1 36  PRO n 
1 37  ALA n 
1 38  VAL n 
1 39  TYR n 
1 40  PHE n 
1 41  GLY n 
1 42  GLY n 
1 43  LYS n 
1 44  ALA n 
1 45  ARG n 
1 46  ILE n 
1 47  ILE n 
1 48  ASP n 
1 49  PHE n 
1 50  ALA n 
1 51  LEU n 
1 52  SER n 
1 53  ASN n 
1 54  ALA n 
1 55  LEU n 
1 56  ASN n 
1 57  SER n 
1 58  GLY n 
1 59  ILE n 
1 60  ARG n 
1 61  ARG n 
1 62  ILE n 
1 63  GLY n 
1 64  VAL n 
1 65  ALA n 
1 66  THR n 
1 67  GLN n 
1 68  TYR n 
1 69  LYS n 
1 70  ALA n 
1 71  HIS n 
1 72  SER n 
1 73  LEU n 
1 74  ILE n 
1 75  ARG n 
1 76  HIS n 
1 77  LEU n 
1 78  GLN n 
1 79  ARG n 
1 80  GLY n 
1 81  TRP n 
1 82  ASP n 
1 83  PHE n 
1 84  PHE n 
1 85  ARG n 
1 86  PRO n 
1 87  GLU n 
1 88  ARG n 
1 89  ASN n 
1 90  GLU n 
1 91  SER n 
1 92  PHE n 
1 93  ASP n 
1 94  ILE n 
1 95  LEU n 
1 96  PRO n 
1 97  ALA n 
1 98  SER n 
1 99  GLN n 
1 100 ARG n 
1 101 VAL n 
1 102 SER n 
1 103 GLU n 
1 104 THR n 
1 105 GLN n 
1 106 TRP n 
1 107 TYR n 
1 108 GLU n 
1 109 GLY n 
1 110 THR n 
1 111 ALA n 
1 112 ASP n 
1 113 ALA n 
1 114 VAL n 
1 115 TYR n 
1 116 GLN n 
1 117 ASN n 
1 118 ILE n 
1 119 ASP n 
1 120 ILE n 
1 121 ILE n 
1 122 GLU n 
1 123 PRO n 
1 124 TYR n 
1 125 ALA n 
1 126 PRO n 
1 127 GLU n 
1 128 TYR n 
1 129 MET n 
1 130 VAL n 
1 131 ILE n 
1 132 LEU n 
1 133 ALA n 
1 134 GLY n 
1 135 ASP n 
1 136 HIS n 
1 137 ILE n 
1 138 TYR n 
1 139 LYS n 
1 140 MET n 
1 141 ASP n 
1 142 TYR n 
1 143 GLU n 
1 144 TYR n 
1 145 MET n 
1 146 LEU n 
1 147 GLN n 
1 148 GLN n 
1 149 HIS n 
1 150 VAL n 
1 151 ASP n 
1 152 SER n 
1 153 GLY n 
1 154 ALA n 
1 155 ASP n 
1 156 VAL n 
1 157 THR n 
1 158 ILE n 
1 159 GLY n 
1 160 CYS n 
1 161 LEU n 
1 162 GLU n 
1 163 VAL n 
1 164 PRO n 
1 165 ARG n 
1 166 MET n 
1 167 GLU n 
1 168 ALA n 
1 169 THR n 
1 170 GLY n 
1 171 PHE n 
1 172 GLY n 
1 173 VAL n 
1 174 MET n 
1 175 HIS n 
1 176 VAL n 
1 177 ASN n 
1 178 GLU n 
1 179 LYS n 
1 180 ASP n 
1 181 GLU n 
1 182 ILE n 
1 183 ILE n 
1 184 ASP n 
1 185 PHE n 
1 186 ILE n 
1 187 GLU n 
1 188 LYS n 
1 189 PRO n 
1 190 ALA n 
1 191 ASP n 
1 192 PRO n 
1 193 PRO n 
1 194 GLY n 
1 195 ILE n 
1 196 PRO n 
1 197 GLY n 
1 198 ASN n 
1 199 GLU n 
1 200 GLY n 
1 201 PHE n 
1 202 ALA n 
1 203 LEU n 
1 204 ALA n 
1 205 SER n 
1 206 MET n 
1 207 GLY n 
1 208 ILE n 
1 209 TYR n 
1 210 VAL n 
1 211 PHE n 
1 212 HIS n 
1 213 THR n 
1 214 LYS n 
1 215 PHE n 
1 216 LEU n 
1 217 MET n 
1 218 GLU n 
1 219 ALA n 
1 220 LEU n 
1 221 ARG n 
1 222 ARG n 
1 223 ASP n 
1 224 ALA n 
1 225 ALA n 
1 226 ASP n 
1 227 PRO n 
1 228 THR n 
1 229 SER n 
1 230 SER n 
1 231 ARG n 
1 232 ASP n 
1 233 PHE n 
1 234 GLY n 
1 235 LYS n 
1 236 ASP n 
1 237 ILE n 
1 238 ILE n 
1 239 PRO n 
1 240 TYR n 
1 241 ILE n 
1 242 VAL n 
1 243 GLU n 
1 244 HIS n 
1 245 GLY n 
1 246 LYS n 
1 247 ALA n 
1 248 VAL n 
1 249 ALA n 
1 250 HIS n 
1 251 ARG n 
1 252 PHE n 
1 253 ALA n 
1 254 ASP n 
1 255 SER n 
1 256 CYS n 
1 257 VAL n 
1 258 ARG n 
1 259 SER n 
1 260 ASP n 
1 261 PHE n 
1 262 GLU n 
1 263 HIS n 
1 264 GLU n 
1 265 PRO n 
1 266 TYR n 
1 267 TRP n 
1 268 ARG n 
1 269 ASP n 
1 270 VAL n 
1 271 GLY n 
1 272 THR n 
1 273 ILE n 
1 274 ASP n 
1 275 ALA n 
1 276 TYR n 
1 277 TRP n 
1 278 GLN n 
1 279 ALA n 
1 280 ASN n 
1 281 ILE n 
1 282 ASP n 
1 283 LEU n 
1 284 THR n 
1 285 ASP n 
1 286 VAL n 
1 287 VAL n 
1 288 PRO n 
1 289 ASP n 
1 290 LEU n 
1 291 ASP n 
1 292 ILE n 
1 293 TYR n 
1 294 ASP n 
1 295 LYS n 
1 296 SER n 
1 297 TRP n 
1 298 PRO n 
1 299 ILE n 
1 300 TRP n 
1 301 THR n 
1 302 TYR n 
1 303 ALA n 
1 304 GLU n 
1 305 ILE n 
1 306 THR n 
1 307 PRO n 
1 308 PRO n 
1 309 ALA n 
1 310 LYS n 
1 311 PHE n 
1 312 VAL n 
1 313 HIS n 
1 314 ASP n 
1 315 ASP n 
1 316 GLU n 
1 317 ASP n 
1 318 ARG n 
1 319 ARG n 
1 320 GLY n 
1 321 SER n 
1 322 ALA n 
1 323 VAL n 
1 324 SER n 
1 325 SER n 
1 326 VAL n 
1 327 VAL n 
1 328 SER n 
1 329 GLY n 
1 330 ASP n 
1 331 CYS n 
1 332 ILE n 
1 333 ILE n 
1 334 SER n 
1 335 GLY n 
1 336 ALA n 
1 337 ALA n 
1 338 LEU n 
1 339 ASN n 
1 340 ARG n 
1 341 SER n 
1 342 LEU n 
1 343 LEU n 
1 344 PHE n 
1 345 THR n 
1 346 GLY n 
1 347 VAL n 
1 348 ARG n 
1 349 ALA n 
1 350 ASN n 
1 351 SER n 
1 352 TYR n 
1 353 SER n 
1 354 ARG n 
1 355 LEU n 
1 356 GLU n 
1 357 ASN n 
1 358 ALA n 
1 359 VAL n 
1 360 VAL n 
1 361 LEU n 
1 362 PRO n 
1 363 SER n 
1 364 VAL n 
1 365 LYS n 
1 366 ILE n 
1 367 GLY n 
1 368 ARG n 
1 369 HIS n 
1 370 ALA n 
1 371 GLN n 
1 372 LEU n 
1 373 SER n 
1 374 ASN n 
1 375 VAL n 
1 376 VAL n 
1 377 ILE n 
1 378 ASP n 
1 379 HIS n 
1 380 GLY n 
1 381 VAL n 
1 382 VAL n 
1 383 ILE n 
1 384 PRO n 
1 385 GLU n 
1 386 GLY n 
1 387 LEU n 
1 388 ILE n 
1 389 VAL n 
1 390 GLY n 
1 391 GLU n 
1 392 ASP n 
1 393 PRO n 
1 394 GLU n 
1 395 LEU n 
1 396 ASP n 
1 397 ALA n 
1 398 LYS n 
1 399 ARG n 
1 400 PHE n 
1 401 ARG n 
1 402 ARG n 
1 403 THR n 
1 404 GLU n 
1 405 SER n 
1 406 GLY n 
1 407 ILE n 
1 408 CYS n 
1 409 LEU n 
1 410 ILE n 
1 411 THR n 
1 412 GLN n 
1 413 SER n 
1 414 MET n 
1 415 ILE n 
1 416 ASP n 
1 417 LYS n 
1 418 LEU n 
1 419 ASP n 
1 420 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   420 
_entity_src_gen.gene_src_common_name               'Agrobacterium tumefaciens' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 glgC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rhizobium radiobacter' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     358 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli K-12' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     83333 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   2   ?   ?   ?   A . n 
A 1 2   SER 2   3   ?   ?   ?   A . n 
A 1 3   GLU 3   4   4   GLU GLU A . n 
A 1 4   LYS 4   5   5   LYS LYS A . n 
A 1 5   ARG 5   6   6   ARG ARG A . n 
A 1 6   VAL 6   7   7   VAL VAL A . n 
A 1 7   GLN 7   8   8   GLN GLN A . n 
A 1 8   PRO 8   9   9   PRO PRO A . n 
A 1 9   LEU 9   10  10  LEU LEU A . n 
A 1 10  ALA 10  11  11  ALA ALA A . n 
A 1 11  ARG 11  12  12  ARG ARG A . n 
A 1 12  ASP 12  13  13  ASP ASP A . n 
A 1 13  ALA 13  14  14  ALA ALA A . n 
A 1 14  MET 14  15  15  MET MET A . n 
A 1 15  ALA 15  16  16  ALA ALA A . n 
A 1 16  TYR 16  17  17  TYR TYR A . n 
A 1 17  VAL 17  18  18  VAL VAL A . n 
A 1 18  LEU 18  19  19  LEU LEU A . n 
A 1 19  ALA 19  20  20  ALA ALA A . n 
A 1 20  GLY 20  21  21  GLY GLY A . n 
A 1 21  GLY 21  22  22  GLY GLY A . n 
A 1 22  ARG 22  23  23  ARG ARG A . n 
A 1 23  GLY 23  24  24  GLY GLY A . n 
A 1 24  SER 24  25  25  SER SER A . n 
A 1 25  ARG 25  26  26  ARG ARG A . n 
A 1 26  LEU 26  27  27  LEU LEU A . n 
A 1 27  LYS 27  28  28  LYS LYS A . n 
A 1 28  GLU 28  29  29  GLU GLU A . n 
A 1 29  LEU 29  30  30  LEU LEU A . n 
A 1 30  THR 30  31  31  THR THR A . n 
A 1 31  ASP 31  32  32  ASP ASP A . n 
A 1 32  ARG 32  33  33  ARG ARG A . n 
A 1 33  ARG 33  34  34  ARG ARG A . n 
A 1 34  ALA 34  35  35  ALA ALA A . n 
A 1 35  LYS 35  36  36  LYS LYS A . n 
A 1 36  PRO 36  37  37  PRO PRO A . n 
A 1 37  ALA 37  38  38  ALA ALA A . n 
A 1 38  VAL 38  39  39  VAL VAL A . n 
A 1 39  TYR 39  40  40  TYR TYR A . n 
A 1 40  PHE 40  41  41  PHE PHE A . n 
A 1 41  GLY 41  42  42  GLY GLY A . n 
A 1 42  GLY 42  43  43  GLY GLY A . n 
A 1 43  LYS 43  44  44  LYS LYS A . n 
A 1 44  ALA 44  45  45  ALA ALA A . n 
A 1 45  ARG 45  46  46  ARG ARG A . n 
A 1 46  ILE 46  47  47  ILE ILE A . n 
A 1 47  ILE 47  48  48  ILE ILE A . n 
A 1 48  ASP 48  49  49  ASP ASP A . n 
A 1 49  PHE 49  50  50  PHE PHE A . n 
A 1 50  ALA 50  51  51  ALA ALA A . n 
A 1 51  LEU 51  52  52  LEU LEU A . n 
A 1 52  SER 52  53  53  SER SER A . n 
A 1 53  ASN 53  54  54  ASN ASN A . n 
A 1 54  ALA 54  55  55  ALA ALA A . n 
A 1 55  LEU 55  56  56  LEU LEU A . n 
A 1 56  ASN 56  57  57  ASN ASN A . n 
A 1 57  SER 57  58  58  SER SER A . n 
A 1 58  GLY 58  59  59  GLY GLY A . n 
A 1 59  ILE 59  60  60  ILE ILE A . n 
A 1 60  ARG 60  61  61  ARG ARG A . n 
A 1 61  ARG 61  62  62  ARG ARG A . n 
A 1 62  ILE 62  63  63  ILE ILE A . n 
A 1 63  GLY 63  64  64  GLY GLY A . n 
A 1 64  VAL 64  65  65  VAL VAL A . n 
A 1 65  ALA 65  66  66  ALA ALA A . n 
A 1 66  THR 66  67  67  THR THR A . n 
A 1 67  GLN 67  68  68  GLN GLN A . n 
A 1 68  TYR 68  69  69  TYR TYR A . n 
A 1 69  LYS 69  70  70  LYS LYS A . n 
A 1 70  ALA 70  71  71  ALA ALA A . n 
A 1 71  HIS 71  72  72  HIS HIS A . n 
A 1 72  SER 72  73  73  SER SER A . n 
A 1 73  LEU 73  74  74  LEU LEU A . n 
A 1 74  ILE 74  75  75  ILE ILE A . n 
A 1 75  ARG 75  76  76  ARG ARG A . n 
A 1 76  HIS 76  77  77  HIS HIS A . n 
A 1 77  LEU 77  78  78  LEU LEU A . n 
A 1 78  GLN 78  79  79  GLN GLN A . n 
A 1 79  ARG 79  80  80  ARG ARG A . n 
A 1 80  GLY 80  81  81  GLY GLY A . n 
A 1 81  TRP 81  82  82  TRP TRP A . n 
A 1 82  ASP 82  83  83  ASP ASP A . n 
A 1 83  PHE 83  84  84  PHE PHE A . n 
A 1 84  PHE 84  85  85  PHE PHE A . n 
A 1 85  ARG 85  86  86  ARG ARG A . n 
A 1 86  PRO 86  87  87  PRO PRO A . n 
A 1 87  GLU 87  88  88  GLU GLU A . n 
A 1 88  ARG 88  89  89  ARG ARG A . n 
A 1 89  ASN 89  90  90  ASN ASN A . n 
A 1 90  GLU 90  91  91  GLU GLU A . n 
A 1 91  SER 91  92  92  SER SER A . n 
A 1 92  PHE 92  93  93  PHE PHE A . n 
A 1 93  ASP 93  94  94  ASP ASP A . n 
A 1 94  ILE 94  95  95  ILE ILE A . n 
A 1 95  LEU 95  96  96  LEU LEU A . n 
A 1 96  PRO 96  97  97  PRO PRO A . n 
A 1 97  ALA 97  98  98  ALA ALA A . n 
A 1 98  SER 98  99  99  SER SER A . n 
A 1 99  GLN 99  100 100 GLN GLN A . n 
A 1 100 ARG 100 101 ?   ?   ?   A . n 
A 1 101 VAL 101 102 ?   ?   ?   A . n 
A 1 102 SER 102 103 ?   ?   ?   A . n 
A 1 103 GLU 103 104 104 GLU GLU A . n 
A 1 104 THR 104 105 105 THR THR A . n 
A 1 105 GLN 105 106 106 GLN GLN A . n 
A 1 106 TRP 106 107 107 TRP TRP A . n 
A 1 107 TYR 107 108 108 TYR TYR A . n 
A 1 108 GLU 108 109 109 GLU GLU A . n 
A 1 109 GLY 109 110 110 GLY GLY A . n 
A 1 110 THR 110 111 111 THR THR A . n 
A 1 111 ALA 111 112 112 ALA ALA A . n 
A 1 112 ASP 112 113 113 ASP ASP A . n 
A 1 113 ALA 113 114 114 ALA ALA A . n 
A 1 114 VAL 114 115 115 VAL VAL A . n 
A 1 115 TYR 115 116 116 TYR TYR A . n 
A 1 116 GLN 116 117 117 GLN GLN A . n 
A 1 117 ASN 117 118 118 ASN ASN A . n 
A 1 118 ILE 118 119 119 ILE ILE A . n 
A 1 119 ASP 119 120 120 ASP ASP A . n 
A 1 120 ILE 120 121 121 ILE ILE A . n 
A 1 121 ILE 121 122 122 ILE ILE A . n 
A 1 122 GLU 122 123 123 GLU GLU A . n 
A 1 123 PRO 123 124 124 PRO PRO A . n 
A 1 124 TYR 124 125 125 TYR TYR A . n 
A 1 125 ALA 125 126 126 ALA ALA A . n 
A 1 126 PRO 126 127 127 PRO PRO A . n 
A 1 127 GLU 127 128 128 GLU GLU A . n 
A 1 128 TYR 128 129 129 TYR TYR A . n 
A 1 129 MET 129 130 130 MET MET A . n 
A 1 130 VAL 130 131 131 VAL VAL A . n 
A 1 131 ILE 131 132 132 ILE ILE A . n 
A 1 132 LEU 132 133 133 LEU LEU A . n 
A 1 133 ALA 133 134 134 ALA ALA A . n 
A 1 134 GLY 134 135 135 GLY GLY A . n 
A 1 135 ASP 135 136 136 ASP ASP A . n 
A 1 136 HIS 136 137 137 HIS HIS A . n 
A 1 137 ILE 137 138 138 ILE ILE A . n 
A 1 138 TYR 138 139 139 TYR TYR A . n 
A 1 139 LYS 139 140 140 LYS LYS A . n 
A 1 140 MET 140 141 141 MET MET A . n 
A 1 141 ASP 141 142 142 ASP ASP A . n 
A 1 142 TYR 142 143 143 TYR TYR A . n 
A 1 143 GLU 143 144 144 GLU GLU A . n 
A 1 144 TYR 144 145 145 TYR TYR A . n 
A 1 145 MET 145 146 146 MET MET A . n 
A 1 146 LEU 146 147 147 LEU LEU A . n 
A 1 147 GLN 147 148 148 GLN GLN A . n 
A 1 148 GLN 148 149 149 GLN GLN A . n 
A 1 149 HIS 149 150 150 HIS HIS A . n 
A 1 150 VAL 150 151 151 VAL VAL A . n 
A 1 151 ASP 151 152 152 ASP ASP A . n 
A 1 152 SER 152 153 153 SER SER A . n 
A 1 153 GLY 153 154 154 GLY GLY A . n 
A 1 154 ALA 154 155 155 ALA ALA A . n 
A 1 155 ASP 155 156 156 ASP ASP A . n 
A 1 156 VAL 156 157 157 VAL VAL A . n 
A 1 157 THR 157 158 158 THR THR A . n 
A 1 158 ILE 158 159 159 ILE ILE A . n 
A 1 159 GLY 159 160 160 GLY GLY A . n 
A 1 160 CYS 160 161 161 CYS CYS A . n 
A 1 161 LEU 161 162 162 LEU LEU A . n 
A 1 162 GLU 162 163 163 GLU GLU A . n 
A 1 163 VAL 163 164 164 VAL VAL A . n 
A 1 164 PRO 164 165 165 PRO PRO A . n 
A 1 165 ARG 165 166 166 ARG ARG A . n 
A 1 166 MET 166 167 167 MET MET A . n 
A 1 167 GLU 167 168 168 GLU GLU A . n 
A 1 168 ALA 168 169 169 ALA ALA A . n 
A 1 169 THR 169 170 170 THR THR A . n 
A 1 170 GLY 170 171 171 GLY GLY A . n 
A 1 171 PHE 171 172 172 PHE PHE A . n 
A 1 172 GLY 172 173 173 GLY GLY A . n 
A 1 173 VAL 173 174 174 VAL VAL A . n 
A 1 174 MET 174 175 175 MET MET A . n 
A 1 175 HIS 175 176 176 HIS HIS A . n 
A 1 176 VAL 176 177 177 VAL VAL A . n 
A 1 177 ASN 177 178 178 ASN ASN A . n 
A 1 178 GLU 178 179 179 GLU GLU A . n 
A 1 179 LYS 179 180 180 LYS LYS A . n 
A 1 180 ASP 180 181 181 ASP ASP A . n 
A 1 181 GLU 181 182 182 GLU GLU A . n 
A 1 182 ILE 182 183 183 ILE ILE A . n 
A 1 183 ILE 183 184 184 ILE ILE A . n 
A 1 184 ASP 184 185 185 ASP ASP A . n 
A 1 185 PHE 185 186 186 PHE PHE A . n 
A 1 186 ILE 186 187 187 ILE ILE A . n 
A 1 187 GLU 187 188 188 GLU GLU A . n 
A 1 188 LYS 188 189 189 LYS LYS A . n 
A 1 189 PRO 189 190 190 PRO PRO A . n 
A 1 190 ALA 190 191 191 ALA ALA A . n 
A 1 191 ASP 191 192 192 ASP ASP A . n 
A 1 192 PRO 192 193 193 PRO PRO A . n 
A 1 193 PRO 193 194 194 PRO PRO A . n 
A 1 194 GLY 194 195 195 GLY GLY A . n 
A 1 195 ILE 195 196 196 ILE ILE A . n 
A 1 196 PRO 196 197 197 PRO PRO A . n 
A 1 197 GLY 197 198 198 GLY GLY A . n 
A 1 198 ASN 198 199 199 ASN ASN A . n 
A 1 199 GLU 199 200 200 GLU GLU A . n 
A 1 200 GLY 200 201 201 GLY GLY A . n 
A 1 201 PHE 201 202 202 PHE PHE A . n 
A 1 202 ALA 202 203 203 ALA ALA A . n 
A 1 203 LEU 203 204 204 LEU LEU A . n 
A 1 204 ALA 204 205 205 ALA ALA A . n 
A 1 205 SER 205 206 206 SER SER A . n 
A 1 206 MET 206 207 207 MET MET A . n 
A 1 207 GLY 207 208 208 GLY GLY A . n 
A 1 208 ILE 208 209 209 ILE ILE A . n 
A 1 209 TYR 209 210 210 TYR TYR A . n 
A 1 210 VAL 210 211 211 VAL VAL A . n 
A 1 211 PHE 211 212 212 PHE PHE A . n 
A 1 212 HIS 212 213 213 HIS HIS A . n 
A 1 213 THR 213 214 214 THR THR A . n 
A 1 214 LYS 214 215 215 LYS LYS A . n 
A 1 215 PHE 215 216 216 PHE PHE A . n 
A 1 216 LEU 216 217 217 LEU LEU A . n 
A 1 217 MET 217 218 218 MET MET A . n 
A 1 218 GLU 218 219 219 GLU GLU A . n 
A 1 219 ALA 219 220 220 ALA ALA A . n 
A 1 220 LEU 220 221 221 LEU LEU A . n 
A 1 221 ARG 221 222 222 ARG ARG A . n 
A 1 222 ARG 222 223 223 ARG ARG A . n 
A 1 223 ASP 223 224 224 ASP ASP A . n 
A 1 224 ALA 224 225 225 ALA ALA A . n 
A 1 225 ALA 225 226 226 ALA ALA A . n 
A 1 226 ASP 226 227 227 ASP ASP A . n 
A 1 227 PRO 227 228 228 PRO PRO A . n 
A 1 228 THR 228 229 229 THR THR A . n 
A 1 229 SER 229 230 230 SER SER A . n 
A 1 230 SER 230 231 231 SER SER A . n 
A 1 231 ARG 231 232 232 ARG ARG A . n 
A 1 232 ASP 232 233 233 ASP ASP A . n 
A 1 233 PHE 233 234 234 PHE PHE A . n 
A 1 234 GLY 234 235 235 GLY GLY A . n 
A 1 235 LYS 235 236 236 LYS LYS A . n 
A 1 236 ASP 236 237 237 ASP ASP A . n 
A 1 237 ILE 237 238 238 ILE ILE A . n 
A 1 238 ILE 238 239 239 ILE ILE A . n 
A 1 239 PRO 239 240 240 PRO PRO A . n 
A 1 240 TYR 240 241 241 TYR TYR A . n 
A 1 241 ILE 241 242 242 ILE ILE A . n 
A 1 242 VAL 242 243 243 VAL VAL A . n 
A 1 243 GLU 243 244 244 GLU GLU A . n 
A 1 244 HIS 244 245 245 HIS HIS A . n 
A 1 245 GLY 245 246 246 GLY GLY A . n 
A 1 246 LYS 246 247 247 LYS LYS A . n 
A 1 247 ALA 247 248 248 ALA ALA A . n 
A 1 248 VAL 248 249 249 VAL VAL A . n 
A 1 249 ALA 249 250 250 ALA ALA A . n 
A 1 250 HIS 250 251 251 HIS HIS A . n 
A 1 251 ARG 251 252 252 ARG ARG A . n 
A 1 252 PHE 252 253 253 PHE PHE A . n 
A 1 253 ALA 253 254 254 ALA ALA A . n 
A 1 254 ASP 254 255 255 ASP ASP A . n 
A 1 255 SER 255 256 256 SER SER A . n 
A 1 256 CYS 256 257 257 CYS CYS A . n 
A 1 257 VAL 257 258 258 VAL VAL A . n 
A 1 258 ARG 258 259 259 ARG ARG A . n 
A 1 259 SER 259 260 260 SER SER A . n 
A 1 260 ASP 260 261 261 ASP ASP A . n 
A 1 261 PHE 261 262 262 PHE PHE A . n 
A 1 262 GLU 262 263 263 GLU GLU A . n 
A 1 263 HIS 263 264 264 HIS HIS A . n 
A 1 264 GLU 264 265 265 GLU GLU A . n 
A 1 265 PRO 265 266 266 PRO PRO A . n 
A 1 266 TYR 266 267 267 TYR TYR A . n 
A 1 267 TRP 267 268 268 TRP TRP A . n 
A 1 268 ARG 268 269 269 ARG ARG A . n 
A 1 269 ASP 269 270 270 ASP ASP A . n 
A 1 270 VAL 270 271 271 VAL VAL A . n 
A 1 271 GLY 271 272 272 GLY GLY A . n 
A 1 272 THR 272 273 273 THR THR A . n 
A 1 273 ILE 273 274 274 ILE ILE A . n 
A 1 274 ASP 274 275 275 ASP ASP A . n 
A 1 275 ALA 275 276 276 ALA ALA A . n 
A 1 276 TYR 276 277 277 TYR TYR A . n 
A 1 277 TRP 277 278 278 TRP TRP A . n 
A 1 278 GLN 278 279 279 GLN GLN A . n 
A 1 279 ALA 279 280 280 ALA ALA A . n 
A 1 280 ASN 280 281 281 ASN ASN A . n 
A 1 281 ILE 281 282 282 ILE ILE A . n 
A 1 282 ASP 282 283 283 ASP ASP A . n 
A 1 283 LEU 283 284 284 LEU LEU A . n 
A 1 284 THR 284 285 285 THR THR A . n 
A 1 285 ASP 285 286 286 ASP ASP A . n 
A 1 286 VAL 286 287 287 VAL VAL A . n 
A 1 287 VAL 287 288 288 VAL VAL A . n 
A 1 288 PRO 288 289 289 PRO PRO A . n 
A 1 289 ASP 289 290 290 ASP ASP A . n 
A 1 290 LEU 290 291 291 LEU LEU A . n 
A 1 291 ASP 291 292 292 ASP ASP A . n 
A 1 292 ILE 292 293 293 ILE ILE A . n 
A 1 293 TYR 293 294 294 TYR TYR A . n 
A 1 294 ASP 294 295 295 ASP ASP A . n 
A 1 295 LYS 295 296 296 LYS LYS A . n 
A 1 296 SER 296 297 297 SER SER A . n 
A 1 297 TRP 297 298 298 TRP TRP A . n 
A 1 298 PRO 298 299 299 PRO PRO A . n 
A 1 299 ILE 299 300 300 ILE ILE A . n 
A 1 300 TRP 300 301 301 TRP TRP A . n 
A 1 301 THR 301 302 302 THR THR A . n 
A 1 302 TYR 302 303 303 TYR TYR A . n 
A 1 303 ALA 303 304 304 ALA ALA A . n 
A 1 304 GLU 304 305 305 GLU GLU A . n 
A 1 305 ILE 305 306 306 ILE ILE A . n 
A 1 306 THR 306 307 307 THR THR A . n 
A 1 307 PRO 307 308 308 PRO PRO A . n 
A 1 308 PRO 308 309 309 PRO PRO A . n 
A 1 309 ALA 309 310 310 ALA ALA A . n 
A 1 310 LYS 310 311 311 LYS LYS A . n 
A 1 311 PHE 311 312 312 PHE PHE A . n 
A 1 312 VAL 312 313 313 VAL VAL A . n 
A 1 313 HIS 313 314 314 HIS HIS A . n 
A 1 314 ASP 314 315 315 ASP ASP A . n 
A 1 315 ASP 315 316 316 ASP ASP A . n 
A 1 316 GLU 316 317 317 GLU GLU A . n 
A 1 317 ASP 317 318 318 ASP ASP A . n 
A 1 318 ARG 318 319 319 ARG ARG A . n 
A 1 319 ARG 319 320 320 ARG ARG A . n 
A 1 320 GLY 320 321 321 GLY GLY A . n 
A 1 321 SER 321 322 322 SER SER A . n 
A 1 322 ALA 322 323 323 ALA ALA A . n 
A 1 323 VAL 323 324 324 VAL VAL A . n 
A 1 324 SER 324 325 325 SER SER A . n 
A 1 325 SER 325 326 326 SER SER A . n 
A 1 326 VAL 326 327 327 VAL VAL A . n 
A 1 327 VAL 327 328 328 VAL VAL A . n 
A 1 328 SER 328 329 329 SER SER A . n 
A 1 329 GLY 329 330 330 GLY GLY A . n 
A 1 330 ASP 330 331 331 ASP ASP A . n 
A 1 331 CYS 331 332 332 CYS CYS A . n 
A 1 332 ILE 332 333 333 ILE ILE A . n 
A 1 333 ILE 333 334 334 ILE ILE A . n 
A 1 334 SER 334 335 335 SER SER A . n 
A 1 335 GLY 335 336 336 GLY GLY A . n 
A 1 336 ALA 336 337 337 ALA ALA A . n 
A 1 337 ALA 337 338 338 ALA ALA A . n 
A 1 338 LEU 338 339 339 LEU LEU A . n 
A 1 339 ASN 339 340 340 ASN ASN A . n 
A 1 340 ARG 340 341 341 ARG ARG A . n 
A 1 341 SER 341 342 342 SER SER A . n 
A 1 342 LEU 342 343 343 LEU LEU A . n 
A 1 343 LEU 343 344 344 LEU LEU A . n 
A 1 344 PHE 344 345 345 PHE PHE A . n 
A 1 345 THR 345 346 346 THR THR A . n 
A 1 346 GLY 346 347 347 GLY GLY A . n 
A 1 347 VAL 347 348 348 VAL VAL A . n 
A 1 348 ARG 348 349 349 ARG ARG A . n 
A 1 349 ALA 349 350 350 ALA ALA A . n 
A 1 350 ASN 350 351 351 ASN ASN A . n 
A 1 351 SER 351 352 352 SER SER A . n 
A 1 352 TYR 352 353 353 TYR TYR A . n 
A 1 353 SER 353 354 354 SER SER A . n 
A 1 354 ARG 354 355 355 ARG ARG A . n 
A 1 355 LEU 355 356 356 LEU LEU A . n 
A 1 356 GLU 356 357 357 GLU GLU A . n 
A 1 357 ASN 357 358 358 ASN ASN A . n 
A 1 358 ALA 358 359 359 ALA ALA A . n 
A 1 359 VAL 359 360 360 VAL VAL A . n 
A 1 360 VAL 360 361 361 VAL VAL A . n 
A 1 361 LEU 361 362 362 LEU LEU A . n 
A 1 362 PRO 362 363 363 PRO PRO A . n 
A 1 363 SER 363 364 364 SER SER A . n 
A 1 364 VAL 364 365 365 VAL VAL A . n 
A 1 365 LYS 365 366 366 LYS LYS A . n 
A 1 366 ILE 366 367 367 ILE ILE A . n 
A 1 367 GLY 367 368 368 GLY GLY A . n 
A 1 368 ARG 368 369 369 ARG ARG A . n 
A 1 369 HIS 369 370 370 HIS HIS A . n 
A 1 370 ALA 370 371 371 ALA ALA A . n 
A 1 371 GLN 371 372 372 GLN GLN A . n 
A 1 372 LEU 372 373 373 LEU LEU A . n 
A 1 373 SER 373 374 374 SER SER A . n 
A 1 374 ASN 374 375 375 ASN ASN A . n 
A 1 375 VAL 375 376 376 VAL VAL A . n 
A 1 376 VAL 376 377 377 VAL VAL A . n 
A 1 377 ILE 377 378 378 ILE ILE A . n 
A 1 378 ASP 378 379 379 ASP ASP A . n 
A 1 379 HIS 379 380 380 HIS HIS A . n 
A 1 380 GLY 380 381 381 GLY GLY A . n 
A 1 381 VAL 381 382 382 VAL VAL A . n 
A 1 382 VAL 382 383 383 VAL VAL A . n 
A 1 383 ILE 383 384 384 ILE ILE A . n 
A 1 384 PRO 384 385 385 PRO PRO A . n 
A 1 385 GLU 385 386 386 GLU GLU A . n 
A 1 386 GLY 386 387 387 GLY GLY A . n 
A 1 387 LEU 387 388 388 LEU LEU A . n 
A 1 388 ILE 388 389 389 ILE ILE A . n 
A 1 389 VAL 389 390 390 VAL VAL A . n 
A 1 390 GLY 390 391 391 GLY GLY A . n 
A 1 391 GLU 391 392 392 GLU GLU A . n 
A 1 392 ASP 392 393 393 ASP ASP A . n 
A 1 393 PRO 393 394 394 PRO PRO A . n 
A 1 394 GLU 394 395 395 GLU GLU A . n 
A 1 395 LEU 395 396 396 LEU LEU A . n 
A 1 396 ASP 396 397 397 ASP ASP A . n 
A 1 397 ALA 397 398 398 ALA ALA A . n 
A 1 398 LYS 398 399 399 LYS LYS A . n 
A 1 399 ARG 399 400 400 ARG ARG A . n 
A 1 400 PHE 400 401 401 PHE PHE A . n 
A 1 401 ARG 401 402 402 ARG ARG A . n 
A 1 402 ARG 402 403 403 ARG ARG A . n 
A 1 403 THR 403 404 404 THR THR A . n 
A 1 404 GLU 404 405 405 GLU GLU A . n 
A 1 405 SER 405 406 406 SER SER A . n 
A 1 406 GLY 406 407 407 GLY GLY A . n 
A 1 407 ILE 407 408 408 ILE ILE A . n 
A 1 408 CYS 408 409 409 CYS CYS A . n 
A 1 409 LEU 409 410 410 LEU LEU A . n 
A 1 410 ILE 410 411 411 ILE ILE A . n 
A 1 411 THR 411 412 412 THR THR A . n 
A 1 412 GLN 412 413 413 GLN GLN A . n 
A 1 413 SER 413 414 414 SER SER A . n 
A 1 414 MET 414 415 415 MET MET A . n 
A 1 415 ILE 415 416 416 ILE ILE A . n 
A 1 416 ASP 416 417 417 ASP ASP A . n 
A 1 417 LYS 417 418 418 LYS LYS A . n 
A 1 418 LEU 418 419 419 LEU LEU A . n 
A 1 419 ASP 419 420 420 ASP ASP A . n 
A 1 420 LEU 420 421 421 LEU LEU A . n 
B 1 1   MET 1   2   ?   ?   ?   B . n 
B 1 2   SER 2   3   ?   ?   ?   B . n 
B 1 3   GLU 3   4   ?   ?   ?   B . n 
B 1 4   LYS 4   5   ?   ?   ?   B . n 
B 1 5   ARG 5   6   ?   ?   ?   B . n 
B 1 6   VAL 6   7   7   VAL VAL B . n 
B 1 7   GLN 7   8   8   GLN GLN B . n 
B 1 8   PRO 8   9   9   PRO PRO B . n 
B 1 9   LEU 9   10  10  LEU LEU B . n 
B 1 10  ALA 10  11  11  ALA ALA B . n 
B 1 11  ARG 11  12  12  ARG ARG B . n 
B 1 12  ASP 12  13  13  ASP ASP B . n 
B 1 13  ALA 13  14  14  ALA ALA B . n 
B 1 14  MET 14  15  15  MET MET B . n 
B 1 15  ALA 15  16  16  ALA ALA B . n 
B 1 16  TYR 16  17  17  TYR TYR B . n 
B 1 17  VAL 17  18  18  VAL VAL B . n 
B 1 18  LEU 18  19  19  LEU LEU B . n 
B 1 19  ALA 19  20  20  ALA ALA B . n 
B 1 20  GLY 20  21  21  GLY GLY B . n 
B 1 21  GLY 21  22  22  GLY GLY B . n 
B 1 22  ARG 22  23  23  ARG ARG B . n 
B 1 23  GLY 23  24  24  GLY GLY B . n 
B 1 24  SER 24  25  25  SER SER B . n 
B 1 25  ARG 25  26  26  ARG ARG B . n 
B 1 26  LEU 26  27  27  LEU LEU B . n 
B 1 27  LYS 27  28  28  LYS LYS B . n 
B 1 28  GLU 28  29  29  GLU GLU B . n 
B 1 29  LEU 29  30  30  LEU LEU B . n 
B 1 30  THR 30  31  31  THR THR B . n 
B 1 31  ASP 31  32  32  ASP ASP B . n 
B 1 32  ARG 32  33  33  ARG ARG B . n 
B 1 33  ARG 33  34  34  ARG ARG B . n 
B 1 34  ALA 34  35  35  ALA ALA B . n 
B 1 35  LYS 35  36  36  LYS LYS B . n 
B 1 36  PRO 36  37  37  PRO PRO B . n 
B 1 37  ALA 37  38  38  ALA ALA B . n 
B 1 38  VAL 38  39  39  VAL VAL B . n 
B 1 39  TYR 39  40  40  TYR TYR B . n 
B 1 40  PHE 40  41  41  PHE PHE B . n 
B 1 41  GLY 41  42  42  GLY GLY B . n 
B 1 42  GLY 42  43  43  GLY GLY B . n 
B 1 43  LYS 43  44  44  LYS LYS B . n 
B 1 44  ALA 44  45  45  ALA ALA B . n 
B 1 45  ARG 45  46  46  ARG ARG B . n 
B 1 46  ILE 46  47  47  ILE ILE B . n 
B 1 47  ILE 47  48  48  ILE ILE B . n 
B 1 48  ASP 48  49  49  ASP ASP B . n 
B 1 49  PHE 49  50  50  PHE PHE B . n 
B 1 50  ALA 50  51  51  ALA ALA B . n 
B 1 51  LEU 51  52  52  LEU LEU B . n 
B 1 52  SER 52  53  53  SER SER B . n 
B 1 53  ASN 53  54  54  ASN ASN B . n 
B 1 54  ALA 54  55  55  ALA ALA B . n 
B 1 55  LEU 55  56  56  LEU LEU B . n 
B 1 56  ASN 56  57  57  ASN ASN B . n 
B 1 57  SER 57  58  58  SER SER B . n 
B 1 58  GLY 58  59  59  GLY GLY B . n 
B 1 59  ILE 59  60  60  ILE ILE B . n 
B 1 60  ARG 60  61  61  ARG ARG B . n 
B 1 61  ARG 61  62  62  ARG ARG B . n 
B 1 62  ILE 62  63  63  ILE ILE B . n 
B 1 63  GLY 63  64  64  GLY GLY B . n 
B 1 64  VAL 64  65  65  VAL VAL B . n 
B 1 65  ALA 65  66  66  ALA ALA B . n 
B 1 66  THR 66  67  67  THR THR B . n 
B 1 67  GLN 67  68  68  GLN GLN B . n 
B 1 68  TYR 68  69  69  TYR TYR B . n 
B 1 69  LYS 69  70  70  LYS LYS B . n 
B 1 70  ALA 70  71  71  ALA ALA B . n 
B 1 71  HIS 71  72  72  HIS HIS B . n 
B 1 72  SER 72  73  73  SER SER B . n 
B 1 73  LEU 73  74  74  LEU LEU B . n 
B 1 74  ILE 74  75  75  ILE ILE B . n 
B 1 75  ARG 75  76  76  ARG ARG B . n 
B 1 76  HIS 76  77  77  HIS HIS B . n 
B 1 77  LEU 77  78  78  LEU LEU B . n 
B 1 78  GLN 78  79  79  GLN GLN B . n 
B 1 79  ARG 79  80  80  ARG ARG B . n 
B 1 80  GLY 80  81  81  GLY GLY B . n 
B 1 81  TRP 81  82  82  TRP TRP B . n 
B 1 82  ASP 82  83  83  ASP ASP B . n 
B 1 83  PHE 83  84  84  PHE PHE B . n 
B 1 84  PHE 84  85  85  PHE PHE B . n 
B 1 85  ARG 85  86  86  ARG ARG B . n 
B 1 86  PRO 86  87  87  PRO PRO B . n 
B 1 87  GLU 87  88  88  GLU GLU B . n 
B 1 88  ARG 88  89  89  ARG ARG B . n 
B 1 89  ASN 89  90  90  ASN ASN B . n 
B 1 90  GLU 90  91  91  GLU GLU B . n 
B 1 91  SER 91  92  92  SER SER B . n 
B 1 92  PHE 92  93  93  PHE PHE B . n 
B 1 93  ASP 93  94  94  ASP ASP B . n 
B 1 94  ILE 94  95  95  ILE ILE B . n 
B 1 95  LEU 95  96  96  LEU LEU B . n 
B 1 96  PRO 96  97  97  PRO PRO B . n 
B 1 97  ALA 97  98  98  ALA ALA B . n 
B 1 98  SER 98  99  99  SER SER B . n 
B 1 99  GLN 99  100 100 GLN GLN B . n 
B 1 100 ARG 100 101 101 ARG ARG B . n 
B 1 101 VAL 101 102 102 VAL VAL B . n 
B 1 102 SER 102 103 103 SER SER B . n 
B 1 103 GLU 103 104 104 GLU GLU B . n 
B 1 104 THR 104 105 105 THR THR B . n 
B 1 105 GLN 105 106 106 GLN GLN B . n 
B 1 106 TRP 106 107 107 TRP TRP B . n 
B 1 107 TYR 107 108 108 TYR TYR B . n 
B 1 108 GLU 108 109 109 GLU GLU B . n 
B 1 109 GLY 109 110 110 GLY GLY B . n 
B 1 110 THR 110 111 111 THR THR B . n 
B 1 111 ALA 111 112 112 ALA ALA B . n 
B 1 112 ASP 112 113 113 ASP ASP B . n 
B 1 113 ALA 113 114 114 ALA ALA B . n 
B 1 114 VAL 114 115 115 VAL VAL B . n 
B 1 115 TYR 115 116 116 TYR TYR B . n 
B 1 116 GLN 116 117 117 GLN GLN B . n 
B 1 117 ASN 117 118 118 ASN ASN B . n 
B 1 118 ILE 118 119 119 ILE ILE B . n 
B 1 119 ASP 119 120 120 ASP ASP B . n 
B 1 120 ILE 120 121 121 ILE ILE B . n 
B 1 121 ILE 121 122 122 ILE ILE B . n 
B 1 122 GLU 122 123 123 GLU GLU B . n 
B 1 123 PRO 123 124 124 PRO PRO B . n 
B 1 124 TYR 124 125 125 TYR TYR B . n 
B 1 125 ALA 125 126 126 ALA ALA B . n 
B 1 126 PRO 126 127 127 PRO PRO B . n 
B 1 127 GLU 127 128 128 GLU GLU B . n 
B 1 128 TYR 128 129 129 TYR TYR B . n 
B 1 129 MET 129 130 130 MET MET B . n 
B 1 130 VAL 130 131 131 VAL VAL B . n 
B 1 131 ILE 131 132 132 ILE ILE B . n 
B 1 132 LEU 132 133 133 LEU LEU B . n 
B 1 133 ALA 133 134 134 ALA ALA B . n 
B 1 134 GLY 134 135 135 GLY GLY B . n 
B 1 135 ASP 135 136 136 ASP ASP B . n 
B 1 136 HIS 136 137 137 HIS HIS B . n 
B 1 137 ILE 137 138 138 ILE ILE B . n 
B 1 138 TYR 138 139 139 TYR TYR B . n 
B 1 139 LYS 139 140 140 LYS LYS B . n 
B 1 140 MET 140 141 141 MET MET B . n 
B 1 141 ASP 141 142 142 ASP ASP B . n 
B 1 142 TYR 142 143 143 TYR TYR B . n 
B 1 143 GLU 143 144 144 GLU GLU B . n 
B 1 144 TYR 144 145 145 TYR TYR B . n 
B 1 145 MET 145 146 146 MET MET B . n 
B 1 146 LEU 146 147 147 LEU LEU B . n 
B 1 147 GLN 147 148 148 GLN GLN B . n 
B 1 148 GLN 148 149 149 GLN GLN B . n 
B 1 149 HIS 149 150 150 HIS HIS B . n 
B 1 150 VAL 150 151 151 VAL VAL B . n 
B 1 151 ASP 151 152 152 ASP ASP B . n 
B 1 152 SER 152 153 153 SER SER B . n 
B 1 153 GLY 153 154 154 GLY GLY B . n 
B 1 154 ALA 154 155 155 ALA ALA B . n 
B 1 155 ASP 155 156 156 ASP ASP B . n 
B 1 156 VAL 156 157 157 VAL VAL B . n 
B 1 157 THR 157 158 158 THR THR B . n 
B 1 158 ILE 158 159 159 ILE ILE B . n 
B 1 159 GLY 159 160 160 GLY GLY B . n 
B 1 160 CYS 160 161 161 CYS CYS B . n 
B 1 161 LEU 161 162 162 LEU LEU B . n 
B 1 162 GLU 162 163 163 GLU GLU B . n 
B 1 163 VAL 163 164 164 VAL VAL B . n 
B 1 164 PRO 164 165 165 PRO PRO B . n 
B 1 165 ARG 165 166 166 ARG ARG B . n 
B 1 166 MET 166 167 167 MET MET B . n 
B 1 167 GLU 167 168 168 GLU GLU B . n 
B 1 168 ALA 168 169 169 ALA ALA B . n 
B 1 169 THR 169 170 170 THR THR B . n 
B 1 170 GLY 170 171 171 GLY GLY B . n 
B 1 171 PHE 171 172 172 PHE PHE B . n 
B 1 172 GLY 172 173 173 GLY GLY B . n 
B 1 173 VAL 173 174 174 VAL VAL B . n 
B 1 174 MET 174 175 175 MET MET B . n 
B 1 175 HIS 175 176 176 HIS HIS B . n 
B 1 176 VAL 176 177 177 VAL VAL B . n 
B 1 177 ASN 177 178 178 ASN ASN B . n 
B 1 178 GLU 178 179 179 GLU GLU B . n 
B 1 179 LYS 179 180 180 LYS LYS B . n 
B 1 180 ASP 180 181 181 ASP ASP B . n 
B 1 181 GLU 181 182 182 GLU GLU B . n 
B 1 182 ILE 182 183 183 ILE ILE B . n 
B 1 183 ILE 183 184 184 ILE ILE B . n 
B 1 184 ASP 184 185 185 ASP ASP B . n 
B 1 185 PHE 185 186 186 PHE PHE B . n 
B 1 186 ILE 186 187 187 ILE ILE B . n 
B 1 187 GLU 187 188 188 GLU GLU B . n 
B 1 188 LYS 188 189 189 LYS LYS B . n 
B 1 189 PRO 189 190 190 PRO PRO B . n 
B 1 190 ALA 190 191 191 ALA ALA B . n 
B 1 191 ASP 191 192 192 ASP ASP B . n 
B 1 192 PRO 192 193 193 PRO PRO B . n 
B 1 193 PRO 193 194 194 PRO PRO B . n 
B 1 194 GLY 194 195 195 GLY GLY B . n 
B 1 195 ILE 195 196 196 ILE ILE B . n 
B 1 196 PRO 196 197 197 PRO PRO B . n 
B 1 197 GLY 197 198 198 GLY GLY B . n 
B 1 198 ASN 198 199 199 ASN ASN B . n 
B 1 199 GLU 199 200 200 GLU GLU B . n 
B 1 200 GLY 200 201 201 GLY GLY B . n 
B 1 201 PHE 201 202 202 PHE PHE B . n 
B 1 202 ALA 202 203 203 ALA ALA B . n 
B 1 203 LEU 203 204 204 LEU LEU B . n 
B 1 204 ALA 204 205 205 ALA ALA B . n 
B 1 205 SER 205 206 206 SER SER B . n 
B 1 206 MET 206 207 207 MET MET B . n 
B 1 207 GLY 207 208 208 GLY GLY B . n 
B 1 208 ILE 208 209 209 ILE ILE B . n 
B 1 209 TYR 209 210 210 TYR TYR B . n 
B 1 210 VAL 210 211 211 VAL VAL B . n 
B 1 211 PHE 211 212 212 PHE PHE B . n 
B 1 212 HIS 212 213 213 HIS HIS B . n 
B 1 213 THR 213 214 214 THR THR B . n 
B 1 214 LYS 214 215 215 LYS LYS B . n 
B 1 215 PHE 215 216 216 PHE PHE B . n 
B 1 216 LEU 216 217 217 LEU LEU B . n 
B 1 217 MET 217 218 218 MET MET B . n 
B 1 218 GLU 218 219 219 GLU GLU B . n 
B 1 219 ALA 219 220 220 ALA ALA B . n 
B 1 220 LEU 220 221 221 LEU LEU B . n 
B 1 221 ARG 221 222 222 ARG ARG B . n 
B 1 222 ARG 222 223 223 ARG ARG B . n 
B 1 223 ASP 223 224 224 ASP ASP B . n 
B 1 224 ALA 224 225 225 ALA ALA B . n 
B 1 225 ALA 225 226 226 ALA ALA B . n 
B 1 226 ASP 226 227 227 ASP ASP B . n 
B 1 227 PRO 227 228 228 PRO PRO B . n 
B 1 228 THR 228 229 229 THR THR B . n 
B 1 229 SER 229 230 230 SER SER B . n 
B 1 230 SER 230 231 231 SER SER B . n 
B 1 231 ARG 231 232 232 ARG ARG B . n 
B 1 232 ASP 232 233 233 ASP ASP B . n 
B 1 233 PHE 233 234 234 PHE PHE B . n 
B 1 234 GLY 234 235 235 GLY GLY B . n 
B 1 235 LYS 235 236 236 LYS LYS B . n 
B 1 236 ASP 236 237 237 ASP ASP B . n 
B 1 237 ILE 237 238 238 ILE ILE B . n 
B 1 238 ILE 238 239 239 ILE ILE B . n 
B 1 239 PRO 239 240 240 PRO PRO B . n 
B 1 240 TYR 240 241 241 TYR TYR B . n 
B 1 241 ILE 241 242 242 ILE ILE B . n 
B 1 242 VAL 242 243 243 VAL VAL B . n 
B 1 243 GLU 243 244 244 GLU GLU B . n 
B 1 244 HIS 244 245 245 HIS HIS B . n 
B 1 245 GLY 245 246 246 GLY GLY B . n 
B 1 246 LYS 246 247 247 LYS LYS B . n 
B 1 247 ALA 247 248 248 ALA ALA B . n 
B 1 248 VAL 248 249 249 VAL VAL B . n 
B 1 249 ALA 249 250 250 ALA ALA B . n 
B 1 250 HIS 250 251 251 HIS HIS B . n 
B 1 251 ARG 251 252 252 ARG ARG B . n 
B 1 252 PHE 252 253 253 PHE PHE B . n 
B 1 253 ALA 253 254 254 ALA ALA B . n 
B 1 254 ASP 254 255 255 ASP ASP B . n 
B 1 255 SER 255 256 256 SER SER B . n 
B 1 256 CYS 256 257 257 CYS CYS B . n 
B 1 257 VAL 257 258 258 VAL VAL B . n 
B 1 258 ARG 258 259 259 ARG ARG B . n 
B 1 259 SER 259 260 260 SER SER B . n 
B 1 260 ASP 260 261 261 ASP ASP B . n 
B 1 261 PHE 261 262 262 PHE PHE B . n 
B 1 262 GLU 262 263 263 GLU GLU B . n 
B 1 263 HIS 263 264 264 HIS HIS B . n 
B 1 264 GLU 264 265 265 GLU GLU B . n 
B 1 265 PRO 265 266 266 PRO PRO B . n 
B 1 266 TYR 266 267 267 TYR TYR B . n 
B 1 267 TRP 267 268 268 TRP TRP B . n 
B 1 268 ARG 268 269 269 ARG ARG B . n 
B 1 269 ASP 269 270 270 ASP ASP B . n 
B 1 270 VAL 270 271 271 VAL VAL B . n 
B 1 271 GLY 271 272 272 GLY GLY B . n 
B 1 272 THR 272 273 273 THR THR B . n 
B 1 273 ILE 273 274 274 ILE ILE B . n 
B 1 274 ASP 274 275 275 ASP ASP B . n 
B 1 275 ALA 275 276 276 ALA ALA B . n 
B 1 276 TYR 276 277 277 TYR TYR B . n 
B 1 277 TRP 277 278 278 TRP TRP B . n 
B 1 278 GLN 278 279 279 GLN GLN B . n 
B 1 279 ALA 279 280 280 ALA ALA B . n 
B 1 280 ASN 280 281 281 ASN ASN B . n 
B 1 281 ILE 281 282 282 ILE ILE B . n 
B 1 282 ASP 282 283 283 ASP ASP B . n 
B 1 283 LEU 283 284 284 LEU LEU B . n 
B 1 284 THR 284 285 285 THR THR B . n 
B 1 285 ASP 285 286 286 ASP ASP B . n 
B 1 286 VAL 286 287 287 VAL VAL B . n 
B 1 287 VAL 287 288 288 VAL VAL B . n 
B 1 288 PRO 288 289 289 PRO PRO B . n 
B 1 289 ASP 289 290 290 ASP ASP B . n 
B 1 290 LEU 290 291 291 LEU LEU B . n 
B 1 291 ASP 291 292 292 ASP ASP B . n 
B 1 292 ILE 292 293 293 ILE ILE B . n 
B 1 293 TYR 293 294 294 TYR TYR B . n 
B 1 294 ASP 294 295 295 ASP ASP B . n 
B 1 295 LYS 295 296 296 LYS LYS B . n 
B 1 296 SER 296 297 297 SER SER B . n 
B 1 297 TRP 297 298 298 TRP TRP B . n 
B 1 298 PRO 298 299 299 PRO PRO B . n 
B 1 299 ILE 299 300 300 ILE ILE B . n 
B 1 300 TRP 300 301 301 TRP TRP B . n 
B 1 301 THR 301 302 302 THR THR B . n 
B 1 302 TYR 302 303 303 TYR TYR B . n 
B 1 303 ALA 303 304 304 ALA ALA B . n 
B 1 304 GLU 304 305 305 GLU GLU B . n 
B 1 305 ILE 305 306 306 ILE ILE B . n 
B 1 306 THR 306 307 307 THR THR B . n 
B 1 307 PRO 307 308 308 PRO PRO B . n 
B 1 308 PRO 308 309 309 PRO PRO B . n 
B 1 309 ALA 309 310 310 ALA ALA B . n 
B 1 310 LYS 310 311 311 LYS LYS B . n 
B 1 311 PHE 311 312 312 PHE PHE B . n 
B 1 312 VAL 312 313 313 VAL VAL B . n 
B 1 313 HIS 313 314 314 HIS HIS B . n 
B 1 314 ASP 314 315 315 ASP ASP B . n 
B 1 315 ASP 315 316 316 ASP ASP B . n 
B 1 316 GLU 316 317 317 GLU GLU B . n 
B 1 317 ASP 317 318 318 ASP ASP B . n 
B 1 318 ARG 318 319 319 ARG ARG B . n 
B 1 319 ARG 319 320 320 ARG ARG B . n 
B 1 320 GLY 320 321 321 GLY GLY B . n 
B 1 321 SER 321 322 322 SER SER B . n 
B 1 322 ALA 322 323 323 ALA ALA B . n 
B 1 323 VAL 323 324 324 VAL VAL B . n 
B 1 324 SER 324 325 325 SER SER B . n 
B 1 325 SER 325 326 326 SER SER B . n 
B 1 326 VAL 326 327 327 VAL VAL B . n 
B 1 327 VAL 327 328 328 VAL VAL B . n 
B 1 328 SER 328 329 329 SER SER B . n 
B 1 329 GLY 329 330 330 GLY GLY B . n 
B 1 330 ASP 330 331 331 ASP ASP B . n 
B 1 331 CYS 331 332 332 CYS CYS B . n 
B 1 332 ILE 332 333 333 ILE ILE B . n 
B 1 333 ILE 333 334 334 ILE ILE B . n 
B 1 334 SER 334 335 335 SER SER B . n 
B 1 335 GLY 335 336 336 GLY GLY B . n 
B 1 336 ALA 336 337 337 ALA ALA B . n 
B 1 337 ALA 337 338 338 ALA ALA B . n 
B 1 338 LEU 338 339 339 LEU LEU B . n 
B 1 339 ASN 339 340 340 ASN ASN B . n 
B 1 340 ARG 340 341 341 ARG ARG B . n 
B 1 341 SER 341 342 342 SER SER B . n 
B 1 342 LEU 342 343 343 LEU LEU B . n 
B 1 343 LEU 343 344 344 LEU LEU B . n 
B 1 344 PHE 344 345 345 PHE PHE B . n 
B 1 345 THR 345 346 346 THR THR B . n 
B 1 346 GLY 346 347 347 GLY GLY B . n 
B 1 347 VAL 347 348 348 VAL VAL B . n 
B 1 348 ARG 348 349 349 ARG ARG B . n 
B 1 349 ALA 349 350 350 ALA ALA B . n 
B 1 350 ASN 350 351 351 ASN ASN B . n 
B 1 351 SER 351 352 352 SER SER B . n 
B 1 352 TYR 352 353 353 TYR TYR B . n 
B 1 353 SER 353 354 354 SER SER B . n 
B 1 354 ARG 354 355 355 ARG ARG B . n 
B 1 355 LEU 355 356 356 LEU LEU B . n 
B 1 356 GLU 356 357 357 GLU GLU B . n 
B 1 357 ASN 357 358 358 ASN ASN B . n 
B 1 358 ALA 358 359 359 ALA ALA B . n 
B 1 359 VAL 359 360 360 VAL VAL B . n 
B 1 360 VAL 360 361 361 VAL VAL B . n 
B 1 361 LEU 361 362 362 LEU LEU B . n 
B 1 362 PRO 362 363 363 PRO PRO B . n 
B 1 363 SER 363 364 364 SER SER B . n 
B 1 364 VAL 364 365 365 VAL VAL B . n 
B 1 365 LYS 365 366 366 LYS LYS B . n 
B 1 366 ILE 366 367 367 ILE ILE B . n 
B 1 367 GLY 367 368 368 GLY GLY B . n 
B 1 368 ARG 368 369 369 ARG ARG B . n 
B 1 369 HIS 369 370 370 HIS HIS B . n 
B 1 370 ALA 370 371 371 ALA ALA B . n 
B 1 371 GLN 371 372 372 GLN GLN B . n 
B 1 372 LEU 372 373 373 LEU LEU B . n 
B 1 373 SER 373 374 374 SER SER B . n 
B 1 374 ASN 374 375 375 ASN ASN B . n 
B 1 375 VAL 375 376 376 VAL VAL B . n 
B 1 376 VAL 376 377 377 VAL VAL B . n 
B 1 377 ILE 377 378 378 ILE ILE B . n 
B 1 378 ASP 378 379 379 ASP ASP B . n 
B 1 379 HIS 379 380 380 HIS HIS B . n 
B 1 380 GLY 380 381 381 GLY GLY B . n 
B 1 381 VAL 381 382 382 VAL VAL B . n 
B 1 382 VAL 382 383 383 VAL VAL B . n 
B 1 383 ILE 383 384 384 ILE ILE B . n 
B 1 384 PRO 384 385 385 PRO PRO B . n 
B 1 385 GLU 385 386 386 GLU GLU B . n 
B 1 386 GLY 386 387 387 GLY GLY B . n 
B 1 387 LEU 387 388 388 LEU LEU B . n 
B 1 388 ILE 388 389 389 ILE ILE B . n 
B 1 389 VAL 389 390 390 VAL VAL B . n 
B 1 390 GLY 390 391 391 GLY GLY B . n 
B 1 391 GLU 391 392 392 GLU GLU B . n 
B 1 392 ASP 392 393 393 ASP ASP B . n 
B 1 393 PRO 393 394 394 PRO PRO B . n 
B 1 394 GLU 394 395 395 GLU GLU B . n 
B 1 395 LEU 395 396 396 LEU LEU B . n 
B 1 396 ASP 396 397 397 ASP ASP B . n 
B 1 397 ALA 397 398 398 ALA ALA B . n 
B 1 398 LYS 398 399 399 LYS LYS B . n 
B 1 399 ARG 399 400 400 ARG ARG B . n 
B 1 400 PHE 400 401 401 PHE PHE B . n 
B 1 401 ARG 401 402 402 ARG ARG B . n 
B 1 402 ARG 402 403 403 ARG ARG B . n 
B 1 403 THR 403 404 404 THR THR B . n 
B 1 404 GLU 404 405 405 GLU GLU B . n 
B 1 405 SER 405 406 406 SER SER B . n 
B 1 406 GLY 406 407 407 GLY GLY B . n 
B 1 407 ILE 407 408 408 ILE ILE B . n 
B 1 408 CYS 408 409 409 CYS CYS B . n 
B 1 409 LEU 409 410 410 LEU LEU B . n 
B 1 410 ILE 410 411 411 ILE ILE B . n 
B 1 411 THR 411 412 412 THR THR B . n 
B 1 412 GLN 412 413 413 GLN GLN B . n 
B 1 413 SER 413 414 414 SER SER B . n 
B 1 414 MET 414 415 415 MET MET B . n 
B 1 415 ILE 415 416 416 ILE ILE B . n 
B 1 416 ASP 416 417 417 ASP ASP B . n 
B 1 417 LYS 417 418 418 LYS LYS B . n 
B 1 418 LEU 418 419 419 LEU LEU B . n 
B 1 419 ASP 419 420 420 ASP ASP B . n 
B 1 420 LEU 420 421 421 LEU LEU B . n 
C 1 1   MET 1   2   ?   ?   ?   C . n 
C 1 2   SER 2   3   ?   ?   ?   C . n 
C 1 3   GLU 3   4   ?   ?   ?   C . n 
C 1 4   LYS 4   5   ?   ?   ?   C . n 
C 1 5   ARG 5   6   ?   ?   ?   C . n 
C 1 6   VAL 6   7   7   VAL VAL C . n 
C 1 7   GLN 7   8   8   GLN GLN C . n 
C 1 8   PRO 8   9   9   PRO PRO C . n 
C 1 9   LEU 9   10  10  LEU LEU C . n 
C 1 10  ALA 10  11  11  ALA ALA C . n 
C 1 11  ARG 11  12  12  ARG ARG C . n 
C 1 12  ASP 12  13  13  ASP ASP C . n 
C 1 13  ALA 13  14  14  ALA ALA C . n 
C 1 14  MET 14  15  15  MET MET C . n 
C 1 15  ALA 15  16  16  ALA ALA C . n 
C 1 16  TYR 16  17  17  TYR TYR C . n 
C 1 17  VAL 17  18  18  VAL VAL C . n 
C 1 18  LEU 18  19  19  LEU LEU C . n 
C 1 19  ALA 19  20  20  ALA ALA C . n 
C 1 20  GLY 20  21  21  GLY GLY C . n 
C 1 21  GLY 21  22  22  GLY GLY C . n 
C 1 22  ARG 22  23  23  ARG ARG C . n 
C 1 23  GLY 23  24  24  GLY GLY C . n 
C 1 24  SER 24  25  25  SER SER C . n 
C 1 25  ARG 25  26  26  ARG ARG C . n 
C 1 26  LEU 26  27  27  LEU LEU C . n 
C 1 27  LYS 27  28  28  LYS LYS C . n 
C 1 28  GLU 28  29  29  GLU GLU C . n 
C 1 29  LEU 29  30  30  LEU LEU C . n 
C 1 30  THR 30  31  31  THR THR C . n 
C 1 31  ASP 31  32  32  ASP ASP C . n 
C 1 32  ARG 32  33  33  ARG ARG C . n 
C 1 33  ARG 33  34  34  ARG ARG C . n 
C 1 34  ALA 34  35  35  ALA ALA C . n 
C 1 35  LYS 35  36  36  LYS LYS C . n 
C 1 36  PRO 36  37  37  PRO PRO C . n 
C 1 37  ALA 37  38  38  ALA ALA C . n 
C 1 38  VAL 38  39  39  VAL VAL C . n 
C 1 39  TYR 39  40  40  TYR TYR C . n 
C 1 40  PHE 40  41  41  PHE PHE C . n 
C 1 41  GLY 41  42  42  GLY GLY C . n 
C 1 42  GLY 42  43  43  GLY GLY C . n 
C 1 43  LYS 43  44  44  LYS LYS C . n 
C 1 44  ALA 44  45  45  ALA ALA C . n 
C 1 45  ARG 45  46  46  ARG ARG C . n 
C 1 46  ILE 46  47  47  ILE ILE C . n 
C 1 47  ILE 47  48  48  ILE ILE C . n 
C 1 48  ASP 48  49  49  ASP ASP C . n 
C 1 49  PHE 49  50  50  PHE PHE C . n 
C 1 50  ALA 50  51  51  ALA ALA C . n 
C 1 51  LEU 51  52  52  LEU LEU C . n 
C 1 52  SER 52  53  53  SER SER C . n 
C 1 53  ASN 53  54  54  ASN ASN C . n 
C 1 54  ALA 54  55  55  ALA ALA C . n 
C 1 55  LEU 55  56  56  LEU LEU C . n 
C 1 56  ASN 56  57  57  ASN ASN C . n 
C 1 57  SER 57  58  58  SER SER C . n 
C 1 58  GLY 58  59  59  GLY GLY C . n 
C 1 59  ILE 59  60  60  ILE ILE C . n 
C 1 60  ARG 60  61  61  ARG ARG C . n 
C 1 61  ARG 61  62  62  ARG ARG C . n 
C 1 62  ILE 62  63  63  ILE ILE C . n 
C 1 63  GLY 63  64  64  GLY GLY C . n 
C 1 64  VAL 64  65  65  VAL VAL C . n 
C 1 65  ALA 65  66  66  ALA ALA C . n 
C 1 66  THR 66  67  67  THR THR C . n 
C 1 67  GLN 67  68  68  GLN GLN C . n 
C 1 68  TYR 68  69  69  TYR TYR C . n 
C 1 69  LYS 69  70  70  LYS LYS C . n 
C 1 70  ALA 70  71  71  ALA ALA C . n 
C 1 71  HIS 71  72  72  HIS HIS C . n 
C 1 72  SER 72  73  73  SER SER C . n 
C 1 73  LEU 73  74  74  LEU LEU C . n 
C 1 74  ILE 74  75  75  ILE ILE C . n 
C 1 75  ARG 75  76  76  ARG ARG C . n 
C 1 76  HIS 76  77  77  HIS HIS C . n 
C 1 77  LEU 77  78  78  LEU LEU C . n 
C 1 78  GLN 78  79  79  GLN GLN C . n 
C 1 79  ARG 79  80  80  ARG ARG C . n 
C 1 80  GLY 80  81  81  GLY GLY C . n 
C 1 81  TRP 81  82  82  TRP TRP C . n 
C 1 82  ASP 82  83  83  ASP ASP C . n 
C 1 83  PHE 83  84  84  PHE PHE C . n 
C 1 84  PHE 84  85  85  PHE PHE C . n 
C 1 85  ARG 85  86  86  ARG ARG C . n 
C 1 86  PRO 86  87  87  PRO PRO C . n 
C 1 87  GLU 87  88  88  GLU GLU C . n 
C 1 88  ARG 88  89  89  ARG ARG C . n 
C 1 89  ASN 89  90  90  ASN ASN C . n 
C 1 90  GLU 90  91  91  GLU GLU C . n 
C 1 91  SER 91  92  92  SER SER C . n 
C 1 92  PHE 92  93  93  PHE PHE C . n 
C 1 93  ASP 93  94  94  ASP ASP C . n 
C 1 94  ILE 94  95  95  ILE ILE C . n 
C 1 95  LEU 95  96  96  LEU LEU C . n 
C 1 96  PRO 96  97  97  PRO PRO C . n 
C 1 97  ALA 97  98  98  ALA ALA C . n 
C 1 98  SER 98  99  99  SER SER C . n 
C 1 99  GLN 99  100 100 GLN GLN C . n 
C 1 100 ARG 100 101 101 ARG ARG C . n 
C 1 101 VAL 101 102 ?   ?   ?   C . n 
C 1 102 SER 102 103 ?   ?   ?   C . n 
C 1 103 GLU 103 104 104 GLU GLU C . n 
C 1 104 THR 104 105 105 THR THR C . n 
C 1 105 GLN 105 106 106 GLN GLN C . n 
C 1 106 TRP 106 107 107 TRP TRP C . n 
C 1 107 TYR 107 108 108 TYR TYR C . n 
C 1 108 GLU 108 109 109 GLU GLU C . n 
C 1 109 GLY 109 110 110 GLY GLY C . n 
C 1 110 THR 110 111 111 THR THR C . n 
C 1 111 ALA 111 112 112 ALA ALA C . n 
C 1 112 ASP 112 113 113 ASP ASP C . n 
C 1 113 ALA 113 114 114 ALA ALA C . n 
C 1 114 VAL 114 115 115 VAL VAL C . n 
C 1 115 TYR 115 116 116 TYR TYR C . n 
C 1 116 GLN 116 117 117 GLN GLN C . n 
C 1 117 ASN 117 118 118 ASN ASN C . n 
C 1 118 ILE 118 119 119 ILE ILE C . n 
C 1 119 ASP 119 120 120 ASP ASP C . n 
C 1 120 ILE 120 121 121 ILE ILE C . n 
C 1 121 ILE 121 122 122 ILE ILE C . n 
C 1 122 GLU 122 123 123 GLU GLU C . n 
C 1 123 PRO 123 124 124 PRO PRO C . n 
C 1 124 TYR 124 125 125 TYR TYR C . n 
C 1 125 ALA 125 126 126 ALA ALA C . n 
C 1 126 PRO 126 127 127 PRO PRO C . n 
C 1 127 GLU 127 128 128 GLU GLU C . n 
C 1 128 TYR 128 129 129 TYR TYR C . n 
C 1 129 MET 129 130 130 MET MET C . n 
C 1 130 VAL 130 131 131 VAL VAL C . n 
C 1 131 ILE 131 132 132 ILE ILE C . n 
C 1 132 LEU 132 133 133 LEU LEU C . n 
C 1 133 ALA 133 134 134 ALA ALA C . n 
C 1 134 GLY 134 135 135 GLY GLY C . n 
C 1 135 ASP 135 136 136 ASP ASP C . n 
C 1 136 HIS 136 137 137 HIS HIS C . n 
C 1 137 ILE 137 138 138 ILE ILE C . n 
C 1 138 TYR 138 139 139 TYR TYR C . n 
C 1 139 LYS 139 140 140 LYS LYS C . n 
C 1 140 MET 140 141 141 MET MET C . n 
C 1 141 ASP 141 142 142 ASP ASP C . n 
C 1 142 TYR 142 143 143 TYR TYR C . n 
C 1 143 GLU 143 144 144 GLU GLU C . n 
C 1 144 TYR 144 145 145 TYR TYR C . n 
C 1 145 MET 145 146 146 MET MET C . n 
C 1 146 LEU 146 147 147 LEU LEU C . n 
C 1 147 GLN 147 148 148 GLN GLN C . n 
C 1 148 GLN 148 149 149 GLN GLN C . n 
C 1 149 HIS 149 150 150 HIS HIS C . n 
C 1 150 VAL 150 151 151 VAL VAL C . n 
C 1 151 ASP 151 152 152 ASP ASP C . n 
C 1 152 SER 152 153 153 SER SER C . n 
C 1 153 GLY 153 154 154 GLY GLY C . n 
C 1 154 ALA 154 155 155 ALA ALA C . n 
C 1 155 ASP 155 156 156 ASP ASP C . n 
C 1 156 VAL 156 157 157 VAL VAL C . n 
C 1 157 THR 157 158 158 THR THR C . n 
C 1 158 ILE 158 159 159 ILE ILE C . n 
C 1 159 GLY 159 160 160 GLY GLY C . n 
C 1 160 CYS 160 161 161 CYS CYS C . n 
C 1 161 LEU 161 162 162 LEU LEU C . n 
C 1 162 GLU 162 163 163 GLU GLU C . n 
C 1 163 VAL 163 164 164 VAL VAL C . n 
C 1 164 PRO 164 165 165 PRO PRO C . n 
C 1 165 ARG 165 166 166 ARG ARG C . n 
C 1 166 MET 166 167 167 MET MET C . n 
C 1 167 GLU 167 168 168 GLU GLU C . n 
C 1 168 ALA 168 169 169 ALA ALA C . n 
C 1 169 THR 169 170 170 THR THR C . n 
C 1 170 GLY 170 171 171 GLY GLY C . n 
C 1 171 PHE 171 172 172 PHE PHE C . n 
C 1 172 GLY 172 173 173 GLY GLY C . n 
C 1 173 VAL 173 174 174 VAL VAL C . n 
C 1 174 MET 174 175 175 MET MET C . n 
C 1 175 HIS 175 176 176 HIS HIS C . n 
C 1 176 VAL 176 177 177 VAL VAL C . n 
C 1 177 ASN 177 178 178 ASN ASN C . n 
C 1 178 GLU 178 179 179 GLU GLU C . n 
C 1 179 LYS 179 180 180 LYS LYS C . n 
C 1 180 ASP 180 181 181 ASP ASP C . n 
C 1 181 GLU 181 182 182 GLU GLU C . n 
C 1 182 ILE 182 183 183 ILE ILE C . n 
C 1 183 ILE 183 184 184 ILE ILE C . n 
C 1 184 ASP 184 185 185 ASP ASP C . n 
C 1 185 PHE 185 186 186 PHE PHE C . n 
C 1 186 ILE 186 187 187 ILE ILE C . n 
C 1 187 GLU 187 188 188 GLU GLU C . n 
C 1 188 LYS 188 189 189 LYS LYS C . n 
C 1 189 PRO 189 190 190 PRO PRO C . n 
C 1 190 ALA 190 191 191 ALA ALA C . n 
C 1 191 ASP 191 192 192 ASP ASP C . n 
C 1 192 PRO 192 193 193 PRO PRO C . n 
C 1 193 PRO 193 194 194 PRO PRO C . n 
C 1 194 GLY 194 195 195 GLY GLY C . n 
C 1 195 ILE 195 196 196 ILE ILE C . n 
C 1 196 PRO 196 197 197 PRO PRO C . n 
C 1 197 GLY 197 198 198 GLY GLY C . n 
C 1 198 ASN 198 199 199 ASN ASN C . n 
C 1 199 GLU 199 200 200 GLU GLU C . n 
C 1 200 GLY 200 201 201 GLY GLY C . n 
C 1 201 PHE 201 202 202 PHE PHE C . n 
C 1 202 ALA 202 203 203 ALA ALA C . n 
C 1 203 LEU 203 204 204 LEU LEU C . n 
C 1 204 ALA 204 205 205 ALA ALA C . n 
C 1 205 SER 205 206 206 SER SER C . n 
C 1 206 MET 206 207 207 MET MET C . n 
C 1 207 GLY 207 208 208 GLY GLY C . n 
C 1 208 ILE 208 209 209 ILE ILE C . n 
C 1 209 TYR 209 210 210 TYR TYR C . n 
C 1 210 VAL 210 211 211 VAL VAL C . n 
C 1 211 PHE 211 212 212 PHE PHE C . n 
C 1 212 HIS 212 213 213 HIS HIS C . n 
C 1 213 THR 213 214 214 THR THR C . n 
C 1 214 LYS 214 215 215 LYS LYS C . n 
C 1 215 PHE 215 216 216 PHE PHE C . n 
C 1 216 LEU 216 217 217 LEU LEU C . n 
C 1 217 MET 217 218 218 MET MET C . n 
C 1 218 GLU 218 219 219 GLU GLU C . n 
C 1 219 ALA 219 220 220 ALA ALA C . n 
C 1 220 LEU 220 221 221 LEU LEU C . n 
C 1 221 ARG 221 222 222 ARG ARG C . n 
C 1 222 ARG 222 223 223 ARG ARG C . n 
C 1 223 ASP 223 224 224 ASP ASP C . n 
C 1 224 ALA 224 225 225 ALA ALA C . n 
C 1 225 ALA 225 226 226 ALA ALA C . n 
C 1 226 ASP 226 227 227 ASP ASP C . n 
C 1 227 PRO 227 228 228 PRO PRO C . n 
C 1 228 THR 228 229 229 THR THR C . n 
C 1 229 SER 229 230 230 SER SER C . n 
C 1 230 SER 230 231 231 SER SER C . n 
C 1 231 ARG 231 232 232 ARG ARG C . n 
C 1 232 ASP 232 233 233 ASP ASP C . n 
C 1 233 PHE 233 234 234 PHE PHE C . n 
C 1 234 GLY 234 235 235 GLY GLY C . n 
C 1 235 LYS 235 236 236 LYS LYS C . n 
C 1 236 ASP 236 237 237 ASP ASP C . n 
C 1 237 ILE 237 238 238 ILE ILE C . n 
C 1 238 ILE 238 239 239 ILE ILE C . n 
C 1 239 PRO 239 240 240 PRO PRO C . n 
C 1 240 TYR 240 241 241 TYR TYR C . n 
C 1 241 ILE 241 242 242 ILE ILE C . n 
C 1 242 VAL 242 243 243 VAL VAL C . n 
C 1 243 GLU 243 244 244 GLU GLU C . n 
C 1 244 HIS 244 245 245 HIS HIS C . n 
C 1 245 GLY 245 246 246 GLY GLY C . n 
C 1 246 LYS 246 247 247 LYS LYS C . n 
C 1 247 ALA 247 248 248 ALA ALA C . n 
C 1 248 VAL 248 249 249 VAL VAL C . n 
C 1 249 ALA 249 250 250 ALA ALA C . n 
C 1 250 HIS 250 251 251 HIS HIS C . n 
C 1 251 ARG 251 252 252 ARG ARG C . n 
C 1 252 PHE 252 253 253 PHE PHE C . n 
C 1 253 ALA 253 254 254 ALA ALA C . n 
C 1 254 ASP 254 255 255 ASP ASP C . n 
C 1 255 SER 255 256 256 SER SER C . n 
C 1 256 CYS 256 257 257 CYS CYS C . n 
C 1 257 VAL 257 258 258 VAL VAL C . n 
C 1 258 ARG 258 259 259 ARG ARG C . n 
C 1 259 SER 259 260 260 SER SER C . n 
C 1 260 ASP 260 261 261 ASP ASP C . n 
C 1 261 PHE 261 262 262 PHE PHE C . n 
C 1 262 GLU 262 263 263 GLU GLU C . n 
C 1 263 HIS 263 264 264 HIS HIS C . n 
C 1 264 GLU 264 265 265 GLU GLU C . n 
C 1 265 PRO 265 266 266 PRO PRO C . n 
C 1 266 TYR 266 267 267 TYR TYR C . n 
C 1 267 TRP 267 268 268 TRP TRP C . n 
C 1 268 ARG 268 269 269 ARG ARG C . n 
C 1 269 ASP 269 270 270 ASP ASP C . n 
C 1 270 VAL 270 271 271 VAL VAL C . n 
C 1 271 GLY 271 272 272 GLY GLY C . n 
C 1 272 THR 272 273 273 THR THR C . n 
C 1 273 ILE 273 274 274 ILE ILE C . n 
C 1 274 ASP 274 275 275 ASP ASP C . n 
C 1 275 ALA 275 276 276 ALA ALA C . n 
C 1 276 TYR 276 277 277 TYR TYR C . n 
C 1 277 TRP 277 278 278 TRP TRP C . n 
C 1 278 GLN 278 279 279 GLN GLN C . n 
C 1 279 ALA 279 280 280 ALA ALA C . n 
C 1 280 ASN 280 281 281 ASN ASN C . n 
C 1 281 ILE 281 282 282 ILE ILE C . n 
C 1 282 ASP 282 283 283 ASP ASP C . n 
C 1 283 LEU 283 284 284 LEU LEU C . n 
C 1 284 THR 284 285 285 THR THR C . n 
C 1 285 ASP 285 286 286 ASP ASP C . n 
C 1 286 VAL 286 287 287 VAL VAL C . n 
C 1 287 VAL 287 288 288 VAL VAL C . n 
C 1 288 PRO 288 289 289 PRO PRO C . n 
C 1 289 ASP 289 290 290 ASP ASP C . n 
C 1 290 LEU 290 291 291 LEU LEU C . n 
C 1 291 ASP 291 292 292 ASP ASP C . n 
C 1 292 ILE 292 293 293 ILE ILE C . n 
C 1 293 TYR 293 294 294 TYR TYR C . n 
C 1 294 ASP 294 295 295 ASP ASP C . n 
C 1 295 LYS 295 296 296 LYS LYS C . n 
C 1 296 SER 296 297 297 SER SER C . n 
C 1 297 TRP 297 298 298 TRP TRP C . n 
C 1 298 PRO 298 299 299 PRO PRO C . n 
C 1 299 ILE 299 300 300 ILE ILE C . n 
C 1 300 TRP 300 301 301 TRP TRP C . n 
C 1 301 THR 301 302 302 THR THR C . n 
C 1 302 TYR 302 303 303 TYR TYR C . n 
C 1 303 ALA 303 304 304 ALA ALA C . n 
C 1 304 GLU 304 305 305 GLU GLU C . n 
C 1 305 ILE 305 306 306 ILE ILE C . n 
C 1 306 THR 306 307 307 THR THR C . n 
C 1 307 PRO 307 308 308 PRO PRO C . n 
C 1 308 PRO 308 309 309 PRO PRO C . n 
C 1 309 ALA 309 310 310 ALA ALA C . n 
C 1 310 LYS 310 311 311 LYS LYS C . n 
C 1 311 PHE 311 312 312 PHE PHE C . n 
C 1 312 VAL 312 313 313 VAL VAL C . n 
C 1 313 HIS 313 314 314 HIS HIS C . n 
C 1 314 ASP 314 315 315 ASP ASP C . n 
C 1 315 ASP 315 316 316 ASP ASP C . n 
C 1 316 GLU 316 317 317 GLU GLU C . n 
C 1 317 ASP 317 318 318 ASP ASP C . n 
C 1 318 ARG 318 319 319 ARG ARG C . n 
C 1 319 ARG 319 320 320 ARG ARG C . n 
C 1 320 GLY 320 321 321 GLY GLY C . n 
C 1 321 SER 321 322 322 SER SER C . n 
C 1 322 ALA 322 323 323 ALA ALA C . n 
C 1 323 VAL 323 324 324 VAL VAL C . n 
C 1 324 SER 324 325 325 SER SER C . n 
C 1 325 SER 325 326 326 SER SER C . n 
C 1 326 VAL 326 327 327 VAL VAL C . n 
C 1 327 VAL 327 328 328 VAL VAL C . n 
C 1 328 SER 328 329 329 SER SER C . n 
C 1 329 GLY 329 330 330 GLY GLY C . n 
C 1 330 ASP 330 331 331 ASP ASP C . n 
C 1 331 CYS 331 332 332 CYS CYS C . n 
C 1 332 ILE 332 333 333 ILE ILE C . n 
C 1 333 ILE 333 334 334 ILE ILE C . n 
C 1 334 SER 334 335 335 SER SER C . n 
C 1 335 GLY 335 336 336 GLY GLY C . n 
C 1 336 ALA 336 337 337 ALA ALA C . n 
C 1 337 ALA 337 338 338 ALA ALA C . n 
C 1 338 LEU 338 339 339 LEU LEU C . n 
C 1 339 ASN 339 340 340 ASN ASN C . n 
C 1 340 ARG 340 341 341 ARG ARG C . n 
C 1 341 SER 341 342 342 SER SER C . n 
C 1 342 LEU 342 343 343 LEU LEU C . n 
C 1 343 LEU 343 344 344 LEU LEU C . n 
C 1 344 PHE 344 345 345 PHE PHE C . n 
C 1 345 THR 345 346 346 THR THR C . n 
C 1 346 GLY 346 347 347 GLY GLY C . n 
C 1 347 VAL 347 348 348 VAL VAL C . n 
C 1 348 ARG 348 349 349 ARG ARG C . n 
C 1 349 ALA 349 350 350 ALA ALA C . n 
C 1 350 ASN 350 351 351 ASN ASN C . n 
C 1 351 SER 351 352 352 SER SER C . n 
C 1 352 TYR 352 353 353 TYR TYR C . n 
C 1 353 SER 353 354 354 SER SER C . n 
C 1 354 ARG 354 355 355 ARG ARG C . n 
C 1 355 LEU 355 356 356 LEU LEU C . n 
C 1 356 GLU 356 357 357 GLU GLU C . n 
C 1 357 ASN 357 358 358 ASN ASN C . n 
C 1 358 ALA 358 359 359 ALA ALA C . n 
C 1 359 VAL 359 360 360 VAL VAL C . n 
C 1 360 VAL 360 361 361 VAL VAL C . n 
C 1 361 LEU 361 362 362 LEU LEU C . n 
C 1 362 PRO 362 363 363 PRO PRO C . n 
C 1 363 SER 363 364 364 SER SER C . n 
C 1 364 VAL 364 365 365 VAL VAL C . n 
C 1 365 LYS 365 366 366 LYS LYS C . n 
C 1 366 ILE 366 367 367 ILE ILE C . n 
C 1 367 GLY 367 368 368 GLY GLY C . n 
C 1 368 ARG 368 369 369 ARG ARG C . n 
C 1 369 HIS 369 370 370 HIS HIS C . n 
C 1 370 ALA 370 371 371 ALA ALA C . n 
C 1 371 GLN 371 372 372 GLN GLN C . n 
C 1 372 LEU 372 373 373 LEU LEU C . n 
C 1 373 SER 373 374 374 SER SER C . n 
C 1 374 ASN 374 375 375 ASN ASN C . n 
C 1 375 VAL 375 376 376 VAL VAL C . n 
C 1 376 VAL 376 377 377 VAL VAL C . n 
C 1 377 ILE 377 378 378 ILE ILE C . n 
C 1 378 ASP 378 379 379 ASP ASP C . n 
C 1 379 HIS 379 380 380 HIS HIS C . n 
C 1 380 GLY 380 381 381 GLY GLY C . n 
C 1 381 VAL 381 382 382 VAL VAL C . n 
C 1 382 VAL 382 383 383 VAL VAL C . n 
C 1 383 ILE 383 384 384 ILE ILE C . n 
C 1 384 PRO 384 385 385 PRO PRO C . n 
C 1 385 GLU 385 386 386 GLU GLU C . n 
C 1 386 GLY 386 387 387 GLY GLY C . n 
C 1 387 LEU 387 388 388 LEU LEU C . n 
C 1 388 ILE 388 389 389 ILE ILE C . n 
C 1 389 VAL 389 390 390 VAL VAL C . n 
C 1 390 GLY 390 391 391 GLY GLY C . n 
C 1 391 GLU 391 392 392 GLU GLU C . n 
C 1 392 ASP 392 393 393 ASP ASP C . n 
C 1 393 PRO 393 394 394 PRO PRO C . n 
C 1 394 GLU 394 395 395 GLU GLU C . n 
C 1 395 LEU 395 396 396 LEU LEU C . n 
C 1 396 ASP 396 397 397 ASP ASP C . n 
C 1 397 ALA 397 398 398 ALA ALA C . n 
C 1 398 LYS 398 399 399 LYS LYS C . n 
C 1 399 ARG 399 400 400 ARG ARG C . n 
C 1 400 PHE 400 401 401 PHE PHE C . n 
C 1 401 ARG 401 402 402 ARG ARG C . n 
C 1 402 ARG 402 403 403 ARG ARG C . n 
C 1 403 THR 403 404 404 THR THR C . n 
C 1 404 GLU 404 405 405 GLU GLU C . n 
C 1 405 SER 405 406 406 SER SER C . n 
C 1 406 GLY 406 407 407 GLY GLY C . n 
C 1 407 ILE 407 408 408 ILE ILE C . n 
C 1 408 CYS 408 409 409 CYS CYS C . n 
C 1 409 LEU 409 410 410 LEU LEU C . n 
C 1 410 ILE 410 411 411 ILE ILE C . n 
C 1 411 THR 411 412 412 THR THR C . n 
C 1 412 GLN 412 413 413 GLN GLN C . n 
C 1 413 SER 413 414 414 SER SER C . n 
C 1 414 MET 414 415 415 MET MET C . n 
C 1 415 ILE 415 416 416 ILE ILE C . n 
C 1 416 ASP 416 417 417 ASP ASP C . n 
C 1 417 LYS 417 418 418 LYS LYS C . n 
C 1 418 LEU 418 419 419 LEU LEU C . n 
C 1 419 ASP 419 420 420 ASP ASP C . n 
C 1 420 LEU 420 421 421 LEU LEU C . n 
D 1 1   MET 1   2   ?   ?   ?   D . n 
D 1 2   SER 2   3   ?   ?   ?   D . n 
D 1 3   GLU 3   4   ?   ?   ?   D . n 
D 1 4   LYS 4   5   ?   ?   ?   D . n 
D 1 5   ARG 5   6   ?   ?   ?   D . n 
D 1 6   VAL 6   7   7   VAL VAL D . n 
D 1 7   GLN 7   8   8   GLN GLN D . n 
D 1 8   PRO 8   9   9   PRO PRO D . n 
D 1 9   LEU 9   10  10  LEU LEU D . n 
D 1 10  ALA 10  11  11  ALA ALA D . n 
D 1 11  ARG 11  12  12  ARG ARG D . n 
D 1 12  ASP 12  13  13  ASP ASP D . n 
D 1 13  ALA 13  14  14  ALA ALA D . n 
D 1 14  MET 14  15  15  MET MET D . n 
D 1 15  ALA 15  16  16  ALA ALA D . n 
D 1 16  TYR 16  17  17  TYR TYR D . n 
D 1 17  VAL 17  18  18  VAL VAL D . n 
D 1 18  LEU 18  19  19  LEU LEU D . n 
D 1 19  ALA 19  20  20  ALA ALA D . n 
D 1 20  GLY 20  21  21  GLY GLY D . n 
D 1 21  GLY 21  22  22  GLY GLY D . n 
D 1 22  ARG 22  23  23  ARG ARG D . n 
D 1 23  GLY 23  24  24  GLY GLY D . n 
D 1 24  SER 24  25  25  SER SER D . n 
D 1 25  ARG 25  26  26  ARG ARG D . n 
D 1 26  LEU 26  27  27  LEU LEU D . n 
D 1 27  LYS 27  28  28  LYS LYS D . n 
D 1 28  GLU 28  29  29  GLU GLU D . n 
D 1 29  LEU 29  30  30  LEU LEU D . n 
D 1 30  THR 30  31  31  THR THR D . n 
D 1 31  ASP 31  32  32  ASP ASP D . n 
D 1 32  ARG 32  33  33  ARG ARG D . n 
D 1 33  ARG 33  34  34  ARG ARG D . n 
D 1 34  ALA 34  35  35  ALA ALA D . n 
D 1 35  LYS 35  36  36  LYS LYS D . n 
D 1 36  PRO 36  37  37  PRO PRO D . n 
D 1 37  ALA 37  38  38  ALA ALA D . n 
D 1 38  VAL 38  39  39  VAL VAL D . n 
D 1 39  TYR 39  40  40  TYR TYR D . n 
D 1 40  PHE 40  41  41  PHE PHE D . n 
D 1 41  GLY 41  42  42  GLY GLY D . n 
D 1 42  GLY 42  43  43  GLY GLY D . n 
D 1 43  LYS 43  44  44  LYS LYS D . n 
D 1 44  ALA 44  45  45  ALA ALA D . n 
D 1 45  ARG 45  46  46  ARG ARG D . n 
D 1 46  ILE 46  47  47  ILE ILE D . n 
D 1 47  ILE 47  48  48  ILE ILE D . n 
D 1 48  ASP 48  49  49  ASP ASP D . n 
D 1 49  PHE 49  50  50  PHE PHE D . n 
D 1 50  ALA 50  51  51  ALA ALA D . n 
D 1 51  LEU 51  52  52  LEU LEU D . n 
D 1 52  SER 52  53  53  SER SER D . n 
D 1 53  ASN 53  54  54  ASN ASN D . n 
D 1 54  ALA 54  55  55  ALA ALA D . n 
D 1 55  LEU 55  56  56  LEU LEU D . n 
D 1 56  ASN 56  57  57  ASN ASN D . n 
D 1 57  SER 57  58  58  SER SER D . n 
D 1 58  GLY 58  59  59  GLY GLY D . n 
D 1 59  ILE 59  60  60  ILE ILE D . n 
D 1 60  ARG 60  61  61  ARG ARG D . n 
D 1 61  ARG 61  62  62  ARG ARG D . n 
D 1 62  ILE 62  63  63  ILE ILE D . n 
D 1 63  GLY 63  64  64  GLY GLY D . n 
D 1 64  VAL 64  65  65  VAL VAL D . n 
D 1 65  ALA 65  66  66  ALA ALA D . n 
D 1 66  THR 66  67  67  THR THR D . n 
D 1 67  GLN 67  68  68  GLN GLN D . n 
D 1 68  TYR 68  69  69  TYR TYR D . n 
D 1 69  LYS 69  70  70  LYS LYS D . n 
D 1 70  ALA 70  71  71  ALA ALA D . n 
D 1 71  HIS 71  72  72  HIS HIS D . n 
D 1 72  SER 72  73  73  SER SER D . n 
D 1 73  LEU 73  74  74  LEU LEU D . n 
D 1 74  ILE 74  75  75  ILE ILE D . n 
D 1 75  ARG 75  76  76  ARG ARG D . n 
D 1 76  HIS 76  77  77  HIS HIS D . n 
D 1 77  LEU 77  78  78  LEU LEU D . n 
D 1 78  GLN 78  79  79  GLN GLN D . n 
D 1 79  ARG 79  80  80  ARG ARG D . n 
D 1 80  GLY 80  81  81  GLY GLY D . n 
D 1 81  TRP 81  82  82  TRP TRP D . n 
D 1 82  ASP 82  83  83  ASP ASP D . n 
D 1 83  PHE 83  84  84  PHE PHE D . n 
D 1 84  PHE 84  85  85  PHE PHE D . n 
D 1 85  ARG 85  86  86  ARG ARG D . n 
D 1 86  PRO 86  87  87  PRO PRO D . n 
D 1 87  GLU 87  88  88  GLU GLU D . n 
D 1 88  ARG 88  89  89  ARG ARG D . n 
D 1 89  ASN 89  90  90  ASN ASN D . n 
D 1 90  GLU 90  91  91  GLU GLU D . n 
D 1 91  SER 91  92  92  SER SER D . n 
D 1 92  PHE 92  93  93  PHE PHE D . n 
D 1 93  ASP 93  94  94  ASP ASP D . n 
D 1 94  ILE 94  95  95  ILE ILE D . n 
D 1 95  LEU 95  96  96  LEU LEU D . n 
D 1 96  PRO 96  97  97  PRO PRO D . n 
D 1 97  ALA 97  98  98  ALA ALA D . n 
D 1 98  SER 98  99  99  SER SER D . n 
D 1 99  GLN 99  100 100 GLN GLN D . n 
D 1 100 ARG 100 101 101 ARG ARG D . n 
D 1 101 VAL 101 102 ?   ?   ?   D . n 
D 1 102 SER 102 103 ?   ?   ?   D . n 
D 1 103 GLU 103 104 ?   ?   ?   D . n 
D 1 104 THR 104 105 105 THR THR D . n 
D 1 105 GLN 105 106 106 GLN GLN D . n 
D 1 106 TRP 106 107 107 TRP TRP D . n 
D 1 107 TYR 107 108 108 TYR TYR D . n 
D 1 108 GLU 108 109 109 GLU GLU D . n 
D 1 109 GLY 109 110 110 GLY GLY D . n 
D 1 110 THR 110 111 111 THR THR D . n 
D 1 111 ALA 111 112 112 ALA ALA D . n 
D 1 112 ASP 112 113 113 ASP ASP D . n 
D 1 113 ALA 113 114 114 ALA ALA D . n 
D 1 114 VAL 114 115 115 VAL VAL D . n 
D 1 115 TYR 115 116 116 TYR TYR D . n 
D 1 116 GLN 116 117 117 GLN GLN D . n 
D 1 117 ASN 117 118 118 ASN ASN D . n 
D 1 118 ILE 118 119 119 ILE ILE D . n 
D 1 119 ASP 119 120 120 ASP ASP D . n 
D 1 120 ILE 120 121 121 ILE ILE D . n 
D 1 121 ILE 121 122 122 ILE ILE D . n 
D 1 122 GLU 122 123 123 GLU GLU D . n 
D 1 123 PRO 123 124 124 PRO PRO D . n 
D 1 124 TYR 124 125 125 TYR TYR D . n 
D 1 125 ALA 125 126 126 ALA ALA D . n 
D 1 126 PRO 126 127 127 PRO PRO D . n 
D 1 127 GLU 127 128 128 GLU GLU D . n 
D 1 128 TYR 128 129 129 TYR TYR D . n 
D 1 129 MET 129 130 130 MET MET D . n 
D 1 130 VAL 130 131 131 VAL VAL D . n 
D 1 131 ILE 131 132 132 ILE ILE D . n 
D 1 132 LEU 132 133 133 LEU LEU D . n 
D 1 133 ALA 133 134 134 ALA ALA D . n 
D 1 134 GLY 134 135 135 GLY GLY D . n 
D 1 135 ASP 135 136 136 ASP ASP D . n 
D 1 136 HIS 136 137 137 HIS HIS D . n 
D 1 137 ILE 137 138 138 ILE ILE D . n 
D 1 138 TYR 138 139 139 TYR TYR D . n 
D 1 139 LYS 139 140 140 LYS LYS D . n 
D 1 140 MET 140 141 141 MET MET D . n 
D 1 141 ASP 141 142 142 ASP ASP D . n 
D 1 142 TYR 142 143 143 TYR TYR D . n 
D 1 143 GLU 143 144 144 GLU GLU D . n 
D 1 144 TYR 144 145 145 TYR TYR D . n 
D 1 145 MET 145 146 146 MET MET D . n 
D 1 146 LEU 146 147 147 LEU LEU D . n 
D 1 147 GLN 147 148 148 GLN GLN D . n 
D 1 148 GLN 148 149 149 GLN GLN D . n 
D 1 149 HIS 149 150 150 HIS HIS D . n 
D 1 150 VAL 150 151 151 VAL VAL D . n 
D 1 151 ASP 151 152 152 ASP ASP D . n 
D 1 152 SER 152 153 153 SER SER D . n 
D 1 153 GLY 153 154 154 GLY GLY D . n 
D 1 154 ALA 154 155 155 ALA ALA D . n 
D 1 155 ASP 155 156 156 ASP ASP D . n 
D 1 156 VAL 156 157 157 VAL VAL D . n 
D 1 157 THR 157 158 158 THR THR D . n 
D 1 158 ILE 158 159 159 ILE ILE D . n 
D 1 159 GLY 159 160 160 GLY GLY D . n 
D 1 160 CYS 160 161 161 CYS CYS D . n 
D 1 161 LEU 161 162 162 LEU LEU D . n 
D 1 162 GLU 162 163 163 GLU GLU D . n 
D 1 163 VAL 163 164 164 VAL VAL D . n 
D 1 164 PRO 164 165 165 PRO PRO D . n 
D 1 165 ARG 165 166 166 ARG ARG D . n 
D 1 166 MET 166 167 167 MET MET D . n 
D 1 167 GLU 167 168 168 GLU GLU D . n 
D 1 168 ALA 168 169 169 ALA ALA D . n 
D 1 169 THR 169 170 170 THR THR D . n 
D 1 170 GLY 170 171 171 GLY GLY D . n 
D 1 171 PHE 171 172 172 PHE PHE D . n 
D 1 172 GLY 172 173 173 GLY GLY D . n 
D 1 173 VAL 173 174 174 VAL VAL D . n 
D 1 174 MET 174 175 175 MET MET D . n 
D 1 175 HIS 175 176 176 HIS HIS D . n 
D 1 176 VAL 176 177 177 VAL VAL D . n 
D 1 177 ASN 177 178 178 ASN ASN D . n 
D 1 178 GLU 178 179 179 GLU GLU D . n 
D 1 179 LYS 179 180 180 LYS LYS D . n 
D 1 180 ASP 180 181 181 ASP ASP D . n 
D 1 181 GLU 181 182 182 GLU GLU D . n 
D 1 182 ILE 182 183 183 ILE ILE D . n 
D 1 183 ILE 183 184 184 ILE ILE D . n 
D 1 184 ASP 184 185 185 ASP ASP D . n 
D 1 185 PHE 185 186 186 PHE PHE D . n 
D 1 186 ILE 186 187 187 ILE ILE D . n 
D 1 187 GLU 187 188 188 GLU GLU D . n 
D 1 188 LYS 188 189 189 LYS LYS D . n 
D 1 189 PRO 189 190 190 PRO PRO D . n 
D 1 190 ALA 190 191 191 ALA ALA D . n 
D 1 191 ASP 191 192 192 ASP ASP D . n 
D 1 192 PRO 192 193 193 PRO PRO D . n 
D 1 193 PRO 193 194 194 PRO PRO D . n 
D 1 194 GLY 194 195 195 GLY GLY D . n 
D 1 195 ILE 195 196 196 ILE ILE D . n 
D 1 196 PRO 196 197 197 PRO PRO D . n 
D 1 197 GLY 197 198 198 GLY GLY D . n 
D 1 198 ASN 198 199 199 ASN ASN D . n 
D 1 199 GLU 199 200 200 GLU GLU D . n 
D 1 200 GLY 200 201 201 GLY GLY D . n 
D 1 201 PHE 201 202 202 PHE PHE D . n 
D 1 202 ALA 202 203 203 ALA ALA D . n 
D 1 203 LEU 203 204 204 LEU LEU D . n 
D 1 204 ALA 204 205 205 ALA ALA D . n 
D 1 205 SER 205 206 206 SER SER D . n 
D 1 206 MET 206 207 207 MET MET D . n 
D 1 207 GLY 207 208 208 GLY GLY D . n 
D 1 208 ILE 208 209 209 ILE ILE D . n 
D 1 209 TYR 209 210 210 TYR TYR D . n 
D 1 210 VAL 210 211 211 VAL VAL D . n 
D 1 211 PHE 211 212 212 PHE PHE D . n 
D 1 212 HIS 212 213 213 HIS HIS D . n 
D 1 213 THR 213 214 214 THR THR D . n 
D 1 214 LYS 214 215 215 LYS LYS D . n 
D 1 215 PHE 215 216 216 PHE PHE D . n 
D 1 216 LEU 216 217 217 LEU LEU D . n 
D 1 217 MET 217 218 218 MET MET D . n 
D 1 218 GLU 218 219 219 GLU GLU D . n 
D 1 219 ALA 219 220 220 ALA ALA D . n 
D 1 220 LEU 220 221 221 LEU LEU D . n 
D 1 221 ARG 221 222 222 ARG ARG D . n 
D 1 222 ARG 222 223 223 ARG ARG D . n 
D 1 223 ASP 223 224 224 ASP ASP D . n 
D 1 224 ALA 224 225 225 ALA ALA D . n 
D 1 225 ALA 225 226 226 ALA ALA D . n 
D 1 226 ASP 226 227 227 ASP ASP D . n 
D 1 227 PRO 227 228 228 PRO PRO D . n 
D 1 228 THR 228 229 229 THR THR D . n 
D 1 229 SER 229 230 230 SER SER D . n 
D 1 230 SER 230 231 231 SER SER D . n 
D 1 231 ARG 231 232 232 ARG ARG D . n 
D 1 232 ASP 232 233 233 ASP ASP D . n 
D 1 233 PHE 233 234 234 PHE PHE D . n 
D 1 234 GLY 234 235 235 GLY GLY D . n 
D 1 235 LYS 235 236 236 LYS LYS D . n 
D 1 236 ASP 236 237 237 ASP ASP D . n 
D 1 237 ILE 237 238 238 ILE ILE D . n 
D 1 238 ILE 238 239 239 ILE ILE D . n 
D 1 239 PRO 239 240 240 PRO PRO D . n 
D 1 240 TYR 240 241 241 TYR TYR D . n 
D 1 241 ILE 241 242 242 ILE ILE D . n 
D 1 242 VAL 242 243 243 VAL VAL D . n 
D 1 243 GLU 243 244 244 GLU GLU D . n 
D 1 244 HIS 244 245 245 HIS HIS D . n 
D 1 245 GLY 245 246 246 GLY GLY D . n 
D 1 246 LYS 246 247 247 LYS LYS D . n 
D 1 247 ALA 247 248 248 ALA ALA D . n 
D 1 248 VAL 248 249 249 VAL VAL D . n 
D 1 249 ALA 249 250 250 ALA ALA D . n 
D 1 250 HIS 250 251 251 HIS HIS D . n 
D 1 251 ARG 251 252 252 ARG ARG D . n 
D 1 252 PHE 252 253 253 PHE PHE D . n 
D 1 253 ALA 253 254 254 ALA ALA D . n 
D 1 254 ASP 254 255 255 ASP ASP D . n 
D 1 255 SER 255 256 256 SER SER D . n 
D 1 256 CYS 256 257 257 CYS CYS D . n 
D 1 257 VAL 257 258 258 VAL VAL D . n 
D 1 258 ARG 258 259 259 ARG ARG D . n 
D 1 259 SER 259 260 260 SER SER D . n 
D 1 260 ASP 260 261 261 ASP ASP D . n 
D 1 261 PHE 261 262 262 PHE PHE D . n 
D 1 262 GLU 262 263 263 GLU GLU D . n 
D 1 263 HIS 263 264 264 HIS HIS D . n 
D 1 264 GLU 264 265 265 GLU GLU D . n 
D 1 265 PRO 265 266 266 PRO PRO D . n 
D 1 266 TYR 266 267 267 TYR TYR D . n 
D 1 267 TRP 267 268 268 TRP TRP D . n 
D 1 268 ARG 268 269 269 ARG ARG D . n 
D 1 269 ASP 269 270 270 ASP ASP D . n 
D 1 270 VAL 270 271 271 VAL VAL D . n 
D 1 271 GLY 271 272 272 GLY GLY D . n 
D 1 272 THR 272 273 273 THR THR D . n 
D 1 273 ILE 273 274 274 ILE ILE D . n 
D 1 274 ASP 274 275 275 ASP ASP D . n 
D 1 275 ALA 275 276 276 ALA ALA D . n 
D 1 276 TYR 276 277 277 TYR TYR D . n 
D 1 277 TRP 277 278 278 TRP TRP D . n 
D 1 278 GLN 278 279 279 GLN GLN D . n 
D 1 279 ALA 279 280 280 ALA ALA D . n 
D 1 280 ASN 280 281 281 ASN ASN D . n 
D 1 281 ILE 281 282 282 ILE ILE D . n 
D 1 282 ASP 282 283 283 ASP ASP D . n 
D 1 283 LEU 283 284 284 LEU LEU D . n 
D 1 284 THR 284 285 285 THR THR D . n 
D 1 285 ASP 285 286 286 ASP ASP D . n 
D 1 286 VAL 286 287 287 VAL VAL D . n 
D 1 287 VAL 287 288 288 VAL VAL D . n 
D 1 288 PRO 288 289 289 PRO PRO D . n 
D 1 289 ASP 289 290 290 ASP ASP D . n 
D 1 290 LEU 290 291 291 LEU LEU D . n 
D 1 291 ASP 291 292 292 ASP ASP D . n 
D 1 292 ILE 292 293 293 ILE ILE D . n 
D 1 293 TYR 293 294 294 TYR TYR D . n 
D 1 294 ASP 294 295 295 ASP ASP D . n 
D 1 295 LYS 295 296 296 LYS LYS D . n 
D 1 296 SER 296 297 297 SER SER D . n 
D 1 297 TRP 297 298 298 TRP TRP D . n 
D 1 298 PRO 298 299 299 PRO PRO D . n 
D 1 299 ILE 299 300 300 ILE ILE D . n 
D 1 300 TRP 300 301 301 TRP TRP D . n 
D 1 301 THR 301 302 302 THR THR D . n 
D 1 302 TYR 302 303 303 TYR TYR D . n 
D 1 303 ALA 303 304 304 ALA ALA D . n 
D 1 304 GLU 304 305 305 GLU GLU D . n 
D 1 305 ILE 305 306 306 ILE ILE D . n 
D 1 306 THR 306 307 307 THR THR D . n 
D 1 307 PRO 307 308 308 PRO PRO D . n 
D 1 308 PRO 308 309 309 PRO PRO D . n 
D 1 309 ALA 309 310 310 ALA ALA D . n 
D 1 310 LYS 310 311 311 LYS LYS D . n 
D 1 311 PHE 311 312 312 PHE PHE D . n 
D 1 312 VAL 312 313 313 VAL VAL D . n 
D 1 313 HIS 313 314 314 HIS HIS D . n 
D 1 314 ASP 314 315 315 ASP ASP D . n 
D 1 315 ASP 315 316 316 ASP ASP D . n 
D 1 316 GLU 316 317 317 GLU GLU D . n 
D 1 317 ASP 317 318 318 ASP ASP D . n 
D 1 318 ARG 318 319 319 ARG ARG D . n 
D 1 319 ARG 319 320 320 ARG ARG D . n 
D 1 320 GLY 320 321 321 GLY GLY D . n 
D 1 321 SER 321 322 322 SER SER D . n 
D 1 322 ALA 322 323 323 ALA ALA D . n 
D 1 323 VAL 323 324 324 VAL VAL D . n 
D 1 324 SER 324 325 325 SER SER D . n 
D 1 325 SER 325 326 326 SER SER D . n 
D 1 326 VAL 326 327 327 VAL VAL D . n 
D 1 327 VAL 327 328 328 VAL VAL D . n 
D 1 328 SER 328 329 329 SER SER D . n 
D 1 329 GLY 329 330 330 GLY GLY D . n 
D 1 330 ASP 330 331 331 ASP ASP D . n 
D 1 331 CYS 331 332 332 CYS CYS D . n 
D 1 332 ILE 332 333 333 ILE ILE D . n 
D 1 333 ILE 333 334 334 ILE ILE D . n 
D 1 334 SER 334 335 335 SER SER D . n 
D 1 335 GLY 335 336 336 GLY GLY D . n 
D 1 336 ALA 336 337 337 ALA ALA D . n 
D 1 337 ALA 337 338 338 ALA ALA D . n 
D 1 338 LEU 338 339 339 LEU LEU D . n 
D 1 339 ASN 339 340 340 ASN ASN D . n 
D 1 340 ARG 340 341 341 ARG ARG D . n 
D 1 341 SER 341 342 342 SER SER D . n 
D 1 342 LEU 342 343 343 LEU LEU D . n 
D 1 343 LEU 343 344 344 LEU LEU D . n 
D 1 344 PHE 344 345 345 PHE PHE D . n 
D 1 345 THR 345 346 346 THR THR D . n 
D 1 346 GLY 346 347 347 GLY GLY D . n 
D 1 347 VAL 347 348 348 VAL VAL D . n 
D 1 348 ARG 348 349 349 ARG ARG D . n 
D 1 349 ALA 349 350 350 ALA ALA D . n 
D 1 350 ASN 350 351 351 ASN ASN D . n 
D 1 351 SER 351 352 352 SER SER D . n 
D 1 352 TYR 352 353 353 TYR TYR D . n 
D 1 353 SER 353 354 354 SER SER D . n 
D 1 354 ARG 354 355 355 ARG ARG D . n 
D 1 355 LEU 355 356 356 LEU LEU D . n 
D 1 356 GLU 356 357 357 GLU GLU D . n 
D 1 357 ASN 357 358 358 ASN ASN D . n 
D 1 358 ALA 358 359 359 ALA ALA D . n 
D 1 359 VAL 359 360 360 VAL VAL D . n 
D 1 360 VAL 360 361 361 VAL VAL D . n 
D 1 361 LEU 361 362 362 LEU LEU D . n 
D 1 362 PRO 362 363 363 PRO PRO D . n 
D 1 363 SER 363 364 364 SER SER D . n 
D 1 364 VAL 364 365 365 VAL VAL D . n 
D 1 365 LYS 365 366 366 LYS LYS D . n 
D 1 366 ILE 366 367 367 ILE ILE D . n 
D 1 367 GLY 367 368 368 GLY GLY D . n 
D 1 368 ARG 368 369 369 ARG ARG D . n 
D 1 369 HIS 369 370 370 HIS HIS D . n 
D 1 370 ALA 370 371 371 ALA ALA D . n 
D 1 371 GLN 371 372 372 GLN GLN D . n 
D 1 372 LEU 372 373 373 LEU LEU D . n 
D 1 373 SER 373 374 374 SER SER D . n 
D 1 374 ASN 374 375 375 ASN ASN D . n 
D 1 375 VAL 375 376 376 VAL VAL D . n 
D 1 376 VAL 376 377 377 VAL VAL D . n 
D 1 377 ILE 377 378 378 ILE ILE D . n 
D 1 378 ASP 378 379 379 ASP ASP D . n 
D 1 379 HIS 379 380 380 HIS HIS D . n 
D 1 380 GLY 380 381 381 GLY GLY D . n 
D 1 381 VAL 381 382 382 VAL VAL D . n 
D 1 382 VAL 382 383 383 VAL VAL D . n 
D 1 383 ILE 383 384 384 ILE ILE D . n 
D 1 384 PRO 384 385 385 PRO PRO D . n 
D 1 385 GLU 385 386 386 GLU GLU D . n 
D 1 386 GLY 386 387 387 GLY GLY D . n 
D 1 387 LEU 387 388 388 LEU LEU D . n 
D 1 388 ILE 388 389 389 ILE ILE D . n 
D 1 389 VAL 389 390 390 VAL VAL D . n 
D 1 390 GLY 390 391 391 GLY GLY D . n 
D 1 391 GLU 391 392 392 GLU GLU D . n 
D 1 392 ASP 392 393 393 ASP ASP D . n 
D 1 393 PRO 393 394 394 PRO PRO D . n 
D 1 394 GLU 394 395 395 GLU GLU D . n 
D 1 395 LEU 395 396 396 LEU LEU D . n 
D 1 396 ASP 396 397 397 ASP ASP D . n 
D 1 397 ALA 397 398 398 ALA ALA D . n 
D 1 398 LYS 398 399 399 LYS LYS D . n 
D 1 399 ARG 399 400 400 ARG ARG D . n 
D 1 400 PHE 400 401 401 PHE PHE D . n 
D 1 401 ARG 401 402 402 ARG ARG D . n 
D 1 402 ARG 402 403 403 ARG ARG D . n 
D 1 403 THR 403 404 404 THR THR D . n 
D 1 404 GLU 404 405 405 GLU GLU D . n 
D 1 405 SER 405 406 406 SER SER D . n 
D 1 406 GLY 406 407 407 GLY GLY D . n 
D 1 407 ILE 407 408 408 ILE ILE D . n 
D 1 408 CYS 408 409 409 CYS CYS D . n 
D 1 409 LEU 409 410 410 LEU LEU D . n 
D 1 410 ILE 410 411 411 ILE ILE D . n 
D 1 411 THR 411 412 412 THR THR D . n 
D 1 412 GLN 412 413 413 GLN GLN D . n 
D 1 413 SER 413 414 414 SER SER D . n 
D 1 414 MET 414 415 415 MET MET D . n 
D 1 415 ILE 415 416 416 ILE ILE D . n 
D 1 416 ASP 416 417 417 ASP ASP D . n 
D 1 417 LYS 417 418 418 LYS LYS D . n 
D 1 418 LEU 418 419 419 LEU LEU D . n 
D 1 419 ASP 419 420 420 ASP ASP D . n 
D 1 420 LEU 420 421 421 LEU LEU D . n 
E 1 1   MET 1   2   ?   ?   ?   E . n 
E 1 2   SER 2   3   ?   ?   ?   E . n 
E 1 3   GLU 3   4   ?   ?   ?   E . n 
E 1 4   LYS 4   5   ?   ?   ?   E . n 
E 1 5   ARG 5   6   ?   ?   ?   E . n 
E 1 6   VAL 6   7   7   VAL VAL E . n 
E 1 7   GLN 7   8   8   GLN GLN E . n 
E 1 8   PRO 8   9   9   PRO PRO E . n 
E 1 9   LEU 9   10  10  LEU LEU E . n 
E 1 10  ALA 10  11  11  ALA ALA E . n 
E 1 11  ARG 11  12  12  ARG ARG E . n 
E 1 12  ASP 12  13  13  ASP ASP E . n 
E 1 13  ALA 13  14  14  ALA ALA E . n 
E 1 14  MET 14  15  15  MET MET E . n 
E 1 15  ALA 15  16  16  ALA ALA E . n 
E 1 16  TYR 16  17  17  TYR TYR E . n 
E 1 17  VAL 17  18  18  VAL VAL E . n 
E 1 18  LEU 18  19  19  LEU LEU E . n 
E 1 19  ALA 19  20  20  ALA ALA E . n 
E 1 20  GLY 20  21  21  GLY GLY E . n 
E 1 21  GLY 21  22  22  GLY GLY E . n 
E 1 22  ARG 22  23  23  ARG ARG E . n 
E 1 23  GLY 23  24  24  GLY GLY E . n 
E 1 24  SER 24  25  25  SER SER E . n 
E 1 25  ARG 25  26  26  ARG ARG E . n 
E 1 26  LEU 26  27  27  LEU LEU E . n 
E 1 27  LYS 27  28  28  LYS LYS E . n 
E 1 28  GLU 28  29  29  GLU GLU E . n 
E 1 29  LEU 29  30  30  LEU LEU E . n 
E 1 30  THR 30  31  31  THR THR E . n 
E 1 31  ASP 31  32  32  ASP ASP E . n 
E 1 32  ARG 32  33  33  ARG ARG E . n 
E 1 33  ARG 33  34  34  ARG ARG E . n 
E 1 34  ALA 34  35  35  ALA ALA E . n 
E 1 35  LYS 35  36  36  LYS LYS E . n 
E 1 36  PRO 36  37  37  PRO PRO E . n 
E 1 37  ALA 37  38  38  ALA ALA E . n 
E 1 38  VAL 38  39  39  VAL VAL E . n 
E 1 39  TYR 39  40  40  TYR TYR E . n 
E 1 40  PHE 40  41  41  PHE PHE E . n 
E 1 41  GLY 41  42  42  GLY GLY E . n 
E 1 42  GLY 42  43  43  GLY GLY E . n 
E 1 43  LYS 43  44  44  LYS LYS E . n 
E 1 44  ALA 44  45  45  ALA ALA E . n 
E 1 45  ARG 45  46  46  ARG ARG E . n 
E 1 46  ILE 46  47  47  ILE ILE E . n 
E 1 47  ILE 47  48  48  ILE ILE E . n 
E 1 48  ASP 48  49  49  ASP ASP E . n 
E 1 49  PHE 49  50  50  PHE PHE E . n 
E 1 50  ALA 50  51  51  ALA ALA E . n 
E 1 51  LEU 51  52  52  LEU LEU E . n 
E 1 52  SER 52  53  53  SER SER E . n 
E 1 53  ASN 53  54  54  ASN ASN E . n 
E 1 54  ALA 54  55  55  ALA ALA E . n 
E 1 55  LEU 55  56  56  LEU LEU E . n 
E 1 56  ASN 56  57  57  ASN ASN E . n 
E 1 57  SER 57  58  58  SER SER E . n 
E 1 58  GLY 58  59  59  GLY GLY E . n 
E 1 59  ILE 59  60  60  ILE ILE E . n 
E 1 60  ARG 60  61  61  ARG ARG E . n 
E 1 61  ARG 61  62  62  ARG ARG E . n 
E 1 62  ILE 62  63  63  ILE ILE E . n 
E 1 63  GLY 63  64  64  GLY GLY E . n 
E 1 64  VAL 64  65  65  VAL VAL E . n 
E 1 65  ALA 65  66  66  ALA ALA E . n 
E 1 66  THR 66  67  67  THR THR E . n 
E 1 67  GLN 67  68  68  GLN GLN E . n 
E 1 68  TYR 68  69  69  TYR TYR E . n 
E 1 69  LYS 69  70  70  LYS LYS E . n 
E 1 70  ALA 70  71  71  ALA ALA E . n 
E 1 71  HIS 71  72  72  HIS HIS E . n 
E 1 72  SER 72  73  73  SER SER E . n 
E 1 73  LEU 73  74  74  LEU LEU E . n 
E 1 74  ILE 74  75  75  ILE ILE E . n 
E 1 75  ARG 75  76  76  ARG ARG E . n 
E 1 76  HIS 76  77  77  HIS HIS E . n 
E 1 77  LEU 77  78  78  LEU LEU E . n 
E 1 78  GLN 78  79  79  GLN GLN E . n 
E 1 79  ARG 79  80  80  ARG ARG E . n 
E 1 80  GLY 80  81  81  GLY GLY E . n 
E 1 81  TRP 81  82  82  TRP TRP E . n 
E 1 82  ASP 82  83  83  ASP ASP E . n 
E 1 83  PHE 83  84  84  PHE PHE E . n 
E 1 84  PHE 84  85  85  PHE PHE E . n 
E 1 85  ARG 85  86  86  ARG ARG E . n 
E 1 86  PRO 86  87  87  PRO PRO E . n 
E 1 87  GLU 87  88  88  GLU GLU E . n 
E 1 88  ARG 88  89  89  ARG ARG E . n 
E 1 89  ASN 89  90  90  ASN ASN E . n 
E 1 90  GLU 90  91  91  GLU GLU E . n 
E 1 91  SER 91  92  92  SER SER E . n 
E 1 92  PHE 92  93  93  PHE PHE E . n 
E 1 93  ASP 93  94  94  ASP ASP E . n 
E 1 94  ILE 94  95  95  ILE ILE E . n 
E 1 95  LEU 95  96  96  LEU LEU E . n 
E 1 96  PRO 96  97  97  PRO PRO E . n 
E 1 97  ALA 97  98  98  ALA ALA E . n 
E 1 98  SER 98  99  ?   ?   ?   E . n 
E 1 99  GLN 99  100 ?   ?   ?   E . n 
E 1 100 ARG 100 101 ?   ?   ?   E . n 
E 1 101 VAL 101 102 ?   ?   ?   E . n 
E 1 102 SER 102 103 ?   ?   ?   E . n 
E 1 103 GLU 103 104 ?   ?   ?   E . n 
E 1 104 THR 104 105 105 THR THR E . n 
E 1 105 GLN 105 106 106 GLN GLN E . n 
E 1 106 TRP 106 107 107 TRP TRP E . n 
E 1 107 TYR 107 108 108 TYR TYR E . n 
E 1 108 GLU 108 109 109 GLU GLU E . n 
E 1 109 GLY 109 110 110 GLY GLY E . n 
E 1 110 THR 110 111 111 THR THR E . n 
E 1 111 ALA 111 112 112 ALA ALA E . n 
E 1 112 ASP 112 113 113 ASP ASP E . n 
E 1 113 ALA 113 114 114 ALA ALA E . n 
E 1 114 VAL 114 115 115 VAL VAL E . n 
E 1 115 TYR 115 116 116 TYR TYR E . n 
E 1 116 GLN 116 117 117 GLN GLN E . n 
E 1 117 ASN 117 118 118 ASN ASN E . n 
E 1 118 ILE 118 119 119 ILE ILE E . n 
E 1 119 ASP 119 120 120 ASP ASP E . n 
E 1 120 ILE 120 121 121 ILE ILE E . n 
E 1 121 ILE 121 122 122 ILE ILE E . n 
E 1 122 GLU 122 123 123 GLU GLU E . n 
E 1 123 PRO 123 124 124 PRO PRO E . n 
E 1 124 TYR 124 125 125 TYR TYR E . n 
E 1 125 ALA 125 126 126 ALA ALA E . n 
E 1 126 PRO 126 127 127 PRO PRO E . n 
E 1 127 GLU 127 128 128 GLU GLU E . n 
E 1 128 TYR 128 129 129 TYR TYR E . n 
E 1 129 MET 129 130 130 MET MET E . n 
E 1 130 VAL 130 131 131 VAL VAL E . n 
E 1 131 ILE 131 132 132 ILE ILE E . n 
E 1 132 LEU 132 133 133 LEU LEU E . n 
E 1 133 ALA 133 134 134 ALA ALA E . n 
E 1 134 GLY 134 135 135 GLY GLY E . n 
E 1 135 ASP 135 136 136 ASP ASP E . n 
E 1 136 HIS 136 137 137 HIS HIS E . n 
E 1 137 ILE 137 138 138 ILE ILE E . n 
E 1 138 TYR 138 139 139 TYR TYR E . n 
E 1 139 LYS 139 140 140 LYS LYS E . n 
E 1 140 MET 140 141 141 MET MET E . n 
E 1 141 ASP 141 142 142 ASP ASP E . n 
E 1 142 TYR 142 143 143 TYR TYR E . n 
E 1 143 GLU 143 144 144 GLU GLU E . n 
E 1 144 TYR 144 145 145 TYR TYR E . n 
E 1 145 MET 145 146 146 MET MET E . n 
E 1 146 LEU 146 147 147 LEU LEU E . n 
E 1 147 GLN 147 148 148 GLN GLN E . n 
E 1 148 GLN 148 149 149 GLN GLN E . n 
E 1 149 HIS 149 150 150 HIS HIS E . n 
E 1 150 VAL 150 151 151 VAL VAL E . n 
E 1 151 ASP 151 152 152 ASP ASP E . n 
E 1 152 SER 152 153 153 SER SER E . n 
E 1 153 GLY 153 154 154 GLY GLY E . n 
E 1 154 ALA 154 155 155 ALA ALA E . n 
E 1 155 ASP 155 156 156 ASP ASP E . n 
E 1 156 VAL 156 157 157 VAL VAL E . n 
E 1 157 THR 157 158 158 THR THR E . n 
E 1 158 ILE 158 159 159 ILE ILE E . n 
E 1 159 GLY 159 160 160 GLY GLY E . n 
E 1 160 CYS 160 161 161 CYS CYS E . n 
E 1 161 LEU 161 162 162 LEU LEU E . n 
E 1 162 GLU 162 163 163 GLU GLU E . n 
E 1 163 VAL 163 164 164 VAL VAL E . n 
E 1 164 PRO 164 165 165 PRO PRO E . n 
E 1 165 ARG 165 166 166 ARG ARG E . n 
E 1 166 MET 166 167 167 MET MET E . n 
E 1 167 GLU 167 168 168 GLU GLU E . n 
E 1 168 ALA 168 169 169 ALA ALA E . n 
E 1 169 THR 169 170 170 THR THR E . n 
E 1 170 GLY 170 171 171 GLY GLY E . n 
E 1 171 PHE 171 172 172 PHE PHE E . n 
E 1 172 GLY 172 173 173 GLY GLY E . n 
E 1 173 VAL 173 174 174 VAL VAL E . n 
E 1 174 MET 174 175 175 MET MET E . n 
E 1 175 HIS 175 176 176 HIS HIS E . n 
E 1 176 VAL 176 177 177 VAL VAL E . n 
E 1 177 ASN 177 178 178 ASN ASN E . n 
E 1 178 GLU 178 179 179 GLU GLU E . n 
E 1 179 LYS 179 180 180 LYS LYS E . n 
E 1 180 ASP 180 181 181 ASP ASP E . n 
E 1 181 GLU 181 182 182 GLU GLU E . n 
E 1 182 ILE 182 183 183 ILE ILE E . n 
E 1 183 ILE 183 184 184 ILE ILE E . n 
E 1 184 ASP 184 185 185 ASP ASP E . n 
E 1 185 PHE 185 186 186 PHE PHE E . n 
E 1 186 ILE 186 187 187 ILE ILE E . n 
E 1 187 GLU 187 188 188 GLU GLU E . n 
E 1 188 LYS 188 189 189 LYS LYS E . n 
E 1 189 PRO 189 190 190 PRO PRO E . n 
E 1 190 ALA 190 191 191 ALA ALA E . n 
E 1 191 ASP 191 192 192 ASP ASP E . n 
E 1 192 PRO 192 193 193 PRO PRO E . n 
E 1 193 PRO 193 194 194 PRO PRO E . n 
E 1 194 GLY 194 195 195 GLY GLY E . n 
E 1 195 ILE 195 196 196 ILE ILE E . n 
E 1 196 PRO 196 197 197 PRO PRO E . n 
E 1 197 GLY 197 198 198 GLY GLY E . n 
E 1 198 ASN 198 199 199 ASN ASN E . n 
E 1 199 GLU 199 200 200 GLU GLU E . n 
E 1 200 GLY 200 201 201 GLY GLY E . n 
E 1 201 PHE 201 202 202 PHE PHE E . n 
E 1 202 ALA 202 203 203 ALA ALA E . n 
E 1 203 LEU 203 204 204 LEU LEU E . n 
E 1 204 ALA 204 205 205 ALA ALA E . n 
E 1 205 SER 205 206 206 SER SER E . n 
E 1 206 MET 206 207 207 MET MET E . n 
E 1 207 GLY 207 208 208 GLY GLY E . n 
E 1 208 ILE 208 209 209 ILE ILE E . n 
E 1 209 TYR 209 210 210 TYR TYR E . n 
E 1 210 VAL 210 211 211 VAL VAL E . n 
E 1 211 PHE 211 212 212 PHE PHE E . n 
E 1 212 HIS 212 213 213 HIS HIS E . n 
E 1 213 THR 213 214 214 THR THR E . n 
E 1 214 LYS 214 215 215 LYS LYS E . n 
E 1 215 PHE 215 216 216 PHE PHE E . n 
E 1 216 LEU 216 217 217 LEU LEU E . n 
E 1 217 MET 217 218 218 MET MET E . n 
E 1 218 GLU 218 219 219 GLU GLU E . n 
E 1 219 ALA 219 220 220 ALA ALA E . n 
E 1 220 LEU 220 221 221 LEU LEU E . n 
E 1 221 ARG 221 222 222 ARG ARG E . n 
E 1 222 ARG 222 223 223 ARG ARG E . n 
E 1 223 ASP 223 224 224 ASP ASP E . n 
E 1 224 ALA 224 225 225 ALA ALA E . n 
E 1 225 ALA 225 226 226 ALA ALA E . n 
E 1 226 ASP 226 227 227 ASP ASP E . n 
E 1 227 PRO 227 228 228 PRO PRO E . n 
E 1 228 THR 228 229 229 THR THR E . n 
E 1 229 SER 229 230 230 SER SER E . n 
E 1 230 SER 230 231 231 SER SER E . n 
E 1 231 ARG 231 232 232 ARG ARG E . n 
E 1 232 ASP 232 233 233 ASP ASP E . n 
E 1 233 PHE 233 234 234 PHE PHE E . n 
E 1 234 GLY 234 235 235 GLY GLY E . n 
E 1 235 LYS 235 236 236 LYS LYS E . n 
E 1 236 ASP 236 237 237 ASP ASP E . n 
E 1 237 ILE 237 238 238 ILE ILE E . n 
E 1 238 ILE 238 239 239 ILE ILE E . n 
E 1 239 PRO 239 240 240 PRO PRO E . n 
E 1 240 TYR 240 241 241 TYR TYR E . n 
E 1 241 ILE 241 242 242 ILE ILE E . n 
E 1 242 VAL 242 243 243 VAL VAL E . n 
E 1 243 GLU 243 244 244 GLU GLU E . n 
E 1 244 HIS 244 245 245 HIS HIS E . n 
E 1 245 GLY 245 246 246 GLY GLY E . n 
E 1 246 LYS 246 247 247 LYS LYS E . n 
E 1 247 ALA 247 248 248 ALA ALA E . n 
E 1 248 VAL 248 249 249 VAL VAL E . n 
E 1 249 ALA 249 250 250 ALA ALA E . n 
E 1 250 HIS 250 251 251 HIS HIS E . n 
E 1 251 ARG 251 252 252 ARG ARG E . n 
E 1 252 PHE 252 253 253 PHE PHE E . n 
E 1 253 ALA 253 254 254 ALA ALA E . n 
E 1 254 ASP 254 255 255 ASP ASP E . n 
E 1 255 SER 255 256 256 SER SER E . n 
E 1 256 CYS 256 257 257 CYS CYS E . n 
E 1 257 VAL 257 258 258 VAL VAL E . n 
E 1 258 ARG 258 259 259 ARG ARG E . n 
E 1 259 SER 259 260 260 SER SER E . n 
E 1 260 ASP 260 261 261 ASP ASP E . n 
E 1 261 PHE 261 262 262 PHE PHE E . n 
E 1 262 GLU 262 263 263 GLU GLU E . n 
E 1 263 HIS 263 264 264 HIS HIS E . n 
E 1 264 GLU 264 265 265 GLU GLU E . n 
E 1 265 PRO 265 266 266 PRO PRO E . n 
E 1 266 TYR 266 267 267 TYR TYR E . n 
E 1 267 TRP 267 268 268 TRP TRP E . n 
E 1 268 ARG 268 269 269 ARG ARG E . n 
E 1 269 ASP 269 270 270 ASP ASP E . n 
E 1 270 VAL 270 271 271 VAL VAL E . n 
E 1 271 GLY 271 272 272 GLY GLY E . n 
E 1 272 THR 272 273 273 THR THR E . n 
E 1 273 ILE 273 274 274 ILE ILE E . n 
E 1 274 ASP 274 275 275 ASP ASP E . n 
E 1 275 ALA 275 276 276 ALA ALA E . n 
E 1 276 TYR 276 277 277 TYR TYR E . n 
E 1 277 TRP 277 278 278 TRP TRP E . n 
E 1 278 GLN 278 279 279 GLN GLN E . n 
E 1 279 ALA 279 280 280 ALA ALA E . n 
E 1 280 ASN 280 281 281 ASN ASN E . n 
E 1 281 ILE 281 282 282 ILE ILE E . n 
E 1 282 ASP 282 283 283 ASP ASP E . n 
E 1 283 LEU 283 284 284 LEU LEU E . n 
E 1 284 THR 284 285 285 THR THR E . n 
E 1 285 ASP 285 286 286 ASP ASP E . n 
E 1 286 VAL 286 287 287 VAL VAL E . n 
E 1 287 VAL 287 288 288 VAL VAL E . n 
E 1 288 PRO 288 289 289 PRO PRO E . n 
E 1 289 ASP 289 290 290 ASP ASP E . n 
E 1 290 LEU 290 291 291 LEU LEU E . n 
E 1 291 ASP 291 292 292 ASP ASP E . n 
E 1 292 ILE 292 293 293 ILE ILE E . n 
E 1 293 TYR 293 294 294 TYR TYR E . n 
E 1 294 ASP 294 295 295 ASP ASP E . n 
E 1 295 LYS 295 296 296 LYS LYS E . n 
E 1 296 SER 296 297 297 SER SER E . n 
E 1 297 TRP 297 298 298 TRP TRP E . n 
E 1 298 PRO 298 299 299 PRO PRO E . n 
E 1 299 ILE 299 300 300 ILE ILE E . n 
E 1 300 TRP 300 301 301 TRP TRP E . n 
E 1 301 THR 301 302 302 THR THR E . n 
E 1 302 TYR 302 303 303 TYR TYR E . n 
E 1 303 ALA 303 304 304 ALA ALA E . n 
E 1 304 GLU 304 305 305 GLU GLU E . n 
E 1 305 ILE 305 306 306 ILE ILE E . n 
E 1 306 THR 306 307 307 THR THR E . n 
E 1 307 PRO 307 308 308 PRO PRO E . n 
E 1 308 PRO 308 309 309 PRO PRO E . n 
E 1 309 ALA 309 310 310 ALA ALA E . n 
E 1 310 LYS 310 311 311 LYS LYS E . n 
E 1 311 PHE 311 312 312 PHE PHE E . n 
E 1 312 VAL 312 313 313 VAL VAL E . n 
E 1 313 HIS 313 314 314 HIS HIS E . n 
E 1 314 ASP 314 315 315 ASP ASP E . n 
E 1 315 ASP 315 316 316 ASP ASP E . n 
E 1 316 GLU 316 317 317 GLU GLU E . n 
E 1 317 ASP 317 318 318 ASP ASP E . n 
E 1 318 ARG 318 319 319 ARG ARG E . n 
E 1 319 ARG 319 320 320 ARG ARG E . n 
E 1 320 GLY 320 321 321 GLY GLY E . n 
E 1 321 SER 321 322 322 SER SER E . n 
E 1 322 ALA 322 323 323 ALA ALA E . n 
E 1 323 VAL 323 324 324 VAL VAL E . n 
E 1 324 SER 324 325 325 SER SER E . n 
E 1 325 SER 325 326 326 SER SER E . n 
E 1 326 VAL 326 327 327 VAL VAL E . n 
E 1 327 VAL 327 328 328 VAL VAL E . n 
E 1 328 SER 328 329 329 SER SER E . n 
E 1 329 GLY 329 330 330 GLY GLY E . n 
E 1 330 ASP 330 331 331 ASP ASP E . n 
E 1 331 CYS 331 332 332 CYS CYS E . n 
E 1 332 ILE 332 333 333 ILE ILE E . n 
E 1 333 ILE 333 334 334 ILE ILE E . n 
E 1 334 SER 334 335 335 SER SER E . n 
E 1 335 GLY 335 336 336 GLY GLY E . n 
E 1 336 ALA 336 337 337 ALA ALA E . n 
E 1 337 ALA 337 338 338 ALA ALA E . n 
E 1 338 LEU 338 339 339 LEU LEU E . n 
E 1 339 ASN 339 340 340 ASN ASN E . n 
E 1 340 ARG 340 341 341 ARG ARG E . n 
E 1 341 SER 341 342 342 SER SER E . n 
E 1 342 LEU 342 343 343 LEU LEU E . n 
E 1 343 LEU 343 344 344 LEU LEU E . n 
E 1 344 PHE 344 345 345 PHE PHE E . n 
E 1 345 THR 345 346 346 THR THR E . n 
E 1 346 GLY 346 347 347 GLY GLY E . n 
E 1 347 VAL 347 348 348 VAL VAL E . n 
E 1 348 ARG 348 349 349 ARG ARG E . n 
E 1 349 ALA 349 350 350 ALA ALA E . n 
E 1 350 ASN 350 351 351 ASN ASN E . n 
E 1 351 SER 351 352 352 SER SER E . n 
E 1 352 TYR 352 353 353 TYR TYR E . n 
E 1 353 SER 353 354 354 SER SER E . n 
E 1 354 ARG 354 355 355 ARG ARG E . n 
E 1 355 LEU 355 356 356 LEU LEU E . n 
E 1 356 GLU 356 357 357 GLU GLU E . n 
E 1 357 ASN 357 358 358 ASN ASN E . n 
E 1 358 ALA 358 359 359 ALA ALA E . n 
E 1 359 VAL 359 360 360 VAL VAL E . n 
E 1 360 VAL 360 361 361 VAL VAL E . n 
E 1 361 LEU 361 362 362 LEU LEU E . n 
E 1 362 PRO 362 363 363 PRO PRO E . n 
E 1 363 SER 363 364 364 SER SER E . n 
E 1 364 VAL 364 365 365 VAL VAL E . n 
E 1 365 LYS 365 366 366 LYS LYS E . n 
E 1 366 ILE 366 367 367 ILE ILE E . n 
E 1 367 GLY 367 368 368 GLY GLY E . n 
E 1 368 ARG 368 369 369 ARG ARG E . n 
E 1 369 HIS 369 370 370 HIS HIS E . n 
E 1 370 ALA 370 371 371 ALA ALA E . n 
E 1 371 GLN 371 372 372 GLN GLN E . n 
E 1 372 LEU 372 373 373 LEU LEU E . n 
E 1 373 SER 373 374 374 SER SER E . n 
E 1 374 ASN 374 375 375 ASN ASN E . n 
E 1 375 VAL 375 376 376 VAL VAL E . n 
E 1 376 VAL 376 377 377 VAL VAL E . n 
E 1 377 ILE 377 378 378 ILE ILE E . n 
E 1 378 ASP 378 379 379 ASP ASP E . n 
E 1 379 HIS 379 380 380 HIS HIS E . n 
E 1 380 GLY 380 381 381 GLY GLY E . n 
E 1 381 VAL 381 382 382 VAL VAL E . n 
E 1 382 VAL 382 383 383 VAL VAL E . n 
E 1 383 ILE 383 384 384 ILE ILE E . n 
E 1 384 PRO 384 385 385 PRO PRO E . n 
E 1 385 GLU 385 386 386 GLU GLU E . n 
E 1 386 GLY 386 387 387 GLY GLY E . n 
E 1 387 LEU 387 388 388 LEU LEU E . n 
E 1 388 ILE 388 389 389 ILE ILE E . n 
E 1 389 VAL 389 390 390 VAL VAL E . n 
E 1 390 GLY 390 391 391 GLY GLY E . n 
E 1 391 GLU 391 392 392 GLU GLU E . n 
E 1 392 ASP 392 393 393 ASP ASP E . n 
E 1 393 PRO 393 394 394 PRO PRO E . n 
E 1 394 GLU 394 395 395 GLU GLU E . n 
E 1 395 LEU 395 396 396 LEU LEU E . n 
E 1 396 ASP 396 397 397 ASP ASP E . n 
E 1 397 ALA 397 398 398 ALA ALA E . n 
E 1 398 LYS 398 399 399 LYS LYS E . n 
E 1 399 ARG 399 400 400 ARG ARG E . n 
E 1 400 PHE 400 401 401 PHE PHE E . n 
E 1 401 ARG 401 402 402 ARG ARG E . n 
E 1 402 ARG 402 403 403 ARG ARG E . n 
E 1 403 THR 403 404 404 THR THR E . n 
E 1 404 GLU 404 405 405 GLU GLU E . n 
E 1 405 SER 405 406 406 SER SER E . n 
E 1 406 GLY 406 407 407 GLY GLY E . n 
E 1 407 ILE 407 408 408 ILE ILE E . n 
E 1 408 CYS 408 409 409 CYS CYS E . n 
E 1 409 LEU 409 410 410 LEU LEU E . n 
E 1 410 ILE 410 411 411 ILE ILE E . n 
E 1 411 THR 411 412 412 THR THR E . n 
E 1 412 GLN 412 413 413 GLN GLN E . n 
E 1 413 SER 413 414 414 SER SER E . n 
E 1 414 MET 414 415 415 MET MET E . n 
E 1 415 ILE 415 416 416 ILE ILE E . n 
E 1 416 ASP 416 417 417 ASP ASP E . n 
E 1 417 LYS 417 418 418 LYS LYS E . n 
E 1 418 LEU 418 419 419 LEU LEU E . n 
E 1 419 ASP 419 420 420 ASP ASP E . n 
E 1 420 LEU 420 421 421 LEU LEU E . n 
F 1 1   MET 1   2   ?   ?   ?   H . n 
F 1 2   SER 2   3   ?   ?   ?   H . n 
F 1 3   GLU 3   4   ?   ?   ?   H . n 
F 1 4   LYS 4   5   ?   ?   ?   H . n 
F 1 5   ARG 5   6   ?   ?   ?   H . n 
F 1 6   VAL 6   7   7   VAL VAL H . n 
F 1 7   GLN 7   8   8   GLN GLN H . n 
F 1 8   PRO 8   9   9   PRO PRO H . n 
F 1 9   LEU 9   10  10  LEU LEU H . n 
F 1 10  ALA 10  11  11  ALA ALA H . n 
F 1 11  ARG 11  12  12  ARG ARG H . n 
F 1 12  ASP 12  13  13  ASP ASP H . n 
F 1 13  ALA 13  14  14  ALA ALA H . n 
F 1 14  MET 14  15  15  MET MET H . n 
F 1 15  ALA 15  16  16  ALA ALA H . n 
F 1 16  TYR 16  17  17  TYR TYR H . n 
F 1 17  VAL 17  18  18  VAL VAL H . n 
F 1 18  LEU 18  19  19  LEU LEU H . n 
F 1 19  ALA 19  20  20  ALA ALA H . n 
F 1 20  GLY 20  21  21  GLY GLY H . n 
F 1 21  GLY 21  22  22  GLY GLY H . n 
F 1 22  ARG 22  23  23  ARG ARG H . n 
F 1 23  GLY 23  24  24  GLY GLY H . n 
F 1 24  SER 24  25  25  SER SER H . n 
F 1 25  ARG 25  26  26  ARG ARG H . n 
F 1 26  LEU 26  27  27  LEU LEU H . n 
F 1 27  LYS 27  28  28  LYS LYS H . n 
F 1 28  GLU 28  29  29  GLU GLU H . n 
F 1 29  LEU 29  30  30  LEU LEU H . n 
F 1 30  THR 30  31  31  THR THR H . n 
F 1 31  ASP 31  32  32  ASP ASP H . n 
F 1 32  ARG 32  33  33  ARG ARG H . n 
F 1 33  ARG 33  34  34  ARG ARG H . n 
F 1 34  ALA 34  35  35  ALA ALA H . n 
F 1 35  LYS 35  36  36  LYS LYS H . n 
F 1 36  PRO 36  37  37  PRO PRO H . n 
F 1 37  ALA 37  38  38  ALA ALA H . n 
F 1 38  VAL 38  39  39  VAL VAL H . n 
F 1 39  TYR 39  40  40  TYR TYR H . n 
F 1 40  PHE 40  41  41  PHE PHE H . n 
F 1 41  GLY 41  42  42  GLY GLY H . n 
F 1 42  GLY 42  43  43  GLY GLY H . n 
F 1 43  LYS 43  44  44  LYS LYS H . n 
F 1 44  ALA 44  45  45  ALA ALA H . n 
F 1 45  ARG 45  46  46  ARG ARG H . n 
F 1 46  ILE 46  47  47  ILE ILE H . n 
F 1 47  ILE 47  48  48  ILE ILE H . n 
F 1 48  ASP 48  49  49  ASP ASP H . n 
F 1 49  PHE 49  50  50  PHE PHE H . n 
F 1 50  ALA 50  51  51  ALA ALA H . n 
F 1 51  LEU 51  52  52  LEU LEU H . n 
F 1 52  SER 52  53  53  SER SER H . n 
F 1 53  ASN 53  54  54  ASN ASN H . n 
F 1 54  ALA 54  55  55  ALA ALA H . n 
F 1 55  LEU 55  56  56  LEU LEU H . n 
F 1 56  ASN 56  57  57  ASN ASN H . n 
F 1 57  SER 57  58  58  SER SER H . n 
F 1 58  GLY 58  59  59  GLY GLY H . n 
F 1 59  ILE 59  60  60  ILE ILE H . n 
F 1 60  ARG 60  61  61  ARG ARG H . n 
F 1 61  ARG 61  62  62  ARG ARG H . n 
F 1 62  ILE 62  63  63  ILE ILE H . n 
F 1 63  GLY 63  64  64  GLY GLY H . n 
F 1 64  VAL 64  65  65  VAL VAL H . n 
F 1 65  ALA 65  66  66  ALA ALA H . n 
F 1 66  THR 66  67  67  THR THR H . n 
F 1 67  GLN 67  68  68  GLN GLN H . n 
F 1 68  TYR 68  69  69  TYR TYR H . n 
F 1 69  LYS 69  70  70  LYS LYS H . n 
F 1 70  ALA 70  71  71  ALA ALA H . n 
F 1 71  HIS 71  72  72  HIS HIS H . n 
F 1 72  SER 72  73  73  SER SER H . n 
F 1 73  LEU 73  74  74  LEU LEU H . n 
F 1 74  ILE 74  75  75  ILE ILE H . n 
F 1 75  ARG 75  76  76  ARG ARG H . n 
F 1 76  HIS 76  77  77  HIS HIS H . n 
F 1 77  LEU 77  78  78  LEU LEU H . n 
F 1 78  GLN 78  79  79  GLN GLN H . n 
F 1 79  ARG 79  80  80  ARG ARG H . n 
F 1 80  GLY 80  81  81  GLY GLY H . n 
F 1 81  TRP 81  82  82  TRP TRP H . n 
F 1 82  ASP 82  83  83  ASP ASP H . n 
F 1 83  PHE 83  84  84  PHE PHE H . n 
F 1 84  PHE 84  85  85  PHE PHE H . n 
F 1 85  ARG 85  86  86  ARG ARG H . n 
F 1 86  PRO 86  87  87  PRO PRO H . n 
F 1 87  GLU 87  88  88  GLU GLU H . n 
F 1 88  ARG 88  89  89  ARG ARG H . n 
F 1 89  ASN 89  90  90  ASN ASN H . n 
F 1 90  GLU 90  91  91  GLU GLU H . n 
F 1 91  SER 91  92  92  SER SER H . n 
F 1 92  PHE 92  93  93  PHE PHE H . n 
F 1 93  ASP 93  94  94  ASP ASP H . n 
F 1 94  ILE 94  95  95  ILE ILE H . n 
F 1 95  LEU 95  96  96  LEU LEU H . n 
F 1 96  PRO 96  97  97  PRO PRO H . n 
F 1 97  ALA 97  98  98  ALA ALA H . n 
F 1 98  SER 98  99  ?   ?   ?   H . n 
F 1 99  GLN 99  100 ?   ?   ?   H . n 
F 1 100 ARG 100 101 ?   ?   ?   H . n 
F 1 101 VAL 101 102 ?   ?   ?   H . n 
F 1 102 SER 102 103 ?   ?   ?   H . n 
F 1 103 GLU 103 104 ?   ?   ?   H . n 
F 1 104 THR 104 105 105 THR THR H . n 
F 1 105 GLN 105 106 106 GLN GLN H . n 
F 1 106 TRP 106 107 107 TRP TRP H . n 
F 1 107 TYR 107 108 108 TYR TYR H . n 
F 1 108 GLU 108 109 109 GLU GLU H . n 
F 1 109 GLY 109 110 110 GLY GLY H . n 
F 1 110 THR 110 111 111 THR THR H . n 
F 1 111 ALA 111 112 112 ALA ALA H . n 
F 1 112 ASP 112 113 113 ASP ASP H . n 
F 1 113 ALA 113 114 114 ALA ALA H . n 
F 1 114 VAL 114 115 115 VAL VAL H . n 
F 1 115 TYR 115 116 116 TYR TYR H . n 
F 1 116 GLN 116 117 117 GLN GLN H . n 
F 1 117 ASN 117 118 118 ASN ASN H . n 
F 1 118 ILE 118 119 119 ILE ILE H . n 
F 1 119 ASP 119 120 120 ASP ASP H . n 
F 1 120 ILE 120 121 121 ILE ILE H . n 
F 1 121 ILE 121 122 122 ILE ILE H . n 
F 1 122 GLU 122 123 123 GLU GLU H . n 
F 1 123 PRO 123 124 124 PRO PRO H . n 
F 1 124 TYR 124 125 125 TYR TYR H . n 
F 1 125 ALA 125 126 126 ALA ALA H . n 
F 1 126 PRO 126 127 127 PRO PRO H . n 
F 1 127 GLU 127 128 128 GLU GLU H . n 
F 1 128 TYR 128 129 129 TYR TYR H . n 
F 1 129 MET 129 130 130 MET MET H . n 
F 1 130 VAL 130 131 131 VAL VAL H . n 
F 1 131 ILE 131 132 132 ILE ILE H . n 
F 1 132 LEU 132 133 133 LEU LEU H . n 
F 1 133 ALA 133 134 134 ALA ALA H . n 
F 1 134 GLY 134 135 135 GLY GLY H . n 
F 1 135 ASP 135 136 136 ASP ASP H . n 
F 1 136 HIS 136 137 137 HIS HIS H . n 
F 1 137 ILE 137 138 138 ILE ILE H . n 
F 1 138 TYR 138 139 139 TYR TYR H . n 
F 1 139 LYS 139 140 140 LYS LYS H . n 
F 1 140 MET 140 141 141 MET MET H . n 
F 1 141 ASP 141 142 142 ASP ASP H . n 
F 1 142 TYR 142 143 143 TYR TYR H . n 
F 1 143 GLU 143 144 144 GLU GLU H . n 
F 1 144 TYR 144 145 145 TYR TYR H . n 
F 1 145 MET 145 146 146 MET MET H . n 
F 1 146 LEU 146 147 147 LEU LEU H . n 
F 1 147 GLN 147 148 148 GLN GLN H . n 
F 1 148 GLN 148 149 149 GLN GLN H . n 
F 1 149 HIS 149 150 150 HIS HIS H . n 
F 1 150 VAL 150 151 151 VAL VAL H . n 
F 1 151 ASP 151 152 152 ASP ASP H . n 
F 1 152 SER 152 153 153 SER SER H . n 
F 1 153 GLY 153 154 154 GLY GLY H . n 
F 1 154 ALA 154 155 155 ALA ALA H . n 
F 1 155 ASP 155 156 156 ASP ASP H . n 
F 1 156 VAL 156 157 157 VAL VAL H . n 
F 1 157 THR 157 158 158 THR THR H . n 
F 1 158 ILE 158 159 159 ILE ILE H . n 
F 1 159 GLY 159 160 160 GLY GLY H . n 
F 1 160 CYS 160 161 161 CYS CYS H . n 
F 1 161 LEU 161 162 162 LEU LEU H . n 
F 1 162 GLU 162 163 163 GLU GLU H . n 
F 1 163 VAL 163 164 164 VAL VAL H . n 
F 1 164 PRO 164 165 165 PRO PRO H . n 
F 1 165 ARG 165 166 166 ARG ARG H . n 
F 1 166 MET 166 167 167 MET MET H . n 
F 1 167 GLU 167 168 168 GLU GLU H . n 
F 1 168 ALA 168 169 169 ALA ALA H . n 
F 1 169 THR 169 170 170 THR THR H . n 
F 1 170 GLY 170 171 171 GLY GLY H . n 
F 1 171 PHE 171 172 172 PHE PHE H . n 
F 1 172 GLY 172 173 173 GLY GLY H . n 
F 1 173 VAL 173 174 174 VAL VAL H . n 
F 1 174 MET 174 175 175 MET MET H . n 
F 1 175 HIS 175 176 176 HIS HIS H . n 
F 1 176 VAL 176 177 177 VAL VAL H . n 
F 1 177 ASN 177 178 178 ASN ASN H . n 
F 1 178 GLU 178 179 179 GLU GLU H . n 
F 1 179 LYS 179 180 180 LYS LYS H . n 
F 1 180 ASP 180 181 181 ASP ASP H . n 
F 1 181 GLU 181 182 182 GLU GLU H . n 
F 1 182 ILE 182 183 183 ILE ILE H . n 
F 1 183 ILE 183 184 184 ILE ILE H . n 
F 1 184 ASP 184 185 185 ASP ASP H . n 
F 1 185 PHE 185 186 186 PHE PHE H . n 
F 1 186 ILE 186 187 187 ILE ILE H . n 
F 1 187 GLU 187 188 188 GLU GLU H . n 
F 1 188 LYS 188 189 189 LYS LYS H . n 
F 1 189 PRO 189 190 190 PRO PRO H . n 
F 1 190 ALA 190 191 191 ALA ALA H . n 
F 1 191 ASP 191 192 192 ASP ASP H . n 
F 1 192 PRO 192 193 193 PRO PRO H . n 
F 1 193 PRO 193 194 194 PRO PRO H . n 
F 1 194 GLY 194 195 195 GLY GLY H . n 
F 1 195 ILE 195 196 196 ILE ILE H . n 
F 1 196 PRO 196 197 197 PRO PRO H . n 
F 1 197 GLY 197 198 198 GLY GLY H . n 
F 1 198 ASN 198 199 199 ASN ASN H . n 
F 1 199 GLU 199 200 200 GLU GLU H . n 
F 1 200 GLY 200 201 201 GLY GLY H . n 
F 1 201 PHE 201 202 202 PHE PHE H . n 
F 1 202 ALA 202 203 203 ALA ALA H . n 
F 1 203 LEU 203 204 204 LEU LEU H . n 
F 1 204 ALA 204 205 205 ALA ALA H . n 
F 1 205 SER 205 206 206 SER SER H . n 
F 1 206 MET 206 207 207 MET MET H . n 
F 1 207 GLY 207 208 208 GLY GLY H . n 
F 1 208 ILE 208 209 209 ILE ILE H . n 
F 1 209 TYR 209 210 210 TYR TYR H . n 
F 1 210 VAL 210 211 211 VAL VAL H . n 
F 1 211 PHE 211 212 212 PHE PHE H . n 
F 1 212 HIS 212 213 213 HIS HIS H . n 
F 1 213 THR 213 214 214 THR THR H . n 
F 1 214 LYS 214 215 215 LYS LYS H . n 
F 1 215 PHE 215 216 216 PHE PHE H . n 
F 1 216 LEU 216 217 217 LEU LEU H . n 
F 1 217 MET 217 218 218 MET MET H . n 
F 1 218 GLU 218 219 219 GLU GLU H . n 
F 1 219 ALA 219 220 220 ALA ALA H . n 
F 1 220 LEU 220 221 221 LEU LEU H . n 
F 1 221 ARG 221 222 222 ARG ARG H . n 
F 1 222 ARG 222 223 223 ARG ARG H . n 
F 1 223 ASP 223 224 224 ASP ASP H . n 
F 1 224 ALA 224 225 225 ALA ALA H . n 
F 1 225 ALA 225 226 226 ALA ALA H . n 
F 1 226 ASP 226 227 227 ASP ASP H . n 
F 1 227 PRO 227 228 228 PRO PRO H . n 
F 1 228 THR 228 229 229 THR THR H . n 
F 1 229 SER 229 230 230 SER SER H . n 
F 1 230 SER 230 231 231 SER SER H . n 
F 1 231 ARG 231 232 232 ARG ARG H . n 
F 1 232 ASP 232 233 233 ASP ASP H . n 
F 1 233 PHE 233 234 234 PHE PHE H . n 
F 1 234 GLY 234 235 235 GLY GLY H . n 
F 1 235 LYS 235 236 236 LYS LYS H . n 
F 1 236 ASP 236 237 237 ASP ASP H . n 
F 1 237 ILE 237 238 238 ILE ILE H . n 
F 1 238 ILE 238 239 239 ILE ILE H . n 
F 1 239 PRO 239 240 240 PRO PRO H . n 
F 1 240 TYR 240 241 241 TYR TYR H . n 
F 1 241 ILE 241 242 242 ILE ILE H . n 
F 1 242 VAL 242 243 243 VAL VAL H . n 
F 1 243 GLU 243 244 244 GLU GLU H . n 
F 1 244 HIS 244 245 245 HIS HIS H . n 
F 1 245 GLY 245 246 246 GLY GLY H . n 
F 1 246 LYS 246 247 247 LYS LYS H . n 
F 1 247 ALA 247 248 248 ALA ALA H . n 
F 1 248 VAL 248 249 249 VAL VAL H . n 
F 1 249 ALA 249 250 250 ALA ALA H . n 
F 1 250 HIS 250 251 251 HIS HIS H . n 
F 1 251 ARG 251 252 252 ARG ARG H . n 
F 1 252 PHE 252 253 253 PHE PHE H . n 
F 1 253 ALA 253 254 254 ALA ALA H . n 
F 1 254 ASP 254 255 255 ASP ASP H . n 
F 1 255 SER 255 256 256 SER SER H . n 
F 1 256 CYS 256 257 257 CYS CYS H . n 
F 1 257 VAL 257 258 258 VAL VAL H . n 
F 1 258 ARG 258 259 259 ARG ARG H . n 
F 1 259 SER 259 260 260 SER SER H . n 
F 1 260 ASP 260 261 261 ASP ASP H . n 
F 1 261 PHE 261 262 262 PHE PHE H . n 
F 1 262 GLU 262 263 263 GLU GLU H . n 
F 1 263 HIS 263 264 264 HIS HIS H . n 
F 1 264 GLU 264 265 265 GLU GLU H . n 
F 1 265 PRO 265 266 266 PRO PRO H . n 
F 1 266 TYR 266 267 267 TYR TYR H . n 
F 1 267 TRP 267 268 268 TRP TRP H . n 
F 1 268 ARG 268 269 269 ARG ARG H . n 
F 1 269 ASP 269 270 270 ASP ASP H . n 
F 1 270 VAL 270 271 271 VAL VAL H . n 
F 1 271 GLY 271 272 272 GLY GLY H . n 
F 1 272 THR 272 273 273 THR THR H . n 
F 1 273 ILE 273 274 274 ILE ILE H . n 
F 1 274 ASP 274 275 275 ASP ASP H . n 
F 1 275 ALA 275 276 276 ALA ALA H . n 
F 1 276 TYR 276 277 277 TYR TYR H . n 
F 1 277 TRP 277 278 278 TRP TRP H . n 
F 1 278 GLN 278 279 279 GLN GLN H . n 
F 1 279 ALA 279 280 280 ALA ALA H . n 
F 1 280 ASN 280 281 281 ASN ASN H . n 
F 1 281 ILE 281 282 282 ILE ILE H . n 
F 1 282 ASP 282 283 283 ASP ASP H . n 
F 1 283 LEU 283 284 284 LEU LEU H . n 
F 1 284 THR 284 285 285 THR THR H . n 
F 1 285 ASP 285 286 286 ASP ASP H . n 
F 1 286 VAL 286 287 287 VAL VAL H . n 
F 1 287 VAL 287 288 288 VAL VAL H . n 
F 1 288 PRO 288 289 289 PRO PRO H . n 
F 1 289 ASP 289 290 290 ASP ASP H . n 
F 1 290 LEU 290 291 291 LEU LEU H . n 
F 1 291 ASP 291 292 292 ASP ASP H . n 
F 1 292 ILE 292 293 293 ILE ILE H . n 
F 1 293 TYR 293 294 294 TYR TYR H . n 
F 1 294 ASP 294 295 295 ASP ASP H . n 
F 1 295 LYS 295 296 296 LYS LYS H . n 
F 1 296 SER 296 297 297 SER SER H . n 
F 1 297 TRP 297 298 298 TRP TRP H . n 
F 1 298 PRO 298 299 299 PRO PRO H . n 
F 1 299 ILE 299 300 300 ILE ILE H . n 
F 1 300 TRP 300 301 301 TRP TRP H . n 
F 1 301 THR 301 302 302 THR THR H . n 
F 1 302 TYR 302 303 303 TYR TYR H . n 
F 1 303 ALA 303 304 304 ALA ALA H . n 
F 1 304 GLU 304 305 305 GLU GLU H . n 
F 1 305 ILE 305 306 306 ILE ILE H . n 
F 1 306 THR 306 307 307 THR THR H . n 
F 1 307 PRO 307 308 308 PRO PRO H . n 
F 1 308 PRO 308 309 309 PRO PRO H . n 
F 1 309 ALA 309 310 310 ALA ALA H . n 
F 1 310 LYS 310 311 311 LYS LYS H . n 
F 1 311 PHE 311 312 312 PHE PHE H . n 
F 1 312 VAL 312 313 313 VAL VAL H . n 
F 1 313 HIS 313 314 314 HIS HIS H . n 
F 1 314 ASP 314 315 315 ASP ASP H . n 
F 1 315 ASP 315 316 316 ASP ASP H . n 
F 1 316 GLU 316 317 317 GLU GLU H . n 
F 1 317 ASP 317 318 318 ASP ASP H . n 
F 1 318 ARG 318 319 319 ARG ARG H . n 
F 1 319 ARG 319 320 320 ARG ARG H . n 
F 1 320 GLY 320 321 321 GLY GLY H . n 
F 1 321 SER 321 322 322 SER SER H . n 
F 1 322 ALA 322 323 323 ALA ALA H . n 
F 1 323 VAL 323 324 324 VAL VAL H . n 
F 1 324 SER 324 325 325 SER SER H . n 
F 1 325 SER 325 326 326 SER SER H . n 
F 1 326 VAL 326 327 327 VAL VAL H . n 
F 1 327 VAL 327 328 328 VAL VAL H . n 
F 1 328 SER 328 329 329 SER SER H . n 
F 1 329 GLY 329 330 330 GLY GLY H . n 
F 1 330 ASP 330 331 331 ASP ASP H . n 
F 1 331 CYS 331 332 332 CYS CYS H . n 
F 1 332 ILE 332 333 333 ILE ILE H . n 
F 1 333 ILE 333 334 334 ILE ILE H . n 
F 1 334 SER 334 335 335 SER SER H . n 
F 1 335 GLY 335 336 336 GLY GLY H . n 
F 1 336 ALA 336 337 337 ALA ALA H . n 
F 1 337 ALA 337 338 338 ALA ALA H . n 
F 1 338 LEU 338 339 339 LEU LEU H . n 
F 1 339 ASN 339 340 340 ASN ASN H . n 
F 1 340 ARG 340 341 341 ARG ARG H . n 
F 1 341 SER 341 342 342 SER SER H . n 
F 1 342 LEU 342 343 343 LEU LEU H . n 
F 1 343 LEU 343 344 344 LEU LEU H . n 
F 1 344 PHE 344 345 345 PHE PHE H . n 
F 1 345 THR 345 346 346 THR THR H . n 
F 1 346 GLY 346 347 347 GLY GLY H . n 
F 1 347 VAL 347 348 348 VAL VAL H . n 
F 1 348 ARG 348 349 349 ARG ARG H . n 
F 1 349 ALA 349 350 350 ALA ALA H . n 
F 1 350 ASN 350 351 351 ASN ASN H . n 
F 1 351 SER 351 352 352 SER SER H . n 
F 1 352 TYR 352 353 353 TYR TYR H . n 
F 1 353 SER 353 354 354 SER SER H . n 
F 1 354 ARG 354 355 355 ARG ARG H . n 
F 1 355 LEU 355 356 356 LEU LEU H . n 
F 1 356 GLU 356 357 357 GLU GLU H . n 
F 1 357 ASN 357 358 358 ASN ASN H . n 
F 1 358 ALA 358 359 359 ALA ALA H . n 
F 1 359 VAL 359 360 360 VAL VAL H . n 
F 1 360 VAL 360 361 361 VAL VAL H . n 
F 1 361 LEU 361 362 362 LEU LEU H . n 
F 1 362 PRO 362 363 363 PRO PRO H . n 
F 1 363 SER 363 364 364 SER SER H . n 
F 1 364 VAL 364 365 365 VAL VAL H . n 
F 1 365 LYS 365 366 366 LYS LYS H . n 
F 1 366 ILE 366 367 367 ILE ILE H . n 
F 1 367 GLY 367 368 368 GLY GLY H . n 
F 1 368 ARG 368 369 369 ARG ARG H . n 
F 1 369 HIS 369 370 370 HIS HIS H . n 
F 1 370 ALA 370 371 371 ALA ALA H . n 
F 1 371 GLN 371 372 372 GLN GLN H . n 
F 1 372 LEU 372 373 373 LEU LEU H . n 
F 1 373 SER 373 374 374 SER SER H . n 
F 1 374 ASN 374 375 375 ASN ASN H . n 
F 1 375 VAL 375 376 376 VAL VAL H . n 
F 1 376 VAL 376 377 377 VAL VAL H . n 
F 1 377 ILE 377 378 378 ILE ILE H . n 
F 1 378 ASP 378 379 379 ASP ASP H . n 
F 1 379 HIS 379 380 380 HIS HIS H . n 
F 1 380 GLY 380 381 381 GLY GLY H . n 
F 1 381 VAL 381 382 382 VAL VAL H . n 
F 1 382 VAL 382 383 383 VAL VAL H . n 
F 1 383 ILE 383 384 384 ILE ILE H . n 
F 1 384 PRO 384 385 385 PRO PRO H . n 
F 1 385 GLU 385 386 386 GLU GLU H . n 
F 1 386 GLY 386 387 387 GLY GLY H . n 
F 1 387 LEU 387 388 388 LEU LEU H . n 
F 1 388 ILE 388 389 389 ILE ILE H . n 
F 1 389 VAL 389 390 390 VAL VAL H . n 
F 1 390 GLY 390 391 391 GLY GLY H . n 
F 1 391 GLU 391 392 392 GLU GLU H . n 
F 1 392 ASP 392 393 393 ASP ASP H . n 
F 1 393 PRO 393 394 394 PRO PRO H . n 
F 1 394 GLU 394 395 395 GLU GLU H . n 
F 1 395 LEU 395 396 396 LEU LEU H . n 
F 1 396 ASP 396 397 397 ASP ASP H . n 
F 1 397 ALA 397 398 398 ALA ALA H . n 
F 1 398 LYS 398 399 399 LYS LYS H . n 
F 1 399 ARG 399 400 400 ARG ARG H . n 
F 1 400 PHE 400 401 401 PHE PHE H . n 
F 1 401 ARG 401 402 402 ARG ARG H . n 
F 1 402 ARG 402 403 403 ARG ARG H . n 
F 1 403 THR 403 404 404 THR THR H . n 
F 1 404 GLU 404 405 405 GLU GLU H . n 
F 1 405 SER 405 406 406 SER SER H . n 
F 1 406 GLY 406 407 407 GLY GLY H . n 
F 1 407 ILE 407 408 408 ILE ILE H . n 
F 1 408 CYS 408 409 409 CYS CYS H . n 
F 1 409 LEU 409 410 410 LEU LEU H . n 
F 1 410 ILE 410 411 411 ILE ILE H . n 
F 1 411 THR 411 412 412 THR THR H . n 
F 1 412 GLN 412 413 413 GLN GLN H . n 
F 1 413 SER 413 414 414 SER SER H . n 
F 1 414 MET 414 415 415 MET MET H . n 
F 1 415 ILE 415 416 416 ILE ILE H . n 
F 1 416 ASP 416 417 417 ASP ASP H . n 
F 1 417 LYS 417 418 418 LYS LYS H . n 
F 1 418 LEU 418 419 419 LEU LEU H . n 
F 1 419 ASP 419 420 420 ASP ASP H . n 
F 1 420 LEU 420 421 421 LEU LEU H . n 
G 1 1   MET 1   2   ?   ?   ?   I . n 
G 1 2   SER 2   3   ?   ?   ?   I . n 
G 1 3   GLU 3   4   ?   ?   ?   I . n 
G 1 4   LYS 4   5   ?   ?   ?   I . n 
G 1 5   ARG 5   6   ?   ?   ?   I . n 
G 1 6   VAL 6   7   7   VAL VAL I . n 
G 1 7   GLN 7   8   8   GLN GLN I . n 
G 1 8   PRO 8   9   9   PRO PRO I . n 
G 1 9   LEU 9   10  10  LEU LEU I . n 
G 1 10  ALA 10  11  11  ALA ALA I . n 
G 1 11  ARG 11  12  12  ARG ARG I . n 
G 1 12  ASP 12  13  13  ASP ASP I . n 
G 1 13  ALA 13  14  14  ALA ALA I . n 
G 1 14  MET 14  15  15  MET MET I . n 
G 1 15  ALA 15  16  16  ALA ALA I . n 
G 1 16  TYR 16  17  17  TYR TYR I . n 
G 1 17  VAL 17  18  18  VAL VAL I . n 
G 1 18  LEU 18  19  19  LEU LEU I . n 
G 1 19  ALA 19  20  20  ALA ALA I . n 
G 1 20  GLY 20  21  21  GLY GLY I . n 
G 1 21  GLY 21  22  22  GLY GLY I . n 
G 1 22  ARG 22  23  23  ARG ARG I . n 
G 1 23  GLY 23  24  24  GLY GLY I . n 
G 1 24  SER 24  25  25  SER SER I . n 
G 1 25  ARG 25  26  26  ARG ARG I . n 
G 1 26  LEU 26  27  27  LEU LEU I . n 
G 1 27  LYS 27  28  28  LYS LYS I . n 
G 1 28  GLU 28  29  29  GLU GLU I . n 
G 1 29  LEU 29  30  30  LEU LEU I . n 
G 1 30  THR 30  31  31  THR THR I . n 
G 1 31  ASP 31  32  32  ASP ASP I . n 
G 1 32  ARG 32  33  33  ARG ARG I . n 
G 1 33  ARG 33  34  34  ARG ARG I . n 
G 1 34  ALA 34  35  35  ALA ALA I . n 
G 1 35  LYS 35  36  36  LYS LYS I . n 
G 1 36  PRO 36  37  37  PRO PRO I . n 
G 1 37  ALA 37  38  38  ALA ALA I . n 
G 1 38  VAL 38  39  39  VAL VAL I . n 
G 1 39  TYR 39  40  40  TYR TYR I . n 
G 1 40  PHE 40  41  41  PHE PHE I . n 
G 1 41  GLY 41  42  42  GLY GLY I . n 
G 1 42  GLY 42  43  43  GLY GLY I . n 
G 1 43  LYS 43  44  44  LYS LYS I . n 
G 1 44  ALA 44  45  45  ALA ALA I . n 
G 1 45  ARG 45  46  46  ARG ARG I . n 
G 1 46  ILE 46  47  47  ILE ILE I . n 
G 1 47  ILE 47  48  48  ILE ILE I . n 
G 1 48  ASP 48  49  49  ASP ASP I . n 
G 1 49  PHE 49  50  50  PHE PHE I . n 
G 1 50  ALA 50  51  51  ALA ALA I . n 
G 1 51  LEU 51  52  52  LEU LEU I . n 
G 1 52  SER 52  53  53  SER SER I . n 
G 1 53  ASN 53  54  54  ASN ASN I . n 
G 1 54  ALA 54  55  55  ALA ALA I . n 
G 1 55  LEU 55  56  56  LEU LEU I . n 
G 1 56  ASN 56  57  57  ASN ASN I . n 
G 1 57  SER 57  58  58  SER SER I . n 
G 1 58  GLY 58  59  59  GLY GLY I . n 
G 1 59  ILE 59  60  60  ILE ILE I . n 
G 1 60  ARG 60  61  61  ARG ARG I . n 
G 1 61  ARG 61  62  62  ARG ARG I . n 
G 1 62  ILE 62  63  63  ILE ILE I . n 
G 1 63  GLY 63  64  64  GLY GLY I . n 
G 1 64  VAL 64  65  65  VAL VAL I . n 
G 1 65  ALA 65  66  66  ALA ALA I . n 
G 1 66  THR 66  67  67  THR THR I . n 
G 1 67  GLN 67  68  68  GLN GLN I . n 
G 1 68  TYR 68  69  69  TYR TYR I . n 
G 1 69  LYS 69  70  70  LYS LYS I . n 
G 1 70  ALA 70  71  71  ALA ALA I . n 
G 1 71  HIS 71  72  72  HIS HIS I . n 
G 1 72  SER 72  73  73  SER SER I . n 
G 1 73  LEU 73  74  74  LEU LEU I . n 
G 1 74  ILE 74  75  75  ILE ILE I . n 
G 1 75  ARG 75  76  76  ARG ARG I . n 
G 1 76  HIS 76  77  77  HIS HIS I . n 
G 1 77  LEU 77  78  78  LEU LEU I . n 
G 1 78  GLN 78  79  79  GLN GLN I . n 
G 1 79  ARG 79  80  80  ARG ARG I . n 
G 1 80  GLY 80  81  81  GLY GLY I . n 
G 1 81  TRP 81  82  82  TRP TRP I . n 
G 1 82  ASP 82  83  83  ASP ASP I . n 
G 1 83  PHE 83  84  84  PHE PHE I . n 
G 1 84  PHE 84  85  85  PHE PHE I . n 
G 1 85  ARG 85  86  86  ARG ARG I . n 
G 1 86  PRO 86  87  87  PRO PRO I . n 
G 1 87  GLU 87  88  88  GLU GLU I . n 
G 1 88  ARG 88  89  89  ARG ARG I . n 
G 1 89  ASN 89  90  90  ASN ASN I . n 
G 1 90  GLU 90  91  91  GLU GLU I . n 
G 1 91  SER 91  92  92  SER SER I . n 
G 1 92  PHE 92  93  93  PHE PHE I . n 
G 1 93  ASP 93  94  94  ASP ASP I . n 
G 1 94  ILE 94  95  95  ILE ILE I . n 
G 1 95  LEU 95  96  96  LEU LEU I . n 
G 1 96  PRO 96  97  97  PRO PRO I . n 
G 1 97  ALA 97  98  98  ALA ALA I . n 
G 1 98  SER 98  99  ?   ?   ?   I . n 
G 1 99  GLN 99  100 ?   ?   ?   I . n 
G 1 100 ARG 100 101 ?   ?   ?   I . n 
G 1 101 VAL 101 102 ?   ?   ?   I . n 
G 1 102 SER 102 103 ?   ?   ?   I . n 
G 1 103 GLU 103 104 ?   ?   ?   I . n 
G 1 104 THR 104 105 105 THR THR I . n 
G 1 105 GLN 105 106 106 GLN GLN I . n 
G 1 106 TRP 106 107 107 TRP TRP I . n 
G 1 107 TYR 107 108 108 TYR TYR I . n 
G 1 108 GLU 108 109 109 GLU GLU I . n 
G 1 109 GLY 109 110 110 GLY GLY I . n 
G 1 110 THR 110 111 111 THR THR I . n 
G 1 111 ALA 111 112 112 ALA ALA I . n 
G 1 112 ASP 112 113 113 ASP ASP I . n 
G 1 113 ALA 113 114 114 ALA ALA I . n 
G 1 114 VAL 114 115 115 VAL VAL I . n 
G 1 115 TYR 115 116 116 TYR TYR I . n 
G 1 116 GLN 116 117 117 GLN GLN I . n 
G 1 117 ASN 117 118 118 ASN ASN I . n 
G 1 118 ILE 118 119 119 ILE ILE I . n 
G 1 119 ASP 119 120 120 ASP ASP I . n 
G 1 120 ILE 120 121 121 ILE ILE I . n 
G 1 121 ILE 121 122 122 ILE ILE I . n 
G 1 122 GLU 122 123 123 GLU GLU I . n 
G 1 123 PRO 123 124 124 PRO PRO I . n 
G 1 124 TYR 124 125 125 TYR TYR I . n 
G 1 125 ALA 125 126 126 ALA ALA I . n 
G 1 126 PRO 126 127 127 PRO PRO I . n 
G 1 127 GLU 127 128 128 GLU GLU I . n 
G 1 128 TYR 128 129 129 TYR TYR I . n 
G 1 129 MET 129 130 130 MET MET I . n 
G 1 130 VAL 130 131 131 VAL VAL I . n 
G 1 131 ILE 131 132 132 ILE ILE I . n 
G 1 132 LEU 132 133 133 LEU LEU I . n 
G 1 133 ALA 133 134 134 ALA ALA I . n 
G 1 134 GLY 134 135 135 GLY GLY I . n 
G 1 135 ASP 135 136 136 ASP ASP I . n 
G 1 136 HIS 136 137 137 HIS HIS I . n 
G 1 137 ILE 137 138 138 ILE ILE I . n 
G 1 138 TYR 138 139 139 TYR TYR I . n 
G 1 139 LYS 139 140 140 LYS LYS I . n 
G 1 140 MET 140 141 141 MET MET I . n 
G 1 141 ASP 141 142 142 ASP ASP I . n 
G 1 142 TYR 142 143 143 TYR TYR I . n 
G 1 143 GLU 143 144 144 GLU GLU I . n 
G 1 144 TYR 144 145 145 TYR TYR I . n 
G 1 145 MET 145 146 146 MET MET I . n 
G 1 146 LEU 146 147 147 LEU LEU I . n 
G 1 147 GLN 147 148 148 GLN GLN I . n 
G 1 148 GLN 148 149 149 GLN GLN I . n 
G 1 149 HIS 149 150 150 HIS HIS I . n 
G 1 150 VAL 150 151 151 VAL VAL I . n 
G 1 151 ASP 151 152 152 ASP ASP I . n 
G 1 152 SER 152 153 153 SER SER I . n 
G 1 153 GLY 153 154 154 GLY GLY I . n 
G 1 154 ALA 154 155 155 ALA ALA I . n 
G 1 155 ASP 155 156 156 ASP ASP I . n 
G 1 156 VAL 156 157 157 VAL VAL I . n 
G 1 157 THR 157 158 158 THR THR I . n 
G 1 158 ILE 158 159 159 ILE ILE I . n 
G 1 159 GLY 159 160 160 GLY GLY I . n 
G 1 160 CYS 160 161 161 CYS CYS I . n 
G 1 161 LEU 161 162 162 LEU LEU I . n 
G 1 162 GLU 162 163 163 GLU GLU I . n 
G 1 163 VAL 163 164 164 VAL VAL I . n 
G 1 164 PRO 164 165 165 PRO PRO I . n 
G 1 165 ARG 165 166 166 ARG ARG I . n 
G 1 166 MET 166 167 167 MET MET I . n 
G 1 167 GLU 167 168 168 GLU GLU I . n 
G 1 168 ALA 168 169 169 ALA ALA I . n 
G 1 169 THR 169 170 170 THR THR I . n 
G 1 170 GLY 170 171 171 GLY GLY I . n 
G 1 171 PHE 171 172 172 PHE PHE I . n 
G 1 172 GLY 172 173 173 GLY GLY I . n 
G 1 173 VAL 173 174 174 VAL VAL I . n 
G 1 174 MET 174 175 175 MET MET I . n 
G 1 175 HIS 175 176 176 HIS HIS I . n 
G 1 176 VAL 176 177 177 VAL VAL I . n 
G 1 177 ASN 177 178 178 ASN ASN I . n 
G 1 178 GLU 178 179 179 GLU GLU I . n 
G 1 179 LYS 179 180 180 LYS LYS I . n 
G 1 180 ASP 180 181 181 ASP ASP I . n 
G 1 181 GLU 181 182 182 GLU GLU I . n 
G 1 182 ILE 182 183 183 ILE ILE I . n 
G 1 183 ILE 183 184 184 ILE ILE I . n 
G 1 184 ASP 184 185 185 ASP ASP I . n 
G 1 185 PHE 185 186 186 PHE PHE I . n 
G 1 186 ILE 186 187 187 ILE ILE I . n 
G 1 187 GLU 187 188 188 GLU GLU I . n 
G 1 188 LYS 188 189 189 LYS LYS I . n 
G 1 189 PRO 189 190 190 PRO PRO I . n 
G 1 190 ALA 190 191 191 ALA ALA I . n 
G 1 191 ASP 191 192 192 ASP ASP I . n 
G 1 192 PRO 192 193 193 PRO PRO I . n 
G 1 193 PRO 193 194 194 PRO PRO I . n 
G 1 194 GLY 194 195 195 GLY GLY I . n 
G 1 195 ILE 195 196 196 ILE ILE I . n 
G 1 196 PRO 196 197 197 PRO PRO I . n 
G 1 197 GLY 197 198 198 GLY GLY I . n 
G 1 198 ASN 198 199 199 ASN ASN I . n 
G 1 199 GLU 199 200 200 GLU GLU I . n 
G 1 200 GLY 200 201 201 GLY GLY I . n 
G 1 201 PHE 201 202 202 PHE PHE I . n 
G 1 202 ALA 202 203 203 ALA ALA I . n 
G 1 203 LEU 203 204 204 LEU LEU I . n 
G 1 204 ALA 204 205 205 ALA ALA I . n 
G 1 205 SER 205 206 206 SER SER I . n 
G 1 206 MET 206 207 207 MET MET I . n 
G 1 207 GLY 207 208 208 GLY GLY I . n 
G 1 208 ILE 208 209 209 ILE ILE I . n 
G 1 209 TYR 209 210 210 TYR TYR I . n 
G 1 210 VAL 210 211 211 VAL VAL I . n 
G 1 211 PHE 211 212 212 PHE PHE I . n 
G 1 212 HIS 212 213 213 HIS HIS I . n 
G 1 213 THR 213 214 214 THR THR I . n 
G 1 214 LYS 214 215 215 LYS LYS I . n 
G 1 215 PHE 215 216 216 PHE PHE I . n 
G 1 216 LEU 216 217 217 LEU LEU I . n 
G 1 217 MET 217 218 218 MET MET I . n 
G 1 218 GLU 218 219 219 GLU GLU I . n 
G 1 219 ALA 219 220 220 ALA ALA I . n 
G 1 220 LEU 220 221 221 LEU LEU I . n 
G 1 221 ARG 221 222 222 ARG ARG I . n 
G 1 222 ARG 222 223 223 ARG ARG I . n 
G 1 223 ASP 223 224 224 ASP ASP I . n 
G 1 224 ALA 224 225 225 ALA ALA I . n 
G 1 225 ALA 225 226 226 ALA ALA I . n 
G 1 226 ASP 226 227 227 ASP ASP I . n 
G 1 227 PRO 227 228 228 PRO PRO I . n 
G 1 228 THR 228 229 229 THR THR I . n 
G 1 229 SER 229 230 230 SER SER I . n 
G 1 230 SER 230 231 231 SER SER I . n 
G 1 231 ARG 231 232 232 ARG ARG I . n 
G 1 232 ASP 232 233 233 ASP ASP I . n 
G 1 233 PHE 233 234 234 PHE PHE I . n 
G 1 234 GLY 234 235 235 GLY GLY I . n 
G 1 235 LYS 235 236 236 LYS LYS I . n 
G 1 236 ASP 236 237 237 ASP ASP I . n 
G 1 237 ILE 237 238 238 ILE ILE I . n 
G 1 238 ILE 238 239 239 ILE ILE I . n 
G 1 239 PRO 239 240 240 PRO PRO I . n 
G 1 240 TYR 240 241 241 TYR TYR I . n 
G 1 241 ILE 241 242 242 ILE ILE I . n 
G 1 242 VAL 242 243 243 VAL VAL I . n 
G 1 243 GLU 243 244 244 GLU GLU I . n 
G 1 244 HIS 244 245 245 HIS HIS I . n 
G 1 245 GLY 245 246 246 GLY GLY I . n 
G 1 246 LYS 246 247 247 LYS LYS I . n 
G 1 247 ALA 247 248 248 ALA ALA I . n 
G 1 248 VAL 248 249 249 VAL VAL I . n 
G 1 249 ALA 249 250 250 ALA ALA I . n 
G 1 250 HIS 250 251 251 HIS HIS I . n 
G 1 251 ARG 251 252 252 ARG ARG I . n 
G 1 252 PHE 252 253 253 PHE PHE I . n 
G 1 253 ALA 253 254 254 ALA ALA I . n 
G 1 254 ASP 254 255 255 ASP ASP I . n 
G 1 255 SER 255 256 256 SER SER I . n 
G 1 256 CYS 256 257 257 CYS CYS I . n 
G 1 257 VAL 257 258 258 VAL VAL I . n 
G 1 258 ARG 258 259 259 ARG ARG I . n 
G 1 259 SER 259 260 260 SER SER I . n 
G 1 260 ASP 260 261 261 ASP ASP I . n 
G 1 261 PHE 261 262 262 PHE PHE I . n 
G 1 262 GLU 262 263 263 GLU GLU I . n 
G 1 263 HIS 263 264 264 HIS HIS I . n 
G 1 264 GLU 264 265 265 GLU GLU I . n 
G 1 265 PRO 265 266 266 PRO PRO I . n 
G 1 266 TYR 266 267 267 TYR TYR I . n 
G 1 267 TRP 267 268 268 TRP TRP I . n 
G 1 268 ARG 268 269 269 ARG ARG I . n 
G 1 269 ASP 269 270 270 ASP ASP I . n 
G 1 270 VAL 270 271 271 VAL VAL I . n 
G 1 271 GLY 271 272 272 GLY GLY I . n 
G 1 272 THR 272 273 273 THR THR I . n 
G 1 273 ILE 273 274 274 ILE ILE I . n 
G 1 274 ASP 274 275 275 ASP ASP I . n 
G 1 275 ALA 275 276 276 ALA ALA I . n 
G 1 276 TYR 276 277 277 TYR TYR I . n 
G 1 277 TRP 277 278 278 TRP TRP I . n 
G 1 278 GLN 278 279 279 GLN GLN I . n 
G 1 279 ALA 279 280 280 ALA ALA I . n 
G 1 280 ASN 280 281 281 ASN ASN I . n 
G 1 281 ILE 281 282 282 ILE ILE I . n 
G 1 282 ASP 282 283 283 ASP ASP I . n 
G 1 283 LEU 283 284 284 LEU LEU I . n 
G 1 284 THR 284 285 285 THR THR I . n 
G 1 285 ASP 285 286 286 ASP ASP I . n 
G 1 286 VAL 286 287 287 VAL VAL I . n 
G 1 287 VAL 287 288 288 VAL VAL I . n 
G 1 288 PRO 288 289 289 PRO PRO I . n 
G 1 289 ASP 289 290 290 ASP ASP I . n 
G 1 290 LEU 290 291 291 LEU LEU I . n 
G 1 291 ASP 291 292 292 ASP ASP I . n 
G 1 292 ILE 292 293 293 ILE ILE I . n 
G 1 293 TYR 293 294 294 TYR TYR I . n 
G 1 294 ASP 294 295 295 ASP ASP I . n 
G 1 295 LYS 295 296 296 LYS LYS I . n 
G 1 296 SER 296 297 297 SER SER I . n 
G 1 297 TRP 297 298 298 TRP TRP I . n 
G 1 298 PRO 298 299 299 PRO PRO I . n 
G 1 299 ILE 299 300 300 ILE ILE I . n 
G 1 300 TRP 300 301 301 TRP TRP I . n 
G 1 301 THR 301 302 302 THR THR I . n 
G 1 302 TYR 302 303 303 TYR TYR I . n 
G 1 303 ALA 303 304 304 ALA ALA I . n 
G 1 304 GLU 304 305 305 GLU GLU I . n 
G 1 305 ILE 305 306 306 ILE ILE I . n 
G 1 306 THR 306 307 307 THR THR I . n 
G 1 307 PRO 307 308 308 PRO PRO I . n 
G 1 308 PRO 308 309 309 PRO PRO I . n 
G 1 309 ALA 309 310 310 ALA ALA I . n 
G 1 310 LYS 310 311 311 LYS LYS I . n 
G 1 311 PHE 311 312 312 PHE PHE I . n 
G 1 312 VAL 312 313 313 VAL VAL I . n 
G 1 313 HIS 313 314 314 HIS HIS I . n 
G 1 314 ASP 314 315 315 ASP ASP I . n 
G 1 315 ASP 315 316 316 ASP ASP I . n 
G 1 316 GLU 316 317 317 GLU GLU I . n 
G 1 317 ASP 317 318 318 ASP ASP I . n 
G 1 318 ARG 318 319 319 ARG ARG I . n 
G 1 319 ARG 319 320 320 ARG ARG I . n 
G 1 320 GLY 320 321 321 GLY GLY I . n 
G 1 321 SER 321 322 322 SER SER I . n 
G 1 322 ALA 322 323 323 ALA ALA I . n 
G 1 323 VAL 323 324 324 VAL VAL I . n 
G 1 324 SER 324 325 325 SER SER I . n 
G 1 325 SER 325 326 326 SER SER I . n 
G 1 326 VAL 326 327 327 VAL VAL I . n 
G 1 327 VAL 327 328 328 VAL VAL I . n 
G 1 328 SER 328 329 329 SER SER I . n 
G 1 329 GLY 329 330 330 GLY GLY I . n 
G 1 330 ASP 330 331 331 ASP ASP I . n 
G 1 331 CYS 331 332 332 CYS CYS I . n 
G 1 332 ILE 332 333 333 ILE ILE I . n 
G 1 333 ILE 333 334 334 ILE ILE I . n 
G 1 334 SER 334 335 335 SER SER I . n 
G 1 335 GLY 335 336 336 GLY GLY I . n 
G 1 336 ALA 336 337 337 ALA ALA I . n 
G 1 337 ALA 337 338 338 ALA ALA I . n 
G 1 338 LEU 338 339 339 LEU LEU I . n 
G 1 339 ASN 339 340 340 ASN ASN I . n 
G 1 340 ARG 340 341 341 ARG ARG I . n 
G 1 341 SER 341 342 342 SER SER I . n 
G 1 342 LEU 342 343 343 LEU LEU I . n 
G 1 343 LEU 343 344 344 LEU LEU I . n 
G 1 344 PHE 344 345 345 PHE PHE I . n 
G 1 345 THR 345 346 346 THR THR I . n 
G 1 346 GLY 346 347 347 GLY GLY I . n 
G 1 347 VAL 347 348 348 VAL VAL I . n 
G 1 348 ARG 348 349 349 ARG ARG I . n 
G 1 349 ALA 349 350 350 ALA ALA I . n 
G 1 350 ASN 350 351 351 ASN ASN I . n 
G 1 351 SER 351 352 352 SER SER I . n 
G 1 352 TYR 352 353 353 TYR TYR I . n 
G 1 353 SER 353 354 354 SER SER I . n 
G 1 354 ARG 354 355 355 ARG ARG I . n 
G 1 355 LEU 355 356 356 LEU LEU I . n 
G 1 356 GLU 356 357 357 GLU GLU I . n 
G 1 357 ASN 357 358 358 ASN ASN I . n 
G 1 358 ALA 358 359 359 ALA ALA I . n 
G 1 359 VAL 359 360 360 VAL VAL I . n 
G 1 360 VAL 360 361 361 VAL VAL I . n 
G 1 361 LEU 361 362 362 LEU LEU I . n 
G 1 362 PRO 362 363 363 PRO PRO I . n 
G 1 363 SER 363 364 364 SER SER I . n 
G 1 364 VAL 364 365 365 VAL VAL I . n 
G 1 365 LYS 365 366 366 LYS LYS I . n 
G 1 366 ILE 366 367 367 ILE ILE I . n 
G 1 367 GLY 367 368 368 GLY GLY I . n 
G 1 368 ARG 368 369 369 ARG ARG I . n 
G 1 369 HIS 369 370 370 HIS HIS I . n 
G 1 370 ALA 370 371 371 ALA ALA I . n 
G 1 371 GLN 371 372 372 GLN GLN I . n 
G 1 372 LEU 372 373 373 LEU LEU I . n 
G 1 373 SER 373 374 374 SER SER I . n 
G 1 374 ASN 374 375 375 ASN ASN I . n 
G 1 375 VAL 375 376 376 VAL VAL I . n 
G 1 376 VAL 376 377 377 VAL VAL I . n 
G 1 377 ILE 377 378 378 ILE ILE I . n 
G 1 378 ASP 378 379 379 ASP ASP I . n 
G 1 379 HIS 379 380 380 HIS HIS I . n 
G 1 380 GLY 380 381 381 GLY GLY I . n 
G 1 381 VAL 381 382 382 VAL VAL I . n 
G 1 382 VAL 382 383 383 VAL VAL I . n 
G 1 383 ILE 383 384 384 ILE ILE I . n 
G 1 384 PRO 384 385 385 PRO PRO I . n 
G 1 385 GLU 385 386 386 GLU GLU I . n 
G 1 386 GLY 386 387 387 GLY GLY I . n 
G 1 387 LEU 387 388 388 LEU LEU I . n 
G 1 388 ILE 388 389 389 ILE ILE I . n 
G 1 389 VAL 389 390 390 VAL VAL I . n 
G 1 390 GLY 390 391 391 GLY GLY I . n 
G 1 391 GLU 391 392 392 GLU GLU I . n 
G 1 392 ASP 392 393 393 ASP ASP I . n 
G 1 393 PRO 393 394 394 PRO PRO I . n 
G 1 394 GLU 394 395 395 GLU GLU I . n 
G 1 395 LEU 395 396 396 LEU LEU I . n 
G 1 396 ASP 396 397 397 ASP ASP I . n 
G 1 397 ALA 397 398 398 ALA ALA I . n 
G 1 398 LYS 398 399 399 LYS LYS I . n 
G 1 399 ARG 399 400 400 ARG ARG I . n 
G 1 400 PHE 400 401 401 PHE PHE I . n 
G 1 401 ARG 401 402 402 ARG ARG I . n 
G 1 402 ARG 402 403 403 ARG ARG I . n 
G 1 403 THR 403 404 404 THR THR I . n 
G 1 404 GLU 404 405 405 GLU GLU I . n 
G 1 405 SER 405 406 406 SER SER I . n 
G 1 406 GLY 406 407 407 GLY GLY I . n 
G 1 407 ILE 407 408 408 ILE ILE I . n 
G 1 408 CYS 408 409 409 CYS CYS I . n 
G 1 409 LEU 409 410 410 LEU LEU I . n 
G 1 410 ILE 410 411 411 ILE ILE I . n 
G 1 411 THR 411 412 412 THR THR I . n 
G 1 412 GLN 412 413 413 GLN GLN I . n 
G 1 413 SER 413 414 414 SER SER I . n 
G 1 414 MET 414 415 415 MET MET I . n 
G 1 415 ILE 415 416 416 ILE ILE I . n 
G 1 416 ASP 416 417 417 ASP ASP I . n 
G 1 417 LYS 417 418 418 LYS LYS I . n 
G 1 418 LEU 418 419 419 LEU LEU I . n 
G 1 419 ASP 419 420 420 ASP ASP I . n 
G 1 420 LEU 420 421 421 LEU LEU I . n 
H 1 1   MET 1   2   ?   ?   ?   J . n 
H 1 2   SER 2   3   ?   ?   ?   J . n 
H 1 3   GLU 3   4   ?   ?   ?   J . n 
H 1 4   LYS 4   5   ?   ?   ?   J . n 
H 1 5   ARG 5   6   ?   ?   ?   J . n 
H 1 6   VAL 6   7   7   VAL VAL J . n 
H 1 7   GLN 7   8   8   GLN GLN J . n 
H 1 8   PRO 8   9   9   PRO PRO J . n 
H 1 9   LEU 9   10  10  LEU LEU J . n 
H 1 10  ALA 10  11  11  ALA ALA J . n 
H 1 11  ARG 11  12  12  ARG ARG J . n 
H 1 12  ASP 12  13  13  ASP ASP J . n 
H 1 13  ALA 13  14  14  ALA ALA J . n 
H 1 14  MET 14  15  15  MET MET J . n 
H 1 15  ALA 15  16  16  ALA ALA J . n 
H 1 16  TYR 16  17  17  TYR TYR J . n 
H 1 17  VAL 17  18  18  VAL VAL J . n 
H 1 18  LEU 18  19  19  LEU LEU J . n 
H 1 19  ALA 19  20  20  ALA ALA J . n 
H 1 20  GLY 20  21  21  GLY GLY J . n 
H 1 21  GLY 21  22  22  GLY GLY J . n 
H 1 22  ARG 22  23  23  ARG ARG J . n 
H 1 23  GLY 23  24  24  GLY GLY J . n 
H 1 24  SER 24  25  25  SER SER J . n 
H 1 25  ARG 25  26  26  ARG ARG J . n 
H 1 26  LEU 26  27  27  LEU LEU J . n 
H 1 27  LYS 27  28  28  LYS LYS J . n 
H 1 28  GLU 28  29  29  GLU GLU J . n 
H 1 29  LEU 29  30  30  LEU LEU J . n 
H 1 30  THR 30  31  31  THR THR J . n 
H 1 31  ASP 31  32  32  ASP ASP J . n 
H 1 32  ARG 32  33  33  ARG ARG J . n 
H 1 33  ARG 33  34  34  ARG ARG J . n 
H 1 34  ALA 34  35  35  ALA ALA J . n 
H 1 35  LYS 35  36  36  LYS LYS J . n 
H 1 36  PRO 36  37  37  PRO PRO J . n 
H 1 37  ALA 37  38  38  ALA ALA J . n 
H 1 38  VAL 38  39  39  VAL VAL J . n 
H 1 39  TYR 39  40  40  TYR TYR J . n 
H 1 40  PHE 40  41  41  PHE PHE J . n 
H 1 41  GLY 41  42  42  GLY GLY J . n 
H 1 42  GLY 42  43  43  GLY GLY J . n 
H 1 43  LYS 43  44  44  LYS LYS J . n 
H 1 44  ALA 44  45  45  ALA ALA J . n 
H 1 45  ARG 45  46  46  ARG ARG J . n 
H 1 46  ILE 46  47  47  ILE ILE J . n 
H 1 47  ILE 47  48  48  ILE ILE J . n 
H 1 48  ASP 48  49  49  ASP ASP J . n 
H 1 49  PHE 49  50  50  PHE PHE J . n 
H 1 50  ALA 50  51  51  ALA ALA J . n 
H 1 51  LEU 51  52  52  LEU LEU J . n 
H 1 52  SER 52  53  53  SER SER J . n 
H 1 53  ASN 53  54  54  ASN ASN J . n 
H 1 54  ALA 54  55  55  ALA ALA J . n 
H 1 55  LEU 55  56  56  LEU LEU J . n 
H 1 56  ASN 56  57  57  ASN ASN J . n 
H 1 57  SER 57  58  58  SER SER J . n 
H 1 58  GLY 58  59  59  GLY GLY J . n 
H 1 59  ILE 59  60  60  ILE ILE J . n 
H 1 60  ARG 60  61  61  ARG ARG J . n 
H 1 61  ARG 61  62  62  ARG ARG J . n 
H 1 62  ILE 62  63  63  ILE ILE J . n 
H 1 63  GLY 63  64  64  GLY GLY J . n 
H 1 64  VAL 64  65  65  VAL VAL J . n 
H 1 65  ALA 65  66  66  ALA ALA J . n 
H 1 66  THR 66  67  67  THR THR J . n 
H 1 67  GLN 67  68  68  GLN GLN J . n 
H 1 68  TYR 68  69  69  TYR TYR J . n 
H 1 69  LYS 69  70  70  LYS LYS J . n 
H 1 70  ALA 70  71  71  ALA ALA J . n 
H 1 71  HIS 71  72  72  HIS HIS J . n 
H 1 72  SER 72  73  73  SER SER J . n 
H 1 73  LEU 73  74  74  LEU LEU J . n 
H 1 74  ILE 74  75  75  ILE ILE J . n 
H 1 75  ARG 75  76  76  ARG ARG J . n 
H 1 76  HIS 76  77  77  HIS HIS J . n 
H 1 77  LEU 77  78  78  LEU LEU J . n 
H 1 78  GLN 78  79  79  GLN GLN J . n 
H 1 79  ARG 79  80  80  ARG ARG J . n 
H 1 80  GLY 80  81  81  GLY GLY J . n 
H 1 81  TRP 81  82  82  TRP TRP J . n 
H 1 82  ASP 82  83  83  ASP ASP J . n 
H 1 83  PHE 83  84  84  PHE PHE J . n 
H 1 84  PHE 84  85  85  PHE PHE J . n 
H 1 85  ARG 85  86  86  ARG ARG J . n 
H 1 86  PRO 86  87  87  PRO PRO J . n 
H 1 87  GLU 87  88  88  GLU GLU J . n 
H 1 88  ARG 88  89  89  ARG ARG J . n 
H 1 89  ASN 89  90  90  ASN ASN J . n 
H 1 90  GLU 90  91  91  GLU GLU J . n 
H 1 91  SER 91  92  92  SER SER J . n 
H 1 92  PHE 92  93  93  PHE PHE J . n 
H 1 93  ASP 93  94  94  ASP ASP J . n 
H 1 94  ILE 94  95  95  ILE ILE J . n 
H 1 95  LEU 95  96  96  LEU LEU J . n 
H 1 96  PRO 96  97  97  PRO PRO J . n 
H 1 97  ALA 97  98  98  ALA ALA J . n 
H 1 98  SER 98  99  99  SER SER J . n 
H 1 99  GLN 99  100 100 GLN GLN J . n 
H 1 100 ARG 100 101 101 ARG ARG J . n 
H 1 101 VAL 101 102 102 VAL VAL J . n 
H 1 102 SER 102 103 103 SER SER J . n 
H 1 103 GLU 103 104 104 GLU GLU J . n 
H 1 104 THR 104 105 105 THR THR J . n 
H 1 105 GLN 105 106 106 GLN GLN J . n 
H 1 106 TRP 106 107 107 TRP TRP J . n 
H 1 107 TYR 107 108 108 TYR TYR J . n 
H 1 108 GLU 108 109 109 GLU GLU J . n 
H 1 109 GLY 109 110 110 GLY GLY J . n 
H 1 110 THR 110 111 111 THR THR J . n 
H 1 111 ALA 111 112 112 ALA ALA J . n 
H 1 112 ASP 112 113 113 ASP ASP J . n 
H 1 113 ALA 113 114 114 ALA ALA J . n 
H 1 114 VAL 114 115 115 VAL VAL J . n 
H 1 115 TYR 115 116 116 TYR TYR J . n 
H 1 116 GLN 116 117 117 GLN GLN J . n 
H 1 117 ASN 117 118 118 ASN ASN J . n 
H 1 118 ILE 118 119 119 ILE ILE J . n 
H 1 119 ASP 119 120 120 ASP ASP J . n 
H 1 120 ILE 120 121 121 ILE ILE J . n 
H 1 121 ILE 121 122 122 ILE ILE J . n 
H 1 122 GLU 122 123 123 GLU GLU J . n 
H 1 123 PRO 123 124 124 PRO PRO J . n 
H 1 124 TYR 124 125 125 TYR TYR J . n 
H 1 125 ALA 125 126 126 ALA ALA J . n 
H 1 126 PRO 126 127 127 PRO PRO J . n 
H 1 127 GLU 127 128 128 GLU GLU J . n 
H 1 128 TYR 128 129 129 TYR TYR J . n 
H 1 129 MET 129 130 130 MET MET J . n 
H 1 130 VAL 130 131 131 VAL VAL J . n 
H 1 131 ILE 131 132 132 ILE ILE J . n 
H 1 132 LEU 132 133 133 LEU LEU J . n 
H 1 133 ALA 133 134 134 ALA ALA J . n 
H 1 134 GLY 134 135 135 GLY GLY J . n 
H 1 135 ASP 135 136 136 ASP ASP J . n 
H 1 136 HIS 136 137 137 HIS HIS J . n 
H 1 137 ILE 137 138 138 ILE ILE J . n 
H 1 138 TYR 138 139 139 TYR TYR J . n 
H 1 139 LYS 139 140 140 LYS LYS J . n 
H 1 140 MET 140 141 141 MET MET J . n 
H 1 141 ASP 141 142 142 ASP ASP J . n 
H 1 142 TYR 142 143 143 TYR TYR J . n 
H 1 143 GLU 143 144 144 GLU GLU J . n 
H 1 144 TYR 144 145 145 TYR TYR J . n 
H 1 145 MET 145 146 146 MET MET J . n 
H 1 146 LEU 146 147 147 LEU LEU J . n 
H 1 147 GLN 147 148 148 GLN GLN J . n 
H 1 148 GLN 148 149 149 GLN GLN J . n 
H 1 149 HIS 149 150 150 HIS HIS J . n 
H 1 150 VAL 150 151 151 VAL VAL J . n 
H 1 151 ASP 151 152 152 ASP ASP J . n 
H 1 152 SER 152 153 153 SER SER J . n 
H 1 153 GLY 153 154 154 GLY GLY J . n 
H 1 154 ALA 154 155 155 ALA ALA J . n 
H 1 155 ASP 155 156 156 ASP ASP J . n 
H 1 156 VAL 156 157 157 VAL VAL J . n 
H 1 157 THR 157 158 158 THR THR J . n 
H 1 158 ILE 158 159 159 ILE ILE J . n 
H 1 159 GLY 159 160 160 GLY GLY J . n 
H 1 160 CYS 160 161 161 CYS CYS J . n 
H 1 161 LEU 161 162 162 LEU LEU J . n 
H 1 162 GLU 162 163 163 GLU GLU J . n 
H 1 163 VAL 163 164 164 VAL VAL J . n 
H 1 164 PRO 164 165 165 PRO PRO J . n 
H 1 165 ARG 165 166 166 ARG ARG J . n 
H 1 166 MET 166 167 167 MET MET J . n 
H 1 167 GLU 167 168 168 GLU GLU J . n 
H 1 168 ALA 168 169 169 ALA ALA J . n 
H 1 169 THR 169 170 170 THR THR J . n 
H 1 170 GLY 170 171 171 GLY GLY J . n 
H 1 171 PHE 171 172 172 PHE PHE J . n 
H 1 172 GLY 172 173 173 GLY GLY J . n 
H 1 173 VAL 173 174 174 VAL VAL J . n 
H 1 174 MET 174 175 175 MET MET J . n 
H 1 175 HIS 175 176 176 HIS HIS J . n 
H 1 176 VAL 176 177 177 VAL VAL J . n 
H 1 177 ASN 177 178 178 ASN ASN J . n 
H 1 178 GLU 178 179 179 GLU GLU J . n 
H 1 179 LYS 179 180 180 LYS LYS J . n 
H 1 180 ASP 180 181 181 ASP ASP J . n 
H 1 181 GLU 181 182 182 GLU GLU J . n 
H 1 182 ILE 182 183 183 ILE ILE J . n 
H 1 183 ILE 183 184 184 ILE ILE J . n 
H 1 184 ASP 184 185 185 ASP ASP J . n 
H 1 185 PHE 185 186 186 PHE PHE J . n 
H 1 186 ILE 186 187 187 ILE ILE J . n 
H 1 187 GLU 187 188 188 GLU GLU J . n 
H 1 188 LYS 188 189 189 LYS LYS J . n 
H 1 189 PRO 189 190 190 PRO PRO J . n 
H 1 190 ALA 190 191 191 ALA ALA J . n 
H 1 191 ASP 191 192 192 ASP ASP J . n 
H 1 192 PRO 192 193 193 PRO PRO J . n 
H 1 193 PRO 193 194 194 PRO PRO J . n 
H 1 194 GLY 194 195 195 GLY GLY J . n 
H 1 195 ILE 195 196 196 ILE ILE J . n 
H 1 196 PRO 196 197 197 PRO PRO J . n 
H 1 197 GLY 197 198 198 GLY GLY J . n 
H 1 198 ASN 198 199 199 ASN ASN J . n 
H 1 199 GLU 199 200 200 GLU GLU J . n 
H 1 200 GLY 200 201 201 GLY GLY J . n 
H 1 201 PHE 201 202 202 PHE PHE J . n 
H 1 202 ALA 202 203 203 ALA ALA J . n 
H 1 203 LEU 203 204 204 LEU LEU J . n 
H 1 204 ALA 204 205 205 ALA ALA J . n 
H 1 205 SER 205 206 206 SER SER J . n 
H 1 206 MET 206 207 207 MET MET J . n 
H 1 207 GLY 207 208 208 GLY GLY J . n 
H 1 208 ILE 208 209 209 ILE ILE J . n 
H 1 209 TYR 209 210 210 TYR TYR J . n 
H 1 210 VAL 210 211 211 VAL VAL J . n 
H 1 211 PHE 211 212 212 PHE PHE J . n 
H 1 212 HIS 212 213 213 HIS HIS J . n 
H 1 213 THR 213 214 214 THR THR J . n 
H 1 214 LYS 214 215 215 LYS LYS J . n 
H 1 215 PHE 215 216 216 PHE PHE J . n 
H 1 216 LEU 216 217 217 LEU LEU J . n 
H 1 217 MET 217 218 218 MET MET J . n 
H 1 218 GLU 218 219 219 GLU GLU J . n 
H 1 219 ALA 219 220 220 ALA ALA J . n 
H 1 220 LEU 220 221 221 LEU LEU J . n 
H 1 221 ARG 221 222 222 ARG ARG J . n 
H 1 222 ARG 222 223 223 ARG ARG J . n 
H 1 223 ASP 223 224 224 ASP ASP J . n 
H 1 224 ALA 224 225 225 ALA ALA J . n 
H 1 225 ALA 225 226 226 ALA ALA J . n 
H 1 226 ASP 226 227 227 ASP ASP J . n 
H 1 227 PRO 227 228 228 PRO PRO J . n 
H 1 228 THR 228 229 229 THR THR J . n 
H 1 229 SER 229 230 230 SER SER J . n 
H 1 230 SER 230 231 231 SER SER J . n 
H 1 231 ARG 231 232 232 ARG ARG J . n 
H 1 232 ASP 232 233 233 ASP ASP J . n 
H 1 233 PHE 233 234 234 PHE PHE J . n 
H 1 234 GLY 234 235 235 GLY GLY J . n 
H 1 235 LYS 235 236 236 LYS LYS J . n 
H 1 236 ASP 236 237 237 ASP ASP J . n 
H 1 237 ILE 237 238 238 ILE ILE J . n 
H 1 238 ILE 238 239 239 ILE ILE J . n 
H 1 239 PRO 239 240 240 PRO PRO J . n 
H 1 240 TYR 240 241 241 TYR TYR J . n 
H 1 241 ILE 241 242 242 ILE ILE J . n 
H 1 242 VAL 242 243 243 VAL VAL J . n 
H 1 243 GLU 243 244 244 GLU GLU J . n 
H 1 244 HIS 244 245 245 HIS HIS J . n 
H 1 245 GLY 245 246 246 GLY GLY J . n 
H 1 246 LYS 246 247 247 LYS LYS J . n 
H 1 247 ALA 247 248 248 ALA ALA J . n 
H 1 248 VAL 248 249 249 VAL VAL J . n 
H 1 249 ALA 249 250 250 ALA ALA J . n 
H 1 250 HIS 250 251 251 HIS HIS J . n 
H 1 251 ARG 251 252 252 ARG ARG J . n 
H 1 252 PHE 252 253 253 PHE PHE J . n 
H 1 253 ALA 253 254 254 ALA ALA J . n 
H 1 254 ASP 254 255 255 ASP ASP J . n 
H 1 255 SER 255 256 256 SER SER J . n 
H 1 256 CYS 256 257 257 CYS CYS J . n 
H 1 257 VAL 257 258 258 VAL VAL J . n 
H 1 258 ARG 258 259 259 ARG ARG J . n 
H 1 259 SER 259 260 260 SER SER J . n 
H 1 260 ASP 260 261 261 ASP ASP J . n 
H 1 261 PHE 261 262 262 PHE PHE J . n 
H 1 262 GLU 262 263 263 GLU GLU J . n 
H 1 263 HIS 263 264 264 HIS HIS J . n 
H 1 264 GLU 264 265 265 GLU GLU J . n 
H 1 265 PRO 265 266 266 PRO PRO J . n 
H 1 266 TYR 266 267 267 TYR TYR J . n 
H 1 267 TRP 267 268 268 TRP TRP J . n 
H 1 268 ARG 268 269 269 ARG ARG J . n 
H 1 269 ASP 269 270 270 ASP ASP J . n 
H 1 270 VAL 270 271 271 VAL VAL J . n 
H 1 271 GLY 271 272 272 GLY GLY J . n 
H 1 272 THR 272 273 273 THR THR J . n 
H 1 273 ILE 273 274 274 ILE ILE J . n 
H 1 274 ASP 274 275 275 ASP ASP J . n 
H 1 275 ALA 275 276 276 ALA ALA J . n 
H 1 276 TYR 276 277 277 TYR TYR J . n 
H 1 277 TRP 277 278 278 TRP TRP J . n 
H 1 278 GLN 278 279 279 GLN GLN J . n 
H 1 279 ALA 279 280 280 ALA ALA J . n 
H 1 280 ASN 280 281 281 ASN ASN J . n 
H 1 281 ILE 281 282 282 ILE ILE J . n 
H 1 282 ASP 282 283 283 ASP ASP J . n 
H 1 283 LEU 283 284 284 LEU LEU J . n 
H 1 284 THR 284 285 285 THR THR J . n 
H 1 285 ASP 285 286 286 ASP ASP J . n 
H 1 286 VAL 286 287 287 VAL VAL J . n 
H 1 287 VAL 287 288 288 VAL VAL J . n 
H 1 288 PRO 288 289 289 PRO PRO J . n 
H 1 289 ASP 289 290 290 ASP ASP J . n 
H 1 290 LEU 290 291 291 LEU LEU J . n 
H 1 291 ASP 291 292 292 ASP ASP J . n 
H 1 292 ILE 292 293 293 ILE ILE J . n 
H 1 293 TYR 293 294 294 TYR TYR J . n 
H 1 294 ASP 294 295 295 ASP ASP J . n 
H 1 295 LYS 295 296 296 LYS LYS J . n 
H 1 296 SER 296 297 297 SER SER J . n 
H 1 297 TRP 297 298 298 TRP TRP J . n 
H 1 298 PRO 298 299 299 PRO PRO J . n 
H 1 299 ILE 299 300 300 ILE ILE J . n 
H 1 300 TRP 300 301 301 TRP TRP J . n 
H 1 301 THR 301 302 302 THR THR J . n 
H 1 302 TYR 302 303 303 TYR TYR J . n 
H 1 303 ALA 303 304 304 ALA ALA J . n 
H 1 304 GLU 304 305 305 GLU GLU J . n 
H 1 305 ILE 305 306 306 ILE ILE J . n 
H 1 306 THR 306 307 307 THR THR J . n 
H 1 307 PRO 307 308 308 PRO PRO J . n 
H 1 308 PRO 308 309 309 PRO PRO J . n 
H 1 309 ALA 309 310 310 ALA ALA J . n 
H 1 310 LYS 310 311 311 LYS LYS J . n 
H 1 311 PHE 311 312 312 PHE PHE J . n 
H 1 312 VAL 312 313 313 VAL VAL J . n 
H 1 313 HIS 313 314 314 HIS HIS J . n 
H 1 314 ASP 314 315 315 ASP ASP J . n 
H 1 315 ASP 315 316 316 ASP ASP J . n 
H 1 316 GLU 316 317 317 GLU GLU J . n 
H 1 317 ASP 317 318 318 ASP ASP J . n 
H 1 318 ARG 318 319 319 ARG ARG J . n 
H 1 319 ARG 319 320 320 ARG ARG J . n 
H 1 320 GLY 320 321 321 GLY GLY J . n 
H 1 321 SER 321 322 322 SER SER J . n 
H 1 322 ALA 322 323 323 ALA ALA J . n 
H 1 323 VAL 323 324 324 VAL VAL J . n 
H 1 324 SER 324 325 325 SER SER J . n 
H 1 325 SER 325 326 326 SER SER J . n 
H 1 326 VAL 326 327 327 VAL VAL J . n 
H 1 327 VAL 327 328 328 VAL VAL J . n 
H 1 328 SER 328 329 329 SER SER J . n 
H 1 329 GLY 329 330 330 GLY GLY J . n 
H 1 330 ASP 330 331 331 ASP ASP J . n 
H 1 331 CYS 331 332 332 CYS CYS J . n 
H 1 332 ILE 332 333 333 ILE ILE J . n 
H 1 333 ILE 333 334 334 ILE ILE J . n 
H 1 334 SER 334 335 335 SER SER J . n 
H 1 335 GLY 335 336 336 GLY GLY J . n 
H 1 336 ALA 336 337 337 ALA ALA J . n 
H 1 337 ALA 337 338 338 ALA ALA J . n 
H 1 338 LEU 338 339 339 LEU LEU J . n 
H 1 339 ASN 339 340 340 ASN ASN J . n 
H 1 340 ARG 340 341 341 ARG ARG J . n 
H 1 341 SER 341 342 342 SER SER J . n 
H 1 342 LEU 342 343 343 LEU LEU J . n 
H 1 343 LEU 343 344 344 LEU LEU J . n 
H 1 344 PHE 344 345 345 PHE PHE J . n 
H 1 345 THR 345 346 346 THR THR J . n 
H 1 346 GLY 346 347 347 GLY GLY J . n 
H 1 347 VAL 347 348 348 VAL VAL J . n 
H 1 348 ARG 348 349 349 ARG ARG J . n 
H 1 349 ALA 349 350 350 ALA ALA J . n 
H 1 350 ASN 350 351 351 ASN ASN J . n 
H 1 351 SER 351 352 352 SER SER J . n 
H 1 352 TYR 352 353 353 TYR TYR J . n 
H 1 353 SER 353 354 354 SER SER J . n 
H 1 354 ARG 354 355 355 ARG ARG J . n 
H 1 355 LEU 355 356 356 LEU LEU J . n 
H 1 356 GLU 356 357 357 GLU GLU J . n 
H 1 357 ASN 357 358 358 ASN ASN J . n 
H 1 358 ALA 358 359 359 ALA ALA J . n 
H 1 359 VAL 359 360 360 VAL VAL J . n 
H 1 360 VAL 360 361 361 VAL VAL J . n 
H 1 361 LEU 361 362 362 LEU LEU J . n 
H 1 362 PRO 362 363 363 PRO PRO J . n 
H 1 363 SER 363 364 364 SER SER J . n 
H 1 364 VAL 364 365 365 VAL VAL J . n 
H 1 365 LYS 365 366 366 LYS LYS J . n 
H 1 366 ILE 366 367 367 ILE ILE J . n 
H 1 367 GLY 367 368 368 GLY GLY J . n 
H 1 368 ARG 368 369 369 ARG ARG J . n 
H 1 369 HIS 369 370 370 HIS HIS J . n 
H 1 370 ALA 370 371 371 ALA ALA J . n 
H 1 371 GLN 371 372 372 GLN GLN J . n 
H 1 372 LEU 372 373 373 LEU LEU J . n 
H 1 373 SER 373 374 374 SER SER J . n 
H 1 374 ASN 374 375 375 ASN ASN J . n 
H 1 375 VAL 375 376 376 VAL VAL J . n 
H 1 376 VAL 376 377 377 VAL VAL J . n 
H 1 377 ILE 377 378 378 ILE ILE J . n 
H 1 378 ASP 378 379 379 ASP ASP J . n 
H 1 379 HIS 379 380 380 HIS HIS J . n 
H 1 380 GLY 380 381 381 GLY GLY J . n 
H 1 381 VAL 381 382 382 VAL VAL J . n 
H 1 382 VAL 382 383 383 VAL VAL J . n 
H 1 383 ILE 383 384 384 ILE ILE J . n 
H 1 384 PRO 384 385 385 PRO PRO J . n 
H 1 385 GLU 385 386 386 GLU GLU J . n 
H 1 386 GLY 386 387 387 GLY GLY J . n 
H 1 387 LEU 387 388 388 LEU LEU J . n 
H 1 388 ILE 388 389 389 ILE ILE J . n 
H 1 389 VAL 389 390 390 VAL VAL J . n 
H 1 390 GLY 390 391 391 GLY GLY J . n 
H 1 391 GLU 391 392 392 GLU GLU J . n 
H 1 392 ASP 392 393 393 ASP ASP J . n 
H 1 393 PRO 393 394 394 PRO PRO J . n 
H 1 394 GLU 394 395 395 GLU GLU J . n 
H 1 395 LEU 395 396 396 LEU LEU J . n 
H 1 396 ASP 396 397 397 ASP ASP J . n 
H 1 397 ALA 397 398 398 ALA ALA J . n 
H 1 398 LYS 398 399 399 LYS LYS J . n 
H 1 399 ARG 399 400 400 ARG ARG J . n 
H 1 400 PHE 400 401 401 PHE PHE J . n 
H 1 401 ARG 401 402 402 ARG ARG J . n 
H 1 402 ARG 402 403 403 ARG ARG J . n 
H 1 403 THR 403 404 404 THR THR J . n 
H 1 404 GLU 404 405 405 GLU GLU J . n 
H 1 405 SER 405 406 406 SER SER J . n 
H 1 406 GLY 406 407 407 GLY GLY J . n 
H 1 407 ILE 407 408 408 ILE ILE J . n 
H 1 408 CYS 408 409 409 CYS CYS J . n 
H 1 409 LEU 409 410 410 LEU LEU J . n 
H 1 410 ILE 410 411 411 ILE ILE J . n 
H 1 411 THR 411 412 412 THR THR J . n 
H 1 412 GLN 412 413 413 GLN GLN J . n 
H 1 413 SER 413 414 414 SER SER J . n 
H 1 414 MET 414 415 415 MET MET J . n 
H 1 415 ILE 415 416 416 ILE ILE J . n 
H 1 416 ASP 416 417 417 ASP ASP J . n 
H 1 417 LYS 417 418 418 LYS LYS J . n 
H 1 418 LEU 418 419 419 LEU LEU J . n 
H 1 419 ASP 419 420 420 ASP ASP J . n 
H 1 420 LEU 420 421 421 LEU LEU J . n 
I 1 1   MET 1   2   ?   ?   ?   K . n 
I 1 2   SER 2   3   ?   ?   ?   K . n 
I 1 3   GLU 3   4   ?   ?   ?   K . n 
I 1 4   LYS 4   5   ?   ?   ?   K . n 
I 1 5   ARG 5   6   ?   ?   ?   K . n 
I 1 6   VAL 6   7   7   VAL VAL K . n 
I 1 7   GLN 7   8   8   GLN GLN K . n 
I 1 8   PRO 8   9   9   PRO PRO K . n 
I 1 9   LEU 9   10  10  LEU LEU K . n 
I 1 10  ALA 10  11  11  ALA ALA K . n 
I 1 11  ARG 11  12  12  ARG ARG K . n 
I 1 12  ASP 12  13  13  ASP ASP K . n 
I 1 13  ALA 13  14  14  ALA ALA K . n 
I 1 14  MET 14  15  15  MET MET K . n 
I 1 15  ALA 15  16  16  ALA ALA K . n 
I 1 16  TYR 16  17  17  TYR TYR K . n 
I 1 17  VAL 17  18  18  VAL VAL K . n 
I 1 18  LEU 18  19  19  LEU LEU K . n 
I 1 19  ALA 19  20  20  ALA ALA K . n 
I 1 20  GLY 20  21  21  GLY GLY K . n 
I 1 21  GLY 21  22  22  GLY GLY K . n 
I 1 22  ARG 22  23  23  ARG ARG K . n 
I 1 23  GLY 23  24  24  GLY GLY K . n 
I 1 24  SER 24  25  25  SER SER K . n 
I 1 25  ARG 25  26  26  ARG ARG K . n 
I 1 26  LEU 26  27  27  LEU LEU K . n 
I 1 27  LYS 27  28  28  LYS LYS K . n 
I 1 28  GLU 28  29  29  GLU GLU K . n 
I 1 29  LEU 29  30  30  LEU LEU K . n 
I 1 30  THR 30  31  31  THR THR K . n 
I 1 31  ASP 31  32  32  ASP ASP K . n 
I 1 32  ARG 32  33  33  ARG ARG K . n 
I 1 33  ARG 33  34  34  ARG ARG K . n 
I 1 34  ALA 34  35  35  ALA ALA K . n 
I 1 35  LYS 35  36  36  LYS LYS K . n 
I 1 36  PRO 36  37  37  PRO PRO K . n 
I 1 37  ALA 37  38  38  ALA ALA K . n 
I 1 38  VAL 38  39  39  VAL VAL K . n 
I 1 39  TYR 39  40  40  TYR TYR K . n 
I 1 40  PHE 40  41  41  PHE PHE K . n 
I 1 41  GLY 41  42  42  GLY GLY K . n 
I 1 42  GLY 42  43  43  GLY GLY K . n 
I 1 43  LYS 43  44  44  LYS LYS K . n 
I 1 44  ALA 44  45  45  ALA ALA K . n 
I 1 45  ARG 45  46  46  ARG ARG K . n 
I 1 46  ILE 46  47  47  ILE ILE K . n 
I 1 47  ILE 47  48  48  ILE ILE K . n 
I 1 48  ASP 48  49  49  ASP ASP K . n 
I 1 49  PHE 49  50  50  PHE PHE K . n 
I 1 50  ALA 50  51  51  ALA ALA K . n 
I 1 51  LEU 51  52  52  LEU LEU K . n 
I 1 52  SER 52  53  53  SER SER K . n 
I 1 53  ASN 53  54  54  ASN ASN K . n 
I 1 54  ALA 54  55  55  ALA ALA K . n 
I 1 55  LEU 55  56  56  LEU LEU K . n 
I 1 56  ASN 56  57  57  ASN ASN K . n 
I 1 57  SER 57  58  58  SER SER K . n 
I 1 58  GLY 58  59  59  GLY GLY K . n 
I 1 59  ILE 59  60  60  ILE ILE K . n 
I 1 60  ARG 60  61  61  ARG ARG K . n 
I 1 61  ARG 61  62  62  ARG ARG K . n 
I 1 62  ILE 62  63  63  ILE ILE K . n 
I 1 63  GLY 63  64  64  GLY GLY K . n 
I 1 64  VAL 64  65  65  VAL VAL K . n 
I 1 65  ALA 65  66  66  ALA ALA K . n 
I 1 66  THR 66  67  67  THR THR K . n 
I 1 67  GLN 67  68  68  GLN GLN K . n 
I 1 68  TYR 68  69  69  TYR TYR K . n 
I 1 69  LYS 69  70  70  LYS LYS K . n 
I 1 70  ALA 70  71  71  ALA ALA K . n 
I 1 71  HIS 71  72  72  HIS HIS K . n 
I 1 72  SER 72  73  73  SER SER K . n 
I 1 73  LEU 73  74  74  LEU LEU K . n 
I 1 74  ILE 74  75  75  ILE ILE K . n 
I 1 75  ARG 75  76  76  ARG ARG K . n 
I 1 76  HIS 76  77  77  HIS HIS K . n 
I 1 77  LEU 77  78  78  LEU LEU K . n 
I 1 78  GLN 78  79  79  GLN GLN K . n 
I 1 79  ARG 79  80  80  ARG ARG K . n 
I 1 80  GLY 80  81  81  GLY GLY K . n 
I 1 81  TRP 81  82  82  TRP TRP K . n 
I 1 82  ASP 82  83  83  ASP ASP K . n 
I 1 83  PHE 83  84  84  PHE PHE K . n 
I 1 84  PHE 84  85  85  PHE PHE K . n 
I 1 85  ARG 85  86  86  ARG ARG K . n 
I 1 86  PRO 86  87  87  PRO PRO K . n 
I 1 87  GLU 87  88  88  GLU GLU K . n 
I 1 88  ARG 88  89  89  ARG ARG K . n 
I 1 89  ASN 89  90  90  ASN ASN K . n 
I 1 90  GLU 90  91  91  GLU GLU K . n 
I 1 91  SER 91  92  92  SER SER K . n 
I 1 92  PHE 92  93  93  PHE PHE K . n 
I 1 93  ASP 93  94  94  ASP ASP K . n 
I 1 94  ILE 94  95  95  ILE ILE K . n 
I 1 95  LEU 95  96  96  LEU LEU K . n 
I 1 96  PRO 96  97  97  PRO PRO K . n 
I 1 97  ALA 97  98  98  ALA ALA K . n 
I 1 98  SER 98  99  99  SER SER K . n 
I 1 99  GLN 99  100 ?   ?   ?   K . n 
I 1 100 ARG 100 101 ?   ?   ?   K . n 
I 1 101 VAL 101 102 ?   ?   ?   K . n 
I 1 102 SER 102 103 ?   ?   ?   K . n 
I 1 103 GLU 103 104 ?   ?   ?   K . n 
I 1 104 THR 104 105 105 THR THR K . n 
I 1 105 GLN 105 106 106 GLN GLN K . n 
I 1 106 TRP 106 107 107 TRP TRP K . n 
I 1 107 TYR 107 108 108 TYR TYR K . n 
I 1 108 GLU 108 109 109 GLU GLU K . n 
I 1 109 GLY 109 110 110 GLY GLY K . n 
I 1 110 THR 110 111 111 THR THR K . n 
I 1 111 ALA 111 112 112 ALA ALA K . n 
I 1 112 ASP 112 113 113 ASP ASP K . n 
I 1 113 ALA 113 114 114 ALA ALA K . n 
I 1 114 VAL 114 115 115 VAL VAL K . n 
I 1 115 TYR 115 116 116 TYR TYR K . n 
I 1 116 GLN 116 117 117 GLN GLN K . n 
I 1 117 ASN 117 118 118 ASN ASN K . n 
I 1 118 ILE 118 119 119 ILE ILE K . n 
I 1 119 ASP 119 120 120 ASP ASP K . n 
I 1 120 ILE 120 121 121 ILE ILE K . n 
I 1 121 ILE 121 122 122 ILE ILE K . n 
I 1 122 GLU 122 123 123 GLU GLU K . n 
I 1 123 PRO 123 124 124 PRO PRO K . n 
I 1 124 TYR 124 125 125 TYR TYR K . n 
I 1 125 ALA 125 126 126 ALA ALA K . n 
I 1 126 PRO 126 127 127 PRO PRO K . n 
I 1 127 GLU 127 128 128 GLU GLU K . n 
I 1 128 TYR 128 129 129 TYR TYR K . n 
I 1 129 MET 129 130 130 MET MET K . n 
I 1 130 VAL 130 131 131 VAL VAL K . n 
I 1 131 ILE 131 132 132 ILE ILE K . n 
I 1 132 LEU 132 133 133 LEU LEU K . n 
I 1 133 ALA 133 134 134 ALA ALA K . n 
I 1 134 GLY 134 135 135 GLY GLY K . n 
I 1 135 ASP 135 136 136 ASP ASP K . n 
I 1 136 HIS 136 137 137 HIS HIS K . n 
I 1 137 ILE 137 138 138 ILE ILE K . n 
I 1 138 TYR 138 139 139 TYR TYR K . n 
I 1 139 LYS 139 140 140 LYS LYS K . n 
I 1 140 MET 140 141 141 MET MET K . n 
I 1 141 ASP 141 142 142 ASP ASP K . n 
I 1 142 TYR 142 143 143 TYR TYR K . n 
I 1 143 GLU 143 144 144 GLU GLU K . n 
I 1 144 TYR 144 145 145 TYR TYR K . n 
I 1 145 MET 145 146 146 MET MET K . n 
I 1 146 LEU 146 147 147 LEU LEU K . n 
I 1 147 GLN 147 148 148 GLN GLN K . n 
I 1 148 GLN 148 149 149 GLN GLN K . n 
I 1 149 HIS 149 150 150 HIS HIS K . n 
I 1 150 VAL 150 151 151 VAL VAL K . n 
I 1 151 ASP 151 152 152 ASP ASP K . n 
I 1 152 SER 152 153 153 SER SER K . n 
I 1 153 GLY 153 154 154 GLY GLY K . n 
I 1 154 ALA 154 155 155 ALA ALA K . n 
I 1 155 ASP 155 156 156 ASP ASP K . n 
I 1 156 VAL 156 157 157 VAL VAL K . n 
I 1 157 THR 157 158 158 THR THR K . n 
I 1 158 ILE 158 159 159 ILE ILE K . n 
I 1 159 GLY 159 160 160 GLY GLY K . n 
I 1 160 CYS 160 161 161 CYS CYS K . n 
I 1 161 LEU 161 162 162 LEU LEU K . n 
I 1 162 GLU 162 163 163 GLU GLU K . n 
I 1 163 VAL 163 164 164 VAL VAL K . n 
I 1 164 PRO 164 165 165 PRO PRO K . n 
I 1 165 ARG 165 166 166 ARG ARG K . n 
I 1 166 MET 166 167 167 MET MET K . n 
I 1 167 GLU 167 168 168 GLU GLU K . n 
I 1 168 ALA 168 169 169 ALA ALA K . n 
I 1 169 THR 169 170 170 THR THR K . n 
I 1 170 GLY 170 171 171 GLY GLY K . n 
I 1 171 PHE 171 172 172 PHE PHE K . n 
I 1 172 GLY 172 173 173 GLY GLY K . n 
I 1 173 VAL 173 174 174 VAL VAL K . n 
I 1 174 MET 174 175 175 MET MET K . n 
I 1 175 HIS 175 176 176 HIS HIS K . n 
I 1 176 VAL 176 177 177 VAL VAL K . n 
I 1 177 ASN 177 178 178 ASN ASN K . n 
I 1 178 GLU 178 179 179 GLU GLU K . n 
I 1 179 LYS 179 180 180 LYS LYS K . n 
I 1 180 ASP 180 181 181 ASP ASP K . n 
I 1 181 GLU 181 182 182 GLU GLU K . n 
I 1 182 ILE 182 183 183 ILE ILE K . n 
I 1 183 ILE 183 184 184 ILE ILE K . n 
I 1 184 ASP 184 185 185 ASP ASP K . n 
I 1 185 PHE 185 186 186 PHE PHE K . n 
I 1 186 ILE 186 187 187 ILE ILE K . n 
I 1 187 GLU 187 188 188 GLU GLU K . n 
I 1 188 LYS 188 189 189 LYS LYS K . n 
I 1 189 PRO 189 190 190 PRO PRO K . n 
I 1 190 ALA 190 191 191 ALA ALA K . n 
I 1 191 ASP 191 192 192 ASP ASP K . n 
I 1 192 PRO 192 193 193 PRO PRO K . n 
I 1 193 PRO 193 194 194 PRO PRO K . n 
I 1 194 GLY 194 195 195 GLY GLY K . n 
I 1 195 ILE 195 196 196 ILE ILE K . n 
I 1 196 PRO 196 197 197 PRO PRO K . n 
I 1 197 GLY 197 198 198 GLY GLY K . n 
I 1 198 ASN 198 199 199 ASN ASN K . n 
I 1 199 GLU 199 200 200 GLU GLU K . n 
I 1 200 GLY 200 201 201 GLY GLY K . n 
I 1 201 PHE 201 202 202 PHE PHE K . n 
I 1 202 ALA 202 203 203 ALA ALA K . n 
I 1 203 LEU 203 204 204 LEU LEU K . n 
I 1 204 ALA 204 205 205 ALA ALA K . n 
I 1 205 SER 205 206 206 SER SER K . n 
I 1 206 MET 206 207 207 MET MET K . n 
I 1 207 GLY 207 208 208 GLY GLY K . n 
I 1 208 ILE 208 209 209 ILE ILE K . n 
I 1 209 TYR 209 210 210 TYR TYR K . n 
I 1 210 VAL 210 211 211 VAL VAL K . n 
I 1 211 PHE 211 212 212 PHE PHE K . n 
I 1 212 HIS 212 213 213 HIS HIS K . n 
I 1 213 THR 213 214 214 THR THR K . n 
I 1 214 LYS 214 215 215 LYS LYS K . n 
I 1 215 PHE 215 216 216 PHE PHE K . n 
I 1 216 LEU 216 217 217 LEU LEU K . n 
I 1 217 MET 217 218 218 MET MET K . n 
I 1 218 GLU 218 219 219 GLU GLU K . n 
I 1 219 ALA 219 220 220 ALA ALA K . n 
I 1 220 LEU 220 221 221 LEU LEU K . n 
I 1 221 ARG 221 222 222 ARG ARG K . n 
I 1 222 ARG 222 223 223 ARG ARG K . n 
I 1 223 ASP 223 224 224 ASP ASP K . n 
I 1 224 ALA 224 225 225 ALA ALA K . n 
I 1 225 ALA 225 226 226 ALA ALA K . n 
I 1 226 ASP 226 227 227 ASP ASP K . n 
I 1 227 PRO 227 228 228 PRO PRO K . n 
I 1 228 THR 228 229 229 THR THR K . n 
I 1 229 SER 229 230 230 SER SER K . n 
I 1 230 SER 230 231 231 SER SER K . n 
I 1 231 ARG 231 232 232 ARG ARG K . n 
I 1 232 ASP 232 233 233 ASP ASP K . n 
I 1 233 PHE 233 234 234 PHE PHE K . n 
I 1 234 GLY 234 235 235 GLY GLY K . n 
I 1 235 LYS 235 236 236 LYS LYS K . n 
I 1 236 ASP 236 237 237 ASP ASP K . n 
I 1 237 ILE 237 238 238 ILE ILE K . n 
I 1 238 ILE 238 239 239 ILE ILE K . n 
I 1 239 PRO 239 240 240 PRO PRO K . n 
I 1 240 TYR 240 241 241 TYR TYR K . n 
I 1 241 ILE 241 242 242 ILE ILE K . n 
I 1 242 VAL 242 243 243 VAL VAL K . n 
I 1 243 GLU 243 244 244 GLU GLU K . n 
I 1 244 HIS 244 245 245 HIS HIS K . n 
I 1 245 GLY 245 246 246 GLY GLY K . n 
I 1 246 LYS 246 247 247 LYS LYS K . n 
I 1 247 ALA 247 248 248 ALA ALA K . n 
I 1 248 VAL 248 249 249 VAL VAL K . n 
I 1 249 ALA 249 250 250 ALA ALA K . n 
I 1 250 HIS 250 251 251 HIS HIS K . n 
I 1 251 ARG 251 252 252 ARG ARG K . n 
I 1 252 PHE 252 253 253 PHE PHE K . n 
I 1 253 ALA 253 254 254 ALA ALA K . n 
I 1 254 ASP 254 255 255 ASP ASP K . n 
I 1 255 SER 255 256 256 SER SER K . n 
I 1 256 CYS 256 257 257 CYS CYS K . n 
I 1 257 VAL 257 258 258 VAL VAL K . n 
I 1 258 ARG 258 259 259 ARG ARG K . n 
I 1 259 SER 259 260 260 SER SER K . n 
I 1 260 ASP 260 261 261 ASP ASP K . n 
I 1 261 PHE 261 262 262 PHE PHE K . n 
I 1 262 GLU 262 263 263 GLU GLU K . n 
I 1 263 HIS 263 264 264 HIS HIS K . n 
I 1 264 GLU 264 265 265 GLU GLU K . n 
I 1 265 PRO 265 266 266 PRO PRO K . n 
I 1 266 TYR 266 267 267 TYR TYR K . n 
I 1 267 TRP 267 268 268 TRP TRP K . n 
I 1 268 ARG 268 269 269 ARG ARG K . n 
I 1 269 ASP 269 270 270 ASP ASP K . n 
I 1 270 VAL 270 271 271 VAL VAL K . n 
I 1 271 GLY 271 272 272 GLY GLY K . n 
I 1 272 THR 272 273 273 THR THR K . n 
I 1 273 ILE 273 274 274 ILE ILE K . n 
I 1 274 ASP 274 275 275 ASP ASP K . n 
I 1 275 ALA 275 276 276 ALA ALA K . n 
I 1 276 TYR 276 277 277 TYR TYR K . n 
I 1 277 TRP 277 278 278 TRP TRP K . n 
I 1 278 GLN 278 279 279 GLN GLN K . n 
I 1 279 ALA 279 280 280 ALA ALA K . n 
I 1 280 ASN 280 281 281 ASN ASN K . n 
I 1 281 ILE 281 282 282 ILE ILE K . n 
I 1 282 ASP 282 283 283 ASP ASP K . n 
I 1 283 LEU 283 284 284 LEU LEU K . n 
I 1 284 THR 284 285 285 THR THR K . n 
I 1 285 ASP 285 286 286 ASP ASP K . n 
I 1 286 VAL 286 287 287 VAL VAL K . n 
I 1 287 VAL 287 288 288 VAL VAL K . n 
I 1 288 PRO 288 289 289 PRO PRO K . n 
I 1 289 ASP 289 290 290 ASP ASP K . n 
I 1 290 LEU 290 291 291 LEU LEU K . n 
I 1 291 ASP 291 292 292 ASP ASP K . n 
I 1 292 ILE 292 293 293 ILE ILE K . n 
I 1 293 TYR 293 294 294 TYR TYR K . n 
I 1 294 ASP 294 295 295 ASP ASP K . n 
I 1 295 LYS 295 296 296 LYS LYS K . n 
I 1 296 SER 296 297 297 SER SER K . n 
I 1 297 TRP 297 298 298 TRP TRP K . n 
I 1 298 PRO 298 299 299 PRO PRO K . n 
I 1 299 ILE 299 300 300 ILE ILE K . n 
I 1 300 TRP 300 301 301 TRP TRP K . n 
I 1 301 THR 301 302 302 THR THR K . n 
I 1 302 TYR 302 303 303 TYR TYR K . n 
I 1 303 ALA 303 304 304 ALA ALA K . n 
I 1 304 GLU 304 305 305 GLU GLU K . n 
I 1 305 ILE 305 306 306 ILE ILE K . n 
I 1 306 THR 306 307 307 THR THR K . n 
I 1 307 PRO 307 308 308 PRO PRO K . n 
I 1 308 PRO 308 309 309 PRO PRO K . n 
I 1 309 ALA 309 310 310 ALA ALA K . n 
I 1 310 LYS 310 311 311 LYS LYS K . n 
I 1 311 PHE 311 312 312 PHE PHE K . n 
I 1 312 VAL 312 313 313 VAL VAL K . n 
I 1 313 HIS 313 314 314 HIS HIS K . n 
I 1 314 ASP 314 315 315 ASP ASP K . n 
I 1 315 ASP 315 316 316 ASP ASP K . n 
I 1 316 GLU 316 317 317 GLU GLU K . n 
I 1 317 ASP 317 318 318 ASP ASP K . n 
I 1 318 ARG 318 319 319 ARG ARG K . n 
I 1 319 ARG 319 320 320 ARG ARG K . n 
I 1 320 GLY 320 321 321 GLY GLY K . n 
I 1 321 SER 321 322 322 SER SER K . n 
I 1 322 ALA 322 323 323 ALA ALA K . n 
I 1 323 VAL 323 324 324 VAL VAL K . n 
I 1 324 SER 324 325 325 SER SER K . n 
I 1 325 SER 325 326 326 SER SER K . n 
I 1 326 VAL 326 327 327 VAL VAL K . n 
I 1 327 VAL 327 328 328 VAL VAL K . n 
I 1 328 SER 328 329 329 SER SER K . n 
I 1 329 GLY 329 330 330 GLY GLY K . n 
I 1 330 ASP 330 331 331 ASP ASP K . n 
I 1 331 CYS 331 332 332 CYS CYS K . n 
I 1 332 ILE 332 333 333 ILE ILE K . n 
I 1 333 ILE 333 334 334 ILE ILE K . n 
I 1 334 SER 334 335 335 SER SER K . n 
I 1 335 GLY 335 336 336 GLY GLY K . n 
I 1 336 ALA 336 337 337 ALA ALA K . n 
I 1 337 ALA 337 338 338 ALA ALA K . n 
I 1 338 LEU 338 339 339 LEU LEU K . n 
I 1 339 ASN 339 340 340 ASN ASN K . n 
I 1 340 ARG 340 341 341 ARG ARG K . n 
I 1 341 SER 341 342 342 SER SER K . n 
I 1 342 LEU 342 343 343 LEU LEU K . n 
I 1 343 LEU 343 344 344 LEU LEU K . n 
I 1 344 PHE 344 345 345 PHE PHE K . n 
I 1 345 THR 345 346 346 THR THR K . n 
I 1 346 GLY 346 347 347 GLY GLY K . n 
I 1 347 VAL 347 348 348 VAL VAL K . n 
I 1 348 ARG 348 349 349 ARG ARG K . n 
I 1 349 ALA 349 350 350 ALA ALA K . n 
I 1 350 ASN 350 351 351 ASN ASN K . n 
I 1 351 SER 351 352 352 SER SER K . n 
I 1 352 TYR 352 353 353 TYR TYR K . n 
I 1 353 SER 353 354 354 SER SER K . n 
I 1 354 ARG 354 355 355 ARG ARG K . n 
I 1 355 LEU 355 356 356 LEU LEU K . n 
I 1 356 GLU 356 357 357 GLU GLU K . n 
I 1 357 ASN 357 358 358 ASN ASN K . n 
I 1 358 ALA 358 359 359 ALA ALA K . n 
I 1 359 VAL 359 360 360 VAL VAL K . n 
I 1 360 VAL 360 361 361 VAL VAL K . n 
I 1 361 LEU 361 362 362 LEU LEU K . n 
I 1 362 PRO 362 363 363 PRO PRO K . n 
I 1 363 SER 363 364 364 SER SER K . n 
I 1 364 VAL 364 365 365 VAL VAL K . n 
I 1 365 LYS 365 366 366 LYS LYS K . n 
I 1 366 ILE 366 367 367 ILE ILE K . n 
I 1 367 GLY 367 368 368 GLY GLY K . n 
I 1 368 ARG 368 369 369 ARG ARG K . n 
I 1 369 HIS 369 370 370 HIS HIS K . n 
I 1 370 ALA 370 371 371 ALA ALA K . n 
I 1 371 GLN 371 372 372 GLN GLN K . n 
I 1 372 LEU 372 373 373 LEU LEU K . n 
I 1 373 SER 373 374 374 SER SER K . n 
I 1 374 ASN 374 375 375 ASN ASN K . n 
I 1 375 VAL 375 376 376 VAL VAL K . n 
I 1 376 VAL 376 377 377 VAL VAL K . n 
I 1 377 ILE 377 378 378 ILE ILE K . n 
I 1 378 ASP 378 379 379 ASP ASP K . n 
I 1 379 HIS 379 380 380 HIS HIS K . n 
I 1 380 GLY 380 381 381 GLY GLY K . n 
I 1 381 VAL 381 382 382 VAL VAL K . n 
I 1 382 VAL 382 383 383 VAL VAL K . n 
I 1 383 ILE 383 384 384 ILE ILE K . n 
I 1 384 PRO 384 385 385 PRO PRO K . n 
I 1 385 GLU 385 386 386 GLU GLU K . n 
I 1 386 GLY 386 387 387 GLY GLY K . n 
I 1 387 LEU 387 388 388 LEU LEU K . n 
I 1 388 ILE 388 389 389 ILE ILE K . n 
I 1 389 VAL 389 390 390 VAL VAL K . n 
I 1 390 GLY 390 391 391 GLY GLY K . n 
I 1 391 GLU 391 392 392 GLU GLU K . n 
I 1 392 ASP 392 393 393 ASP ASP K . n 
I 1 393 PRO 393 394 394 PRO PRO K . n 
I 1 394 GLU 394 395 395 GLU GLU K . n 
I 1 395 LEU 395 396 396 LEU LEU K . n 
I 1 396 ASP 396 397 397 ASP ASP K . n 
I 1 397 ALA 397 398 398 ALA ALA K . n 
I 1 398 LYS 398 399 399 LYS LYS K . n 
I 1 399 ARG 399 400 400 ARG ARG K . n 
I 1 400 PHE 400 401 401 PHE PHE K . n 
I 1 401 ARG 401 402 402 ARG ARG K . n 
I 1 402 ARG 402 403 403 ARG ARG K . n 
I 1 403 THR 403 404 404 THR THR K . n 
I 1 404 GLU 404 405 405 GLU GLU K . n 
I 1 405 SER 405 406 406 SER SER K . n 
I 1 406 GLY 406 407 407 GLY GLY K . n 
I 1 407 ILE 407 408 408 ILE ILE K . n 
I 1 408 CYS 408 409 409 CYS CYS K . n 
I 1 409 LEU 409 410 410 LEU LEU K . n 
I 1 410 ILE 410 411 411 ILE ILE K . n 
I 1 411 THR 411 412 412 THR THR K . n 
I 1 412 GLN 412 413 413 GLN GLN K . n 
I 1 413 SER 413 414 414 SER SER K . n 
I 1 414 MET 414 415 415 MET MET K . n 
I 1 415 ILE 415 416 416 ILE ILE K . n 
I 1 416 ASP 416 417 417 ASP ASP K . n 
I 1 417 LYS 417 418 418 LYS LYS K . n 
I 1 418 LEU 418 419 419 LEU LEU K . n 
I 1 419 ASP 419 420 420 ASP ASP K . n 
I 1 420 LEU 420 421 421 LEU LEU K . n 
J 1 1   MET 1   2   ?   ?   ?   L . n 
J 1 2   SER 2   3   ?   ?   ?   L . n 
J 1 3   GLU 3   4   ?   ?   ?   L . n 
J 1 4   LYS 4   5   ?   ?   ?   L . n 
J 1 5   ARG 5   6   ?   ?   ?   L . n 
J 1 6   VAL 6   7   7   VAL VAL L . n 
J 1 7   GLN 7   8   8   GLN GLN L . n 
J 1 8   PRO 8   9   9   PRO PRO L . n 
J 1 9   LEU 9   10  10  LEU LEU L . n 
J 1 10  ALA 10  11  11  ALA ALA L . n 
J 1 11  ARG 11  12  12  ARG ARG L . n 
J 1 12  ASP 12  13  13  ASP ASP L . n 
J 1 13  ALA 13  14  14  ALA ALA L . n 
J 1 14  MET 14  15  15  MET MET L . n 
J 1 15  ALA 15  16  16  ALA ALA L . n 
J 1 16  TYR 16  17  17  TYR TYR L . n 
J 1 17  VAL 17  18  18  VAL VAL L . n 
J 1 18  LEU 18  19  19  LEU LEU L . n 
J 1 19  ALA 19  20  20  ALA ALA L . n 
J 1 20  GLY 20  21  21  GLY GLY L . n 
J 1 21  GLY 21  22  22  GLY GLY L . n 
J 1 22  ARG 22  23  23  ARG ARG L . n 
J 1 23  GLY 23  24  24  GLY GLY L . n 
J 1 24  SER 24  25  25  SER SER L . n 
J 1 25  ARG 25  26  26  ARG ARG L . n 
J 1 26  LEU 26  27  27  LEU LEU L . n 
J 1 27  LYS 27  28  28  LYS LYS L . n 
J 1 28  GLU 28  29  29  GLU GLU L . n 
J 1 29  LEU 29  30  30  LEU LEU L . n 
J 1 30  THR 30  31  31  THR THR L . n 
J 1 31  ASP 31  32  32  ASP ASP L . n 
J 1 32  ARG 32  33  33  ARG ARG L . n 
J 1 33  ARG 33  34  34  ARG ARG L . n 
J 1 34  ALA 34  35  35  ALA ALA L . n 
J 1 35  LYS 35  36  36  LYS LYS L . n 
J 1 36  PRO 36  37  37  PRO PRO L . n 
J 1 37  ALA 37  38  38  ALA ALA L . n 
J 1 38  VAL 38  39  39  VAL VAL L . n 
J 1 39  TYR 39  40  40  TYR TYR L . n 
J 1 40  PHE 40  41  41  PHE PHE L . n 
J 1 41  GLY 41  42  42  GLY GLY L . n 
J 1 42  GLY 42  43  43  GLY GLY L . n 
J 1 43  LYS 43  44  44  LYS LYS L . n 
J 1 44  ALA 44  45  45  ALA ALA L . n 
J 1 45  ARG 45  46  46  ARG ARG L . n 
J 1 46  ILE 46  47  47  ILE ILE L . n 
J 1 47  ILE 47  48  48  ILE ILE L . n 
J 1 48  ASP 48  49  49  ASP ASP L . n 
J 1 49  PHE 49  50  50  PHE PHE L . n 
J 1 50  ALA 50  51  51  ALA ALA L . n 
J 1 51  LEU 51  52  52  LEU LEU L . n 
J 1 52  SER 52  53  53  SER SER L . n 
J 1 53  ASN 53  54  54  ASN ASN L . n 
J 1 54  ALA 54  55  55  ALA ALA L . n 
J 1 55  LEU 55  56  56  LEU LEU L . n 
J 1 56  ASN 56  57  57  ASN ASN L . n 
J 1 57  SER 57  58  58  SER SER L . n 
J 1 58  GLY 58  59  59  GLY GLY L . n 
J 1 59  ILE 59  60  60  ILE ILE L . n 
J 1 60  ARG 60  61  61  ARG ARG L . n 
J 1 61  ARG 61  62  62  ARG ARG L . n 
J 1 62  ILE 62  63  63  ILE ILE L . n 
J 1 63  GLY 63  64  64  GLY GLY L . n 
J 1 64  VAL 64  65  65  VAL VAL L . n 
J 1 65  ALA 65  66  66  ALA ALA L . n 
J 1 66  THR 66  67  67  THR THR L . n 
J 1 67  GLN 67  68  68  GLN GLN L . n 
J 1 68  TYR 68  69  69  TYR TYR L . n 
J 1 69  LYS 69  70  70  LYS LYS L . n 
J 1 70  ALA 70  71  71  ALA ALA L . n 
J 1 71  HIS 71  72  72  HIS HIS L . n 
J 1 72  SER 72  73  73  SER SER L . n 
J 1 73  LEU 73  74  74  LEU LEU L . n 
J 1 74  ILE 74  75  75  ILE ILE L . n 
J 1 75  ARG 75  76  76  ARG ARG L . n 
J 1 76  HIS 76  77  77  HIS HIS L . n 
J 1 77  LEU 77  78  78  LEU LEU L . n 
J 1 78  GLN 78  79  79  GLN GLN L . n 
J 1 79  ARG 79  80  80  ARG ARG L . n 
J 1 80  GLY 80  81  81  GLY GLY L . n 
J 1 81  TRP 81  82  82  TRP TRP L . n 
J 1 82  ASP 82  83  83  ASP ASP L . n 
J 1 83  PHE 83  84  84  PHE PHE L . n 
J 1 84  PHE 84  85  85  PHE PHE L . n 
J 1 85  ARG 85  86  86  ARG ARG L . n 
J 1 86  PRO 86  87  87  PRO PRO L . n 
J 1 87  GLU 87  88  88  GLU GLU L . n 
J 1 88  ARG 88  89  89  ARG ARG L . n 
J 1 89  ASN 89  90  90  ASN ASN L . n 
J 1 90  GLU 90  91  91  GLU GLU L . n 
J 1 91  SER 91  92  92  SER SER L . n 
J 1 92  PHE 92  93  93  PHE PHE L . n 
J 1 93  ASP 93  94  94  ASP ASP L . n 
J 1 94  ILE 94  95  95  ILE ILE L . n 
J 1 95  LEU 95  96  96  LEU LEU L . n 
J 1 96  PRO 96  97  97  PRO PRO L . n 
J 1 97  ALA 97  98  98  ALA ALA L . n 
J 1 98  SER 98  99  99  SER SER L . n 
J 1 99  GLN 99  100 ?   ?   ?   L . n 
J 1 100 ARG 100 101 ?   ?   ?   L . n 
J 1 101 VAL 101 102 ?   ?   ?   L . n 
J 1 102 SER 102 103 ?   ?   ?   L . n 
J 1 103 GLU 103 104 ?   ?   ?   L . n 
J 1 104 THR 104 105 105 THR THR L . n 
J 1 105 GLN 105 106 106 GLN GLN L . n 
J 1 106 TRP 106 107 107 TRP TRP L . n 
J 1 107 TYR 107 108 108 TYR TYR L . n 
J 1 108 GLU 108 109 109 GLU GLU L . n 
J 1 109 GLY 109 110 110 GLY GLY L . n 
J 1 110 THR 110 111 111 THR THR L . n 
J 1 111 ALA 111 112 112 ALA ALA L . n 
J 1 112 ASP 112 113 113 ASP ASP L . n 
J 1 113 ALA 113 114 114 ALA ALA L . n 
J 1 114 VAL 114 115 115 VAL VAL L . n 
J 1 115 TYR 115 116 116 TYR TYR L . n 
J 1 116 GLN 116 117 117 GLN GLN L . n 
J 1 117 ASN 117 118 118 ASN ASN L . n 
J 1 118 ILE 118 119 119 ILE ILE L . n 
J 1 119 ASP 119 120 120 ASP ASP L . n 
J 1 120 ILE 120 121 121 ILE ILE L . n 
J 1 121 ILE 121 122 122 ILE ILE L . n 
J 1 122 GLU 122 123 123 GLU GLU L . n 
J 1 123 PRO 123 124 124 PRO PRO L . n 
J 1 124 TYR 124 125 125 TYR TYR L . n 
J 1 125 ALA 125 126 126 ALA ALA L . n 
J 1 126 PRO 126 127 127 PRO PRO L . n 
J 1 127 GLU 127 128 128 GLU GLU L . n 
J 1 128 TYR 128 129 129 TYR TYR L . n 
J 1 129 MET 129 130 130 MET MET L . n 
J 1 130 VAL 130 131 131 VAL VAL L . n 
J 1 131 ILE 131 132 132 ILE ILE L . n 
J 1 132 LEU 132 133 133 LEU LEU L . n 
J 1 133 ALA 133 134 134 ALA ALA L . n 
J 1 134 GLY 134 135 135 GLY GLY L . n 
J 1 135 ASP 135 136 136 ASP ASP L . n 
J 1 136 HIS 136 137 137 HIS HIS L . n 
J 1 137 ILE 137 138 138 ILE ILE L . n 
J 1 138 TYR 138 139 139 TYR TYR L . n 
J 1 139 LYS 139 140 140 LYS LYS L . n 
J 1 140 MET 140 141 141 MET MET L . n 
J 1 141 ASP 141 142 142 ASP ASP L . n 
J 1 142 TYR 142 143 143 TYR TYR L . n 
J 1 143 GLU 143 144 144 GLU GLU L . n 
J 1 144 TYR 144 145 145 TYR TYR L . n 
J 1 145 MET 145 146 146 MET MET L . n 
J 1 146 LEU 146 147 147 LEU LEU L . n 
J 1 147 GLN 147 148 148 GLN GLN L . n 
J 1 148 GLN 148 149 149 GLN GLN L . n 
J 1 149 HIS 149 150 150 HIS HIS L . n 
J 1 150 VAL 150 151 151 VAL VAL L . n 
J 1 151 ASP 151 152 152 ASP ASP L . n 
J 1 152 SER 152 153 153 SER SER L . n 
J 1 153 GLY 153 154 154 GLY GLY L . n 
J 1 154 ALA 154 155 155 ALA ALA L . n 
J 1 155 ASP 155 156 156 ASP ASP L . n 
J 1 156 VAL 156 157 157 VAL VAL L . n 
J 1 157 THR 157 158 158 THR THR L . n 
J 1 158 ILE 158 159 159 ILE ILE L . n 
J 1 159 GLY 159 160 160 GLY GLY L . n 
J 1 160 CYS 160 161 161 CYS CYS L . n 
J 1 161 LEU 161 162 162 LEU LEU L . n 
J 1 162 GLU 162 163 163 GLU GLU L . n 
J 1 163 VAL 163 164 164 VAL VAL L . n 
J 1 164 PRO 164 165 165 PRO PRO L . n 
J 1 165 ARG 165 166 166 ARG ARG L . n 
J 1 166 MET 166 167 167 MET MET L . n 
J 1 167 GLU 167 168 168 GLU GLU L . n 
J 1 168 ALA 168 169 169 ALA ALA L . n 
J 1 169 THR 169 170 170 THR THR L . n 
J 1 170 GLY 170 171 171 GLY GLY L . n 
J 1 171 PHE 171 172 172 PHE PHE L . n 
J 1 172 GLY 172 173 173 GLY GLY L . n 
J 1 173 VAL 173 174 174 VAL VAL L . n 
J 1 174 MET 174 175 175 MET MET L . n 
J 1 175 HIS 175 176 176 HIS HIS L . n 
J 1 176 VAL 176 177 177 VAL VAL L . n 
J 1 177 ASN 177 178 178 ASN ASN L . n 
J 1 178 GLU 178 179 179 GLU GLU L . n 
J 1 179 LYS 179 180 180 LYS LYS L . n 
J 1 180 ASP 180 181 181 ASP ASP L . n 
J 1 181 GLU 181 182 182 GLU GLU L . n 
J 1 182 ILE 182 183 183 ILE ILE L . n 
J 1 183 ILE 183 184 184 ILE ILE L . n 
J 1 184 ASP 184 185 185 ASP ASP L . n 
J 1 185 PHE 185 186 186 PHE PHE L . n 
J 1 186 ILE 186 187 187 ILE ILE L . n 
J 1 187 GLU 187 188 188 GLU GLU L . n 
J 1 188 LYS 188 189 189 LYS LYS L . n 
J 1 189 PRO 189 190 190 PRO PRO L . n 
J 1 190 ALA 190 191 191 ALA ALA L . n 
J 1 191 ASP 191 192 192 ASP ASP L . n 
J 1 192 PRO 192 193 193 PRO PRO L . n 
J 1 193 PRO 193 194 194 PRO PRO L . n 
J 1 194 GLY 194 195 195 GLY GLY L . n 
J 1 195 ILE 195 196 196 ILE ILE L . n 
J 1 196 PRO 196 197 197 PRO PRO L . n 
J 1 197 GLY 197 198 198 GLY GLY L . n 
J 1 198 ASN 198 199 199 ASN ASN L . n 
J 1 199 GLU 199 200 200 GLU GLU L . n 
J 1 200 GLY 200 201 201 GLY GLY L . n 
J 1 201 PHE 201 202 202 PHE PHE L . n 
J 1 202 ALA 202 203 203 ALA ALA L . n 
J 1 203 LEU 203 204 204 LEU LEU L . n 
J 1 204 ALA 204 205 205 ALA ALA L . n 
J 1 205 SER 205 206 206 SER SER L . n 
J 1 206 MET 206 207 207 MET MET L . n 
J 1 207 GLY 207 208 208 GLY GLY L . n 
J 1 208 ILE 208 209 209 ILE ILE L . n 
J 1 209 TYR 209 210 210 TYR TYR L . n 
J 1 210 VAL 210 211 211 VAL VAL L . n 
J 1 211 PHE 211 212 212 PHE PHE L . n 
J 1 212 HIS 212 213 213 HIS HIS L . n 
J 1 213 THR 213 214 214 THR THR L . n 
J 1 214 LYS 214 215 215 LYS LYS L . n 
J 1 215 PHE 215 216 216 PHE PHE L . n 
J 1 216 LEU 216 217 217 LEU LEU L . n 
J 1 217 MET 217 218 218 MET MET L . n 
J 1 218 GLU 218 219 219 GLU GLU L . n 
J 1 219 ALA 219 220 220 ALA ALA L . n 
J 1 220 LEU 220 221 221 LEU LEU L . n 
J 1 221 ARG 221 222 222 ARG ARG L . n 
J 1 222 ARG 222 223 223 ARG ARG L . n 
J 1 223 ASP 223 224 224 ASP ASP L . n 
J 1 224 ALA 224 225 225 ALA ALA L . n 
J 1 225 ALA 225 226 226 ALA ALA L . n 
J 1 226 ASP 226 227 227 ASP ASP L . n 
J 1 227 PRO 227 228 228 PRO PRO L . n 
J 1 228 THR 228 229 229 THR THR L . n 
J 1 229 SER 229 230 230 SER SER L . n 
J 1 230 SER 230 231 231 SER SER L . n 
J 1 231 ARG 231 232 232 ARG ARG L . n 
J 1 232 ASP 232 233 233 ASP ASP L . n 
J 1 233 PHE 233 234 234 PHE PHE L . n 
J 1 234 GLY 234 235 235 GLY GLY L . n 
J 1 235 LYS 235 236 236 LYS LYS L . n 
J 1 236 ASP 236 237 237 ASP ASP L . n 
J 1 237 ILE 237 238 238 ILE ILE L . n 
J 1 238 ILE 238 239 239 ILE ILE L . n 
J 1 239 PRO 239 240 240 PRO PRO L . n 
J 1 240 TYR 240 241 241 TYR TYR L . n 
J 1 241 ILE 241 242 242 ILE ILE L . n 
J 1 242 VAL 242 243 243 VAL VAL L . n 
J 1 243 GLU 243 244 244 GLU GLU L . n 
J 1 244 HIS 244 245 245 HIS HIS L . n 
J 1 245 GLY 245 246 246 GLY GLY L . n 
J 1 246 LYS 246 247 247 LYS LYS L . n 
J 1 247 ALA 247 248 248 ALA ALA L . n 
J 1 248 VAL 248 249 249 VAL VAL L . n 
J 1 249 ALA 249 250 250 ALA ALA L . n 
J 1 250 HIS 250 251 251 HIS HIS L . n 
J 1 251 ARG 251 252 252 ARG ARG L . n 
J 1 252 PHE 252 253 253 PHE PHE L . n 
J 1 253 ALA 253 254 254 ALA ALA L . n 
J 1 254 ASP 254 255 255 ASP ASP L . n 
J 1 255 SER 255 256 256 SER SER L . n 
J 1 256 CYS 256 257 257 CYS CYS L . n 
J 1 257 VAL 257 258 258 VAL VAL L . n 
J 1 258 ARG 258 259 259 ARG ARG L . n 
J 1 259 SER 259 260 260 SER SER L . n 
J 1 260 ASP 260 261 261 ASP ASP L . n 
J 1 261 PHE 261 262 262 PHE PHE L . n 
J 1 262 GLU 262 263 263 GLU GLU L . n 
J 1 263 HIS 263 264 264 HIS HIS L . n 
J 1 264 GLU 264 265 265 GLU GLU L . n 
J 1 265 PRO 265 266 266 PRO PRO L . n 
J 1 266 TYR 266 267 267 TYR TYR L . n 
J 1 267 TRP 267 268 268 TRP TRP L . n 
J 1 268 ARG 268 269 269 ARG ARG L . n 
J 1 269 ASP 269 270 270 ASP ASP L . n 
J 1 270 VAL 270 271 271 VAL VAL L . n 
J 1 271 GLY 271 272 272 GLY GLY L . n 
J 1 272 THR 272 273 273 THR THR L . n 
J 1 273 ILE 273 274 274 ILE ILE L . n 
J 1 274 ASP 274 275 275 ASP ASP L . n 
J 1 275 ALA 275 276 276 ALA ALA L . n 
J 1 276 TYR 276 277 277 TYR TYR L . n 
J 1 277 TRP 277 278 278 TRP TRP L . n 
J 1 278 GLN 278 279 279 GLN GLN L . n 
J 1 279 ALA 279 280 280 ALA ALA L . n 
J 1 280 ASN 280 281 281 ASN ASN L . n 
J 1 281 ILE 281 282 282 ILE ILE L . n 
J 1 282 ASP 282 283 283 ASP ASP L . n 
J 1 283 LEU 283 284 284 LEU LEU L . n 
J 1 284 THR 284 285 285 THR THR L . n 
J 1 285 ASP 285 286 286 ASP ASP L . n 
J 1 286 VAL 286 287 287 VAL VAL L . n 
J 1 287 VAL 287 288 288 VAL VAL L . n 
J 1 288 PRO 288 289 289 PRO PRO L . n 
J 1 289 ASP 289 290 290 ASP ASP L . n 
J 1 290 LEU 290 291 291 LEU LEU L . n 
J 1 291 ASP 291 292 292 ASP ASP L . n 
J 1 292 ILE 292 293 293 ILE ILE L . n 
J 1 293 TYR 293 294 294 TYR TYR L . n 
J 1 294 ASP 294 295 295 ASP ASP L . n 
J 1 295 LYS 295 296 296 LYS LYS L . n 
J 1 296 SER 296 297 297 SER SER L . n 
J 1 297 TRP 297 298 298 TRP TRP L . n 
J 1 298 PRO 298 299 299 PRO PRO L . n 
J 1 299 ILE 299 300 300 ILE ILE L . n 
J 1 300 TRP 300 301 301 TRP TRP L . n 
J 1 301 THR 301 302 302 THR THR L . n 
J 1 302 TYR 302 303 303 TYR TYR L . n 
J 1 303 ALA 303 304 304 ALA ALA L . n 
J 1 304 GLU 304 305 305 GLU GLU L . n 
J 1 305 ILE 305 306 306 ILE ILE L . n 
J 1 306 THR 306 307 307 THR THR L . n 
J 1 307 PRO 307 308 308 PRO PRO L . n 
J 1 308 PRO 308 309 309 PRO PRO L . n 
J 1 309 ALA 309 310 310 ALA ALA L . n 
J 1 310 LYS 310 311 311 LYS LYS L . n 
J 1 311 PHE 311 312 312 PHE PHE L . n 
J 1 312 VAL 312 313 313 VAL VAL L . n 
J 1 313 HIS 313 314 314 HIS HIS L . n 
J 1 314 ASP 314 315 315 ASP ASP L . n 
J 1 315 ASP 315 316 316 ASP ASP L . n 
J 1 316 GLU 316 317 317 GLU GLU L . n 
J 1 317 ASP 317 318 318 ASP ASP L . n 
J 1 318 ARG 318 319 319 ARG ARG L . n 
J 1 319 ARG 319 320 320 ARG ARG L . n 
J 1 320 GLY 320 321 321 GLY GLY L . n 
J 1 321 SER 321 322 322 SER SER L . n 
J 1 322 ALA 322 323 323 ALA ALA L . n 
J 1 323 VAL 323 324 324 VAL VAL L . n 
J 1 324 SER 324 325 325 SER SER L . n 
J 1 325 SER 325 326 326 SER SER L . n 
J 1 326 VAL 326 327 327 VAL VAL L . n 
J 1 327 VAL 327 328 328 VAL VAL L . n 
J 1 328 SER 328 329 329 SER SER L . n 
J 1 329 GLY 329 330 330 GLY GLY L . n 
J 1 330 ASP 330 331 331 ASP ASP L . n 
J 1 331 CYS 331 332 332 CYS CYS L . n 
J 1 332 ILE 332 333 333 ILE ILE L . n 
J 1 333 ILE 333 334 334 ILE ILE L . n 
J 1 334 SER 334 335 335 SER SER L . n 
J 1 335 GLY 335 336 336 GLY GLY L . n 
J 1 336 ALA 336 337 337 ALA ALA L . n 
J 1 337 ALA 337 338 338 ALA ALA L . n 
J 1 338 LEU 338 339 339 LEU LEU L . n 
J 1 339 ASN 339 340 340 ASN ASN L . n 
J 1 340 ARG 340 341 341 ARG ARG L . n 
J 1 341 SER 341 342 342 SER SER L . n 
J 1 342 LEU 342 343 343 LEU LEU L . n 
J 1 343 LEU 343 344 344 LEU LEU L . n 
J 1 344 PHE 344 345 345 PHE PHE L . n 
J 1 345 THR 345 346 346 THR THR L . n 
J 1 346 GLY 346 347 347 GLY GLY L . n 
J 1 347 VAL 347 348 348 VAL VAL L . n 
J 1 348 ARG 348 349 349 ARG ARG L . n 
J 1 349 ALA 349 350 350 ALA ALA L . n 
J 1 350 ASN 350 351 351 ASN ASN L . n 
J 1 351 SER 351 352 352 SER SER L . n 
J 1 352 TYR 352 353 353 TYR TYR L . n 
J 1 353 SER 353 354 354 SER SER L . n 
J 1 354 ARG 354 355 355 ARG ARG L . n 
J 1 355 LEU 355 356 356 LEU LEU L . n 
J 1 356 GLU 356 357 357 GLU GLU L . n 
J 1 357 ASN 357 358 358 ASN ASN L . n 
J 1 358 ALA 358 359 359 ALA ALA L . n 
J 1 359 VAL 359 360 360 VAL VAL L . n 
J 1 360 VAL 360 361 361 VAL VAL L . n 
J 1 361 LEU 361 362 362 LEU LEU L . n 
J 1 362 PRO 362 363 363 PRO PRO L . n 
J 1 363 SER 363 364 364 SER SER L . n 
J 1 364 VAL 364 365 365 VAL VAL L . n 
J 1 365 LYS 365 366 366 LYS LYS L . n 
J 1 366 ILE 366 367 367 ILE ILE L . n 
J 1 367 GLY 367 368 368 GLY GLY L . n 
J 1 368 ARG 368 369 369 ARG ARG L . n 
J 1 369 HIS 369 370 370 HIS HIS L . n 
J 1 370 ALA 370 371 371 ALA ALA L . n 
J 1 371 GLN 371 372 372 GLN GLN L . n 
J 1 372 LEU 372 373 373 LEU LEU L . n 
J 1 373 SER 373 374 374 SER SER L . n 
J 1 374 ASN 374 375 375 ASN ASN L . n 
J 1 375 VAL 375 376 376 VAL VAL L . n 
J 1 376 VAL 376 377 377 VAL VAL L . n 
J 1 377 ILE 377 378 378 ILE ILE L . n 
J 1 378 ASP 378 379 379 ASP ASP L . n 
J 1 379 HIS 379 380 380 HIS HIS L . n 
J 1 380 GLY 380 381 381 GLY GLY L . n 
J 1 381 VAL 381 382 382 VAL VAL L . n 
J 1 382 VAL 382 383 383 VAL VAL L . n 
J 1 383 ILE 383 384 384 ILE ILE L . n 
J 1 384 PRO 384 385 385 PRO PRO L . n 
J 1 385 GLU 385 386 386 GLU GLU L . n 
J 1 386 GLY 386 387 387 GLY GLY L . n 
J 1 387 LEU 387 388 388 LEU LEU L . n 
J 1 388 ILE 388 389 389 ILE ILE L . n 
J 1 389 VAL 389 390 390 VAL VAL L . n 
J 1 390 GLY 390 391 391 GLY GLY L . n 
J 1 391 GLU 391 392 392 GLU GLU L . n 
J 1 392 ASP 392 393 393 ASP ASP L . n 
J 1 393 PRO 393 394 394 PRO PRO L . n 
J 1 394 GLU 394 395 395 GLU GLU L . n 
J 1 395 LEU 395 396 396 LEU LEU L . n 
J 1 396 ASP 396 397 397 ASP ASP L . n 
J 1 397 ALA 397 398 398 ALA ALA L . n 
J 1 398 LYS 398 399 399 LYS LYS L . n 
J 1 399 ARG 399 400 400 ARG ARG L . n 
J 1 400 PHE 400 401 401 PHE PHE L . n 
J 1 401 ARG 401 402 402 ARG ARG L . n 
J 1 402 ARG 402 403 403 ARG ARG L . n 
J 1 403 THR 403 404 404 THR THR L . n 
J 1 404 GLU 404 405 405 GLU GLU L . n 
J 1 405 SER 405 406 406 SER SER L . n 
J 1 406 GLY 406 407 407 GLY GLY L . n 
J 1 407 ILE 407 408 408 ILE ILE L . n 
J 1 408 CYS 408 409 409 CYS CYS L . n 
J 1 409 LEU 409 410 410 LEU LEU L . n 
J 1 410 ILE 410 411 411 ILE ILE L . n 
J 1 411 THR 411 412 412 THR THR L . n 
J 1 412 GLN 412 413 413 GLN GLN L . n 
J 1 413 SER 413 414 414 SER SER L . n 
J 1 414 MET 414 415 415 MET MET L . n 
J 1 415 ILE 415 416 416 ILE ILE L . n 
J 1 416 ASP 416 417 417 ASP ASP L . n 
J 1 417 LYS 417 418 418 LYS LYS L . n 
J 1 418 LEU 418 419 419 LEU LEU L . n 
J 1 419 ASP 419 420 420 ASP ASP L . n 
J 1 420 LEU 420 421 421 LEU LEU L . n 
K 1 1   MET 1   2   ?   ?   ?   N . n 
K 1 2   SER 2   3   ?   ?   ?   N . n 
K 1 3   GLU 3   4   ?   ?   ?   N . n 
K 1 4   LYS 4   5   ?   ?   ?   N . n 
K 1 5   ARG 5   6   ?   ?   ?   N . n 
K 1 6   VAL 6   7   7   VAL VAL N . n 
K 1 7   GLN 7   8   8   GLN GLN N . n 
K 1 8   PRO 8   9   9   PRO PRO N . n 
K 1 9   LEU 9   10  10  LEU LEU N . n 
K 1 10  ALA 10  11  11  ALA ALA N . n 
K 1 11  ARG 11  12  12  ARG ARG N . n 
K 1 12  ASP 12  13  13  ASP ASP N . n 
K 1 13  ALA 13  14  14  ALA ALA N . n 
K 1 14  MET 14  15  15  MET MET N . n 
K 1 15  ALA 15  16  16  ALA ALA N . n 
K 1 16  TYR 16  17  17  TYR TYR N . n 
K 1 17  VAL 17  18  18  VAL VAL N . n 
K 1 18  LEU 18  19  19  LEU LEU N . n 
K 1 19  ALA 19  20  20  ALA ALA N . n 
K 1 20  GLY 20  21  21  GLY GLY N . n 
K 1 21  GLY 21  22  22  GLY GLY N . n 
K 1 22  ARG 22  23  23  ARG ARG N . n 
K 1 23  GLY 23  24  24  GLY GLY N . n 
K 1 24  SER 24  25  25  SER SER N . n 
K 1 25  ARG 25  26  26  ARG ARG N . n 
K 1 26  LEU 26  27  27  LEU LEU N . n 
K 1 27  LYS 27  28  28  LYS LYS N . n 
K 1 28  GLU 28  29  29  GLU GLU N . n 
K 1 29  LEU 29  30  30  LEU LEU N . n 
K 1 30  THR 30  31  31  THR THR N . n 
K 1 31  ASP 31  32  32  ASP ASP N . n 
K 1 32  ARG 32  33  33  ARG ARG N . n 
K 1 33  ARG 33  34  34  ARG ARG N . n 
K 1 34  ALA 34  35  35  ALA ALA N . n 
K 1 35  LYS 35  36  36  LYS LYS N . n 
K 1 36  PRO 36  37  37  PRO PRO N . n 
K 1 37  ALA 37  38  38  ALA ALA N . n 
K 1 38  VAL 38  39  39  VAL VAL N . n 
K 1 39  TYR 39  40  40  TYR TYR N . n 
K 1 40  PHE 40  41  41  PHE PHE N . n 
K 1 41  GLY 41  42  42  GLY GLY N . n 
K 1 42  GLY 42  43  43  GLY GLY N . n 
K 1 43  LYS 43  44  44  LYS LYS N . n 
K 1 44  ALA 44  45  45  ALA ALA N . n 
K 1 45  ARG 45  46  46  ARG ARG N . n 
K 1 46  ILE 46  47  47  ILE ILE N . n 
K 1 47  ILE 47  48  48  ILE ILE N . n 
K 1 48  ASP 48  49  49  ASP ASP N . n 
K 1 49  PHE 49  50  50  PHE PHE N . n 
K 1 50  ALA 50  51  51  ALA ALA N . n 
K 1 51  LEU 51  52  52  LEU LEU N . n 
K 1 52  SER 52  53  53  SER SER N . n 
K 1 53  ASN 53  54  54  ASN ASN N . n 
K 1 54  ALA 54  55  55  ALA ALA N . n 
K 1 55  LEU 55  56  56  LEU LEU N . n 
K 1 56  ASN 56  57  57  ASN ASN N . n 
K 1 57  SER 57  58  58  SER SER N . n 
K 1 58  GLY 58  59  59  GLY GLY N . n 
K 1 59  ILE 59  60  60  ILE ILE N . n 
K 1 60  ARG 60  61  61  ARG ARG N . n 
K 1 61  ARG 61  62  62  ARG ARG N . n 
K 1 62  ILE 62  63  63  ILE ILE N . n 
K 1 63  GLY 63  64  64  GLY GLY N . n 
K 1 64  VAL 64  65  65  VAL VAL N . n 
K 1 65  ALA 65  66  66  ALA ALA N . n 
K 1 66  THR 66  67  67  THR THR N . n 
K 1 67  GLN 67  68  68  GLN GLN N . n 
K 1 68  TYR 68  69  69  TYR TYR N . n 
K 1 69  LYS 69  70  70  LYS LYS N . n 
K 1 70  ALA 70  71  71  ALA ALA N . n 
K 1 71  HIS 71  72  72  HIS HIS N . n 
K 1 72  SER 72  73  73  SER SER N . n 
K 1 73  LEU 73  74  74  LEU LEU N . n 
K 1 74  ILE 74  75  75  ILE ILE N . n 
K 1 75  ARG 75  76  76  ARG ARG N . n 
K 1 76  HIS 76  77  77  HIS HIS N . n 
K 1 77  LEU 77  78  78  LEU LEU N . n 
K 1 78  GLN 78  79  79  GLN GLN N . n 
K 1 79  ARG 79  80  80  ARG ARG N . n 
K 1 80  GLY 80  81  81  GLY GLY N . n 
K 1 81  TRP 81  82  82  TRP TRP N . n 
K 1 82  ASP 82  83  83  ASP ASP N . n 
K 1 83  PHE 83  84  84  PHE PHE N . n 
K 1 84  PHE 84  85  85  PHE PHE N . n 
K 1 85  ARG 85  86  86  ARG ARG N . n 
K 1 86  PRO 86  87  87  PRO PRO N . n 
K 1 87  GLU 87  88  88  GLU GLU N . n 
K 1 88  ARG 88  89  89  ARG ARG N . n 
K 1 89  ASN 89  90  90  ASN ASN N . n 
K 1 90  GLU 90  91  91  GLU GLU N . n 
K 1 91  SER 91  92  92  SER SER N . n 
K 1 92  PHE 92  93  93  PHE PHE N . n 
K 1 93  ASP 93  94  94  ASP ASP N . n 
K 1 94  ILE 94  95  95  ILE ILE N . n 
K 1 95  LEU 95  96  96  LEU LEU N . n 
K 1 96  PRO 96  97  97  PRO PRO N . n 
K 1 97  ALA 97  98  98  ALA ALA N . n 
K 1 98  SER 98  99  99  SER SER N . n 
K 1 99  GLN 99  100 100 GLN GLN N . n 
K 1 100 ARG 100 101 101 ARG ARG N . n 
K 1 101 VAL 101 102 102 VAL VAL N . n 
K 1 102 SER 102 103 103 SER SER N . n 
K 1 103 GLU 103 104 104 GLU GLU N . n 
K 1 104 THR 104 105 105 THR THR N . n 
K 1 105 GLN 105 106 106 GLN GLN N . n 
K 1 106 TRP 106 107 107 TRP TRP N . n 
K 1 107 TYR 107 108 108 TYR TYR N . n 
K 1 108 GLU 108 109 109 GLU GLU N . n 
K 1 109 GLY 109 110 110 GLY GLY N . n 
K 1 110 THR 110 111 111 THR THR N . n 
K 1 111 ALA 111 112 112 ALA ALA N . n 
K 1 112 ASP 112 113 113 ASP ASP N . n 
K 1 113 ALA 113 114 114 ALA ALA N . n 
K 1 114 VAL 114 115 115 VAL VAL N . n 
K 1 115 TYR 115 116 116 TYR TYR N . n 
K 1 116 GLN 116 117 117 GLN GLN N . n 
K 1 117 ASN 117 118 118 ASN ASN N . n 
K 1 118 ILE 118 119 119 ILE ILE N . n 
K 1 119 ASP 119 120 120 ASP ASP N . n 
K 1 120 ILE 120 121 121 ILE ILE N . n 
K 1 121 ILE 121 122 122 ILE ILE N . n 
K 1 122 GLU 122 123 123 GLU GLU N . n 
K 1 123 PRO 123 124 124 PRO PRO N . n 
K 1 124 TYR 124 125 125 TYR TYR N . n 
K 1 125 ALA 125 126 126 ALA ALA N . n 
K 1 126 PRO 126 127 127 PRO PRO N . n 
K 1 127 GLU 127 128 128 GLU GLU N . n 
K 1 128 TYR 128 129 129 TYR TYR N . n 
K 1 129 MET 129 130 130 MET MET N . n 
K 1 130 VAL 130 131 131 VAL VAL N . n 
K 1 131 ILE 131 132 132 ILE ILE N . n 
K 1 132 LEU 132 133 133 LEU LEU N . n 
K 1 133 ALA 133 134 134 ALA ALA N . n 
K 1 134 GLY 134 135 135 GLY GLY N . n 
K 1 135 ASP 135 136 136 ASP ASP N . n 
K 1 136 HIS 136 137 137 HIS HIS N . n 
K 1 137 ILE 137 138 138 ILE ILE N . n 
K 1 138 TYR 138 139 139 TYR TYR N . n 
K 1 139 LYS 139 140 140 LYS LYS N . n 
K 1 140 MET 140 141 141 MET MET N . n 
K 1 141 ASP 141 142 142 ASP ASP N . n 
K 1 142 TYR 142 143 143 TYR TYR N . n 
K 1 143 GLU 143 144 144 GLU GLU N . n 
K 1 144 TYR 144 145 145 TYR TYR N . n 
K 1 145 MET 145 146 146 MET MET N . n 
K 1 146 LEU 146 147 147 LEU LEU N . n 
K 1 147 GLN 147 148 148 GLN GLN N . n 
K 1 148 GLN 148 149 149 GLN GLN N . n 
K 1 149 HIS 149 150 150 HIS HIS N . n 
K 1 150 VAL 150 151 151 VAL VAL N . n 
K 1 151 ASP 151 152 152 ASP ASP N . n 
K 1 152 SER 152 153 153 SER SER N . n 
K 1 153 GLY 153 154 154 GLY GLY N . n 
K 1 154 ALA 154 155 155 ALA ALA N . n 
K 1 155 ASP 155 156 156 ASP ASP N . n 
K 1 156 VAL 156 157 157 VAL VAL N . n 
K 1 157 THR 157 158 158 THR THR N . n 
K 1 158 ILE 158 159 159 ILE ILE N . n 
K 1 159 GLY 159 160 160 GLY GLY N . n 
K 1 160 CYS 160 161 161 CYS CYS N . n 
K 1 161 LEU 161 162 162 LEU LEU N . n 
K 1 162 GLU 162 163 163 GLU GLU N . n 
K 1 163 VAL 163 164 164 VAL VAL N . n 
K 1 164 PRO 164 165 165 PRO PRO N . n 
K 1 165 ARG 165 166 166 ARG ARG N . n 
K 1 166 MET 166 167 167 MET MET N . n 
K 1 167 GLU 167 168 168 GLU GLU N . n 
K 1 168 ALA 168 169 169 ALA ALA N . n 
K 1 169 THR 169 170 170 THR THR N . n 
K 1 170 GLY 170 171 171 GLY GLY N . n 
K 1 171 PHE 171 172 172 PHE PHE N . n 
K 1 172 GLY 172 173 173 GLY GLY N . n 
K 1 173 VAL 173 174 174 VAL VAL N . n 
K 1 174 MET 174 175 175 MET MET N . n 
K 1 175 HIS 175 176 176 HIS HIS N . n 
K 1 176 VAL 176 177 177 VAL VAL N . n 
K 1 177 ASN 177 178 178 ASN ASN N . n 
K 1 178 GLU 178 179 179 GLU GLU N . n 
K 1 179 LYS 179 180 180 LYS LYS N . n 
K 1 180 ASP 180 181 181 ASP ASP N . n 
K 1 181 GLU 181 182 182 GLU GLU N . n 
K 1 182 ILE 182 183 183 ILE ILE N . n 
K 1 183 ILE 183 184 184 ILE ILE N . n 
K 1 184 ASP 184 185 185 ASP ASP N . n 
K 1 185 PHE 185 186 186 PHE PHE N . n 
K 1 186 ILE 186 187 187 ILE ILE N . n 
K 1 187 GLU 187 188 188 GLU GLU N . n 
K 1 188 LYS 188 189 189 LYS LYS N . n 
K 1 189 PRO 189 190 190 PRO PRO N . n 
K 1 190 ALA 190 191 191 ALA ALA N . n 
K 1 191 ASP 191 192 192 ASP ASP N . n 
K 1 192 PRO 192 193 193 PRO PRO N . n 
K 1 193 PRO 193 194 194 PRO PRO N . n 
K 1 194 GLY 194 195 195 GLY GLY N . n 
K 1 195 ILE 195 196 196 ILE ILE N . n 
K 1 196 PRO 196 197 197 PRO PRO N . n 
K 1 197 GLY 197 198 198 GLY GLY N . n 
K 1 198 ASN 198 199 199 ASN ASN N . n 
K 1 199 GLU 199 200 200 GLU GLU N . n 
K 1 200 GLY 200 201 201 GLY GLY N . n 
K 1 201 PHE 201 202 202 PHE PHE N . n 
K 1 202 ALA 202 203 203 ALA ALA N . n 
K 1 203 LEU 203 204 204 LEU LEU N . n 
K 1 204 ALA 204 205 205 ALA ALA N . n 
K 1 205 SER 205 206 206 SER SER N . n 
K 1 206 MET 206 207 207 MET MET N . n 
K 1 207 GLY 207 208 208 GLY GLY N . n 
K 1 208 ILE 208 209 209 ILE ILE N . n 
K 1 209 TYR 209 210 210 TYR TYR N . n 
K 1 210 VAL 210 211 211 VAL VAL N . n 
K 1 211 PHE 211 212 212 PHE PHE N . n 
K 1 212 HIS 212 213 213 HIS HIS N . n 
K 1 213 THR 213 214 214 THR THR N . n 
K 1 214 LYS 214 215 215 LYS LYS N . n 
K 1 215 PHE 215 216 216 PHE PHE N . n 
K 1 216 LEU 216 217 217 LEU LEU N . n 
K 1 217 MET 217 218 218 MET MET N . n 
K 1 218 GLU 218 219 219 GLU GLU N . n 
K 1 219 ALA 219 220 220 ALA ALA N . n 
K 1 220 LEU 220 221 221 LEU LEU N . n 
K 1 221 ARG 221 222 222 ARG ARG N . n 
K 1 222 ARG 222 223 223 ARG ARG N . n 
K 1 223 ASP 223 224 224 ASP ASP N . n 
K 1 224 ALA 224 225 225 ALA ALA N . n 
K 1 225 ALA 225 226 226 ALA ALA N . n 
K 1 226 ASP 226 227 227 ASP ASP N . n 
K 1 227 PRO 227 228 228 PRO PRO N . n 
K 1 228 THR 228 229 229 THR THR N . n 
K 1 229 SER 229 230 230 SER SER N . n 
K 1 230 SER 230 231 231 SER SER N . n 
K 1 231 ARG 231 232 232 ARG ARG N . n 
K 1 232 ASP 232 233 233 ASP ASP N . n 
K 1 233 PHE 233 234 234 PHE PHE N . n 
K 1 234 GLY 234 235 235 GLY GLY N . n 
K 1 235 LYS 235 236 236 LYS LYS N . n 
K 1 236 ASP 236 237 237 ASP ASP N . n 
K 1 237 ILE 237 238 238 ILE ILE N . n 
K 1 238 ILE 238 239 239 ILE ILE N . n 
K 1 239 PRO 239 240 240 PRO PRO N . n 
K 1 240 TYR 240 241 241 TYR TYR N . n 
K 1 241 ILE 241 242 242 ILE ILE N . n 
K 1 242 VAL 242 243 243 VAL VAL N . n 
K 1 243 GLU 243 244 244 GLU GLU N . n 
K 1 244 HIS 244 245 245 HIS HIS N . n 
K 1 245 GLY 245 246 246 GLY GLY N . n 
K 1 246 LYS 246 247 247 LYS LYS N . n 
K 1 247 ALA 247 248 248 ALA ALA N . n 
K 1 248 VAL 248 249 249 VAL VAL N . n 
K 1 249 ALA 249 250 250 ALA ALA N . n 
K 1 250 HIS 250 251 251 HIS HIS N . n 
K 1 251 ARG 251 252 252 ARG ARG N . n 
K 1 252 PHE 252 253 253 PHE PHE N . n 
K 1 253 ALA 253 254 254 ALA ALA N . n 
K 1 254 ASP 254 255 255 ASP ASP N . n 
K 1 255 SER 255 256 256 SER SER N . n 
K 1 256 CYS 256 257 257 CYS CYS N . n 
K 1 257 VAL 257 258 258 VAL VAL N . n 
K 1 258 ARG 258 259 259 ARG ARG N . n 
K 1 259 SER 259 260 260 SER SER N . n 
K 1 260 ASP 260 261 261 ASP ASP N . n 
K 1 261 PHE 261 262 262 PHE PHE N . n 
K 1 262 GLU 262 263 263 GLU GLU N . n 
K 1 263 HIS 263 264 264 HIS HIS N . n 
K 1 264 GLU 264 265 265 GLU GLU N . n 
K 1 265 PRO 265 266 266 PRO PRO N . n 
K 1 266 TYR 266 267 267 TYR TYR N . n 
K 1 267 TRP 267 268 268 TRP TRP N . n 
K 1 268 ARG 268 269 269 ARG ARG N . n 
K 1 269 ASP 269 270 270 ASP ASP N . n 
K 1 270 VAL 270 271 271 VAL VAL N . n 
K 1 271 GLY 271 272 272 GLY GLY N . n 
K 1 272 THR 272 273 273 THR THR N . n 
K 1 273 ILE 273 274 274 ILE ILE N . n 
K 1 274 ASP 274 275 275 ASP ASP N . n 
K 1 275 ALA 275 276 276 ALA ALA N . n 
K 1 276 TYR 276 277 277 TYR TYR N . n 
K 1 277 TRP 277 278 278 TRP TRP N . n 
K 1 278 GLN 278 279 279 GLN GLN N . n 
K 1 279 ALA 279 280 280 ALA ALA N . n 
K 1 280 ASN 280 281 281 ASN ASN N . n 
K 1 281 ILE 281 282 282 ILE ILE N . n 
K 1 282 ASP 282 283 283 ASP ASP N . n 
K 1 283 LEU 283 284 284 LEU LEU N . n 
K 1 284 THR 284 285 285 THR THR N . n 
K 1 285 ASP 285 286 286 ASP ASP N . n 
K 1 286 VAL 286 287 287 VAL VAL N . n 
K 1 287 VAL 287 288 288 VAL VAL N . n 
K 1 288 PRO 288 289 289 PRO PRO N . n 
K 1 289 ASP 289 290 290 ASP ASP N . n 
K 1 290 LEU 290 291 291 LEU LEU N . n 
K 1 291 ASP 291 292 292 ASP ASP N . n 
K 1 292 ILE 292 293 293 ILE ILE N . n 
K 1 293 TYR 293 294 294 TYR TYR N . n 
K 1 294 ASP 294 295 295 ASP ASP N . n 
K 1 295 LYS 295 296 296 LYS LYS N . n 
K 1 296 SER 296 297 297 SER SER N . n 
K 1 297 TRP 297 298 298 TRP TRP N . n 
K 1 298 PRO 298 299 299 PRO PRO N . n 
K 1 299 ILE 299 300 300 ILE ILE N . n 
K 1 300 TRP 300 301 301 TRP TRP N . n 
K 1 301 THR 301 302 302 THR THR N . n 
K 1 302 TYR 302 303 303 TYR TYR N . n 
K 1 303 ALA 303 304 304 ALA ALA N . n 
K 1 304 GLU 304 305 305 GLU GLU N . n 
K 1 305 ILE 305 306 306 ILE ILE N . n 
K 1 306 THR 306 307 307 THR THR N . n 
K 1 307 PRO 307 308 308 PRO PRO N . n 
K 1 308 PRO 308 309 309 PRO PRO N . n 
K 1 309 ALA 309 310 310 ALA ALA N . n 
K 1 310 LYS 310 311 311 LYS LYS N . n 
K 1 311 PHE 311 312 312 PHE PHE N . n 
K 1 312 VAL 312 313 313 VAL VAL N . n 
K 1 313 HIS 313 314 314 HIS HIS N . n 
K 1 314 ASP 314 315 315 ASP ASP N . n 
K 1 315 ASP 315 316 316 ASP ASP N . n 
K 1 316 GLU 316 317 317 GLU GLU N . n 
K 1 317 ASP 317 318 318 ASP ASP N . n 
K 1 318 ARG 318 319 319 ARG ARG N . n 
K 1 319 ARG 319 320 320 ARG ARG N . n 
K 1 320 GLY 320 321 321 GLY GLY N . n 
K 1 321 SER 321 322 322 SER SER N . n 
K 1 322 ALA 322 323 323 ALA ALA N . n 
K 1 323 VAL 323 324 324 VAL VAL N . n 
K 1 324 SER 324 325 325 SER SER N . n 
K 1 325 SER 325 326 326 SER SER N . n 
K 1 326 VAL 326 327 327 VAL VAL N . n 
K 1 327 VAL 327 328 328 VAL VAL N . n 
K 1 328 SER 328 329 329 SER SER N . n 
K 1 329 GLY 329 330 330 GLY GLY N . n 
K 1 330 ASP 330 331 331 ASP ASP N . n 
K 1 331 CYS 331 332 332 CYS CYS N . n 
K 1 332 ILE 332 333 333 ILE ILE N . n 
K 1 333 ILE 333 334 334 ILE ILE N . n 
K 1 334 SER 334 335 335 SER SER N . n 
K 1 335 GLY 335 336 336 GLY GLY N . n 
K 1 336 ALA 336 337 337 ALA ALA N . n 
K 1 337 ALA 337 338 338 ALA ALA N . n 
K 1 338 LEU 338 339 339 LEU LEU N . n 
K 1 339 ASN 339 340 340 ASN ASN N . n 
K 1 340 ARG 340 341 341 ARG ARG N . n 
K 1 341 SER 341 342 342 SER SER N . n 
K 1 342 LEU 342 343 343 LEU LEU N . n 
K 1 343 LEU 343 344 344 LEU LEU N . n 
K 1 344 PHE 344 345 345 PHE PHE N . n 
K 1 345 THR 345 346 346 THR THR N . n 
K 1 346 GLY 346 347 347 GLY GLY N . n 
K 1 347 VAL 347 348 348 VAL VAL N . n 
K 1 348 ARG 348 349 349 ARG ARG N . n 
K 1 349 ALA 349 350 350 ALA ALA N . n 
K 1 350 ASN 350 351 351 ASN ASN N . n 
K 1 351 SER 351 352 352 SER SER N . n 
K 1 352 TYR 352 353 353 TYR TYR N . n 
K 1 353 SER 353 354 354 SER SER N . n 
K 1 354 ARG 354 355 355 ARG ARG N . n 
K 1 355 LEU 355 356 356 LEU LEU N . n 
K 1 356 GLU 356 357 357 GLU GLU N . n 
K 1 357 ASN 357 358 358 ASN ASN N . n 
K 1 358 ALA 358 359 359 ALA ALA N . n 
K 1 359 VAL 359 360 360 VAL VAL N . n 
K 1 360 VAL 360 361 361 VAL VAL N . n 
K 1 361 LEU 361 362 362 LEU LEU N . n 
K 1 362 PRO 362 363 363 PRO PRO N . n 
K 1 363 SER 363 364 364 SER SER N . n 
K 1 364 VAL 364 365 365 VAL VAL N . n 
K 1 365 LYS 365 366 366 LYS LYS N . n 
K 1 366 ILE 366 367 367 ILE ILE N . n 
K 1 367 GLY 367 368 368 GLY GLY N . n 
K 1 368 ARG 368 369 369 ARG ARG N . n 
K 1 369 HIS 369 370 370 HIS HIS N . n 
K 1 370 ALA 370 371 371 ALA ALA N . n 
K 1 371 GLN 371 372 372 GLN GLN N . n 
K 1 372 LEU 372 373 373 LEU LEU N . n 
K 1 373 SER 373 374 374 SER SER N . n 
K 1 374 ASN 374 375 375 ASN ASN N . n 
K 1 375 VAL 375 376 376 VAL VAL N . n 
K 1 376 VAL 376 377 377 VAL VAL N . n 
K 1 377 ILE 377 378 378 ILE ILE N . n 
K 1 378 ASP 378 379 379 ASP ASP N . n 
K 1 379 HIS 379 380 380 HIS HIS N . n 
K 1 380 GLY 380 381 381 GLY GLY N . n 
K 1 381 VAL 381 382 382 VAL VAL N . n 
K 1 382 VAL 382 383 383 VAL VAL N . n 
K 1 383 ILE 383 384 384 ILE ILE N . n 
K 1 384 PRO 384 385 385 PRO PRO N . n 
K 1 385 GLU 385 386 386 GLU GLU N . n 
K 1 386 GLY 386 387 387 GLY GLY N . n 
K 1 387 LEU 387 388 388 LEU LEU N . n 
K 1 388 ILE 388 389 389 ILE ILE N . n 
K 1 389 VAL 389 390 390 VAL VAL N . n 
K 1 390 GLY 390 391 391 GLY GLY N . n 
K 1 391 GLU 391 392 392 GLU GLU N . n 
K 1 392 ASP 392 393 393 ASP ASP N . n 
K 1 393 PRO 393 394 394 PRO PRO N . n 
K 1 394 GLU 394 395 395 GLU GLU N . n 
K 1 395 LEU 395 396 396 LEU LEU N . n 
K 1 396 ASP 396 397 397 ASP ASP N . n 
K 1 397 ALA 397 398 398 ALA ALA N . n 
K 1 398 LYS 398 399 399 LYS LYS N . n 
K 1 399 ARG 399 400 400 ARG ARG N . n 
K 1 400 PHE 400 401 401 PHE PHE N . n 
K 1 401 ARG 401 402 402 ARG ARG N . n 
K 1 402 ARG 402 403 403 ARG ARG N . n 
K 1 403 THR 403 404 404 THR THR N . n 
K 1 404 GLU 404 405 405 GLU GLU N . n 
K 1 405 SER 405 406 406 SER SER N . n 
K 1 406 GLY 406 407 407 GLY GLY N . n 
K 1 407 ILE 407 408 408 ILE ILE N . n 
K 1 408 CYS 408 409 409 CYS CYS N . n 
K 1 409 LEU 409 410 410 LEU LEU N . n 
K 1 410 ILE 410 411 411 ILE ILE N . n 
K 1 411 THR 411 412 412 THR THR N . n 
K 1 412 GLN 412 413 413 GLN GLN N . n 
K 1 413 SER 413 414 414 SER SER N . n 
K 1 414 MET 414 415 415 MET MET N . n 
K 1 415 ILE 415 416 416 ILE ILE N . n 
K 1 416 ASP 416 417 417 ASP ASP N . n 
K 1 417 LYS 417 418 418 LYS LYS N . n 
K 1 418 LEU 418 419 419 LEU LEU N . n 
K 1 419 ASP 419 420 420 ASP ASP N . n 
K 1 420 LEU 420 421 421 LEU LEU N . n 
L 1 1   MET 1   2   ?   ?   ?   O . n 
L 1 2   SER 2   3   ?   ?   ?   O . n 
L 1 3   GLU 3   4   ?   ?   ?   O . n 
L 1 4   LYS 4   5   ?   ?   ?   O . n 
L 1 5   ARG 5   6   ?   ?   ?   O . n 
L 1 6   VAL 6   7   7   VAL VAL O . n 
L 1 7   GLN 7   8   8   GLN GLN O . n 
L 1 8   PRO 8   9   9   PRO PRO O . n 
L 1 9   LEU 9   10  10  LEU LEU O . n 
L 1 10  ALA 10  11  11  ALA ALA O . n 
L 1 11  ARG 11  12  12  ARG ARG O . n 
L 1 12  ASP 12  13  13  ASP ASP O . n 
L 1 13  ALA 13  14  14  ALA ALA O . n 
L 1 14  MET 14  15  15  MET MET O . n 
L 1 15  ALA 15  16  16  ALA ALA O . n 
L 1 16  TYR 16  17  17  TYR TYR O . n 
L 1 17  VAL 17  18  18  VAL VAL O . n 
L 1 18  LEU 18  19  19  LEU LEU O . n 
L 1 19  ALA 19  20  20  ALA ALA O . n 
L 1 20  GLY 20  21  21  GLY GLY O . n 
L 1 21  GLY 21  22  22  GLY GLY O . n 
L 1 22  ARG 22  23  23  ARG ARG O . n 
L 1 23  GLY 23  24  24  GLY GLY O . n 
L 1 24  SER 24  25  25  SER SER O . n 
L 1 25  ARG 25  26  26  ARG ARG O . n 
L 1 26  LEU 26  27  27  LEU LEU O . n 
L 1 27  LYS 27  28  28  LYS LYS O . n 
L 1 28  GLU 28  29  29  GLU GLU O . n 
L 1 29  LEU 29  30  30  LEU LEU O . n 
L 1 30  THR 30  31  31  THR THR O . n 
L 1 31  ASP 31  32  32  ASP ASP O . n 
L 1 32  ARG 32  33  33  ARG ARG O . n 
L 1 33  ARG 33  34  34  ARG ARG O . n 
L 1 34  ALA 34  35  35  ALA ALA O . n 
L 1 35  LYS 35  36  36  LYS LYS O . n 
L 1 36  PRO 36  37  37  PRO PRO O . n 
L 1 37  ALA 37  38  38  ALA ALA O . n 
L 1 38  VAL 38  39  39  VAL VAL O . n 
L 1 39  TYR 39  40  40  TYR TYR O . n 
L 1 40  PHE 40  41  41  PHE PHE O . n 
L 1 41  GLY 41  42  42  GLY GLY O . n 
L 1 42  GLY 42  43  43  GLY GLY O . n 
L 1 43  LYS 43  44  44  LYS LYS O . n 
L 1 44  ALA 44  45  45  ALA ALA O . n 
L 1 45  ARG 45  46  46  ARG ARG O . n 
L 1 46  ILE 46  47  47  ILE ILE O . n 
L 1 47  ILE 47  48  48  ILE ILE O . n 
L 1 48  ASP 48  49  49  ASP ASP O . n 
L 1 49  PHE 49  50  50  PHE PHE O . n 
L 1 50  ALA 50  51  51  ALA ALA O . n 
L 1 51  LEU 51  52  52  LEU LEU O . n 
L 1 52  SER 52  53  53  SER SER O . n 
L 1 53  ASN 53  54  54  ASN ASN O . n 
L 1 54  ALA 54  55  55  ALA ALA O . n 
L 1 55  LEU 55  56  56  LEU LEU O . n 
L 1 56  ASN 56  57  57  ASN ASN O . n 
L 1 57  SER 57  58  58  SER SER O . n 
L 1 58  GLY 58  59  59  GLY GLY O . n 
L 1 59  ILE 59  60  60  ILE ILE O . n 
L 1 60  ARG 60  61  61  ARG ARG O . n 
L 1 61  ARG 61  62  62  ARG ARG O . n 
L 1 62  ILE 62  63  63  ILE ILE O . n 
L 1 63  GLY 63  64  64  GLY GLY O . n 
L 1 64  VAL 64  65  65  VAL VAL O . n 
L 1 65  ALA 65  66  66  ALA ALA O . n 
L 1 66  THR 66  67  67  THR THR O . n 
L 1 67  GLN 67  68  68  GLN GLN O . n 
L 1 68  TYR 68  69  69  TYR TYR O . n 
L 1 69  LYS 69  70  70  LYS LYS O . n 
L 1 70  ALA 70  71  71  ALA ALA O . n 
L 1 71  HIS 71  72  72  HIS HIS O . n 
L 1 72  SER 72  73  73  SER SER O . n 
L 1 73  LEU 73  74  74  LEU LEU O . n 
L 1 74  ILE 74  75  75  ILE ILE O . n 
L 1 75  ARG 75  76  76  ARG ARG O . n 
L 1 76  HIS 76  77  77  HIS HIS O . n 
L 1 77  LEU 77  78  78  LEU LEU O . n 
L 1 78  GLN 78  79  79  GLN GLN O . n 
L 1 79  ARG 79  80  80  ARG ARG O . n 
L 1 80  GLY 80  81  81  GLY GLY O . n 
L 1 81  TRP 81  82  82  TRP TRP O . n 
L 1 82  ASP 82  83  83  ASP ASP O . n 
L 1 83  PHE 83  84  84  PHE PHE O . n 
L 1 84  PHE 84  85  85  PHE PHE O . n 
L 1 85  ARG 85  86  86  ARG ARG O . n 
L 1 86  PRO 86  87  87  PRO PRO O . n 
L 1 87  GLU 87  88  88  GLU GLU O . n 
L 1 88  ARG 88  89  89  ARG ARG O . n 
L 1 89  ASN 89  90  90  ASN ASN O . n 
L 1 90  GLU 90  91  91  GLU GLU O . n 
L 1 91  SER 91  92  92  SER SER O . n 
L 1 92  PHE 92  93  93  PHE PHE O . n 
L 1 93  ASP 93  94  94  ASP ASP O . n 
L 1 94  ILE 94  95  95  ILE ILE O . n 
L 1 95  LEU 95  96  96  LEU LEU O . n 
L 1 96  PRO 96  97  97  PRO PRO O . n 
L 1 97  ALA 97  98  98  ALA ALA O . n 
L 1 98  SER 98  99  99  SER SER O . n 
L 1 99  GLN 99  100 100 GLN GLN O . n 
L 1 100 ARG 100 101 ?   ?   ?   O . n 
L 1 101 VAL 101 102 ?   ?   ?   O . n 
L 1 102 SER 102 103 ?   ?   ?   O . n 
L 1 103 GLU 103 104 ?   ?   ?   O . n 
L 1 104 THR 104 105 105 THR THR O . n 
L 1 105 GLN 105 106 106 GLN GLN O . n 
L 1 106 TRP 106 107 107 TRP TRP O . n 
L 1 107 TYR 107 108 108 TYR TYR O . n 
L 1 108 GLU 108 109 109 GLU GLU O . n 
L 1 109 GLY 109 110 110 GLY GLY O . n 
L 1 110 THR 110 111 111 THR THR O . n 
L 1 111 ALA 111 112 112 ALA ALA O . n 
L 1 112 ASP 112 113 113 ASP ASP O . n 
L 1 113 ALA 113 114 114 ALA ALA O . n 
L 1 114 VAL 114 115 115 VAL VAL O . n 
L 1 115 TYR 115 116 116 TYR TYR O . n 
L 1 116 GLN 116 117 117 GLN GLN O . n 
L 1 117 ASN 117 118 118 ASN ASN O . n 
L 1 118 ILE 118 119 119 ILE ILE O . n 
L 1 119 ASP 119 120 120 ASP ASP O . n 
L 1 120 ILE 120 121 121 ILE ILE O . n 
L 1 121 ILE 121 122 122 ILE ILE O . n 
L 1 122 GLU 122 123 123 GLU GLU O . n 
L 1 123 PRO 123 124 124 PRO PRO O . n 
L 1 124 TYR 124 125 125 TYR TYR O . n 
L 1 125 ALA 125 126 126 ALA ALA O . n 
L 1 126 PRO 126 127 127 PRO PRO O . n 
L 1 127 GLU 127 128 128 GLU GLU O . n 
L 1 128 TYR 128 129 129 TYR TYR O . n 
L 1 129 MET 129 130 130 MET MET O . n 
L 1 130 VAL 130 131 131 VAL VAL O . n 
L 1 131 ILE 131 132 132 ILE ILE O . n 
L 1 132 LEU 132 133 133 LEU LEU O . n 
L 1 133 ALA 133 134 134 ALA ALA O . n 
L 1 134 GLY 134 135 135 GLY GLY O . n 
L 1 135 ASP 135 136 136 ASP ASP O . n 
L 1 136 HIS 136 137 137 HIS HIS O . n 
L 1 137 ILE 137 138 138 ILE ILE O . n 
L 1 138 TYR 138 139 139 TYR TYR O . n 
L 1 139 LYS 139 140 140 LYS LYS O . n 
L 1 140 MET 140 141 141 MET MET O . n 
L 1 141 ASP 141 142 142 ASP ASP O . n 
L 1 142 TYR 142 143 143 TYR TYR O . n 
L 1 143 GLU 143 144 144 GLU GLU O . n 
L 1 144 TYR 144 145 145 TYR TYR O . n 
L 1 145 MET 145 146 146 MET MET O . n 
L 1 146 LEU 146 147 147 LEU LEU O . n 
L 1 147 GLN 147 148 148 GLN GLN O . n 
L 1 148 GLN 148 149 149 GLN GLN O . n 
L 1 149 HIS 149 150 150 HIS HIS O . n 
L 1 150 VAL 150 151 151 VAL VAL O . n 
L 1 151 ASP 151 152 152 ASP ASP O . n 
L 1 152 SER 152 153 153 SER SER O . n 
L 1 153 GLY 153 154 154 GLY GLY O . n 
L 1 154 ALA 154 155 155 ALA ALA O . n 
L 1 155 ASP 155 156 156 ASP ASP O . n 
L 1 156 VAL 156 157 157 VAL VAL O . n 
L 1 157 THR 157 158 158 THR THR O . n 
L 1 158 ILE 158 159 159 ILE ILE O . n 
L 1 159 GLY 159 160 160 GLY GLY O . n 
L 1 160 CYS 160 161 161 CYS CYS O . n 
L 1 161 LEU 161 162 162 LEU LEU O . n 
L 1 162 GLU 162 163 163 GLU GLU O . n 
L 1 163 VAL 163 164 164 VAL VAL O . n 
L 1 164 PRO 164 165 165 PRO PRO O . n 
L 1 165 ARG 165 166 166 ARG ARG O . n 
L 1 166 MET 166 167 167 MET MET O . n 
L 1 167 GLU 167 168 168 GLU GLU O . n 
L 1 168 ALA 168 169 169 ALA ALA O . n 
L 1 169 THR 169 170 170 THR THR O . n 
L 1 170 GLY 170 171 171 GLY GLY O . n 
L 1 171 PHE 171 172 172 PHE PHE O . n 
L 1 172 GLY 172 173 173 GLY GLY O . n 
L 1 173 VAL 173 174 174 VAL VAL O . n 
L 1 174 MET 174 175 175 MET MET O . n 
L 1 175 HIS 175 176 176 HIS HIS O . n 
L 1 176 VAL 176 177 177 VAL VAL O . n 
L 1 177 ASN 177 178 178 ASN ASN O . n 
L 1 178 GLU 178 179 179 GLU GLU O . n 
L 1 179 LYS 179 180 180 LYS LYS O . n 
L 1 180 ASP 180 181 181 ASP ASP O . n 
L 1 181 GLU 181 182 182 GLU GLU O . n 
L 1 182 ILE 182 183 183 ILE ILE O . n 
L 1 183 ILE 183 184 184 ILE ILE O . n 
L 1 184 ASP 184 185 185 ASP ASP O . n 
L 1 185 PHE 185 186 186 PHE PHE O . n 
L 1 186 ILE 186 187 187 ILE ILE O . n 
L 1 187 GLU 187 188 188 GLU GLU O . n 
L 1 188 LYS 188 189 189 LYS LYS O . n 
L 1 189 PRO 189 190 190 PRO PRO O . n 
L 1 190 ALA 190 191 191 ALA ALA O . n 
L 1 191 ASP 191 192 192 ASP ASP O . n 
L 1 192 PRO 192 193 193 PRO PRO O . n 
L 1 193 PRO 193 194 194 PRO PRO O . n 
L 1 194 GLY 194 195 195 GLY GLY O . n 
L 1 195 ILE 195 196 196 ILE ILE O . n 
L 1 196 PRO 196 197 197 PRO PRO O . n 
L 1 197 GLY 197 198 198 GLY GLY O . n 
L 1 198 ASN 198 199 199 ASN ASN O . n 
L 1 199 GLU 199 200 200 GLU GLU O . n 
L 1 200 GLY 200 201 201 GLY GLY O . n 
L 1 201 PHE 201 202 202 PHE PHE O . n 
L 1 202 ALA 202 203 203 ALA ALA O . n 
L 1 203 LEU 203 204 204 LEU LEU O . n 
L 1 204 ALA 204 205 205 ALA ALA O . n 
L 1 205 SER 205 206 206 SER SER O . n 
L 1 206 MET 206 207 207 MET MET O . n 
L 1 207 GLY 207 208 208 GLY GLY O . n 
L 1 208 ILE 208 209 209 ILE ILE O . n 
L 1 209 TYR 209 210 210 TYR TYR O . n 
L 1 210 VAL 210 211 211 VAL VAL O . n 
L 1 211 PHE 211 212 212 PHE PHE O . n 
L 1 212 HIS 212 213 213 HIS HIS O . n 
L 1 213 THR 213 214 214 THR THR O . n 
L 1 214 LYS 214 215 215 LYS LYS O . n 
L 1 215 PHE 215 216 216 PHE PHE O . n 
L 1 216 LEU 216 217 217 LEU LEU O . n 
L 1 217 MET 217 218 218 MET MET O . n 
L 1 218 GLU 218 219 219 GLU GLU O . n 
L 1 219 ALA 219 220 220 ALA ALA O . n 
L 1 220 LEU 220 221 221 LEU LEU O . n 
L 1 221 ARG 221 222 222 ARG ARG O . n 
L 1 222 ARG 222 223 223 ARG ARG O . n 
L 1 223 ASP 223 224 224 ASP ASP O . n 
L 1 224 ALA 224 225 225 ALA ALA O . n 
L 1 225 ALA 225 226 226 ALA ALA O . n 
L 1 226 ASP 226 227 227 ASP ASP O . n 
L 1 227 PRO 227 228 228 PRO PRO O . n 
L 1 228 THR 228 229 229 THR THR O . n 
L 1 229 SER 229 230 230 SER SER O . n 
L 1 230 SER 230 231 231 SER SER O . n 
L 1 231 ARG 231 232 232 ARG ARG O . n 
L 1 232 ASP 232 233 233 ASP ASP O . n 
L 1 233 PHE 233 234 234 PHE PHE O . n 
L 1 234 GLY 234 235 235 GLY GLY O . n 
L 1 235 LYS 235 236 236 LYS LYS O . n 
L 1 236 ASP 236 237 237 ASP ASP O . n 
L 1 237 ILE 237 238 238 ILE ILE O . n 
L 1 238 ILE 238 239 239 ILE ILE O . n 
L 1 239 PRO 239 240 240 PRO PRO O . n 
L 1 240 TYR 240 241 241 TYR TYR O . n 
L 1 241 ILE 241 242 242 ILE ILE O . n 
L 1 242 VAL 242 243 243 VAL VAL O . n 
L 1 243 GLU 243 244 244 GLU GLU O . n 
L 1 244 HIS 244 245 245 HIS HIS O . n 
L 1 245 GLY 245 246 246 GLY GLY O . n 
L 1 246 LYS 246 247 247 LYS LYS O . n 
L 1 247 ALA 247 248 248 ALA ALA O . n 
L 1 248 VAL 248 249 249 VAL VAL O . n 
L 1 249 ALA 249 250 250 ALA ALA O . n 
L 1 250 HIS 250 251 251 HIS HIS O . n 
L 1 251 ARG 251 252 252 ARG ARG O . n 
L 1 252 PHE 252 253 253 PHE PHE O . n 
L 1 253 ALA 253 254 254 ALA ALA O . n 
L 1 254 ASP 254 255 255 ASP ASP O . n 
L 1 255 SER 255 256 256 SER SER O . n 
L 1 256 CYS 256 257 257 CYS CYS O . n 
L 1 257 VAL 257 258 258 VAL VAL O . n 
L 1 258 ARG 258 259 259 ARG ARG O . n 
L 1 259 SER 259 260 260 SER SER O . n 
L 1 260 ASP 260 261 261 ASP ASP O . n 
L 1 261 PHE 261 262 262 PHE PHE O . n 
L 1 262 GLU 262 263 263 GLU GLU O . n 
L 1 263 HIS 263 264 264 HIS HIS O . n 
L 1 264 GLU 264 265 265 GLU GLU O . n 
L 1 265 PRO 265 266 266 PRO PRO O . n 
L 1 266 TYR 266 267 267 TYR TYR O . n 
L 1 267 TRP 267 268 268 TRP TRP O . n 
L 1 268 ARG 268 269 269 ARG ARG O . n 
L 1 269 ASP 269 270 270 ASP ASP O . n 
L 1 270 VAL 270 271 271 VAL VAL O . n 
L 1 271 GLY 271 272 272 GLY GLY O . n 
L 1 272 THR 272 273 273 THR THR O . n 
L 1 273 ILE 273 274 274 ILE ILE O . n 
L 1 274 ASP 274 275 275 ASP ASP O . n 
L 1 275 ALA 275 276 276 ALA ALA O . n 
L 1 276 TYR 276 277 277 TYR TYR O . n 
L 1 277 TRP 277 278 278 TRP TRP O . n 
L 1 278 GLN 278 279 279 GLN GLN O . n 
L 1 279 ALA 279 280 280 ALA ALA O . n 
L 1 280 ASN 280 281 281 ASN ASN O . n 
L 1 281 ILE 281 282 282 ILE ILE O . n 
L 1 282 ASP 282 283 283 ASP ASP O . n 
L 1 283 LEU 283 284 284 LEU LEU O . n 
L 1 284 THR 284 285 285 THR THR O . n 
L 1 285 ASP 285 286 286 ASP ASP O . n 
L 1 286 VAL 286 287 287 VAL VAL O . n 
L 1 287 VAL 287 288 288 VAL VAL O . n 
L 1 288 PRO 288 289 289 PRO PRO O . n 
L 1 289 ASP 289 290 290 ASP ASP O . n 
L 1 290 LEU 290 291 291 LEU LEU O . n 
L 1 291 ASP 291 292 292 ASP ASP O . n 
L 1 292 ILE 292 293 293 ILE ILE O . n 
L 1 293 TYR 293 294 294 TYR TYR O . n 
L 1 294 ASP 294 295 295 ASP ASP O . n 
L 1 295 LYS 295 296 296 LYS LYS O . n 
L 1 296 SER 296 297 297 SER SER O . n 
L 1 297 TRP 297 298 298 TRP TRP O . n 
L 1 298 PRO 298 299 299 PRO PRO O . n 
L 1 299 ILE 299 300 300 ILE ILE O . n 
L 1 300 TRP 300 301 301 TRP TRP O . n 
L 1 301 THR 301 302 302 THR THR O . n 
L 1 302 TYR 302 303 303 TYR TYR O . n 
L 1 303 ALA 303 304 304 ALA ALA O . n 
L 1 304 GLU 304 305 305 GLU GLU O . n 
L 1 305 ILE 305 306 306 ILE ILE O . n 
L 1 306 THR 306 307 307 THR THR O . n 
L 1 307 PRO 307 308 308 PRO PRO O . n 
L 1 308 PRO 308 309 309 PRO PRO O . n 
L 1 309 ALA 309 310 310 ALA ALA O . n 
L 1 310 LYS 310 311 311 LYS LYS O . n 
L 1 311 PHE 311 312 312 PHE PHE O . n 
L 1 312 VAL 312 313 313 VAL VAL O . n 
L 1 313 HIS 313 314 314 HIS HIS O . n 
L 1 314 ASP 314 315 315 ASP ASP O . n 
L 1 315 ASP 315 316 316 ASP ASP O . n 
L 1 316 GLU 316 317 317 GLU GLU O . n 
L 1 317 ASP 317 318 318 ASP ASP O . n 
L 1 318 ARG 318 319 319 ARG ARG O . n 
L 1 319 ARG 319 320 320 ARG ARG O . n 
L 1 320 GLY 320 321 321 GLY GLY O . n 
L 1 321 SER 321 322 322 SER SER O . n 
L 1 322 ALA 322 323 323 ALA ALA O . n 
L 1 323 VAL 323 324 324 VAL VAL O . n 
L 1 324 SER 324 325 325 SER SER O . n 
L 1 325 SER 325 326 326 SER SER O . n 
L 1 326 VAL 326 327 327 VAL VAL O . n 
L 1 327 VAL 327 328 328 VAL VAL O . n 
L 1 328 SER 328 329 329 SER SER O . n 
L 1 329 GLY 329 330 330 GLY GLY O . n 
L 1 330 ASP 330 331 331 ASP ASP O . n 
L 1 331 CYS 331 332 332 CYS CYS O . n 
L 1 332 ILE 332 333 333 ILE ILE O . n 
L 1 333 ILE 333 334 334 ILE ILE O . n 
L 1 334 SER 334 335 335 SER SER O . n 
L 1 335 GLY 335 336 336 GLY GLY O . n 
L 1 336 ALA 336 337 337 ALA ALA O . n 
L 1 337 ALA 337 338 338 ALA ALA O . n 
L 1 338 LEU 338 339 339 LEU LEU O . n 
L 1 339 ASN 339 340 340 ASN ASN O . n 
L 1 340 ARG 340 341 341 ARG ARG O . n 
L 1 341 SER 341 342 342 SER SER O . n 
L 1 342 LEU 342 343 343 LEU LEU O . n 
L 1 343 LEU 343 344 344 LEU LEU O . n 
L 1 344 PHE 344 345 345 PHE PHE O . n 
L 1 345 THR 345 346 346 THR THR O . n 
L 1 346 GLY 346 347 347 GLY GLY O . n 
L 1 347 VAL 347 348 348 VAL VAL O . n 
L 1 348 ARG 348 349 349 ARG ARG O . n 
L 1 349 ALA 349 350 350 ALA ALA O . n 
L 1 350 ASN 350 351 351 ASN ASN O . n 
L 1 351 SER 351 352 352 SER SER O . n 
L 1 352 TYR 352 353 353 TYR TYR O . n 
L 1 353 SER 353 354 354 SER SER O . n 
L 1 354 ARG 354 355 355 ARG ARG O . n 
L 1 355 LEU 355 356 356 LEU LEU O . n 
L 1 356 GLU 356 357 357 GLU GLU O . n 
L 1 357 ASN 357 358 358 ASN ASN O . n 
L 1 358 ALA 358 359 359 ALA ALA O . n 
L 1 359 VAL 359 360 360 VAL VAL O . n 
L 1 360 VAL 360 361 361 VAL VAL O . n 
L 1 361 LEU 361 362 362 LEU LEU O . n 
L 1 362 PRO 362 363 363 PRO PRO O . n 
L 1 363 SER 363 364 364 SER SER O . n 
L 1 364 VAL 364 365 365 VAL VAL O . n 
L 1 365 LYS 365 366 366 LYS LYS O . n 
L 1 366 ILE 366 367 367 ILE ILE O . n 
L 1 367 GLY 367 368 368 GLY GLY O . n 
L 1 368 ARG 368 369 369 ARG ARG O . n 
L 1 369 HIS 369 370 370 HIS HIS O . n 
L 1 370 ALA 370 371 371 ALA ALA O . n 
L 1 371 GLN 371 372 372 GLN GLN O . n 
L 1 372 LEU 372 373 373 LEU LEU O . n 
L 1 373 SER 373 374 374 SER SER O . n 
L 1 374 ASN 374 375 375 ASN ASN O . n 
L 1 375 VAL 375 376 376 VAL VAL O . n 
L 1 376 VAL 376 377 377 VAL VAL O . n 
L 1 377 ILE 377 378 378 ILE ILE O . n 
L 1 378 ASP 378 379 379 ASP ASP O . n 
L 1 379 HIS 379 380 380 HIS HIS O . n 
L 1 380 GLY 380 381 381 GLY GLY O . n 
L 1 381 VAL 381 382 382 VAL VAL O . n 
L 1 382 VAL 382 383 383 VAL VAL O . n 
L 1 383 ILE 383 384 384 ILE ILE O . n 
L 1 384 PRO 384 385 385 PRO PRO O . n 
L 1 385 GLU 385 386 386 GLU GLU O . n 
L 1 386 GLY 386 387 387 GLY GLY O . n 
L 1 387 LEU 387 388 388 LEU LEU O . n 
L 1 388 ILE 388 389 389 ILE ILE O . n 
L 1 389 VAL 389 390 390 VAL VAL O . n 
L 1 390 GLY 390 391 391 GLY GLY O . n 
L 1 391 GLU 391 392 392 GLU GLU O . n 
L 1 392 ASP 392 393 393 ASP ASP O . n 
L 1 393 PRO 393 394 394 PRO PRO O . n 
L 1 394 GLU 394 395 395 GLU GLU O . n 
L 1 395 LEU 395 396 396 LEU LEU O . n 
L 1 396 ASP 396 397 397 ASP ASP O . n 
L 1 397 ALA 397 398 398 ALA ALA O . n 
L 1 398 LYS 398 399 399 LYS LYS O . n 
L 1 399 ARG 399 400 400 ARG ARG O . n 
L 1 400 PHE 400 401 401 PHE PHE O . n 
L 1 401 ARG 401 402 402 ARG ARG O . n 
L 1 402 ARG 402 403 403 ARG ARG O . n 
L 1 403 THR 403 404 404 THR THR O . n 
L 1 404 GLU 404 405 405 GLU GLU O . n 
L 1 405 SER 405 406 406 SER SER O . n 
L 1 406 GLY 406 407 407 GLY GLY O . n 
L 1 407 ILE 407 408 408 ILE ILE O . n 
L 1 408 CYS 408 409 409 CYS CYS O . n 
L 1 409 LEU 409 410 410 LEU LEU O . n 
L 1 410 ILE 410 411 411 ILE ILE O . n 
L 1 411 THR 411 412 412 THR THR O . n 
L 1 412 GLN 412 413 413 GLN GLN O . n 
L 1 413 SER 413 414 414 SER SER O . n 
L 1 414 MET 414 415 415 MET MET O . n 
L 1 415 ILE 415 416 416 ILE ILE O . n 
L 1 416 ASP 416 417 417 ASP ASP O . n 
L 1 417 LYS 417 418 418 LYS LYS O . n 
L 1 418 LEU 418 419 419 LEU LEU O . n 
L 1 419 ASP 419 420 420 ASP ASP O . n 
L 1 420 LEU 420 421 421 LEU LEU O . n 
M 1 1   MET 1   2   ?   ?   ?   P . n 
M 1 2   SER 2   3   ?   ?   ?   P . n 
M 1 3   GLU 3   4   ?   ?   ?   P . n 
M 1 4   LYS 4   5   ?   ?   ?   P . n 
M 1 5   ARG 5   6   ?   ?   ?   P . n 
M 1 6   VAL 6   7   7   VAL VAL P . n 
M 1 7   GLN 7   8   8   GLN GLN P . n 
M 1 8   PRO 8   9   9   PRO PRO P . n 
M 1 9   LEU 9   10  10  LEU LEU P . n 
M 1 10  ALA 10  11  11  ALA ALA P . n 
M 1 11  ARG 11  12  12  ARG ARG P . n 
M 1 12  ASP 12  13  13  ASP ASP P . n 
M 1 13  ALA 13  14  14  ALA ALA P . n 
M 1 14  MET 14  15  15  MET MET P . n 
M 1 15  ALA 15  16  16  ALA ALA P . n 
M 1 16  TYR 16  17  17  TYR TYR P . n 
M 1 17  VAL 17  18  18  VAL VAL P . n 
M 1 18  LEU 18  19  19  LEU LEU P . n 
M 1 19  ALA 19  20  20  ALA ALA P . n 
M 1 20  GLY 20  21  21  GLY GLY P . n 
M 1 21  GLY 21  22  22  GLY GLY P . n 
M 1 22  ARG 22  23  23  ARG ARG P . n 
M 1 23  GLY 23  24  24  GLY GLY P . n 
M 1 24  SER 24  25  25  SER SER P . n 
M 1 25  ARG 25  26  26  ARG ARG P . n 
M 1 26  LEU 26  27  27  LEU LEU P . n 
M 1 27  LYS 27  28  28  LYS LYS P . n 
M 1 28  GLU 28  29  29  GLU GLU P . n 
M 1 29  LEU 29  30  30  LEU LEU P . n 
M 1 30  THR 30  31  31  THR THR P . n 
M 1 31  ASP 31  32  32  ASP ASP P . n 
M 1 32  ARG 32  33  33  ARG ARG P . n 
M 1 33  ARG 33  34  34  ARG ARG P . n 
M 1 34  ALA 34  35  35  ALA ALA P . n 
M 1 35  LYS 35  36  36  LYS LYS P . n 
M 1 36  PRO 36  37  37  PRO PRO P . n 
M 1 37  ALA 37  38  38  ALA ALA P . n 
M 1 38  VAL 38  39  39  VAL VAL P . n 
M 1 39  TYR 39  40  40  TYR TYR P . n 
M 1 40  PHE 40  41  41  PHE PHE P . n 
M 1 41  GLY 41  42  42  GLY GLY P . n 
M 1 42  GLY 42  43  43  GLY GLY P . n 
M 1 43  LYS 43  44  44  LYS LYS P . n 
M 1 44  ALA 44  45  45  ALA ALA P . n 
M 1 45  ARG 45  46  46  ARG ARG P . n 
M 1 46  ILE 46  47  47  ILE ILE P . n 
M 1 47  ILE 47  48  48  ILE ILE P . n 
M 1 48  ASP 48  49  49  ASP ASP P . n 
M 1 49  PHE 49  50  50  PHE PHE P . n 
M 1 50  ALA 50  51  51  ALA ALA P . n 
M 1 51  LEU 51  52  52  LEU LEU P . n 
M 1 52  SER 52  53  53  SER SER P . n 
M 1 53  ASN 53  54  54  ASN ASN P . n 
M 1 54  ALA 54  55  55  ALA ALA P . n 
M 1 55  LEU 55  56  56  LEU LEU P . n 
M 1 56  ASN 56  57  57  ASN ASN P . n 
M 1 57  SER 57  58  58  SER SER P . n 
M 1 58  GLY 58  59  59  GLY GLY P . n 
M 1 59  ILE 59  60  60  ILE ILE P . n 
M 1 60  ARG 60  61  61  ARG ARG P . n 
M 1 61  ARG 61  62  62  ARG ARG P . n 
M 1 62  ILE 62  63  63  ILE ILE P . n 
M 1 63  GLY 63  64  64  GLY GLY P . n 
M 1 64  VAL 64  65  65  VAL VAL P . n 
M 1 65  ALA 65  66  66  ALA ALA P . n 
M 1 66  THR 66  67  67  THR THR P . n 
M 1 67  GLN 67  68  68  GLN GLN P . n 
M 1 68  TYR 68  69  69  TYR TYR P . n 
M 1 69  LYS 69  70  70  LYS LYS P . n 
M 1 70  ALA 70  71  71  ALA ALA P . n 
M 1 71  HIS 71  72  72  HIS HIS P . n 
M 1 72  SER 72  73  73  SER SER P . n 
M 1 73  LEU 73  74  74  LEU LEU P . n 
M 1 74  ILE 74  75  75  ILE ILE P . n 
M 1 75  ARG 75  76  76  ARG ARG P . n 
M 1 76  HIS 76  77  77  HIS HIS P . n 
M 1 77  LEU 77  78  78  LEU LEU P . n 
M 1 78  GLN 78  79  79  GLN GLN P . n 
M 1 79  ARG 79  80  80  ARG ARG P . n 
M 1 80  GLY 80  81  81  GLY GLY P . n 
M 1 81  TRP 81  82  82  TRP TRP P . n 
M 1 82  ASP 82  83  83  ASP ASP P . n 
M 1 83  PHE 83  84  84  PHE PHE P . n 
M 1 84  PHE 84  85  85  PHE PHE P . n 
M 1 85  ARG 85  86  86  ARG ARG P . n 
M 1 86  PRO 86  87  87  PRO PRO P . n 
M 1 87  GLU 87  88  88  GLU GLU P . n 
M 1 88  ARG 88  89  89  ARG ARG P . n 
M 1 89  ASN 89  90  90  ASN ASN P . n 
M 1 90  GLU 90  91  91  GLU GLU P . n 
M 1 91  SER 91  92  92  SER SER P . n 
M 1 92  PHE 92  93  93  PHE PHE P . n 
M 1 93  ASP 93  94  94  ASP ASP P . n 
M 1 94  ILE 94  95  95  ILE ILE P . n 
M 1 95  LEU 95  96  96  LEU LEU P . n 
M 1 96  PRO 96  97  97  PRO PRO P . n 
M 1 97  ALA 97  98  98  ALA ALA P . n 
M 1 98  SER 98  99  ?   ?   ?   P . n 
M 1 99  GLN 99  100 ?   ?   ?   P . n 
M 1 100 ARG 100 101 ?   ?   ?   P . n 
M 1 101 VAL 101 102 ?   ?   ?   P . n 
M 1 102 SER 102 103 ?   ?   ?   P . n 
M 1 103 GLU 103 104 ?   ?   ?   P . n 
M 1 104 THR 104 105 105 THR THR P . n 
M 1 105 GLN 105 106 106 GLN GLN P . n 
M 1 106 TRP 106 107 107 TRP TRP P . n 
M 1 107 TYR 107 108 108 TYR TYR P . n 
M 1 108 GLU 108 109 109 GLU GLU P . n 
M 1 109 GLY 109 110 110 GLY GLY P . n 
M 1 110 THR 110 111 111 THR THR P . n 
M 1 111 ALA 111 112 112 ALA ALA P . n 
M 1 112 ASP 112 113 113 ASP ASP P . n 
M 1 113 ALA 113 114 114 ALA ALA P . n 
M 1 114 VAL 114 115 115 VAL VAL P . n 
M 1 115 TYR 115 116 116 TYR TYR P . n 
M 1 116 GLN 116 117 117 GLN GLN P . n 
M 1 117 ASN 117 118 118 ASN ASN P . n 
M 1 118 ILE 118 119 119 ILE ILE P . n 
M 1 119 ASP 119 120 120 ASP ASP P . n 
M 1 120 ILE 120 121 121 ILE ILE P . n 
M 1 121 ILE 121 122 122 ILE ILE P . n 
M 1 122 GLU 122 123 123 GLU GLU P . n 
M 1 123 PRO 123 124 124 PRO PRO P . n 
M 1 124 TYR 124 125 125 TYR TYR P . n 
M 1 125 ALA 125 126 126 ALA ALA P . n 
M 1 126 PRO 126 127 127 PRO PRO P . n 
M 1 127 GLU 127 128 128 GLU GLU P . n 
M 1 128 TYR 128 129 129 TYR TYR P . n 
M 1 129 MET 129 130 130 MET MET P . n 
M 1 130 VAL 130 131 131 VAL VAL P . n 
M 1 131 ILE 131 132 132 ILE ILE P . n 
M 1 132 LEU 132 133 133 LEU LEU P . n 
M 1 133 ALA 133 134 134 ALA ALA P . n 
M 1 134 GLY 134 135 135 GLY GLY P . n 
M 1 135 ASP 135 136 136 ASP ASP P . n 
M 1 136 HIS 136 137 137 HIS HIS P . n 
M 1 137 ILE 137 138 138 ILE ILE P . n 
M 1 138 TYR 138 139 139 TYR TYR P . n 
M 1 139 LYS 139 140 140 LYS LYS P . n 
M 1 140 MET 140 141 141 MET MET P . n 
M 1 141 ASP 141 142 142 ASP ASP P . n 
M 1 142 TYR 142 143 143 TYR TYR P . n 
M 1 143 GLU 143 144 144 GLU GLU P . n 
M 1 144 TYR 144 145 145 TYR TYR P . n 
M 1 145 MET 145 146 146 MET MET P . n 
M 1 146 LEU 146 147 147 LEU LEU P . n 
M 1 147 GLN 147 148 148 GLN GLN P . n 
M 1 148 GLN 148 149 149 GLN GLN P . n 
M 1 149 HIS 149 150 150 HIS HIS P . n 
M 1 150 VAL 150 151 151 VAL VAL P . n 
M 1 151 ASP 151 152 152 ASP ASP P . n 
M 1 152 SER 152 153 153 SER SER P . n 
M 1 153 GLY 153 154 154 GLY GLY P . n 
M 1 154 ALA 154 155 155 ALA ALA P . n 
M 1 155 ASP 155 156 156 ASP ASP P . n 
M 1 156 VAL 156 157 157 VAL VAL P . n 
M 1 157 THR 157 158 158 THR THR P . n 
M 1 158 ILE 158 159 159 ILE ILE P . n 
M 1 159 GLY 159 160 160 GLY GLY P . n 
M 1 160 CYS 160 161 161 CYS CYS P . n 
M 1 161 LEU 161 162 162 LEU LEU P . n 
M 1 162 GLU 162 163 163 GLU GLU P . n 
M 1 163 VAL 163 164 164 VAL VAL P . n 
M 1 164 PRO 164 165 165 PRO PRO P . n 
M 1 165 ARG 165 166 166 ARG ARG P . n 
M 1 166 MET 166 167 167 MET MET P . n 
M 1 167 GLU 167 168 168 GLU GLU P . n 
M 1 168 ALA 168 169 169 ALA ALA P . n 
M 1 169 THR 169 170 170 THR THR P . n 
M 1 170 GLY 170 171 171 GLY GLY P . n 
M 1 171 PHE 171 172 172 PHE PHE P . n 
M 1 172 GLY 172 173 173 GLY GLY P . n 
M 1 173 VAL 173 174 174 VAL VAL P . n 
M 1 174 MET 174 175 175 MET MET P . n 
M 1 175 HIS 175 176 176 HIS HIS P . n 
M 1 176 VAL 176 177 177 VAL VAL P . n 
M 1 177 ASN 177 178 178 ASN ASN P . n 
M 1 178 GLU 178 179 179 GLU GLU P . n 
M 1 179 LYS 179 180 180 LYS LYS P . n 
M 1 180 ASP 180 181 181 ASP ASP P . n 
M 1 181 GLU 181 182 182 GLU GLU P . n 
M 1 182 ILE 182 183 183 ILE ILE P . n 
M 1 183 ILE 183 184 184 ILE ILE P . n 
M 1 184 ASP 184 185 185 ASP ASP P . n 
M 1 185 PHE 185 186 186 PHE PHE P . n 
M 1 186 ILE 186 187 187 ILE ILE P . n 
M 1 187 GLU 187 188 188 GLU GLU P . n 
M 1 188 LYS 188 189 189 LYS LYS P . n 
M 1 189 PRO 189 190 190 PRO PRO P . n 
M 1 190 ALA 190 191 191 ALA ALA P . n 
M 1 191 ASP 191 192 192 ASP ASP P . n 
M 1 192 PRO 192 193 193 PRO PRO P . n 
M 1 193 PRO 193 194 194 PRO PRO P . n 
M 1 194 GLY 194 195 195 GLY GLY P . n 
M 1 195 ILE 195 196 196 ILE ILE P . n 
M 1 196 PRO 196 197 197 PRO PRO P . n 
M 1 197 GLY 197 198 198 GLY GLY P . n 
M 1 198 ASN 198 199 199 ASN ASN P . n 
M 1 199 GLU 199 200 200 GLU GLU P . n 
M 1 200 GLY 200 201 201 GLY GLY P . n 
M 1 201 PHE 201 202 202 PHE PHE P . n 
M 1 202 ALA 202 203 203 ALA ALA P . n 
M 1 203 LEU 203 204 204 LEU LEU P . n 
M 1 204 ALA 204 205 205 ALA ALA P . n 
M 1 205 SER 205 206 206 SER SER P . n 
M 1 206 MET 206 207 207 MET MET P . n 
M 1 207 GLY 207 208 208 GLY GLY P . n 
M 1 208 ILE 208 209 209 ILE ILE P . n 
M 1 209 TYR 209 210 210 TYR TYR P . n 
M 1 210 VAL 210 211 211 VAL VAL P . n 
M 1 211 PHE 211 212 212 PHE PHE P . n 
M 1 212 HIS 212 213 213 HIS HIS P . n 
M 1 213 THR 213 214 214 THR THR P . n 
M 1 214 LYS 214 215 215 LYS LYS P . n 
M 1 215 PHE 215 216 216 PHE PHE P . n 
M 1 216 LEU 216 217 217 LEU LEU P . n 
M 1 217 MET 217 218 218 MET MET P . n 
M 1 218 GLU 218 219 219 GLU GLU P . n 
M 1 219 ALA 219 220 220 ALA ALA P . n 
M 1 220 LEU 220 221 221 LEU LEU P . n 
M 1 221 ARG 221 222 222 ARG ARG P . n 
M 1 222 ARG 222 223 223 ARG ARG P . n 
M 1 223 ASP 223 224 224 ASP ASP P . n 
M 1 224 ALA 224 225 225 ALA ALA P . n 
M 1 225 ALA 225 226 226 ALA ALA P . n 
M 1 226 ASP 226 227 227 ASP ASP P . n 
M 1 227 PRO 227 228 228 PRO PRO P . n 
M 1 228 THR 228 229 229 THR THR P . n 
M 1 229 SER 229 230 230 SER SER P . n 
M 1 230 SER 230 231 231 SER SER P . n 
M 1 231 ARG 231 232 232 ARG ARG P . n 
M 1 232 ASP 232 233 233 ASP ASP P . n 
M 1 233 PHE 233 234 234 PHE PHE P . n 
M 1 234 GLY 234 235 235 GLY GLY P . n 
M 1 235 LYS 235 236 236 LYS LYS P . n 
M 1 236 ASP 236 237 237 ASP ASP P . n 
M 1 237 ILE 237 238 238 ILE ILE P . n 
M 1 238 ILE 238 239 239 ILE ILE P . n 
M 1 239 PRO 239 240 240 PRO PRO P . n 
M 1 240 TYR 240 241 241 TYR TYR P . n 
M 1 241 ILE 241 242 242 ILE ILE P . n 
M 1 242 VAL 242 243 243 VAL VAL P . n 
M 1 243 GLU 243 244 244 GLU GLU P . n 
M 1 244 HIS 244 245 245 HIS HIS P . n 
M 1 245 GLY 245 246 246 GLY GLY P . n 
M 1 246 LYS 246 247 247 LYS LYS P . n 
M 1 247 ALA 247 248 248 ALA ALA P . n 
M 1 248 VAL 248 249 249 VAL VAL P . n 
M 1 249 ALA 249 250 250 ALA ALA P . n 
M 1 250 HIS 250 251 251 HIS HIS P . n 
M 1 251 ARG 251 252 252 ARG ARG P . n 
M 1 252 PHE 252 253 253 PHE PHE P . n 
M 1 253 ALA 253 254 254 ALA ALA P . n 
M 1 254 ASP 254 255 255 ASP ASP P . n 
M 1 255 SER 255 256 256 SER SER P . n 
M 1 256 CYS 256 257 257 CYS CYS P . n 
M 1 257 VAL 257 258 258 VAL VAL P . n 
M 1 258 ARG 258 259 259 ARG ARG P . n 
M 1 259 SER 259 260 260 SER SER P . n 
M 1 260 ASP 260 261 261 ASP ASP P . n 
M 1 261 PHE 261 262 262 PHE PHE P . n 
M 1 262 GLU 262 263 263 GLU GLU P . n 
M 1 263 HIS 263 264 264 HIS HIS P . n 
M 1 264 GLU 264 265 265 GLU GLU P . n 
M 1 265 PRO 265 266 266 PRO PRO P . n 
M 1 266 TYR 266 267 267 TYR TYR P . n 
M 1 267 TRP 267 268 268 TRP TRP P . n 
M 1 268 ARG 268 269 269 ARG ARG P . n 
M 1 269 ASP 269 270 270 ASP ASP P . n 
M 1 270 VAL 270 271 271 VAL VAL P . n 
M 1 271 GLY 271 272 272 GLY GLY P . n 
M 1 272 THR 272 273 273 THR THR P . n 
M 1 273 ILE 273 274 274 ILE ILE P . n 
M 1 274 ASP 274 275 275 ASP ASP P . n 
M 1 275 ALA 275 276 276 ALA ALA P . n 
M 1 276 TYR 276 277 277 TYR TYR P . n 
M 1 277 TRP 277 278 278 TRP TRP P . n 
M 1 278 GLN 278 279 279 GLN GLN P . n 
M 1 279 ALA 279 280 280 ALA ALA P . n 
M 1 280 ASN 280 281 281 ASN ASN P . n 
M 1 281 ILE 281 282 282 ILE ILE P . n 
M 1 282 ASP 282 283 283 ASP ASP P . n 
M 1 283 LEU 283 284 284 LEU LEU P . n 
M 1 284 THR 284 285 285 THR THR P . n 
M 1 285 ASP 285 286 286 ASP ASP P . n 
M 1 286 VAL 286 287 287 VAL VAL P . n 
M 1 287 VAL 287 288 288 VAL VAL P . n 
M 1 288 PRO 288 289 289 PRO PRO P . n 
M 1 289 ASP 289 290 290 ASP ASP P . n 
M 1 290 LEU 290 291 291 LEU LEU P . n 
M 1 291 ASP 291 292 292 ASP ASP P . n 
M 1 292 ILE 292 293 293 ILE ILE P . n 
M 1 293 TYR 293 294 294 TYR TYR P . n 
M 1 294 ASP 294 295 295 ASP ASP P . n 
M 1 295 LYS 295 296 296 LYS LYS P . n 
M 1 296 SER 296 297 297 SER SER P . n 
M 1 297 TRP 297 298 298 TRP TRP P . n 
M 1 298 PRO 298 299 299 PRO PRO P . n 
M 1 299 ILE 299 300 300 ILE ILE P . n 
M 1 300 TRP 300 301 301 TRP TRP P . n 
M 1 301 THR 301 302 302 THR THR P . n 
M 1 302 TYR 302 303 303 TYR TYR P . n 
M 1 303 ALA 303 304 304 ALA ALA P . n 
M 1 304 GLU 304 305 305 GLU GLU P . n 
M 1 305 ILE 305 306 306 ILE ILE P . n 
M 1 306 THR 306 307 307 THR THR P . n 
M 1 307 PRO 307 308 308 PRO PRO P . n 
M 1 308 PRO 308 309 309 PRO PRO P . n 
M 1 309 ALA 309 310 310 ALA ALA P . n 
M 1 310 LYS 310 311 311 LYS LYS P . n 
M 1 311 PHE 311 312 312 PHE PHE P . n 
M 1 312 VAL 312 313 313 VAL VAL P . n 
M 1 313 HIS 313 314 314 HIS HIS P . n 
M 1 314 ASP 314 315 315 ASP ASP P . n 
M 1 315 ASP 315 316 316 ASP ASP P . n 
M 1 316 GLU 316 317 317 GLU GLU P . n 
M 1 317 ASP 317 318 318 ASP ASP P . n 
M 1 318 ARG 318 319 319 ARG ARG P . n 
M 1 319 ARG 319 320 320 ARG ARG P . n 
M 1 320 GLY 320 321 321 GLY GLY P . n 
M 1 321 SER 321 322 322 SER SER P . n 
M 1 322 ALA 322 323 323 ALA ALA P . n 
M 1 323 VAL 323 324 324 VAL VAL P . n 
M 1 324 SER 324 325 325 SER SER P . n 
M 1 325 SER 325 326 326 SER SER P . n 
M 1 326 VAL 326 327 327 VAL VAL P . n 
M 1 327 VAL 327 328 328 VAL VAL P . n 
M 1 328 SER 328 329 329 SER SER P . n 
M 1 329 GLY 329 330 330 GLY GLY P . n 
M 1 330 ASP 330 331 331 ASP ASP P . n 
M 1 331 CYS 331 332 332 CYS CYS P . n 
M 1 332 ILE 332 333 333 ILE ILE P . n 
M 1 333 ILE 333 334 334 ILE ILE P . n 
M 1 334 SER 334 335 335 SER SER P . n 
M 1 335 GLY 335 336 336 GLY GLY P . n 
M 1 336 ALA 336 337 337 ALA ALA P . n 
M 1 337 ALA 337 338 338 ALA ALA P . n 
M 1 338 LEU 338 339 339 LEU LEU P . n 
M 1 339 ASN 339 340 340 ASN ASN P . n 
M 1 340 ARG 340 341 341 ARG ARG P . n 
M 1 341 SER 341 342 342 SER SER P . n 
M 1 342 LEU 342 343 343 LEU LEU P . n 
M 1 343 LEU 343 344 344 LEU LEU P . n 
M 1 344 PHE 344 345 345 PHE PHE P . n 
M 1 345 THR 345 346 346 THR THR P . n 
M 1 346 GLY 346 347 347 GLY GLY P . n 
M 1 347 VAL 347 348 348 VAL VAL P . n 
M 1 348 ARG 348 349 349 ARG ARG P . n 
M 1 349 ALA 349 350 350 ALA ALA P . n 
M 1 350 ASN 350 351 351 ASN ASN P . n 
M 1 351 SER 351 352 352 SER SER P . n 
M 1 352 TYR 352 353 353 TYR TYR P . n 
M 1 353 SER 353 354 354 SER SER P . n 
M 1 354 ARG 354 355 355 ARG ARG P . n 
M 1 355 LEU 355 356 356 LEU LEU P . n 
M 1 356 GLU 356 357 357 GLU GLU P . n 
M 1 357 ASN 357 358 358 ASN ASN P . n 
M 1 358 ALA 358 359 359 ALA ALA P . n 
M 1 359 VAL 359 360 360 VAL VAL P . n 
M 1 360 VAL 360 361 361 VAL VAL P . n 
M 1 361 LEU 361 362 362 LEU LEU P . n 
M 1 362 PRO 362 363 363 PRO PRO P . n 
M 1 363 SER 363 364 364 SER SER P . n 
M 1 364 VAL 364 365 365 VAL VAL P . n 
M 1 365 LYS 365 366 366 LYS LYS P . n 
M 1 366 ILE 366 367 367 ILE ILE P . n 
M 1 367 GLY 367 368 368 GLY GLY P . n 
M 1 368 ARG 368 369 369 ARG ARG P . n 
M 1 369 HIS 369 370 370 HIS HIS P . n 
M 1 370 ALA 370 371 371 ALA ALA P . n 
M 1 371 GLN 371 372 372 GLN GLN P . n 
M 1 372 LEU 372 373 373 LEU LEU P . n 
M 1 373 SER 373 374 374 SER SER P . n 
M 1 374 ASN 374 375 375 ASN ASN P . n 
M 1 375 VAL 375 376 376 VAL VAL P . n 
M 1 376 VAL 376 377 377 VAL VAL P . n 
M 1 377 ILE 377 378 378 ILE ILE P . n 
M 1 378 ASP 378 379 379 ASP ASP P . n 
M 1 379 HIS 379 380 380 HIS HIS P . n 
M 1 380 GLY 380 381 381 GLY GLY P . n 
M 1 381 VAL 381 382 382 VAL VAL P . n 
M 1 382 VAL 382 383 383 VAL VAL P . n 
M 1 383 ILE 383 384 384 ILE ILE P . n 
M 1 384 PRO 384 385 385 PRO PRO P . n 
M 1 385 GLU 385 386 386 GLU GLU P . n 
M 1 386 GLY 386 387 387 GLY GLY P . n 
M 1 387 LEU 387 388 388 LEU LEU P . n 
M 1 388 ILE 388 389 389 ILE ILE P . n 
M 1 389 VAL 389 390 390 VAL VAL P . n 
M 1 390 GLY 390 391 391 GLY GLY P . n 
M 1 391 GLU 391 392 392 GLU GLU P . n 
M 1 392 ASP 392 393 393 ASP ASP P . n 
M 1 393 PRO 393 394 394 PRO PRO P . n 
M 1 394 GLU 394 395 395 GLU GLU P . n 
M 1 395 LEU 395 396 396 LEU LEU P . n 
M 1 396 ASP 396 397 397 ASP ASP P . n 
M 1 397 ALA 397 398 398 ALA ALA P . n 
M 1 398 LYS 398 399 399 LYS LYS P . n 
M 1 399 ARG 399 400 400 ARG ARG P . n 
M 1 400 PHE 400 401 401 PHE PHE P . n 
M 1 401 ARG 401 402 402 ARG ARG P . n 
M 1 402 ARG 402 403 403 ARG ARG P . n 
M 1 403 THR 403 404 404 THR THR P . n 
M 1 404 GLU 404 405 405 GLU GLU P . n 
M 1 405 SER 405 406 406 SER SER P . n 
M 1 406 GLY 406 407 407 GLY GLY P . n 
M 1 407 ILE 407 408 408 ILE ILE P . n 
M 1 408 CYS 408 409 409 CYS CYS P . n 
M 1 409 LEU 409 410 410 LEU LEU P . n 
M 1 410 ILE 410 411 411 ILE ILE P . n 
M 1 411 THR 411 412 412 THR THR P . n 
M 1 412 GLN 412 413 413 GLN GLN P . n 
M 1 413 SER 413 414 414 SER SER P . n 
M 1 414 MET 414 415 415 MET MET P . n 
M 1 415 ILE 415 416 416 ILE ILE P . n 
M 1 416 ASP 416 417 417 ASP ASP P . n 
M 1 417 LYS 417 418 418 LYS LYS P . n 
M 1 418 LEU 418 419 419 LEU LEU P . n 
M 1 419 ASP 419 420 420 ASP ASP P . n 
M 1 420 LEU 420 421 421 LEU LEU P . n 
N 1 1   MET 1   2   ?   ?   ?   Q . n 
N 1 2   SER 2   3   ?   ?   ?   Q . n 
N 1 3   GLU 3   4   ?   ?   ?   Q . n 
N 1 4   LYS 4   5   ?   ?   ?   Q . n 
N 1 5   ARG 5   6   ?   ?   ?   Q . n 
N 1 6   VAL 6   7   7   VAL VAL Q . n 
N 1 7   GLN 7   8   8   GLN GLN Q . n 
N 1 8   PRO 8   9   9   PRO PRO Q . n 
N 1 9   LEU 9   10  10  LEU LEU Q . n 
N 1 10  ALA 10  11  11  ALA ALA Q . n 
N 1 11  ARG 11  12  12  ARG ARG Q . n 
N 1 12  ASP 12  13  13  ASP ASP Q . n 
N 1 13  ALA 13  14  14  ALA ALA Q . n 
N 1 14  MET 14  15  15  MET MET Q . n 
N 1 15  ALA 15  16  16  ALA ALA Q . n 
N 1 16  TYR 16  17  17  TYR TYR Q . n 
N 1 17  VAL 17  18  18  VAL VAL Q . n 
N 1 18  LEU 18  19  19  LEU LEU Q . n 
N 1 19  ALA 19  20  20  ALA ALA Q . n 
N 1 20  GLY 20  21  21  GLY GLY Q . n 
N 1 21  GLY 21  22  22  GLY GLY Q . n 
N 1 22  ARG 22  23  23  ARG ARG Q . n 
N 1 23  GLY 23  24  24  GLY GLY Q . n 
N 1 24  SER 24  25  25  SER SER Q . n 
N 1 25  ARG 25  26  26  ARG ARG Q . n 
N 1 26  LEU 26  27  27  LEU LEU Q . n 
N 1 27  LYS 27  28  28  LYS LYS Q . n 
N 1 28  GLU 28  29  29  GLU GLU Q . n 
N 1 29  LEU 29  30  30  LEU LEU Q . n 
N 1 30  THR 30  31  31  THR THR Q . n 
N 1 31  ASP 31  32  32  ASP ASP Q . n 
N 1 32  ARG 32  33  33  ARG ARG Q . n 
N 1 33  ARG 33  34  34  ARG ARG Q . n 
N 1 34  ALA 34  35  35  ALA ALA Q . n 
N 1 35  LYS 35  36  36  LYS LYS Q . n 
N 1 36  PRO 36  37  37  PRO PRO Q . n 
N 1 37  ALA 37  38  38  ALA ALA Q . n 
N 1 38  VAL 38  39  39  VAL VAL Q . n 
N 1 39  TYR 39  40  40  TYR TYR Q . n 
N 1 40  PHE 40  41  41  PHE PHE Q . n 
N 1 41  GLY 41  42  42  GLY GLY Q . n 
N 1 42  GLY 42  43  43  GLY GLY Q . n 
N 1 43  LYS 43  44  44  LYS LYS Q . n 
N 1 44  ALA 44  45  45  ALA ALA Q . n 
N 1 45  ARG 45  46  46  ARG ARG Q . n 
N 1 46  ILE 46  47  47  ILE ILE Q . n 
N 1 47  ILE 47  48  48  ILE ILE Q . n 
N 1 48  ASP 48  49  49  ASP ASP Q . n 
N 1 49  PHE 49  50  50  PHE PHE Q . n 
N 1 50  ALA 50  51  51  ALA ALA Q . n 
N 1 51  LEU 51  52  52  LEU LEU Q . n 
N 1 52  SER 52  53  53  SER SER Q . n 
N 1 53  ASN 53  54  54  ASN ASN Q . n 
N 1 54  ALA 54  55  55  ALA ALA Q . n 
N 1 55  LEU 55  56  56  LEU LEU Q . n 
N 1 56  ASN 56  57  57  ASN ASN Q . n 
N 1 57  SER 57  58  58  SER SER Q . n 
N 1 58  GLY 58  59  59  GLY GLY Q . n 
N 1 59  ILE 59  60  60  ILE ILE Q . n 
N 1 60  ARG 60  61  61  ARG ARG Q . n 
N 1 61  ARG 61  62  62  ARG ARG Q . n 
N 1 62  ILE 62  63  63  ILE ILE Q . n 
N 1 63  GLY 63  64  64  GLY GLY Q . n 
N 1 64  VAL 64  65  65  VAL VAL Q . n 
N 1 65  ALA 65  66  66  ALA ALA Q . n 
N 1 66  THR 66  67  67  THR THR Q . n 
N 1 67  GLN 67  68  68  GLN GLN Q . n 
N 1 68  TYR 68  69  69  TYR TYR Q . n 
N 1 69  LYS 69  70  70  LYS LYS Q . n 
N 1 70  ALA 70  71  71  ALA ALA Q . n 
N 1 71  HIS 71  72  72  HIS HIS Q . n 
N 1 72  SER 72  73  73  SER SER Q . n 
N 1 73  LEU 73  74  74  LEU LEU Q . n 
N 1 74  ILE 74  75  75  ILE ILE Q . n 
N 1 75  ARG 75  76  76  ARG ARG Q . n 
N 1 76  HIS 76  77  77  HIS HIS Q . n 
N 1 77  LEU 77  78  78  LEU LEU Q . n 
N 1 78  GLN 78  79  79  GLN GLN Q . n 
N 1 79  ARG 79  80  80  ARG ARG Q . n 
N 1 80  GLY 80  81  81  GLY GLY Q . n 
N 1 81  TRP 81  82  82  TRP TRP Q . n 
N 1 82  ASP 82  83  83  ASP ASP Q . n 
N 1 83  PHE 83  84  84  PHE PHE Q . n 
N 1 84  PHE 84  85  85  PHE PHE Q . n 
N 1 85  ARG 85  86  86  ARG ARG Q . n 
N 1 86  PRO 86  87  87  PRO PRO Q . n 
N 1 87  GLU 87  88  88  GLU GLU Q . n 
N 1 88  ARG 88  89  89  ARG ARG Q . n 
N 1 89  ASN 89  90  90  ASN ASN Q . n 
N 1 90  GLU 90  91  91  GLU GLU Q . n 
N 1 91  SER 91  92  92  SER SER Q . n 
N 1 92  PHE 92  93  93  PHE PHE Q . n 
N 1 93  ASP 93  94  94  ASP ASP Q . n 
N 1 94  ILE 94  95  95  ILE ILE Q . n 
N 1 95  LEU 95  96  96  LEU LEU Q . n 
N 1 96  PRO 96  97  97  PRO PRO Q . n 
N 1 97  ALA 97  98  98  ALA ALA Q . n 
N 1 98  SER 98  99  ?   ?   ?   Q . n 
N 1 99  GLN 99  100 ?   ?   ?   Q . n 
N 1 100 ARG 100 101 ?   ?   ?   Q . n 
N 1 101 VAL 101 102 ?   ?   ?   Q . n 
N 1 102 SER 102 103 ?   ?   ?   Q . n 
N 1 103 GLU 103 104 ?   ?   ?   Q . n 
N 1 104 THR 104 105 105 THR THR Q . n 
N 1 105 GLN 105 106 106 GLN GLN Q . n 
N 1 106 TRP 106 107 107 TRP TRP Q . n 
N 1 107 TYR 107 108 108 TYR TYR Q . n 
N 1 108 GLU 108 109 109 GLU GLU Q . n 
N 1 109 GLY 109 110 110 GLY GLY Q . n 
N 1 110 THR 110 111 111 THR THR Q . n 
N 1 111 ALA 111 112 112 ALA ALA Q . n 
N 1 112 ASP 112 113 113 ASP ASP Q . n 
N 1 113 ALA 113 114 114 ALA ALA Q . n 
N 1 114 VAL 114 115 115 VAL VAL Q . n 
N 1 115 TYR 115 116 116 TYR TYR Q . n 
N 1 116 GLN 116 117 117 GLN GLN Q . n 
N 1 117 ASN 117 118 118 ASN ASN Q . n 
N 1 118 ILE 118 119 119 ILE ILE Q . n 
N 1 119 ASP 119 120 120 ASP ASP Q . n 
N 1 120 ILE 120 121 121 ILE ILE Q . n 
N 1 121 ILE 121 122 122 ILE ILE Q . n 
N 1 122 GLU 122 123 123 GLU GLU Q . n 
N 1 123 PRO 123 124 124 PRO PRO Q . n 
N 1 124 TYR 124 125 125 TYR TYR Q . n 
N 1 125 ALA 125 126 126 ALA ALA Q . n 
N 1 126 PRO 126 127 127 PRO PRO Q . n 
N 1 127 GLU 127 128 128 GLU GLU Q . n 
N 1 128 TYR 128 129 129 TYR TYR Q . n 
N 1 129 MET 129 130 130 MET MET Q . n 
N 1 130 VAL 130 131 131 VAL VAL Q . n 
N 1 131 ILE 131 132 132 ILE ILE Q . n 
N 1 132 LEU 132 133 133 LEU LEU Q . n 
N 1 133 ALA 133 134 134 ALA ALA Q . n 
N 1 134 GLY 134 135 135 GLY GLY Q . n 
N 1 135 ASP 135 136 136 ASP ASP Q . n 
N 1 136 HIS 136 137 137 HIS HIS Q . n 
N 1 137 ILE 137 138 138 ILE ILE Q . n 
N 1 138 TYR 138 139 139 TYR TYR Q . n 
N 1 139 LYS 139 140 140 LYS LYS Q . n 
N 1 140 MET 140 141 141 MET MET Q . n 
N 1 141 ASP 141 142 142 ASP ASP Q . n 
N 1 142 TYR 142 143 143 TYR TYR Q . n 
N 1 143 GLU 143 144 144 GLU GLU Q . n 
N 1 144 TYR 144 145 145 TYR TYR Q . n 
N 1 145 MET 145 146 146 MET MET Q . n 
N 1 146 LEU 146 147 147 LEU LEU Q . n 
N 1 147 GLN 147 148 148 GLN GLN Q . n 
N 1 148 GLN 148 149 149 GLN GLN Q . n 
N 1 149 HIS 149 150 150 HIS HIS Q . n 
N 1 150 VAL 150 151 151 VAL VAL Q . n 
N 1 151 ASP 151 152 152 ASP ASP Q . n 
N 1 152 SER 152 153 153 SER SER Q . n 
N 1 153 GLY 153 154 154 GLY GLY Q . n 
N 1 154 ALA 154 155 155 ALA ALA Q . n 
N 1 155 ASP 155 156 156 ASP ASP Q . n 
N 1 156 VAL 156 157 157 VAL VAL Q . n 
N 1 157 THR 157 158 158 THR THR Q . n 
N 1 158 ILE 158 159 159 ILE ILE Q . n 
N 1 159 GLY 159 160 160 GLY GLY Q . n 
N 1 160 CYS 160 161 161 CYS CYS Q . n 
N 1 161 LEU 161 162 162 LEU LEU Q . n 
N 1 162 GLU 162 163 163 GLU GLU Q . n 
N 1 163 VAL 163 164 164 VAL VAL Q . n 
N 1 164 PRO 164 165 165 PRO PRO Q . n 
N 1 165 ARG 165 166 166 ARG ARG Q . n 
N 1 166 MET 166 167 167 MET MET Q . n 
N 1 167 GLU 167 168 168 GLU GLU Q . n 
N 1 168 ALA 168 169 169 ALA ALA Q . n 
N 1 169 THR 169 170 170 THR THR Q . n 
N 1 170 GLY 170 171 171 GLY GLY Q . n 
N 1 171 PHE 171 172 172 PHE PHE Q . n 
N 1 172 GLY 172 173 173 GLY GLY Q . n 
N 1 173 VAL 173 174 174 VAL VAL Q . n 
N 1 174 MET 174 175 175 MET MET Q . n 
N 1 175 HIS 175 176 176 HIS HIS Q . n 
N 1 176 VAL 176 177 177 VAL VAL Q . n 
N 1 177 ASN 177 178 178 ASN ASN Q . n 
N 1 178 GLU 178 179 179 GLU GLU Q . n 
N 1 179 LYS 179 180 180 LYS LYS Q . n 
N 1 180 ASP 180 181 181 ASP ASP Q . n 
N 1 181 GLU 181 182 182 GLU GLU Q . n 
N 1 182 ILE 182 183 183 ILE ILE Q . n 
N 1 183 ILE 183 184 184 ILE ILE Q . n 
N 1 184 ASP 184 185 185 ASP ASP Q . n 
N 1 185 PHE 185 186 186 PHE PHE Q . n 
N 1 186 ILE 186 187 187 ILE ILE Q . n 
N 1 187 GLU 187 188 188 GLU GLU Q . n 
N 1 188 LYS 188 189 189 LYS LYS Q . n 
N 1 189 PRO 189 190 190 PRO PRO Q . n 
N 1 190 ALA 190 191 191 ALA ALA Q . n 
N 1 191 ASP 191 192 192 ASP ASP Q . n 
N 1 192 PRO 192 193 193 PRO PRO Q . n 
N 1 193 PRO 193 194 194 PRO PRO Q . n 
N 1 194 GLY 194 195 195 GLY GLY Q . n 
N 1 195 ILE 195 196 196 ILE ILE Q . n 
N 1 196 PRO 196 197 197 PRO PRO Q . n 
N 1 197 GLY 197 198 198 GLY GLY Q . n 
N 1 198 ASN 198 199 199 ASN ASN Q . n 
N 1 199 GLU 199 200 200 GLU GLU Q . n 
N 1 200 GLY 200 201 201 GLY GLY Q . n 
N 1 201 PHE 201 202 202 PHE PHE Q . n 
N 1 202 ALA 202 203 203 ALA ALA Q . n 
N 1 203 LEU 203 204 204 LEU LEU Q . n 
N 1 204 ALA 204 205 205 ALA ALA Q . n 
N 1 205 SER 205 206 206 SER SER Q . n 
N 1 206 MET 206 207 207 MET MET Q . n 
N 1 207 GLY 207 208 208 GLY GLY Q . n 
N 1 208 ILE 208 209 209 ILE ILE Q . n 
N 1 209 TYR 209 210 210 TYR TYR Q . n 
N 1 210 VAL 210 211 211 VAL VAL Q . n 
N 1 211 PHE 211 212 212 PHE PHE Q . n 
N 1 212 HIS 212 213 213 HIS HIS Q . n 
N 1 213 THR 213 214 214 THR THR Q . n 
N 1 214 LYS 214 215 215 LYS LYS Q . n 
N 1 215 PHE 215 216 216 PHE PHE Q . n 
N 1 216 LEU 216 217 217 LEU LEU Q . n 
N 1 217 MET 217 218 218 MET MET Q . n 
N 1 218 GLU 218 219 219 GLU GLU Q . n 
N 1 219 ALA 219 220 220 ALA ALA Q . n 
N 1 220 LEU 220 221 221 LEU LEU Q . n 
N 1 221 ARG 221 222 222 ARG ARG Q . n 
N 1 222 ARG 222 223 223 ARG ARG Q . n 
N 1 223 ASP 223 224 224 ASP ASP Q . n 
N 1 224 ALA 224 225 225 ALA ALA Q . n 
N 1 225 ALA 225 226 226 ALA ALA Q . n 
N 1 226 ASP 226 227 227 ASP ASP Q . n 
N 1 227 PRO 227 228 228 PRO PRO Q . n 
N 1 228 THR 228 229 229 THR THR Q . n 
N 1 229 SER 229 230 230 SER SER Q . n 
N 1 230 SER 230 231 231 SER SER Q . n 
N 1 231 ARG 231 232 232 ARG ARG Q . n 
N 1 232 ASP 232 233 233 ASP ASP Q . n 
N 1 233 PHE 233 234 234 PHE PHE Q . n 
N 1 234 GLY 234 235 235 GLY GLY Q . n 
N 1 235 LYS 235 236 236 LYS LYS Q . n 
N 1 236 ASP 236 237 237 ASP ASP Q . n 
N 1 237 ILE 237 238 238 ILE ILE Q . n 
N 1 238 ILE 238 239 239 ILE ILE Q . n 
N 1 239 PRO 239 240 240 PRO PRO Q . n 
N 1 240 TYR 240 241 241 TYR TYR Q . n 
N 1 241 ILE 241 242 242 ILE ILE Q . n 
N 1 242 VAL 242 243 243 VAL VAL Q . n 
N 1 243 GLU 243 244 244 GLU GLU Q . n 
N 1 244 HIS 244 245 245 HIS HIS Q . n 
N 1 245 GLY 245 246 246 GLY GLY Q . n 
N 1 246 LYS 246 247 247 LYS LYS Q . n 
N 1 247 ALA 247 248 248 ALA ALA Q . n 
N 1 248 VAL 248 249 249 VAL VAL Q . n 
N 1 249 ALA 249 250 250 ALA ALA Q . n 
N 1 250 HIS 250 251 251 HIS HIS Q . n 
N 1 251 ARG 251 252 252 ARG ARG Q . n 
N 1 252 PHE 252 253 253 PHE PHE Q . n 
N 1 253 ALA 253 254 254 ALA ALA Q . n 
N 1 254 ASP 254 255 255 ASP ASP Q . n 
N 1 255 SER 255 256 256 SER SER Q . n 
N 1 256 CYS 256 257 257 CYS CYS Q . n 
N 1 257 VAL 257 258 258 VAL VAL Q . n 
N 1 258 ARG 258 259 259 ARG ARG Q . n 
N 1 259 SER 259 260 260 SER SER Q . n 
N 1 260 ASP 260 261 261 ASP ASP Q . n 
N 1 261 PHE 261 262 262 PHE PHE Q . n 
N 1 262 GLU 262 263 263 GLU GLU Q . n 
N 1 263 HIS 263 264 264 HIS HIS Q . n 
N 1 264 GLU 264 265 265 GLU GLU Q . n 
N 1 265 PRO 265 266 266 PRO PRO Q . n 
N 1 266 TYR 266 267 267 TYR TYR Q . n 
N 1 267 TRP 267 268 268 TRP TRP Q . n 
N 1 268 ARG 268 269 269 ARG ARG Q . n 
N 1 269 ASP 269 270 270 ASP ASP Q . n 
N 1 270 VAL 270 271 271 VAL VAL Q . n 
N 1 271 GLY 271 272 272 GLY GLY Q . n 
N 1 272 THR 272 273 273 THR THR Q . n 
N 1 273 ILE 273 274 274 ILE ILE Q . n 
N 1 274 ASP 274 275 275 ASP ASP Q . n 
N 1 275 ALA 275 276 276 ALA ALA Q . n 
N 1 276 TYR 276 277 277 TYR TYR Q . n 
N 1 277 TRP 277 278 278 TRP TRP Q . n 
N 1 278 GLN 278 279 279 GLN GLN Q . n 
N 1 279 ALA 279 280 280 ALA ALA Q . n 
N 1 280 ASN 280 281 281 ASN ASN Q . n 
N 1 281 ILE 281 282 282 ILE ILE Q . n 
N 1 282 ASP 282 283 283 ASP ASP Q . n 
N 1 283 LEU 283 284 284 LEU LEU Q . n 
N 1 284 THR 284 285 285 THR THR Q . n 
N 1 285 ASP 285 286 286 ASP ASP Q . n 
N 1 286 VAL 286 287 287 VAL VAL Q . n 
N 1 287 VAL 287 288 288 VAL VAL Q . n 
N 1 288 PRO 288 289 289 PRO PRO Q . n 
N 1 289 ASP 289 290 290 ASP ASP Q . n 
N 1 290 LEU 290 291 291 LEU LEU Q . n 
N 1 291 ASP 291 292 292 ASP ASP Q . n 
N 1 292 ILE 292 293 293 ILE ILE Q . n 
N 1 293 TYR 293 294 294 TYR TYR Q . n 
N 1 294 ASP 294 295 295 ASP ASP Q . n 
N 1 295 LYS 295 296 296 LYS LYS Q . n 
N 1 296 SER 296 297 297 SER SER Q . n 
N 1 297 TRP 297 298 298 TRP TRP Q . n 
N 1 298 PRO 298 299 299 PRO PRO Q . n 
N 1 299 ILE 299 300 300 ILE ILE Q . n 
N 1 300 TRP 300 301 301 TRP TRP Q . n 
N 1 301 THR 301 302 302 THR THR Q . n 
N 1 302 TYR 302 303 303 TYR TYR Q . n 
N 1 303 ALA 303 304 304 ALA ALA Q . n 
N 1 304 GLU 304 305 305 GLU GLU Q . n 
N 1 305 ILE 305 306 306 ILE ILE Q . n 
N 1 306 THR 306 307 307 THR THR Q . n 
N 1 307 PRO 307 308 308 PRO PRO Q . n 
N 1 308 PRO 308 309 309 PRO PRO Q . n 
N 1 309 ALA 309 310 310 ALA ALA Q . n 
N 1 310 LYS 310 311 311 LYS LYS Q . n 
N 1 311 PHE 311 312 312 PHE PHE Q . n 
N 1 312 VAL 312 313 313 VAL VAL Q . n 
N 1 313 HIS 313 314 314 HIS HIS Q . n 
N 1 314 ASP 314 315 315 ASP ASP Q . n 
N 1 315 ASP 315 316 316 ASP ASP Q . n 
N 1 316 GLU 316 317 317 GLU GLU Q . n 
N 1 317 ASP 317 318 318 ASP ASP Q . n 
N 1 318 ARG 318 319 319 ARG ARG Q . n 
N 1 319 ARG 319 320 320 ARG ARG Q . n 
N 1 320 GLY 320 321 321 GLY GLY Q . n 
N 1 321 SER 321 322 322 SER SER Q . n 
N 1 322 ALA 322 323 323 ALA ALA Q . n 
N 1 323 VAL 323 324 324 VAL VAL Q . n 
N 1 324 SER 324 325 325 SER SER Q . n 
N 1 325 SER 325 326 326 SER SER Q . n 
N 1 326 VAL 326 327 327 VAL VAL Q . n 
N 1 327 VAL 327 328 328 VAL VAL Q . n 
N 1 328 SER 328 329 329 SER SER Q . n 
N 1 329 GLY 329 330 330 GLY GLY Q . n 
N 1 330 ASP 330 331 331 ASP ASP Q . n 
N 1 331 CYS 331 332 332 CYS CYS Q . n 
N 1 332 ILE 332 333 333 ILE ILE Q . n 
N 1 333 ILE 333 334 334 ILE ILE Q . n 
N 1 334 SER 334 335 335 SER SER Q . n 
N 1 335 GLY 335 336 336 GLY GLY Q . n 
N 1 336 ALA 336 337 337 ALA ALA Q . n 
N 1 337 ALA 337 338 338 ALA ALA Q . n 
N 1 338 LEU 338 339 339 LEU LEU Q . n 
N 1 339 ASN 339 340 340 ASN ASN Q . n 
N 1 340 ARG 340 341 341 ARG ARG Q . n 
N 1 341 SER 341 342 342 SER SER Q . n 
N 1 342 LEU 342 343 343 LEU LEU Q . n 
N 1 343 LEU 343 344 344 LEU LEU Q . n 
N 1 344 PHE 344 345 345 PHE PHE Q . n 
N 1 345 THR 345 346 346 THR THR Q . n 
N 1 346 GLY 346 347 347 GLY GLY Q . n 
N 1 347 VAL 347 348 348 VAL VAL Q . n 
N 1 348 ARG 348 349 349 ARG ARG Q . n 
N 1 349 ALA 349 350 350 ALA ALA Q . n 
N 1 350 ASN 350 351 351 ASN ASN Q . n 
N 1 351 SER 351 352 352 SER SER Q . n 
N 1 352 TYR 352 353 353 TYR TYR Q . n 
N 1 353 SER 353 354 354 SER SER Q . n 
N 1 354 ARG 354 355 355 ARG ARG Q . n 
N 1 355 LEU 355 356 356 LEU LEU Q . n 
N 1 356 GLU 356 357 357 GLU GLU Q . n 
N 1 357 ASN 357 358 358 ASN ASN Q . n 
N 1 358 ALA 358 359 359 ALA ALA Q . n 
N 1 359 VAL 359 360 360 VAL VAL Q . n 
N 1 360 VAL 360 361 361 VAL VAL Q . n 
N 1 361 LEU 361 362 362 LEU LEU Q . n 
N 1 362 PRO 362 363 363 PRO PRO Q . n 
N 1 363 SER 363 364 364 SER SER Q . n 
N 1 364 VAL 364 365 365 VAL VAL Q . n 
N 1 365 LYS 365 366 366 LYS LYS Q . n 
N 1 366 ILE 366 367 367 ILE ILE Q . n 
N 1 367 GLY 367 368 368 GLY GLY Q . n 
N 1 368 ARG 368 369 369 ARG ARG Q . n 
N 1 369 HIS 369 370 370 HIS HIS Q . n 
N 1 370 ALA 370 371 371 ALA ALA Q . n 
N 1 371 GLN 371 372 372 GLN GLN Q . n 
N 1 372 LEU 372 373 373 LEU LEU Q . n 
N 1 373 SER 373 374 374 SER SER Q . n 
N 1 374 ASN 374 375 375 ASN ASN Q . n 
N 1 375 VAL 375 376 376 VAL VAL Q . n 
N 1 376 VAL 376 377 377 VAL VAL Q . n 
N 1 377 ILE 377 378 378 ILE ILE Q . n 
N 1 378 ASP 378 379 379 ASP ASP Q . n 
N 1 379 HIS 379 380 380 HIS HIS Q . n 
N 1 380 GLY 380 381 381 GLY GLY Q . n 
N 1 381 VAL 381 382 382 VAL VAL Q . n 
N 1 382 VAL 382 383 383 VAL VAL Q . n 
N 1 383 ILE 383 384 384 ILE ILE Q . n 
N 1 384 PRO 384 385 385 PRO PRO Q . n 
N 1 385 GLU 385 386 386 GLU GLU Q . n 
N 1 386 GLY 386 387 387 GLY GLY Q . n 
N 1 387 LEU 387 388 388 LEU LEU Q . n 
N 1 388 ILE 388 389 389 ILE ILE Q . n 
N 1 389 VAL 389 390 390 VAL VAL Q . n 
N 1 390 GLY 390 391 391 GLY GLY Q . n 
N 1 391 GLU 391 392 392 GLU GLU Q . n 
N 1 392 ASP 392 393 393 ASP ASP Q . n 
N 1 393 PRO 393 394 394 PRO PRO Q . n 
N 1 394 GLU 394 395 395 GLU GLU Q . n 
N 1 395 LEU 395 396 396 LEU LEU Q . n 
N 1 396 ASP 396 397 397 ASP ASP Q . n 
N 1 397 ALA 397 398 398 ALA ALA Q . n 
N 1 398 LYS 398 399 399 LYS LYS Q . n 
N 1 399 ARG 399 400 400 ARG ARG Q . n 
N 1 400 PHE 400 401 401 PHE PHE Q . n 
N 1 401 ARG 401 402 402 ARG ARG Q . n 
N 1 402 ARG 402 403 403 ARG ARG Q . n 
N 1 403 THR 403 404 404 THR THR Q . n 
N 1 404 GLU 404 405 405 GLU GLU Q . n 
N 1 405 SER 405 406 406 SER SER Q . n 
N 1 406 GLY 406 407 407 GLY GLY Q . n 
N 1 407 ILE 407 408 408 ILE ILE Q . n 
N 1 408 CYS 408 409 409 CYS CYS Q . n 
N 1 409 LEU 409 410 410 LEU LEU Q . n 
N 1 410 ILE 410 411 411 ILE ILE Q . n 
N 1 411 THR 411 412 412 THR THR Q . n 
N 1 412 GLN 412 413 413 GLN GLN Q . n 
N 1 413 SER 413 414 414 SER SER Q . n 
N 1 414 MET 414 415 415 MET MET Q . n 
N 1 415 ILE 415 416 416 ILE ILE Q . n 
N 1 416 ASP 416 417 417 ASP ASP Q . n 
N 1 417 LYS 417 418 418 LYS LYS Q . n 
N 1 418 LEU 418 419 419 LEU LEU Q . n 
N 1 419 ASP 419 420 420 ASP ASP Q . n 
N 1 420 LEU 420 421 421 LEU LEU Q . n 
O 1 1   MET 1   2   ?   ?   ?   R . n 
O 1 2   SER 2   3   ?   ?   ?   R . n 
O 1 3   GLU 3   4   ?   ?   ?   R . n 
O 1 4   LYS 4   5   ?   ?   ?   R . n 
O 1 5   ARG 5   6   ?   ?   ?   R . n 
O 1 6   VAL 6   7   7   VAL VAL R . n 
O 1 7   GLN 7   8   8   GLN GLN R . n 
O 1 8   PRO 8   9   9   PRO PRO R . n 
O 1 9   LEU 9   10  10  LEU LEU R . n 
O 1 10  ALA 10  11  11  ALA ALA R . n 
O 1 11  ARG 11  12  12  ARG ARG R . n 
O 1 12  ASP 12  13  13  ASP ASP R . n 
O 1 13  ALA 13  14  14  ALA ALA R . n 
O 1 14  MET 14  15  15  MET MET R . n 
O 1 15  ALA 15  16  16  ALA ALA R . n 
O 1 16  TYR 16  17  17  TYR TYR R . n 
O 1 17  VAL 17  18  18  VAL VAL R . n 
O 1 18  LEU 18  19  19  LEU LEU R . n 
O 1 19  ALA 19  20  20  ALA ALA R . n 
O 1 20  GLY 20  21  21  GLY GLY R . n 
O 1 21  GLY 21  22  22  GLY GLY R . n 
O 1 22  ARG 22  23  23  ARG ARG R . n 
O 1 23  GLY 23  24  24  GLY GLY R . n 
O 1 24  SER 24  25  25  SER SER R . n 
O 1 25  ARG 25  26  26  ARG ARG R . n 
O 1 26  LEU 26  27  27  LEU LEU R . n 
O 1 27  LYS 27  28  28  LYS LYS R . n 
O 1 28  GLU 28  29  29  GLU GLU R . n 
O 1 29  LEU 29  30  30  LEU LEU R . n 
O 1 30  THR 30  31  31  THR THR R . n 
O 1 31  ASP 31  32  32  ASP ASP R . n 
O 1 32  ARG 32  33  33  ARG ARG R . n 
O 1 33  ARG 33  34  34  ARG ARG R . n 
O 1 34  ALA 34  35  35  ALA ALA R . n 
O 1 35  LYS 35  36  36  LYS LYS R . n 
O 1 36  PRO 36  37  37  PRO PRO R . n 
O 1 37  ALA 37  38  38  ALA ALA R . n 
O 1 38  VAL 38  39  39  VAL VAL R . n 
O 1 39  TYR 39  40  40  TYR TYR R . n 
O 1 40  PHE 40  41  41  PHE PHE R . n 
O 1 41  GLY 41  42  42  GLY GLY R . n 
O 1 42  GLY 42  43  43  GLY GLY R . n 
O 1 43  LYS 43  44  44  LYS LYS R . n 
O 1 44  ALA 44  45  45  ALA ALA R . n 
O 1 45  ARG 45  46  46  ARG ARG R . n 
O 1 46  ILE 46  47  47  ILE ILE R . n 
O 1 47  ILE 47  48  48  ILE ILE R . n 
O 1 48  ASP 48  49  49  ASP ASP R . n 
O 1 49  PHE 49  50  50  PHE PHE R . n 
O 1 50  ALA 50  51  51  ALA ALA R . n 
O 1 51  LEU 51  52  52  LEU LEU R . n 
O 1 52  SER 52  53  53  SER SER R . n 
O 1 53  ASN 53  54  54  ASN ASN R . n 
O 1 54  ALA 54  55  55  ALA ALA R . n 
O 1 55  LEU 55  56  56  LEU LEU R . n 
O 1 56  ASN 56  57  57  ASN ASN R . n 
O 1 57  SER 57  58  58  SER SER R . n 
O 1 58  GLY 58  59  59  GLY GLY R . n 
O 1 59  ILE 59  60  60  ILE ILE R . n 
O 1 60  ARG 60  61  61  ARG ARG R . n 
O 1 61  ARG 61  62  62  ARG ARG R . n 
O 1 62  ILE 62  63  63  ILE ILE R . n 
O 1 63  GLY 63  64  64  GLY GLY R . n 
O 1 64  VAL 64  65  65  VAL VAL R . n 
O 1 65  ALA 65  66  66  ALA ALA R . n 
O 1 66  THR 66  67  67  THR THR R . n 
O 1 67  GLN 67  68  68  GLN GLN R . n 
O 1 68  TYR 68  69  69  TYR TYR R . n 
O 1 69  LYS 69  70  70  LYS LYS R . n 
O 1 70  ALA 70  71  71  ALA ALA R . n 
O 1 71  HIS 71  72  72  HIS HIS R . n 
O 1 72  SER 72  73  73  SER SER R . n 
O 1 73  LEU 73  74  74  LEU LEU R . n 
O 1 74  ILE 74  75  75  ILE ILE R . n 
O 1 75  ARG 75  76  76  ARG ARG R . n 
O 1 76  HIS 76  77  77  HIS HIS R . n 
O 1 77  LEU 77  78  78  LEU LEU R . n 
O 1 78  GLN 78  79  79  GLN GLN R . n 
O 1 79  ARG 79  80  80  ARG ARG R . n 
O 1 80  GLY 80  81  81  GLY GLY R . n 
O 1 81  TRP 81  82  82  TRP TRP R . n 
O 1 82  ASP 82  83  83  ASP ASP R . n 
O 1 83  PHE 83  84  84  PHE PHE R . n 
O 1 84  PHE 84  85  85  PHE PHE R . n 
O 1 85  ARG 85  86  86  ARG ARG R . n 
O 1 86  PRO 86  87  87  PRO PRO R . n 
O 1 87  GLU 87  88  88  GLU GLU R . n 
O 1 88  ARG 88  89  89  ARG ARG R . n 
O 1 89  ASN 89  90  90  ASN ASN R . n 
O 1 90  GLU 90  91  91  GLU GLU R . n 
O 1 91  SER 91  92  92  SER SER R . n 
O 1 92  PHE 92  93  93  PHE PHE R . n 
O 1 93  ASP 93  94  94  ASP ASP R . n 
O 1 94  ILE 94  95  95  ILE ILE R . n 
O 1 95  LEU 95  96  96  LEU LEU R . n 
O 1 96  PRO 96  97  97  PRO PRO R . n 
O 1 97  ALA 97  98  98  ALA ALA R . n 
O 1 98  SER 98  99  ?   ?   ?   R . n 
O 1 99  GLN 99  100 ?   ?   ?   R . n 
O 1 100 ARG 100 101 ?   ?   ?   R . n 
O 1 101 VAL 101 102 ?   ?   ?   R . n 
O 1 102 SER 102 103 ?   ?   ?   R . n 
O 1 103 GLU 103 104 ?   ?   ?   R . n 
O 1 104 THR 104 105 105 THR THR R . n 
O 1 105 GLN 105 106 106 GLN GLN R . n 
O 1 106 TRP 106 107 107 TRP TRP R . n 
O 1 107 TYR 107 108 108 TYR TYR R . n 
O 1 108 GLU 108 109 109 GLU GLU R . n 
O 1 109 GLY 109 110 110 GLY GLY R . n 
O 1 110 THR 110 111 111 THR THR R . n 
O 1 111 ALA 111 112 112 ALA ALA R . n 
O 1 112 ASP 112 113 113 ASP ASP R . n 
O 1 113 ALA 113 114 114 ALA ALA R . n 
O 1 114 VAL 114 115 115 VAL VAL R . n 
O 1 115 TYR 115 116 116 TYR TYR R . n 
O 1 116 GLN 116 117 117 GLN GLN R . n 
O 1 117 ASN 117 118 118 ASN ASN R . n 
O 1 118 ILE 118 119 119 ILE ILE R . n 
O 1 119 ASP 119 120 120 ASP ASP R . n 
O 1 120 ILE 120 121 121 ILE ILE R . n 
O 1 121 ILE 121 122 122 ILE ILE R . n 
O 1 122 GLU 122 123 123 GLU GLU R . n 
O 1 123 PRO 123 124 124 PRO PRO R . n 
O 1 124 TYR 124 125 125 TYR TYR R . n 
O 1 125 ALA 125 126 126 ALA ALA R . n 
O 1 126 PRO 126 127 127 PRO PRO R . n 
O 1 127 GLU 127 128 128 GLU GLU R . n 
O 1 128 TYR 128 129 129 TYR TYR R . n 
O 1 129 MET 129 130 130 MET MET R . n 
O 1 130 VAL 130 131 131 VAL VAL R . n 
O 1 131 ILE 131 132 132 ILE ILE R . n 
O 1 132 LEU 132 133 133 LEU LEU R . n 
O 1 133 ALA 133 134 134 ALA ALA R . n 
O 1 134 GLY 134 135 135 GLY GLY R . n 
O 1 135 ASP 135 136 136 ASP ASP R . n 
O 1 136 HIS 136 137 137 HIS HIS R . n 
O 1 137 ILE 137 138 138 ILE ILE R . n 
O 1 138 TYR 138 139 139 TYR TYR R . n 
O 1 139 LYS 139 140 140 LYS LYS R . n 
O 1 140 MET 140 141 141 MET MET R . n 
O 1 141 ASP 141 142 142 ASP ASP R . n 
O 1 142 TYR 142 143 143 TYR TYR R . n 
O 1 143 GLU 143 144 144 GLU GLU R . n 
O 1 144 TYR 144 145 145 TYR TYR R . n 
O 1 145 MET 145 146 146 MET MET R . n 
O 1 146 LEU 146 147 147 LEU LEU R . n 
O 1 147 GLN 147 148 148 GLN GLN R . n 
O 1 148 GLN 148 149 149 GLN GLN R . n 
O 1 149 HIS 149 150 150 HIS HIS R . n 
O 1 150 VAL 150 151 151 VAL VAL R . n 
O 1 151 ASP 151 152 152 ASP ASP R . n 
O 1 152 SER 152 153 153 SER SER R . n 
O 1 153 GLY 153 154 154 GLY GLY R . n 
O 1 154 ALA 154 155 155 ALA ALA R . n 
O 1 155 ASP 155 156 156 ASP ASP R . n 
O 1 156 VAL 156 157 157 VAL VAL R . n 
O 1 157 THR 157 158 158 THR THR R . n 
O 1 158 ILE 158 159 159 ILE ILE R . n 
O 1 159 GLY 159 160 160 GLY GLY R . n 
O 1 160 CYS 160 161 161 CYS CYS R . n 
O 1 161 LEU 161 162 162 LEU LEU R . n 
O 1 162 GLU 162 163 163 GLU GLU R . n 
O 1 163 VAL 163 164 164 VAL VAL R . n 
O 1 164 PRO 164 165 165 PRO PRO R . n 
O 1 165 ARG 165 166 166 ARG ARG R . n 
O 1 166 MET 166 167 167 MET MET R . n 
O 1 167 GLU 167 168 168 GLU GLU R . n 
O 1 168 ALA 168 169 169 ALA ALA R . n 
O 1 169 THR 169 170 170 THR THR R . n 
O 1 170 GLY 170 171 171 GLY GLY R . n 
O 1 171 PHE 171 172 172 PHE PHE R . n 
O 1 172 GLY 172 173 173 GLY GLY R . n 
O 1 173 VAL 173 174 174 VAL VAL R . n 
O 1 174 MET 174 175 175 MET MET R . n 
O 1 175 HIS 175 176 176 HIS HIS R . n 
O 1 176 VAL 176 177 177 VAL VAL R . n 
O 1 177 ASN 177 178 178 ASN ASN R . n 
O 1 178 GLU 178 179 179 GLU GLU R . n 
O 1 179 LYS 179 180 180 LYS LYS R . n 
O 1 180 ASP 180 181 181 ASP ASP R . n 
O 1 181 GLU 181 182 182 GLU GLU R . n 
O 1 182 ILE 182 183 183 ILE ILE R . n 
O 1 183 ILE 183 184 184 ILE ILE R . n 
O 1 184 ASP 184 185 185 ASP ASP R . n 
O 1 185 PHE 185 186 186 PHE PHE R . n 
O 1 186 ILE 186 187 187 ILE ILE R . n 
O 1 187 GLU 187 188 188 GLU GLU R . n 
O 1 188 LYS 188 189 189 LYS LYS R . n 
O 1 189 PRO 189 190 190 PRO PRO R . n 
O 1 190 ALA 190 191 191 ALA ALA R . n 
O 1 191 ASP 191 192 192 ASP ASP R . n 
O 1 192 PRO 192 193 193 PRO PRO R . n 
O 1 193 PRO 193 194 194 PRO PRO R . n 
O 1 194 GLY 194 195 195 GLY GLY R . n 
O 1 195 ILE 195 196 196 ILE ILE R . n 
O 1 196 PRO 196 197 197 PRO PRO R . n 
O 1 197 GLY 197 198 198 GLY GLY R . n 
O 1 198 ASN 198 199 199 ASN ASN R . n 
O 1 199 GLU 199 200 200 GLU GLU R . n 
O 1 200 GLY 200 201 201 GLY GLY R . n 
O 1 201 PHE 201 202 202 PHE PHE R . n 
O 1 202 ALA 202 203 203 ALA ALA R . n 
O 1 203 LEU 203 204 204 LEU LEU R . n 
O 1 204 ALA 204 205 205 ALA ALA R . n 
O 1 205 SER 205 206 206 SER SER R . n 
O 1 206 MET 206 207 207 MET MET R . n 
O 1 207 GLY 207 208 208 GLY GLY R . n 
O 1 208 ILE 208 209 209 ILE ILE R . n 
O 1 209 TYR 209 210 210 TYR TYR R . n 
O 1 210 VAL 210 211 211 VAL VAL R . n 
O 1 211 PHE 211 212 212 PHE PHE R . n 
O 1 212 HIS 212 213 213 HIS HIS R . n 
O 1 213 THR 213 214 214 THR THR R . n 
O 1 214 LYS 214 215 215 LYS LYS R . n 
O 1 215 PHE 215 216 216 PHE PHE R . n 
O 1 216 LEU 216 217 217 LEU LEU R . n 
O 1 217 MET 217 218 218 MET MET R . n 
O 1 218 GLU 218 219 219 GLU GLU R . n 
O 1 219 ALA 219 220 220 ALA ALA R . n 
O 1 220 LEU 220 221 221 LEU LEU R . n 
O 1 221 ARG 221 222 222 ARG ARG R . n 
O 1 222 ARG 222 223 223 ARG ARG R . n 
O 1 223 ASP 223 224 224 ASP ASP R . n 
O 1 224 ALA 224 225 225 ALA ALA R . n 
O 1 225 ALA 225 226 226 ALA ALA R . n 
O 1 226 ASP 226 227 227 ASP ASP R . n 
O 1 227 PRO 227 228 228 PRO PRO R . n 
O 1 228 THR 228 229 229 THR THR R . n 
O 1 229 SER 229 230 230 SER SER R . n 
O 1 230 SER 230 231 231 SER SER R . n 
O 1 231 ARG 231 232 232 ARG ARG R . n 
O 1 232 ASP 232 233 233 ASP ASP R . n 
O 1 233 PHE 233 234 234 PHE PHE R . n 
O 1 234 GLY 234 235 235 GLY GLY R . n 
O 1 235 LYS 235 236 236 LYS LYS R . n 
O 1 236 ASP 236 237 237 ASP ASP R . n 
O 1 237 ILE 237 238 238 ILE ILE R . n 
O 1 238 ILE 238 239 239 ILE ILE R . n 
O 1 239 PRO 239 240 240 PRO PRO R . n 
O 1 240 TYR 240 241 241 TYR TYR R . n 
O 1 241 ILE 241 242 242 ILE ILE R . n 
O 1 242 VAL 242 243 243 VAL VAL R . n 
O 1 243 GLU 243 244 244 GLU GLU R . n 
O 1 244 HIS 244 245 245 HIS HIS R . n 
O 1 245 GLY 245 246 246 GLY GLY R . n 
O 1 246 LYS 246 247 247 LYS LYS R . n 
O 1 247 ALA 247 248 248 ALA ALA R . n 
O 1 248 VAL 248 249 249 VAL VAL R . n 
O 1 249 ALA 249 250 250 ALA ALA R . n 
O 1 250 HIS 250 251 251 HIS HIS R . n 
O 1 251 ARG 251 252 252 ARG ARG R . n 
O 1 252 PHE 252 253 253 PHE PHE R . n 
O 1 253 ALA 253 254 254 ALA ALA R . n 
O 1 254 ASP 254 255 255 ASP ASP R . n 
O 1 255 SER 255 256 256 SER SER R . n 
O 1 256 CYS 256 257 257 CYS CYS R . n 
O 1 257 VAL 257 258 258 VAL VAL R . n 
O 1 258 ARG 258 259 259 ARG ARG R . n 
O 1 259 SER 259 260 260 SER SER R . n 
O 1 260 ASP 260 261 261 ASP ASP R . n 
O 1 261 PHE 261 262 262 PHE PHE R . n 
O 1 262 GLU 262 263 263 GLU GLU R . n 
O 1 263 HIS 263 264 264 HIS HIS R . n 
O 1 264 GLU 264 265 265 GLU GLU R . n 
O 1 265 PRO 265 266 266 PRO PRO R . n 
O 1 266 TYR 266 267 267 TYR TYR R . n 
O 1 267 TRP 267 268 268 TRP TRP R . n 
O 1 268 ARG 268 269 269 ARG ARG R . n 
O 1 269 ASP 269 270 270 ASP ASP R . n 
O 1 270 VAL 270 271 271 VAL VAL R . n 
O 1 271 GLY 271 272 272 GLY GLY R . n 
O 1 272 THR 272 273 273 THR THR R . n 
O 1 273 ILE 273 274 274 ILE ILE R . n 
O 1 274 ASP 274 275 275 ASP ASP R . n 
O 1 275 ALA 275 276 276 ALA ALA R . n 
O 1 276 TYR 276 277 277 TYR TYR R . n 
O 1 277 TRP 277 278 278 TRP TRP R . n 
O 1 278 GLN 278 279 279 GLN GLN R . n 
O 1 279 ALA 279 280 280 ALA ALA R . n 
O 1 280 ASN 280 281 281 ASN ASN R . n 
O 1 281 ILE 281 282 282 ILE ILE R . n 
O 1 282 ASP 282 283 283 ASP ASP R . n 
O 1 283 LEU 283 284 284 LEU LEU R . n 
O 1 284 THR 284 285 285 THR THR R . n 
O 1 285 ASP 285 286 286 ASP ASP R . n 
O 1 286 VAL 286 287 287 VAL VAL R . n 
O 1 287 VAL 287 288 288 VAL VAL R . n 
O 1 288 PRO 288 289 289 PRO PRO R . n 
O 1 289 ASP 289 290 290 ASP ASP R . n 
O 1 290 LEU 290 291 291 LEU LEU R . n 
O 1 291 ASP 291 292 292 ASP ASP R . n 
O 1 292 ILE 292 293 293 ILE ILE R . n 
O 1 293 TYR 293 294 294 TYR TYR R . n 
O 1 294 ASP 294 295 295 ASP ASP R . n 
O 1 295 LYS 295 296 296 LYS LYS R . n 
O 1 296 SER 296 297 297 SER SER R . n 
O 1 297 TRP 297 298 298 TRP TRP R . n 
O 1 298 PRO 298 299 299 PRO PRO R . n 
O 1 299 ILE 299 300 300 ILE ILE R . n 
O 1 300 TRP 300 301 301 TRP TRP R . n 
O 1 301 THR 301 302 302 THR THR R . n 
O 1 302 TYR 302 303 303 TYR TYR R . n 
O 1 303 ALA 303 304 304 ALA ALA R . n 
O 1 304 GLU 304 305 305 GLU GLU R . n 
O 1 305 ILE 305 306 306 ILE ILE R . n 
O 1 306 THR 306 307 307 THR THR R . n 
O 1 307 PRO 307 308 308 PRO PRO R . n 
O 1 308 PRO 308 309 309 PRO PRO R . n 
O 1 309 ALA 309 310 310 ALA ALA R . n 
O 1 310 LYS 310 311 311 LYS LYS R . n 
O 1 311 PHE 311 312 312 PHE PHE R . n 
O 1 312 VAL 312 313 313 VAL VAL R . n 
O 1 313 HIS 313 314 314 HIS HIS R . n 
O 1 314 ASP 314 315 315 ASP ASP R . n 
O 1 315 ASP 315 316 316 ASP ASP R . n 
O 1 316 GLU 316 317 317 GLU GLU R . n 
O 1 317 ASP 317 318 318 ASP ASP R . n 
O 1 318 ARG 318 319 319 ARG ARG R . n 
O 1 319 ARG 319 320 320 ARG ARG R . n 
O 1 320 GLY 320 321 321 GLY GLY R . n 
O 1 321 SER 321 322 322 SER SER R . n 
O 1 322 ALA 322 323 323 ALA ALA R . n 
O 1 323 VAL 323 324 324 VAL VAL R . n 
O 1 324 SER 324 325 325 SER SER R . n 
O 1 325 SER 325 326 326 SER SER R . n 
O 1 326 VAL 326 327 327 VAL VAL R . n 
O 1 327 VAL 327 328 328 VAL VAL R . n 
O 1 328 SER 328 329 329 SER SER R . n 
O 1 329 GLY 329 330 330 GLY GLY R . n 
O 1 330 ASP 330 331 331 ASP ASP R . n 
O 1 331 CYS 331 332 332 CYS CYS R . n 
O 1 332 ILE 332 333 333 ILE ILE R . n 
O 1 333 ILE 333 334 334 ILE ILE R . n 
O 1 334 SER 334 335 335 SER SER R . n 
O 1 335 GLY 335 336 336 GLY GLY R . n 
O 1 336 ALA 336 337 337 ALA ALA R . n 
O 1 337 ALA 337 338 338 ALA ALA R . n 
O 1 338 LEU 338 339 339 LEU LEU R . n 
O 1 339 ASN 339 340 340 ASN ASN R . n 
O 1 340 ARG 340 341 341 ARG ARG R . n 
O 1 341 SER 341 342 342 SER SER R . n 
O 1 342 LEU 342 343 343 LEU LEU R . n 
O 1 343 LEU 343 344 344 LEU LEU R . n 
O 1 344 PHE 344 345 345 PHE PHE R . n 
O 1 345 THR 345 346 346 THR THR R . n 
O 1 346 GLY 346 347 347 GLY GLY R . n 
O 1 347 VAL 347 348 348 VAL VAL R . n 
O 1 348 ARG 348 349 349 ARG ARG R . n 
O 1 349 ALA 349 350 350 ALA ALA R . n 
O 1 350 ASN 350 351 351 ASN ASN R . n 
O 1 351 SER 351 352 352 SER SER R . n 
O 1 352 TYR 352 353 353 TYR TYR R . n 
O 1 353 SER 353 354 354 SER SER R . n 
O 1 354 ARG 354 355 355 ARG ARG R . n 
O 1 355 LEU 355 356 356 LEU LEU R . n 
O 1 356 GLU 356 357 357 GLU GLU R . n 
O 1 357 ASN 357 358 358 ASN ASN R . n 
O 1 358 ALA 358 359 359 ALA ALA R . n 
O 1 359 VAL 359 360 360 VAL VAL R . n 
O 1 360 VAL 360 361 361 VAL VAL R . n 
O 1 361 LEU 361 362 362 LEU LEU R . n 
O 1 362 PRO 362 363 363 PRO PRO R . n 
O 1 363 SER 363 364 364 SER SER R . n 
O 1 364 VAL 364 365 365 VAL VAL R . n 
O 1 365 LYS 365 366 366 LYS LYS R . n 
O 1 366 ILE 366 367 367 ILE ILE R . n 
O 1 367 GLY 367 368 368 GLY GLY R . n 
O 1 368 ARG 368 369 369 ARG ARG R . n 
O 1 369 HIS 369 370 370 HIS HIS R . n 
O 1 370 ALA 370 371 371 ALA ALA R . n 
O 1 371 GLN 371 372 372 GLN GLN R . n 
O 1 372 LEU 372 373 373 LEU LEU R . n 
O 1 373 SER 373 374 374 SER SER R . n 
O 1 374 ASN 374 375 375 ASN ASN R . n 
O 1 375 VAL 375 376 376 VAL VAL R . n 
O 1 376 VAL 376 377 377 VAL VAL R . n 
O 1 377 ILE 377 378 378 ILE ILE R . n 
O 1 378 ASP 378 379 379 ASP ASP R . n 
O 1 379 HIS 379 380 380 HIS HIS R . n 
O 1 380 GLY 380 381 381 GLY GLY R . n 
O 1 381 VAL 381 382 382 VAL VAL R . n 
O 1 382 VAL 382 383 383 VAL VAL R . n 
O 1 383 ILE 383 384 384 ILE ILE R . n 
O 1 384 PRO 384 385 385 PRO PRO R . n 
O 1 385 GLU 385 386 386 GLU GLU R . n 
O 1 386 GLY 386 387 387 GLY GLY R . n 
O 1 387 LEU 387 388 388 LEU LEU R . n 
O 1 388 ILE 388 389 389 ILE ILE R . n 
O 1 389 VAL 389 390 390 VAL VAL R . n 
O 1 390 GLY 390 391 391 GLY GLY R . n 
O 1 391 GLU 391 392 392 GLU GLU R . n 
O 1 392 ASP 392 393 393 ASP ASP R . n 
O 1 393 PRO 393 394 394 PRO PRO R . n 
O 1 394 GLU 394 395 395 GLU GLU R . n 
O 1 395 LEU 395 396 396 LEU LEU R . n 
O 1 396 ASP 396 397 397 ASP ASP R . n 
O 1 397 ALA 397 398 398 ALA ALA R . n 
O 1 398 LYS 398 399 399 LYS LYS R . n 
O 1 399 ARG 399 400 400 ARG ARG R . n 
O 1 400 PHE 400 401 401 PHE PHE R . n 
O 1 401 ARG 401 402 402 ARG ARG R . n 
O 1 402 ARG 402 403 403 ARG ARG R . n 
O 1 403 THR 403 404 404 THR THR R . n 
O 1 404 GLU 404 405 405 GLU GLU R . n 
O 1 405 SER 405 406 406 SER SER R . n 
O 1 406 GLY 406 407 407 GLY GLY R . n 
O 1 407 ILE 407 408 408 ILE ILE R . n 
O 1 408 CYS 408 409 409 CYS CYS R . n 
O 1 409 LEU 409 410 410 LEU LEU R . n 
O 1 410 ILE 410 411 411 ILE ILE R . n 
O 1 411 THR 411 412 412 THR THR R . n 
O 1 412 GLN 412 413 413 GLN GLN R . n 
O 1 413 SER 413 414 414 SER SER R . n 
O 1 414 MET 414 415 415 MET MET R . n 
O 1 415 ILE 415 416 416 ILE ILE R . n 
O 1 416 ASP 416 417 417 ASP ASP R . n 
O 1 417 LYS 417 418 418 LYS LYS R . n 
O 1 418 LEU 418 419 419 LEU LEU R . n 
O 1 419 ASP 419 420 420 ASP ASP R . n 
O 1 420 LEU 420 421 421 LEU LEU R . n 
P 1 1   MET 1   2   ?   ?   ?   F . n 
P 1 2   SER 2   3   ?   ?   ?   F . n 
P 1 3   GLU 3   4   ?   ?   ?   F . n 
P 1 4   LYS 4   5   ?   ?   ?   F . n 
P 1 5   ARG 5   6   ?   ?   ?   F . n 
P 1 6   VAL 6   7   7   VAL VAL F . n 
P 1 7   GLN 7   8   8   GLN GLN F . n 
P 1 8   PRO 8   9   9   PRO PRO F . n 
P 1 9   LEU 9   10  10  LEU LEU F . n 
P 1 10  ALA 10  11  11  ALA ALA F . n 
P 1 11  ARG 11  12  12  ARG ARG F . n 
P 1 12  ASP 12  13  13  ASP ASP F . n 
P 1 13  ALA 13  14  14  ALA ALA F . n 
P 1 14  MET 14  15  15  MET MET F . n 
P 1 15  ALA 15  16  16  ALA ALA F . n 
P 1 16  TYR 16  17  17  TYR TYR F . n 
P 1 17  VAL 17  18  18  VAL VAL F . n 
P 1 18  LEU 18  19  19  LEU LEU F . n 
P 1 19  ALA 19  20  20  ALA ALA F . n 
P 1 20  GLY 20  21  21  GLY GLY F . n 
P 1 21  GLY 21  22  22  GLY GLY F . n 
P 1 22  ARG 22  23  23  ARG ARG F . n 
P 1 23  GLY 23  24  24  GLY GLY F . n 
P 1 24  SER 24  25  25  SER SER F . n 
P 1 25  ARG 25  26  26  ARG ARG F . n 
P 1 26  LEU 26  27  27  LEU LEU F . n 
P 1 27  LYS 27  28  28  LYS LYS F . n 
P 1 28  GLU 28  29  29  GLU GLU F . n 
P 1 29  LEU 29  30  30  LEU LEU F . n 
P 1 30  THR 30  31  31  THR THR F . n 
P 1 31  ASP 31  32  32  ASP ASP F . n 
P 1 32  ARG 32  33  33  ARG ARG F . n 
P 1 33  ARG 33  34  34  ARG ARG F . n 
P 1 34  ALA 34  35  35  ALA ALA F . n 
P 1 35  LYS 35  36  36  LYS LYS F . n 
P 1 36  PRO 36  37  37  PRO PRO F . n 
P 1 37  ALA 37  38  38  ALA ALA F . n 
P 1 38  VAL 38  39  39  VAL VAL F . n 
P 1 39  TYR 39  40  40  TYR TYR F . n 
P 1 40  PHE 40  41  41  PHE PHE F . n 
P 1 41  GLY 41  42  42  GLY GLY F . n 
P 1 42  GLY 42  43  43  GLY GLY F . n 
P 1 43  LYS 43  44  44  LYS LYS F . n 
P 1 44  ALA 44  45  45  ALA ALA F . n 
P 1 45  ARG 45  46  46  ARG ARG F . n 
P 1 46  ILE 46  47  47  ILE ILE F . n 
P 1 47  ILE 47  48  48  ILE ILE F . n 
P 1 48  ASP 48  49  49  ASP ASP F . n 
P 1 49  PHE 49  50  50  PHE PHE F . n 
P 1 50  ALA 50  51  51  ALA ALA F . n 
P 1 51  LEU 51  52  52  LEU LEU F . n 
P 1 52  SER 52  53  53  SER SER F . n 
P 1 53  ASN 53  54  54  ASN ASN F . n 
P 1 54  ALA 54  55  55  ALA ALA F . n 
P 1 55  LEU 55  56  56  LEU LEU F . n 
P 1 56  ASN 56  57  57  ASN ASN F . n 
P 1 57  SER 57  58  58  SER SER F . n 
P 1 58  GLY 58  59  59  GLY GLY F . n 
P 1 59  ILE 59  60  60  ILE ILE F . n 
P 1 60  ARG 60  61  61  ARG ARG F . n 
P 1 61  ARG 61  62  62  ARG ARG F . n 
P 1 62  ILE 62  63  63  ILE ILE F . n 
P 1 63  GLY 63  64  64  GLY GLY F . n 
P 1 64  VAL 64  65  65  VAL VAL F . n 
P 1 65  ALA 65  66  66  ALA ALA F . n 
P 1 66  THR 66  67  67  THR THR F . n 
P 1 67  GLN 67  68  68  GLN GLN F . n 
P 1 68  TYR 68  69  69  TYR TYR F . n 
P 1 69  LYS 69  70  70  LYS LYS F . n 
P 1 70  ALA 70  71  71  ALA ALA F . n 
P 1 71  HIS 71  72  72  HIS HIS F . n 
P 1 72  SER 72  73  73  SER SER F . n 
P 1 73  LEU 73  74  74  LEU LEU F . n 
P 1 74  ILE 74  75  75  ILE ILE F . n 
P 1 75  ARG 75  76  76  ARG ARG F . n 
P 1 76  HIS 76  77  77  HIS HIS F . n 
P 1 77  LEU 77  78  78  LEU LEU F . n 
P 1 78  GLN 78  79  79  GLN GLN F . n 
P 1 79  ARG 79  80  80  ARG ARG F . n 
P 1 80  GLY 80  81  81  GLY GLY F . n 
P 1 81  TRP 81  82  82  TRP TRP F . n 
P 1 82  ASP 82  83  83  ASP ASP F . n 
P 1 83  PHE 83  84  84  PHE PHE F . n 
P 1 84  PHE 84  85  85  PHE PHE F . n 
P 1 85  ARG 85  86  86  ARG ARG F . n 
P 1 86  PRO 86  87  87  PRO PRO F . n 
P 1 87  GLU 87  88  88  GLU GLU F . n 
P 1 88  ARG 88  89  89  ARG ARG F . n 
P 1 89  ASN 89  90  90  ASN ASN F . n 
P 1 90  GLU 90  91  91  GLU GLU F . n 
P 1 91  SER 91  92  92  SER SER F . n 
P 1 92  PHE 92  93  93  PHE PHE F . n 
P 1 93  ASP 93  94  94  ASP ASP F . n 
P 1 94  ILE 94  95  95  ILE ILE F . n 
P 1 95  LEU 95  96  96  LEU LEU F . n 
P 1 96  PRO 96  97  97  PRO PRO F . n 
P 1 97  ALA 97  98  ?   ?   ?   F . n 
P 1 98  SER 98  99  ?   ?   ?   F . n 
P 1 99  GLN 99  100 ?   ?   ?   F . n 
P 1 100 ARG 100 101 ?   ?   ?   F . n 
P 1 101 VAL 101 102 ?   ?   ?   F . n 
P 1 102 SER 102 103 ?   ?   ?   F . n 
P 1 103 GLU 103 104 ?   ?   ?   F . n 
P 1 104 THR 104 105 105 THR THR F . n 
P 1 105 GLN 105 106 106 GLN GLN F . n 
P 1 106 TRP 106 107 107 TRP TRP F . n 
P 1 107 TYR 107 108 108 TYR TYR F . n 
P 1 108 GLU 108 109 109 GLU GLU F . n 
P 1 109 GLY 109 110 110 GLY GLY F . n 
P 1 110 THR 110 111 111 THR THR F . n 
P 1 111 ALA 111 112 112 ALA ALA F . n 
P 1 112 ASP 112 113 113 ASP ASP F . n 
P 1 113 ALA 113 114 114 ALA ALA F . n 
P 1 114 VAL 114 115 115 VAL VAL F . n 
P 1 115 TYR 115 116 116 TYR TYR F . n 
P 1 116 GLN 116 117 117 GLN GLN F . n 
P 1 117 ASN 117 118 118 ASN ASN F . n 
P 1 118 ILE 118 119 119 ILE ILE F . n 
P 1 119 ASP 119 120 120 ASP ASP F . n 
P 1 120 ILE 120 121 121 ILE ILE F . n 
P 1 121 ILE 121 122 122 ILE ILE F . n 
P 1 122 GLU 122 123 123 GLU GLU F . n 
P 1 123 PRO 123 124 124 PRO PRO F . n 
P 1 124 TYR 124 125 125 TYR TYR F . n 
P 1 125 ALA 125 126 126 ALA ALA F . n 
P 1 126 PRO 126 127 127 PRO PRO F . n 
P 1 127 GLU 127 128 128 GLU GLU F . n 
P 1 128 TYR 128 129 129 TYR TYR F . n 
P 1 129 MET 129 130 130 MET MET F . n 
P 1 130 VAL 130 131 131 VAL VAL F . n 
P 1 131 ILE 131 132 132 ILE ILE F . n 
P 1 132 LEU 132 133 133 LEU LEU F . n 
P 1 133 ALA 133 134 134 ALA ALA F . n 
P 1 134 GLY 134 135 135 GLY GLY F . n 
P 1 135 ASP 135 136 136 ASP ASP F . n 
P 1 136 HIS 136 137 137 HIS HIS F . n 
P 1 137 ILE 137 138 138 ILE ILE F . n 
P 1 138 TYR 138 139 139 TYR TYR F . n 
P 1 139 LYS 139 140 140 LYS LYS F . n 
P 1 140 MET 140 141 141 MET MET F . n 
P 1 141 ASP 141 142 142 ASP ASP F . n 
P 1 142 TYR 142 143 143 TYR TYR F . n 
P 1 143 GLU 143 144 144 GLU GLU F . n 
P 1 144 TYR 144 145 145 TYR TYR F . n 
P 1 145 MET 145 146 146 MET MET F . n 
P 1 146 LEU 146 147 147 LEU LEU F . n 
P 1 147 GLN 147 148 148 GLN GLN F . n 
P 1 148 GLN 148 149 149 GLN GLN F . n 
P 1 149 HIS 149 150 150 HIS HIS F . n 
P 1 150 VAL 150 151 151 VAL VAL F . n 
P 1 151 ASP 151 152 152 ASP ASP F . n 
P 1 152 SER 152 153 153 SER SER F . n 
P 1 153 GLY 153 154 154 GLY GLY F . n 
P 1 154 ALA 154 155 155 ALA ALA F . n 
P 1 155 ASP 155 156 156 ASP ASP F . n 
P 1 156 VAL 156 157 157 VAL VAL F . n 
P 1 157 THR 157 158 158 THR THR F . n 
P 1 158 ILE 158 159 159 ILE ILE F . n 
P 1 159 GLY 159 160 160 GLY GLY F . n 
P 1 160 CYS 160 161 161 CYS CYS F . n 
P 1 161 LEU 161 162 162 LEU LEU F . n 
P 1 162 GLU 162 163 163 GLU GLU F . n 
P 1 163 VAL 163 164 164 VAL VAL F . n 
P 1 164 PRO 164 165 165 PRO PRO F . n 
P 1 165 ARG 165 166 166 ARG ARG F . n 
P 1 166 MET 166 167 167 MET MET F . n 
P 1 167 GLU 167 168 168 GLU GLU F . n 
P 1 168 ALA 168 169 169 ALA ALA F . n 
P 1 169 THR 169 170 170 THR THR F . n 
P 1 170 GLY 170 171 171 GLY GLY F . n 
P 1 171 PHE 171 172 172 PHE PHE F . n 
P 1 172 GLY 172 173 173 GLY GLY F . n 
P 1 173 VAL 173 174 174 VAL VAL F . n 
P 1 174 MET 174 175 175 MET MET F . n 
P 1 175 HIS 175 176 176 HIS HIS F . n 
P 1 176 VAL 176 177 177 VAL VAL F . n 
P 1 177 ASN 177 178 178 ASN ASN F . n 
P 1 178 GLU 178 179 179 GLU GLU F . n 
P 1 179 LYS 179 180 180 LYS LYS F . n 
P 1 180 ASP 180 181 181 ASP ASP F . n 
P 1 181 GLU 181 182 182 GLU GLU F . n 
P 1 182 ILE 182 183 183 ILE ILE F . n 
P 1 183 ILE 183 184 184 ILE ILE F . n 
P 1 184 ASP 184 185 185 ASP ASP F . n 
P 1 185 PHE 185 186 186 PHE PHE F . n 
P 1 186 ILE 186 187 187 ILE ILE F . n 
P 1 187 GLU 187 188 188 GLU GLU F . n 
P 1 188 LYS 188 189 189 LYS LYS F . n 
P 1 189 PRO 189 190 190 PRO PRO F . n 
P 1 190 ALA 190 191 191 ALA ALA F . n 
P 1 191 ASP 191 192 192 ASP ASP F . n 
P 1 192 PRO 192 193 193 PRO PRO F . n 
P 1 193 PRO 193 194 194 PRO PRO F . n 
P 1 194 GLY 194 195 195 GLY GLY F . n 
P 1 195 ILE 195 196 196 ILE ILE F . n 
P 1 196 PRO 196 197 197 PRO PRO F . n 
P 1 197 GLY 197 198 198 GLY GLY F . n 
P 1 198 ASN 198 199 199 ASN ASN F . n 
P 1 199 GLU 199 200 200 GLU GLU F . n 
P 1 200 GLY 200 201 201 GLY GLY F . n 
P 1 201 PHE 201 202 202 PHE PHE F . n 
P 1 202 ALA 202 203 203 ALA ALA F . n 
P 1 203 LEU 203 204 204 LEU LEU F . n 
P 1 204 ALA 204 205 205 ALA ALA F . n 
P 1 205 SER 205 206 206 SER SER F . n 
P 1 206 MET 206 207 207 MET MET F . n 
P 1 207 GLY 207 208 208 GLY GLY F . n 
P 1 208 ILE 208 209 209 ILE ILE F . n 
P 1 209 TYR 209 210 210 TYR TYR F . n 
P 1 210 VAL 210 211 211 VAL VAL F . n 
P 1 211 PHE 211 212 212 PHE PHE F . n 
P 1 212 HIS 212 213 213 HIS HIS F . n 
P 1 213 THR 213 214 214 THR THR F . n 
P 1 214 LYS 214 215 215 LYS LYS F . n 
P 1 215 PHE 215 216 216 PHE PHE F . n 
P 1 216 LEU 216 217 217 LEU LEU F . n 
P 1 217 MET 217 218 218 MET MET F . n 
P 1 218 GLU 218 219 219 GLU GLU F . n 
P 1 219 ALA 219 220 220 ALA ALA F . n 
P 1 220 LEU 220 221 221 LEU LEU F . n 
P 1 221 ARG 221 222 222 ARG ARG F . n 
P 1 222 ARG 222 223 223 ARG ARG F . n 
P 1 223 ASP 223 224 224 ASP ASP F . n 
P 1 224 ALA 224 225 225 ALA ALA F . n 
P 1 225 ALA 225 226 226 ALA ALA F . n 
P 1 226 ASP 226 227 227 ASP ASP F . n 
P 1 227 PRO 227 228 228 PRO PRO F . n 
P 1 228 THR 228 229 229 THR THR F . n 
P 1 229 SER 229 230 230 SER SER F . n 
P 1 230 SER 230 231 231 SER SER F . n 
P 1 231 ARG 231 232 232 ARG ARG F . n 
P 1 232 ASP 232 233 233 ASP ASP F . n 
P 1 233 PHE 233 234 234 PHE PHE F . n 
P 1 234 GLY 234 235 235 GLY GLY F . n 
P 1 235 LYS 235 236 236 LYS LYS F . n 
P 1 236 ASP 236 237 237 ASP ASP F . n 
P 1 237 ILE 237 238 238 ILE ILE F . n 
P 1 238 ILE 238 239 239 ILE ILE F . n 
P 1 239 PRO 239 240 240 PRO PRO F . n 
P 1 240 TYR 240 241 241 TYR TYR F . n 
P 1 241 ILE 241 242 242 ILE ILE F . n 
P 1 242 VAL 242 243 243 VAL VAL F . n 
P 1 243 GLU 243 244 244 GLU GLU F . n 
P 1 244 HIS 244 245 245 HIS HIS F . n 
P 1 245 GLY 245 246 246 GLY GLY F . n 
P 1 246 LYS 246 247 247 LYS LYS F . n 
P 1 247 ALA 247 248 248 ALA ALA F . n 
P 1 248 VAL 248 249 249 VAL VAL F . n 
P 1 249 ALA 249 250 250 ALA ALA F . n 
P 1 250 HIS 250 251 251 HIS HIS F . n 
P 1 251 ARG 251 252 252 ARG ARG F . n 
P 1 252 PHE 252 253 253 PHE PHE F . n 
P 1 253 ALA 253 254 254 ALA ALA F . n 
P 1 254 ASP 254 255 255 ASP ASP F . n 
P 1 255 SER 255 256 256 SER SER F . n 
P 1 256 CYS 256 257 257 CYS CYS F . n 
P 1 257 VAL 257 258 258 VAL VAL F . n 
P 1 258 ARG 258 259 259 ARG ARG F . n 
P 1 259 SER 259 260 260 SER SER F . n 
P 1 260 ASP 260 261 261 ASP ASP F . n 
P 1 261 PHE 261 262 262 PHE PHE F . n 
P 1 262 GLU 262 263 263 GLU GLU F . n 
P 1 263 HIS 263 264 264 HIS HIS F . n 
P 1 264 GLU 264 265 265 GLU GLU F . n 
P 1 265 PRO 265 266 266 PRO PRO F . n 
P 1 266 TYR 266 267 267 TYR TYR F . n 
P 1 267 TRP 267 268 268 TRP TRP F . n 
P 1 268 ARG 268 269 269 ARG ARG F . n 
P 1 269 ASP 269 270 270 ASP ASP F . n 
P 1 270 VAL 270 271 271 VAL VAL F . n 
P 1 271 GLY 271 272 272 GLY GLY F . n 
P 1 272 THR 272 273 273 THR THR F . n 
P 1 273 ILE 273 274 274 ILE ILE F . n 
P 1 274 ASP 274 275 275 ASP ASP F . n 
P 1 275 ALA 275 276 276 ALA ALA F . n 
P 1 276 TYR 276 277 277 TYR TYR F . n 
P 1 277 TRP 277 278 278 TRP TRP F . n 
P 1 278 GLN 278 279 279 GLN GLN F . n 
P 1 279 ALA 279 280 280 ALA ALA F . n 
P 1 280 ASN 280 281 281 ASN ASN F . n 
P 1 281 ILE 281 282 282 ILE ILE F . n 
P 1 282 ASP 282 283 283 ASP ASP F . n 
P 1 283 LEU 283 284 284 LEU LEU F . n 
P 1 284 THR 284 285 285 THR THR F . n 
P 1 285 ASP 285 286 286 ASP ASP F . n 
P 1 286 VAL 286 287 287 VAL VAL F . n 
P 1 287 VAL 287 288 288 VAL VAL F . n 
P 1 288 PRO 288 289 289 PRO PRO F . n 
P 1 289 ASP 289 290 290 ASP ASP F . n 
P 1 290 LEU 290 291 291 LEU LEU F . n 
P 1 291 ASP 291 292 292 ASP ASP F . n 
P 1 292 ILE 292 293 293 ILE ILE F . n 
P 1 293 TYR 293 294 294 TYR TYR F . n 
P 1 294 ASP 294 295 295 ASP ASP F . n 
P 1 295 LYS 295 296 296 LYS LYS F . n 
P 1 296 SER 296 297 297 SER SER F . n 
P 1 297 TRP 297 298 298 TRP TRP F . n 
P 1 298 PRO 298 299 299 PRO PRO F . n 
P 1 299 ILE 299 300 300 ILE ILE F . n 
P 1 300 TRP 300 301 301 TRP TRP F . n 
P 1 301 THR 301 302 302 THR THR F . n 
P 1 302 TYR 302 303 303 TYR TYR F . n 
P 1 303 ALA 303 304 304 ALA ALA F . n 
P 1 304 GLU 304 305 305 GLU GLU F . n 
P 1 305 ILE 305 306 306 ILE ILE F . n 
P 1 306 THR 306 307 307 THR THR F . n 
P 1 307 PRO 307 308 308 PRO PRO F . n 
P 1 308 PRO 308 309 309 PRO PRO F . n 
P 1 309 ALA 309 310 310 ALA ALA F . n 
P 1 310 LYS 310 311 311 LYS LYS F . n 
P 1 311 PHE 311 312 312 PHE PHE F . n 
P 1 312 VAL 312 313 313 VAL VAL F . n 
P 1 313 HIS 313 314 314 HIS HIS F . n 
P 1 314 ASP 314 315 315 ASP ASP F . n 
P 1 315 ASP 315 316 316 ASP ASP F . n 
P 1 316 GLU 316 317 317 GLU GLU F . n 
P 1 317 ASP 317 318 318 ASP ASP F . n 
P 1 318 ARG 318 319 319 ARG ARG F . n 
P 1 319 ARG 319 320 320 ARG ARG F . n 
P 1 320 GLY 320 321 321 GLY GLY F . n 
P 1 321 SER 321 322 322 SER SER F . n 
P 1 322 ALA 322 323 323 ALA ALA F . n 
P 1 323 VAL 323 324 324 VAL VAL F . n 
P 1 324 SER 324 325 325 SER SER F . n 
P 1 325 SER 325 326 326 SER SER F . n 
P 1 326 VAL 326 327 327 VAL VAL F . n 
P 1 327 VAL 327 328 328 VAL VAL F . n 
P 1 328 SER 328 329 329 SER SER F . n 
P 1 329 GLY 329 330 330 GLY GLY F . n 
P 1 330 ASP 330 331 331 ASP ASP F . n 
P 1 331 CYS 331 332 332 CYS CYS F . n 
P 1 332 ILE 332 333 333 ILE ILE F . n 
P 1 333 ILE 333 334 334 ILE ILE F . n 
P 1 334 SER 334 335 335 SER SER F . n 
P 1 335 GLY 335 336 336 GLY GLY F . n 
P 1 336 ALA 336 337 337 ALA ALA F . n 
P 1 337 ALA 337 338 338 ALA ALA F . n 
P 1 338 LEU 338 339 339 LEU LEU F . n 
P 1 339 ASN 339 340 340 ASN ASN F . n 
P 1 340 ARG 340 341 341 ARG ARG F . n 
P 1 341 SER 341 342 342 SER SER F . n 
P 1 342 LEU 342 343 343 LEU LEU F . n 
P 1 343 LEU 343 344 344 LEU LEU F . n 
P 1 344 PHE 344 345 345 PHE PHE F . n 
P 1 345 THR 345 346 346 THR THR F . n 
P 1 346 GLY 346 347 347 GLY GLY F . n 
P 1 347 VAL 347 348 348 VAL VAL F . n 
P 1 348 ARG 348 349 349 ARG ARG F . n 
P 1 349 ALA 349 350 350 ALA ALA F . n 
P 1 350 ASN 350 351 351 ASN ASN F . n 
P 1 351 SER 351 352 352 SER SER F . n 
P 1 352 TYR 352 353 353 TYR TYR F . n 
P 1 353 SER 353 354 354 SER SER F . n 
P 1 354 ARG 354 355 355 ARG ARG F . n 
P 1 355 LEU 355 356 356 LEU LEU F . n 
P 1 356 GLU 356 357 357 GLU GLU F . n 
P 1 357 ASN 357 358 358 ASN ASN F . n 
P 1 358 ALA 358 359 359 ALA ALA F . n 
P 1 359 VAL 359 360 360 VAL VAL F . n 
P 1 360 VAL 360 361 361 VAL VAL F . n 
P 1 361 LEU 361 362 362 LEU LEU F . n 
P 1 362 PRO 362 363 363 PRO PRO F . n 
P 1 363 SER 363 364 364 SER SER F . n 
P 1 364 VAL 364 365 365 VAL VAL F . n 
P 1 365 LYS 365 366 366 LYS LYS F . n 
P 1 366 ILE 366 367 367 ILE ILE F . n 
P 1 367 GLY 367 368 368 GLY GLY F . n 
P 1 368 ARG 368 369 369 ARG ARG F . n 
P 1 369 HIS 369 370 370 HIS HIS F . n 
P 1 370 ALA 370 371 371 ALA ALA F . n 
P 1 371 GLN 371 372 372 GLN GLN F . n 
P 1 372 LEU 372 373 373 LEU LEU F . n 
P 1 373 SER 373 374 374 SER SER F . n 
P 1 374 ASN 374 375 375 ASN ASN F . n 
P 1 375 VAL 375 376 376 VAL VAL F . n 
P 1 376 VAL 376 377 377 VAL VAL F . n 
P 1 377 ILE 377 378 378 ILE ILE F . n 
P 1 378 ASP 378 379 379 ASP ASP F . n 
P 1 379 HIS 379 380 380 HIS HIS F . n 
P 1 380 GLY 380 381 381 GLY GLY F . n 
P 1 381 VAL 381 382 382 VAL VAL F . n 
P 1 382 VAL 382 383 383 VAL VAL F . n 
P 1 383 ILE 383 384 384 ILE ILE F . n 
P 1 384 PRO 384 385 385 PRO PRO F . n 
P 1 385 GLU 385 386 386 GLU GLU F . n 
P 1 386 GLY 386 387 387 GLY GLY F . n 
P 1 387 LEU 387 388 388 LEU LEU F . n 
P 1 388 ILE 388 389 389 ILE ILE F . n 
P 1 389 VAL 389 390 390 VAL VAL F . n 
P 1 390 GLY 390 391 391 GLY GLY F . n 
P 1 391 GLU 391 392 392 GLU GLU F . n 
P 1 392 ASP 392 393 393 ASP ASP F . n 
P 1 393 PRO 393 394 394 PRO PRO F . n 
P 1 394 GLU 394 395 395 GLU GLU F . n 
P 1 395 LEU 395 396 396 LEU LEU F . n 
P 1 396 ASP 396 397 397 ASP ASP F . n 
P 1 397 ALA 397 398 398 ALA ALA F . n 
P 1 398 LYS 398 399 399 LYS LYS F . n 
P 1 399 ARG 399 400 400 ARG ARG F . n 
P 1 400 PHE 400 401 401 PHE PHE F . n 
P 1 401 ARG 401 402 402 ARG ARG F . n 
P 1 402 ARG 402 403 403 ARG ARG F . n 
P 1 403 THR 403 404 404 THR THR F . n 
P 1 404 GLU 404 405 405 GLU GLU F . n 
P 1 405 SER 405 406 406 SER SER F . n 
P 1 406 GLY 406 407 407 GLY GLY F . n 
P 1 407 ILE 407 408 408 ILE ILE F . n 
P 1 408 CYS 408 409 409 CYS CYS F . n 
P 1 409 LEU 409 410 410 LEU LEU F . n 
P 1 410 ILE 410 411 411 ILE ILE F . n 
P 1 411 THR 411 412 412 THR THR F . n 
P 1 412 GLN 412 413 413 GLN GLN F . n 
P 1 413 SER 413 414 414 SER SER F . n 
P 1 414 MET 414 415 415 MET MET F . n 
P 1 415 ILE 415 416 416 ILE ILE F . n 
P 1 416 ASP 416 417 417 ASP ASP F . n 
P 1 417 LYS 417 418 418 LYS LYS F . n 
P 1 418 LEU 418 419 419 LEU LEU F . n 
P 1 419 ASP 419 420 420 ASP ASP F . n 
P 1 420 LEU 420 421 421 LEU LEU F . n 
Q 1 1   MET 1   2   ?   ?   ?   G . n 
Q 1 2   SER 2   3   ?   ?   ?   G . n 
Q 1 3   GLU 3   4   ?   ?   ?   G . n 
Q 1 4   LYS 4   5   ?   ?   ?   G . n 
Q 1 5   ARG 5   6   6   ARG ARG G . n 
Q 1 6   VAL 6   7   7   VAL VAL G . n 
Q 1 7   GLN 7   8   8   GLN GLN G . n 
Q 1 8   PRO 8   9   9   PRO PRO G . n 
Q 1 9   LEU 9   10  10  LEU LEU G . n 
Q 1 10  ALA 10  11  11  ALA ALA G . n 
Q 1 11  ARG 11  12  12  ARG ARG G . n 
Q 1 12  ASP 12  13  13  ASP ASP G . n 
Q 1 13  ALA 13  14  14  ALA ALA G . n 
Q 1 14  MET 14  15  15  MET MET G . n 
Q 1 15  ALA 15  16  16  ALA ALA G . n 
Q 1 16  TYR 16  17  17  TYR TYR G . n 
Q 1 17  VAL 17  18  18  VAL VAL G . n 
Q 1 18  LEU 18  19  19  LEU LEU G . n 
Q 1 19  ALA 19  20  20  ALA ALA G . n 
Q 1 20  GLY 20  21  21  GLY GLY G . n 
Q 1 21  GLY 21  22  22  GLY GLY G . n 
Q 1 22  ARG 22  23  23  ARG ARG G . n 
Q 1 23  GLY 23  24  24  GLY GLY G . n 
Q 1 24  SER 24  25  25  SER SER G . n 
Q 1 25  ARG 25  26  26  ARG ARG G . n 
Q 1 26  LEU 26  27  27  LEU LEU G . n 
Q 1 27  LYS 27  28  28  LYS LYS G . n 
Q 1 28  GLU 28  29  29  GLU GLU G . n 
Q 1 29  LEU 29  30  30  LEU LEU G . n 
Q 1 30  THR 30  31  31  THR THR G . n 
Q 1 31  ASP 31  32  32  ASP ASP G . n 
Q 1 32  ARG 32  33  33  ARG ARG G . n 
Q 1 33  ARG 33  34  34  ARG ARG G . n 
Q 1 34  ALA 34  35  35  ALA ALA G . n 
Q 1 35  LYS 35  36  36  LYS LYS G . n 
Q 1 36  PRO 36  37  37  PRO PRO G . n 
Q 1 37  ALA 37  38  38  ALA ALA G . n 
Q 1 38  VAL 38  39  39  VAL VAL G . n 
Q 1 39  TYR 39  40  40  TYR TYR G . n 
Q 1 40  PHE 40  41  41  PHE PHE G . n 
Q 1 41  GLY 41  42  42  GLY GLY G . n 
Q 1 42  GLY 42  43  43  GLY GLY G . n 
Q 1 43  LYS 43  44  44  LYS LYS G . n 
Q 1 44  ALA 44  45  45  ALA ALA G . n 
Q 1 45  ARG 45  46  46  ARG ARG G . n 
Q 1 46  ILE 46  47  47  ILE ILE G . n 
Q 1 47  ILE 47  48  48  ILE ILE G . n 
Q 1 48  ASP 48  49  49  ASP ASP G . n 
Q 1 49  PHE 49  50  50  PHE PHE G . n 
Q 1 50  ALA 50  51  51  ALA ALA G . n 
Q 1 51  LEU 51  52  52  LEU LEU G . n 
Q 1 52  SER 52  53  53  SER SER G . n 
Q 1 53  ASN 53  54  54  ASN ASN G . n 
Q 1 54  ALA 54  55  55  ALA ALA G . n 
Q 1 55  LEU 55  56  56  LEU LEU G . n 
Q 1 56  ASN 56  57  57  ASN ASN G . n 
Q 1 57  SER 57  58  58  SER SER G . n 
Q 1 58  GLY 58  59  59  GLY GLY G . n 
Q 1 59  ILE 59  60  60  ILE ILE G . n 
Q 1 60  ARG 60  61  61  ARG ARG G . n 
Q 1 61  ARG 61  62  62  ARG ARG G . n 
Q 1 62  ILE 62  63  63  ILE ILE G . n 
Q 1 63  GLY 63  64  64  GLY GLY G . n 
Q 1 64  VAL 64  65  65  VAL VAL G . n 
Q 1 65  ALA 65  66  66  ALA ALA G . n 
Q 1 66  THR 66  67  67  THR THR G . n 
Q 1 67  GLN 67  68  68  GLN GLN G . n 
Q 1 68  TYR 68  69  69  TYR TYR G . n 
Q 1 69  LYS 69  70  70  LYS LYS G . n 
Q 1 70  ALA 70  71  71  ALA ALA G . n 
Q 1 71  HIS 71  72  72  HIS HIS G . n 
Q 1 72  SER 72  73  73  SER SER G . n 
Q 1 73  LEU 73  74  74  LEU LEU G . n 
Q 1 74  ILE 74  75  75  ILE ILE G . n 
Q 1 75  ARG 75  76  76  ARG ARG G . n 
Q 1 76  HIS 76  77  77  HIS HIS G . n 
Q 1 77  LEU 77  78  78  LEU LEU G . n 
Q 1 78  GLN 78  79  79  GLN GLN G . n 
Q 1 79  ARG 79  80  80  ARG ARG G . n 
Q 1 80  GLY 80  81  81  GLY GLY G . n 
Q 1 81  TRP 81  82  82  TRP TRP G . n 
Q 1 82  ASP 82  83  83  ASP ASP G . n 
Q 1 83  PHE 83  84  84  PHE PHE G . n 
Q 1 84  PHE 84  85  85  PHE PHE G . n 
Q 1 85  ARG 85  86  86  ARG ARG G . n 
Q 1 86  PRO 86  87  87  PRO PRO G . n 
Q 1 87  GLU 87  88  88  GLU GLU G . n 
Q 1 88  ARG 88  89  89  ARG ARG G . n 
Q 1 89  ASN 89  90  90  ASN ASN G . n 
Q 1 90  GLU 90  91  91  GLU GLU G . n 
Q 1 91  SER 91  92  92  SER SER G . n 
Q 1 92  PHE 92  93  93  PHE PHE G . n 
Q 1 93  ASP 93  94  94  ASP ASP G . n 
Q 1 94  ILE 94  95  95  ILE ILE G . n 
Q 1 95  LEU 95  96  96  LEU LEU G . n 
Q 1 96  PRO 96  97  97  PRO PRO G . n 
Q 1 97  ALA 97  98  98  ALA ALA G . n 
Q 1 98  SER 98  99  ?   ?   ?   G . n 
Q 1 99  GLN 99  100 ?   ?   ?   G . n 
Q 1 100 ARG 100 101 ?   ?   ?   G . n 
Q 1 101 VAL 101 102 ?   ?   ?   G . n 
Q 1 102 SER 102 103 ?   ?   ?   G . n 
Q 1 103 GLU 103 104 ?   ?   ?   G . n 
Q 1 104 THR 104 105 105 THR THR G . n 
Q 1 105 GLN 105 106 106 GLN GLN G . n 
Q 1 106 TRP 106 107 107 TRP TRP G . n 
Q 1 107 TYR 107 108 108 TYR TYR G . n 
Q 1 108 GLU 108 109 109 GLU GLU G . n 
Q 1 109 GLY 109 110 110 GLY GLY G . n 
Q 1 110 THR 110 111 111 THR THR G . n 
Q 1 111 ALA 111 112 112 ALA ALA G . n 
Q 1 112 ASP 112 113 113 ASP ASP G . n 
Q 1 113 ALA 113 114 114 ALA ALA G . n 
Q 1 114 VAL 114 115 115 VAL VAL G . n 
Q 1 115 TYR 115 116 116 TYR TYR G . n 
Q 1 116 GLN 116 117 117 GLN GLN G . n 
Q 1 117 ASN 117 118 118 ASN ASN G . n 
Q 1 118 ILE 118 119 119 ILE ILE G . n 
Q 1 119 ASP 119 120 120 ASP ASP G . n 
Q 1 120 ILE 120 121 121 ILE ILE G . n 
Q 1 121 ILE 121 122 122 ILE ILE G . n 
Q 1 122 GLU 122 123 123 GLU GLU G . n 
Q 1 123 PRO 123 124 124 PRO PRO G . n 
Q 1 124 TYR 124 125 125 TYR TYR G . n 
Q 1 125 ALA 125 126 126 ALA ALA G . n 
Q 1 126 PRO 126 127 127 PRO PRO G . n 
Q 1 127 GLU 127 128 128 GLU GLU G . n 
Q 1 128 TYR 128 129 129 TYR TYR G . n 
Q 1 129 MET 129 130 130 MET MET G . n 
Q 1 130 VAL 130 131 131 VAL VAL G . n 
Q 1 131 ILE 131 132 132 ILE ILE G . n 
Q 1 132 LEU 132 133 133 LEU LEU G . n 
Q 1 133 ALA 133 134 134 ALA ALA G . n 
Q 1 134 GLY 134 135 135 GLY GLY G . n 
Q 1 135 ASP 135 136 136 ASP ASP G . n 
Q 1 136 HIS 136 137 137 HIS HIS G . n 
Q 1 137 ILE 137 138 138 ILE ILE G . n 
Q 1 138 TYR 138 139 139 TYR TYR G . n 
Q 1 139 LYS 139 140 140 LYS LYS G . n 
Q 1 140 MET 140 141 141 MET MET G . n 
Q 1 141 ASP 141 142 142 ASP ASP G . n 
Q 1 142 TYR 142 143 143 TYR TYR G . n 
Q 1 143 GLU 143 144 144 GLU GLU G . n 
Q 1 144 TYR 144 145 145 TYR TYR G . n 
Q 1 145 MET 145 146 146 MET MET G . n 
Q 1 146 LEU 146 147 147 LEU LEU G . n 
Q 1 147 GLN 147 148 148 GLN GLN G . n 
Q 1 148 GLN 148 149 149 GLN GLN G . n 
Q 1 149 HIS 149 150 150 HIS HIS G . n 
Q 1 150 VAL 150 151 151 VAL VAL G . n 
Q 1 151 ASP 151 152 152 ASP ASP G . n 
Q 1 152 SER 152 153 153 SER SER G . n 
Q 1 153 GLY 153 154 154 GLY GLY G . n 
Q 1 154 ALA 154 155 155 ALA ALA G . n 
Q 1 155 ASP 155 156 156 ASP ASP G . n 
Q 1 156 VAL 156 157 157 VAL VAL G . n 
Q 1 157 THR 157 158 158 THR THR G . n 
Q 1 158 ILE 158 159 159 ILE ILE G . n 
Q 1 159 GLY 159 160 160 GLY GLY G . n 
Q 1 160 CYS 160 161 161 CYS CYS G . n 
Q 1 161 LEU 161 162 162 LEU LEU G . n 
Q 1 162 GLU 162 163 163 GLU GLU G . n 
Q 1 163 VAL 163 164 164 VAL VAL G . n 
Q 1 164 PRO 164 165 165 PRO PRO G . n 
Q 1 165 ARG 165 166 166 ARG ARG G . n 
Q 1 166 MET 166 167 167 MET MET G . n 
Q 1 167 GLU 167 168 168 GLU GLU G . n 
Q 1 168 ALA 168 169 169 ALA ALA G . n 
Q 1 169 THR 169 170 170 THR THR G . n 
Q 1 170 GLY 170 171 171 GLY GLY G . n 
Q 1 171 PHE 171 172 172 PHE PHE G . n 
Q 1 172 GLY 172 173 173 GLY GLY G . n 
Q 1 173 VAL 173 174 174 VAL VAL G . n 
Q 1 174 MET 174 175 175 MET MET G . n 
Q 1 175 HIS 175 176 176 HIS HIS G . n 
Q 1 176 VAL 176 177 177 VAL VAL G . n 
Q 1 177 ASN 177 178 178 ASN ASN G . n 
Q 1 178 GLU 178 179 179 GLU GLU G . n 
Q 1 179 LYS 179 180 180 LYS LYS G . n 
Q 1 180 ASP 180 181 181 ASP ASP G . n 
Q 1 181 GLU 181 182 182 GLU GLU G . n 
Q 1 182 ILE 182 183 183 ILE ILE G . n 
Q 1 183 ILE 183 184 184 ILE ILE G . n 
Q 1 184 ASP 184 185 185 ASP ASP G . n 
Q 1 185 PHE 185 186 186 PHE PHE G . n 
Q 1 186 ILE 186 187 187 ILE ILE G . n 
Q 1 187 GLU 187 188 188 GLU GLU G . n 
Q 1 188 LYS 188 189 189 LYS LYS G . n 
Q 1 189 PRO 189 190 190 PRO PRO G . n 
Q 1 190 ALA 190 191 191 ALA ALA G . n 
Q 1 191 ASP 191 192 192 ASP ASP G . n 
Q 1 192 PRO 192 193 193 PRO PRO G . n 
Q 1 193 PRO 193 194 194 PRO PRO G . n 
Q 1 194 GLY 194 195 195 GLY GLY G . n 
Q 1 195 ILE 195 196 196 ILE ILE G . n 
Q 1 196 PRO 196 197 197 PRO PRO G . n 
Q 1 197 GLY 197 198 198 GLY GLY G . n 
Q 1 198 ASN 198 199 199 ASN ASN G . n 
Q 1 199 GLU 199 200 200 GLU GLU G . n 
Q 1 200 GLY 200 201 201 GLY GLY G . n 
Q 1 201 PHE 201 202 202 PHE PHE G . n 
Q 1 202 ALA 202 203 203 ALA ALA G . n 
Q 1 203 LEU 203 204 204 LEU LEU G . n 
Q 1 204 ALA 204 205 205 ALA ALA G . n 
Q 1 205 SER 205 206 206 SER SER G . n 
Q 1 206 MET 206 207 207 MET MET G . n 
Q 1 207 GLY 207 208 208 GLY GLY G . n 
Q 1 208 ILE 208 209 209 ILE ILE G . n 
Q 1 209 TYR 209 210 210 TYR TYR G . n 
Q 1 210 VAL 210 211 211 VAL VAL G . n 
Q 1 211 PHE 211 212 212 PHE PHE G . n 
Q 1 212 HIS 212 213 213 HIS HIS G . n 
Q 1 213 THR 213 214 214 THR THR G . n 
Q 1 214 LYS 214 215 215 LYS LYS G . n 
Q 1 215 PHE 215 216 216 PHE PHE G . n 
Q 1 216 LEU 216 217 217 LEU LEU G . n 
Q 1 217 MET 217 218 218 MET MET G . n 
Q 1 218 GLU 218 219 219 GLU GLU G . n 
Q 1 219 ALA 219 220 220 ALA ALA G . n 
Q 1 220 LEU 220 221 221 LEU LEU G . n 
Q 1 221 ARG 221 222 222 ARG ARG G . n 
Q 1 222 ARG 222 223 223 ARG ARG G . n 
Q 1 223 ASP 223 224 224 ASP ASP G . n 
Q 1 224 ALA 224 225 225 ALA ALA G . n 
Q 1 225 ALA 225 226 226 ALA ALA G . n 
Q 1 226 ASP 226 227 227 ASP ASP G . n 
Q 1 227 PRO 227 228 228 PRO PRO G . n 
Q 1 228 THR 228 229 229 THR THR G . n 
Q 1 229 SER 229 230 230 SER SER G . n 
Q 1 230 SER 230 231 231 SER SER G . n 
Q 1 231 ARG 231 232 232 ARG ARG G . n 
Q 1 232 ASP 232 233 233 ASP ASP G . n 
Q 1 233 PHE 233 234 234 PHE PHE G . n 
Q 1 234 GLY 234 235 235 GLY GLY G . n 
Q 1 235 LYS 235 236 236 LYS LYS G . n 
Q 1 236 ASP 236 237 237 ASP ASP G . n 
Q 1 237 ILE 237 238 238 ILE ILE G . n 
Q 1 238 ILE 238 239 239 ILE ILE G . n 
Q 1 239 PRO 239 240 240 PRO PRO G . n 
Q 1 240 TYR 240 241 241 TYR TYR G . n 
Q 1 241 ILE 241 242 242 ILE ILE G . n 
Q 1 242 VAL 242 243 243 VAL VAL G . n 
Q 1 243 GLU 243 244 244 GLU GLU G . n 
Q 1 244 HIS 244 245 245 HIS HIS G . n 
Q 1 245 GLY 245 246 246 GLY GLY G . n 
Q 1 246 LYS 246 247 247 LYS LYS G . n 
Q 1 247 ALA 247 248 248 ALA ALA G . n 
Q 1 248 VAL 248 249 249 VAL VAL G . n 
Q 1 249 ALA 249 250 250 ALA ALA G . n 
Q 1 250 HIS 250 251 251 HIS HIS G . n 
Q 1 251 ARG 251 252 252 ARG ARG G . n 
Q 1 252 PHE 252 253 253 PHE PHE G . n 
Q 1 253 ALA 253 254 254 ALA ALA G . n 
Q 1 254 ASP 254 255 255 ASP ASP G . n 
Q 1 255 SER 255 256 256 SER SER G . n 
Q 1 256 CYS 256 257 257 CYS CYS G . n 
Q 1 257 VAL 257 258 258 VAL VAL G . n 
Q 1 258 ARG 258 259 259 ARG ARG G . n 
Q 1 259 SER 259 260 260 SER SER G . n 
Q 1 260 ASP 260 261 261 ASP ASP G . n 
Q 1 261 PHE 261 262 262 PHE PHE G . n 
Q 1 262 GLU 262 263 263 GLU GLU G . n 
Q 1 263 HIS 263 264 264 HIS HIS G . n 
Q 1 264 GLU 264 265 265 GLU GLU G . n 
Q 1 265 PRO 265 266 266 PRO PRO G . n 
Q 1 266 TYR 266 267 267 TYR TYR G . n 
Q 1 267 TRP 267 268 268 TRP TRP G . n 
Q 1 268 ARG 268 269 269 ARG ARG G . n 
Q 1 269 ASP 269 270 270 ASP ASP G . n 
Q 1 270 VAL 270 271 271 VAL VAL G . n 
Q 1 271 GLY 271 272 272 GLY GLY G . n 
Q 1 272 THR 272 273 273 THR THR G . n 
Q 1 273 ILE 273 274 274 ILE ILE G . n 
Q 1 274 ASP 274 275 275 ASP ASP G . n 
Q 1 275 ALA 275 276 276 ALA ALA G . n 
Q 1 276 TYR 276 277 277 TYR TYR G . n 
Q 1 277 TRP 277 278 278 TRP TRP G . n 
Q 1 278 GLN 278 279 279 GLN GLN G . n 
Q 1 279 ALA 279 280 280 ALA ALA G . n 
Q 1 280 ASN 280 281 281 ASN ASN G . n 
Q 1 281 ILE 281 282 282 ILE ILE G . n 
Q 1 282 ASP 282 283 283 ASP ASP G . n 
Q 1 283 LEU 283 284 284 LEU LEU G . n 
Q 1 284 THR 284 285 285 THR THR G . n 
Q 1 285 ASP 285 286 286 ASP ASP G . n 
Q 1 286 VAL 286 287 287 VAL VAL G . n 
Q 1 287 VAL 287 288 288 VAL VAL G . n 
Q 1 288 PRO 288 289 289 PRO PRO G . n 
Q 1 289 ASP 289 290 290 ASP ASP G . n 
Q 1 290 LEU 290 291 291 LEU LEU G . n 
Q 1 291 ASP 291 292 292 ASP ASP G . n 
Q 1 292 ILE 292 293 293 ILE ILE G . n 
Q 1 293 TYR 293 294 294 TYR TYR G . n 
Q 1 294 ASP 294 295 295 ASP ASP G . n 
Q 1 295 LYS 295 296 296 LYS LYS G . n 
Q 1 296 SER 296 297 297 SER SER G . n 
Q 1 297 TRP 297 298 298 TRP TRP G . n 
Q 1 298 PRO 298 299 299 PRO PRO G . n 
Q 1 299 ILE 299 300 300 ILE ILE G . n 
Q 1 300 TRP 300 301 301 TRP TRP G . n 
Q 1 301 THR 301 302 302 THR THR G . n 
Q 1 302 TYR 302 303 303 TYR TYR G . n 
Q 1 303 ALA 303 304 304 ALA ALA G . n 
Q 1 304 GLU 304 305 305 GLU GLU G . n 
Q 1 305 ILE 305 306 306 ILE ILE G . n 
Q 1 306 THR 306 307 307 THR THR G . n 
Q 1 307 PRO 307 308 308 PRO PRO G . n 
Q 1 308 PRO 308 309 309 PRO PRO G . n 
Q 1 309 ALA 309 310 310 ALA ALA G . n 
Q 1 310 LYS 310 311 311 LYS LYS G . n 
Q 1 311 PHE 311 312 312 PHE PHE G . n 
Q 1 312 VAL 312 313 313 VAL VAL G . n 
Q 1 313 HIS 313 314 314 HIS HIS G . n 
Q 1 314 ASP 314 315 315 ASP ASP G . n 
Q 1 315 ASP 315 316 316 ASP ASP G . n 
Q 1 316 GLU 316 317 317 GLU GLU G . n 
Q 1 317 ASP 317 318 318 ASP ASP G . n 
Q 1 318 ARG 318 319 319 ARG ARG G . n 
Q 1 319 ARG 319 320 320 ARG ARG G . n 
Q 1 320 GLY 320 321 321 GLY GLY G . n 
Q 1 321 SER 321 322 322 SER SER G . n 
Q 1 322 ALA 322 323 323 ALA ALA G . n 
Q 1 323 VAL 323 324 324 VAL VAL G . n 
Q 1 324 SER 324 325 325 SER SER G . n 
Q 1 325 SER 325 326 326 SER SER G . n 
Q 1 326 VAL 326 327 327 VAL VAL G . n 
Q 1 327 VAL 327 328 328 VAL VAL G . n 
Q 1 328 SER 328 329 329 SER SER G . n 
Q 1 329 GLY 329 330 330 GLY GLY G . n 
Q 1 330 ASP 330 331 331 ASP ASP G . n 
Q 1 331 CYS 331 332 332 CYS CYS G . n 
Q 1 332 ILE 332 333 333 ILE ILE G . n 
Q 1 333 ILE 333 334 334 ILE ILE G . n 
Q 1 334 SER 334 335 335 SER SER G . n 
Q 1 335 GLY 335 336 336 GLY GLY G . n 
Q 1 336 ALA 336 337 337 ALA ALA G . n 
Q 1 337 ALA 337 338 338 ALA ALA G . n 
Q 1 338 LEU 338 339 339 LEU LEU G . n 
Q 1 339 ASN 339 340 340 ASN ASN G . n 
Q 1 340 ARG 340 341 341 ARG ARG G . n 
Q 1 341 SER 341 342 342 SER SER G . n 
Q 1 342 LEU 342 343 343 LEU LEU G . n 
Q 1 343 LEU 343 344 344 LEU LEU G . n 
Q 1 344 PHE 344 345 345 PHE PHE G . n 
Q 1 345 THR 345 346 346 THR THR G . n 
Q 1 346 GLY 346 347 347 GLY GLY G . n 
Q 1 347 VAL 347 348 348 VAL VAL G . n 
Q 1 348 ARG 348 349 349 ARG ARG G . n 
Q 1 349 ALA 349 350 350 ALA ALA G . n 
Q 1 350 ASN 350 351 351 ASN ASN G . n 
Q 1 351 SER 351 352 352 SER SER G . n 
Q 1 352 TYR 352 353 353 TYR TYR G . n 
Q 1 353 SER 353 354 354 SER SER G . n 
Q 1 354 ARG 354 355 355 ARG ARG G . n 
Q 1 355 LEU 355 356 356 LEU LEU G . n 
Q 1 356 GLU 356 357 357 GLU GLU G . n 
Q 1 357 ASN 357 358 358 ASN ASN G . n 
Q 1 358 ALA 358 359 359 ALA ALA G . n 
Q 1 359 VAL 359 360 360 VAL VAL G . n 
Q 1 360 VAL 360 361 361 VAL VAL G . n 
Q 1 361 LEU 361 362 362 LEU LEU G . n 
Q 1 362 PRO 362 363 363 PRO PRO G . n 
Q 1 363 SER 363 364 364 SER SER G . n 
Q 1 364 VAL 364 365 365 VAL VAL G . n 
Q 1 365 LYS 365 366 366 LYS LYS G . n 
Q 1 366 ILE 366 367 367 ILE ILE G . n 
Q 1 367 GLY 367 368 368 GLY GLY G . n 
Q 1 368 ARG 368 369 369 ARG ARG G . n 
Q 1 369 HIS 369 370 370 HIS HIS G . n 
Q 1 370 ALA 370 371 371 ALA ALA G . n 
Q 1 371 GLN 371 372 372 GLN GLN G . n 
Q 1 372 LEU 372 373 373 LEU LEU G . n 
Q 1 373 SER 373 374 374 SER SER G . n 
Q 1 374 ASN 374 375 375 ASN ASN G . n 
Q 1 375 VAL 375 376 376 VAL VAL G . n 
Q 1 376 VAL 376 377 377 VAL VAL G . n 
Q 1 377 ILE 377 378 378 ILE ILE G . n 
Q 1 378 ASP 378 379 379 ASP ASP G . n 
Q 1 379 HIS 379 380 380 HIS HIS G . n 
Q 1 380 GLY 380 381 381 GLY GLY G . n 
Q 1 381 VAL 381 382 382 VAL VAL G . n 
Q 1 382 VAL 382 383 383 VAL VAL G . n 
Q 1 383 ILE 383 384 384 ILE ILE G . n 
Q 1 384 PRO 384 385 385 PRO PRO G . n 
Q 1 385 GLU 385 386 386 GLU GLU G . n 
Q 1 386 GLY 386 387 387 GLY GLY G . n 
Q 1 387 LEU 387 388 388 LEU LEU G . n 
Q 1 388 ILE 388 389 389 ILE ILE G . n 
Q 1 389 VAL 389 390 390 VAL VAL G . n 
Q 1 390 GLY 390 391 391 GLY GLY G . n 
Q 1 391 GLU 391 392 392 GLU GLU G . n 
Q 1 392 ASP 392 393 393 ASP ASP G . n 
Q 1 393 PRO 393 394 394 PRO PRO G . n 
Q 1 394 GLU 394 395 395 GLU GLU G . n 
Q 1 395 LEU 395 396 396 LEU LEU G . n 
Q 1 396 ASP 396 397 397 ASP ASP G . n 
Q 1 397 ALA 397 398 398 ALA ALA G . n 
Q 1 398 LYS 398 399 399 LYS LYS G . n 
Q 1 399 ARG 399 400 400 ARG ARG G . n 
Q 1 400 PHE 400 401 401 PHE PHE G . n 
Q 1 401 ARG 401 402 402 ARG ARG G . n 
Q 1 402 ARG 402 403 403 ARG ARG G . n 
Q 1 403 THR 403 404 404 THR THR G . n 
Q 1 404 GLU 404 405 405 GLU GLU G . n 
Q 1 405 SER 405 406 406 SER SER G . n 
Q 1 406 GLY 406 407 407 GLY GLY G . n 
Q 1 407 ILE 407 408 408 ILE ILE G . n 
Q 1 408 CYS 408 409 409 CYS CYS G . n 
Q 1 409 LEU 409 410 410 LEU LEU G . n 
Q 1 410 ILE 410 411 411 ILE ILE G . n 
Q 1 411 THR 411 412 412 THR THR G . n 
Q 1 412 GLN 412 413 413 GLN GLN G . n 
Q 1 413 SER 413 414 414 SER SER G . n 
Q 1 414 MET 414 415 415 MET MET G . n 
Q 1 415 ILE 415 416 416 ILE ILE G . n 
Q 1 416 ASP 416 417 417 ASP ASP G . n 
Q 1 417 LYS 417 418 418 LYS LYS G . n 
Q 1 418 LEU 418 419 419 LEU LEU G . n 
Q 1 419 ASP 419 420 420 ASP ASP G . n 
Q 1 420 LEU 420 421 421 LEU LEU G . n 
R 1 1   MET 1   2   ?   ?   ?   M . n 
R 1 2   SER 2   3   ?   ?   ?   M . n 
R 1 3   GLU 3   4   ?   ?   ?   M . n 
R 1 4   LYS 4   5   ?   ?   ?   M . n 
R 1 5   ARG 5   6   6   ARG ARG M . n 
R 1 6   VAL 6   7   7   VAL VAL M . n 
R 1 7   GLN 7   8   8   GLN GLN M . n 
R 1 8   PRO 8   9   9   PRO PRO M . n 
R 1 9   LEU 9   10  10  LEU LEU M . n 
R 1 10  ALA 10  11  11  ALA ALA M . n 
R 1 11  ARG 11  12  12  ARG ARG M . n 
R 1 12  ASP 12  13  13  ASP ASP M . n 
R 1 13  ALA 13  14  14  ALA ALA M . n 
R 1 14  MET 14  15  15  MET MET M . n 
R 1 15  ALA 15  16  16  ALA ALA M . n 
R 1 16  TYR 16  17  17  TYR TYR M . n 
R 1 17  VAL 17  18  18  VAL VAL M . n 
R 1 18  LEU 18  19  19  LEU LEU M . n 
R 1 19  ALA 19  20  20  ALA ALA M . n 
R 1 20  GLY 20  21  21  GLY GLY M . n 
R 1 21  GLY 21  22  22  GLY GLY M . n 
R 1 22  ARG 22  23  23  ARG ARG M . n 
R 1 23  GLY 23  24  24  GLY GLY M . n 
R 1 24  SER 24  25  25  SER SER M . n 
R 1 25  ARG 25  26  26  ARG ARG M . n 
R 1 26  LEU 26  27  27  LEU LEU M . n 
R 1 27  LYS 27  28  28  LYS LYS M . n 
R 1 28  GLU 28  29  29  GLU GLU M . n 
R 1 29  LEU 29  30  30  LEU LEU M . n 
R 1 30  THR 30  31  31  THR THR M . n 
R 1 31  ASP 31  32  32  ASP ASP M . n 
R 1 32  ARG 32  33  33  ARG ARG M . n 
R 1 33  ARG 33  34  34  ARG ARG M . n 
R 1 34  ALA 34  35  35  ALA ALA M . n 
R 1 35  LYS 35  36  36  LYS LYS M . n 
R 1 36  PRO 36  37  37  PRO PRO M . n 
R 1 37  ALA 37  38  38  ALA ALA M . n 
R 1 38  VAL 38  39  39  VAL VAL M . n 
R 1 39  TYR 39  40  40  TYR TYR M . n 
R 1 40  PHE 40  41  41  PHE PHE M . n 
R 1 41  GLY 41  42  42  GLY GLY M . n 
R 1 42  GLY 42  43  43  GLY GLY M . n 
R 1 43  LYS 43  44  44  LYS LYS M . n 
R 1 44  ALA 44  45  45  ALA ALA M . n 
R 1 45  ARG 45  46  46  ARG ARG M . n 
R 1 46  ILE 46  47  47  ILE ILE M . n 
R 1 47  ILE 47  48  48  ILE ILE M . n 
R 1 48  ASP 48  49  49  ASP ASP M . n 
R 1 49  PHE 49  50  50  PHE PHE M . n 
R 1 50  ALA 50  51  51  ALA ALA M . n 
R 1 51  LEU 51  52  52  LEU LEU M . n 
R 1 52  SER 52  53  53  SER SER M . n 
R 1 53  ASN 53  54  54  ASN ASN M . n 
R 1 54  ALA 54  55  55  ALA ALA M . n 
R 1 55  LEU 55  56  56  LEU LEU M . n 
R 1 56  ASN 56  57  57  ASN ASN M . n 
R 1 57  SER 57  58  58  SER SER M . n 
R 1 58  GLY 58  59  59  GLY GLY M . n 
R 1 59  ILE 59  60  60  ILE ILE M . n 
R 1 60  ARG 60  61  61  ARG ARG M . n 
R 1 61  ARG 61  62  62  ARG ARG M . n 
R 1 62  ILE 62  63  63  ILE ILE M . n 
R 1 63  GLY 63  64  64  GLY GLY M . n 
R 1 64  VAL 64  65  65  VAL VAL M . n 
R 1 65  ALA 65  66  66  ALA ALA M . n 
R 1 66  THR 66  67  67  THR THR M . n 
R 1 67  GLN 67  68  68  GLN GLN M . n 
R 1 68  TYR 68  69  69  TYR TYR M . n 
R 1 69  LYS 69  70  70  LYS LYS M . n 
R 1 70  ALA 70  71  71  ALA ALA M . n 
R 1 71  HIS 71  72  72  HIS HIS M . n 
R 1 72  SER 72  73  73  SER SER M . n 
R 1 73  LEU 73  74  74  LEU LEU M . n 
R 1 74  ILE 74  75  75  ILE ILE M . n 
R 1 75  ARG 75  76  76  ARG ARG M . n 
R 1 76  HIS 76  77  77  HIS HIS M . n 
R 1 77  LEU 77  78  78  LEU LEU M . n 
R 1 78  GLN 78  79  79  GLN GLN M . n 
R 1 79  ARG 79  80  80  ARG ARG M . n 
R 1 80  GLY 80  81  81  GLY GLY M . n 
R 1 81  TRP 81  82  82  TRP TRP M . n 
R 1 82  ASP 82  83  83  ASP ASP M . n 
R 1 83  PHE 83  84  84  PHE PHE M . n 
R 1 84  PHE 84  85  85  PHE PHE M . n 
R 1 85  ARG 85  86  86  ARG ARG M . n 
R 1 86  PRO 86  87  87  PRO PRO M . n 
R 1 87  GLU 87  88  88  GLU GLU M . n 
R 1 88  ARG 88  89  89  ARG ARG M . n 
R 1 89  ASN 89  90  90  ASN ASN M . n 
R 1 90  GLU 90  91  91  GLU GLU M . n 
R 1 91  SER 91  92  92  SER SER M . n 
R 1 92  PHE 92  93  93  PHE PHE M . n 
R 1 93  ASP 93  94  94  ASP ASP M . n 
R 1 94  ILE 94  95  95  ILE ILE M . n 
R 1 95  LEU 95  96  96  LEU LEU M . n 
R 1 96  PRO 96  97  97  PRO PRO M . n 
R 1 97  ALA 97  98  98  ALA ALA M . n 
R 1 98  SER 98  99  ?   ?   ?   M . n 
R 1 99  GLN 99  100 ?   ?   ?   M . n 
R 1 100 ARG 100 101 ?   ?   ?   M . n 
R 1 101 VAL 101 102 ?   ?   ?   M . n 
R 1 102 SER 102 103 ?   ?   ?   M . n 
R 1 103 GLU 103 104 ?   ?   ?   M . n 
R 1 104 THR 104 105 105 THR THR M . n 
R 1 105 GLN 105 106 106 GLN GLN M . n 
R 1 106 TRP 106 107 107 TRP TRP M . n 
R 1 107 TYR 107 108 108 TYR TYR M . n 
R 1 108 GLU 108 109 109 GLU GLU M . n 
R 1 109 GLY 109 110 110 GLY GLY M . n 
R 1 110 THR 110 111 111 THR THR M . n 
R 1 111 ALA 111 112 112 ALA ALA M . n 
R 1 112 ASP 112 113 113 ASP ASP M . n 
R 1 113 ALA 113 114 114 ALA ALA M . n 
R 1 114 VAL 114 115 115 VAL VAL M . n 
R 1 115 TYR 115 116 116 TYR TYR M . n 
R 1 116 GLN 116 117 117 GLN GLN M . n 
R 1 117 ASN 117 118 118 ASN ASN M . n 
R 1 118 ILE 118 119 119 ILE ILE M . n 
R 1 119 ASP 119 120 120 ASP ASP M . n 
R 1 120 ILE 120 121 121 ILE ILE M . n 
R 1 121 ILE 121 122 122 ILE ILE M . n 
R 1 122 GLU 122 123 123 GLU GLU M . n 
R 1 123 PRO 123 124 124 PRO PRO M . n 
R 1 124 TYR 124 125 125 TYR TYR M . n 
R 1 125 ALA 125 126 126 ALA ALA M . n 
R 1 126 PRO 126 127 127 PRO PRO M . n 
R 1 127 GLU 127 128 128 GLU GLU M . n 
R 1 128 TYR 128 129 129 TYR TYR M . n 
R 1 129 MET 129 130 130 MET MET M . n 
R 1 130 VAL 130 131 131 VAL VAL M . n 
R 1 131 ILE 131 132 132 ILE ILE M . n 
R 1 132 LEU 132 133 133 LEU LEU M . n 
R 1 133 ALA 133 134 134 ALA ALA M . n 
R 1 134 GLY 134 135 135 GLY GLY M . n 
R 1 135 ASP 135 136 136 ASP ASP M . n 
R 1 136 HIS 136 137 137 HIS HIS M . n 
R 1 137 ILE 137 138 138 ILE ILE M . n 
R 1 138 TYR 138 139 139 TYR TYR M . n 
R 1 139 LYS 139 140 140 LYS LYS M . n 
R 1 140 MET 140 141 141 MET MET M . n 
R 1 141 ASP 141 142 142 ASP ASP M . n 
R 1 142 TYR 142 143 143 TYR TYR M . n 
R 1 143 GLU 143 144 144 GLU GLU M . n 
R 1 144 TYR 144 145 145 TYR TYR M . n 
R 1 145 MET 145 146 146 MET MET M . n 
R 1 146 LEU 146 147 147 LEU LEU M . n 
R 1 147 GLN 147 148 148 GLN GLN M . n 
R 1 148 GLN 148 149 149 GLN GLN M . n 
R 1 149 HIS 149 150 150 HIS HIS M . n 
R 1 150 VAL 150 151 151 VAL VAL M . n 
R 1 151 ASP 151 152 152 ASP ASP M . n 
R 1 152 SER 152 153 153 SER SER M . n 
R 1 153 GLY 153 154 154 GLY GLY M . n 
R 1 154 ALA 154 155 155 ALA ALA M . n 
R 1 155 ASP 155 156 156 ASP ASP M . n 
R 1 156 VAL 156 157 157 VAL VAL M . n 
R 1 157 THR 157 158 158 THR THR M . n 
R 1 158 ILE 158 159 159 ILE ILE M . n 
R 1 159 GLY 159 160 160 GLY GLY M . n 
R 1 160 CYS 160 161 161 CYS CYS M . n 
R 1 161 LEU 161 162 162 LEU LEU M . n 
R 1 162 GLU 162 163 163 GLU GLU M . n 
R 1 163 VAL 163 164 164 VAL VAL M . n 
R 1 164 PRO 164 165 165 PRO PRO M . n 
R 1 165 ARG 165 166 166 ARG ARG M . n 
R 1 166 MET 166 167 167 MET MET M . n 
R 1 167 GLU 167 168 168 GLU GLU M . n 
R 1 168 ALA 168 169 169 ALA ALA M . n 
R 1 169 THR 169 170 170 THR THR M . n 
R 1 170 GLY 170 171 171 GLY GLY M . n 
R 1 171 PHE 171 172 172 PHE PHE M . n 
R 1 172 GLY 172 173 173 GLY GLY M . n 
R 1 173 VAL 173 174 174 VAL VAL M . n 
R 1 174 MET 174 175 175 MET MET M . n 
R 1 175 HIS 175 176 176 HIS HIS M . n 
R 1 176 VAL 176 177 177 VAL VAL M . n 
R 1 177 ASN 177 178 178 ASN ASN M . n 
R 1 178 GLU 178 179 179 GLU GLU M . n 
R 1 179 LYS 179 180 180 LYS LYS M . n 
R 1 180 ASP 180 181 181 ASP ASP M . n 
R 1 181 GLU 181 182 182 GLU GLU M . n 
R 1 182 ILE 182 183 183 ILE ILE M . n 
R 1 183 ILE 183 184 184 ILE ILE M . n 
R 1 184 ASP 184 185 185 ASP ASP M . n 
R 1 185 PHE 185 186 186 PHE PHE M . n 
R 1 186 ILE 186 187 187 ILE ILE M . n 
R 1 187 GLU 187 188 188 GLU GLU M . n 
R 1 188 LYS 188 189 189 LYS LYS M . n 
R 1 189 PRO 189 190 190 PRO PRO M . n 
R 1 190 ALA 190 191 191 ALA ALA M . n 
R 1 191 ASP 191 192 192 ASP ASP M . n 
R 1 192 PRO 192 193 193 PRO PRO M . n 
R 1 193 PRO 193 194 194 PRO PRO M . n 
R 1 194 GLY 194 195 195 GLY GLY M . n 
R 1 195 ILE 195 196 196 ILE ILE M . n 
R 1 196 PRO 196 197 197 PRO PRO M . n 
R 1 197 GLY 197 198 198 GLY GLY M . n 
R 1 198 ASN 198 199 199 ASN ASN M . n 
R 1 199 GLU 199 200 200 GLU GLU M . n 
R 1 200 GLY 200 201 201 GLY GLY M . n 
R 1 201 PHE 201 202 202 PHE PHE M . n 
R 1 202 ALA 202 203 203 ALA ALA M . n 
R 1 203 LEU 203 204 204 LEU LEU M . n 
R 1 204 ALA 204 205 205 ALA ALA M . n 
R 1 205 SER 205 206 206 SER SER M . n 
R 1 206 MET 206 207 207 MET MET M . n 
R 1 207 GLY 207 208 208 GLY GLY M . n 
R 1 208 ILE 208 209 209 ILE ILE M . n 
R 1 209 TYR 209 210 210 TYR TYR M . n 
R 1 210 VAL 210 211 211 VAL VAL M . n 
R 1 211 PHE 211 212 212 PHE PHE M . n 
R 1 212 HIS 212 213 213 HIS HIS M . n 
R 1 213 THR 213 214 214 THR THR M . n 
R 1 214 LYS 214 215 215 LYS LYS M . n 
R 1 215 PHE 215 216 216 PHE PHE M . n 
R 1 216 LEU 216 217 217 LEU LEU M . n 
R 1 217 MET 217 218 218 MET MET M . n 
R 1 218 GLU 218 219 219 GLU GLU M . n 
R 1 219 ALA 219 220 220 ALA ALA M . n 
R 1 220 LEU 220 221 221 LEU LEU M . n 
R 1 221 ARG 221 222 222 ARG ARG M . n 
R 1 222 ARG 222 223 223 ARG ARG M . n 
R 1 223 ASP 223 224 224 ASP ASP M . n 
R 1 224 ALA 224 225 225 ALA ALA M . n 
R 1 225 ALA 225 226 226 ALA ALA M . n 
R 1 226 ASP 226 227 227 ASP ASP M . n 
R 1 227 PRO 227 228 228 PRO PRO M . n 
R 1 228 THR 228 229 229 THR THR M . n 
R 1 229 SER 229 230 230 SER SER M . n 
R 1 230 SER 230 231 231 SER SER M . n 
R 1 231 ARG 231 232 232 ARG ARG M . n 
R 1 232 ASP 232 233 233 ASP ASP M . n 
R 1 233 PHE 233 234 234 PHE PHE M . n 
R 1 234 GLY 234 235 235 GLY GLY M . n 
R 1 235 LYS 235 236 236 LYS LYS M . n 
R 1 236 ASP 236 237 237 ASP ASP M . n 
R 1 237 ILE 237 238 238 ILE ILE M . n 
R 1 238 ILE 238 239 239 ILE ILE M . n 
R 1 239 PRO 239 240 240 PRO PRO M . n 
R 1 240 TYR 240 241 241 TYR TYR M . n 
R 1 241 ILE 241 242 242 ILE ILE M . n 
R 1 242 VAL 242 243 243 VAL VAL M . n 
R 1 243 GLU 243 244 244 GLU GLU M . n 
R 1 244 HIS 244 245 245 HIS HIS M . n 
R 1 245 GLY 245 246 246 GLY GLY M . n 
R 1 246 LYS 246 247 247 LYS LYS M . n 
R 1 247 ALA 247 248 248 ALA ALA M . n 
R 1 248 VAL 248 249 249 VAL VAL M . n 
R 1 249 ALA 249 250 250 ALA ALA M . n 
R 1 250 HIS 250 251 251 HIS HIS M . n 
R 1 251 ARG 251 252 252 ARG ARG M . n 
R 1 252 PHE 252 253 253 PHE PHE M . n 
R 1 253 ALA 253 254 254 ALA ALA M . n 
R 1 254 ASP 254 255 255 ASP ASP M . n 
R 1 255 SER 255 256 256 SER SER M . n 
R 1 256 CYS 256 257 257 CYS CYS M . n 
R 1 257 VAL 257 258 258 VAL VAL M . n 
R 1 258 ARG 258 259 259 ARG ARG M . n 
R 1 259 SER 259 260 260 SER SER M . n 
R 1 260 ASP 260 261 261 ASP ASP M . n 
R 1 261 PHE 261 262 262 PHE PHE M . n 
R 1 262 GLU 262 263 263 GLU GLU M . n 
R 1 263 HIS 263 264 264 HIS HIS M . n 
R 1 264 GLU 264 265 265 GLU GLU M . n 
R 1 265 PRO 265 266 266 PRO PRO M . n 
R 1 266 TYR 266 267 267 TYR TYR M . n 
R 1 267 TRP 267 268 268 TRP TRP M . n 
R 1 268 ARG 268 269 269 ARG ARG M . n 
R 1 269 ASP 269 270 270 ASP ASP M . n 
R 1 270 VAL 270 271 271 VAL VAL M . n 
R 1 271 GLY 271 272 272 GLY GLY M . n 
R 1 272 THR 272 273 273 THR THR M . n 
R 1 273 ILE 273 274 274 ILE ILE M . n 
R 1 274 ASP 274 275 275 ASP ASP M . n 
R 1 275 ALA 275 276 276 ALA ALA M . n 
R 1 276 TYR 276 277 277 TYR TYR M . n 
R 1 277 TRP 277 278 278 TRP TRP M . n 
R 1 278 GLN 278 279 279 GLN GLN M . n 
R 1 279 ALA 279 280 280 ALA ALA M . n 
R 1 280 ASN 280 281 281 ASN ASN M . n 
R 1 281 ILE 281 282 282 ILE ILE M . n 
R 1 282 ASP 282 283 283 ASP ASP M . n 
R 1 283 LEU 283 284 284 LEU LEU M . n 
R 1 284 THR 284 285 285 THR THR M . n 
R 1 285 ASP 285 286 286 ASP ASP M . n 
R 1 286 VAL 286 287 287 VAL VAL M . n 
R 1 287 VAL 287 288 288 VAL VAL M . n 
R 1 288 PRO 288 289 289 PRO PRO M . n 
R 1 289 ASP 289 290 290 ASP ASP M . n 
R 1 290 LEU 290 291 291 LEU LEU M . n 
R 1 291 ASP 291 292 292 ASP ASP M . n 
R 1 292 ILE 292 293 293 ILE ILE M . n 
R 1 293 TYR 293 294 294 TYR TYR M . n 
R 1 294 ASP 294 295 295 ASP ASP M . n 
R 1 295 LYS 295 296 296 LYS LYS M . n 
R 1 296 SER 296 297 297 SER SER M . n 
R 1 297 TRP 297 298 298 TRP TRP M . n 
R 1 298 PRO 298 299 299 PRO PRO M . n 
R 1 299 ILE 299 300 300 ILE ILE M . n 
R 1 300 TRP 300 301 301 TRP TRP M . n 
R 1 301 THR 301 302 302 THR THR M . n 
R 1 302 TYR 302 303 303 TYR TYR M . n 
R 1 303 ALA 303 304 304 ALA ALA M . n 
R 1 304 GLU 304 305 305 GLU GLU M . n 
R 1 305 ILE 305 306 306 ILE ILE M . n 
R 1 306 THR 306 307 307 THR THR M . n 
R 1 307 PRO 307 308 308 PRO PRO M . n 
R 1 308 PRO 308 309 309 PRO PRO M . n 
R 1 309 ALA 309 310 310 ALA ALA M . n 
R 1 310 LYS 310 311 311 LYS LYS M . n 
R 1 311 PHE 311 312 312 PHE PHE M . n 
R 1 312 VAL 312 313 313 VAL VAL M . n 
R 1 313 HIS 313 314 314 HIS HIS M . n 
R 1 314 ASP 314 315 315 ASP ASP M . n 
R 1 315 ASP 315 316 316 ASP ASP M . n 
R 1 316 GLU 316 317 317 GLU GLU M . n 
R 1 317 ASP 317 318 318 ASP ASP M . n 
R 1 318 ARG 318 319 319 ARG ARG M . n 
R 1 319 ARG 319 320 320 ARG ARG M . n 
R 1 320 GLY 320 321 321 GLY GLY M . n 
R 1 321 SER 321 322 322 SER SER M . n 
R 1 322 ALA 322 323 323 ALA ALA M . n 
R 1 323 VAL 323 324 324 VAL VAL M . n 
R 1 324 SER 324 325 325 SER SER M . n 
R 1 325 SER 325 326 326 SER SER M . n 
R 1 326 VAL 326 327 327 VAL VAL M . n 
R 1 327 VAL 327 328 328 VAL VAL M . n 
R 1 328 SER 328 329 329 SER SER M . n 
R 1 329 GLY 329 330 330 GLY GLY M . n 
R 1 330 ASP 330 331 331 ASP ASP M . n 
R 1 331 CYS 331 332 332 CYS CYS M . n 
R 1 332 ILE 332 333 333 ILE ILE M . n 
R 1 333 ILE 333 334 334 ILE ILE M . n 
R 1 334 SER 334 335 335 SER SER M . n 
R 1 335 GLY 335 336 336 GLY GLY M . n 
R 1 336 ALA 336 337 337 ALA ALA M . n 
R 1 337 ALA 337 338 338 ALA ALA M . n 
R 1 338 LEU 338 339 339 LEU LEU M . n 
R 1 339 ASN 339 340 340 ASN ASN M . n 
R 1 340 ARG 340 341 341 ARG ARG M . n 
R 1 341 SER 341 342 342 SER SER M . n 
R 1 342 LEU 342 343 343 LEU LEU M . n 
R 1 343 LEU 343 344 344 LEU LEU M . n 
R 1 344 PHE 344 345 345 PHE PHE M . n 
R 1 345 THR 345 346 346 THR THR M . n 
R 1 346 GLY 346 347 347 GLY GLY M . n 
R 1 347 VAL 347 348 348 VAL VAL M . n 
R 1 348 ARG 348 349 349 ARG ARG M . n 
R 1 349 ALA 349 350 350 ALA ALA M . n 
R 1 350 ASN 350 351 351 ASN ASN M . n 
R 1 351 SER 351 352 352 SER SER M . n 
R 1 352 TYR 352 353 353 TYR TYR M . n 
R 1 353 SER 353 354 354 SER SER M . n 
R 1 354 ARG 354 355 355 ARG ARG M . n 
R 1 355 LEU 355 356 356 LEU LEU M . n 
R 1 356 GLU 356 357 357 GLU GLU M . n 
R 1 357 ASN 357 358 358 ASN ASN M . n 
R 1 358 ALA 358 359 359 ALA ALA M . n 
R 1 359 VAL 359 360 360 VAL VAL M . n 
R 1 360 VAL 360 361 361 VAL VAL M . n 
R 1 361 LEU 361 362 362 LEU LEU M . n 
R 1 362 PRO 362 363 363 PRO PRO M . n 
R 1 363 SER 363 364 364 SER SER M . n 
R 1 364 VAL 364 365 365 VAL VAL M . n 
R 1 365 LYS 365 366 366 LYS LYS M . n 
R 1 366 ILE 366 367 367 ILE ILE M . n 
R 1 367 GLY 367 368 368 GLY GLY M . n 
R 1 368 ARG 368 369 369 ARG ARG M . n 
R 1 369 HIS 369 370 370 HIS HIS M . n 
R 1 370 ALA 370 371 371 ALA ALA M . n 
R 1 371 GLN 371 372 372 GLN GLN M . n 
R 1 372 LEU 372 373 373 LEU LEU M . n 
R 1 373 SER 373 374 374 SER SER M . n 
R 1 374 ASN 374 375 375 ASN ASN M . n 
R 1 375 VAL 375 376 376 VAL VAL M . n 
R 1 376 VAL 376 377 377 VAL VAL M . n 
R 1 377 ILE 377 378 378 ILE ILE M . n 
R 1 378 ASP 378 379 379 ASP ASP M . n 
R 1 379 HIS 379 380 380 HIS HIS M . n 
R 1 380 GLY 380 381 381 GLY GLY M . n 
R 1 381 VAL 381 382 382 VAL VAL M . n 
R 1 382 VAL 382 383 383 VAL VAL M . n 
R 1 383 ILE 383 384 384 ILE ILE M . n 
R 1 384 PRO 384 385 385 PRO PRO M . n 
R 1 385 GLU 385 386 386 GLU GLU M . n 
R 1 386 GLY 386 387 387 GLY GLY M . n 
R 1 387 LEU 387 388 388 LEU LEU M . n 
R 1 388 ILE 388 389 389 ILE ILE M . n 
R 1 389 VAL 389 390 390 VAL VAL M . n 
R 1 390 GLY 390 391 391 GLY GLY M . n 
R 1 391 GLU 391 392 392 GLU GLU M . n 
R 1 392 ASP 392 393 393 ASP ASP M . n 
R 1 393 PRO 393 394 394 PRO PRO M . n 
R 1 394 GLU 394 395 395 GLU GLU M . n 
R 1 395 LEU 395 396 396 LEU LEU M . n 
R 1 396 ASP 396 397 397 ASP ASP M . n 
R 1 397 ALA 397 398 398 ALA ALA M . n 
R 1 398 LYS 398 399 399 LYS LYS M . n 
R 1 399 ARG 399 400 400 ARG ARG M . n 
R 1 400 PHE 400 401 401 PHE PHE M . n 
R 1 401 ARG 401 402 402 ARG ARG M . n 
R 1 402 ARG 402 403 403 ARG ARG M . n 
R 1 403 THR 403 404 404 THR THR M . n 
R 1 404 GLU 404 405 405 GLU GLU M . n 
R 1 405 SER 405 406 406 SER SER M . n 
R 1 406 GLY 406 407 407 GLY GLY M . n 
R 1 407 ILE 407 408 408 ILE ILE M . n 
R 1 408 CYS 408 409 409 CYS CYS M . n 
R 1 409 LEU 409 410 410 LEU LEU M . n 
R 1 410 ILE 410 411 411 ILE ILE M . n 
R 1 411 THR 411 412 412 THR THR M . n 
R 1 412 GLN 412 413 413 GLN GLN M . n 
R 1 413 SER 413 414 414 SER SER M . n 
R 1 414 MET 414 415 415 MET MET M . n 
R 1 415 ILE 415 416 416 ILE ILE M . n 
R 1 416 ASP 416 417 417 ASP ASP M . n 
R 1 417 LYS 417 418 418 LYS LYS M . n 
R 1 418 LEU 418 419 419 LEU LEU M . n 
R 1 419 ASP 419 420 420 ASP ASP M . n 
R 1 420 LEU 420 421 421 LEU LEU M . n 
S 1 1   MET 1   2   ?   ?   ?   T . n 
S 1 2   SER 2   3   ?   ?   ?   T . n 
S 1 3   GLU 3   4   ?   ?   ?   T . n 
S 1 4   LYS 4   5   ?   ?   ?   T . n 
S 1 5   ARG 5   6   ?   ?   ?   T . n 
S 1 6   VAL 6   7   7   VAL VAL T . n 
S 1 7   GLN 7   8   8   GLN GLN T . n 
S 1 8   PRO 8   9   9   PRO PRO T . n 
S 1 9   LEU 9   10  10  LEU LEU T . n 
S 1 10  ALA 10  11  11  ALA ALA T . n 
S 1 11  ARG 11  12  12  ARG ARG T . n 
S 1 12  ASP 12  13  13  ASP ASP T . n 
S 1 13  ALA 13  14  14  ALA ALA T . n 
S 1 14  MET 14  15  15  MET MET T . n 
S 1 15  ALA 15  16  16  ALA ALA T . n 
S 1 16  TYR 16  17  17  TYR TYR T . n 
S 1 17  VAL 17  18  18  VAL VAL T . n 
S 1 18  LEU 18  19  19  LEU LEU T . n 
S 1 19  ALA 19  20  20  ALA ALA T . n 
S 1 20  GLY 20  21  21  GLY GLY T . n 
S 1 21  GLY 21  22  22  GLY GLY T . n 
S 1 22  ARG 22  23  23  ARG ARG T . n 
S 1 23  GLY 23  24  24  GLY GLY T . n 
S 1 24  SER 24  25  25  SER SER T . n 
S 1 25  ARG 25  26  26  ARG ARG T . n 
S 1 26  LEU 26  27  27  LEU LEU T . n 
S 1 27  LYS 27  28  28  LYS LYS T . n 
S 1 28  GLU 28  29  29  GLU GLU T . n 
S 1 29  LEU 29  30  30  LEU LEU T . n 
S 1 30  THR 30  31  31  THR THR T . n 
S 1 31  ASP 31  32  32  ASP ASP T . n 
S 1 32  ARG 32  33  33  ARG ARG T . n 
S 1 33  ARG 33  34  34  ARG ARG T . n 
S 1 34  ALA 34  35  35  ALA ALA T . n 
S 1 35  LYS 35  36  36  LYS LYS T . n 
S 1 36  PRO 36  37  37  PRO PRO T . n 
S 1 37  ALA 37  38  38  ALA ALA T . n 
S 1 38  VAL 38  39  39  VAL VAL T . n 
S 1 39  TYR 39  40  40  TYR TYR T . n 
S 1 40  PHE 40  41  41  PHE PHE T . n 
S 1 41  GLY 41  42  42  GLY GLY T . n 
S 1 42  GLY 42  43  43  GLY GLY T . n 
S 1 43  LYS 43  44  44  LYS LYS T . n 
S 1 44  ALA 44  45  45  ALA ALA T . n 
S 1 45  ARG 45  46  46  ARG ARG T . n 
S 1 46  ILE 46  47  47  ILE ILE T . n 
S 1 47  ILE 47  48  48  ILE ILE T . n 
S 1 48  ASP 48  49  49  ASP ASP T . n 
S 1 49  PHE 49  50  50  PHE PHE T . n 
S 1 50  ALA 50  51  51  ALA ALA T . n 
S 1 51  LEU 51  52  52  LEU LEU T . n 
S 1 52  SER 52  53  53  SER SER T . n 
S 1 53  ASN 53  54  54  ASN ASN T . n 
S 1 54  ALA 54  55  55  ALA ALA T . n 
S 1 55  LEU 55  56  56  LEU LEU T . n 
S 1 56  ASN 56  57  57  ASN ASN T . n 
S 1 57  SER 57  58  58  SER SER T . n 
S 1 58  GLY 58  59  59  GLY GLY T . n 
S 1 59  ILE 59  60  60  ILE ILE T . n 
S 1 60  ARG 60  61  61  ARG ARG T . n 
S 1 61  ARG 61  62  62  ARG ARG T . n 
S 1 62  ILE 62  63  63  ILE ILE T . n 
S 1 63  GLY 63  64  64  GLY GLY T . n 
S 1 64  VAL 64  65  65  VAL VAL T . n 
S 1 65  ALA 65  66  66  ALA ALA T . n 
S 1 66  THR 66  67  67  THR THR T . n 
S 1 67  GLN 67  68  68  GLN GLN T . n 
S 1 68  TYR 68  69  69  TYR TYR T . n 
S 1 69  LYS 69  70  70  LYS LYS T . n 
S 1 70  ALA 70  71  71  ALA ALA T . n 
S 1 71  HIS 71  72  72  HIS HIS T . n 
S 1 72  SER 72  73  73  SER SER T . n 
S 1 73  LEU 73  74  74  LEU LEU T . n 
S 1 74  ILE 74  75  75  ILE ILE T . n 
S 1 75  ARG 75  76  76  ARG ARG T . n 
S 1 76  HIS 76  77  77  HIS HIS T . n 
S 1 77  LEU 77  78  78  LEU LEU T . n 
S 1 78  GLN 78  79  79  GLN GLN T . n 
S 1 79  ARG 79  80  80  ARG ARG T . n 
S 1 80  GLY 80  81  81  GLY GLY T . n 
S 1 81  TRP 81  82  82  TRP TRP T . n 
S 1 82  ASP 82  83  83  ASP ASP T . n 
S 1 83  PHE 83  84  84  PHE PHE T . n 
S 1 84  PHE 84  85  85  PHE PHE T . n 
S 1 85  ARG 85  86  86  ARG ARG T . n 
S 1 86  PRO 86  87  87  PRO PRO T . n 
S 1 87  GLU 87  88  88  GLU GLU T . n 
S 1 88  ARG 88  89  89  ARG ARG T . n 
S 1 89  ASN 89  90  90  ASN ASN T . n 
S 1 90  GLU 90  91  91  GLU GLU T . n 
S 1 91  SER 91  92  92  SER SER T . n 
S 1 92  PHE 92  93  93  PHE PHE T . n 
S 1 93  ASP 93  94  94  ASP ASP T . n 
S 1 94  ILE 94  95  95  ILE ILE T . n 
S 1 95  LEU 95  96  96  LEU LEU T . n 
S 1 96  PRO 96  97  97  PRO PRO T . n 
S 1 97  ALA 97  98  98  ALA ALA T . n 
S 1 98  SER 98  99  99  SER SER T . n 
S 1 99  GLN 99  100 100 GLN GLN T . n 
S 1 100 ARG 100 101 101 ARG ARG T . n 
S 1 101 VAL 101 102 102 VAL VAL T . n 
S 1 102 SER 102 103 103 SER SER T . n 
S 1 103 GLU 103 104 104 GLU GLU T . n 
S 1 104 THR 104 105 105 THR THR T . n 
S 1 105 GLN 105 106 106 GLN GLN T . n 
S 1 106 TRP 106 107 107 TRP TRP T . n 
S 1 107 TYR 107 108 108 TYR TYR T . n 
S 1 108 GLU 108 109 109 GLU GLU T . n 
S 1 109 GLY 109 110 110 GLY GLY T . n 
S 1 110 THR 110 111 111 THR THR T . n 
S 1 111 ALA 111 112 112 ALA ALA T . n 
S 1 112 ASP 112 113 113 ASP ASP T . n 
S 1 113 ALA 113 114 114 ALA ALA T . n 
S 1 114 VAL 114 115 115 VAL VAL T . n 
S 1 115 TYR 115 116 116 TYR TYR T . n 
S 1 116 GLN 116 117 117 GLN GLN T . n 
S 1 117 ASN 117 118 118 ASN ASN T . n 
S 1 118 ILE 118 119 119 ILE ILE T . n 
S 1 119 ASP 119 120 120 ASP ASP T . n 
S 1 120 ILE 120 121 121 ILE ILE T . n 
S 1 121 ILE 121 122 122 ILE ILE T . n 
S 1 122 GLU 122 123 123 GLU GLU T . n 
S 1 123 PRO 123 124 124 PRO PRO T . n 
S 1 124 TYR 124 125 125 TYR TYR T . n 
S 1 125 ALA 125 126 126 ALA ALA T . n 
S 1 126 PRO 126 127 127 PRO PRO T . n 
S 1 127 GLU 127 128 128 GLU GLU T . n 
S 1 128 TYR 128 129 129 TYR TYR T . n 
S 1 129 MET 129 130 130 MET MET T . n 
S 1 130 VAL 130 131 131 VAL VAL T . n 
S 1 131 ILE 131 132 132 ILE ILE T . n 
S 1 132 LEU 132 133 133 LEU LEU T . n 
S 1 133 ALA 133 134 134 ALA ALA T . n 
S 1 134 GLY 134 135 135 GLY GLY T . n 
S 1 135 ASP 135 136 136 ASP ASP T . n 
S 1 136 HIS 136 137 137 HIS HIS T . n 
S 1 137 ILE 137 138 138 ILE ILE T . n 
S 1 138 TYR 138 139 139 TYR TYR T . n 
S 1 139 LYS 139 140 140 LYS LYS T . n 
S 1 140 MET 140 141 141 MET MET T . n 
S 1 141 ASP 141 142 142 ASP ASP T . n 
S 1 142 TYR 142 143 143 TYR TYR T . n 
S 1 143 GLU 143 144 144 GLU GLU T . n 
S 1 144 TYR 144 145 145 TYR TYR T . n 
S 1 145 MET 145 146 146 MET MET T . n 
S 1 146 LEU 146 147 147 LEU LEU T . n 
S 1 147 GLN 147 148 148 GLN GLN T . n 
S 1 148 GLN 148 149 149 GLN GLN T . n 
S 1 149 HIS 149 150 150 HIS HIS T . n 
S 1 150 VAL 150 151 151 VAL VAL T . n 
S 1 151 ASP 151 152 152 ASP ASP T . n 
S 1 152 SER 152 153 153 SER SER T . n 
S 1 153 GLY 153 154 154 GLY GLY T . n 
S 1 154 ALA 154 155 155 ALA ALA T . n 
S 1 155 ASP 155 156 156 ASP ASP T . n 
S 1 156 VAL 156 157 157 VAL VAL T . n 
S 1 157 THR 157 158 158 THR THR T . n 
S 1 158 ILE 158 159 159 ILE ILE T . n 
S 1 159 GLY 159 160 160 GLY GLY T . n 
S 1 160 CYS 160 161 161 CYS CYS T . n 
S 1 161 LEU 161 162 162 LEU LEU T . n 
S 1 162 GLU 162 163 163 GLU GLU T . n 
S 1 163 VAL 163 164 164 VAL VAL T . n 
S 1 164 PRO 164 165 165 PRO PRO T . n 
S 1 165 ARG 165 166 166 ARG ARG T . n 
S 1 166 MET 166 167 167 MET MET T . n 
S 1 167 GLU 167 168 168 GLU GLU T . n 
S 1 168 ALA 168 169 169 ALA ALA T . n 
S 1 169 THR 169 170 170 THR THR T . n 
S 1 170 GLY 170 171 171 GLY GLY T . n 
S 1 171 PHE 171 172 172 PHE PHE T . n 
S 1 172 GLY 172 173 173 GLY GLY T . n 
S 1 173 VAL 173 174 174 VAL VAL T . n 
S 1 174 MET 174 175 175 MET MET T . n 
S 1 175 HIS 175 176 176 HIS HIS T . n 
S 1 176 VAL 176 177 177 VAL VAL T . n 
S 1 177 ASN 177 178 178 ASN ASN T . n 
S 1 178 GLU 178 179 179 GLU GLU T . n 
S 1 179 LYS 179 180 180 LYS LYS T . n 
S 1 180 ASP 180 181 181 ASP ASP T . n 
S 1 181 GLU 181 182 182 GLU GLU T . n 
S 1 182 ILE 182 183 183 ILE ILE T . n 
S 1 183 ILE 183 184 184 ILE ILE T . n 
S 1 184 ASP 184 185 185 ASP ASP T . n 
S 1 185 PHE 185 186 186 PHE PHE T . n 
S 1 186 ILE 186 187 187 ILE ILE T . n 
S 1 187 GLU 187 188 188 GLU GLU T . n 
S 1 188 LYS 188 189 189 LYS LYS T . n 
S 1 189 PRO 189 190 190 PRO PRO T . n 
S 1 190 ALA 190 191 191 ALA ALA T . n 
S 1 191 ASP 191 192 192 ASP ASP T . n 
S 1 192 PRO 192 193 193 PRO PRO T . n 
S 1 193 PRO 193 194 194 PRO PRO T . n 
S 1 194 GLY 194 195 195 GLY GLY T . n 
S 1 195 ILE 195 196 196 ILE ILE T . n 
S 1 196 PRO 196 197 197 PRO PRO T . n 
S 1 197 GLY 197 198 198 GLY GLY T . n 
S 1 198 ASN 198 199 199 ASN ASN T . n 
S 1 199 GLU 199 200 200 GLU GLU T . n 
S 1 200 GLY 200 201 201 GLY GLY T . n 
S 1 201 PHE 201 202 202 PHE PHE T . n 
S 1 202 ALA 202 203 203 ALA ALA T . n 
S 1 203 LEU 203 204 204 LEU LEU T . n 
S 1 204 ALA 204 205 205 ALA ALA T . n 
S 1 205 SER 205 206 206 SER SER T . n 
S 1 206 MET 206 207 207 MET MET T . n 
S 1 207 GLY 207 208 208 GLY GLY T . n 
S 1 208 ILE 208 209 209 ILE ILE T . n 
S 1 209 TYR 209 210 210 TYR TYR T . n 
S 1 210 VAL 210 211 211 VAL VAL T . n 
S 1 211 PHE 211 212 212 PHE PHE T . n 
S 1 212 HIS 212 213 213 HIS HIS T . n 
S 1 213 THR 213 214 214 THR THR T . n 
S 1 214 LYS 214 215 215 LYS LYS T . n 
S 1 215 PHE 215 216 216 PHE PHE T . n 
S 1 216 LEU 216 217 217 LEU LEU T . n 
S 1 217 MET 217 218 218 MET MET T . n 
S 1 218 GLU 218 219 219 GLU GLU T . n 
S 1 219 ALA 219 220 220 ALA ALA T . n 
S 1 220 LEU 220 221 221 LEU LEU T . n 
S 1 221 ARG 221 222 222 ARG ARG T . n 
S 1 222 ARG 222 223 223 ARG ARG T . n 
S 1 223 ASP 223 224 224 ASP ASP T . n 
S 1 224 ALA 224 225 225 ALA ALA T . n 
S 1 225 ALA 225 226 226 ALA ALA T . n 
S 1 226 ASP 226 227 227 ASP ASP T . n 
S 1 227 PRO 227 228 228 PRO PRO T . n 
S 1 228 THR 228 229 229 THR THR T . n 
S 1 229 SER 229 230 230 SER SER T . n 
S 1 230 SER 230 231 231 SER SER T . n 
S 1 231 ARG 231 232 232 ARG ARG T . n 
S 1 232 ASP 232 233 233 ASP ASP T . n 
S 1 233 PHE 233 234 234 PHE PHE T . n 
S 1 234 GLY 234 235 235 GLY GLY T . n 
S 1 235 LYS 235 236 236 LYS LYS T . n 
S 1 236 ASP 236 237 237 ASP ASP T . n 
S 1 237 ILE 237 238 238 ILE ILE T . n 
S 1 238 ILE 238 239 239 ILE ILE T . n 
S 1 239 PRO 239 240 240 PRO PRO T . n 
S 1 240 TYR 240 241 241 TYR TYR T . n 
S 1 241 ILE 241 242 242 ILE ILE T . n 
S 1 242 VAL 242 243 243 VAL VAL T . n 
S 1 243 GLU 243 244 244 GLU GLU T . n 
S 1 244 HIS 244 245 245 HIS HIS T . n 
S 1 245 GLY 245 246 246 GLY GLY T . n 
S 1 246 LYS 246 247 247 LYS LYS T . n 
S 1 247 ALA 247 248 248 ALA ALA T . n 
S 1 248 VAL 248 249 249 VAL VAL T . n 
S 1 249 ALA 249 250 250 ALA ALA T . n 
S 1 250 HIS 250 251 251 HIS HIS T . n 
S 1 251 ARG 251 252 252 ARG ARG T . n 
S 1 252 PHE 252 253 253 PHE PHE T . n 
S 1 253 ALA 253 254 254 ALA ALA T . n 
S 1 254 ASP 254 255 255 ASP ASP T . n 
S 1 255 SER 255 256 256 SER SER T . n 
S 1 256 CYS 256 257 257 CYS CYS T . n 
S 1 257 VAL 257 258 258 VAL VAL T . n 
S 1 258 ARG 258 259 259 ARG ARG T . n 
S 1 259 SER 259 260 260 SER SER T . n 
S 1 260 ASP 260 261 261 ASP ASP T . n 
S 1 261 PHE 261 262 262 PHE PHE T . n 
S 1 262 GLU 262 263 263 GLU GLU T . n 
S 1 263 HIS 263 264 264 HIS HIS T . n 
S 1 264 GLU 264 265 265 GLU GLU T . n 
S 1 265 PRO 265 266 266 PRO PRO T . n 
S 1 266 TYR 266 267 267 TYR TYR T . n 
S 1 267 TRP 267 268 268 TRP TRP T . n 
S 1 268 ARG 268 269 269 ARG ARG T . n 
S 1 269 ASP 269 270 270 ASP ASP T . n 
S 1 270 VAL 270 271 271 VAL VAL T . n 
S 1 271 GLY 271 272 272 GLY GLY T . n 
S 1 272 THR 272 273 273 THR THR T . n 
S 1 273 ILE 273 274 274 ILE ILE T . n 
S 1 274 ASP 274 275 275 ASP ASP T . n 
S 1 275 ALA 275 276 276 ALA ALA T . n 
S 1 276 TYR 276 277 277 TYR TYR T . n 
S 1 277 TRP 277 278 278 TRP TRP T . n 
S 1 278 GLN 278 279 279 GLN GLN T . n 
S 1 279 ALA 279 280 280 ALA ALA T . n 
S 1 280 ASN 280 281 281 ASN ASN T . n 
S 1 281 ILE 281 282 282 ILE ILE T . n 
S 1 282 ASP 282 283 283 ASP ASP T . n 
S 1 283 LEU 283 284 284 LEU LEU T . n 
S 1 284 THR 284 285 285 THR THR T . n 
S 1 285 ASP 285 286 286 ASP ASP T . n 
S 1 286 VAL 286 287 287 VAL VAL T . n 
S 1 287 VAL 287 288 288 VAL VAL T . n 
S 1 288 PRO 288 289 289 PRO PRO T . n 
S 1 289 ASP 289 290 290 ASP ASP T . n 
S 1 290 LEU 290 291 291 LEU LEU T . n 
S 1 291 ASP 291 292 292 ASP ASP T . n 
S 1 292 ILE 292 293 293 ILE ILE T . n 
S 1 293 TYR 293 294 294 TYR TYR T . n 
S 1 294 ASP 294 295 295 ASP ASP T . n 
S 1 295 LYS 295 296 296 LYS LYS T . n 
S 1 296 SER 296 297 297 SER SER T . n 
S 1 297 TRP 297 298 298 TRP TRP T . n 
S 1 298 PRO 298 299 299 PRO PRO T . n 
S 1 299 ILE 299 300 300 ILE ILE T . n 
S 1 300 TRP 300 301 301 TRP TRP T . n 
S 1 301 THR 301 302 302 THR THR T . n 
S 1 302 TYR 302 303 303 TYR TYR T . n 
S 1 303 ALA 303 304 304 ALA ALA T . n 
S 1 304 GLU 304 305 305 GLU GLU T . n 
S 1 305 ILE 305 306 306 ILE ILE T . n 
S 1 306 THR 306 307 307 THR THR T . n 
S 1 307 PRO 307 308 308 PRO PRO T . n 
S 1 308 PRO 308 309 309 PRO PRO T . n 
S 1 309 ALA 309 310 310 ALA ALA T . n 
S 1 310 LYS 310 311 311 LYS LYS T . n 
S 1 311 PHE 311 312 312 PHE PHE T . n 
S 1 312 VAL 312 313 313 VAL VAL T . n 
S 1 313 HIS 313 314 314 HIS HIS T . n 
S 1 314 ASP 314 315 315 ASP ASP T . n 
S 1 315 ASP 315 316 316 ASP ASP T . n 
S 1 316 GLU 316 317 317 GLU GLU T . n 
S 1 317 ASP 317 318 318 ASP ASP T . n 
S 1 318 ARG 318 319 319 ARG ARG T . n 
S 1 319 ARG 319 320 320 ARG ARG T . n 
S 1 320 GLY 320 321 321 GLY GLY T . n 
S 1 321 SER 321 322 322 SER SER T . n 
S 1 322 ALA 322 323 323 ALA ALA T . n 
S 1 323 VAL 323 324 324 VAL VAL T . n 
S 1 324 SER 324 325 325 SER SER T . n 
S 1 325 SER 325 326 326 SER SER T . n 
S 1 326 VAL 326 327 327 VAL VAL T . n 
S 1 327 VAL 327 328 328 VAL VAL T . n 
S 1 328 SER 328 329 329 SER SER T . n 
S 1 329 GLY 329 330 330 GLY GLY T . n 
S 1 330 ASP 330 331 331 ASP ASP T . n 
S 1 331 CYS 331 332 332 CYS CYS T . n 
S 1 332 ILE 332 333 333 ILE ILE T . n 
S 1 333 ILE 333 334 334 ILE ILE T . n 
S 1 334 SER 334 335 335 SER SER T . n 
S 1 335 GLY 335 336 336 GLY GLY T . n 
S 1 336 ALA 336 337 337 ALA ALA T . n 
S 1 337 ALA 337 338 338 ALA ALA T . n 
S 1 338 LEU 338 339 339 LEU LEU T . n 
S 1 339 ASN 339 340 340 ASN ASN T . n 
S 1 340 ARG 340 341 341 ARG ARG T . n 
S 1 341 SER 341 342 342 SER SER T . n 
S 1 342 LEU 342 343 343 LEU LEU T . n 
S 1 343 LEU 343 344 344 LEU LEU T . n 
S 1 344 PHE 344 345 345 PHE PHE T . n 
S 1 345 THR 345 346 346 THR THR T . n 
S 1 346 GLY 346 347 347 GLY GLY T . n 
S 1 347 VAL 347 348 348 VAL VAL T . n 
S 1 348 ARG 348 349 349 ARG ARG T . n 
S 1 349 ALA 349 350 350 ALA ALA T . n 
S 1 350 ASN 350 351 351 ASN ASN T . n 
S 1 351 SER 351 352 352 SER SER T . n 
S 1 352 TYR 352 353 353 TYR TYR T . n 
S 1 353 SER 353 354 354 SER SER T . n 
S 1 354 ARG 354 355 355 ARG ARG T . n 
S 1 355 LEU 355 356 356 LEU LEU T . n 
S 1 356 GLU 356 357 357 GLU GLU T . n 
S 1 357 ASN 357 358 358 ASN ASN T . n 
S 1 358 ALA 358 359 359 ALA ALA T . n 
S 1 359 VAL 359 360 360 VAL VAL T . n 
S 1 360 VAL 360 361 361 VAL VAL T . n 
S 1 361 LEU 361 362 362 LEU LEU T . n 
S 1 362 PRO 362 363 363 PRO PRO T . n 
S 1 363 SER 363 364 364 SER SER T . n 
S 1 364 VAL 364 365 365 VAL VAL T . n 
S 1 365 LYS 365 366 366 LYS LYS T . n 
S 1 366 ILE 366 367 367 ILE ILE T . n 
S 1 367 GLY 367 368 368 GLY GLY T . n 
S 1 368 ARG 368 369 369 ARG ARG T . n 
S 1 369 HIS 369 370 370 HIS HIS T . n 
S 1 370 ALA 370 371 371 ALA ALA T . n 
S 1 371 GLN 371 372 372 GLN GLN T . n 
S 1 372 LEU 372 373 373 LEU LEU T . n 
S 1 373 SER 373 374 374 SER SER T . n 
S 1 374 ASN 374 375 375 ASN ASN T . n 
S 1 375 VAL 375 376 376 VAL VAL T . n 
S 1 376 VAL 376 377 377 VAL VAL T . n 
S 1 377 ILE 377 378 378 ILE ILE T . n 
S 1 378 ASP 378 379 379 ASP ASP T . n 
S 1 379 HIS 379 380 380 HIS HIS T . n 
S 1 380 GLY 380 381 381 GLY GLY T . n 
S 1 381 VAL 381 382 382 VAL VAL T . n 
S 1 382 VAL 382 383 383 VAL VAL T . n 
S 1 383 ILE 383 384 384 ILE ILE T . n 
S 1 384 PRO 384 385 385 PRO PRO T . n 
S 1 385 GLU 385 386 386 GLU GLU T . n 
S 1 386 GLY 386 387 387 GLY GLY T . n 
S 1 387 LEU 387 388 388 LEU LEU T . n 
S 1 388 ILE 388 389 389 ILE ILE T . n 
S 1 389 VAL 389 390 390 VAL VAL T . n 
S 1 390 GLY 390 391 391 GLY GLY T . n 
S 1 391 GLU 391 392 392 GLU GLU T . n 
S 1 392 ASP 392 393 393 ASP ASP T . n 
S 1 393 PRO 393 394 394 PRO PRO T . n 
S 1 394 GLU 394 395 395 GLU GLU T . n 
S 1 395 LEU 395 396 396 LEU LEU T . n 
S 1 396 ASP 396 397 397 ASP ASP T . n 
S 1 397 ALA 397 398 398 ALA ALA T . n 
S 1 398 LYS 398 399 399 LYS LYS T . n 
S 1 399 ARG 399 400 400 ARG ARG T . n 
S 1 400 PHE 400 401 401 PHE PHE T . n 
S 1 401 ARG 401 402 402 ARG ARG T . n 
S 1 402 ARG 402 403 403 ARG ARG T . n 
S 1 403 THR 403 404 404 THR THR T . n 
S 1 404 GLU 404 405 405 GLU GLU T . n 
S 1 405 SER 405 406 406 SER SER T . n 
S 1 406 GLY 406 407 407 GLY GLY T . n 
S 1 407 ILE 407 408 408 ILE ILE T . n 
S 1 408 CYS 408 409 409 CYS CYS T . n 
S 1 409 LEU 409 410 410 LEU LEU T . n 
S 1 410 ILE 410 411 411 ILE ILE T . n 
S 1 411 THR 411 412 412 THR THR T . n 
S 1 412 GLN 412 413 413 GLN GLN T . n 
S 1 413 SER 413 414 414 SER SER T . n 
S 1 414 MET 414 415 415 MET MET T . n 
S 1 415 ILE 415 416 416 ILE ILE T . n 
S 1 416 ASP 416 417 417 ASP ASP T . n 
S 1 417 LYS 417 418 418 LYS LYS T . n 
S 1 418 LEU 418 419 419 LEU LEU T . n 
S 1 419 ASP 419 420 420 ASP ASP T . n 
S 1 420 LEU 420 421 421 LEU LEU T . n 
T 1 1   MET 1   2   ?   ?   ?   U . n 
T 1 2   SER 2   3   ?   ?   ?   U . n 
T 1 3   GLU 3   4   ?   ?   ?   U . n 
T 1 4   LYS 4   5   ?   ?   ?   U . n 
T 1 5   ARG 5   6   ?   ?   ?   U . n 
T 1 6   VAL 6   7   7   VAL VAL U . n 
T 1 7   GLN 7   8   8   GLN GLN U . n 
T 1 8   PRO 8   9   9   PRO PRO U . n 
T 1 9   LEU 9   10  10  LEU LEU U . n 
T 1 10  ALA 10  11  11  ALA ALA U . n 
T 1 11  ARG 11  12  12  ARG ARG U . n 
T 1 12  ASP 12  13  13  ASP ASP U . n 
T 1 13  ALA 13  14  14  ALA ALA U . n 
T 1 14  MET 14  15  15  MET MET U . n 
T 1 15  ALA 15  16  16  ALA ALA U . n 
T 1 16  TYR 16  17  17  TYR TYR U . n 
T 1 17  VAL 17  18  18  VAL VAL U . n 
T 1 18  LEU 18  19  19  LEU LEU U . n 
T 1 19  ALA 19  20  20  ALA ALA U . n 
T 1 20  GLY 20  21  21  GLY GLY U . n 
T 1 21  GLY 21  22  22  GLY GLY U . n 
T 1 22  ARG 22  23  23  ARG ARG U . n 
T 1 23  GLY 23  24  24  GLY GLY U . n 
T 1 24  SER 24  25  25  SER SER U . n 
T 1 25  ARG 25  26  26  ARG ARG U . n 
T 1 26  LEU 26  27  27  LEU LEU U . n 
T 1 27  LYS 27  28  28  LYS LYS U . n 
T 1 28  GLU 28  29  29  GLU GLU U . n 
T 1 29  LEU 29  30  30  LEU LEU U . n 
T 1 30  THR 30  31  31  THR THR U . n 
T 1 31  ASP 31  32  32  ASP ASP U . n 
T 1 32  ARG 32  33  33  ARG ARG U . n 
T 1 33  ARG 33  34  34  ARG ARG U . n 
T 1 34  ALA 34  35  35  ALA ALA U . n 
T 1 35  LYS 35  36  36  LYS LYS U . n 
T 1 36  PRO 36  37  37  PRO PRO U . n 
T 1 37  ALA 37  38  38  ALA ALA U . n 
T 1 38  VAL 38  39  39  VAL VAL U . n 
T 1 39  TYR 39  40  40  TYR TYR U . n 
T 1 40  PHE 40  41  41  PHE PHE U . n 
T 1 41  GLY 41  42  42  GLY GLY U . n 
T 1 42  GLY 42  43  43  GLY GLY U . n 
T 1 43  LYS 43  44  44  LYS LYS U . n 
T 1 44  ALA 44  45  45  ALA ALA U . n 
T 1 45  ARG 45  46  46  ARG ARG U . n 
T 1 46  ILE 46  47  47  ILE ILE U . n 
T 1 47  ILE 47  48  48  ILE ILE U . n 
T 1 48  ASP 48  49  49  ASP ASP U . n 
T 1 49  PHE 49  50  50  PHE PHE U . n 
T 1 50  ALA 50  51  51  ALA ALA U . n 
T 1 51  LEU 51  52  52  LEU LEU U . n 
T 1 52  SER 52  53  53  SER SER U . n 
T 1 53  ASN 53  54  54  ASN ASN U . n 
T 1 54  ALA 54  55  55  ALA ALA U . n 
T 1 55  LEU 55  56  56  LEU LEU U . n 
T 1 56  ASN 56  57  57  ASN ASN U . n 
T 1 57  SER 57  58  58  SER SER U . n 
T 1 58  GLY 58  59  59  GLY GLY U . n 
T 1 59  ILE 59  60  60  ILE ILE U . n 
T 1 60  ARG 60  61  61  ARG ARG U . n 
T 1 61  ARG 61  62  62  ARG ARG U . n 
T 1 62  ILE 62  63  63  ILE ILE U . n 
T 1 63  GLY 63  64  64  GLY GLY U . n 
T 1 64  VAL 64  65  65  VAL VAL U . n 
T 1 65  ALA 65  66  66  ALA ALA U . n 
T 1 66  THR 66  67  67  THR THR U . n 
T 1 67  GLN 67  68  68  GLN GLN U . n 
T 1 68  TYR 68  69  69  TYR TYR U . n 
T 1 69  LYS 69  70  70  LYS LYS U . n 
T 1 70  ALA 70  71  71  ALA ALA U . n 
T 1 71  HIS 71  72  72  HIS HIS U . n 
T 1 72  SER 72  73  73  SER SER U . n 
T 1 73  LEU 73  74  74  LEU LEU U . n 
T 1 74  ILE 74  75  75  ILE ILE U . n 
T 1 75  ARG 75  76  76  ARG ARG U . n 
T 1 76  HIS 76  77  77  HIS HIS U . n 
T 1 77  LEU 77  78  78  LEU LEU U . n 
T 1 78  GLN 78  79  79  GLN GLN U . n 
T 1 79  ARG 79  80  80  ARG ARG U . n 
T 1 80  GLY 80  81  81  GLY GLY U . n 
T 1 81  TRP 81  82  82  TRP TRP U . n 
T 1 82  ASP 82  83  83  ASP ASP U . n 
T 1 83  PHE 83  84  84  PHE PHE U . n 
T 1 84  PHE 84  85  85  PHE PHE U . n 
T 1 85  ARG 85  86  86  ARG ARG U . n 
T 1 86  PRO 86  87  87  PRO PRO U . n 
T 1 87  GLU 87  88  88  GLU GLU U . n 
T 1 88  ARG 88  89  89  ARG ARG U . n 
T 1 89  ASN 89  90  90  ASN ASN U . n 
T 1 90  GLU 90  91  91  GLU GLU U . n 
T 1 91  SER 91  92  92  SER SER U . n 
T 1 92  PHE 92  93  93  PHE PHE U . n 
T 1 93  ASP 93  94  94  ASP ASP U . n 
T 1 94  ILE 94  95  95  ILE ILE U . n 
T 1 95  LEU 95  96  96  LEU LEU U . n 
T 1 96  PRO 96  97  97  PRO PRO U . n 
T 1 97  ALA 97  98  98  ALA ALA U . n 
T 1 98  SER 98  99  99  SER SER U . n 
T 1 99  GLN 99  100 100 GLN GLN U . n 
T 1 100 ARG 100 101 101 ARG ARG U . n 
T 1 101 VAL 101 102 102 VAL VAL U . n 
T 1 102 SER 102 103 103 SER SER U . n 
T 1 103 GLU 103 104 104 GLU GLU U . n 
T 1 104 THR 104 105 105 THR THR U . n 
T 1 105 GLN 105 106 106 GLN GLN U . n 
T 1 106 TRP 106 107 107 TRP TRP U . n 
T 1 107 TYR 107 108 108 TYR TYR U . n 
T 1 108 GLU 108 109 109 GLU GLU U . n 
T 1 109 GLY 109 110 110 GLY GLY U . n 
T 1 110 THR 110 111 111 THR THR U . n 
T 1 111 ALA 111 112 112 ALA ALA U . n 
T 1 112 ASP 112 113 113 ASP ASP U . n 
T 1 113 ALA 113 114 114 ALA ALA U . n 
T 1 114 VAL 114 115 115 VAL VAL U . n 
T 1 115 TYR 115 116 116 TYR TYR U . n 
T 1 116 GLN 116 117 117 GLN GLN U . n 
T 1 117 ASN 117 118 118 ASN ASN U . n 
T 1 118 ILE 118 119 119 ILE ILE U . n 
T 1 119 ASP 119 120 120 ASP ASP U . n 
T 1 120 ILE 120 121 121 ILE ILE U . n 
T 1 121 ILE 121 122 122 ILE ILE U . n 
T 1 122 GLU 122 123 123 GLU GLU U . n 
T 1 123 PRO 123 124 124 PRO PRO U . n 
T 1 124 TYR 124 125 125 TYR TYR U . n 
T 1 125 ALA 125 126 126 ALA ALA U . n 
T 1 126 PRO 126 127 127 PRO PRO U . n 
T 1 127 GLU 127 128 128 GLU GLU U . n 
T 1 128 TYR 128 129 129 TYR TYR U . n 
T 1 129 MET 129 130 130 MET MET U . n 
T 1 130 VAL 130 131 131 VAL VAL U . n 
T 1 131 ILE 131 132 132 ILE ILE U . n 
T 1 132 LEU 132 133 133 LEU LEU U . n 
T 1 133 ALA 133 134 134 ALA ALA U . n 
T 1 134 GLY 134 135 135 GLY GLY U . n 
T 1 135 ASP 135 136 136 ASP ASP U . n 
T 1 136 HIS 136 137 137 HIS HIS U . n 
T 1 137 ILE 137 138 138 ILE ILE U . n 
T 1 138 TYR 138 139 139 TYR TYR U . n 
T 1 139 LYS 139 140 140 LYS LYS U . n 
T 1 140 MET 140 141 141 MET MET U . n 
T 1 141 ASP 141 142 142 ASP ASP U . n 
T 1 142 TYR 142 143 143 TYR TYR U . n 
T 1 143 GLU 143 144 144 GLU GLU U . n 
T 1 144 TYR 144 145 145 TYR TYR U . n 
T 1 145 MET 145 146 146 MET MET U . n 
T 1 146 LEU 146 147 147 LEU LEU U . n 
T 1 147 GLN 147 148 148 GLN GLN U . n 
T 1 148 GLN 148 149 149 GLN GLN U . n 
T 1 149 HIS 149 150 150 HIS HIS U . n 
T 1 150 VAL 150 151 151 VAL VAL U . n 
T 1 151 ASP 151 152 152 ASP ASP U . n 
T 1 152 SER 152 153 153 SER SER U . n 
T 1 153 GLY 153 154 154 GLY GLY U . n 
T 1 154 ALA 154 155 155 ALA ALA U . n 
T 1 155 ASP 155 156 156 ASP ASP U . n 
T 1 156 VAL 156 157 157 VAL VAL U . n 
T 1 157 THR 157 158 158 THR THR U . n 
T 1 158 ILE 158 159 159 ILE ILE U . n 
T 1 159 GLY 159 160 160 GLY GLY U . n 
T 1 160 CYS 160 161 161 CYS CYS U . n 
T 1 161 LEU 161 162 162 LEU LEU U . n 
T 1 162 GLU 162 163 163 GLU GLU U . n 
T 1 163 VAL 163 164 164 VAL VAL U . n 
T 1 164 PRO 164 165 165 PRO PRO U . n 
T 1 165 ARG 165 166 166 ARG ARG U . n 
T 1 166 MET 166 167 167 MET MET U . n 
T 1 167 GLU 167 168 168 GLU GLU U . n 
T 1 168 ALA 168 169 169 ALA ALA U . n 
T 1 169 THR 169 170 170 THR THR U . n 
T 1 170 GLY 170 171 171 GLY GLY U . n 
T 1 171 PHE 171 172 172 PHE PHE U . n 
T 1 172 GLY 172 173 173 GLY GLY U . n 
T 1 173 VAL 173 174 174 VAL VAL U . n 
T 1 174 MET 174 175 175 MET MET U . n 
T 1 175 HIS 175 176 176 HIS HIS U . n 
T 1 176 VAL 176 177 177 VAL VAL U . n 
T 1 177 ASN 177 178 178 ASN ASN U . n 
T 1 178 GLU 178 179 179 GLU GLU U . n 
T 1 179 LYS 179 180 180 LYS LYS U . n 
T 1 180 ASP 180 181 181 ASP ASP U . n 
T 1 181 GLU 181 182 182 GLU GLU U . n 
T 1 182 ILE 182 183 183 ILE ILE U . n 
T 1 183 ILE 183 184 184 ILE ILE U . n 
T 1 184 ASP 184 185 185 ASP ASP U . n 
T 1 185 PHE 185 186 186 PHE PHE U . n 
T 1 186 ILE 186 187 187 ILE ILE U . n 
T 1 187 GLU 187 188 188 GLU GLU U . n 
T 1 188 LYS 188 189 189 LYS LYS U . n 
T 1 189 PRO 189 190 190 PRO PRO U . n 
T 1 190 ALA 190 191 191 ALA ALA U . n 
T 1 191 ASP 191 192 192 ASP ASP U . n 
T 1 192 PRO 192 193 193 PRO PRO U . n 
T 1 193 PRO 193 194 194 PRO PRO U . n 
T 1 194 GLY 194 195 195 GLY GLY U . n 
T 1 195 ILE 195 196 196 ILE ILE U . n 
T 1 196 PRO 196 197 197 PRO PRO U . n 
T 1 197 GLY 197 198 198 GLY GLY U . n 
T 1 198 ASN 198 199 199 ASN ASN U . n 
T 1 199 GLU 199 200 200 GLU GLU U . n 
T 1 200 GLY 200 201 201 GLY GLY U . n 
T 1 201 PHE 201 202 202 PHE PHE U . n 
T 1 202 ALA 202 203 203 ALA ALA U . n 
T 1 203 LEU 203 204 204 LEU LEU U . n 
T 1 204 ALA 204 205 205 ALA ALA U . n 
T 1 205 SER 205 206 206 SER SER U . n 
T 1 206 MET 206 207 207 MET MET U . n 
T 1 207 GLY 207 208 208 GLY GLY U . n 
T 1 208 ILE 208 209 209 ILE ILE U . n 
T 1 209 TYR 209 210 210 TYR TYR U . n 
T 1 210 VAL 210 211 211 VAL VAL U . n 
T 1 211 PHE 211 212 212 PHE PHE U . n 
T 1 212 HIS 212 213 213 HIS HIS U . n 
T 1 213 THR 213 214 214 THR THR U . n 
T 1 214 LYS 214 215 215 LYS LYS U . n 
T 1 215 PHE 215 216 216 PHE PHE U . n 
T 1 216 LEU 216 217 217 LEU LEU U . n 
T 1 217 MET 217 218 218 MET MET U . n 
T 1 218 GLU 218 219 219 GLU GLU U . n 
T 1 219 ALA 219 220 220 ALA ALA U . n 
T 1 220 LEU 220 221 221 LEU LEU U . n 
T 1 221 ARG 221 222 222 ARG ARG U . n 
T 1 222 ARG 222 223 223 ARG ARG U . n 
T 1 223 ASP 223 224 224 ASP ASP U . n 
T 1 224 ALA 224 225 225 ALA ALA U . n 
T 1 225 ALA 225 226 226 ALA ALA U . n 
T 1 226 ASP 226 227 227 ASP ASP U . n 
T 1 227 PRO 227 228 228 PRO PRO U . n 
T 1 228 THR 228 229 229 THR THR U . n 
T 1 229 SER 229 230 230 SER SER U . n 
T 1 230 SER 230 231 231 SER SER U . n 
T 1 231 ARG 231 232 232 ARG ARG U . n 
T 1 232 ASP 232 233 233 ASP ASP U . n 
T 1 233 PHE 233 234 234 PHE PHE U . n 
T 1 234 GLY 234 235 235 GLY GLY U . n 
T 1 235 LYS 235 236 236 LYS LYS U . n 
T 1 236 ASP 236 237 237 ASP ASP U . n 
T 1 237 ILE 237 238 238 ILE ILE U . n 
T 1 238 ILE 238 239 239 ILE ILE U . n 
T 1 239 PRO 239 240 240 PRO PRO U . n 
T 1 240 TYR 240 241 241 TYR TYR U . n 
T 1 241 ILE 241 242 242 ILE ILE U . n 
T 1 242 VAL 242 243 243 VAL VAL U . n 
T 1 243 GLU 243 244 244 GLU GLU U . n 
T 1 244 HIS 244 245 245 HIS HIS U . n 
T 1 245 GLY 245 246 246 GLY GLY U . n 
T 1 246 LYS 246 247 247 LYS LYS U . n 
T 1 247 ALA 247 248 248 ALA ALA U . n 
T 1 248 VAL 248 249 249 VAL VAL U . n 
T 1 249 ALA 249 250 250 ALA ALA U . n 
T 1 250 HIS 250 251 251 HIS HIS U . n 
T 1 251 ARG 251 252 252 ARG ARG U . n 
T 1 252 PHE 252 253 253 PHE PHE U . n 
T 1 253 ALA 253 254 254 ALA ALA U . n 
T 1 254 ASP 254 255 255 ASP ASP U . n 
T 1 255 SER 255 256 256 SER SER U . n 
T 1 256 CYS 256 257 257 CYS CYS U . n 
T 1 257 VAL 257 258 258 VAL VAL U . n 
T 1 258 ARG 258 259 259 ARG ARG U . n 
T 1 259 SER 259 260 260 SER SER U . n 
T 1 260 ASP 260 261 261 ASP ASP U . n 
T 1 261 PHE 261 262 262 PHE PHE U . n 
T 1 262 GLU 262 263 263 GLU GLU U . n 
T 1 263 HIS 263 264 264 HIS HIS U . n 
T 1 264 GLU 264 265 265 GLU GLU U . n 
T 1 265 PRO 265 266 266 PRO PRO U . n 
T 1 266 TYR 266 267 267 TYR TYR U . n 
T 1 267 TRP 267 268 268 TRP TRP U . n 
T 1 268 ARG 268 269 269 ARG ARG U . n 
T 1 269 ASP 269 270 270 ASP ASP U . n 
T 1 270 VAL 270 271 271 VAL VAL U . n 
T 1 271 GLY 271 272 272 GLY GLY U . n 
T 1 272 THR 272 273 273 THR THR U . n 
T 1 273 ILE 273 274 274 ILE ILE U . n 
T 1 274 ASP 274 275 275 ASP ASP U . n 
T 1 275 ALA 275 276 276 ALA ALA U . n 
T 1 276 TYR 276 277 277 TYR TYR U . n 
T 1 277 TRP 277 278 278 TRP TRP U . n 
T 1 278 GLN 278 279 279 GLN GLN U . n 
T 1 279 ALA 279 280 280 ALA ALA U . n 
T 1 280 ASN 280 281 281 ASN ASN U . n 
T 1 281 ILE 281 282 282 ILE ILE U . n 
T 1 282 ASP 282 283 283 ASP ASP U . n 
T 1 283 LEU 283 284 284 LEU LEU U . n 
T 1 284 THR 284 285 285 THR THR U . n 
T 1 285 ASP 285 286 286 ASP ASP U . n 
T 1 286 VAL 286 287 287 VAL VAL U . n 
T 1 287 VAL 287 288 288 VAL VAL U . n 
T 1 288 PRO 288 289 289 PRO PRO U . n 
T 1 289 ASP 289 290 290 ASP ASP U . n 
T 1 290 LEU 290 291 291 LEU LEU U . n 
T 1 291 ASP 291 292 292 ASP ASP U . n 
T 1 292 ILE 292 293 293 ILE ILE U . n 
T 1 293 TYR 293 294 294 TYR TYR U . n 
T 1 294 ASP 294 295 295 ASP ASP U . n 
T 1 295 LYS 295 296 296 LYS LYS U . n 
T 1 296 SER 296 297 297 SER SER U . n 
T 1 297 TRP 297 298 298 TRP TRP U . n 
T 1 298 PRO 298 299 299 PRO PRO U . n 
T 1 299 ILE 299 300 300 ILE ILE U . n 
T 1 300 TRP 300 301 301 TRP TRP U . n 
T 1 301 THR 301 302 302 THR THR U . n 
T 1 302 TYR 302 303 303 TYR TYR U . n 
T 1 303 ALA 303 304 304 ALA ALA U . n 
T 1 304 GLU 304 305 305 GLU GLU U . n 
T 1 305 ILE 305 306 306 ILE ILE U . n 
T 1 306 THR 306 307 307 THR THR U . n 
T 1 307 PRO 307 308 308 PRO PRO U . n 
T 1 308 PRO 308 309 309 PRO PRO U . n 
T 1 309 ALA 309 310 310 ALA ALA U . n 
T 1 310 LYS 310 311 311 LYS LYS U . n 
T 1 311 PHE 311 312 312 PHE PHE U . n 
T 1 312 VAL 312 313 313 VAL VAL U . n 
T 1 313 HIS 313 314 314 HIS HIS U . n 
T 1 314 ASP 314 315 315 ASP ASP U . n 
T 1 315 ASP 315 316 316 ASP ASP U . n 
T 1 316 GLU 316 317 317 GLU GLU U . n 
T 1 317 ASP 317 318 318 ASP ASP U . n 
T 1 318 ARG 318 319 319 ARG ARG U . n 
T 1 319 ARG 319 320 320 ARG ARG U . n 
T 1 320 GLY 320 321 321 GLY GLY U . n 
T 1 321 SER 321 322 322 SER SER U . n 
T 1 322 ALA 322 323 323 ALA ALA U . n 
T 1 323 VAL 323 324 324 VAL VAL U . n 
T 1 324 SER 324 325 325 SER SER U . n 
T 1 325 SER 325 326 326 SER SER U . n 
T 1 326 VAL 326 327 327 VAL VAL U . n 
T 1 327 VAL 327 328 328 VAL VAL U . n 
T 1 328 SER 328 329 329 SER SER U . n 
T 1 329 GLY 329 330 330 GLY GLY U . n 
T 1 330 ASP 330 331 331 ASP ASP U . n 
T 1 331 CYS 331 332 332 CYS CYS U . n 
T 1 332 ILE 332 333 333 ILE ILE U . n 
T 1 333 ILE 333 334 334 ILE ILE U . n 
T 1 334 SER 334 335 335 SER SER U . n 
T 1 335 GLY 335 336 336 GLY GLY U . n 
T 1 336 ALA 336 337 337 ALA ALA U . n 
T 1 337 ALA 337 338 338 ALA ALA U . n 
T 1 338 LEU 338 339 339 LEU LEU U . n 
T 1 339 ASN 339 340 340 ASN ASN U . n 
T 1 340 ARG 340 341 341 ARG ARG U . n 
T 1 341 SER 341 342 342 SER SER U . n 
T 1 342 LEU 342 343 343 LEU LEU U . n 
T 1 343 LEU 343 344 344 LEU LEU U . n 
T 1 344 PHE 344 345 345 PHE PHE U . n 
T 1 345 THR 345 346 346 THR THR U . n 
T 1 346 GLY 346 347 347 GLY GLY U . n 
T 1 347 VAL 347 348 348 VAL VAL U . n 
T 1 348 ARG 348 349 349 ARG ARG U . n 
T 1 349 ALA 349 350 350 ALA ALA U . n 
T 1 350 ASN 350 351 351 ASN ASN U . n 
T 1 351 SER 351 352 352 SER SER U . n 
T 1 352 TYR 352 353 353 TYR TYR U . n 
T 1 353 SER 353 354 354 SER SER U . n 
T 1 354 ARG 354 355 355 ARG ARG U . n 
T 1 355 LEU 355 356 356 LEU LEU U . n 
T 1 356 GLU 356 357 357 GLU GLU U . n 
T 1 357 ASN 357 358 358 ASN ASN U . n 
T 1 358 ALA 358 359 359 ALA ALA U . n 
T 1 359 VAL 359 360 360 VAL VAL U . n 
T 1 360 VAL 360 361 361 VAL VAL U . n 
T 1 361 LEU 361 362 362 LEU LEU U . n 
T 1 362 PRO 362 363 363 PRO PRO U . n 
T 1 363 SER 363 364 364 SER SER U . n 
T 1 364 VAL 364 365 365 VAL VAL U . n 
T 1 365 LYS 365 366 366 LYS LYS U . n 
T 1 366 ILE 366 367 367 ILE ILE U . n 
T 1 367 GLY 367 368 368 GLY GLY U . n 
T 1 368 ARG 368 369 369 ARG ARG U . n 
T 1 369 HIS 369 370 370 HIS HIS U . n 
T 1 370 ALA 370 371 371 ALA ALA U . n 
T 1 371 GLN 371 372 372 GLN GLN U . n 
T 1 372 LEU 372 373 373 LEU LEU U . n 
T 1 373 SER 373 374 374 SER SER U . n 
T 1 374 ASN 374 375 375 ASN ASN U . n 
T 1 375 VAL 375 376 376 VAL VAL U . n 
T 1 376 VAL 376 377 377 VAL VAL U . n 
T 1 377 ILE 377 378 378 ILE ILE U . n 
T 1 378 ASP 378 379 379 ASP ASP U . n 
T 1 379 HIS 379 380 380 HIS HIS U . n 
T 1 380 GLY 380 381 381 GLY GLY U . n 
T 1 381 VAL 381 382 382 VAL VAL U . n 
T 1 382 VAL 382 383 383 VAL VAL U . n 
T 1 383 ILE 383 384 384 ILE ILE U . n 
T 1 384 PRO 384 385 385 PRO PRO U . n 
T 1 385 GLU 385 386 386 GLU GLU U . n 
T 1 386 GLY 386 387 387 GLY GLY U . n 
T 1 387 LEU 387 388 388 LEU LEU U . n 
T 1 388 ILE 388 389 389 ILE ILE U . n 
T 1 389 VAL 389 390 390 VAL VAL U . n 
T 1 390 GLY 390 391 391 GLY GLY U . n 
T 1 391 GLU 391 392 392 GLU GLU U . n 
T 1 392 ASP 392 393 393 ASP ASP U . n 
T 1 393 PRO 393 394 394 PRO PRO U . n 
T 1 394 GLU 394 395 395 GLU GLU U . n 
T 1 395 LEU 395 396 396 LEU LEU U . n 
T 1 396 ASP 396 397 397 ASP ASP U . n 
T 1 397 ALA 397 398 398 ALA ALA U . n 
T 1 398 LYS 398 399 399 LYS LYS U . n 
T 1 399 ARG 399 400 400 ARG ARG U . n 
T 1 400 PHE 400 401 401 PHE PHE U . n 
T 1 401 ARG 401 402 402 ARG ARG U . n 
T 1 402 ARG 402 403 403 ARG ARG U . n 
T 1 403 THR 403 404 404 THR THR U . n 
T 1 404 GLU 404 405 405 GLU GLU U . n 
T 1 405 SER 405 406 406 SER SER U . n 
T 1 406 GLY 406 407 407 GLY GLY U . n 
T 1 407 ILE 407 408 408 ILE ILE U . n 
T 1 408 CYS 408 409 409 CYS CYS U . n 
T 1 409 LEU 409 410 410 LEU LEU U . n 
T 1 410 ILE 410 411 411 ILE ILE U . n 
T 1 411 THR 411 412 412 THR THR U . n 
T 1 412 GLN 412 413 413 GLN GLN U . n 
T 1 413 SER 413 414 414 SER SER U . n 
T 1 414 MET 414 415 415 MET MET U . n 
T 1 415 ILE 415 416 416 ILE ILE U . n 
T 1 416 ASP 416 417 417 ASP ASP U . n 
T 1 417 LYS 417 418 418 LYS LYS U . n 
T 1 418 LEU 418 419 419 LEU LEU U . n 
T 1 419 ASP 419 420 420 ASP ASP U . n 
T 1 420 LEU 420 421 421 LEU LEU U . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
U  2 SO4 1   501  501  SO4 SO4 A . 
V  2 SO4 1   502  502  SO4 SO4 A . 
W  2 SO4 1   501  503  SO4 SO4 B . 
X  2 SO4 1   502  504  SO4 SO4 B . 
Y  2 SO4 1   501  503  SO4 SO4 C . 
Z  2 SO4 1   502  504  SO4 SO4 C . 
AA 2 SO4 1   501  503  SO4 SO4 D . 
BA 2 SO4 1   502  504  SO4 SO4 D . 
CA 2 SO4 1   501  503  SO4 SO4 E . 
DA 2 SO4 1   502  504  SO4 SO4 E . 
EA 2 SO4 1   503  505  SO4 SO4 E . 
FA 2 SO4 1   501  503  SO4 SO4 H . 
GA 2 SO4 1   502  504  SO4 SO4 H . 
HA 2 SO4 1   501  501  SO4 SO4 I . 
IA 2 SO4 1   502  502  SO4 SO4 I . 
JA 2 SO4 1   501  501  SO4 SO4 J . 
KA 2 SO4 1   502  502  SO4 SO4 J . 
LA 2 SO4 1   501  503  SO4 SO4 K . 
MA 2 SO4 1   502  504  SO4 SO4 K . 
NA 2 SO4 1   501  503  SO4 SO4 L . 
OA 2 SO4 1   502  504  SO4 SO4 L . 
PA 2 SO4 1   501  503  SO4 SO4 N . 
QA 2 SO4 1   502  504  SO4 SO4 N . 
RA 2 SO4 1   501  503  SO4 SO4 O . 
SA 2 SO4 1   502  504  SO4 SO4 O . 
TA 2 SO4 1   501  503  SO4 SO4 P . 
UA 2 SO4 1   502  504  SO4 SO4 P . 
VA 2 SO4 1   501  503  SO4 SO4 Q . 
WA 2 SO4 1   502  504  SO4 SO4 Q . 
XA 2 SO4 1   501  501  SO4 SO4 R . 
YA 2 SO4 1   502  502  SO4 SO4 R . 
ZA 2 SO4 1   501  501  SO4 SO4 F . 
AB 2 SO4 1   502  502  SO4 SO4 F . 
BB 2 SO4 1   501  503  SO4 SO4 G . 
CB 2 SO4 1   502  504  SO4 SO4 G . 
DB 2 SO4 1   501  503  SO4 SO4 M . 
EB 2 SO4 1   502  504  SO4 SO4 M . 
FB 2 SO4 1   501  503  SO4 SO4 T . 
GB 2 SO4 1   502  504  SO4 SO4 T . 
HB 2 SO4 1   503  505  SO4 SO4 T . 
IB 2 SO4 1   501  503  SO4 SO4 U . 
JB 2 SO4 1   502  504  SO4 SO4 U . 
KB 3 HOH 1   601  601  HOH HOH A . 
KB 3 HOH 2   602  602  HOH HOH A . 
KB 3 HOH 3   603  603  HOH HOH A . 
KB 3 HOH 4   604  604  HOH HOH A . 
KB 3 HOH 5   605  605  HOH HOH A . 
KB 3 HOH 6   606  606  HOH HOH A . 
KB 3 HOH 7   607  607  HOH HOH A . 
KB 3 HOH 8   608  608  HOH HOH A . 
KB 3 HOH 9   609  609  HOH HOH A . 
KB 3 HOH 10  610  610  HOH HOH A . 
KB 3 HOH 11  611  611  HOH HOH A . 
KB 3 HOH 12  612  612  HOH HOH A . 
KB 3 HOH 13  613  613  HOH HOH A . 
KB 3 HOH 14  614  614  HOH HOH A . 
KB 3 HOH 15  615  615  HOH HOH A . 
KB 3 HOH 16  616  616  HOH HOH A . 
KB 3 HOH 17  617  617  HOH HOH A . 
KB 3 HOH 18  618  618  HOH HOH A . 
KB 3 HOH 19  619  619  HOH HOH A . 
KB 3 HOH 20  620  620  HOH HOH A . 
KB 3 HOH 21  621  621  HOH HOH A . 
KB 3 HOH 22  622  622  HOH HOH A . 
KB 3 HOH 23  623  623  HOH HOH A . 
KB 3 HOH 24  624  624  HOH HOH A . 
KB 3 HOH 25  625  625  HOH HOH A . 
KB 3 HOH 26  626  626  HOH HOH A . 
KB 3 HOH 27  627  627  HOH HOH A . 
KB 3 HOH 28  628  628  HOH HOH A . 
KB 3 HOH 29  629  629  HOH HOH A . 
KB 3 HOH 30  630  630  HOH HOH A . 
KB 3 HOH 31  631  631  HOH HOH A . 
KB 3 HOH 32  632  632  HOH HOH A . 
KB 3 HOH 33  633  633  HOH HOH A . 
KB 3 HOH 34  634  634  HOH HOH A . 
KB 3 HOH 35  635  635  HOH HOH A . 
KB 3 HOH 36  636  636  HOH HOH A . 
KB 3 HOH 37  637  637  HOH HOH A . 
KB 3 HOH 38  638  638  HOH HOH A . 
KB 3 HOH 39  639  639  HOH HOH A . 
KB 3 HOH 40  640  640  HOH HOH A . 
KB 3 HOH 41  641  641  HOH HOH A . 
KB 3 HOH 42  642  642  HOH HOH A . 
KB 3 HOH 43  643  643  HOH HOH A . 
KB 3 HOH 44  644  644  HOH HOH A . 
KB 3 HOH 45  645  645  HOH HOH A . 
KB 3 HOH 46  646  646  HOH HOH A . 
KB 3 HOH 47  647  647  HOH HOH A . 
KB 3 HOH 48  648  648  HOH HOH A . 
KB 3 HOH 49  649  649  HOH HOH A . 
KB 3 HOH 50  650  650  HOH HOH A . 
KB 3 HOH 51  651  651  HOH HOH A . 
KB 3 HOH 52  652  652  HOH HOH A . 
KB 3 HOH 53  653  653  HOH HOH A . 
KB 3 HOH 54  654  654  HOH HOH A . 
KB 3 HOH 55  655  655  HOH HOH A . 
KB 3 HOH 56  656  656  HOH HOH A . 
KB 3 HOH 57  657  657  HOH HOH A . 
KB 3 HOH 58  658  658  HOH HOH A . 
KB 3 HOH 59  659  659  HOH HOH A . 
KB 3 HOH 60  660  660  HOH HOH A . 
KB 3 HOH 61  661  661  HOH HOH A . 
KB 3 HOH 62  662  662  HOH HOH A . 
KB 3 HOH 63  663  663  HOH HOH A . 
KB 3 HOH 64  664  664  HOH HOH A . 
KB 3 HOH 65  665  665  HOH HOH A . 
KB 3 HOH 66  666  666  HOH HOH A . 
KB 3 HOH 67  667  667  HOH HOH A . 
KB 3 HOH 68  668  668  HOH HOH A . 
KB 3 HOH 69  669  669  HOH HOH A . 
KB 3 HOH 70  670  670  HOH HOH A . 
KB 3 HOH 71  671  671  HOH HOH A . 
KB 3 HOH 72  672  672  HOH HOH A . 
KB 3 HOH 73  673  673  HOH HOH A . 
KB 3 HOH 74  674  674  HOH HOH A . 
KB 3 HOH 75  675  675  HOH HOH A . 
KB 3 HOH 76  676  676  HOH HOH A . 
KB 3 HOH 77  677  677  HOH HOH A . 
KB 3 HOH 78  678  678  HOH HOH A . 
KB 3 HOH 79  679  679  HOH HOH A . 
KB 3 HOH 80  680  680  HOH HOH A . 
KB 3 HOH 81  681  681  HOH HOH A . 
KB 3 HOH 82  682  682  HOH HOH A . 
KB 3 HOH 83  683  683  HOH HOH A . 
KB 3 HOH 84  684  684  HOH HOH A . 
KB 3 HOH 85  685  685  HOH HOH A . 
KB 3 HOH 86  686  686  HOH HOH A . 
KB 3 HOH 87  687  687  HOH HOH A . 
KB 3 HOH 88  688  688  HOH HOH A . 
KB 3 HOH 89  689  689  HOH HOH A . 
KB 3 HOH 90  690  690  HOH HOH A . 
KB 3 HOH 91  691  691  HOH HOH A . 
KB 3 HOH 92  692  692  HOH HOH A . 
KB 3 HOH 93  693  693  HOH HOH A . 
KB 3 HOH 94  694  694  HOH HOH A . 
KB 3 HOH 95  695  695  HOH HOH A . 
KB 3 HOH 96  696  696  HOH HOH A . 
KB 3 HOH 97  697  697  HOH HOH A . 
KB 3 HOH 98  698  698  HOH HOH A . 
KB 3 HOH 99  699  699  HOH HOH A . 
KB 3 HOH 100 700  700  HOH HOH A . 
KB 3 HOH 101 701  701  HOH HOH A . 
KB 3 HOH 102 702  702  HOH HOH A . 
KB 3 HOH 103 703  703  HOH HOH A . 
KB 3 HOH 104 704  704  HOH HOH A . 
KB 3 HOH 105 705  705  HOH HOH A . 
KB 3 HOH 106 706  706  HOH HOH A . 
KB 3 HOH 107 707  707  HOH HOH A . 
KB 3 HOH 108 708  708  HOH HOH A . 
KB 3 HOH 109 709  709  HOH HOH A . 
KB 3 HOH 110 710  710  HOH HOH A . 
KB 3 HOH 111 711  711  HOH HOH A . 
KB 3 HOH 112 712  712  HOH HOH A . 
KB 3 HOH 113 713  713  HOH HOH A . 
KB 3 HOH 114 714  714  HOH HOH A . 
KB 3 HOH 115 715  715  HOH HOH A . 
KB 3 HOH 116 716  716  HOH HOH A . 
KB 3 HOH 117 717  717  HOH HOH A . 
KB 3 HOH 118 718  718  HOH HOH A . 
KB 3 HOH 119 719  719  HOH HOH A . 
KB 3 HOH 120 720  720  HOH HOH A . 
KB 3 HOH 121 721  721  HOH HOH A . 
KB 3 HOH 122 722  722  HOH HOH A . 
KB 3 HOH 123 723  723  HOH HOH A . 
KB 3 HOH 124 724  724  HOH HOH A . 
KB 3 HOH 125 725  725  HOH HOH A . 
KB 3 HOH 126 726  726  HOH HOH A . 
KB 3 HOH 127 727  727  HOH HOH A . 
KB 3 HOH 128 728  728  HOH HOH A . 
KB 3 HOH 129 729  729  HOH HOH A . 
KB 3 HOH 130 730  730  HOH HOH A . 
KB 3 HOH 131 731  731  HOH HOH A . 
KB 3 HOH 132 732  732  HOH HOH A . 
KB 3 HOH 133 733  733  HOH HOH A . 
KB 3 HOH 134 734  734  HOH HOH A . 
KB 3 HOH 135 735  735  HOH HOH A . 
KB 3 HOH 136 736  736  HOH HOH A . 
KB 3 HOH 137 737  737  HOH HOH A . 
KB 3 HOH 138 738  738  HOH HOH A . 
KB 3 HOH 139 739  739  HOH HOH A . 
KB 3 HOH 140 740  740  HOH HOH A . 
KB 3 HOH 141 741  741  HOH HOH A . 
KB 3 HOH 142 742  742  HOH HOH A . 
KB 3 HOH 143 743  743  HOH HOH A . 
KB 3 HOH 144 744  744  HOH HOH A . 
KB 3 HOH 145 745  745  HOH HOH A . 
KB 3 HOH 146 746  746  HOH HOH A . 
KB 3 HOH 147 747  747  HOH HOH A . 
KB 3 HOH 148 748  748  HOH HOH A . 
KB 3 HOH 149 749  749  HOH HOH A . 
KB 3 HOH 150 750  750  HOH HOH A . 
KB 3 HOH 151 751  751  HOH HOH A . 
KB 3 HOH 152 752  752  HOH HOH A . 
KB 3 HOH 153 753  753  HOH HOH A . 
KB 3 HOH 154 754  754  HOH HOH A . 
KB 3 HOH 155 755  755  HOH HOH A . 
KB 3 HOH 156 756  756  HOH HOH A . 
KB 3 HOH 157 757  757  HOH HOH A . 
KB 3 HOH 158 758  758  HOH HOH A . 
KB 3 HOH 159 759  759  HOH HOH A . 
KB 3 HOH 160 760  760  HOH HOH A . 
KB 3 HOH 161 761  761  HOH HOH A . 
KB 3 HOH 162 762  762  HOH HOH A . 
KB 3 HOH 163 763  763  HOH HOH A . 
KB 3 HOH 164 764  764  HOH HOH A . 
KB 3 HOH 165 765  765  HOH HOH A . 
KB 3 HOH 166 766  766  HOH HOH A . 
KB 3 HOH 167 767  767  HOH HOH A . 
KB 3 HOH 168 768  768  HOH HOH A . 
KB 3 HOH 169 769  769  HOH HOH A . 
KB 3 HOH 170 770  770  HOH HOH A . 
KB 3 HOH 171 771  771  HOH HOH A . 
KB 3 HOH 172 772  772  HOH HOH A . 
KB 3 HOH 173 773  773  HOH HOH A . 
KB 3 HOH 174 774  774  HOH HOH A . 
KB 3 HOH 175 775  775  HOH HOH A . 
KB 3 HOH 176 776  776  HOH HOH A . 
KB 3 HOH 177 777  777  HOH HOH A . 
KB 3 HOH 178 778  778  HOH HOH A . 
KB 3 HOH 179 779  779  HOH HOH A . 
KB 3 HOH 180 780  780  HOH HOH A . 
KB 3 HOH 181 781  781  HOH HOH A . 
KB 3 HOH 182 782  782  HOH HOH A . 
KB 3 HOH 183 783  783  HOH HOH A . 
KB 3 HOH 184 784  784  HOH HOH A . 
KB 3 HOH 185 785  785  HOH HOH A . 
KB 3 HOH 186 786  786  HOH HOH A . 
KB 3 HOH 187 787  787  HOH HOH A . 
KB 3 HOH 188 788  788  HOH HOH A . 
KB 3 HOH 189 789  789  HOH HOH A . 
KB 3 HOH 190 790  790  HOH HOH A . 
KB 3 HOH 191 791  791  HOH HOH A . 
KB 3 HOH 192 792  792  HOH HOH A . 
KB 3 HOH 193 793  793  HOH HOH A . 
KB 3 HOH 194 794  794  HOH HOH A . 
KB 3 HOH 195 795  795  HOH HOH A . 
KB 3 HOH 196 796  796  HOH HOH A . 
KB 3 HOH 197 797  797  HOH HOH A . 
KB 3 HOH 198 798  798  HOH HOH A . 
KB 3 HOH 199 799  799  HOH HOH A . 
KB 3 HOH 200 800  800  HOH HOH A . 
KB 3 HOH 201 801  801  HOH HOH A . 
KB 3 HOH 202 802  802  HOH HOH A . 
KB 3 HOH 203 803  803  HOH HOH A . 
KB 3 HOH 204 804  804  HOH HOH A . 
KB 3 HOH 205 805  805  HOH HOH A . 
KB 3 HOH 206 806  806  HOH HOH A . 
KB 3 HOH 207 807  807  HOH HOH A . 
KB 3 HOH 208 808  808  HOH HOH A . 
KB 3 HOH 209 809  809  HOH HOH A . 
KB 3 HOH 210 810  810  HOH HOH A . 
KB 3 HOH 211 811  811  HOH HOH A . 
KB 3 HOH 212 812  812  HOH HOH A . 
KB 3 HOH 213 813  813  HOH HOH A . 
KB 3 HOH 214 814  814  HOH HOH A . 
KB 3 HOH 215 815  815  HOH HOH A . 
KB 3 HOH 216 816  816  HOH HOH A . 
KB 3 HOH 217 817  817  HOH HOH A . 
KB 3 HOH 218 818  818  HOH HOH A . 
KB 3 HOH 219 819  819  HOH HOH A . 
KB 3 HOH 220 820  820  HOH HOH A . 
KB 3 HOH 221 821  821  HOH HOH A . 
KB 3 HOH 222 822  822  HOH HOH A . 
KB 3 HOH 223 823  823  HOH HOH A . 
KB 3 HOH 224 824  824  HOH HOH A . 
KB 3 HOH 225 825  825  HOH HOH A . 
KB 3 HOH 226 826  826  HOH HOH A . 
KB 3 HOH 227 827  827  HOH HOH A . 
KB 3 HOH 228 828  828  HOH HOH A . 
KB 3 HOH 229 829  829  HOH HOH A . 
KB 3 HOH 230 830  830  HOH HOH A . 
KB 3 HOH 231 831  831  HOH HOH A . 
KB 3 HOH 232 832  832  HOH HOH A . 
KB 3 HOH 233 833  833  HOH HOH A . 
KB 3 HOH 234 834  834  HOH HOH A . 
KB 3 HOH 235 835  835  HOH HOH A . 
KB 3 HOH 236 836  836  HOH HOH A . 
KB 3 HOH 237 837  837  HOH HOH A . 
KB 3 HOH 238 838  838  HOH HOH A . 
KB 3 HOH 239 839  839  HOH HOH A . 
KB 3 HOH 240 840  840  HOH HOH A . 
KB 3 HOH 241 841  841  HOH HOH A . 
KB 3 HOH 242 842  842  HOH HOH A . 
KB 3 HOH 243 843  843  HOH HOH A . 
KB 3 HOH 244 844  844  HOH HOH A . 
KB 3 HOH 245 845  845  HOH HOH A . 
KB 3 HOH 246 846  846  HOH HOH A . 
KB 3 HOH 247 847  847  HOH HOH A . 
KB 3 HOH 248 848  848  HOH HOH A . 
KB 3 HOH 249 849  849  HOH HOH A . 
KB 3 HOH 250 850  850  HOH HOH A . 
KB 3 HOH 251 851  851  HOH HOH A . 
KB 3 HOH 252 852  852  HOH HOH A . 
KB 3 HOH 253 853  853  HOH HOH A . 
KB 3 HOH 254 854  854  HOH HOH A . 
KB 3 HOH 255 855  855  HOH HOH A . 
KB 3 HOH 256 856  856  HOH HOH A . 
KB 3 HOH 257 857  857  HOH HOH A . 
KB 3 HOH 258 858  858  HOH HOH A . 
KB 3 HOH 259 859  859  HOH HOH A . 
KB 3 HOH 260 860  860  HOH HOH A . 
KB 3 HOH 261 861  861  HOH HOH A . 
KB 3 HOH 262 862  862  HOH HOH A . 
KB 3 HOH 263 863  863  HOH HOH A . 
KB 3 HOH 264 864  864  HOH HOH A . 
KB 3 HOH 265 865  865  HOH HOH A . 
KB 3 HOH 266 866  866  HOH HOH A . 
KB 3 HOH 267 867  867  HOH HOH A . 
KB 3 HOH 268 868  868  HOH HOH A . 
KB 3 HOH 269 869  869  HOH HOH A . 
KB 3 HOH 270 870  870  HOH HOH A . 
KB 3 HOH 271 871  871  HOH HOH A . 
KB 3 HOH 272 872  872  HOH HOH A . 
KB 3 HOH 273 873  873  HOH HOH A . 
KB 3 HOH 274 874  874  HOH HOH A . 
KB 3 HOH 275 875  875  HOH HOH A . 
KB 3 HOH 276 876  876  HOH HOH A . 
KB 3 HOH 277 877  877  HOH HOH A . 
KB 3 HOH 278 878  878  HOH HOH A . 
KB 3 HOH 279 879  879  HOH HOH A . 
KB 3 HOH 280 880  880  HOH HOH A . 
KB 3 HOH 281 881  881  HOH HOH A . 
KB 3 HOH 282 882  882  HOH HOH A . 
KB 3 HOH 283 883  883  HOH HOH A . 
KB 3 HOH 284 884  884  HOH HOH A . 
KB 3 HOH 285 885  885  HOH HOH A . 
KB 3 HOH 286 886  886  HOH HOH A . 
KB 3 HOH 287 887  887  HOH HOH A . 
KB 3 HOH 288 888  888  HOH HOH A . 
KB 3 HOH 289 889  889  HOH HOH A . 
KB 3 HOH 290 890  890  HOH HOH A . 
KB 3 HOH 291 891  891  HOH HOH A . 
KB 3 HOH 292 892  892  HOH HOH A . 
KB 3 HOH 293 893  893  HOH HOH A . 
KB 3 HOH 294 894  894  HOH HOH A . 
KB 3 HOH 295 895  895  HOH HOH A . 
KB 3 HOH 296 896  896  HOH HOH A . 
KB 3 HOH 297 897  897  HOH HOH A . 
KB 3 HOH 298 898  898  HOH HOH A . 
KB 3 HOH 299 899  899  HOH HOH A . 
KB 3 HOH 300 900  900  HOH HOH A . 
KB 3 HOH 301 901  901  HOH HOH A . 
KB 3 HOH 302 902  902  HOH HOH A . 
KB 3 HOH 303 903  903  HOH HOH A . 
KB 3 HOH 304 904  904  HOH HOH A . 
KB 3 HOH 305 905  905  HOH HOH A . 
KB 3 HOH 306 906  906  HOH HOH A . 
KB 3 HOH 307 907  907  HOH HOH A . 
KB 3 HOH 308 908  908  HOH HOH A . 
KB 3 HOH 309 909  909  HOH HOH A . 
KB 3 HOH 310 910  910  HOH HOH A . 
KB 3 HOH 311 911  911  HOH HOH A . 
KB 3 HOH 312 912  912  HOH HOH A . 
KB 3 HOH 313 913  913  HOH HOH A . 
KB 3 HOH 314 914  914  HOH HOH A . 
KB 3 HOH 315 915  915  HOH HOH A . 
KB 3 HOH 316 916  916  HOH HOH A . 
KB 3 HOH 317 917  917  HOH HOH A . 
KB 3 HOH 318 918  918  HOH HOH A . 
KB 3 HOH 319 919  919  HOH HOH A . 
KB 3 HOH 320 920  920  HOH HOH A . 
KB 3 HOH 321 921  921  HOH HOH A . 
KB 3 HOH 322 922  922  HOH HOH A . 
KB 3 HOH 323 923  923  HOH HOH A . 
KB 3 HOH 324 924  924  HOH HOH A . 
KB 3 HOH 325 925  925  HOH HOH A . 
KB 3 HOH 326 926  926  HOH HOH A . 
KB 3 HOH 327 927  927  HOH HOH A . 
KB 3 HOH 328 928  928  HOH HOH A . 
KB 3 HOH 329 929  929  HOH HOH A . 
KB 3 HOH 330 930  930  HOH HOH A . 
KB 3 HOH 331 931  931  HOH HOH A . 
KB 3 HOH 332 932  932  HOH HOH A . 
KB 3 HOH 333 933  933  HOH HOH A . 
KB 3 HOH 334 934  934  HOH HOH A . 
KB 3 HOH 335 935  935  HOH HOH A . 
KB 3 HOH 336 936  936  HOH HOH A . 
KB 3 HOH 337 937  937  HOH HOH A . 
KB 3 HOH 338 938  938  HOH HOH A . 
KB 3 HOH 339 939  939  HOH HOH A . 
KB 3 HOH 340 940  940  HOH HOH A . 
KB 3 HOH 341 941  941  HOH HOH A . 
KB 3 HOH 342 942  942  HOH HOH A . 
KB 3 HOH 343 943  943  HOH HOH A . 
KB 3 HOH 344 944  944  HOH HOH A . 
KB 3 HOH 345 945  945  HOH HOH A . 
KB 3 HOH 346 946  946  HOH HOH A . 
KB 3 HOH 347 947  947  HOH HOH A . 
KB 3 HOH 348 948  948  HOH HOH A . 
KB 3 HOH 349 949  949  HOH HOH A . 
KB 3 HOH 350 950  950  HOH HOH A . 
KB 3 HOH 351 951  951  HOH HOH A . 
KB 3 HOH 352 952  952  HOH HOH A . 
KB 3 HOH 353 953  953  HOH HOH A . 
KB 3 HOH 354 954  954  HOH HOH A . 
KB 3 HOH 355 955  955  HOH HOH A . 
KB 3 HOH 356 956  956  HOH HOH A . 
KB 3 HOH 357 957  957  HOH HOH A . 
KB 3 HOH 358 958  958  HOH HOH A . 
KB 3 HOH 359 959  959  HOH HOH A . 
KB 3 HOH 360 960  960  HOH HOH A . 
KB 3 HOH 361 961  961  HOH HOH A . 
KB 3 HOH 362 962  962  HOH HOH A . 
KB 3 HOH 363 963  963  HOH HOH A . 
KB 3 HOH 364 964  964  HOH HOH A . 
KB 3 HOH 365 965  965  HOH HOH A . 
KB 3 HOH 366 966  966  HOH HOH A . 
KB 3 HOH 367 967  967  HOH HOH A . 
KB 3 HOH 368 968  968  HOH HOH A . 
KB 3 HOH 369 969  969  HOH HOH A . 
KB 3 HOH 370 970  970  HOH HOH A . 
KB 3 HOH 371 971  971  HOH HOH A . 
KB 3 HOH 372 972  972  HOH HOH A . 
KB 3 HOH 373 973  973  HOH HOH A . 
KB 3 HOH 374 974  974  HOH HOH A . 
KB 3 HOH 375 975  975  HOH HOH A . 
KB 3 HOH 376 976  976  HOH HOH A . 
KB 3 HOH 377 977  977  HOH HOH A . 
KB 3 HOH 378 978  978  HOH HOH A . 
KB 3 HOH 379 979  979  HOH HOH A . 
KB 3 HOH 380 980  980  HOH HOH A . 
KB 3 HOH 381 981  981  HOH HOH A . 
KB 3 HOH 382 982  982  HOH HOH A . 
KB 3 HOH 383 983  983  HOH HOH A . 
KB 3 HOH 384 984  984  HOH HOH A . 
KB 3 HOH 385 985  985  HOH HOH A . 
KB 3 HOH 386 986  986  HOH HOH A . 
KB 3 HOH 387 987  987  HOH HOH A . 
KB 3 HOH 388 988  988  HOH HOH A . 
KB 3 HOH 389 989  989  HOH HOH A . 
KB 3 HOH 390 990  990  HOH HOH A . 
KB 3 HOH 391 991  991  HOH HOH A . 
KB 3 HOH 392 992  992  HOH HOH A . 
KB 3 HOH 393 993  993  HOH HOH A . 
KB 3 HOH 394 994  994  HOH HOH A . 
KB 3 HOH 395 995  995  HOH HOH A . 
KB 3 HOH 396 996  996  HOH HOH A . 
KB 3 HOH 397 997  997  HOH HOH A . 
KB 3 HOH 398 998  998  HOH HOH A . 
KB 3 HOH 399 999  999  HOH HOH A . 
KB 3 HOH 400 1000 1000 HOH HOH A . 
KB 3 HOH 401 1001 1001 HOH HOH A . 
KB 3 HOH 402 1002 1002 HOH HOH A . 
KB 3 HOH 403 1003 1003 HOH HOH A . 
KB 3 HOH 404 1004 1004 HOH HOH A . 
KB 3 HOH 405 1005 1005 HOH HOH A . 
KB 3 HOH 406 1006 1006 HOH HOH A . 
KB 3 HOH 407 1007 1007 HOH HOH A . 
KB 3 HOH 408 1008 1008 HOH HOH A . 
KB 3 HOH 409 1009 1009 HOH HOH A . 
KB 3 HOH 410 1010 1010 HOH HOH A . 
KB 3 HOH 411 1011 1011 HOH HOH A . 
KB 3 HOH 412 1012 1012 HOH HOH A . 
KB 3 HOH 413 1013 1013 HOH HOH A . 
KB 3 HOH 414 1014 1014 HOH HOH A . 
KB 3 HOH 415 1015 1015 HOH HOH A . 
KB 3 HOH 416 1016 1016 HOH HOH A . 
KB 3 HOH 417 1017 1017 HOH HOH A . 
KB 3 HOH 418 1018 1018 HOH HOH A . 
KB 3 HOH 419 1019 1019 HOH HOH A . 
KB 3 HOH 420 1020 1020 HOH HOH A . 
KB 3 HOH 421 1021 1021 HOH HOH A . 
KB 3 HOH 422 1022 1022 HOH HOH A . 
KB 3 HOH 423 1023 1023 HOH HOH A . 
KB 3 HOH 424 1024 1024 HOH HOH A . 
KB 3 HOH 425 1025 1025 HOH HOH A . 
KB 3 HOH 426 1026 1026 HOH HOH A . 
KB 3 HOH 427 1027 1027 HOH HOH A . 
KB 3 HOH 428 1028 1028 HOH HOH A . 
KB 3 HOH 429 1029 1029 HOH HOH A . 
KB 3 HOH 430 1030 1030 HOH HOH A . 
KB 3 HOH 431 1031 1031 HOH HOH A . 
KB 3 HOH 432 1032 1032 HOH HOH A . 
KB 3 HOH 433 1033 1033 HOH HOH A . 
KB 3 HOH 434 1034 1034 HOH HOH A . 
KB 3 HOH 435 1035 1035 HOH HOH A . 
KB 3 HOH 436 1036 1036 HOH HOH A . 
KB 3 HOH 437 1037 1037 HOH HOH A . 
KB 3 HOH 438 1038 1038 HOH HOH A . 
KB 3 HOH 439 1039 1039 HOH HOH A . 
KB 3 HOH 440 1040 1040 HOH HOH A . 
KB 3 HOH 441 1041 1041 HOH HOH A . 
KB 3 HOH 442 1042 1042 HOH HOH A . 
KB 3 HOH 443 1043 1043 HOH HOH A . 
KB 3 HOH 444 1044 1044 HOH HOH A . 
KB 3 HOH 445 1045 1045 HOH HOH A . 
KB 3 HOH 446 1046 1046 HOH HOH A . 
KB 3 HOH 447 1047 1047 HOH HOH A . 
KB 3 HOH 448 1048 1048 HOH HOH A . 
KB 3 HOH 449 1049 1049 HOH HOH A . 
KB 3 HOH 450 1050 1050 HOH HOH A . 
KB 3 HOH 451 1051 1051 HOH HOH A . 
KB 3 HOH 452 1052 1052 HOH HOH A . 
KB 3 HOH 453 1053 1053 HOH HOH A . 
KB 3 HOH 454 1054 1054 HOH HOH A . 
KB 3 HOH 455 1055 1055 HOH HOH A . 
KB 3 HOH 456 1056 1056 HOH HOH A . 
KB 3 HOH 457 1057 1057 HOH HOH A . 
KB 3 HOH 458 1058 1058 HOH HOH A . 
KB 3 HOH 459 1059 1059 HOH HOH A . 
KB 3 HOH 460 1060 1060 HOH HOH A . 
KB 3 HOH 461 1061 1061 HOH HOH A . 
KB 3 HOH 462 1062 1062 HOH HOH A . 
KB 3 HOH 463 1063 1063 HOH HOH A . 
KB 3 HOH 464 1064 1064 HOH HOH A . 
KB 3 HOH 465 1065 1065 HOH HOH A . 
KB 3 HOH 466 1066 1066 HOH HOH A . 
KB 3 HOH 467 1067 1067 HOH HOH A . 
KB 3 HOH 468 1068 1068 HOH HOH A . 
KB 3 HOH 469 1069 1069 HOH HOH A . 
KB 3 HOH 470 1070 1070 HOH HOH A . 
KB 3 HOH 471 1071 1071 HOH HOH A . 
KB 3 HOH 472 1072 1072 HOH HOH A . 
KB 3 HOH 473 1073 1073 HOH HOH A . 
KB 3 HOH 474 1074 1074 HOH HOH A . 
KB 3 HOH 475 1075 1075 HOH HOH A . 
KB 3 HOH 476 1076 1076 HOH HOH A . 
KB 3 HOH 477 1077 1077 HOH HOH A . 
KB 3 HOH 478 1078 1078 HOH HOH A . 
KB 3 HOH 479 1079 1079 HOH HOH A . 
KB 3 HOH 480 1080 1080 HOH HOH A . 
KB 3 HOH 481 1081 1081 HOH HOH A . 
KB 3 HOH 482 1082 1082 HOH HOH A . 
KB 3 HOH 483 1083 1083 HOH HOH A . 
KB 3 HOH 484 1084 1084 HOH HOH A . 
KB 3 HOH 485 1085 1085 HOH HOH A . 
KB 3 HOH 486 1086 1086 HOH HOH A . 
KB 3 HOH 487 1087 1087 HOH HOH A . 
KB 3 HOH 488 1088 1088 HOH HOH A . 
KB 3 HOH 489 1089 1089 HOH HOH A . 
KB 3 HOH 490 1090 1090 HOH HOH A . 
KB 3 HOH 491 1091 1091 HOH HOH A . 
KB 3 HOH 492 1092 1092 HOH HOH A . 
KB 3 HOH 493 1093 1093 HOH HOH A . 
KB 3 HOH 494 1094 1094 HOH HOH A . 
KB 3 HOH 495 1095 1095 HOH HOH A . 
KB 3 HOH 496 1096 1096 HOH HOH A . 
KB 3 HOH 497 1097 1097 HOH HOH A . 
KB 3 HOH 498 1098 1098 HOH HOH A . 
KB 3 HOH 499 1099 1099 HOH HOH A . 
KB 3 HOH 500 1100 1100 HOH HOH A . 
KB 3 HOH 501 1101 1101 HOH HOH A . 
KB 3 HOH 502 1102 1102 HOH HOH A . 
KB 3 HOH 503 1103 1103 HOH HOH A . 
KB 3 HOH 504 1104 1104 HOH HOH A . 
KB 3 HOH 505 1105 1105 HOH HOH A . 
KB 3 HOH 506 1106 1106 HOH HOH A . 
KB 3 HOH 507 1107 1107 HOH HOH A . 
KB 3 HOH 508 1108 1108 HOH HOH A . 
KB 3 HOH 509 1109 1109 HOH HOH A . 
KB 3 HOH 510 1110 1110 HOH HOH A . 
KB 3 HOH 511 1111 1111 HOH HOH A . 
KB 3 HOH 512 1112 1112 HOH HOH A . 
KB 3 HOH 513 1113 1113 HOH HOH A . 
KB 3 HOH 514 1114 1114 HOH HOH A . 
LB 3 HOH 1   601  601  HOH HOH B . 
LB 3 HOH 2   602  602  HOH HOH B . 
LB 3 HOH 3   603  603  HOH HOH B . 
LB 3 HOH 4   604  604  HOH HOH B . 
LB 3 HOH 5   605  605  HOH HOH B . 
LB 3 HOH 6   606  606  HOH HOH B . 
LB 3 HOH 7   607  607  HOH HOH B . 
LB 3 HOH 8   608  608  HOH HOH B . 
LB 3 HOH 9   609  609  HOH HOH B . 
LB 3 HOH 10  610  610  HOH HOH B . 
LB 3 HOH 11  611  611  HOH HOH B . 
LB 3 HOH 12  612  612  HOH HOH B . 
LB 3 HOH 13  613  613  HOH HOH B . 
LB 3 HOH 14  614  614  HOH HOH B . 
LB 3 HOH 15  615  615  HOH HOH B . 
LB 3 HOH 16  616  616  HOH HOH B . 
LB 3 HOH 17  617  617  HOH HOH B . 
LB 3 HOH 18  618  618  HOH HOH B . 
LB 3 HOH 19  619  619  HOH HOH B . 
LB 3 HOH 20  620  620  HOH HOH B . 
LB 3 HOH 21  621  621  HOH HOH B . 
LB 3 HOH 22  622  622  HOH HOH B . 
LB 3 HOH 23  623  623  HOH HOH B . 
LB 3 HOH 24  624  624  HOH HOH B . 
LB 3 HOH 25  625  625  HOH HOH B . 
LB 3 HOH 26  626  626  HOH HOH B . 
LB 3 HOH 27  627  627  HOH HOH B . 
LB 3 HOH 28  628  628  HOH HOH B . 
LB 3 HOH 29  629  629  HOH HOH B . 
LB 3 HOH 30  630  630  HOH HOH B . 
LB 3 HOH 31  631  631  HOH HOH B . 
LB 3 HOH 32  632  632  HOH HOH B . 
LB 3 HOH 33  633  633  HOH HOH B . 
LB 3 HOH 34  634  634  HOH HOH B . 
LB 3 HOH 35  635  635  HOH HOH B . 
LB 3 HOH 36  636  636  HOH HOH B . 
LB 3 HOH 37  637  637  HOH HOH B . 
LB 3 HOH 38  638  638  HOH HOH B . 
LB 3 HOH 39  639  639  HOH HOH B . 
LB 3 HOH 40  640  640  HOH HOH B . 
LB 3 HOH 41  641  641  HOH HOH B . 
LB 3 HOH 42  642  642  HOH HOH B . 
LB 3 HOH 43  643  643  HOH HOH B . 
LB 3 HOH 44  644  644  HOH HOH B . 
LB 3 HOH 45  645  645  HOH HOH B . 
LB 3 HOH 46  646  646  HOH HOH B . 
LB 3 HOH 47  647  647  HOH HOH B . 
LB 3 HOH 48  648  648  HOH HOH B . 
LB 3 HOH 49  649  649  HOH HOH B . 
LB 3 HOH 50  650  650  HOH HOH B . 
LB 3 HOH 51  651  651  HOH HOH B . 
LB 3 HOH 52  652  652  HOH HOH B . 
LB 3 HOH 53  653  653  HOH HOH B . 
LB 3 HOH 54  654  654  HOH HOH B . 
LB 3 HOH 55  655  655  HOH HOH B . 
LB 3 HOH 56  656  656  HOH HOH B . 
LB 3 HOH 57  657  657  HOH HOH B . 
LB 3 HOH 58  658  658  HOH HOH B . 
LB 3 HOH 59  659  659  HOH HOH B . 
LB 3 HOH 60  660  660  HOH HOH B . 
LB 3 HOH 61  661  661  HOH HOH B . 
LB 3 HOH 62  662  662  HOH HOH B . 
LB 3 HOH 63  663  663  HOH HOH B . 
LB 3 HOH 64  664  664  HOH HOH B . 
LB 3 HOH 65  665  665  HOH HOH B . 
LB 3 HOH 66  666  666  HOH HOH B . 
LB 3 HOH 67  667  667  HOH HOH B . 
LB 3 HOH 68  668  668  HOH HOH B . 
LB 3 HOH 69  669  669  HOH HOH B . 
LB 3 HOH 70  670  670  HOH HOH B . 
LB 3 HOH 71  671  671  HOH HOH B . 
LB 3 HOH 72  672  672  HOH HOH B . 
LB 3 HOH 73  673  673  HOH HOH B . 
LB 3 HOH 74  674  674  HOH HOH B . 
LB 3 HOH 75  675  675  HOH HOH B . 
LB 3 HOH 76  676  676  HOH HOH B . 
LB 3 HOH 77  677  677  HOH HOH B . 
LB 3 HOH 78  678  678  HOH HOH B . 
LB 3 HOH 79  679  679  HOH HOH B . 
LB 3 HOH 80  680  680  HOH HOH B . 
LB 3 HOH 81  681  681  HOH HOH B . 
LB 3 HOH 82  682  682  HOH HOH B . 
LB 3 HOH 83  683  683  HOH HOH B . 
LB 3 HOH 84  684  684  HOH HOH B . 
LB 3 HOH 85  685  685  HOH HOH B . 
LB 3 HOH 86  686  686  HOH HOH B . 
LB 3 HOH 87  687  687  HOH HOH B . 
LB 3 HOH 88  688  688  HOH HOH B . 
LB 3 HOH 89  689  689  HOH HOH B . 
LB 3 HOH 90  690  690  HOH HOH B . 
LB 3 HOH 91  691  691  HOH HOH B . 
LB 3 HOH 92  692  692  HOH HOH B . 
LB 3 HOH 93  693  693  HOH HOH B . 
LB 3 HOH 94  694  694  HOH HOH B . 
LB 3 HOH 95  695  695  HOH HOH B . 
LB 3 HOH 96  696  696  HOH HOH B . 
LB 3 HOH 97  697  697  HOH HOH B . 
LB 3 HOH 98  698  698  HOH HOH B . 
LB 3 HOH 99  699  699  HOH HOH B . 
LB 3 HOH 100 700  700  HOH HOH B . 
LB 3 HOH 101 701  701  HOH HOH B . 
LB 3 HOH 102 702  702  HOH HOH B . 
LB 3 HOH 103 703  703  HOH HOH B . 
LB 3 HOH 104 704  704  HOH HOH B . 
LB 3 HOH 105 705  705  HOH HOH B . 
LB 3 HOH 106 706  706  HOH HOH B . 
LB 3 HOH 107 707  707  HOH HOH B . 
LB 3 HOH 108 708  708  HOH HOH B . 
LB 3 HOH 109 709  709  HOH HOH B . 
LB 3 HOH 110 710  710  HOH HOH B . 
LB 3 HOH 111 711  711  HOH HOH B . 
LB 3 HOH 112 712  712  HOH HOH B . 
LB 3 HOH 113 713  713  HOH HOH B . 
LB 3 HOH 114 714  714  HOH HOH B . 
LB 3 HOH 115 715  715  HOH HOH B . 
LB 3 HOH 116 716  716  HOH HOH B . 
LB 3 HOH 117 717  717  HOH HOH B . 
LB 3 HOH 118 718  718  HOH HOH B . 
LB 3 HOH 119 719  719  HOH HOH B . 
LB 3 HOH 120 720  720  HOH HOH B . 
LB 3 HOH 121 721  721  HOH HOH B . 
LB 3 HOH 122 722  722  HOH HOH B . 
LB 3 HOH 123 723  723  HOH HOH B . 
LB 3 HOH 124 724  724  HOH HOH B . 
LB 3 HOH 125 725  725  HOH HOH B . 
LB 3 HOH 126 726  726  HOH HOH B . 
LB 3 HOH 127 727  727  HOH HOH B . 
LB 3 HOH 128 728  728  HOH HOH B . 
LB 3 HOH 129 729  729  HOH HOH B . 
LB 3 HOH 130 730  730  HOH HOH B . 
LB 3 HOH 131 731  731  HOH HOH B . 
LB 3 HOH 132 732  732  HOH HOH B . 
LB 3 HOH 133 733  733  HOH HOH B . 
LB 3 HOH 134 734  734  HOH HOH B . 
LB 3 HOH 135 735  735  HOH HOH B . 
LB 3 HOH 136 736  736  HOH HOH B . 
LB 3 HOH 137 737  737  HOH HOH B . 
LB 3 HOH 138 738  738  HOH HOH B . 
LB 3 HOH 139 739  739  HOH HOH B . 
LB 3 HOH 140 740  740  HOH HOH B . 
LB 3 HOH 141 741  741  HOH HOH B . 
LB 3 HOH 142 742  742  HOH HOH B . 
LB 3 HOH 143 743  743  HOH HOH B . 
LB 3 HOH 144 744  744  HOH HOH B . 
LB 3 HOH 145 745  745  HOH HOH B . 
LB 3 HOH 146 746  746  HOH HOH B . 
LB 3 HOH 147 747  747  HOH HOH B . 
LB 3 HOH 148 748  748  HOH HOH B . 
LB 3 HOH 149 749  749  HOH HOH B . 
LB 3 HOH 150 750  750  HOH HOH B . 
LB 3 HOH 151 751  751  HOH HOH B . 
LB 3 HOH 152 752  752  HOH HOH B . 
LB 3 HOH 153 753  753  HOH HOH B . 
LB 3 HOH 154 754  754  HOH HOH B . 
LB 3 HOH 155 755  755  HOH HOH B . 
LB 3 HOH 156 756  756  HOH HOH B . 
LB 3 HOH 157 757  757  HOH HOH B . 
LB 3 HOH 158 758  758  HOH HOH B . 
LB 3 HOH 159 759  759  HOH HOH B . 
LB 3 HOH 160 760  760  HOH HOH B . 
LB 3 HOH 161 761  761  HOH HOH B . 
LB 3 HOH 162 762  762  HOH HOH B . 
LB 3 HOH 163 763  763  HOH HOH B . 
LB 3 HOH 164 764  764  HOH HOH B . 
LB 3 HOH 165 765  765  HOH HOH B . 
LB 3 HOH 166 766  766  HOH HOH B . 
LB 3 HOH 167 767  767  HOH HOH B . 
LB 3 HOH 168 768  768  HOH HOH B . 
LB 3 HOH 169 769  769  HOH HOH B . 
LB 3 HOH 170 770  770  HOH HOH B . 
LB 3 HOH 171 771  771  HOH HOH B . 
LB 3 HOH 172 772  772  HOH HOH B . 
LB 3 HOH 173 773  773  HOH HOH B . 
LB 3 HOH 174 774  774  HOH HOH B . 
LB 3 HOH 175 775  775  HOH HOH B . 
LB 3 HOH 176 776  776  HOH HOH B . 
LB 3 HOH 177 777  777  HOH HOH B . 
LB 3 HOH 178 778  778  HOH HOH B . 
LB 3 HOH 179 779  779  HOH HOH B . 
LB 3 HOH 180 780  780  HOH HOH B . 
LB 3 HOH 181 781  781  HOH HOH B . 
LB 3 HOH 182 782  782  HOH HOH B . 
LB 3 HOH 183 783  783  HOH HOH B . 
LB 3 HOH 184 784  784  HOH HOH B . 
LB 3 HOH 185 785  785  HOH HOH B . 
LB 3 HOH 186 786  786  HOH HOH B . 
LB 3 HOH 187 787  787  HOH HOH B . 
LB 3 HOH 188 788  788  HOH HOH B . 
LB 3 HOH 189 789  789  HOH HOH B . 
LB 3 HOH 190 790  790  HOH HOH B . 
LB 3 HOH 191 791  791  HOH HOH B . 
LB 3 HOH 192 792  792  HOH HOH B . 
LB 3 HOH 193 793  793  HOH HOH B . 
LB 3 HOH 194 794  794  HOH HOH B . 
LB 3 HOH 195 795  795  HOH HOH B . 
LB 3 HOH 196 796  796  HOH HOH B . 
LB 3 HOH 197 797  797  HOH HOH B . 
LB 3 HOH 198 798  798  HOH HOH B . 
LB 3 HOH 199 799  799  HOH HOH B . 
LB 3 HOH 200 800  800  HOH HOH B . 
LB 3 HOH 201 801  801  HOH HOH B . 
LB 3 HOH 202 802  802  HOH HOH B . 
LB 3 HOH 203 803  803  HOH HOH B . 
LB 3 HOH 204 804  804  HOH HOH B . 
LB 3 HOH 205 805  805  HOH HOH B . 
LB 3 HOH 206 806  806  HOH HOH B . 
LB 3 HOH 207 807  807  HOH HOH B . 
LB 3 HOH 208 808  808  HOH HOH B . 
LB 3 HOH 209 809  809  HOH HOH B . 
LB 3 HOH 210 810  810  HOH HOH B . 
LB 3 HOH 211 811  811  HOH HOH B . 
LB 3 HOH 212 812  812  HOH HOH B . 
LB 3 HOH 213 813  813  HOH HOH B . 
LB 3 HOH 214 814  814  HOH HOH B . 
LB 3 HOH 215 815  815  HOH HOH B . 
LB 3 HOH 216 816  816  HOH HOH B . 
LB 3 HOH 217 817  817  HOH HOH B . 
LB 3 HOH 218 818  818  HOH HOH B . 
LB 3 HOH 219 819  819  HOH HOH B . 
LB 3 HOH 220 820  820  HOH HOH B . 
LB 3 HOH 221 821  821  HOH HOH B . 
LB 3 HOH 222 822  822  HOH HOH B . 
LB 3 HOH 223 823  823  HOH HOH B . 
LB 3 HOH 224 824  824  HOH HOH B . 
LB 3 HOH 225 825  825  HOH HOH B . 
LB 3 HOH 226 826  826  HOH HOH B . 
LB 3 HOH 227 827  827  HOH HOH B . 
LB 3 HOH 228 828  828  HOH HOH B . 
LB 3 HOH 229 829  829  HOH HOH B . 
LB 3 HOH 230 830  830  HOH HOH B . 
LB 3 HOH 231 831  831  HOH HOH B . 
LB 3 HOH 232 832  832  HOH HOH B . 
LB 3 HOH 233 833  833  HOH HOH B . 
LB 3 HOH 234 834  834  HOH HOH B . 
LB 3 HOH 235 835  835  HOH HOH B . 
LB 3 HOH 236 836  836  HOH HOH B . 
LB 3 HOH 237 837  837  HOH HOH B . 
LB 3 HOH 238 838  838  HOH HOH B . 
LB 3 HOH 239 839  839  HOH HOH B . 
LB 3 HOH 240 840  840  HOH HOH B . 
LB 3 HOH 241 841  841  HOH HOH B . 
LB 3 HOH 242 842  842  HOH HOH B . 
LB 3 HOH 243 843  843  HOH HOH B . 
LB 3 HOH 244 844  844  HOH HOH B . 
LB 3 HOH 245 845  845  HOH HOH B . 
LB 3 HOH 246 846  846  HOH HOH B . 
LB 3 HOH 247 847  847  HOH HOH B . 
LB 3 HOH 248 848  848  HOH HOH B . 
LB 3 HOH 249 849  849  HOH HOH B . 
LB 3 HOH 250 850  850  HOH HOH B . 
LB 3 HOH 251 851  851  HOH HOH B . 
LB 3 HOH 252 852  852  HOH HOH B . 
LB 3 HOH 253 853  853  HOH HOH B . 
LB 3 HOH 254 854  854  HOH HOH B . 
LB 3 HOH 255 855  855  HOH HOH B . 
LB 3 HOH 256 856  856  HOH HOH B . 
LB 3 HOH 257 857  857  HOH HOH B . 
LB 3 HOH 258 858  858  HOH HOH B . 
LB 3 HOH 259 859  859  HOH HOH B . 
LB 3 HOH 260 860  860  HOH HOH B . 
LB 3 HOH 261 861  861  HOH HOH B . 
LB 3 HOH 262 862  862  HOH HOH B . 
LB 3 HOH 263 863  863  HOH HOH B . 
LB 3 HOH 264 864  864  HOH HOH B . 
LB 3 HOH 265 865  865  HOH HOH B . 
LB 3 HOH 266 866  866  HOH HOH B . 
LB 3 HOH 267 867  867  HOH HOH B . 
LB 3 HOH 268 868  868  HOH HOH B . 
LB 3 HOH 269 869  869  HOH HOH B . 
LB 3 HOH 270 870  870  HOH HOH B . 
LB 3 HOH 271 871  871  HOH HOH B . 
LB 3 HOH 272 872  872  HOH HOH B . 
LB 3 HOH 273 873  873  HOH HOH B . 
LB 3 HOH 274 874  874  HOH HOH B . 
LB 3 HOH 275 875  875  HOH HOH B . 
LB 3 HOH 276 876  876  HOH HOH B . 
LB 3 HOH 277 877  877  HOH HOH B . 
LB 3 HOH 278 878  878  HOH HOH B . 
LB 3 HOH 279 879  879  HOH HOH B . 
LB 3 HOH 280 880  880  HOH HOH B . 
LB 3 HOH 281 881  881  HOH HOH B . 
LB 3 HOH 282 882  882  HOH HOH B . 
LB 3 HOH 283 883  883  HOH HOH B . 
LB 3 HOH 284 884  884  HOH HOH B . 
LB 3 HOH 285 885  885  HOH HOH B . 
LB 3 HOH 286 886  886  HOH HOH B . 
LB 3 HOH 287 887  887  HOH HOH B . 
LB 3 HOH 288 888  888  HOH HOH B . 
LB 3 HOH 289 889  889  HOH HOH B . 
LB 3 HOH 290 890  890  HOH HOH B . 
LB 3 HOH 291 891  891  HOH HOH B . 
LB 3 HOH 292 892  892  HOH HOH B . 
LB 3 HOH 293 893  893  HOH HOH B . 
LB 3 HOH 294 894  894  HOH HOH B . 
LB 3 HOH 295 895  895  HOH HOH B . 
LB 3 HOH 296 896  896  HOH HOH B . 
LB 3 HOH 297 897  897  HOH HOH B . 
LB 3 HOH 298 898  898  HOH HOH B . 
LB 3 HOH 299 899  899  HOH HOH B . 
LB 3 HOH 300 900  900  HOH HOH B . 
LB 3 HOH 301 901  901  HOH HOH B . 
LB 3 HOH 302 902  902  HOH HOH B . 
LB 3 HOH 303 903  903  HOH HOH B . 
LB 3 HOH 304 904  904  HOH HOH B . 
LB 3 HOH 305 905  905  HOH HOH B . 
LB 3 HOH 306 906  906  HOH HOH B . 
LB 3 HOH 307 907  907  HOH HOH B . 
LB 3 HOH 308 908  908  HOH HOH B . 
LB 3 HOH 309 909  909  HOH HOH B . 
LB 3 HOH 310 910  910  HOH HOH B . 
LB 3 HOH 311 911  911  HOH HOH B . 
LB 3 HOH 312 912  912  HOH HOH B . 
LB 3 HOH 313 913  913  HOH HOH B . 
LB 3 HOH 314 914  914  HOH HOH B . 
LB 3 HOH 315 915  915  HOH HOH B . 
LB 3 HOH 316 916  916  HOH HOH B . 
LB 3 HOH 317 917  917  HOH HOH B . 
LB 3 HOH 318 918  918  HOH HOH B . 
LB 3 HOH 319 919  919  HOH HOH B . 
LB 3 HOH 320 920  920  HOH HOH B . 
LB 3 HOH 321 921  921  HOH HOH B . 
LB 3 HOH 322 922  922  HOH HOH B . 
LB 3 HOH 323 923  923  HOH HOH B . 
LB 3 HOH 324 924  924  HOH HOH B . 
LB 3 HOH 325 925  925  HOH HOH B . 
LB 3 HOH 326 926  926  HOH HOH B . 
LB 3 HOH 327 927  927  HOH HOH B . 
LB 3 HOH 328 928  928  HOH HOH B . 
LB 3 HOH 329 929  929  HOH HOH B . 
LB 3 HOH 330 930  930  HOH HOH B . 
LB 3 HOH 331 931  931  HOH HOH B . 
LB 3 HOH 332 932  932  HOH HOH B . 
LB 3 HOH 333 933  933  HOH HOH B . 
LB 3 HOH 334 934  934  HOH HOH B . 
LB 3 HOH 335 935  935  HOH HOH B . 
LB 3 HOH 336 936  936  HOH HOH B . 
LB 3 HOH 337 937  937  HOH HOH B . 
LB 3 HOH 338 938  938  HOH HOH B . 
LB 3 HOH 339 939  939  HOH HOH B . 
LB 3 HOH 340 940  940  HOH HOH B . 
LB 3 HOH 341 941  941  HOH HOH B . 
LB 3 HOH 342 942  942  HOH HOH B . 
LB 3 HOH 343 943  943  HOH HOH B . 
LB 3 HOH 344 944  944  HOH HOH B . 
LB 3 HOH 345 945  945  HOH HOH B . 
LB 3 HOH 346 946  946  HOH HOH B . 
LB 3 HOH 347 947  947  HOH HOH B . 
LB 3 HOH 348 948  948  HOH HOH B . 
LB 3 HOH 349 949  949  HOH HOH B . 
LB 3 HOH 350 950  950  HOH HOH B . 
LB 3 HOH 351 951  951  HOH HOH B . 
LB 3 HOH 352 952  952  HOH HOH B . 
LB 3 HOH 353 953  953  HOH HOH B . 
LB 3 HOH 354 954  954  HOH HOH B . 
LB 3 HOH 355 955  955  HOH HOH B . 
LB 3 HOH 356 956  956  HOH HOH B . 
LB 3 HOH 357 957  957  HOH HOH B . 
LB 3 HOH 358 958  958  HOH HOH B . 
LB 3 HOH 359 959  959  HOH HOH B . 
LB 3 HOH 360 960  960  HOH HOH B . 
LB 3 HOH 361 961  961  HOH HOH B . 
LB 3 HOH 362 962  962  HOH HOH B . 
LB 3 HOH 363 963  963  HOH HOH B . 
LB 3 HOH 364 964  964  HOH HOH B . 
LB 3 HOH 365 965  965  HOH HOH B . 
LB 3 HOH 366 966  966  HOH HOH B . 
LB 3 HOH 367 967  967  HOH HOH B . 
LB 3 HOH 368 968  968  HOH HOH B . 
LB 3 HOH 369 969  969  HOH HOH B . 
LB 3 HOH 370 970  970  HOH HOH B . 
LB 3 HOH 371 971  971  HOH HOH B . 
LB 3 HOH 372 972  972  HOH HOH B . 
LB 3 HOH 373 973  973  HOH HOH B . 
LB 3 HOH 374 974  974  HOH HOH B . 
LB 3 HOH 375 975  975  HOH HOH B . 
LB 3 HOH 376 976  976  HOH HOH B . 
LB 3 HOH 377 977  977  HOH HOH B . 
LB 3 HOH 378 978  978  HOH HOH B . 
LB 3 HOH 379 979  979  HOH HOH B . 
LB 3 HOH 380 980  980  HOH HOH B . 
LB 3 HOH 381 981  981  HOH HOH B . 
LB 3 HOH 382 982  982  HOH HOH B . 
LB 3 HOH 383 983  983  HOH HOH B . 
LB 3 HOH 384 984  984  HOH HOH B . 
LB 3 HOH 385 985  985  HOH HOH B . 
LB 3 HOH 386 986  986  HOH HOH B . 
LB 3 HOH 387 987  987  HOH HOH B . 
LB 3 HOH 388 988  988  HOH HOH B . 
LB 3 HOH 389 989  989  HOH HOH B . 
LB 3 HOH 390 990  990  HOH HOH B . 
LB 3 HOH 391 991  991  HOH HOH B . 
LB 3 HOH 392 992  992  HOH HOH B . 
LB 3 HOH 393 993  993  HOH HOH B . 
LB 3 HOH 394 994  994  HOH HOH B . 
LB 3 HOH 395 995  995  HOH HOH B . 
LB 3 HOH 396 996  996  HOH HOH B . 
LB 3 HOH 397 997  997  HOH HOH B . 
LB 3 HOH 398 998  998  HOH HOH B . 
LB 3 HOH 399 999  999  HOH HOH B . 
LB 3 HOH 400 1000 1000 HOH HOH B . 
LB 3 HOH 401 1001 1001 HOH HOH B . 
LB 3 HOH 402 1002 1002 HOH HOH B . 
LB 3 HOH 403 1003 1003 HOH HOH B . 
LB 3 HOH 404 1004 1004 HOH HOH B . 
LB 3 HOH 405 1005 1005 HOH HOH B . 
LB 3 HOH 406 1006 1006 HOH HOH B . 
LB 3 HOH 407 1007 1007 HOH HOH B . 
LB 3 HOH 408 1008 1008 HOH HOH B . 
LB 3 HOH 409 1009 1009 HOH HOH B . 
LB 3 HOH 410 1010 1010 HOH HOH B . 
LB 3 HOH 411 1011 1011 HOH HOH B . 
LB 3 HOH 412 1012 1012 HOH HOH B . 
LB 3 HOH 413 1013 1013 HOH HOH B . 
LB 3 HOH 414 1014 1014 HOH HOH B . 
LB 3 HOH 415 1015 1015 HOH HOH B . 
LB 3 HOH 416 1016 1016 HOH HOH B . 
LB 3 HOH 417 1017 1017 HOH HOH B . 
LB 3 HOH 418 1018 1018 HOH HOH B . 
LB 3 HOH 419 1019 1019 HOH HOH B . 
LB 3 HOH 420 1020 1020 HOH HOH B . 
LB 3 HOH 421 1021 1021 HOH HOH B . 
LB 3 HOH 422 1022 1022 HOH HOH B . 
LB 3 HOH 423 1023 1023 HOH HOH B . 
LB 3 HOH 424 1024 1024 HOH HOH B . 
LB 3 HOH 425 1025 1025 HOH HOH B . 
LB 3 HOH 426 1026 1026 HOH HOH B . 
LB 3 HOH 427 1027 1027 HOH HOH B . 
LB 3 HOH 428 1028 1028 HOH HOH B . 
LB 3 HOH 429 1029 1029 HOH HOH B . 
LB 3 HOH 430 1030 1030 HOH HOH B . 
LB 3 HOH 431 1031 1031 HOH HOH B . 
LB 3 HOH 432 1032 1032 HOH HOH B . 
LB 3 HOH 433 1033 1033 HOH HOH B . 
LB 3 HOH 434 1034 1034 HOH HOH B . 
LB 3 HOH 435 1035 1035 HOH HOH B . 
LB 3 HOH 436 1036 1036 HOH HOH B . 
LB 3 HOH 437 1037 1037 HOH HOH B . 
LB 3 HOH 438 1038 1038 HOH HOH B . 
LB 3 HOH 439 1039 1039 HOH HOH B . 
LB 3 HOH 440 1040 1040 HOH HOH B . 
LB 3 HOH 441 1041 1041 HOH HOH B . 
LB 3 HOH 442 1042 1042 HOH HOH B . 
LB 3 HOH 443 1043 1043 HOH HOH B . 
LB 3 HOH 444 1044 1044 HOH HOH B . 
LB 3 HOH 445 1045 1045 HOH HOH B . 
LB 3 HOH 446 1046 1046 HOH HOH B . 
LB 3 HOH 447 1047 1047 HOH HOH B . 
LB 3 HOH 448 1048 1048 HOH HOH B . 
LB 3 HOH 449 1049 1049 HOH HOH B . 
LB 3 HOH 450 1050 1050 HOH HOH B . 
LB 3 HOH 451 1051 1051 HOH HOH B . 
LB 3 HOH 452 1052 1052 HOH HOH B . 
LB 3 HOH 453 1053 1053 HOH HOH B . 
LB 3 HOH 454 1054 1054 HOH HOH B . 
LB 3 HOH 455 1055 1055 HOH HOH B . 
LB 3 HOH 456 1056 1056 HOH HOH B . 
LB 3 HOH 457 1057 1057 HOH HOH B . 
LB 3 HOH 458 1058 1058 HOH HOH B . 
LB 3 HOH 459 1059 1059 HOH HOH B . 
LB 3 HOH 460 1060 1060 HOH HOH B . 
LB 3 HOH 461 1061 1061 HOH HOH B . 
LB 3 HOH 462 1062 1063 HOH HOH B . 
LB 3 HOH 463 1063 1064 HOH HOH B . 
LB 3 HOH 464 1064 1065 HOH HOH B . 
LB 3 HOH 465 1065 1066 HOH HOH B . 
LB 3 HOH 466 1066 1067 HOH HOH B . 
LB 3 HOH 467 1067 1068 HOH HOH B . 
LB 3 HOH 468 1068 1069 HOH HOH B . 
LB 3 HOH 469 1069 1070 HOH HOH B . 
LB 3 HOH 470 1070 1071 HOH HOH B . 
LB 3 HOH 471 1071 1072 HOH HOH B . 
LB 3 HOH 472 1072 1073 HOH HOH B . 
LB 3 HOH 473 1073 1074 HOH HOH B . 
LB 3 HOH 474 1074 1075 HOH HOH B . 
LB 3 HOH 475 1075 1076 HOH HOH B . 
LB 3 HOH 476 1076 1077 HOH HOH B . 
LB 3 HOH 477 1077 1078 HOH HOH B . 
LB 3 HOH 478 1078 1079 HOH HOH B . 
LB 3 HOH 479 1079 1080 HOH HOH B . 
LB 3 HOH 480 1080 1081 HOH HOH B . 
LB 3 HOH 481 1081 1082 HOH HOH B . 
LB 3 HOH 482 1082 1083 HOH HOH B . 
LB 3 HOH 483 1083 1084 HOH HOH B . 
LB 3 HOH 484 1084 1085 HOH HOH B . 
LB 3 HOH 485 1085 1087 HOH HOH B . 
LB 3 HOH 486 1086 1089 HOH HOH B . 
LB 3 HOH 487 1087 1090 HOH HOH B . 
LB 3 HOH 488 1088 1091 HOH HOH B . 
LB 3 HOH 489 1089 1092 HOH HOH B . 
LB 3 HOH 490 1090 1093 HOH HOH B . 
LB 3 HOH 491 1091 1094 HOH HOH B . 
LB 3 HOH 492 1092 1095 HOH HOH B . 
LB 3 HOH 493 1093 1096 HOH HOH B . 
LB 3 HOH 494 1094 1097 HOH HOH B . 
LB 3 HOH 495 1095 1086 HOH HOH B . 
LB 3 HOH 496 1096 1098 HOH HOH B . 
LB 3 HOH 497 1097 1099 HOH HOH B . 
LB 3 HOH 498 1098 1100 HOH HOH B . 
LB 3 HOH 499 1099 1101 HOH HOH B . 
LB 3 HOH 500 1100 1102 HOH HOH B . 
LB 3 HOH 501 1101 1103 HOH HOH B . 
LB 3 HOH 502 1102 1104 HOH HOH B . 
LB 3 HOH 503 1103 1105 HOH HOH B . 
LB 3 HOH 504 1104 1106 HOH HOH B . 
LB 3 HOH 505 1105 1107 HOH HOH B . 
LB 3 HOH 506 1106 1108 HOH HOH B . 
LB 3 HOH 507 1107 1088 HOH HOH B . 
LB 3 HOH 508 1108 1109 HOH HOH B . 
LB 3 HOH 509 1109 1110 HOH HOH B . 
LB 3 HOH 510 1110 1111 HOH HOH B . 
LB 3 HOH 511 1111 1112 HOH HOH B . 
LB 3 HOH 512 1112 1113 HOH HOH B . 
LB 3 HOH 513 1113 1114 HOH HOH B . 
LB 3 HOH 514 1114 1115 HOH HOH B . 
LB 3 HOH 515 1115 1116 HOH HOH B . 
LB 3 HOH 516 1116 1117 HOH HOH B . 
LB 3 HOH 517 1117 1118 HOH HOH B . 
LB 3 HOH 518 1118 1120 HOH HOH B . 
LB 3 HOH 519 1119 1121 HOH HOH B . 
LB 3 HOH 520 1120 1122 HOH HOH B . 
LB 3 HOH 521 1121 1123 HOH HOH B . 
LB 3 HOH 522 1122 1119 HOH HOH B . 
LB 3 HOH 523 1123 1124 HOH HOH B . 
LB 3 HOH 524 1124 1125 HOH HOH B . 
LB 3 HOH 525 1125 1062 HOH HOH B . 
LB 3 HOH 526 1126 1126 HOH HOH B . 
LB 3 HOH 527 1127 1127 HOH HOH B . 
LB 3 HOH 528 1128 1128 HOH HOH B . 
LB 3 HOH 529 1129 1129 HOH HOH B . 
LB 3 HOH 530 1130 1130 HOH HOH B . 
LB 3 HOH 531 1131 1131 HOH HOH B . 
MB 3 HOH 1   601  601  HOH HOH C . 
MB 3 HOH 2   602  602  HOH HOH C . 
MB 3 HOH 3   603  603  HOH HOH C . 
MB 3 HOH 4   604  605  HOH HOH C . 
MB 3 HOH 5   605  606  HOH HOH C . 
MB 3 HOH 6   606  607  HOH HOH C . 
MB 3 HOH 7   607  608  HOH HOH C . 
MB 3 HOH 8   608  609  HOH HOH C . 
MB 3 HOH 9   609  610  HOH HOH C . 
MB 3 HOH 10  610  611  HOH HOH C . 
MB 3 HOH 11  611  612  HOH HOH C . 
MB 3 HOH 12  612  613  HOH HOH C . 
MB 3 HOH 13  613  614  HOH HOH C . 
MB 3 HOH 14  614  615  HOH HOH C . 
MB 3 HOH 15  615  616  HOH HOH C . 
MB 3 HOH 16  616  617  HOH HOH C . 
MB 3 HOH 17  617  618  HOH HOH C . 
MB 3 HOH 18  618  619  HOH HOH C . 
MB 3 HOH 19  619  620  HOH HOH C . 
MB 3 HOH 20  620  621  HOH HOH C . 
MB 3 HOH 21  621  622  HOH HOH C . 
MB 3 HOH 22  622  623  HOH HOH C . 
MB 3 HOH 23  623  624  HOH HOH C . 
MB 3 HOH 24  624  625  HOH HOH C . 
MB 3 HOH 25  625  626  HOH HOH C . 
MB 3 HOH 26  626  627  HOH HOH C . 
MB 3 HOH 27  627  628  HOH HOH C . 
MB 3 HOH 28  628  629  HOH HOH C . 
MB 3 HOH 29  629  630  HOH HOH C . 
MB 3 HOH 30  630  631  HOH HOH C . 
MB 3 HOH 31  631  632  HOH HOH C . 
MB 3 HOH 32  632  633  HOH HOH C . 
MB 3 HOH 33  633  634  HOH HOH C . 
MB 3 HOH 34  634  635  HOH HOH C . 
MB 3 HOH 35  635  636  HOH HOH C . 
MB 3 HOH 36  636  637  HOH HOH C . 
MB 3 HOH 37  637  638  HOH HOH C . 
MB 3 HOH 38  638  639  HOH HOH C . 
MB 3 HOH 39  639  640  HOH HOH C . 
MB 3 HOH 40  640  641  HOH HOH C . 
MB 3 HOH 41  641  642  HOH HOH C . 
MB 3 HOH 42  642  643  HOH HOH C . 
MB 3 HOH 43  643  644  HOH HOH C . 
MB 3 HOH 44  644  645  HOH HOH C . 
MB 3 HOH 45  645  646  HOH HOH C . 
MB 3 HOH 46  646  647  HOH HOH C . 
MB 3 HOH 47  647  648  HOH HOH C . 
MB 3 HOH 48  648  649  HOH HOH C . 
MB 3 HOH 49  649  650  HOH HOH C . 
MB 3 HOH 50  650  651  HOH HOH C . 
MB 3 HOH 51  651  652  HOH HOH C . 
MB 3 HOH 52  652  653  HOH HOH C . 
MB 3 HOH 53  653  654  HOH HOH C . 
MB 3 HOH 54  654  655  HOH HOH C . 
MB 3 HOH 55  655  656  HOH HOH C . 
MB 3 HOH 56  656  657  HOH HOH C . 
MB 3 HOH 57  657  658  HOH HOH C . 
MB 3 HOH 58  658  659  HOH HOH C . 
MB 3 HOH 59  659  660  HOH HOH C . 
MB 3 HOH 60  660  661  HOH HOH C . 
MB 3 HOH 61  661  662  HOH HOH C . 
MB 3 HOH 62  662  663  HOH HOH C . 
MB 3 HOH 63  663  664  HOH HOH C . 
MB 3 HOH 64  664  665  HOH HOH C . 
MB 3 HOH 65  665  666  HOH HOH C . 
MB 3 HOH 66  666  667  HOH HOH C . 
MB 3 HOH 67  667  668  HOH HOH C . 
MB 3 HOH 68  668  669  HOH HOH C . 
MB 3 HOH 69  669  670  HOH HOH C . 
MB 3 HOH 70  670  671  HOH HOH C . 
MB 3 HOH 71  671  672  HOH HOH C . 
MB 3 HOH 72  672  673  HOH HOH C . 
MB 3 HOH 73  673  674  HOH HOH C . 
MB 3 HOH 74  674  675  HOH HOH C . 
MB 3 HOH 75  675  676  HOH HOH C . 
MB 3 HOH 76  676  677  HOH HOH C . 
MB 3 HOH 77  677  678  HOH HOH C . 
MB 3 HOH 78  678  679  HOH HOH C . 
MB 3 HOH 79  679  680  HOH HOH C . 
MB 3 HOH 80  680  681  HOH HOH C . 
MB 3 HOH 81  681  682  HOH HOH C . 
MB 3 HOH 82  682  683  HOH HOH C . 
MB 3 HOH 83  683  684  HOH HOH C . 
MB 3 HOH 84  684  685  HOH HOH C . 
MB 3 HOH 85  685  686  HOH HOH C . 
MB 3 HOH 86  686  687  HOH HOH C . 
MB 3 HOH 87  687  688  HOH HOH C . 
MB 3 HOH 88  688  689  HOH HOH C . 
MB 3 HOH 89  689  690  HOH HOH C . 
MB 3 HOH 90  690  691  HOH HOH C . 
MB 3 HOH 91  691  692  HOH HOH C . 
MB 3 HOH 92  692  693  HOH HOH C . 
MB 3 HOH 93  693  694  HOH HOH C . 
MB 3 HOH 94  694  695  HOH HOH C . 
MB 3 HOH 95  695  696  HOH HOH C . 
MB 3 HOH 96  696  697  HOH HOH C . 
MB 3 HOH 97  697  698  HOH HOH C . 
MB 3 HOH 98  698  699  HOH HOH C . 
MB 3 HOH 99  699  700  HOH HOH C . 
MB 3 HOH 100 700  701  HOH HOH C . 
MB 3 HOH 101 701  702  HOH HOH C . 
MB 3 HOH 102 702  703  HOH HOH C . 
MB 3 HOH 103 703  704  HOH HOH C . 
MB 3 HOH 104 704  705  HOH HOH C . 
MB 3 HOH 105 705  706  HOH HOH C . 
MB 3 HOH 106 706  707  HOH HOH C . 
MB 3 HOH 107 707  708  HOH HOH C . 
MB 3 HOH 108 708  709  HOH HOH C . 
MB 3 HOH 109 709  710  HOH HOH C . 
MB 3 HOH 110 710  711  HOH HOH C . 
MB 3 HOH 111 711  712  HOH HOH C . 
MB 3 HOH 112 712  713  HOH HOH C . 
MB 3 HOH 113 713  714  HOH HOH C . 
MB 3 HOH 114 714  715  HOH HOH C . 
MB 3 HOH 115 715  716  HOH HOH C . 
MB 3 HOH 116 716  717  HOH HOH C . 
MB 3 HOH 117 717  718  HOH HOH C . 
MB 3 HOH 118 718  719  HOH HOH C . 
MB 3 HOH 119 719  720  HOH HOH C . 
MB 3 HOH 120 720  721  HOH HOH C . 
MB 3 HOH 121 721  722  HOH HOH C . 
MB 3 HOH 122 722  723  HOH HOH C . 
MB 3 HOH 123 723  724  HOH HOH C . 
MB 3 HOH 124 724  725  HOH HOH C . 
MB 3 HOH 125 725  726  HOH HOH C . 
MB 3 HOH 126 726  727  HOH HOH C . 
MB 3 HOH 127 727  728  HOH HOH C . 
MB 3 HOH 128 728  729  HOH HOH C . 
MB 3 HOH 129 729  730  HOH HOH C . 
MB 3 HOH 130 730  731  HOH HOH C . 
MB 3 HOH 131 731  732  HOH HOH C . 
MB 3 HOH 132 732  733  HOH HOH C . 
MB 3 HOH 133 733  734  HOH HOH C . 
MB 3 HOH 134 734  735  HOH HOH C . 
MB 3 HOH 135 735  736  HOH HOH C . 
MB 3 HOH 136 736  737  HOH HOH C . 
MB 3 HOH 137 737  738  HOH HOH C . 
MB 3 HOH 138 738  739  HOH HOH C . 
MB 3 HOH 139 739  740  HOH HOH C . 
MB 3 HOH 140 740  741  HOH HOH C . 
MB 3 HOH 141 741  742  HOH HOH C . 
MB 3 HOH 142 742  743  HOH HOH C . 
MB 3 HOH 143 743  744  HOH HOH C . 
MB 3 HOH 144 744  745  HOH HOH C . 
MB 3 HOH 145 745  746  HOH HOH C . 
MB 3 HOH 146 746  747  HOH HOH C . 
MB 3 HOH 147 747  748  HOH HOH C . 
MB 3 HOH 148 748  749  HOH HOH C . 
MB 3 HOH 149 749  750  HOH HOH C . 
MB 3 HOH 150 750  751  HOH HOH C . 
MB 3 HOH 151 751  752  HOH HOH C . 
MB 3 HOH 152 752  753  HOH HOH C . 
MB 3 HOH 153 753  754  HOH HOH C . 
MB 3 HOH 154 754  755  HOH HOH C . 
MB 3 HOH 155 755  756  HOH HOH C . 
MB 3 HOH 156 756  757  HOH HOH C . 
MB 3 HOH 157 757  758  HOH HOH C . 
MB 3 HOH 158 758  759  HOH HOH C . 
MB 3 HOH 159 759  760  HOH HOH C . 
MB 3 HOH 160 760  761  HOH HOH C . 
MB 3 HOH 161 761  762  HOH HOH C . 
MB 3 HOH 162 762  763  HOH HOH C . 
MB 3 HOH 163 763  764  HOH HOH C . 
MB 3 HOH 164 764  765  HOH HOH C . 
MB 3 HOH 165 765  766  HOH HOH C . 
MB 3 HOH 166 766  767  HOH HOH C . 
MB 3 HOH 167 767  768  HOH HOH C . 
MB 3 HOH 168 768  769  HOH HOH C . 
MB 3 HOH 169 769  770  HOH HOH C . 
MB 3 HOH 170 770  771  HOH HOH C . 
MB 3 HOH 171 771  772  HOH HOH C . 
MB 3 HOH 172 772  773  HOH HOH C . 
MB 3 HOH 173 773  774  HOH HOH C . 
MB 3 HOH 174 774  775  HOH HOH C . 
MB 3 HOH 175 775  776  HOH HOH C . 
MB 3 HOH 176 776  777  HOH HOH C . 
MB 3 HOH 177 777  778  HOH HOH C . 
MB 3 HOH 178 778  779  HOH HOH C . 
MB 3 HOH 179 779  780  HOH HOH C . 
MB 3 HOH 180 780  781  HOH HOH C . 
MB 3 HOH 181 781  782  HOH HOH C . 
MB 3 HOH 182 782  783  HOH HOH C . 
MB 3 HOH 183 783  784  HOH HOH C . 
MB 3 HOH 184 784  785  HOH HOH C . 
MB 3 HOH 185 785  786  HOH HOH C . 
MB 3 HOH 186 786  787  HOH HOH C . 
MB 3 HOH 187 787  788  HOH HOH C . 
MB 3 HOH 188 788  789  HOH HOH C . 
MB 3 HOH 189 789  790  HOH HOH C . 
MB 3 HOH 190 790  791  HOH HOH C . 
MB 3 HOH 191 791  792  HOH HOH C . 
MB 3 HOH 192 792  793  HOH HOH C . 
MB 3 HOH 193 793  794  HOH HOH C . 
MB 3 HOH 194 794  795  HOH HOH C . 
MB 3 HOH 195 795  796  HOH HOH C . 
MB 3 HOH 196 796  797  HOH HOH C . 
MB 3 HOH 197 797  798  HOH HOH C . 
MB 3 HOH 198 798  799  HOH HOH C . 
MB 3 HOH 199 799  800  HOH HOH C . 
MB 3 HOH 200 800  801  HOH HOH C . 
MB 3 HOH 201 801  802  HOH HOH C . 
MB 3 HOH 202 802  803  HOH HOH C . 
MB 3 HOH 203 803  804  HOH HOH C . 
MB 3 HOH 204 804  805  HOH HOH C . 
MB 3 HOH 205 805  806  HOH HOH C . 
MB 3 HOH 206 806  807  HOH HOH C . 
MB 3 HOH 207 807  808  HOH HOH C . 
MB 3 HOH 208 808  809  HOH HOH C . 
MB 3 HOH 209 809  810  HOH HOH C . 
MB 3 HOH 210 810  811  HOH HOH C . 
MB 3 HOH 211 811  812  HOH HOH C . 
MB 3 HOH 212 812  813  HOH HOH C . 
MB 3 HOH 213 813  814  HOH HOH C . 
MB 3 HOH 214 814  815  HOH HOH C . 
MB 3 HOH 215 815  816  HOH HOH C . 
MB 3 HOH 216 816  817  HOH HOH C . 
MB 3 HOH 217 817  818  HOH HOH C . 
MB 3 HOH 218 818  819  HOH HOH C . 
MB 3 HOH 219 819  820  HOH HOH C . 
MB 3 HOH 220 820  821  HOH HOH C . 
MB 3 HOH 221 821  822  HOH HOH C . 
MB 3 HOH 222 822  823  HOH HOH C . 
MB 3 HOH 223 823  824  HOH HOH C . 
MB 3 HOH 224 824  825  HOH HOH C . 
MB 3 HOH 225 825  826  HOH HOH C . 
MB 3 HOH 226 826  827  HOH HOH C . 
MB 3 HOH 227 827  828  HOH HOH C . 
MB 3 HOH 228 828  829  HOH HOH C . 
MB 3 HOH 229 829  830  HOH HOH C . 
MB 3 HOH 230 830  831  HOH HOH C . 
MB 3 HOH 231 831  832  HOH HOH C . 
MB 3 HOH 232 832  833  HOH HOH C . 
MB 3 HOH 233 833  834  HOH HOH C . 
MB 3 HOH 234 834  835  HOH HOH C . 
MB 3 HOH 235 835  836  HOH HOH C . 
MB 3 HOH 236 836  837  HOH HOH C . 
MB 3 HOH 237 837  838  HOH HOH C . 
MB 3 HOH 238 838  839  HOH HOH C . 
MB 3 HOH 239 839  840  HOH HOH C . 
MB 3 HOH 240 840  841  HOH HOH C . 
MB 3 HOH 241 841  842  HOH HOH C . 
MB 3 HOH 242 842  843  HOH HOH C . 
MB 3 HOH 243 843  844  HOH HOH C . 
MB 3 HOH 244 844  845  HOH HOH C . 
MB 3 HOH 245 845  846  HOH HOH C . 
MB 3 HOH 246 846  847  HOH HOH C . 
MB 3 HOH 247 847  848  HOH HOH C . 
MB 3 HOH 248 848  849  HOH HOH C . 
MB 3 HOH 249 849  850  HOH HOH C . 
MB 3 HOH 250 850  851  HOH HOH C . 
MB 3 HOH 251 851  852  HOH HOH C . 
MB 3 HOH 252 852  853  HOH HOH C . 
MB 3 HOH 253 853  854  HOH HOH C . 
MB 3 HOH 254 854  855  HOH HOH C . 
MB 3 HOH 255 855  856  HOH HOH C . 
MB 3 HOH 256 856  857  HOH HOH C . 
MB 3 HOH 257 857  858  HOH HOH C . 
MB 3 HOH 258 858  859  HOH HOH C . 
MB 3 HOH 259 859  860  HOH HOH C . 
MB 3 HOH 260 860  861  HOH HOH C . 
MB 3 HOH 261 861  862  HOH HOH C . 
MB 3 HOH 262 862  863  HOH HOH C . 
MB 3 HOH 263 863  864  HOH HOH C . 
MB 3 HOH 264 864  865  HOH HOH C . 
MB 3 HOH 265 865  866  HOH HOH C . 
MB 3 HOH 266 866  867  HOH HOH C . 
MB 3 HOH 267 867  868  HOH HOH C . 
MB 3 HOH 268 868  869  HOH HOH C . 
MB 3 HOH 269 869  870  HOH HOH C . 
MB 3 HOH 270 870  871  HOH HOH C . 
MB 3 HOH 271 871  872  HOH HOH C . 
MB 3 HOH 272 872  873  HOH HOH C . 
MB 3 HOH 273 873  874  HOH HOH C . 
MB 3 HOH 274 874  875  HOH HOH C . 
MB 3 HOH 275 875  876  HOH HOH C . 
MB 3 HOH 276 876  877  HOH HOH C . 
MB 3 HOH 277 877  878  HOH HOH C . 
MB 3 HOH 278 878  879  HOH HOH C . 
MB 3 HOH 279 879  880  HOH HOH C . 
MB 3 HOH 280 880  881  HOH HOH C . 
MB 3 HOH 281 881  882  HOH HOH C . 
MB 3 HOH 282 882  883  HOH HOH C . 
MB 3 HOH 283 883  884  HOH HOH C . 
MB 3 HOH 284 884  885  HOH HOH C . 
MB 3 HOH 285 885  886  HOH HOH C . 
MB 3 HOH 286 886  887  HOH HOH C . 
MB 3 HOH 287 887  888  HOH HOH C . 
MB 3 HOH 288 888  889  HOH HOH C . 
MB 3 HOH 289 889  890  HOH HOH C . 
MB 3 HOH 290 890  891  HOH HOH C . 
MB 3 HOH 291 891  892  HOH HOH C . 
MB 3 HOH 292 892  893  HOH HOH C . 
MB 3 HOH 293 893  894  HOH HOH C . 
MB 3 HOH 294 894  895  HOH HOH C . 
MB 3 HOH 295 895  896  HOH HOH C . 
MB 3 HOH 296 896  897  HOH HOH C . 
MB 3 HOH 297 897  898  HOH HOH C . 
MB 3 HOH 298 898  899  HOH HOH C . 
MB 3 HOH 299 899  900  HOH HOH C . 
MB 3 HOH 300 900  901  HOH HOH C . 
MB 3 HOH 301 901  902  HOH HOH C . 
MB 3 HOH 302 902  903  HOH HOH C . 
MB 3 HOH 303 903  904  HOH HOH C . 
MB 3 HOH 304 904  905  HOH HOH C . 
MB 3 HOH 305 905  906  HOH HOH C . 
MB 3 HOH 306 906  907  HOH HOH C . 
MB 3 HOH 307 907  908  HOH HOH C . 
MB 3 HOH 308 908  909  HOH HOH C . 
MB 3 HOH 309 909  910  HOH HOH C . 
MB 3 HOH 310 910  911  HOH HOH C . 
MB 3 HOH 311 911  912  HOH HOH C . 
MB 3 HOH 312 912  913  HOH HOH C . 
MB 3 HOH 313 913  914  HOH HOH C . 
MB 3 HOH 314 914  915  HOH HOH C . 
MB 3 HOH 315 915  916  HOH HOH C . 
MB 3 HOH 316 916  917  HOH HOH C . 
MB 3 HOH 317 917  918  HOH HOH C . 
MB 3 HOH 318 918  919  HOH HOH C . 
MB 3 HOH 319 919  920  HOH HOH C . 
MB 3 HOH 320 920  921  HOH HOH C . 
MB 3 HOH 321 921  922  HOH HOH C . 
MB 3 HOH 322 922  923  HOH HOH C . 
MB 3 HOH 323 923  924  HOH HOH C . 
MB 3 HOH 324 924  925  HOH HOH C . 
MB 3 HOH 325 925  926  HOH HOH C . 
MB 3 HOH 326 926  927  HOH HOH C . 
MB 3 HOH 327 927  928  HOH HOH C . 
MB 3 HOH 328 928  929  HOH HOH C . 
MB 3 HOH 329 929  930  HOH HOH C . 
MB 3 HOH 330 930  931  HOH HOH C . 
MB 3 HOH 331 931  932  HOH HOH C . 
MB 3 HOH 332 932  933  HOH HOH C . 
MB 3 HOH 333 933  934  HOH HOH C . 
MB 3 HOH 334 934  935  HOH HOH C . 
MB 3 HOH 335 935  936  HOH HOH C . 
MB 3 HOH 336 936  937  HOH HOH C . 
MB 3 HOH 337 937  938  HOH HOH C . 
MB 3 HOH 338 938  939  HOH HOH C . 
MB 3 HOH 339 939  940  HOH HOH C . 
MB 3 HOH 340 940  941  HOH HOH C . 
MB 3 HOH 341 941  942  HOH HOH C . 
MB 3 HOH 342 942  943  HOH HOH C . 
MB 3 HOH 343 943  944  HOH HOH C . 
MB 3 HOH 344 944  945  HOH HOH C . 
MB 3 HOH 345 945  946  HOH HOH C . 
MB 3 HOH 346 946  947  HOH HOH C . 
MB 3 HOH 347 947  948  HOH HOH C . 
MB 3 HOH 348 948  949  HOH HOH C . 
MB 3 HOH 349 949  950  HOH HOH C . 
MB 3 HOH 350 950  951  HOH HOH C . 
MB 3 HOH 351 951  952  HOH HOH C . 
MB 3 HOH 352 952  953  HOH HOH C . 
MB 3 HOH 353 953  954  HOH HOH C . 
MB 3 HOH 354 954  955  HOH HOH C . 
MB 3 HOH 355 955  956  HOH HOH C . 
MB 3 HOH 356 956  957  HOH HOH C . 
MB 3 HOH 357 957  958  HOH HOH C . 
MB 3 HOH 358 958  959  HOH HOH C . 
MB 3 HOH 359 959  960  HOH HOH C . 
MB 3 HOH 360 960  961  HOH HOH C . 
MB 3 HOH 361 961  962  HOH HOH C . 
MB 3 HOH 362 962  963  HOH HOH C . 
MB 3 HOH 363 963  964  HOH HOH C . 
MB 3 HOH 364 964  965  HOH HOH C . 
MB 3 HOH 365 965  966  HOH HOH C . 
MB 3 HOH 366 966  967  HOH HOH C . 
MB 3 HOH 367 967  968  HOH HOH C . 
MB 3 HOH 368 968  969  HOH HOH C . 
MB 3 HOH 369 969  970  HOH HOH C . 
MB 3 HOH 370 970  971  HOH HOH C . 
MB 3 HOH 371 971  972  HOH HOH C . 
MB 3 HOH 372 972  973  HOH HOH C . 
MB 3 HOH 373 973  974  HOH HOH C . 
MB 3 HOH 374 974  975  HOH HOH C . 
MB 3 HOH 375 975  976  HOH HOH C . 
MB 3 HOH 376 976  977  HOH HOH C . 
MB 3 HOH 377 977  978  HOH HOH C . 
MB 3 HOH 378 978  979  HOH HOH C . 
MB 3 HOH 379 979  980  HOH HOH C . 
MB 3 HOH 380 980  981  HOH HOH C . 
MB 3 HOH 381 981  982  HOH HOH C . 
MB 3 HOH 382 982  983  HOH HOH C . 
MB 3 HOH 383 983  984  HOH HOH C . 
MB 3 HOH 384 984  985  HOH HOH C . 
MB 3 HOH 385 985  986  HOH HOH C . 
MB 3 HOH 386 986  987  HOH HOH C . 
MB 3 HOH 387 987  988  HOH HOH C . 
MB 3 HOH 388 988  989  HOH HOH C . 
MB 3 HOH 389 989  990  HOH HOH C . 
MB 3 HOH 390 990  991  HOH HOH C . 
MB 3 HOH 391 991  992  HOH HOH C . 
MB 3 HOH 392 992  993  HOH HOH C . 
MB 3 HOH 393 993  994  HOH HOH C . 
MB 3 HOH 394 994  995  HOH HOH C . 
MB 3 HOH 395 995  996  HOH HOH C . 
MB 3 HOH 396 996  997  HOH HOH C . 
MB 3 HOH 397 997  998  HOH HOH C . 
MB 3 HOH 398 998  999  HOH HOH C . 
MB 3 HOH 399 999  1000 HOH HOH C . 
MB 3 HOH 400 1000 1001 HOH HOH C . 
MB 3 HOH 401 1001 1002 HOH HOH C . 
MB 3 HOH 402 1002 1003 HOH HOH C . 
MB 3 HOH 403 1003 1004 HOH HOH C . 
MB 3 HOH 404 1004 1005 HOH HOH C . 
MB 3 HOH 405 1005 1006 HOH HOH C . 
MB 3 HOH 406 1006 1007 HOH HOH C . 
MB 3 HOH 407 1007 1008 HOH HOH C . 
MB 3 HOH 408 1008 1009 HOH HOH C . 
MB 3 HOH 409 1009 1010 HOH HOH C . 
MB 3 HOH 410 1010 1011 HOH HOH C . 
MB 3 HOH 411 1011 1012 HOH HOH C . 
MB 3 HOH 412 1012 1013 HOH HOH C . 
MB 3 HOH 413 1013 1014 HOH HOH C . 
MB 3 HOH 414 1014 1015 HOH HOH C . 
MB 3 HOH 415 1015 1016 HOH HOH C . 
MB 3 HOH 416 1016 1017 HOH HOH C . 
MB 3 HOH 417 1017 1018 HOH HOH C . 
MB 3 HOH 418 1018 1019 HOH HOH C . 
MB 3 HOH 419 1019 1020 HOH HOH C . 
MB 3 HOH 420 1020 1021 HOH HOH C . 
MB 3 HOH 421 1021 1022 HOH HOH C . 
MB 3 HOH 422 1022 1023 HOH HOH C . 
MB 3 HOH 423 1023 1024 HOH HOH C . 
MB 3 HOH 424 1024 1025 HOH HOH C . 
MB 3 HOH 425 1025 1026 HOH HOH C . 
MB 3 HOH 426 1026 1027 HOH HOH C . 
MB 3 HOH 427 1027 1028 HOH HOH C . 
MB 3 HOH 428 1028 1029 HOH HOH C . 
MB 3 HOH 429 1029 1030 HOH HOH C . 
MB 3 HOH 430 1030 1031 HOH HOH C . 
MB 3 HOH 431 1031 1032 HOH HOH C . 
MB 3 HOH 432 1032 1033 HOH HOH C . 
MB 3 HOH 433 1033 1034 HOH HOH C . 
MB 3 HOH 434 1034 1035 HOH HOH C . 
MB 3 HOH 435 1035 1036 HOH HOH C . 
MB 3 HOH 436 1036 1037 HOH HOH C . 
MB 3 HOH 437 1037 1038 HOH HOH C . 
MB 3 HOH 438 1038 1039 HOH HOH C . 
MB 3 HOH 439 1039 1040 HOH HOH C . 
MB 3 HOH 440 1040 1041 HOH HOH C . 
MB 3 HOH 441 1041 1042 HOH HOH C . 
MB 3 HOH 442 1042 1043 HOH HOH C . 
MB 3 HOH 443 1043 1044 HOH HOH C . 
MB 3 HOH 444 1044 1045 HOH HOH C . 
MB 3 HOH 445 1045 1046 HOH HOH C . 
MB 3 HOH 446 1046 1047 HOH HOH C . 
MB 3 HOH 447 1047 1048 HOH HOH C . 
MB 3 HOH 448 1048 1049 HOH HOH C . 
MB 3 HOH 449 1049 1050 HOH HOH C . 
MB 3 HOH 450 1050 1051 HOH HOH C . 
MB 3 HOH 451 1051 1052 HOH HOH C . 
MB 3 HOH 452 1052 1053 HOH HOH C . 
MB 3 HOH 453 1053 1054 HOH HOH C . 
MB 3 HOH 454 1054 1055 HOH HOH C . 
MB 3 HOH 455 1055 1056 HOH HOH C . 
MB 3 HOH 456 1056 1057 HOH HOH C . 
MB 3 HOH 457 1057 1058 HOH HOH C . 
MB 3 HOH 458 1058 1059 HOH HOH C . 
MB 3 HOH 459 1059 1060 HOH HOH C . 
MB 3 HOH 460 1060 1061 HOH HOH C . 
MB 3 HOH 461 1061 1062 HOH HOH C . 
MB 3 HOH 462 1062 1063 HOH HOH C . 
MB 3 HOH 463 1063 1064 HOH HOH C . 
MB 3 HOH 464 1064 1065 HOH HOH C . 
MB 3 HOH 465 1065 1066 HOH HOH C . 
MB 3 HOH 466 1066 1067 HOH HOH C . 
MB 3 HOH 467 1067 1068 HOH HOH C . 
MB 3 HOH 468 1068 1069 HOH HOH C . 
MB 3 HOH 469 1069 1070 HOH HOH C . 
MB 3 HOH 470 1070 1071 HOH HOH C . 
MB 3 HOH 471 1071 1072 HOH HOH C . 
MB 3 HOH 472 1072 1073 HOH HOH C . 
MB 3 HOH 473 1073 1074 HOH HOH C . 
MB 3 HOH 474 1074 1075 HOH HOH C . 
MB 3 HOH 475 1075 1076 HOH HOH C . 
MB 3 HOH 476 1076 1077 HOH HOH C . 
MB 3 HOH 477 1077 1078 HOH HOH C . 
MB 3 HOH 478 1078 1079 HOH HOH C . 
MB 3 HOH 479 1079 1080 HOH HOH C . 
MB 3 HOH 480 1080 1081 HOH HOH C . 
MB 3 HOH 481 1081 1082 HOH HOH C . 
MB 3 HOH 482 1082 1083 HOH HOH C . 
MB 3 HOH 483 1083 1084 HOH HOH C . 
MB 3 HOH 484 1084 1085 HOH HOH C . 
MB 3 HOH 485 1085 1086 HOH HOH C . 
MB 3 HOH 486 1086 1087 HOH HOH C . 
MB 3 HOH 487 1087 1088 HOH HOH C . 
MB 3 HOH 488 1088 1089 HOH HOH C . 
MB 3 HOH 489 1089 1090 HOH HOH C . 
MB 3 HOH 490 1090 1091 HOH HOH C . 
MB 3 HOH 491 1091 1092 HOH HOH C . 
MB 3 HOH 492 1092 1093 HOH HOH C . 
MB 3 HOH 493 1093 1094 HOH HOH C . 
MB 3 HOH 494 1094 1095 HOH HOH C . 
MB 3 HOH 495 1095 1096 HOH HOH C . 
MB 3 HOH 496 1096 1097 HOH HOH C . 
MB 3 HOH 497 1097 1098 HOH HOH C . 
MB 3 HOH 498 1098 1099 HOH HOH C . 
MB 3 HOH 499 1099 1100 HOH HOH C . 
MB 3 HOH 500 1100 1101 HOH HOH C . 
MB 3 HOH 501 1101 1102 HOH HOH C . 
MB 3 HOH 502 1102 1103 HOH HOH C . 
MB 3 HOH 503 1103 1104 HOH HOH C . 
MB 3 HOH 504 1104 1105 HOH HOH C . 
MB 3 HOH 505 1105 1106 HOH HOH C . 
MB 3 HOH 506 1106 1107 HOH HOH C . 
MB 3 HOH 507 1107 1108 HOH HOH C . 
MB 3 HOH 508 1108 1109 HOH HOH C . 
MB 3 HOH 509 1109 1110 HOH HOH C . 
MB 3 HOH 510 1110 1111 HOH HOH C . 
MB 3 HOH 511 1111 1112 HOH HOH C . 
MB 3 HOH 512 1112 1113 HOH HOH C . 
MB 3 HOH 513 1113 1114 HOH HOH C . 
MB 3 HOH 514 1114 1115 HOH HOH C . 
MB 3 HOH 515 1115 1116 HOH HOH C . 
MB 3 HOH 516 1116 1117 HOH HOH C . 
MB 3 HOH 517 1117 1118 HOH HOH C . 
MB 3 HOH 518 1118 1119 HOH HOH C . 
MB 3 HOH 519 1119 1120 HOH HOH C . 
MB 3 HOH 520 1120 1121 HOH HOH C . 
MB 3 HOH 521 1121 1122 HOH HOH C . 
MB 3 HOH 522 1122 1123 HOH HOH C . 
MB 3 HOH 523 1123 1124 HOH HOH C . 
MB 3 HOH 524 1124 1125 HOH HOH C . 
MB 3 HOH 525 1125 1126 HOH HOH C . 
MB 3 HOH 526 1126 1127 HOH HOH C . 
MB 3 HOH 527 1127 1128 HOH HOH C . 
MB 3 HOH 528 1128 1129 HOH HOH C . 
MB 3 HOH 529 1129 1130 HOH HOH C . 
MB 3 HOH 530 1130 1131 HOH HOH C . 
MB 3 HOH 531 1131 1132 HOH HOH C . 
MB 3 HOH 532 1132 1133 HOH HOH C . 
MB 3 HOH 533 1133 1134 HOH HOH C . 
MB 3 HOH 534 1134 1135 HOH HOH C . 
MB 3 HOH 535 1135 1136 HOH HOH C . 
MB 3 HOH 536 1136 1137 HOH HOH C . 
MB 3 HOH 537 1137 1138 HOH HOH C . 
MB 3 HOH 538 1138 1139 HOH HOH C . 
MB 3 HOH 539 1139 1140 HOH HOH C . 
MB 3 HOH 540 1140 1141 HOH HOH C . 
MB 3 HOH 541 1141 1142 HOH HOH C . 
MB 3 HOH 542 1142 1143 HOH HOH C . 
MB 3 HOH 543 1143 1144 HOH HOH C . 
MB 3 HOH 544 1144 1145 HOH HOH C . 
MB 3 HOH 545 1145 1146 HOH HOH C . 
MB 3 HOH 546 1146 1147 HOH HOH C . 
MB 3 HOH 547 1147 1148 HOH HOH C . 
MB 3 HOH 548 1148 1149 HOH HOH C . 
MB 3 HOH 549 1149 1150 HOH HOH C . 
MB 3 HOH 550 1150 1151 HOH HOH C . 
MB 3 HOH 551 1151 1152 HOH HOH C . 
MB 3 HOH 552 1152 1153 HOH HOH C . 
MB 3 HOH 553 1153 1154 HOH HOH C . 
MB 3 HOH 554 1154 1155 HOH HOH C . 
MB 3 HOH 555 1155 1156 HOH HOH C . 
MB 3 HOH 556 1156 1157 HOH HOH C . 
MB 3 HOH 557 1157 1158 HOH HOH C . 
MB 3 HOH 558 1158 1159 HOH HOH C . 
MB 3 HOH 559 1159 1160 HOH HOH C . 
MB 3 HOH 560 1160 1161 HOH HOH C . 
MB 3 HOH 561 1161 1162 HOH HOH C . 
MB 3 HOH 562 1162 1163 HOH HOH C . 
MB 3 HOH 563 1163 1164 HOH HOH C . 
MB 3 HOH 564 1164 1165 HOH HOH C . 
MB 3 HOH 565 1165 1166 HOH HOH C . 
MB 3 HOH 566 1166 1167 HOH HOH C . 
MB 3 HOH 567 1167 1168 HOH HOH C . 
MB 3 HOH 568 1168 1169 HOH HOH C . 
MB 3 HOH 569 1169 1170 HOH HOH C . 
MB 3 HOH 570 1170 1171 HOH HOH C . 
MB 3 HOH 571 1171 1172 HOH HOH C . 
MB 3 HOH 572 1172 1173 HOH HOH C . 
MB 3 HOH 573 1173 1174 HOH HOH C . 
MB 3 HOH 574 1174 1175 HOH HOH C . 
MB 3 HOH 575 1175 1176 HOH HOH C . 
MB 3 HOH 576 1176 1177 HOH HOH C . 
MB 3 HOH 577 1177 1178 HOH HOH C . 
MB 3 HOH 578 1178 1179 HOH HOH C . 
MB 3 HOH 579 1179 1180 HOH HOH C . 
MB 3 HOH 580 1180 1181 HOH HOH C . 
MB 3 HOH 581 1181 1182 HOH HOH C . 
MB 3 HOH 582 1182 1183 HOH HOH C . 
MB 3 HOH 583 1183 1184 HOH HOH C . 
MB 3 HOH 584 1184 1185 HOH HOH C . 
MB 3 HOH 585 1185 1186 HOH HOH C . 
MB 3 HOH 586 1186 1187 HOH HOH C . 
MB 3 HOH 587 1187 1188 HOH HOH C . 
MB 3 HOH 588 1188 1189 HOH HOH C . 
MB 3 HOH 589 1189 1190 HOH HOH C . 
MB 3 HOH 590 1190 1191 HOH HOH C . 
MB 3 HOH 591 1191 1192 HOH HOH C . 
MB 3 HOH 592 1192 1193 HOH HOH C . 
MB 3 HOH 593 1193 1194 HOH HOH C . 
MB 3 HOH 594 1194 1195 HOH HOH C . 
MB 3 HOH 595 1195 1196 HOH HOH C . 
MB 3 HOH 596 1196 1197 HOH HOH C . 
MB 3 HOH 597 1197 1198 HOH HOH C . 
MB 3 HOH 598 1198 1199 HOH HOH C . 
MB 3 HOH 599 1199 1200 HOH HOH C . 
MB 3 HOH 600 1200 1201 HOH HOH C . 
MB 3 HOH 601 1201 1202 HOH HOH C . 
MB 3 HOH 602 1202 1203 HOH HOH C . 
MB 3 HOH 603 1203 1204 HOH HOH C . 
MB 3 HOH 604 1204 1205 HOH HOH C . 
MB 3 HOH 605 1205 1206 HOH HOH C . 
MB 3 HOH 606 1206 1207 HOH HOH C . 
MB 3 HOH 607 1207 1208 HOH HOH C . 
MB 3 HOH 608 1208 604  HOH HOH C . 
MB 3 HOH 609 1209 1209 HOH HOH C . 
MB 3 HOH 610 1210 1210 HOH HOH C . 
MB 3 HOH 611 1211 1211 HOH HOH C . 
MB 3 HOH 612 1212 1212 HOH HOH C . 
MB 3 HOH 613 1213 1213 HOH HOH C . 
MB 3 HOH 614 1214 1214 HOH HOH C . 
MB 3 HOH 615 1215 1215 HOH HOH C . 
MB 3 HOH 616 1216 1216 HOH HOH C . 
MB 3 HOH 617 1217 1217 HOH HOH C . 
MB 3 HOH 618 1218 1218 HOH HOH C . 
MB 3 HOH 619 1219 1219 HOH HOH C . 
NB 3 HOH 1   601  601  HOH HOH D . 
NB 3 HOH 2   602  602  HOH HOH D . 
NB 3 HOH 3   603  603  HOH HOH D . 
NB 3 HOH 4   604  604  HOH HOH D . 
NB 3 HOH 5   605  605  HOH HOH D . 
NB 3 HOH 6   606  606  HOH HOH D . 
NB 3 HOH 7   607  607  HOH HOH D . 
NB 3 HOH 8   608  608  HOH HOH D . 
NB 3 HOH 9   609  609  HOH HOH D . 
NB 3 HOH 10  610  610  HOH HOH D . 
NB 3 HOH 11  611  611  HOH HOH D . 
NB 3 HOH 12  612  612  HOH HOH D . 
NB 3 HOH 13  613  613  HOH HOH D . 
NB 3 HOH 14  614  614  HOH HOH D . 
NB 3 HOH 15  615  615  HOH HOH D . 
NB 3 HOH 16  616  616  HOH HOH D . 
NB 3 HOH 17  617  617  HOH HOH D . 
NB 3 HOH 18  618  618  HOH HOH D . 
NB 3 HOH 19  619  619  HOH HOH D . 
NB 3 HOH 20  620  620  HOH HOH D . 
NB 3 HOH 21  621  621  HOH HOH D . 
NB 3 HOH 22  622  622  HOH HOH D . 
NB 3 HOH 23  623  623  HOH HOH D . 
NB 3 HOH 24  624  624  HOH HOH D . 
NB 3 HOH 25  625  625  HOH HOH D . 
NB 3 HOH 26  626  626  HOH HOH D . 
NB 3 HOH 27  627  627  HOH HOH D . 
NB 3 HOH 28  628  628  HOH HOH D . 
NB 3 HOH 29  629  629  HOH HOH D . 
NB 3 HOH 30  630  630  HOH HOH D . 
NB 3 HOH 31  631  631  HOH HOH D . 
NB 3 HOH 32  632  632  HOH HOH D . 
NB 3 HOH 33  633  633  HOH HOH D . 
NB 3 HOH 34  634  634  HOH HOH D . 
NB 3 HOH 35  635  635  HOH HOH D . 
NB 3 HOH 36  636  636  HOH HOH D . 
NB 3 HOH 37  637  637  HOH HOH D . 
NB 3 HOH 38  638  638  HOH HOH D . 
NB 3 HOH 39  639  639  HOH HOH D . 
NB 3 HOH 40  640  640  HOH HOH D . 
NB 3 HOH 41  641  641  HOH HOH D . 
NB 3 HOH 42  642  642  HOH HOH D . 
NB 3 HOH 43  643  643  HOH HOH D . 
NB 3 HOH 44  644  644  HOH HOH D . 
NB 3 HOH 45  645  645  HOH HOH D . 
NB 3 HOH 46  646  646  HOH HOH D . 
NB 3 HOH 47  647  647  HOH HOH D . 
NB 3 HOH 48  648  648  HOH HOH D . 
NB 3 HOH 49  649  649  HOH HOH D . 
NB 3 HOH 50  650  650  HOH HOH D . 
NB 3 HOH 51  651  651  HOH HOH D . 
NB 3 HOH 52  652  652  HOH HOH D . 
NB 3 HOH 53  653  653  HOH HOH D . 
NB 3 HOH 54  654  654  HOH HOH D . 
NB 3 HOH 55  655  655  HOH HOH D . 
NB 3 HOH 56  656  656  HOH HOH D . 
NB 3 HOH 57  657  657  HOH HOH D . 
NB 3 HOH 58  658  658  HOH HOH D . 
NB 3 HOH 59  659  659  HOH HOH D . 
NB 3 HOH 60  660  660  HOH HOH D . 
NB 3 HOH 61  661  661  HOH HOH D . 
NB 3 HOH 62  662  662  HOH HOH D . 
NB 3 HOH 63  663  663  HOH HOH D . 
NB 3 HOH 64  664  664  HOH HOH D . 
NB 3 HOH 65  665  665  HOH HOH D . 
NB 3 HOH 66  666  666  HOH HOH D . 
NB 3 HOH 67  667  667  HOH HOH D . 
NB 3 HOH 68  668  668  HOH HOH D . 
NB 3 HOH 69  669  669  HOH HOH D . 
NB 3 HOH 70  670  670  HOH HOH D . 
NB 3 HOH 71  671  671  HOH HOH D . 
NB 3 HOH 72  672  672  HOH HOH D . 
NB 3 HOH 73  673  673  HOH HOH D . 
NB 3 HOH 74  674  674  HOH HOH D . 
NB 3 HOH 75  675  675  HOH HOH D . 
NB 3 HOH 76  676  676  HOH HOH D . 
NB 3 HOH 77  677  677  HOH HOH D . 
NB 3 HOH 78  678  678  HOH HOH D . 
NB 3 HOH 79  679  679  HOH HOH D . 
NB 3 HOH 80  680  680  HOH HOH D . 
NB 3 HOH 81  681  681  HOH HOH D . 
NB 3 HOH 82  682  682  HOH HOH D . 
NB 3 HOH 83  683  683  HOH HOH D . 
NB 3 HOH 84  684  684  HOH HOH D . 
NB 3 HOH 85  685  685  HOH HOH D . 
NB 3 HOH 86  686  686  HOH HOH D . 
NB 3 HOH 87  687  687  HOH HOH D . 
NB 3 HOH 88  688  688  HOH HOH D . 
NB 3 HOH 89  689  689  HOH HOH D . 
NB 3 HOH 90  690  690  HOH HOH D . 
NB 3 HOH 91  691  691  HOH HOH D . 
NB 3 HOH 92  692  692  HOH HOH D . 
NB 3 HOH 93  693  693  HOH HOH D . 
NB 3 HOH 94  694  694  HOH HOH D . 
NB 3 HOH 95  695  695  HOH HOH D . 
NB 3 HOH 96  696  696  HOH HOH D . 
NB 3 HOH 97  697  697  HOH HOH D . 
NB 3 HOH 98  698  698  HOH HOH D . 
NB 3 HOH 99  699  699  HOH HOH D . 
NB 3 HOH 100 700  700  HOH HOH D . 
NB 3 HOH 101 701  701  HOH HOH D . 
NB 3 HOH 102 702  702  HOH HOH D . 
NB 3 HOH 103 703  703  HOH HOH D . 
NB 3 HOH 104 704  704  HOH HOH D . 
NB 3 HOH 105 705  705  HOH HOH D . 
NB 3 HOH 106 706  706  HOH HOH D . 
NB 3 HOH 107 707  707  HOH HOH D . 
NB 3 HOH 108 708  708  HOH HOH D . 
NB 3 HOH 109 709  709  HOH HOH D . 
NB 3 HOH 110 710  710  HOH HOH D . 
NB 3 HOH 111 711  711  HOH HOH D . 
NB 3 HOH 112 712  712  HOH HOH D . 
NB 3 HOH 113 713  713  HOH HOH D . 
NB 3 HOH 114 714  714  HOH HOH D . 
NB 3 HOH 115 715  715  HOH HOH D . 
NB 3 HOH 116 716  716  HOH HOH D . 
NB 3 HOH 117 717  717  HOH HOH D . 
NB 3 HOH 118 718  718  HOH HOH D . 
NB 3 HOH 119 719  719  HOH HOH D . 
NB 3 HOH 120 720  720  HOH HOH D . 
NB 3 HOH 121 721  721  HOH HOH D . 
NB 3 HOH 122 722  722  HOH HOH D . 
NB 3 HOH 123 723  723  HOH HOH D . 
NB 3 HOH 124 724  724  HOH HOH D . 
NB 3 HOH 125 725  725  HOH HOH D . 
NB 3 HOH 126 726  726  HOH HOH D . 
NB 3 HOH 127 727  727  HOH HOH D . 
NB 3 HOH 128 728  728  HOH HOH D . 
NB 3 HOH 129 729  729  HOH HOH D . 
NB 3 HOH 130 730  730  HOH HOH D . 
NB 3 HOH 131 731  731  HOH HOH D . 
NB 3 HOH 132 732  732  HOH HOH D . 
NB 3 HOH 133 733  733  HOH HOH D . 
NB 3 HOH 134 734  734  HOH HOH D . 
NB 3 HOH 135 735  735  HOH HOH D . 
NB 3 HOH 136 736  736  HOH HOH D . 
NB 3 HOH 137 737  737  HOH HOH D . 
NB 3 HOH 138 738  738  HOH HOH D . 
NB 3 HOH 139 739  739  HOH HOH D . 
NB 3 HOH 140 740  740  HOH HOH D . 
NB 3 HOH 141 741  741  HOH HOH D . 
NB 3 HOH 142 742  742  HOH HOH D . 
NB 3 HOH 143 743  743  HOH HOH D . 
NB 3 HOH 144 744  744  HOH HOH D . 
NB 3 HOH 145 745  745  HOH HOH D . 
NB 3 HOH 146 746  746  HOH HOH D . 
NB 3 HOH 147 747  747  HOH HOH D . 
NB 3 HOH 148 748  748  HOH HOH D . 
NB 3 HOH 149 749  749  HOH HOH D . 
NB 3 HOH 150 750  750  HOH HOH D . 
NB 3 HOH 151 751  751  HOH HOH D . 
NB 3 HOH 152 752  752  HOH HOH D . 
NB 3 HOH 153 753  753  HOH HOH D . 
NB 3 HOH 154 754  754  HOH HOH D . 
NB 3 HOH 155 755  755  HOH HOH D . 
NB 3 HOH 156 756  756  HOH HOH D . 
NB 3 HOH 157 757  757  HOH HOH D . 
NB 3 HOH 158 758  758  HOH HOH D . 
NB 3 HOH 159 759  759  HOH HOH D . 
NB 3 HOH 160 760  760  HOH HOH D . 
NB 3 HOH 161 761  761  HOH HOH D . 
NB 3 HOH 162 762  762  HOH HOH D . 
NB 3 HOH 163 763  763  HOH HOH D . 
NB 3 HOH 164 764  764  HOH HOH D . 
NB 3 HOH 165 765  765  HOH HOH D . 
NB 3 HOH 166 766  766  HOH HOH D . 
NB 3 HOH 167 767  767  HOH HOH D . 
NB 3 HOH 168 768  768  HOH HOH D . 
NB 3 HOH 169 769  769  HOH HOH D . 
NB 3 HOH 170 770  770  HOH HOH D . 
NB 3 HOH 171 771  771  HOH HOH D . 
NB 3 HOH 172 772  772  HOH HOH D . 
NB 3 HOH 173 773  773  HOH HOH D . 
NB 3 HOH 174 774  774  HOH HOH D . 
NB 3 HOH 175 775  775  HOH HOH D . 
NB 3 HOH 176 776  776  HOH HOH D . 
NB 3 HOH 177 777  777  HOH HOH D . 
NB 3 HOH 178 778  778  HOH HOH D . 
NB 3 HOH 179 779  779  HOH HOH D . 
NB 3 HOH 180 780  780  HOH HOH D . 
NB 3 HOH 181 781  781  HOH HOH D . 
NB 3 HOH 182 782  782  HOH HOH D . 
NB 3 HOH 183 783  783  HOH HOH D . 
NB 3 HOH 184 784  784  HOH HOH D . 
NB 3 HOH 185 785  785  HOH HOH D . 
NB 3 HOH 186 786  786  HOH HOH D . 
NB 3 HOH 187 787  787  HOH HOH D . 
NB 3 HOH 188 788  788  HOH HOH D . 
NB 3 HOH 189 789  789  HOH HOH D . 
NB 3 HOH 190 790  790  HOH HOH D . 
NB 3 HOH 191 791  791  HOH HOH D . 
NB 3 HOH 192 792  792  HOH HOH D . 
NB 3 HOH 193 793  793  HOH HOH D . 
NB 3 HOH 194 794  794  HOH HOH D . 
NB 3 HOH 195 795  795  HOH HOH D . 
NB 3 HOH 196 796  796  HOH HOH D . 
NB 3 HOH 197 797  797  HOH HOH D . 
NB 3 HOH 198 798  798  HOH HOH D . 
NB 3 HOH 199 799  799  HOH HOH D . 
NB 3 HOH 200 800  800  HOH HOH D . 
NB 3 HOH 201 801  801  HOH HOH D . 
NB 3 HOH 202 802  802  HOH HOH D . 
NB 3 HOH 203 803  803  HOH HOH D . 
NB 3 HOH 204 804  804  HOH HOH D . 
NB 3 HOH 205 805  805  HOH HOH D . 
NB 3 HOH 206 806  806  HOH HOH D . 
NB 3 HOH 207 807  807  HOH HOH D . 
NB 3 HOH 208 808  808  HOH HOH D . 
NB 3 HOH 209 809  809  HOH HOH D . 
NB 3 HOH 210 810  810  HOH HOH D . 
NB 3 HOH 211 811  811  HOH HOH D . 
NB 3 HOH 212 812  812  HOH HOH D . 
NB 3 HOH 213 813  813  HOH HOH D . 
NB 3 HOH 214 814  814  HOH HOH D . 
NB 3 HOH 215 815  815  HOH HOH D . 
NB 3 HOH 216 816  816  HOH HOH D . 
NB 3 HOH 217 817  817  HOH HOH D . 
NB 3 HOH 218 818  818  HOH HOH D . 
NB 3 HOH 219 819  819  HOH HOH D . 
NB 3 HOH 220 820  820  HOH HOH D . 
NB 3 HOH 221 821  821  HOH HOH D . 
NB 3 HOH 222 822  822  HOH HOH D . 
NB 3 HOH 223 823  823  HOH HOH D . 
NB 3 HOH 224 824  824  HOH HOH D . 
NB 3 HOH 225 825  825  HOH HOH D . 
NB 3 HOH 226 826  826  HOH HOH D . 
NB 3 HOH 227 827  827  HOH HOH D . 
NB 3 HOH 228 828  828  HOH HOH D . 
NB 3 HOH 229 829  829  HOH HOH D . 
NB 3 HOH 230 830  830  HOH HOH D . 
NB 3 HOH 231 831  831  HOH HOH D . 
NB 3 HOH 232 832  832  HOH HOH D . 
NB 3 HOH 233 833  833  HOH HOH D . 
NB 3 HOH 234 834  834  HOH HOH D . 
NB 3 HOH 235 835  835  HOH HOH D . 
NB 3 HOH 236 836  836  HOH HOH D . 
NB 3 HOH 237 837  837  HOH HOH D . 
NB 3 HOH 238 838  838  HOH HOH D . 
NB 3 HOH 239 839  839  HOH HOH D . 
NB 3 HOH 240 840  840  HOH HOH D . 
NB 3 HOH 241 841  841  HOH HOH D . 
NB 3 HOH 242 842  842  HOH HOH D . 
NB 3 HOH 243 843  843  HOH HOH D . 
NB 3 HOH 244 844  844  HOH HOH D . 
NB 3 HOH 245 845  845  HOH HOH D . 
NB 3 HOH 246 846  846  HOH HOH D . 
NB 3 HOH 247 847  847  HOH HOH D . 
NB 3 HOH 248 848  848  HOH HOH D . 
NB 3 HOH 249 849  849  HOH HOH D . 
NB 3 HOH 250 850  850  HOH HOH D . 
NB 3 HOH 251 851  851  HOH HOH D . 
NB 3 HOH 252 852  852  HOH HOH D . 
NB 3 HOH 253 853  853  HOH HOH D . 
NB 3 HOH 254 854  854  HOH HOH D . 
NB 3 HOH 255 855  855  HOH HOH D . 
NB 3 HOH 256 856  856  HOH HOH D . 
NB 3 HOH 257 857  857  HOH HOH D . 
NB 3 HOH 258 858  858  HOH HOH D . 
NB 3 HOH 259 859  859  HOH HOH D . 
NB 3 HOH 260 860  860  HOH HOH D . 
NB 3 HOH 261 861  861  HOH HOH D . 
NB 3 HOH 262 862  862  HOH HOH D . 
NB 3 HOH 263 863  863  HOH HOH D . 
NB 3 HOH 264 864  864  HOH HOH D . 
NB 3 HOH 265 865  865  HOH HOH D . 
NB 3 HOH 266 866  866  HOH HOH D . 
NB 3 HOH 267 867  867  HOH HOH D . 
NB 3 HOH 268 868  868  HOH HOH D . 
NB 3 HOH 269 869  869  HOH HOH D . 
NB 3 HOH 270 870  870  HOH HOH D . 
NB 3 HOH 271 871  871  HOH HOH D . 
NB 3 HOH 272 872  872  HOH HOH D . 
NB 3 HOH 273 873  873  HOH HOH D . 
NB 3 HOH 274 874  874  HOH HOH D . 
NB 3 HOH 275 875  875  HOH HOH D . 
NB 3 HOH 276 876  876  HOH HOH D . 
NB 3 HOH 277 877  877  HOH HOH D . 
NB 3 HOH 278 878  878  HOH HOH D . 
NB 3 HOH 279 879  879  HOH HOH D . 
NB 3 HOH 280 880  880  HOH HOH D . 
NB 3 HOH 281 881  881  HOH HOH D . 
NB 3 HOH 282 882  882  HOH HOH D . 
NB 3 HOH 283 883  883  HOH HOH D . 
NB 3 HOH 284 884  884  HOH HOH D . 
NB 3 HOH 285 885  885  HOH HOH D . 
NB 3 HOH 286 886  886  HOH HOH D . 
NB 3 HOH 287 887  887  HOH HOH D . 
NB 3 HOH 288 888  888  HOH HOH D . 
NB 3 HOH 289 889  889  HOH HOH D . 
NB 3 HOH 290 890  890  HOH HOH D . 
NB 3 HOH 291 891  891  HOH HOH D . 
NB 3 HOH 292 892  892  HOH HOH D . 
NB 3 HOH 293 893  893  HOH HOH D . 
NB 3 HOH 294 894  894  HOH HOH D . 
NB 3 HOH 295 895  895  HOH HOH D . 
NB 3 HOH 296 896  896  HOH HOH D . 
NB 3 HOH 297 897  897  HOH HOH D . 
NB 3 HOH 298 898  898  HOH HOH D . 
NB 3 HOH 299 899  899  HOH HOH D . 
NB 3 HOH 300 900  900  HOH HOH D . 
NB 3 HOH 301 901  902  HOH HOH D . 
NB 3 HOH 302 902  903  HOH HOH D . 
NB 3 HOH 303 903  904  HOH HOH D . 
NB 3 HOH 304 904  905  HOH HOH D . 
NB 3 HOH 305 905  906  HOH HOH D . 
NB 3 HOH 306 906  907  HOH HOH D . 
NB 3 HOH 307 907  908  HOH HOH D . 
NB 3 HOH 308 908  909  HOH HOH D . 
NB 3 HOH 309 909  910  HOH HOH D . 
NB 3 HOH 310 910  911  HOH HOH D . 
NB 3 HOH 311 911  912  HOH HOH D . 
NB 3 HOH 312 912  913  HOH HOH D . 
NB 3 HOH 313 913  914  HOH HOH D . 
NB 3 HOH 314 914  915  HOH HOH D . 
NB 3 HOH 315 915  916  HOH HOH D . 
NB 3 HOH 316 916  917  HOH HOH D . 
NB 3 HOH 317 917  918  HOH HOH D . 
NB 3 HOH 318 918  919  HOH HOH D . 
NB 3 HOH 319 919  920  HOH HOH D . 
NB 3 HOH 320 920  921  HOH HOH D . 
NB 3 HOH 321 921  922  HOH HOH D . 
NB 3 HOH 322 922  923  HOH HOH D . 
NB 3 HOH 323 923  924  HOH HOH D . 
NB 3 HOH 324 924  925  HOH HOH D . 
NB 3 HOH 325 925  926  HOH HOH D . 
NB 3 HOH 326 926  927  HOH HOH D . 
NB 3 HOH 327 927  928  HOH HOH D . 
NB 3 HOH 328 928  929  HOH HOH D . 
NB 3 HOH 329 929  930  HOH HOH D . 
NB 3 HOH 330 930  931  HOH HOH D . 
NB 3 HOH 331 931  932  HOH HOH D . 
NB 3 HOH 332 932  933  HOH HOH D . 
NB 3 HOH 333 933  934  HOH HOH D . 
NB 3 HOH 334 934  935  HOH HOH D . 
NB 3 HOH 335 935  936  HOH HOH D . 
NB 3 HOH 336 936  937  HOH HOH D . 
NB 3 HOH 337 937  938  HOH HOH D . 
NB 3 HOH 338 938  939  HOH HOH D . 
NB 3 HOH 339 939  940  HOH HOH D . 
NB 3 HOH 340 940  941  HOH HOH D . 
NB 3 HOH 341 941  942  HOH HOH D . 
NB 3 HOH 342 942  943  HOH HOH D . 
NB 3 HOH 343 943  944  HOH HOH D . 
NB 3 HOH 344 944  945  HOH HOH D . 
NB 3 HOH 345 945  946  HOH HOH D . 
NB 3 HOH 346 946  947  HOH HOH D . 
NB 3 HOH 347 947  948  HOH HOH D . 
NB 3 HOH 348 948  949  HOH HOH D . 
NB 3 HOH 349 949  950  HOH HOH D . 
NB 3 HOH 350 950  951  HOH HOH D . 
NB 3 HOH 351 951  952  HOH HOH D . 
NB 3 HOH 352 952  953  HOH HOH D . 
NB 3 HOH 353 953  954  HOH HOH D . 
NB 3 HOH 354 954  955  HOH HOH D . 
NB 3 HOH 355 955  956  HOH HOH D . 
NB 3 HOH 356 956  957  HOH HOH D . 
NB 3 HOH 357 957  958  HOH HOH D . 
NB 3 HOH 358 958  959  HOH HOH D . 
NB 3 HOH 359 959  960  HOH HOH D . 
NB 3 HOH 360 960  961  HOH HOH D . 
NB 3 HOH 361 961  962  HOH HOH D . 
NB 3 HOH 362 962  963  HOH HOH D . 
NB 3 HOH 363 963  964  HOH HOH D . 
NB 3 HOH 364 964  965  HOH HOH D . 
NB 3 HOH 365 965  966  HOH HOH D . 
NB 3 HOH 366 966  967  HOH HOH D . 
NB 3 HOH 367 967  968  HOH HOH D . 
NB 3 HOH 368 968  969  HOH HOH D . 
NB 3 HOH 369 969  970  HOH HOH D . 
NB 3 HOH 370 970  971  HOH HOH D . 
NB 3 HOH 371 971  972  HOH HOH D . 
NB 3 HOH 372 972  973  HOH HOH D . 
NB 3 HOH 373 973  974  HOH HOH D . 
NB 3 HOH 374 974  975  HOH HOH D . 
NB 3 HOH 375 975  976  HOH HOH D . 
NB 3 HOH 376 976  977  HOH HOH D . 
NB 3 HOH 377 977  978  HOH HOH D . 
NB 3 HOH 378 978  979  HOH HOH D . 
NB 3 HOH 379 979  980  HOH HOH D . 
NB 3 HOH 380 980  981  HOH HOH D . 
NB 3 HOH 381 981  982  HOH HOH D . 
NB 3 HOH 382 982  983  HOH HOH D . 
NB 3 HOH 383 983  984  HOH HOH D . 
NB 3 HOH 384 984  985  HOH HOH D . 
NB 3 HOH 385 985  986  HOH HOH D . 
NB 3 HOH 386 986  987  HOH HOH D . 
NB 3 HOH 387 987  988  HOH HOH D . 
NB 3 HOH 388 988  989  HOH HOH D . 
NB 3 HOH 389 989  990  HOH HOH D . 
NB 3 HOH 390 990  991  HOH HOH D . 
NB 3 HOH 391 991  992  HOH HOH D . 
NB 3 HOH 392 992  993  HOH HOH D . 
NB 3 HOH 393 993  994  HOH HOH D . 
NB 3 HOH 394 994  995  HOH HOH D . 
NB 3 HOH 395 995  996  HOH HOH D . 
NB 3 HOH 396 996  997  HOH HOH D . 
NB 3 HOH 397 997  998  HOH HOH D . 
NB 3 HOH 398 998  999  HOH HOH D . 
NB 3 HOH 399 999  1000 HOH HOH D . 
NB 3 HOH 400 1000 1001 HOH HOH D . 
NB 3 HOH 401 1001 1002 HOH HOH D . 
NB 3 HOH 402 1002 1003 HOH HOH D . 
NB 3 HOH 403 1003 1004 HOH HOH D . 
NB 3 HOH 404 1004 901  HOH HOH D . 
NB 3 HOH 405 1005 1005 HOH HOH D . 
NB 3 HOH 406 1006 1006 HOH HOH D . 
NB 3 HOH 407 1007 1007 HOH HOH D . 
NB 3 HOH 408 1008 1008 HOH HOH D . 
NB 3 HOH 409 1009 1009 HOH HOH D . 
NB 3 HOH 410 1010 1010 HOH HOH D . 
NB 3 HOH 411 1011 1011 HOH HOH D . 
NB 3 HOH 412 1012 1012 HOH HOH D . 
NB 3 HOH 413 1013 1013 HOH HOH D . 
NB 3 HOH 414 1014 1014 HOH HOH D . 
NB 3 HOH 415 1015 1015 HOH HOH D . 
NB 3 HOH 416 1016 1016 HOH HOH D . 
NB 3 HOH 417 1017 1017 HOH HOH D . 
NB 3 HOH 418 1018 1018 HOH HOH D . 
NB 3 HOH 419 1019 1019 HOH HOH D . 
NB 3 HOH 420 1020 1020 HOH HOH D . 
NB 3 HOH 421 1021 1021 HOH HOH D . 
NB 3 HOH 422 1022 1022 HOH HOH D . 
NB 3 HOH 423 1023 1023 HOH HOH D . 
NB 3 HOH 424 1024 1024 HOH HOH D . 
NB 3 HOH 425 1025 1025 HOH HOH D . 
NB 3 HOH 426 1026 1026 HOH HOH D . 
NB 3 HOH 427 1027 1027 HOH HOH D . 
NB 3 HOH 428 1028 1028 HOH HOH D . 
NB 3 HOH 429 1029 1029 HOH HOH D . 
NB 3 HOH 430 1030 1030 HOH HOH D . 
NB 3 HOH 431 1031 1031 HOH HOH D . 
NB 3 HOH 432 1032 1032 HOH HOH D . 
NB 3 HOH 433 1033 1033 HOH HOH D . 
NB 3 HOH 434 1034 1034 HOH HOH D . 
NB 3 HOH 435 1035 1035 HOH HOH D . 
NB 3 HOH 436 1036 1036 HOH HOH D . 
NB 3 HOH 437 1037 1037 HOH HOH D . 
NB 3 HOH 438 1038 1038 HOH HOH D . 
NB 3 HOH 439 1039 1039 HOH HOH D . 
NB 3 HOH 440 1040 1040 HOH HOH D . 
NB 3 HOH 441 1041 1041 HOH HOH D . 
NB 3 HOH 442 1042 1042 HOH HOH D . 
NB 3 HOH 443 1043 1043 HOH HOH D . 
NB 3 HOH 444 1044 1044 HOH HOH D . 
NB 3 HOH 445 1045 1045 HOH HOH D . 
NB 3 HOH 446 1046 1046 HOH HOH D . 
NB 3 HOH 447 1047 1047 HOH HOH D . 
NB 3 HOH 448 1048 1048 HOH HOH D . 
NB 3 HOH 449 1049 1049 HOH HOH D . 
NB 3 HOH 450 1050 1050 HOH HOH D . 
NB 3 HOH 451 1051 1051 HOH HOH D . 
NB 3 HOH 452 1052 1052 HOH HOH D . 
NB 3 HOH 453 1053 1053 HOH HOH D . 
NB 3 HOH 454 1054 1054 HOH HOH D . 
NB 3 HOH 455 1055 1055 HOH HOH D . 
NB 3 HOH 456 1056 1056 HOH HOH D . 
NB 3 HOH 457 1057 1057 HOH HOH D . 
NB 3 HOH 458 1058 1058 HOH HOH D . 
NB 3 HOH 459 1059 1059 HOH HOH D . 
NB 3 HOH 460 1060 1060 HOH HOH D . 
NB 3 HOH 461 1061 1061 HOH HOH D . 
NB 3 HOH 462 1062 1062 HOH HOH D . 
NB 3 HOH 463 1063 1063 HOH HOH D . 
NB 3 HOH 464 1064 1064 HOH HOH D . 
NB 3 HOH 465 1065 1065 HOH HOH D . 
NB 3 HOH 466 1066 1066 HOH HOH D . 
NB 3 HOH 467 1067 1067 HOH HOH D . 
NB 3 HOH 468 1068 1068 HOH HOH D . 
NB 3 HOH 469 1069 1069 HOH HOH D . 
NB 3 HOH 470 1070 1070 HOH HOH D . 
NB 3 HOH 471 1071 1071 HOH HOH D . 
NB 3 HOH 472 1072 1072 HOH HOH D . 
NB 3 HOH 473 1073 1073 HOH HOH D . 
NB 3 HOH 474 1074 1074 HOH HOH D . 
NB 3 HOH 475 1075 1075 HOH HOH D . 
NB 3 HOH 476 1076 1076 HOH HOH D . 
NB 3 HOH 477 1077 1077 HOH HOH D . 
NB 3 HOH 478 1078 1078 HOH HOH D . 
NB 3 HOH 479 1079 1079 HOH HOH D . 
NB 3 HOH 480 1080 1080 HOH HOH D . 
NB 3 HOH 481 1081 1081 HOH HOH D . 
NB 3 HOH 482 1082 1082 HOH HOH D . 
NB 3 HOH 483 1083 1083 HOH HOH D . 
NB 3 HOH 484 1084 1084 HOH HOH D . 
NB 3 HOH 485 1085 1085 HOH HOH D . 
NB 3 HOH 486 1086 1086 HOH HOH D . 
NB 3 HOH 487 1087 1087 HOH HOH D . 
NB 3 HOH 488 1088 1088 HOH HOH D . 
NB 3 HOH 489 1089 1089 HOH HOH D . 
NB 3 HOH 490 1090 1090 HOH HOH D . 
NB 3 HOH 491 1091 1091 HOH HOH D . 
NB 3 HOH 492 1092 1092 HOH HOH D . 
NB 3 HOH 493 1093 1093 HOH HOH D . 
NB 3 HOH 494 1094 1094 HOH HOH D . 
NB 3 HOH 495 1095 1095 HOH HOH D . 
NB 3 HOH 496 1096 1096 HOH HOH D . 
NB 3 HOH 497 1097 1097 HOH HOH D . 
NB 3 HOH 498 1098 1098 HOH HOH D . 
NB 3 HOH 499 1099 1099 HOH HOH D . 
NB 3 HOH 500 1100 1100 HOH HOH D . 
NB 3 HOH 501 1101 1101 HOH HOH D . 
NB 3 HOH 502 1102 1102 HOH HOH D . 
NB 3 HOH 503 1103 1103 HOH HOH D . 
NB 3 HOH 504 1104 1104 HOH HOH D . 
NB 3 HOH 505 1105 1105 HOH HOH D . 
NB 3 HOH 506 1106 1106 HOH HOH D . 
NB 3 HOH 507 1107 1107 HOH HOH D . 
NB 3 HOH 508 1108 1108 HOH HOH D . 
NB 3 HOH 509 1109 1109 HOH HOH D . 
NB 3 HOH 510 1110 1110 HOH HOH D . 
NB 3 HOH 511 1111 1111 HOH HOH D . 
NB 3 HOH 512 1112 1112 HOH HOH D . 
NB 3 HOH 513 1113 1113 HOH HOH D . 
NB 3 HOH 514 1114 1114 HOH HOH D . 
NB 3 HOH 515 1115 1115 HOH HOH D . 
NB 3 HOH 516 1116 1116 HOH HOH D . 
NB 3 HOH 517 1117 1117 HOH HOH D . 
NB 3 HOH 518 1118 1118 HOH HOH D . 
NB 3 HOH 519 1119 1119 HOH HOH D . 
NB 3 HOH 520 1120 1120 HOH HOH D . 
NB 3 HOH 521 1121 1121 HOH HOH D . 
NB 3 HOH 522 1122 1122 HOH HOH D . 
NB 3 HOH 523 1123 1123 HOH HOH D . 
NB 3 HOH 524 1124 1124 HOH HOH D . 
NB 3 HOH 525 1125 1125 HOH HOH D . 
NB 3 HOH 526 1126 1126 HOH HOH D . 
NB 3 HOH 527 1127 1127 HOH HOH D . 
NB 3 HOH 528 1128 1128 HOH HOH D . 
NB 3 HOH 529 1129 1129 HOH HOH D . 
NB 3 HOH 530 1130 1130 HOH HOH D . 
NB 3 HOH 531 1131 1131 HOH HOH D . 
NB 3 HOH 532 1132 1132 HOH HOH D . 
NB 3 HOH 533 1133 1133 HOH HOH D . 
NB 3 HOH 534 1134 1134 HOH HOH D . 
NB 3 HOH 535 1135 1135 HOH HOH D . 
NB 3 HOH 536 1136 1136 HOH HOH D . 
NB 3 HOH 537 1137 1137 HOH HOH D . 
NB 3 HOH 538 1138 1138 HOH HOH D . 
NB 3 HOH 539 1139 1139 HOH HOH D . 
NB 3 HOH 540 1140 1140 HOH HOH D . 
NB 3 HOH 541 1141 1141 HOH HOH D . 
NB 3 HOH 542 1142 1142 HOH HOH D . 
NB 3 HOH 543 1143 1143 HOH HOH D . 
NB 3 HOH 544 1144 1144 HOH HOH D . 
NB 3 HOH 545 1145 1145 HOH HOH D . 
NB 3 HOH 546 1146 1146 HOH HOH D . 
NB 3 HOH 547 1147 1147 HOH HOH D . 
NB 3 HOH 548 1148 1148 HOH HOH D . 
NB 3 HOH 549 1149 1149 HOH HOH D . 
NB 3 HOH 550 1150 1150 HOH HOH D . 
NB 3 HOH 551 1151 1151 HOH HOH D . 
NB 3 HOH 552 1152 1152 HOH HOH D . 
NB 3 HOH 553 1153 1153 HOH HOH D . 
NB 3 HOH 554 1154 1154 HOH HOH D . 
NB 3 HOH 555 1155 1155 HOH HOH D . 
NB 3 HOH 556 1156 1156 HOH HOH D . 
NB 3 HOH 557 1157 1157 HOH HOH D . 
NB 3 HOH 558 1158 1158 HOH HOH D . 
NB 3 HOH 559 1159 1159 HOH HOH D . 
NB 3 HOH 560 1160 1160 HOH HOH D . 
NB 3 HOH 561 1161 1161 HOH HOH D . 
NB 3 HOH 562 1162 1162 HOH HOH D . 
NB 3 HOH 563 1163 1163 HOH HOH D . 
NB 3 HOH 564 1164 1164 HOH HOH D . 
NB 3 HOH 565 1165 1165 HOH HOH D . 
NB 3 HOH 566 1166 1166 HOH HOH D . 
NB 3 HOH 567 1167 1167 HOH HOH D . 
NB 3 HOH 568 1168 1168 HOH HOH D . 
NB 3 HOH 569 1169 1169 HOH HOH D . 
NB 3 HOH 570 1170 1170 HOH HOH D . 
NB 3 HOH 571 1171 1171 HOH HOH D . 
NB 3 HOH 572 1172 1172 HOH HOH D . 
NB 3 HOH 573 1173 1173 HOH HOH D . 
OB 3 HOH 1   601  601  HOH HOH E . 
OB 3 HOH 2   602  602  HOH HOH E . 
OB 3 HOH 3   603  603  HOH HOH E . 
OB 3 HOH 4   604  604  HOH HOH E . 
OB 3 HOH 5   605  605  HOH HOH E . 
OB 3 HOH 6   606  606  HOH HOH E . 
OB 3 HOH 7   607  607  HOH HOH E . 
OB 3 HOH 8   608  608  HOH HOH E . 
OB 3 HOH 9   609  609  HOH HOH E . 
OB 3 HOH 10  610  610  HOH HOH E . 
OB 3 HOH 11  611  611  HOH HOH E . 
OB 3 HOH 12  612  612  HOH HOH E . 
OB 3 HOH 13  613  613  HOH HOH E . 
OB 3 HOH 14  614  614  HOH HOH E . 
OB 3 HOH 15  615  615  HOH HOH E . 
OB 3 HOH 16  616  616  HOH HOH E . 
OB 3 HOH 17  617  617  HOH HOH E . 
OB 3 HOH 18  618  618  HOH HOH E . 
OB 3 HOH 19  619  619  HOH HOH E . 
OB 3 HOH 20  620  620  HOH HOH E . 
OB 3 HOH 21  621  621  HOH HOH E . 
OB 3 HOH 22  622  622  HOH HOH E . 
OB 3 HOH 23  623  623  HOH HOH E . 
OB 3 HOH 24  624  624  HOH HOH E . 
OB 3 HOH 25  625  625  HOH HOH E . 
OB 3 HOH 26  626  626  HOH HOH E . 
OB 3 HOH 27  627  627  HOH HOH E . 
OB 3 HOH 28  628  628  HOH HOH E . 
OB 3 HOH 29  629  629  HOH HOH E . 
OB 3 HOH 30  630  630  HOH HOH E . 
OB 3 HOH 31  631  631  HOH HOH E . 
OB 3 HOH 32  632  632  HOH HOH E . 
OB 3 HOH 33  633  633  HOH HOH E . 
OB 3 HOH 34  634  634  HOH HOH E . 
OB 3 HOH 35  635  635  HOH HOH E . 
OB 3 HOH 36  636  636  HOH HOH E . 
OB 3 HOH 37  637  637  HOH HOH E . 
OB 3 HOH 38  638  638  HOH HOH E . 
OB 3 HOH 39  639  640  HOH HOH E . 
OB 3 HOH 40  640  641  HOH HOH E . 
OB 3 HOH 41  641  642  HOH HOH E . 
OB 3 HOH 42  642  643  HOH HOH E . 
OB 3 HOH 43  643  644  HOH HOH E . 
OB 3 HOH 44  644  645  HOH HOH E . 
OB 3 HOH 45  645  646  HOH HOH E . 
OB 3 HOH 46  646  647  HOH HOH E . 
OB 3 HOH 47  647  648  HOH HOH E . 
OB 3 HOH 48  648  649  HOH HOH E . 
OB 3 HOH 49  649  650  HOH HOH E . 
OB 3 HOH 50  650  651  HOH HOH E . 
OB 3 HOH 51  651  652  HOH HOH E . 
OB 3 HOH 52  652  653  HOH HOH E . 
OB 3 HOH 53  653  654  HOH HOH E . 
OB 3 HOH 54  654  655  HOH HOH E . 
OB 3 HOH 55  655  656  HOH HOH E . 
OB 3 HOH 56  656  657  HOH HOH E . 
OB 3 HOH 57  657  658  HOH HOH E . 
OB 3 HOH 58  658  659  HOH HOH E . 
OB 3 HOH 59  659  660  HOH HOH E . 
OB 3 HOH 60  660  661  HOH HOH E . 
OB 3 HOH 61  661  662  HOH HOH E . 
OB 3 HOH 62  662  663  HOH HOH E . 
OB 3 HOH 63  663  664  HOH HOH E . 
OB 3 HOH 64  664  665  HOH HOH E . 
OB 3 HOH 65  665  666  HOH HOH E . 
OB 3 HOH 66  666  667  HOH HOH E . 
OB 3 HOH 67  667  668  HOH HOH E . 
OB 3 HOH 68  668  669  HOH HOH E . 
OB 3 HOH 69  669  670  HOH HOH E . 
OB 3 HOH 70  670  671  HOH HOH E . 
OB 3 HOH 71  671  672  HOH HOH E . 
OB 3 HOH 72  672  673  HOH HOH E . 
OB 3 HOH 73  673  674  HOH HOH E . 
OB 3 HOH 74  674  675  HOH HOH E . 
OB 3 HOH 75  675  676  HOH HOH E . 
OB 3 HOH 76  676  677  HOH HOH E . 
OB 3 HOH 77  677  678  HOH HOH E . 
OB 3 HOH 78  678  679  HOH HOH E . 
OB 3 HOH 79  679  680  HOH HOH E . 
OB 3 HOH 80  680  681  HOH HOH E . 
OB 3 HOH 81  681  682  HOH HOH E . 
OB 3 HOH 82  682  683  HOH HOH E . 
OB 3 HOH 83  683  685  HOH HOH E . 
OB 3 HOH 84  684  686  HOH HOH E . 
OB 3 HOH 85  685  687  HOH HOH E . 
OB 3 HOH 86  686  688  HOH HOH E . 
OB 3 HOH 87  687  689  HOH HOH E . 
OB 3 HOH 88  688  690  HOH HOH E . 
OB 3 HOH 89  689  691  HOH HOH E . 
OB 3 HOH 90  690  692  HOH HOH E . 
OB 3 HOH 91  691  693  HOH HOH E . 
OB 3 HOH 92  692  694  HOH HOH E . 
OB 3 HOH 93  693  695  HOH HOH E . 
OB 3 HOH 94  694  696  HOH HOH E . 
OB 3 HOH 95  695  697  HOH HOH E . 
OB 3 HOH 96  696  698  HOH HOH E . 
OB 3 HOH 97  697  699  HOH HOH E . 
OB 3 HOH 98  698  700  HOH HOH E . 
OB 3 HOH 99  699  701  HOH HOH E . 
OB 3 HOH 100 700  702  HOH HOH E . 
OB 3 HOH 101 701  703  HOH HOH E . 
OB 3 HOH 102 702  704  HOH HOH E . 
OB 3 HOH 103 703  705  HOH HOH E . 
OB 3 HOH 104 704  706  HOH HOH E . 
OB 3 HOH 105 705  707  HOH HOH E . 
OB 3 HOH 106 706  708  HOH HOH E . 
OB 3 HOH 107 707  709  HOH HOH E . 
OB 3 HOH 108 708  710  HOH HOH E . 
OB 3 HOH 109 709  711  HOH HOH E . 
OB 3 HOH 110 710  712  HOH HOH E . 
OB 3 HOH 111 711  713  HOH HOH E . 
OB 3 HOH 112 712  714  HOH HOH E . 
OB 3 HOH 113 713  715  HOH HOH E . 
OB 3 HOH 114 714  716  HOH HOH E . 
OB 3 HOH 115 715  717  HOH HOH E . 
OB 3 HOH 116 716  718  HOH HOH E . 
OB 3 HOH 117 717  719  HOH HOH E . 
OB 3 HOH 118 718  720  HOH HOH E . 
OB 3 HOH 119 719  721  HOH HOH E . 
OB 3 HOH 120 720  722  HOH HOH E . 
OB 3 HOH 121 721  723  HOH HOH E . 
OB 3 HOH 122 722  724  HOH HOH E . 
OB 3 HOH 123 723  725  HOH HOH E . 
OB 3 HOH 124 724  726  HOH HOH E . 
OB 3 HOH 125 725  727  HOH HOH E . 
OB 3 HOH 126 726  728  HOH HOH E . 
OB 3 HOH 127 727  729  HOH HOH E . 
OB 3 HOH 128 728  730  HOH HOH E . 
OB 3 HOH 129 729  731  HOH HOH E . 
OB 3 HOH 130 730  732  HOH HOH E . 
OB 3 HOH 131 731  733  HOH HOH E . 
OB 3 HOH 132 732  734  HOH HOH E . 
OB 3 HOH 133 733  735  HOH HOH E . 
OB 3 HOH 134 734  736  HOH HOH E . 
OB 3 HOH 135 735  737  HOH HOH E . 
OB 3 HOH 136 736  738  HOH HOH E . 
OB 3 HOH 137 737  739  HOH HOH E . 
OB 3 HOH 138 738  740  HOH HOH E . 
OB 3 HOH 139 739  741  HOH HOH E . 
OB 3 HOH 140 740  742  HOH HOH E . 
OB 3 HOH 141 741  743  HOH HOH E . 
OB 3 HOH 142 742  744  HOH HOH E . 
OB 3 HOH 143 743  745  HOH HOH E . 
OB 3 HOH 144 744  746  HOH HOH E . 
OB 3 HOH 145 745  747  HOH HOH E . 
OB 3 HOH 146 746  748  HOH HOH E . 
OB 3 HOH 147 747  750  HOH HOH E . 
OB 3 HOH 148 748  751  HOH HOH E . 
OB 3 HOH 149 749  752  HOH HOH E . 
OB 3 HOH 150 750  753  HOH HOH E . 
OB 3 HOH 151 751  754  HOH HOH E . 
OB 3 HOH 152 752  755  HOH HOH E . 
OB 3 HOH 153 753  756  HOH HOH E . 
OB 3 HOH 154 754  757  HOH HOH E . 
OB 3 HOH 155 755  758  HOH HOH E . 
OB 3 HOH 156 756  759  HOH HOH E . 
OB 3 HOH 157 757  760  HOH HOH E . 
OB 3 HOH 158 758  761  HOH HOH E . 
OB 3 HOH 159 759  762  HOH HOH E . 
OB 3 HOH 160 760  763  HOH HOH E . 
OB 3 HOH 161 761  764  HOH HOH E . 
OB 3 HOH 162 762  765  HOH HOH E . 
OB 3 HOH 163 763  766  HOH HOH E . 
OB 3 HOH 164 764  767  HOH HOH E . 
OB 3 HOH 165 765  768  HOH HOH E . 
OB 3 HOH 166 766  769  HOH HOH E . 
OB 3 HOH 167 767  770  HOH HOH E . 
OB 3 HOH 168 768  771  HOH HOH E . 
OB 3 HOH 169 769  772  HOH HOH E . 
OB 3 HOH 170 770  773  HOH HOH E . 
OB 3 HOH 171 771  774  HOH HOH E . 
OB 3 HOH 172 772  775  HOH HOH E . 
OB 3 HOH 173 773  776  HOH HOH E . 
OB 3 HOH 174 774  777  HOH HOH E . 
OB 3 HOH 175 775  778  HOH HOH E . 
OB 3 HOH 176 776  779  HOH HOH E . 
OB 3 HOH 177 777  780  HOH HOH E . 
OB 3 HOH 178 778  781  HOH HOH E . 
OB 3 HOH 179 779  782  HOH HOH E . 
OB 3 HOH 180 780  783  HOH HOH E . 
OB 3 HOH 181 781  784  HOH HOH E . 
OB 3 HOH 182 782  785  HOH HOH E . 
OB 3 HOH 183 783  786  HOH HOH E . 
OB 3 HOH 184 784  787  HOH HOH E . 
OB 3 HOH 185 785  788  HOH HOH E . 
OB 3 HOH 186 786  789  HOH HOH E . 
OB 3 HOH 187 787  790  HOH HOH E . 
OB 3 HOH 188 788  791  HOH HOH E . 
OB 3 HOH 189 789  792  HOH HOH E . 
OB 3 HOH 190 790  793  HOH HOH E . 
OB 3 HOH 191 791  794  HOH HOH E . 
OB 3 HOH 192 792  795  HOH HOH E . 
OB 3 HOH 193 793  796  HOH HOH E . 
OB 3 HOH 194 794  797  HOH HOH E . 
OB 3 HOH 195 795  798  HOH HOH E . 
OB 3 HOH 196 796  799  HOH HOH E . 
OB 3 HOH 197 797  800  HOH HOH E . 
OB 3 HOH 198 798  801  HOH HOH E . 
OB 3 HOH 199 799  802  HOH HOH E . 
OB 3 HOH 200 800  803  HOH HOH E . 
OB 3 HOH 201 801  804  HOH HOH E . 
OB 3 HOH 202 802  805  HOH HOH E . 
OB 3 HOH 203 803  806  HOH HOH E . 
OB 3 HOH 204 804  807  HOH HOH E . 
OB 3 HOH 205 805  808  HOH HOH E . 
OB 3 HOH 206 806  809  HOH HOH E . 
OB 3 HOH 207 807  810  HOH HOH E . 
OB 3 HOH 208 808  811  HOH HOH E . 
OB 3 HOH 209 809  812  HOH HOH E . 
OB 3 HOH 210 810  813  HOH HOH E . 
OB 3 HOH 211 811  814  HOH HOH E . 
OB 3 HOH 212 812  815  HOH HOH E . 
OB 3 HOH 213 813  816  HOH HOH E . 
OB 3 HOH 214 814  817  HOH HOH E . 
OB 3 HOH 215 815  818  HOH HOH E . 
OB 3 HOH 216 816  819  HOH HOH E . 
OB 3 HOH 217 817  820  HOH HOH E . 
OB 3 HOH 218 818  821  HOH HOH E . 
OB 3 HOH 219 819  822  HOH HOH E . 
OB 3 HOH 220 820  823  HOH HOH E . 
OB 3 HOH 221 821  824  HOH HOH E . 
OB 3 HOH 222 822  825  HOH HOH E . 
OB 3 HOH 223 823  826  HOH HOH E . 
OB 3 HOH 224 824  827  HOH HOH E . 
OB 3 HOH 225 825  828  HOH HOH E . 
OB 3 HOH 226 826  829  HOH HOH E . 
OB 3 HOH 227 827  830  HOH HOH E . 
OB 3 HOH 228 828  831  HOH HOH E . 
OB 3 HOH 229 829  832  HOH HOH E . 
OB 3 HOH 230 830  833  HOH HOH E . 
OB 3 HOH 231 831  834  HOH HOH E . 
OB 3 HOH 232 832  835  HOH HOH E . 
OB 3 HOH 233 833  836  HOH HOH E . 
OB 3 HOH 234 834  837  HOH HOH E . 
OB 3 HOH 235 835  838  HOH HOH E . 
OB 3 HOH 236 836  839  HOH HOH E . 
OB 3 HOH 237 837  840  HOH HOH E . 
OB 3 HOH 238 838  841  HOH HOH E . 
OB 3 HOH 239 839  842  HOH HOH E . 
OB 3 HOH 240 840  843  HOH HOH E . 
OB 3 HOH 241 841  844  HOH HOH E . 
OB 3 HOH 242 842  845  HOH HOH E . 
OB 3 HOH 243 843  846  HOH HOH E . 
OB 3 HOH 244 844  847  HOH HOH E . 
OB 3 HOH 245 845  848  HOH HOH E . 
OB 3 HOH 246 846  849  HOH HOH E . 
OB 3 HOH 247 847  850  HOH HOH E . 
OB 3 HOH 248 848  851  HOH HOH E . 
OB 3 HOH 249 849  852  HOH HOH E . 
OB 3 HOH 250 850  853  HOH HOH E . 
OB 3 HOH 251 851  854  HOH HOH E . 
OB 3 HOH 252 852  855  HOH HOH E . 
OB 3 HOH 253 853  856  HOH HOH E . 
OB 3 HOH 254 854  857  HOH HOH E . 
OB 3 HOH 255 855  858  HOH HOH E . 
OB 3 HOH 256 856  859  HOH HOH E . 
OB 3 HOH 257 857  860  HOH HOH E . 
OB 3 HOH 258 858  861  HOH HOH E . 
OB 3 HOH 259 859  862  HOH HOH E . 
OB 3 HOH 260 860  863  HOH HOH E . 
OB 3 HOH 261 861  864  HOH HOH E . 
OB 3 HOH 262 862  865  HOH HOH E . 
OB 3 HOH 263 863  866  HOH HOH E . 
OB 3 HOH 264 864  867  HOH HOH E . 
OB 3 HOH 265 865  868  HOH HOH E . 
OB 3 HOH 266 866  869  HOH HOH E . 
OB 3 HOH 267 867  870  HOH HOH E . 
OB 3 HOH 268 868  871  HOH HOH E . 
OB 3 HOH 269 869  872  HOH HOH E . 
OB 3 HOH 270 870  873  HOH HOH E . 
OB 3 HOH 271 871  874  HOH HOH E . 
OB 3 HOH 272 872  875  HOH HOH E . 
OB 3 HOH 273 873  876  HOH HOH E . 
OB 3 HOH 274 874  877  HOH HOH E . 
OB 3 HOH 275 875  878  HOH HOH E . 
OB 3 HOH 276 876  879  HOH HOH E . 
OB 3 HOH 277 877  880  HOH HOH E . 
OB 3 HOH 278 878  881  HOH HOH E . 
OB 3 HOH 279 879  882  HOH HOH E . 
OB 3 HOH 280 880  883  HOH HOH E . 
OB 3 HOH 281 881  884  HOH HOH E . 
OB 3 HOH 282 882  885  HOH HOH E . 
OB 3 HOH 283 883  886  HOH HOH E . 
OB 3 HOH 284 884  887  HOH HOH E . 
OB 3 HOH 285 885  888  HOH HOH E . 
OB 3 HOH 286 886  889  HOH HOH E . 
OB 3 HOH 287 887  890  HOH HOH E . 
OB 3 HOH 288 888  891  HOH HOH E . 
OB 3 HOH 289 889  892  HOH HOH E . 
OB 3 HOH 290 890  893  HOH HOH E . 
OB 3 HOH 291 891  894  HOH HOH E . 
OB 3 HOH 292 892  895  HOH HOH E . 
OB 3 HOH 293 893  896  HOH HOH E . 
OB 3 HOH 294 894  897  HOH HOH E . 
OB 3 HOH 295 895  898  HOH HOH E . 
OB 3 HOH 296 896  899  HOH HOH E . 
OB 3 HOH 297 897  900  HOH HOH E . 
OB 3 HOH 298 898  901  HOH HOH E . 
OB 3 HOH 299 899  902  HOH HOH E . 
OB 3 HOH 300 900  903  HOH HOH E . 
OB 3 HOH 301 901  904  HOH HOH E . 
OB 3 HOH 302 902  905  HOH HOH E . 
OB 3 HOH 303 903  906  HOH HOH E . 
OB 3 HOH 304 904  907  HOH HOH E . 
OB 3 HOH 305 905  908  HOH HOH E . 
OB 3 HOH 306 906  909  HOH HOH E . 
OB 3 HOH 307 907  910  HOH HOH E . 
OB 3 HOH 308 908  911  HOH HOH E . 
OB 3 HOH 309 909  912  HOH HOH E . 
OB 3 HOH 310 910  913  HOH HOH E . 
OB 3 HOH 311 911  914  HOH HOH E . 
OB 3 HOH 312 912  915  HOH HOH E . 
OB 3 HOH 313 913  916  HOH HOH E . 
OB 3 HOH 314 914  917  HOH HOH E . 
OB 3 HOH 315 915  918  HOH HOH E . 
OB 3 HOH 316 916  919  HOH HOH E . 
OB 3 HOH 317 917  920  HOH HOH E . 
OB 3 HOH 318 918  921  HOH HOH E . 
OB 3 HOH 319 919  922  HOH HOH E . 
OB 3 HOH 320 920  923  HOH HOH E . 
OB 3 HOH 321 921  924  HOH HOH E . 
OB 3 HOH 322 922  925  HOH HOH E . 
OB 3 HOH 323 923  926  HOH HOH E . 
OB 3 HOH 324 924  927  HOH HOH E . 
OB 3 HOH 325 925  928  HOH HOH E . 
OB 3 HOH 326 926  929  HOH HOH E . 
OB 3 HOH 327 927  930  HOH HOH E . 
OB 3 HOH 328 928  931  HOH HOH E . 
OB 3 HOH 329 929  932  HOH HOH E . 
OB 3 HOH 330 930  933  HOH HOH E . 
OB 3 HOH 331 931  934  HOH HOH E . 
OB 3 HOH 332 932  935  HOH HOH E . 
OB 3 HOH 333 933  936  HOH HOH E . 
OB 3 HOH 334 934  937  HOH HOH E . 
OB 3 HOH 335 935  938  HOH HOH E . 
OB 3 HOH 336 936  939  HOH HOH E . 
OB 3 HOH 337 937  940  HOH HOH E . 
OB 3 HOH 338 938  941  HOH HOH E . 
OB 3 HOH 339 939  942  HOH HOH E . 
OB 3 HOH 340 940  943  HOH HOH E . 
OB 3 HOH 341 941  944  HOH HOH E . 
OB 3 HOH 342 942  945  HOH HOH E . 
OB 3 HOH 343 943  946  HOH HOH E . 
OB 3 HOH 344 944  947  HOH HOH E . 
OB 3 HOH 345 945  948  HOH HOH E . 
OB 3 HOH 346 946  949  HOH HOH E . 
OB 3 HOH 347 947  950  HOH HOH E . 
OB 3 HOH 348 948  951  HOH HOH E . 
OB 3 HOH 349 949  952  HOH HOH E . 
OB 3 HOH 350 950  953  HOH HOH E . 
OB 3 HOH 351 951  954  HOH HOH E . 
OB 3 HOH 352 952  955  HOH HOH E . 
OB 3 HOH 353 953  956  HOH HOH E . 
OB 3 HOH 354 954  957  HOH HOH E . 
OB 3 HOH 355 955  958  HOH HOH E . 
OB 3 HOH 356 956  959  HOH HOH E . 
OB 3 HOH 357 957  960  HOH HOH E . 
OB 3 HOH 358 958  961  HOH HOH E . 
OB 3 HOH 359 959  962  HOH HOH E . 
OB 3 HOH 360 960  963  HOH HOH E . 
OB 3 HOH 361 961  964  HOH HOH E . 
OB 3 HOH 362 962  965  HOH HOH E . 
OB 3 HOH 363 963  966  HOH HOH E . 
OB 3 HOH 364 964  967  HOH HOH E . 
OB 3 HOH 365 965  968  HOH HOH E . 
OB 3 HOH 366 966  969  HOH HOH E . 
OB 3 HOH 367 967  970  HOH HOH E . 
OB 3 HOH 368 968  971  HOH HOH E . 
OB 3 HOH 369 969  972  HOH HOH E . 
OB 3 HOH 370 970  973  HOH HOH E . 
OB 3 HOH 371 971  974  HOH HOH E . 
OB 3 HOH 372 972  975  HOH HOH E . 
OB 3 HOH 373 973  976  HOH HOH E . 
OB 3 HOH 374 974  977  HOH HOH E . 
OB 3 HOH 375 975  978  HOH HOH E . 
OB 3 HOH 376 976  979  HOH HOH E . 
OB 3 HOH 377 977  980  HOH HOH E . 
OB 3 HOH 378 978  981  HOH HOH E . 
OB 3 HOH 379 979  982  HOH HOH E . 
OB 3 HOH 380 980  983  HOH HOH E . 
OB 3 HOH 381 981  984  HOH HOH E . 
OB 3 HOH 382 982  985  HOH HOH E . 
OB 3 HOH 383 983  986  HOH HOH E . 
OB 3 HOH 384 984  987  HOH HOH E . 
OB 3 HOH 385 985  988  HOH HOH E . 
OB 3 HOH 386 986  989  HOH HOH E . 
OB 3 HOH 387 987  990  HOH HOH E . 
OB 3 HOH 388 988  991  HOH HOH E . 
OB 3 HOH 389 989  992  HOH HOH E . 
OB 3 HOH 390 990  993  HOH HOH E . 
OB 3 HOH 391 991  994  HOH HOH E . 
OB 3 HOH 392 992  995  HOH HOH E . 
OB 3 HOH 393 993  996  HOH HOH E . 
OB 3 HOH 394 994  997  HOH HOH E . 
OB 3 HOH 395 995  998  HOH HOH E . 
OB 3 HOH 396 996  999  HOH HOH E . 
OB 3 HOH 397 997  1000 HOH HOH E . 
OB 3 HOH 398 998  1001 HOH HOH E . 
OB 3 HOH 399 999  1002 HOH HOH E . 
OB 3 HOH 400 1000 1003 HOH HOH E . 
OB 3 HOH 401 1001 1004 HOH HOH E . 
OB 3 HOH 402 1002 1005 HOH HOH E . 
OB 3 HOH 403 1003 1006 HOH HOH E . 
OB 3 HOH 404 1004 1007 HOH HOH E . 
OB 3 HOH 405 1005 1008 HOH HOH E . 
OB 3 HOH 406 1006 1009 HOH HOH E . 
OB 3 HOH 407 1007 1010 HOH HOH E . 
OB 3 HOH 408 1008 1011 HOH HOH E . 
OB 3 HOH 409 1009 1012 HOH HOH E . 
OB 3 HOH 410 1010 1013 HOH HOH E . 
OB 3 HOH 411 1011 1014 HOH HOH E . 
OB 3 HOH 412 1012 1015 HOH HOH E . 
OB 3 HOH 413 1013 1016 HOH HOH E . 
OB 3 HOH 414 1014 1017 HOH HOH E . 
OB 3 HOH 415 1015 1018 HOH HOH E . 
OB 3 HOH 416 1016 1019 HOH HOH E . 
OB 3 HOH 417 1017 1020 HOH HOH E . 
OB 3 HOH 418 1018 1021 HOH HOH E . 
OB 3 HOH 419 1019 1022 HOH HOH E . 
OB 3 HOH 420 1020 639  HOH HOH E . 
OB 3 HOH 421 1021 1023 HOH HOH E . 
OB 3 HOH 422 1022 1024 HOH HOH E . 
OB 3 HOH 423 1023 1025 HOH HOH E . 
OB 3 HOH 424 1024 1026 HOH HOH E . 
OB 3 HOH 425 1025 1027 HOH HOH E . 
OB 3 HOH 426 1026 1028 HOH HOH E . 
OB 3 HOH 427 1027 1029 HOH HOH E . 
OB 3 HOH 428 1028 1030 HOH HOH E . 
OB 3 HOH 429 1029 1031 HOH HOH E . 
OB 3 HOH 430 1030 1032 HOH HOH E . 
OB 3 HOH 431 1031 1033 HOH HOH E . 
OB 3 HOH 432 1032 1034 HOH HOH E . 
OB 3 HOH 433 1033 1035 HOH HOH E . 
OB 3 HOH 434 1034 1036 HOH HOH E . 
OB 3 HOH 435 1035 1037 HOH HOH E . 
OB 3 HOH 436 1036 1038 HOH HOH E . 
OB 3 HOH 437 1037 1039 HOH HOH E . 
OB 3 HOH 438 1038 1040 HOH HOH E . 
OB 3 HOH 439 1039 1041 HOH HOH E . 
OB 3 HOH 440 1040 1042 HOH HOH E . 
OB 3 HOH 441 1041 1043 HOH HOH E . 
OB 3 HOH 442 1042 1044 HOH HOH E . 
OB 3 HOH 443 1043 1045 HOH HOH E . 
OB 3 HOH 444 1044 1046 HOH HOH E . 
OB 3 HOH 445 1045 1047 HOH HOH E . 
OB 3 HOH 446 1046 1048 HOH HOH E . 
OB 3 HOH 447 1047 1049 HOH HOH E . 
OB 3 HOH 448 1048 1050 HOH HOH E . 
OB 3 HOH 449 1049 1051 HOH HOH E . 
OB 3 HOH 450 1050 1052 HOH HOH E . 
OB 3 HOH 451 1051 1053 HOH HOH E . 
OB 3 HOH 452 1052 1054 HOH HOH E . 
OB 3 HOH 453 1053 1055 HOH HOH E . 
OB 3 HOH 454 1054 1056 HOH HOH E . 
OB 3 HOH 455 1055 1057 HOH HOH E . 
OB 3 HOH 456 1056 1058 HOH HOH E . 
OB 3 HOH 457 1057 1059 HOH HOH E . 
OB 3 HOH 458 1058 1060 HOH HOH E . 
OB 3 HOH 459 1059 1061 HOH HOH E . 
OB 3 HOH 460 1060 1062 HOH HOH E . 
OB 3 HOH 461 1061 1063 HOH HOH E . 
OB 3 HOH 462 1062 1064 HOH HOH E . 
OB 3 HOH 463 1063 1065 HOH HOH E . 
OB 3 HOH 464 1064 1066 HOH HOH E . 
OB 3 HOH 465 1065 1067 HOH HOH E . 
OB 3 HOH 466 1066 1068 HOH HOH E . 
OB 3 HOH 467 1067 1069 HOH HOH E . 
OB 3 HOH 468 1068 1070 HOH HOH E . 
OB 3 HOH 469 1069 1071 HOH HOH E . 
OB 3 HOH 470 1070 1072 HOH HOH E . 
OB 3 HOH 471 1071 1073 HOH HOH E . 
OB 3 HOH 472 1072 1074 HOH HOH E . 
OB 3 HOH 473 1073 1075 HOH HOH E . 
OB 3 HOH 474 1074 1076 HOH HOH E . 
OB 3 HOH 475 1075 1077 HOH HOH E . 
OB 3 HOH 476 1076 1078 HOH HOH E . 
OB 3 HOH 477 1077 1079 HOH HOH E . 
OB 3 HOH 478 1078 1080 HOH HOH E . 
OB 3 HOH 479 1079 1081 HOH HOH E . 
OB 3 HOH 480 1080 1082 HOH HOH E . 
OB 3 HOH 481 1081 1083 HOH HOH E . 
OB 3 HOH 482 1082 1084 HOH HOH E . 
OB 3 HOH 483 1083 1085 HOH HOH E . 
OB 3 HOH 484 1084 1086 HOH HOH E . 
OB 3 HOH 485 1085 1087 HOH HOH E . 
OB 3 HOH 486 1086 1088 HOH HOH E . 
OB 3 HOH 487 1087 1089 HOH HOH E . 
OB 3 HOH 488 1088 1090 HOH HOH E . 
OB 3 HOH 489 1089 1091 HOH HOH E . 
OB 3 HOH 490 1090 1092 HOH HOH E . 
OB 3 HOH 491 1091 1093 HOH HOH E . 
OB 3 HOH 492 1092 1094 HOH HOH E . 
OB 3 HOH 493 1093 1095 HOH HOH E . 
OB 3 HOH 494 1094 1096 HOH HOH E . 
OB 3 HOH 495 1095 1097 HOH HOH E . 
OB 3 HOH 496 1096 1098 HOH HOH E . 
OB 3 HOH 497 1097 1099 HOH HOH E . 
OB 3 HOH 498 1098 1100 HOH HOH E . 
OB 3 HOH 499 1099 1101 HOH HOH E . 
OB 3 HOH 500 1100 1102 HOH HOH E . 
OB 3 HOH 501 1101 1103 HOH HOH E . 
OB 3 HOH 502 1102 1104 HOH HOH E . 
OB 3 HOH 503 1103 1105 HOH HOH E . 
OB 3 HOH 504 1104 1106 HOH HOH E . 
OB 3 HOH 505 1105 1107 HOH HOH E . 
OB 3 HOH 506 1106 1108 HOH HOH E . 
OB 3 HOH 507 1107 1109 HOH HOH E . 
OB 3 HOH 508 1108 1110 HOH HOH E . 
OB 3 HOH 509 1109 1111 HOH HOH E . 
OB 3 HOH 510 1110 1112 HOH HOH E . 
OB 3 HOH 511 1111 1113 HOH HOH E . 
OB 3 HOH 512 1112 1114 HOH HOH E . 
OB 3 HOH 513 1113 1115 HOH HOH E . 
OB 3 HOH 514 1114 1116 HOH HOH E . 
OB 3 HOH 515 1115 1117 HOH HOH E . 
OB 3 HOH 516 1116 1118 HOH HOH E . 
OB 3 HOH 517 1117 1119 HOH HOH E . 
OB 3 HOH 518 1118 1120 HOH HOH E . 
OB 3 HOH 519 1119 1121 HOH HOH E . 
OB 3 HOH 520 1120 1122 HOH HOH E . 
OB 3 HOH 521 1121 1123 HOH HOH E . 
OB 3 HOH 522 1122 1124 HOH HOH E . 
OB 3 HOH 523 1123 1125 HOH HOH E . 
OB 3 HOH 524 1124 1126 HOH HOH E . 
OB 3 HOH 525 1125 1127 HOH HOH E . 
OB 3 HOH 526 1126 1128 HOH HOH E . 
OB 3 HOH 527 1127 1129 HOH HOH E . 
OB 3 HOH 528 1128 1130 HOH HOH E . 
OB 3 HOH 529 1129 1131 HOH HOH E . 
OB 3 HOH 530 1130 1132 HOH HOH E . 
OB 3 HOH 531 1131 1133 HOH HOH E . 
OB 3 HOH 532 1132 1134 HOH HOH E . 
OB 3 HOH 533 1133 1135 HOH HOH E . 
OB 3 HOH 534 1134 1136 HOH HOH E . 
OB 3 HOH 535 1135 1137 HOH HOH E . 
OB 3 HOH 536 1136 1138 HOH HOH E . 
OB 3 HOH 537 1137 1139 HOH HOH E . 
OB 3 HOH 538 1138 1140 HOH HOH E . 
OB 3 HOH 539 1139 1141 HOH HOH E . 
OB 3 HOH 540 1140 1142 HOH HOH E . 
OB 3 HOH 541 1141 1143 HOH HOH E . 
OB 3 HOH 542 1142 1144 HOH HOH E . 
OB 3 HOH 543 1143 1145 HOH HOH E . 
OB 3 HOH 544 1144 1146 HOH HOH E . 
OB 3 HOH 545 1145 1147 HOH HOH E . 
OB 3 HOH 546 1146 1148 HOH HOH E . 
OB 3 HOH 547 1147 1149 HOH HOH E . 
OB 3 HOH 548 1148 1150 HOH HOH E . 
OB 3 HOH 549 1149 1151 HOH HOH E . 
OB 3 HOH 550 1150 1152 HOH HOH E . 
OB 3 HOH 551 1151 1153 HOH HOH E . 
OB 3 HOH 552 1152 1154 HOH HOH E . 
OB 3 HOH 553 1153 1155 HOH HOH E . 
OB 3 HOH 554 1154 1156 HOH HOH E . 
OB 3 HOH 555 1155 1157 HOH HOH E . 
OB 3 HOH 556 1156 1158 HOH HOH E . 
OB 3 HOH 557 1157 1159 HOH HOH E . 
OB 3 HOH 558 1158 1160 HOH HOH E . 
OB 3 HOH 559 1159 1161 HOH HOH E . 
OB 3 HOH 560 1160 1162 HOH HOH E . 
OB 3 HOH 561 1161 1163 HOH HOH E . 
OB 3 HOH 562 1162 684  HOH HOH E . 
OB 3 HOH 563 1163 1164 HOH HOH E . 
OB 3 HOH 564 1164 1165 HOH HOH E . 
OB 3 HOH 565 1165 1166 HOH HOH E . 
OB 3 HOH 566 1166 749  HOH HOH E . 
OB 3 HOH 567 1167 1167 HOH HOH E . 
OB 3 HOH 568 1168 1168 HOH HOH E . 
OB 3 HOH 569 1169 1169 HOH HOH E . 
OB 3 HOH 570 1170 1170 HOH HOH E . 
OB 3 HOH 571 1171 1171 HOH HOH E . 
OB 3 HOH 572 1172 1172 HOH HOH E . 
OB 3 HOH 573 1173 1173 HOH HOH E . 
OB 3 HOH 574 1174 1174 HOH HOH E . 
OB 3 HOH 575 1175 1175 HOH HOH E . 
OB 3 HOH 576 1176 1176 HOH HOH E . 
OB 3 HOH 577 1177 1177 HOH HOH E . 
OB 3 HOH 578 1178 1178 HOH HOH E . 
OB 3 HOH 579 1179 1179 HOH HOH E . 
OB 3 HOH 580 1180 1180 HOH HOH E . 
OB 3 HOH 581 1181 1181 HOH HOH E . 
OB 3 HOH 582 1182 1182 HOH HOH E . 
OB 3 HOH 583 1183 1183 HOH HOH E . 
OB 3 HOH 584 1184 1184 HOH HOH E . 
OB 3 HOH 585 1185 1185 HOH HOH E . 
OB 3 HOH 586 1186 1186 HOH HOH E . 
OB 3 HOH 587 1187 1187 HOH HOH E . 
PB 3 HOH 1   601  601  HOH HOH H . 
PB 3 HOH 2   602  602  HOH HOH H . 
PB 3 HOH 3   603  603  HOH HOH H . 
PB 3 HOH 4   604  604  HOH HOH H . 
PB 3 HOH 5   605  605  HOH HOH H . 
PB 3 HOH 6   606  606  HOH HOH H . 
PB 3 HOH 7   607  607  HOH HOH H . 
PB 3 HOH 8   608  608  HOH HOH H . 
PB 3 HOH 9   609  609  HOH HOH H . 
PB 3 HOH 10  610  610  HOH HOH H . 
PB 3 HOH 11  611  611  HOH HOH H . 
PB 3 HOH 12  612  612  HOH HOH H . 
PB 3 HOH 13  613  613  HOH HOH H . 
PB 3 HOH 14  614  614  HOH HOH H . 
PB 3 HOH 15  615  615  HOH HOH H . 
PB 3 HOH 16  616  616  HOH HOH H . 
PB 3 HOH 17  617  617  HOH HOH H . 
PB 3 HOH 18  618  618  HOH HOH H . 
PB 3 HOH 19  619  619  HOH HOH H . 
PB 3 HOH 20  620  620  HOH HOH H . 
PB 3 HOH 21  621  621  HOH HOH H . 
PB 3 HOH 22  622  622  HOH HOH H . 
PB 3 HOH 23  623  623  HOH HOH H . 
PB 3 HOH 24  624  624  HOH HOH H . 
PB 3 HOH 25  625  625  HOH HOH H . 
PB 3 HOH 26  626  626  HOH HOH H . 
PB 3 HOH 27  627  627  HOH HOH H . 
PB 3 HOH 28  628  628  HOH HOH H . 
PB 3 HOH 29  629  629  HOH HOH H . 
PB 3 HOH 30  630  630  HOH HOH H . 
PB 3 HOH 31  631  631  HOH HOH H . 
PB 3 HOH 32  632  632  HOH HOH H . 
PB 3 HOH 33  633  633  HOH HOH H . 
PB 3 HOH 34  634  634  HOH HOH H . 
PB 3 HOH 35  635  635  HOH HOH H . 
PB 3 HOH 36  636  636  HOH HOH H . 
PB 3 HOH 37  637  637  HOH HOH H . 
PB 3 HOH 38  638  638  HOH HOH H . 
PB 3 HOH 39  639  639  HOH HOH H . 
PB 3 HOH 40  640  640  HOH HOH H . 
PB 3 HOH 41  641  641  HOH HOH H . 
PB 3 HOH 42  642  642  HOH HOH H . 
PB 3 HOH 43  643  643  HOH HOH H . 
PB 3 HOH 44  644  644  HOH HOH H . 
PB 3 HOH 45  645  645  HOH HOH H . 
PB 3 HOH 46  646  646  HOH HOH H . 
PB 3 HOH 47  647  647  HOH HOH H . 
PB 3 HOH 48  648  648  HOH HOH H . 
PB 3 HOH 49  649  649  HOH HOH H . 
PB 3 HOH 50  650  650  HOH HOH H . 
PB 3 HOH 51  651  651  HOH HOH H . 
PB 3 HOH 52  652  652  HOH HOH H . 
PB 3 HOH 53  653  653  HOH HOH H . 
PB 3 HOH 54  654  654  HOH HOH H . 
PB 3 HOH 55  655  655  HOH HOH H . 
PB 3 HOH 56  656  656  HOH HOH H . 
PB 3 HOH 57  657  657  HOH HOH H . 
PB 3 HOH 58  658  658  HOH HOH H . 
PB 3 HOH 59  659  659  HOH HOH H . 
PB 3 HOH 60  660  660  HOH HOH H . 
PB 3 HOH 61  661  661  HOH HOH H . 
PB 3 HOH 62  662  662  HOH HOH H . 
PB 3 HOH 63  663  663  HOH HOH H . 
PB 3 HOH 64  664  664  HOH HOH H . 
PB 3 HOH 65  665  665  HOH HOH H . 
PB 3 HOH 66  666  666  HOH HOH H . 
PB 3 HOH 67  667  667  HOH HOH H . 
PB 3 HOH 68  668  668  HOH HOH H . 
PB 3 HOH 69  669  669  HOH HOH H . 
PB 3 HOH 70  670  670  HOH HOH H . 
PB 3 HOH 71  671  671  HOH HOH H . 
PB 3 HOH 72  672  672  HOH HOH H . 
PB 3 HOH 73  673  673  HOH HOH H . 
PB 3 HOH 74  674  674  HOH HOH H . 
PB 3 HOH 75  675  675  HOH HOH H . 
PB 3 HOH 76  676  676  HOH HOH H . 
PB 3 HOH 77  677  677  HOH HOH H . 
PB 3 HOH 78  678  678  HOH HOH H . 
PB 3 HOH 79  679  679  HOH HOH H . 
PB 3 HOH 80  680  680  HOH HOH H . 
PB 3 HOH 81  681  681  HOH HOH H . 
PB 3 HOH 82  682  682  HOH HOH H . 
PB 3 HOH 83  683  683  HOH HOH H . 
PB 3 HOH 84  684  684  HOH HOH H . 
PB 3 HOH 85  685  685  HOH HOH H . 
PB 3 HOH 86  686  686  HOH HOH H . 
PB 3 HOH 87  687  687  HOH HOH H . 
PB 3 HOH 88  688  688  HOH HOH H . 
PB 3 HOH 89  689  689  HOH HOH H . 
PB 3 HOH 90  690  690  HOH HOH H . 
PB 3 HOH 91  691  691  HOH HOH H . 
PB 3 HOH 92  692  692  HOH HOH H . 
PB 3 HOH 93  693  693  HOH HOH H . 
PB 3 HOH 94  694  694  HOH HOH H . 
PB 3 HOH 95  695  695  HOH HOH H . 
PB 3 HOH 96  696  696  HOH HOH H . 
PB 3 HOH 97  697  697  HOH HOH H . 
PB 3 HOH 98  698  698  HOH HOH H . 
PB 3 HOH 99  699  699  HOH HOH H . 
PB 3 HOH 100 700  700  HOH HOH H . 
PB 3 HOH 101 701  701  HOH HOH H . 
PB 3 HOH 102 702  702  HOH HOH H . 
PB 3 HOH 103 703  703  HOH HOH H . 
PB 3 HOH 104 704  704  HOH HOH H . 
PB 3 HOH 105 705  705  HOH HOH H . 
PB 3 HOH 106 706  706  HOH HOH H . 
PB 3 HOH 107 707  707  HOH HOH H . 
PB 3 HOH 108 708  708  HOH HOH H . 
PB 3 HOH 109 709  709  HOH HOH H . 
PB 3 HOH 110 710  710  HOH HOH H . 
PB 3 HOH 111 711  711  HOH HOH H . 
PB 3 HOH 112 712  712  HOH HOH H . 
PB 3 HOH 113 713  713  HOH HOH H . 
PB 3 HOH 114 714  714  HOH HOH H . 
PB 3 HOH 115 715  715  HOH HOH H . 
PB 3 HOH 116 716  716  HOH HOH H . 
PB 3 HOH 117 717  717  HOH HOH H . 
PB 3 HOH 118 718  718  HOH HOH H . 
PB 3 HOH 119 719  719  HOH HOH H . 
PB 3 HOH 120 720  720  HOH HOH H . 
PB 3 HOH 121 721  721  HOH HOH H . 
PB 3 HOH 122 722  722  HOH HOH H . 
PB 3 HOH 123 723  723  HOH HOH H . 
PB 3 HOH 124 724  724  HOH HOH H . 
PB 3 HOH 125 725  725  HOH HOH H . 
PB 3 HOH 126 726  726  HOH HOH H . 
PB 3 HOH 127 727  727  HOH HOH H . 
PB 3 HOH 128 728  728  HOH HOH H . 
PB 3 HOH 129 729  729  HOH HOH H . 
PB 3 HOH 130 730  730  HOH HOH H . 
PB 3 HOH 131 731  731  HOH HOH H . 
PB 3 HOH 132 732  732  HOH HOH H . 
PB 3 HOH 133 733  733  HOH HOH H . 
PB 3 HOH 134 734  734  HOH HOH H . 
PB 3 HOH 135 735  735  HOH HOH H . 
PB 3 HOH 136 736  736  HOH HOH H . 
PB 3 HOH 137 737  737  HOH HOH H . 
PB 3 HOH 138 738  738  HOH HOH H . 
PB 3 HOH 139 739  739  HOH HOH H . 
PB 3 HOH 140 740  740  HOH HOH H . 
PB 3 HOH 141 741  741  HOH HOH H . 
PB 3 HOH 142 742  742  HOH HOH H . 
PB 3 HOH 143 743  743  HOH HOH H . 
PB 3 HOH 144 744  744  HOH HOH H . 
PB 3 HOH 145 745  745  HOH HOH H . 
PB 3 HOH 146 746  746  HOH HOH H . 
PB 3 HOH 147 747  747  HOH HOH H . 
PB 3 HOH 148 748  748  HOH HOH H . 
PB 3 HOH 149 749  749  HOH HOH H . 
PB 3 HOH 150 750  750  HOH HOH H . 
PB 3 HOH 151 751  751  HOH HOH H . 
PB 3 HOH 152 752  752  HOH HOH H . 
PB 3 HOH 153 753  753  HOH HOH H . 
PB 3 HOH 154 754  754  HOH HOH H . 
PB 3 HOH 155 755  755  HOH HOH H . 
PB 3 HOH 156 756  756  HOH HOH H . 
PB 3 HOH 157 757  757  HOH HOH H . 
PB 3 HOH 158 758  758  HOH HOH H . 
PB 3 HOH 159 759  759  HOH HOH H . 
PB 3 HOH 160 760  760  HOH HOH H . 
PB 3 HOH 161 761  761  HOH HOH H . 
PB 3 HOH 162 762  762  HOH HOH H . 
PB 3 HOH 163 763  763  HOH HOH H . 
PB 3 HOH 164 764  764  HOH HOH H . 
PB 3 HOH 165 765  765  HOH HOH H . 
PB 3 HOH 166 766  766  HOH HOH H . 
PB 3 HOH 167 767  767  HOH HOH H . 
PB 3 HOH 168 768  768  HOH HOH H . 
PB 3 HOH 169 769  769  HOH HOH H . 
PB 3 HOH 170 770  770  HOH HOH H . 
PB 3 HOH 171 771  771  HOH HOH H . 
PB 3 HOH 172 772  772  HOH HOH H . 
PB 3 HOH 173 773  773  HOH HOH H . 
PB 3 HOH 174 774  774  HOH HOH H . 
PB 3 HOH 175 775  775  HOH HOH H . 
PB 3 HOH 176 776  776  HOH HOH H . 
PB 3 HOH 177 777  777  HOH HOH H . 
PB 3 HOH 178 778  778  HOH HOH H . 
PB 3 HOH 179 779  779  HOH HOH H . 
PB 3 HOH 180 780  780  HOH HOH H . 
PB 3 HOH 181 781  781  HOH HOH H . 
PB 3 HOH 182 782  782  HOH HOH H . 
PB 3 HOH 183 783  783  HOH HOH H . 
PB 3 HOH 184 784  784  HOH HOH H . 
PB 3 HOH 185 785  785  HOH HOH H . 
PB 3 HOH 186 786  786  HOH HOH H . 
PB 3 HOH 187 787  787  HOH HOH H . 
PB 3 HOH 188 788  788  HOH HOH H . 
PB 3 HOH 189 789  789  HOH HOH H . 
PB 3 HOH 190 790  790  HOH HOH H . 
PB 3 HOH 191 791  791  HOH HOH H . 
PB 3 HOH 192 792  792  HOH HOH H . 
PB 3 HOH 193 793  793  HOH HOH H . 
PB 3 HOH 194 794  794  HOH HOH H . 
PB 3 HOH 195 795  795  HOH HOH H . 
PB 3 HOH 196 796  796  HOH HOH H . 
PB 3 HOH 197 797  797  HOH HOH H . 
PB 3 HOH 198 798  798  HOH HOH H . 
PB 3 HOH 199 799  799  HOH HOH H . 
PB 3 HOH 200 800  800  HOH HOH H . 
PB 3 HOH 201 801  801  HOH HOH H . 
PB 3 HOH 202 802  802  HOH HOH H . 
PB 3 HOH 203 803  803  HOH HOH H . 
PB 3 HOH 204 804  804  HOH HOH H . 
PB 3 HOH 205 805  805  HOH HOH H . 
PB 3 HOH 206 806  806  HOH HOH H . 
PB 3 HOH 207 807  807  HOH HOH H . 
PB 3 HOH 208 808  808  HOH HOH H . 
PB 3 HOH 209 809  809  HOH HOH H . 
PB 3 HOH 210 810  810  HOH HOH H . 
PB 3 HOH 211 811  811  HOH HOH H . 
PB 3 HOH 212 812  812  HOH HOH H . 
PB 3 HOH 213 813  813  HOH HOH H . 
PB 3 HOH 214 814  814  HOH HOH H . 
PB 3 HOH 215 815  815  HOH HOH H . 
PB 3 HOH 216 816  816  HOH HOH H . 
PB 3 HOH 217 817  817  HOH HOH H . 
PB 3 HOH 218 818  818  HOH HOH H . 
PB 3 HOH 219 819  819  HOH HOH H . 
PB 3 HOH 220 820  820  HOH HOH H . 
PB 3 HOH 221 821  821  HOH HOH H . 
PB 3 HOH 222 822  822  HOH HOH H . 
PB 3 HOH 223 823  823  HOH HOH H . 
PB 3 HOH 224 824  824  HOH HOH H . 
PB 3 HOH 225 825  825  HOH HOH H . 
PB 3 HOH 226 826  826  HOH HOH H . 
PB 3 HOH 227 827  827  HOH HOH H . 
PB 3 HOH 228 828  828  HOH HOH H . 
PB 3 HOH 229 829  829  HOH HOH H . 
PB 3 HOH 230 830  830  HOH HOH H . 
PB 3 HOH 231 831  831  HOH HOH H . 
PB 3 HOH 232 832  832  HOH HOH H . 
PB 3 HOH 233 833  833  HOH HOH H . 
PB 3 HOH 234 834  834  HOH HOH H . 
PB 3 HOH 235 835  835  HOH HOH H . 
PB 3 HOH 236 836  836  HOH HOH H . 
PB 3 HOH 237 837  837  HOH HOH H . 
PB 3 HOH 238 838  838  HOH HOH H . 
PB 3 HOH 239 839  839  HOH HOH H . 
PB 3 HOH 240 840  840  HOH HOH H . 
PB 3 HOH 241 841  841  HOH HOH H . 
PB 3 HOH 242 842  842  HOH HOH H . 
PB 3 HOH 243 843  843  HOH HOH H . 
PB 3 HOH 244 844  844  HOH HOH H . 
PB 3 HOH 245 845  845  HOH HOH H . 
PB 3 HOH 246 846  846  HOH HOH H . 
PB 3 HOH 247 847  847  HOH HOH H . 
PB 3 HOH 248 848  848  HOH HOH H . 
PB 3 HOH 249 849  849  HOH HOH H . 
PB 3 HOH 250 850  850  HOH HOH H . 
PB 3 HOH 251 851  851  HOH HOH H . 
PB 3 HOH 252 852  852  HOH HOH H . 
PB 3 HOH 253 853  853  HOH HOH H . 
PB 3 HOH 254 854  854  HOH HOH H . 
PB 3 HOH 255 855  855  HOH HOH H . 
PB 3 HOH 256 856  856  HOH HOH H . 
PB 3 HOH 257 857  857  HOH HOH H . 
PB 3 HOH 258 858  858  HOH HOH H . 
PB 3 HOH 259 859  859  HOH HOH H . 
PB 3 HOH 260 860  860  HOH HOH H . 
PB 3 HOH 261 861  861  HOH HOH H . 
PB 3 HOH 262 862  862  HOH HOH H . 
PB 3 HOH 263 863  863  HOH HOH H . 
PB 3 HOH 264 864  864  HOH HOH H . 
PB 3 HOH 265 865  865  HOH HOH H . 
PB 3 HOH 266 866  866  HOH HOH H . 
PB 3 HOH 267 867  867  HOH HOH H . 
PB 3 HOH 268 868  868  HOH HOH H . 
PB 3 HOH 269 869  869  HOH HOH H . 
PB 3 HOH 270 870  870  HOH HOH H . 
PB 3 HOH 271 871  871  HOH HOH H . 
PB 3 HOH 272 872  872  HOH HOH H . 
PB 3 HOH 273 873  873  HOH HOH H . 
PB 3 HOH 274 874  874  HOH HOH H . 
PB 3 HOH 275 875  875  HOH HOH H . 
PB 3 HOH 276 876  876  HOH HOH H . 
PB 3 HOH 277 877  877  HOH HOH H . 
PB 3 HOH 278 878  878  HOH HOH H . 
PB 3 HOH 279 879  879  HOH HOH H . 
PB 3 HOH 280 880  880  HOH HOH H . 
PB 3 HOH 281 881  881  HOH HOH H . 
PB 3 HOH 282 882  882  HOH HOH H . 
PB 3 HOH 283 883  883  HOH HOH H . 
PB 3 HOH 284 884  884  HOH HOH H . 
PB 3 HOH 285 885  885  HOH HOH H . 
PB 3 HOH 286 886  886  HOH HOH H . 
PB 3 HOH 287 887  887  HOH HOH H . 
PB 3 HOH 288 888  888  HOH HOH H . 
PB 3 HOH 289 889  889  HOH HOH H . 
PB 3 HOH 290 890  890  HOH HOH H . 
PB 3 HOH 291 891  891  HOH HOH H . 
PB 3 HOH 292 892  892  HOH HOH H . 
PB 3 HOH 293 893  893  HOH HOH H . 
PB 3 HOH 294 894  894  HOH HOH H . 
PB 3 HOH 295 895  895  HOH HOH H . 
PB 3 HOH 296 896  896  HOH HOH H . 
PB 3 HOH 297 897  897  HOH HOH H . 
PB 3 HOH 298 898  898  HOH HOH H . 
PB 3 HOH 299 899  899  HOH HOH H . 
PB 3 HOH 300 900  900  HOH HOH H . 
PB 3 HOH 301 901  901  HOH HOH H . 
PB 3 HOH 302 902  902  HOH HOH H . 
PB 3 HOH 303 903  903  HOH HOH H . 
PB 3 HOH 304 904  904  HOH HOH H . 
PB 3 HOH 305 905  905  HOH HOH H . 
PB 3 HOH 306 906  906  HOH HOH H . 
PB 3 HOH 307 907  907  HOH HOH H . 
PB 3 HOH 308 908  908  HOH HOH H . 
PB 3 HOH 309 909  909  HOH HOH H . 
PB 3 HOH 310 910  910  HOH HOH H . 
PB 3 HOH 311 911  911  HOH HOH H . 
PB 3 HOH 312 912  912  HOH HOH H . 
PB 3 HOH 313 913  913  HOH HOH H . 
PB 3 HOH 314 914  914  HOH HOH H . 
PB 3 HOH 315 915  915  HOH HOH H . 
PB 3 HOH 316 916  916  HOH HOH H . 
PB 3 HOH 317 917  917  HOH HOH H . 
PB 3 HOH 318 918  918  HOH HOH H . 
PB 3 HOH 319 919  919  HOH HOH H . 
PB 3 HOH 320 920  920  HOH HOH H . 
PB 3 HOH 321 921  921  HOH HOH H . 
PB 3 HOH 322 922  922  HOH HOH H . 
PB 3 HOH 323 923  923  HOH HOH H . 
PB 3 HOH 324 924  924  HOH HOH H . 
PB 3 HOH 325 925  925  HOH HOH H . 
PB 3 HOH 326 926  926  HOH HOH H . 
PB 3 HOH 327 927  927  HOH HOH H . 
PB 3 HOH 328 928  928  HOH HOH H . 
PB 3 HOH 329 929  929  HOH HOH H . 
PB 3 HOH 330 930  930  HOH HOH H . 
PB 3 HOH 331 931  931  HOH HOH H . 
PB 3 HOH 332 932  932  HOH HOH H . 
PB 3 HOH 333 933  933  HOH HOH H . 
PB 3 HOH 334 934  934  HOH HOH H . 
PB 3 HOH 335 935  935  HOH HOH H . 
PB 3 HOH 336 936  936  HOH HOH H . 
PB 3 HOH 337 937  937  HOH HOH H . 
PB 3 HOH 338 938  938  HOH HOH H . 
PB 3 HOH 339 939  939  HOH HOH H . 
PB 3 HOH 340 940  940  HOH HOH H . 
PB 3 HOH 341 941  941  HOH HOH H . 
PB 3 HOH 342 942  942  HOH HOH H . 
PB 3 HOH 343 943  943  HOH HOH H . 
PB 3 HOH 344 944  944  HOH HOH H . 
PB 3 HOH 345 945  945  HOH HOH H . 
PB 3 HOH 346 946  946  HOH HOH H . 
PB 3 HOH 347 947  947  HOH HOH H . 
PB 3 HOH 348 948  948  HOH HOH H . 
PB 3 HOH 349 949  949  HOH HOH H . 
PB 3 HOH 350 950  950  HOH HOH H . 
PB 3 HOH 351 951  951  HOH HOH H . 
PB 3 HOH 352 952  952  HOH HOH H . 
PB 3 HOH 353 953  953  HOH HOH H . 
PB 3 HOH 354 954  954  HOH HOH H . 
PB 3 HOH 355 955  955  HOH HOH H . 
PB 3 HOH 356 956  956  HOH HOH H . 
PB 3 HOH 357 957  957  HOH HOH H . 
PB 3 HOH 358 958  958  HOH HOH H . 
PB 3 HOH 359 959  959  HOH HOH H . 
PB 3 HOH 360 960  960  HOH HOH H . 
PB 3 HOH 361 961  961  HOH HOH H . 
PB 3 HOH 362 962  962  HOH HOH H . 
PB 3 HOH 363 963  963  HOH HOH H . 
PB 3 HOH 364 964  964  HOH HOH H . 
PB 3 HOH 365 965  965  HOH HOH H . 
PB 3 HOH 366 966  966  HOH HOH H . 
PB 3 HOH 367 967  967  HOH HOH H . 
PB 3 HOH 368 968  968  HOH HOH H . 
PB 3 HOH 369 969  969  HOH HOH H . 
PB 3 HOH 370 970  970  HOH HOH H . 
PB 3 HOH 371 971  971  HOH HOH H . 
PB 3 HOH 372 972  972  HOH HOH H . 
PB 3 HOH 373 973  973  HOH HOH H . 
PB 3 HOH 374 974  974  HOH HOH H . 
PB 3 HOH 375 975  975  HOH HOH H . 
PB 3 HOH 376 976  976  HOH HOH H . 
PB 3 HOH 377 977  977  HOH HOH H . 
PB 3 HOH 378 978  978  HOH HOH H . 
PB 3 HOH 379 979  979  HOH HOH H . 
PB 3 HOH 380 980  980  HOH HOH H . 
PB 3 HOH 381 981  981  HOH HOH H . 
PB 3 HOH 382 982  982  HOH HOH H . 
PB 3 HOH 383 983  983  HOH HOH H . 
PB 3 HOH 384 984  984  HOH HOH H . 
PB 3 HOH 385 985  985  HOH HOH H . 
PB 3 HOH 386 986  986  HOH HOH H . 
PB 3 HOH 387 987  987  HOH HOH H . 
PB 3 HOH 388 988  988  HOH HOH H . 
PB 3 HOH 389 989  989  HOH HOH H . 
PB 3 HOH 390 990  990  HOH HOH H . 
PB 3 HOH 391 991  991  HOH HOH H . 
PB 3 HOH 392 992  992  HOH HOH H . 
PB 3 HOH 393 993  993  HOH HOH H . 
PB 3 HOH 394 994  994  HOH HOH H . 
PB 3 HOH 395 995  995  HOH HOH H . 
PB 3 HOH 396 996  996  HOH HOH H . 
PB 3 HOH 397 997  997  HOH HOH H . 
PB 3 HOH 398 998  998  HOH HOH H . 
PB 3 HOH 399 999  999  HOH HOH H . 
PB 3 HOH 400 1000 1000 HOH HOH H . 
PB 3 HOH 401 1001 1001 HOH HOH H . 
PB 3 HOH 402 1002 1002 HOH HOH H . 
PB 3 HOH 403 1003 1003 HOH HOH H . 
PB 3 HOH 404 1004 1004 HOH HOH H . 
PB 3 HOH 405 1005 1005 HOH HOH H . 
PB 3 HOH 406 1006 1006 HOH HOH H . 
PB 3 HOH 407 1007 1007 HOH HOH H . 
PB 3 HOH 408 1008 1008 HOH HOH H . 
PB 3 HOH 409 1009 1009 HOH HOH H . 
PB 3 HOH 410 1010 1010 HOH HOH H . 
PB 3 HOH 411 1011 1011 HOH HOH H . 
PB 3 HOH 412 1012 1012 HOH HOH H . 
PB 3 HOH 413 1013 1013 HOH HOH H . 
PB 3 HOH 414 1014 1014 HOH HOH H . 
PB 3 HOH 415 1015 1015 HOH HOH H . 
PB 3 HOH 416 1016 1016 HOH HOH H . 
PB 3 HOH 417 1017 1017 HOH HOH H . 
PB 3 HOH 418 1018 1018 HOH HOH H . 
PB 3 HOH 419 1019 1019 HOH HOH H . 
PB 3 HOH 420 1020 1020 HOH HOH H . 
PB 3 HOH 421 1021 1021 HOH HOH H . 
PB 3 HOH 422 1022 1022 HOH HOH H . 
PB 3 HOH 423 1023 1023 HOH HOH H . 
PB 3 HOH 424 1024 1024 HOH HOH H . 
PB 3 HOH 425 1025 1025 HOH HOH H . 
PB 3 HOH 426 1026 1026 HOH HOH H . 
PB 3 HOH 427 1027 1027 HOH HOH H . 
PB 3 HOH 428 1028 1028 HOH HOH H . 
PB 3 HOH 429 1029 1029 HOH HOH H . 
PB 3 HOH 430 1030 1030 HOH HOH H . 
PB 3 HOH 431 1031 1031 HOH HOH H . 
PB 3 HOH 432 1032 1032 HOH HOH H . 
PB 3 HOH 433 1033 1033 HOH HOH H . 
PB 3 HOH 434 1034 1034 HOH HOH H . 
PB 3 HOH 435 1035 1035 HOH HOH H . 
PB 3 HOH 436 1036 1036 HOH HOH H . 
PB 3 HOH 437 1037 1037 HOH HOH H . 
PB 3 HOH 438 1038 1038 HOH HOH H . 
PB 3 HOH 439 1039 1039 HOH HOH H . 
PB 3 HOH 440 1040 1040 HOH HOH H . 
PB 3 HOH 441 1041 1041 HOH HOH H . 
PB 3 HOH 442 1042 1042 HOH HOH H . 
PB 3 HOH 443 1043 1043 HOH HOH H . 
PB 3 HOH 444 1044 1044 HOH HOH H . 
PB 3 HOH 445 1045 1045 HOH HOH H . 
PB 3 HOH 446 1046 1046 HOH HOH H . 
PB 3 HOH 447 1047 1047 HOH HOH H . 
PB 3 HOH 448 1048 1048 HOH HOH H . 
PB 3 HOH 449 1049 1049 HOH HOH H . 
PB 3 HOH 450 1050 1050 HOH HOH H . 
PB 3 HOH 451 1051 1051 HOH HOH H . 
PB 3 HOH 452 1052 1052 HOH HOH H . 
PB 3 HOH 453 1053 1053 HOH HOH H . 
PB 3 HOH 454 1054 1054 HOH HOH H . 
PB 3 HOH 455 1055 1055 HOH HOH H . 
PB 3 HOH 456 1056 1056 HOH HOH H . 
PB 3 HOH 457 1057 1057 HOH HOH H . 
PB 3 HOH 458 1058 1058 HOH HOH H . 
PB 3 HOH 459 1059 1059 HOH HOH H . 
PB 3 HOH 460 1060 1060 HOH HOH H . 
PB 3 HOH 461 1061 1061 HOH HOH H . 
PB 3 HOH 462 1062 1062 HOH HOH H . 
PB 3 HOH 463 1063 1063 HOH HOH H . 
PB 3 HOH 464 1064 1064 HOH HOH H . 
PB 3 HOH 465 1065 1065 HOH HOH H . 
PB 3 HOH 466 1066 1066 HOH HOH H . 
PB 3 HOH 467 1067 1067 HOH HOH H . 
PB 3 HOH 468 1068 1068 HOH HOH H . 
PB 3 HOH 469 1069 1069 HOH HOH H . 
PB 3 HOH 470 1070 1070 HOH HOH H . 
PB 3 HOH 471 1071 1071 HOH HOH H . 
PB 3 HOH 472 1072 1072 HOH HOH H . 
PB 3 HOH 473 1073 1073 HOH HOH H . 
PB 3 HOH 474 1074 1074 HOH HOH H . 
PB 3 HOH 475 1075 1075 HOH HOH H . 
PB 3 HOH 476 1076 1076 HOH HOH H . 
PB 3 HOH 477 1077 1077 HOH HOH H . 
PB 3 HOH 478 1078 1078 HOH HOH H . 
PB 3 HOH 479 1079 1079 HOH HOH H . 
PB 3 HOH 480 1080 1080 HOH HOH H . 
PB 3 HOH 481 1081 1081 HOH HOH H . 
PB 3 HOH 482 1082 1082 HOH HOH H . 
PB 3 HOH 483 1083 1083 HOH HOH H . 
PB 3 HOH 484 1084 1084 HOH HOH H . 
PB 3 HOH 485 1085 1085 HOH HOH H . 
PB 3 HOH 486 1086 1086 HOH HOH H . 
PB 3 HOH 487 1087 1087 HOH HOH H . 
PB 3 HOH 488 1088 1088 HOH HOH H . 
PB 3 HOH 489 1089 1089 HOH HOH H . 
PB 3 HOH 490 1090 1090 HOH HOH H . 
PB 3 HOH 491 1091 1091 HOH HOH H . 
PB 3 HOH 492 1092 1092 HOH HOH H . 
PB 3 HOH 493 1093 1093 HOH HOH H . 
PB 3 HOH 494 1094 1094 HOH HOH H . 
PB 3 HOH 495 1095 1095 HOH HOH H . 
PB 3 HOH 496 1096 1096 HOH HOH H . 
PB 3 HOH 497 1097 1097 HOH HOH H . 
PB 3 HOH 498 1098 1098 HOH HOH H . 
PB 3 HOH 499 1099 1099 HOH HOH H . 
PB 3 HOH 500 1100 1100 HOH HOH H . 
PB 3 HOH 501 1101 1101 HOH HOH H . 
PB 3 HOH 502 1102 1102 HOH HOH H . 
PB 3 HOH 503 1103 1103 HOH HOH H . 
PB 3 HOH 504 1104 1104 HOH HOH H . 
PB 3 HOH 505 1105 1105 HOH HOH H . 
PB 3 HOH 506 1106 1106 HOH HOH H . 
PB 3 HOH 507 1107 1107 HOH HOH H . 
PB 3 HOH 508 1108 1108 HOH HOH H . 
PB 3 HOH 509 1109 1109 HOH HOH H . 
PB 3 HOH 510 1110 1110 HOH HOH H . 
PB 3 HOH 511 1111 1111 HOH HOH H . 
PB 3 HOH 512 1112 1112 HOH HOH H . 
PB 3 HOH 513 1113 1113 HOH HOH H . 
PB 3 HOH 514 1114 1114 HOH HOH H . 
PB 3 HOH 515 1115 1115 HOH HOH H . 
PB 3 HOH 516 1116 1116 HOH HOH H . 
PB 3 HOH 517 1117 1117 HOH HOH H . 
PB 3 HOH 518 1118 1118 HOH HOH H . 
PB 3 HOH 519 1119 1119 HOH HOH H . 
PB 3 HOH 520 1120 1120 HOH HOH H . 
PB 3 HOH 521 1121 1121 HOH HOH H . 
PB 3 HOH 522 1122 1122 HOH HOH H . 
PB 3 HOH 523 1123 1123 HOH HOH H . 
PB 3 HOH 524 1124 1124 HOH HOH H . 
PB 3 HOH 525 1125 1125 HOH HOH H . 
PB 3 HOH 526 1126 1126 HOH HOH H . 
PB 3 HOH 527 1127 1127 HOH HOH H . 
PB 3 HOH 528 1128 1128 HOH HOH H . 
PB 3 HOH 529 1129 1130 HOH HOH H . 
PB 3 HOH 530 1130 1131 HOH HOH H . 
PB 3 HOH 531 1131 1129 HOH HOH H . 
PB 3 HOH 532 1132 1132 HOH HOH H . 
PB 3 HOH 533 1133 1133 HOH HOH H . 
PB 3 HOH 534 1134 1134 HOH HOH H . 
PB 3 HOH 535 1135 1135 HOH HOH H . 
PB 3 HOH 536 1136 1136 HOH HOH H . 
PB 3 HOH 537 1137 1137 HOH HOH H . 
PB 3 HOH 538 1138 1138 HOH HOH H . 
PB 3 HOH 539 1139 1139 HOH HOH H . 
PB 3 HOH 540 1140 1140 HOH HOH H . 
PB 3 HOH 541 1141 1141 HOH HOH H . 
PB 3 HOH 542 1142 1142 HOH HOH H . 
PB 3 HOH 543 1143 1143 HOH HOH H . 
PB 3 HOH 544 1144 1144 HOH HOH H . 
QB 3 HOH 1   601  601  HOH HOH I . 
QB 3 HOH 2   602  602  HOH HOH I . 
QB 3 HOH 3   603  603  HOH HOH I . 
QB 3 HOH 4   604  604  HOH HOH I . 
QB 3 HOH 5   605  605  HOH HOH I . 
QB 3 HOH 6   606  606  HOH HOH I . 
QB 3 HOH 7   607  607  HOH HOH I . 
QB 3 HOH 8   608  608  HOH HOH I . 
QB 3 HOH 9   609  609  HOH HOH I . 
QB 3 HOH 10  610  610  HOH HOH I . 
QB 3 HOH 11  611  611  HOH HOH I . 
QB 3 HOH 12  612  612  HOH HOH I . 
QB 3 HOH 13  613  613  HOH HOH I . 
QB 3 HOH 14  614  614  HOH HOH I . 
QB 3 HOH 15  615  615  HOH HOH I . 
QB 3 HOH 16  616  616  HOH HOH I . 
QB 3 HOH 17  617  617  HOH HOH I . 
QB 3 HOH 18  618  618  HOH HOH I . 
QB 3 HOH 19  619  619  HOH HOH I . 
QB 3 HOH 20  620  620  HOH HOH I . 
QB 3 HOH 21  621  621  HOH HOH I . 
QB 3 HOH 22  622  622  HOH HOH I . 
QB 3 HOH 23  623  623  HOH HOH I . 
QB 3 HOH 24  624  624  HOH HOH I . 
QB 3 HOH 25  625  625  HOH HOH I . 
QB 3 HOH 26  626  626  HOH HOH I . 
QB 3 HOH 27  627  627  HOH HOH I . 
QB 3 HOH 28  628  628  HOH HOH I . 
QB 3 HOH 29  629  629  HOH HOH I . 
QB 3 HOH 30  630  630  HOH HOH I . 
QB 3 HOH 31  631  631  HOH HOH I . 
QB 3 HOH 32  632  632  HOH HOH I . 
QB 3 HOH 33  633  633  HOH HOH I . 
QB 3 HOH 34  634  634  HOH HOH I . 
QB 3 HOH 35  635  635  HOH HOH I . 
QB 3 HOH 36  636  636  HOH HOH I . 
QB 3 HOH 37  637  637  HOH HOH I . 
QB 3 HOH 38  638  638  HOH HOH I . 
QB 3 HOH 39  639  639  HOH HOH I . 
QB 3 HOH 40  640  640  HOH HOH I . 
QB 3 HOH 41  641  641  HOH HOH I . 
QB 3 HOH 42  642  642  HOH HOH I . 
QB 3 HOH 43  643  643  HOH HOH I . 
QB 3 HOH 44  644  644  HOH HOH I . 
QB 3 HOH 45  645  645  HOH HOH I . 
QB 3 HOH 46  646  646  HOH HOH I . 
QB 3 HOH 47  647  647  HOH HOH I . 
QB 3 HOH 48  648  648  HOH HOH I . 
QB 3 HOH 49  649  649  HOH HOH I . 
QB 3 HOH 50  650  650  HOH HOH I . 
QB 3 HOH 51  651  651  HOH HOH I . 
QB 3 HOH 52  652  652  HOH HOH I . 
QB 3 HOH 53  653  653  HOH HOH I . 
QB 3 HOH 54  654  654  HOH HOH I . 
QB 3 HOH 55  655  655  HOH HOH I . 
QB 3 HOH 56  656  656  HOH HOH I . 
QB 3 HOH 57  657  657  HOH HOH I . 
QB 3 HOH 58  658  658  HOH HOH I . 
QB 3 HOH 59  659  659  HOH HOH I . 
QB 3 HOH 60  660  660  HOH HOH I . 
QB 3 HOH 61  661  661  HOH HOH I . 
QB 3 HOH 62  662  662  HOH HOH I . 
QB 3 HOH 63  663  663  HOH HOH I . 
QB 3 HOH 64  664  664  HOH HOH I . 
QB 3 HOH 65  665  665  HOH HOH I . 
QB 3 HOH 66  666  666  HOH HOH I . 
QB 3 HOH 67  667  667  HOH HOH I . 
QB 3 HOH 68  668  668  HOH HOH I . 
QB 3 HOH 69  669  669  HOH HOH I . 
QB 3 HOH 70  670  670  HOH HOH I . 
QB 3 HOH 71  671  671  HOH HOH I . 
QB 3 HOH 72  672  672  HOH HOH I . 
QB 3 HOH 73  673  673  HOH HOH I . 
QB 3 HOH 74  674  674  HOH HOH I . 
QB 3 HOH 75  675  675  HOH HOH I . 
QB 3 HOH 76  676  676  HOH HOH I . 
QB 3 HOH 77  677  677  HOH HOH I . 
QB 3 HOH 78  678  678  HOH HOH I . 
QB 3 HOH 79  679  679  HOH HOH I . 
QB 3 HOH 80  680  680  HOH HOH I . 
QB 3 HOH 81  681  681  HOH HOH I . 
QB 3 HOH 82  682  682  HOH HOH I . 
QB 3 HOH 83  683  683  HOH HOH I . 
QB 3 HOH 84  684  684  HOH HOH I . 
QB 3 HOH 85  685  685  HOH HOH I . 
QB 3 HOH 86  686  686  HOH HOH I . 
QB 3 HOH 87  687  687  HOH HOH I . 
QB 3 HOH 88  688  688  HOH HOH I . 
QB 3 HOH 89  689  689  HOH HOH I . 
QB 3 HOH 90  690  690  HOH HOH I . 
QB 3 HOH 91  691  691  HOH HOH I . 
QB 3 HOH 92  692  692  HOH HOH I . 
QB 3 HOH 93  693  693  HOH HOH I . 
QB 3 HOH 94  694  694  HOH HOH I . 
QB 3 HOH 95  695  695  HOH HOH I . 
QB 3 HOH 96  696  696  HOH HOH I . 
QB 3 HOH 97  697  697  HOH HOH I . 
QB 3 HOH 98  698  698  HOH HOH I . 
QB 3 HOH 99  699  699  HOH HOH I . 
QB 3 HOH 100 700  700  HOH HOH I . 
QB 3 HOH 101 701  701  HOH HOH I . 
QB 3 HOH 102 702  702  HOH HOH I . 
QB 3 HOH 103 703  703  HOH HOH I . 
QB 3 HOH 104 704  704  HOH HOH I . 
QB 3 HOH 105 705  705  HOH HOH I . 
QB 3 HOH 106 706  706  HOH HOH I . 
QB 3 HOH 107 707  707  HOH HOH I . 
QB 3 HOH 108 708  708  HOH HOH I . 
QB 3 HOH 109 709  709  HOH HOH I . 
QB 3 HOH 110 710  710  HOH HOH I . 
QB 3 HOH 111 711  711  HOH HOH I . 
QB 3 HOH 112 712  712  HOH HOH I . 
QB 3 HOH 113 713  713  HOH HOH I . 
QB 3 HOH 114 714  714  HOH HOH I . 
QB 3 HOH 115 715  715  HOH HOH I . 
QB 3 HOH 116 716  716  HOH HOH I . 
QB 3 HOH 117 717  717  HOH HOH I . 
QB 3 HOH 118 718  718  HOH HOH I . 
QB 3 HOH 119 719  719  HOH HOH I . 
QB 3 HOH 120 720  720  HOH HOH I . 
QB 3 HOH 121 721  721  HOH HOH I . 
QB 3 HOH 122 722  722  HOH HOH I . 
QB 3 HOH 123 723  723  HOH HOH I . 
QB 3 HOH 124 724  724  HOH HOH I . 
QB 3 HOH 125 725  725  HOH HOH I . 
QB 3 HOH 126 726  726  HOH HOH I . 
QB 3 HOH 127 727  727  HOH HOH I . 
QB 3 HOH 128 728  728  HOH HOH I . 
QB 3 HOH 129 729  729  HOH HOH I . 
QB 3 HOH 130 730  730  HOH HOH I . 
QB 3 HOH 131 731  731  HOH HOH I . 
QB 3 HOH 132 732  732  HOH HOH I . 
QB 3 HOH 133 733  733  HOH HOH I . 
QB 3 HOH 134 734  734  HOH HOH I . 
QB 3 HOH 135 735  735  HOH HOH I . 
QB 3 HOH 136 736  736  HOH HOH I . 
QB 3 HOH 137 737  737  HOH HOH I . 
QB 3 HOH 138 738  738  HOH HOH I . 
QB 3 HOH 139 739  739  HOH HOH I . 
QB 3 HOH 140 740  740  HOH HOH I . 
QB 3 HOH 141 741  741  HOH HOH I . 
QB 3 HOH 142 742  742  HOH HOH I . 
QB 3 HOH 143 743  743  HOH HOH I . 
QB 3 HOH 144 744  744  HOH HOH I . 
QB 3 HOH 145 745  745  HOH HOH I . 
QB 3 HOH 146 746  746  HOH HOH I . 
QB 3 HOH 147 747  747  HOH HOH I . 
QB 3 HOH 148 748  748  HOH HOH I . 
QB 3 HOH 149 749  749  HOH HOH I . 
QB 3 HOH 150 750  750  HOH HOH I . 
QB 3 HOH 151 751  751  HOH HOH I . 
QB 3 HOH 152 752  752  HOH HOH I . 
QB 3 HOH 153 753  753  HOH HOH I . 
QB 3 HOH 154 754  754  HOH HOH I . 
QB 3 HOH 155 755  755  HOH HOH I . 
QB 3 HOH 156 756  756  HOH HOH I . 
QB 3 HOH 157 757  757  HOH HOH I . 
QB 3 HOH 158 758  758  HOH HOH I . 
QB 3 HOH 159 759  759  HOH HOH I . 
QB 3 HOH 160 760  760  HOH HOH I . 
QB 3 HOH 161 761  761  HOH HOH I . 
QB 3 HOH 162 762  762  HOH HOH I . 
QB 3 HOH 163 763  763  HOH HOH I . 
QB 3 HOH 164 764  764  HOH HOH I . 
QB 3 HOH 165 765  765  HOH HOH I . 
QB 3 HOH 166 766  766  HOH HOH I . 
QB 3 HOH 167 767  767  HOH HOH I . 
QB 3 HOH 168 768  768  HOH HOH I . 
QB 3 HOH 169 769  769  HOH HOH I . 
QB 3 HOH 170 770  770  HOH HOH I . 
QB 3 HOH 171 771  771  HOH HOH I . 
QB 3 HOH 172 772  772  HOH HOH I . 
QB 3 HOH 173 773  773  HOH HOH I . 
QB 3 HOH 174 774  774  HOH HOH I . 
QB 3 HOH 175 775  775  HOH HOH I . 
QB 3 HOH 176 776  776  HOH HOH I . 
QB 3 HOH 177 777  777  HOH HOH I . 
QB 3 HOH 178 778  778  HOH HOH I . 
QB 3 HOH 179 779  779  HOH HOH I . 
QB 3 HOH 180 780  780  HOH HOH I . 
QB 3 HOH 181 781  781  HOH HOH I . 
QB 3 HOH 182 782  782  HOH HOH I . 
QB 3 HOH 183 783  783  HOH HOH I . 
QB 3 HOH 184 784  784  HOH HOH I . 
QB 3 HOH 185 785  785  HOH HOH I . 
QB 3 HOH 186 786  786  HOH HOH I . 
QB 3 HOH 187 787  787  HOH HOH I . 
QB 3 HOH 188 788  788  HOH HOH I . 
QB 3 HOH 189 789  789  HOH HOH I . 
QB 3 HOH 190 790  790  HOH HOH I . 
QB 3 HOH 191 791  791  HOH HOH I . 
QB 3 HOH 192 792  792  HOH HOH I . 
QB 3 HOH 193 793  793  HOH HOH I . 
QB 3 HOH 194 794  794  HOH HOH I . 
QB 3 HOH 195 795  795  HOH HOH I . 
QB 3 HOH 196 796  796  HOH HOH I . 
QB 3 HOH 197 797  797  HOH HOH I . 
QB 3 HOH 198 798  798  HOH HOH I . 
QB 3 HOH 199 799  799  HOH HOH I . 
QB 3 HOH 200 800  800  HOH HOH I . 
QB 3 HOH 201 801  801  HOH HOH I . 
QB 3 HOH 202 802  802  HOH HOH I . 
QB 3 HOH 203 803  803  HOH HOH I . 
QB 3 HOH 204 804  804  HOH HOH I . 
QB 3 HOH 205 805  805  HOH HOH I . 
QB 3 HOH 206 806  806  HOH HOH I . 
QB 3 HOH 207 807  807  HOH HOH I . 
QB 3 HOH 208 808  808  HOH HOH I . 
QB 3 HOH 209 809  809  HOH HOH I . 
QB 3 HOH 210 810  810  HOH HOH I . 
QB 3 HOH 211 811  811  HOH HOH I . 
QB 3 HOH 212 812  812  HOH HOH I . 
QB 3 HOH 213 813  813  HOH HOH I . 
QB 3 HOH 214 814  814  HOH HOH I . 
QB 3 HOH 215 815  815  HOH HOH I . 
QB 3 HOH 216 816  816  HOH HOH I . 
QB 3 HOH 217 817  817  HOH HOH I . 
QB 3 HOH 218 818  818  HOH HOH I . 
QB 3 HOH 219 819  819  HOH HOH I . 
QB 3 HOH 220 820  820  HOH HOH I . 
QB 3 HOH 221 821  821  HOH HOH I . 
QB 3 HOH 222 822  822  HOH HOH I . 
QB 3 HOH 223 823  823  HOH HOH I . 
QB 3 HOH 224 824  824  HOH HOH I . 
QB 3 HOH 225 825  825  HOH HOH I . 
QB 3 HOH 226 826  826  HOH HOH I . 
QB 3 HOH 227 827  827  HOH HOH I . 
QB 3 HOH 228 828  828  HOH HOH I . 
QB 3 HOH 229 829  829  HOH HOH I . 
QB 3 HOH 230 830  830  HOH HOH I . 
QB 3 HOH 231 831  831  HOH HOH I . 
QB 3 HOH 232 832  832  HOH HOH I . 
QB 3 HOH 233 833  833  HOH HOH I . 
QB 3 HOH 234 834  834  HOH HOH I . 
QB 3 HOH 235 835  835  HOH HOH I . 
QB 3 HOH 236 836  836  HOH HOH I . 
QB 3 HOH 237 837  837  HOH HOH I . 
QB 3 HOH 238 838  838  HOH HOH I . 
QB 3 HOH 239 839  839  HOH HOH I . 
QB 3 HOH 240 840  840  HOH HOH I . 
QB 3 HOH 241 841  841  HOH HOH I . 
QB 3 HOH 242 842  842  HOH HOH I . 
QB 3 HOH 243 843  843  HOH HOH I . 
QB 3 HOH 244 844  844  HOH HOH I . 
QB 3 HOH 245 845  845  HOH HOH I . 
QB 3 HOH 246 846  846  HOH HOH I . 
QB 3 HOH 247 847  847  HOH HOH I . 
QB 3 HOH 248 848  848  HOH HOH I . 
QB 3 HOH 249 849  849  HOH HOH I . 
QB 3 HOH 250 850  850  HOH HOH I . 
QB 3 HOH 251 851  851  HOH HOH I . 
QB 3 HOH 252 852  852  HOH HOH I . 
QB 3 HOH 253 853  853  HOH HOH I . 
QB 3 HOH 254 854  854  HOH HOH I . 
QB 3 HOH 255 855  855  HOH HOH I . 
QB 3 HOH 256 856  856  HOH HOH I . 
QB 3 HOH 257 857  857  HOH HOH I . 
QB 3 HOH 258 858  858  HOH HOH I . 
QB 3 HOH 259 859  859  HOH HOH I . 
QB 3 HOH 260 860  860  HOH HOH I . 
QB 3 HOH 261 861  861  HOH HOH I . 
QB 3 HOH 262 862  862  HOH HOH I . 
QB 3 HOH 263 863  863  HOH HOH I . 
QB 3 HOH 264 864  864  HOH HOH I . 
QB 3 HOH 265 865  865  HOH HOH I . 
QB 3 HOH 266 866  866  HOH HOH I . 
QB 3 HOH 267 867  867  HOH HOH I . 
QB 3 HOH 268 868  868  HOH HOH I . 
QB 3 HOH 269 869  869  HOH HOH I . 
QB 3 HOH 270 870  870  HOH HOH I . 
QB 3 HOH 271 871  871  HOH HOH I . 
QB 3 HOH 272 872  872  HOH HOH I . 
QB 3 HOH 273 873  873  HOH HOH I . 
QB 3 HOH 274 874  874  HOH HOH I . 
QB 3 HOH 275 875  875  HOH HOH I . 
QB 3 HOH 276 876  876  HOH HOH I . 
QB 3 HOH 277 877  877  HOH HOH I . 
QB 3 HOH 278 878  878  HOH HOH I . 
QB 3 HOH 279 879  879  HOH HOH I . 
QB 3 HOH 280 880  880  HOH HOH I . 
QB 3 HOH 281 881  881  HOH HOH I . 
QB 3 HOH 282 882  882  HOH HOH I . 
QB 3 HOH 283 883  883  HOH HOH I . 
QB 3 HOH 284 884  884  HOH HOH I . 
QB 3 HOH 285 885  885  HOH HOH I . 
QB 3 HOH 286 886  886  HOH HOH I . 
QB 3 HOH 287 887  887  HOH HOH I . 
QB 3 HOH 288 888  888  HOH HOH I . 
QB 3 HOH 289 889  889  HOH HOH I . 
QB 3 HOH 290 890  890  HOH HOH I . 
QB 3 HOH 291 891  891  HOH HOH I . 
QB 3 HOH 292 892  892  HOH HOH I . 
QB 3 HOH 293 893  893  HOH HOH I . 
QB 3 HOH 294 894  894  HOH HOH I . 
QB 3 HOH 295 895  895  HOH HOH I . 
QB 3 HOH 296 896  896  HOH HOH I . 
QB 3 HOH 297 897  897  HOH HOH I . 
QB 3 HOH 298 898  898  HOH HOH I . 
QB 3 HOH 299 899  899  HOH HOH I . 
QB 3 HOH 300 900  900  HOH HOH I . 
QB 3 HOH 301 901  901  HOH HOH I . 
QB 3 HOH 302 902  902  HOH HOH I . 
QB 3 HOH 303 903  903  HOH HOH I . 
QB 3 HOH 304 904  904  HOH HOH I . 
QB 3 HOH 305 905  905  HOH HOH I . 
QB 3 HOH 306 906  906  HOH HOH I . 
QB 3 HOH 307 907  907  HOH HOH I . 
QB 3 HOH 308 908  908  HOH HOH I . 
QB 3 HOH 309 909  909  HOH HOH I . 
QB 3 HOH 310 910  910  HOH HOH I . 
QB 3 HOH 311 911  911  HOH HOH I . 
QB 3 HOH 312 912  912  HOH HOH I . 
QB 3 HOH 313 913  913  HOH HOH I . 
QB 3 HOH 314 914  914  HOH HOH I . 
QB 3 HOH 315 915  915  HOH HOH I . 
QB 3 HOH 316 916  916  HOH HOH I . 
QB 3 HOH 317 917  917  HOH HOH I . 
QB 3 HOH 318 918  918  HOH HOH I . 
QB 3 HOH 319 919  919  HOH HOH I . 
QB 3 HOH 320 920  920  HOH HOH I . 
QB 3 HOH 321 921  921  HOH HOH I . 
QB 3 HOH 322 922  922  HOH HOH I . 
QB 3 HOH 323 923  923  HOH HOH I . 
QB 3 HOH 324 924  924  HOH HOH I . 
QB 3 HOH 325 925  925  HOH HOH I . 
QB 3 HOH 326 926  926  HOH HOH I . 
QB 3 HOH 327 927  927  HOH HOH I . 
QB 3 HOH 328 928  928  HOH HOH I . 
QB 3 HOH 329 929  929  HOH HOH I . 
QB 3 HOH 330 930  930  HOH HOH I . 
QB 3 HOH 331 931  931  HOH HOH I . 
QB 3 HOH 332 932  932  HOH HOH I . 
QB 3 HOH 333 933  933  HOH HOH I . 
QB 3 HOH 334 934  934  HOH HOH I . 
QB 3 HOH 335 935  935  HOH HOH I . 
QB 3 HOH 336 936  936  HOH HOH I . 
QB 3 HOH 337 937  937  HOH HOH I . 
QB 3 HOH 338 938  938  HOH HOH I . 
QB 3 HOH 339 939  939  HOH HOH I . 
QB 3 HOH 340 940  940  HOH HOH I . 
QB 3 HOH 341 941  941  HOH HOH I . 
QB 3 HOH 342 942  942  HOH HOH I . 
QB 3 HOH 343 943  943  HOH HOH I . 
QB 3 HOH 344 944  944  HOH HOH I . 
QB 3 HOH 345 945  945  HOH HOH I . 
QB 3 HOH 346 946  946  HOH HOH I . 
QB 3 HOH 347 947  947  HOH HOH I . 
QB 3 HOH 348 948  948  HOH HOH I . 
QB 3 HOH 349 949  949  HOH HOH I . 
QB 3 HOH 350 950  950  HOH HOH I . 
QB 3 HOH 351 951  951  HOH HOH I . 
QB 3 HOH 352 952  952  HOH HOH I . 
QB 3 HOH 353 953  953  HOH HOH I . 
QB 3 HOH 354 954  954  HOH HOH I . 
QB 3 HOH 355 955  955  HOH HOH I . 
QB 3 HOH 356 956  956  HOH HOH I . 
QB 3 HOH 357 957  957  HOH HOH I . 
QB 3 HOH 358 958  958  HOH HOH I . 
QB 3 HOH 359 959  959  HOH HOH I . 
QB 3 HOH 360 960  960  HOH HOH I . 
QB 3 HOH 361 961  961  HOH HOH I . 
QB 3 HOH 362 962  962  HOH HOH I . 
QB 3 HOH 363 963  963  HOH HOH I . 
QB 3 HOH 364 964  964  HOH HOH I . 
QB 3 HOH 365 965  965  HOH HOH I . 
QB 3 HOH 366 966  966  HOH HOH I . 
QB 3 HOH 367 967  967  HOH HOH I . 
QB 3 HOH 368 968  968  HOH HOH I . 
QB 3 HOH 369 969  969  HOH HOH I . 
QB 3 HOH 370 970  970  HOH HOH I . 
QB 3 HOH 371 971  971  HOH HOH I . 
QB 3 HOH 372 972  972  HOH HOH I . 
QB 3 HOH 373 973  973  HOH HOH I . 
QB 3 HOH 374 974  974  HOH HOH I . 
QB 3 HOH 375 975  975  HOH HOH I . 
QB 3 HOH 376 976  976  HOH HOH I . 
QB 3 HOH 377 977  977  HOH HOH I . 
QB 3 HOH 378 978  978  HOH HOH I . 
QB 3 HOH 379 979  979  HOH HOH I . 
QB 3 HOH 380 980  980  HOH HOH I . 
QB 3 HOH 381 981  981  HOH HOH I . 
QB 3 HOH 382 982  982  HOH HOH I . 
QB 3 HOH 383 983  983  HOH HOH I . 
QB 3 HOH 384 984  984  HOH HOH I . 
QB 3 HOH 385 985  985  HOH HOH I . 
QB 3 HOH 386 986  986  HOH HOH I . 
QB 3 HOH 387 987  987  HOH HOH I . 
QB 3 HOH 388 988  988  HOH HOH I . 
QB 3 HOH 389 989  989  HOH HOH I . 
QB 3 HOH 390 990  990  HOH HOH I . 
QB 3 HOH 391 991  991  HOH HOH I . 
QB 3 HOH 392 992  992  HOH HOH I . 
QB 3 HOH 393 993  993  HOH HOH I . 
QB 3 HOH 394 994  994  HOH HOH I . 
QB 3 HOH 395 995  995  HOH HOH I . 
QB 3 HOH 396 996  996  HOH HOH I . 
QB 3 HOH 397 997  997  HOH HOH I . 
QB 3 HOH 398 998  998  HOH HOH I . 
QB 3 HOH 399 999  999  HOH HOH I . 
QB 3 HOH 400 1000 1000 HOH HOH I . 
QB 3 HOH 401 1001 1001 HOH HOH I . 
QB 3 HOH 402 1002 1002 HOH HOH I . 
QB 3 HOH 403 1003 1003 HOH HOH I . 
QB 3 HOH 404 1004 1004 HOH HOH I . 
QB 3 HOH 405 1005 1005 HOH HOH I . 
QB 3 HOH 406 1006 1006 HOH HOH I . 
QB 3 HOH 407 1007 1007 HOH HOH I . 
QB 3 HOH 408 1008 1008 HOH HOH I . 
QB 3 HOH 409 1009 1009 HOH HOH I . 
QB 3 HOH 410 1010 1010 HOH HOH I . 
QB 3 HOH 411 1011 1011 HOH HOH I . 
QB 3 HOH 412 1012 1012 HOH HOH I . 
QB 3 HOH 413 1013 1013 HOH HOH I . 
QB 3 HOH 414 1014 1014 HOH HOH I . 
QB 3 HOH 415 1015 1015 HOH HOH I . 
QB 3 HOH 416 1016 1016 HOH HOH I . 
QB 3 HOH 417 1017 1017 HOH HOH I . 
QB 3 HOH 418 1018 1018 HOH HOH I . 
QB 3 HOH 419 1019 1019 HOH HOH I . 
QB 3 HOH 420 1020 1020 HOH HOH I . 
QB 3 HOH 421 1021 1021 HOH HOH I . 
QB 3 HOH 422 1022 1022 HOH HOH I . 
QB 3 HOH 423 1023 1023 HOH HOH I . 
QB 3 HOH 424 1024 1024 HOH HOH I . 
QB 3 HOH 425 1025 1025 HOH HOH I . 
QB 3 HOH 426 1026 1026 HOH HOH I . 
QB 3 HOH 427 1027 1027 HOH HOH I . 
QB 3 HOH 428 1028 1028 HOH HOH I . 
QB 3 HOH 429 1029 1029 HOH HOH I . 
QB 3 HOH 430 1030 1030 HOH HOH I . 
QB 3 HOH 431 1031 1031 HOH HOH I . 
QB 3 HOH 432 1032 1032 HOH HOH I . 
QB 3 HOH 433 1033 1033 HOH HOH I . 
QB 3 HOH 434 1034 1034 HOH HOH I . 
QB 3 HOH 435 1035 1035 HOH HOH I . 
QB 3 HOH 436 1036 1036 HOH HOH I . 
QB 3 HOH 437 1037 1037 HOH HOH I . 
QB 3 HOH 438 1038 1038 HOH HOH I . 
QB 3 HOH 439 1039 1039 HOH HOH I . 
QB 3 HOH 440 1040 1040 HOH HOH I . 
QB 3 HOH 441 1041 1041 HOH HOH I . 
QB 3 HOH 442 1042 1042 HOH HOH I . 
QB 3 HOH 443 1043 1043 HOH HOH I . 
QB 3 HOH 444 1044 1044 HOH HOH I . 
QB 3 HOH 445 1045 1045 HOH HOH I . 
QB 3 HOH 446 1046 1046 HOH HOH I . 
QB 3 HOH 447 1047 1047 HOH HOH I . 
QB 3 HOH 448 1048 1048 HOH HOH I . 
QB 3 HOH 449 1049 1049 HOH HOH I . 
QB 3 HOH 450 1050 1050 HOH HOH I . 
QB 3 HOH 451 1051 1051 HOH HOH I . 
QB 3 HOH 452 1052 1052 HOH HOH I . 
QB 3 HOH 453 1053 1053 HOH HOH I . 
QB 3 HOH 454 1054 1054 HOH HOH I . 
QB 3 HOH 455 1055 1055 HOH HOH I . 
QB 3 HOH 456 1056 1056 HOH HOH I . 
QB 3 HOH 457 1057 1057 HOH HOH I . 
QB 3 HOH 458 1058 1058 HOH HOH I . 
QB 3 HOH 459 1059 1059 HOH HOH I . 
QB 3 HOH 460 1060 1060 HOH HOH I . 
QB 3 HOH 461 1061 1061 HOH HOH I . 
QB 3 HOH 462 1062 1062 HOH HOH I . 
QB 3 HOH 463 1063 1063 HOH HOH I . 
QB 3 HOH 464 1064 1064 HOH HOH I . 
QB 3 HOH 465 1065 1065 HOH HOH I . 
QB 3 HOH 466 1066 1066 HOH HOH I . 
QB 3 HOH 467 1067 1067 HOH HOH I . 
QB 3 HOH 468 1068 1068 HOH HOH I . 
QB 3 HOH 469 1069 1069 HOH HOH I . 
QB 3 HOH 470 1070 1070 HOH HOH I . 
QB 3 HOH 471 1071 1071 HOH HOH I . 
QB 3 HOH 472 1072 1072 HOH HOH I . 
QB 3 HOH 473 1073 1073 HOH HOH I . 
QB 3 HOH 474 1074 1074 HOH HOH I . 
QB 3 HOH 475 1075 1075 HOH HOH I . 
QB 3 HOH 476 1076 1076 HOH HOH I . 
QB 3 HOH 477 1077 1077 HOH HOH I . 
QB 3 HOH 478 1078 1078 HOH HOH I . 
QB 3 HOH 479 1079 1079 HOH HOH I . 
QB 3 HOH 480 1080 1080 HOH HOH I . 
QB 3 HOH 481 1081 1081 HOH HOH I . 
QB 3 HOH 482 1082 1082 HOH HOH I . 
QB 3 HOH 483 1083 1083 HOH HOH I . 
QB 3 HOH 484 1084 1084 HOH HOH I . 
QB 3 HOH 485 1085 1085 HOH HOH I . 
QB 3 HOH 486 1086 1086 HOH HOH I . 
QB 3 HOH 487 1087 1087 HOH HOH I . 
QB 3 HOH 488 1088 1088 HOH HOH I . 
QB 3 HOH 489 1089 1089 HOH HOH I . 
QB 3 HOH 490 1090 1090 HOH HOH I . 
QB 3 HOH 491 1091 1091 HOH HOH I . 
QB 3 HOH 492 1092 1092 HOH HOH I . 
QB 3 HOH 493 1093 1093 HOH HOH I . 
QB 3 HOH 494 1094 1094 HOH HOH I . 
QB 3 HOH 495 1095 1095 HOH HOH I . 
QB 3 HOH 496 1096 1096 HOH HOH I . 
QB 3 HOH 497 1097 1097 HOH HOH I . 
QB 3 HOH 498 1098 1098 HOH HOH I . 
QB 3 HOH 499 1099 1099 HOH HOH I . 
QB 3 HOH 500 1100 1100 HOH HOH I . 
QB 3 HOH 501 1101 1101 HOH HOH I . 
QB 3 HOH 502 1102 1102 HOH HOH I . 
QB 3 HOH 503 1103 1103 HOH HOH I . 
QB 3 HOH 504 1104 1104 HOH HOH I . 
QB 3 HOH 505 1105 1105 HOH HOH I . 
QB 3 HOH 506 1106 1106 HOH HOH I . 
QB 3 HOH 507 1107 1107 HOH HOH I . 
QB 3 HOH 508 1108 1108 HOH HOH I . 
QB 3 HOH 509 1109 1109 HOH HOH I . 
QB 3 HOH 510 1110 1110 HOH HOH I . 
QB 3 HOH 511 1111 1111 HOH HOH I . 
QB 3 HOH 512 1112 1112 HOH HOH I . 
QB 3 HOH 513 1113 1113 HOH HOH I . 
QB 3 HOH 514 1114 1114 HOH HOH I . 
QB 3 HOH 515 1115 1115 HOH HOH I . 
QB 3 HOH 516 1116 1116 HOH HOH I . 
QB 3 HOH 517 1117 1117 HOH HOH I . 
QB 3 HOH 518 1118 1118 HOH HOH I . 
QB 3 HOH 519 1119 1119 HOH HOH I . 
QB 3 HOH 520 1120 1120 HOH HOH I . 
QB 3 HOH 521 1121 1121 HOH HOH I . 
QB 3 HOH 522 1122 1122 HOH HOH I . 
QB 3 HOH 523 1123 1123 HOH HOH I . 
QB 3 HOH 524 1124 1124 HOH HOH I . 
QB 3 HOH 525 1125 1125 HOH HOH I . 
QB 3 HOH 526 1126 1126 HOH HOH I . 
QB 3 HOH 527 1127 1127 HOH HOH I . 
QB 3 HOH 528 1128 1128 HOH HOH I . 
QB 3 HOH 529 1129 1129 HOH HOH I . 
QB 3 HOH 530 1130 1130 HOH HOH I . 
QB 3 HOH 531 1131 1131 HOH HOH I . 
QB 3 HOH 532 1132 1132 HOH HOH I . 
QB 3 HOH 533 1133 1133 HOH HOH I . 
QB 3 HOH 534 1134 1134 HOH HOH I . 
QB 3 HOH 535 1135 1135 HOH HOH I . 
QB 3 HOH 536 1136 1136 HOH HOH I . 
QB 3 HOH 537 1137 1137 HOH HOH I . 
QB 3 HOH 538 1138 1138 HOH HOH I . 
QB 3 HOH 539 1139 1139 HOH HOH I . 
QB 3 HOH 540 1140 1140 HOH HOH I . 
QB 3 HOH 541 1141 1141 HOH HOH I . 
QB 3 HOH 542 1142 1142 HOH HOH I . 
QB 3 HOH 543 1143 1143 HOH HOH I . 
QB 3 HOH 544 1144 1144 HOH HOH I . 
QB 3 HOH 545 1145 1145 HOH HOH I . 
QB 3 HOH 546 1146 1146 HOH HOH I . 
QB 3 HOH 547 1147 1147 HOH HOH I . 
QB 3 HOH 548 1148 1148 HOH HOH I . 
QB 3 HOH 549 1149 1149 HOH HOH I . 
QB 3 HOH 550 1150 1150 HOH HOH I . 
QB 3 HOH 551 1151 1151 HOH HOH I . 
QB 3 HOH 552 1152 1152 HOH HOH I . 
QB 3 HOH 553 1153 1153 HOH HOH I . 
QB 3 HOH 554 1154 1154 HOH HOH I . 
QB 3 HOH 555 1155 1155 HOH HOH I . 
QB 3 HOH 556 1156 1156 HOH HOH I . 
QB 3 HOH 557 1157 1157 HOH HOH I . 
QB 3 HOH 558 1158 1158 HOH HOH I . 
QB 3 HOH 559 1159 1159 HOH HOH I . 
QB 3 HOH 560 1160 1160 HOH HOH I . 
QB 3 HOH 561 1161 1161 HOH HOH I . 
QB 3 HOH 562 1162 1162 HOH HOH I . 
QB 3 HOH 563 1163 1163 HOH HOH I . 
QB 3 HOH 564 1164 1164 HOH HOH I . 
QB 3 HOH 565 1165 1165 HOH HOH I . 
QB 3 HOH 566 1166 1166 HOH HOH I . 
QB 3 HOH 567 1167 1167 HOH HOH I . 
QB 3 HOH 568 1168 1168 HOH HOH I . 
QB 3 HOH 569 1169 1169 HOH HOH I . 
QB 3 HOH 570 1170 1170 HOH HOH I . 
QB 3 HOH 571 1171 1171 HOH HOH I . 
QB 3 HOH 572 1172 1172 HOH HOH I . 
QB 3 HOH 573 1173 1173 HOH HOH I . 
QB 3 HOH 574 1174 1174 HOH HOH I . 
QB 3 HOH 575 1175 1175 HOH HOH I . 
QB 3 HOH 576 1176 1176 HOH HOH I . 
QB 3 HOH 577 1177 1177 HOH HOH I . 
QB 3 HOH 578 1178 1178 HOH HOH I . 
QB 3 HOH 579 1179 1179 HOH HOH I . 
QB 3 HOH 580 1180 1180 HOH HOH I . 
QB 3 HOH 581 1181 1181 HOH HOH I . 
QB 3 HOH 582 1182 1182 HOH HOH I . 
QB 3 HOH 583 1183 1183 HOH HOH I . 
QB 3 HOH 584 1184 1184 HOH HOH I . 
QB 3 HOH 585 1185 1185 HOH HOH I . 
QB 3 HOH 586 1186 1186 HOH HOH I . 
QB 3 HOH 587 1187 1187 HOH HOH I . 
QB 3 HOH 588 1188 1188 HOH HOH I . 
QB 3 HOH 589 1189 1189 HOH HOH I . 
QB 3 HOH 590 1190 1190 HOH HOH I . 
QB 3 HOH 591 1191 1191 HOH HOH I . 
QB 3 HOH 592 1192 1192 HOH HOH I . 
QB 3 HOH 593 1193 1193 HOH HOH I . 
QB 3 HOH 594 1194 1194 HOH HOH I . 
QB 3 HOH 595 1195 1195 HOH HOH I . 
QB 3 HOH 596 1196 1196 HOH HOH I . 
QB 3 HOH 597 1197 1197 HOH HOH I . 
QB 3 HOH 598 1198 1198 HOH HOH I . 
QB 3 HOH 599 1199 1199 HOH HOH I . 
QB 3 HOH 600 1200 1200 HOH HOH I . 
QB 3 HOH 601 1201 1201 HOH HOH I . 
QB 3 HOH 602 1202 1202 HOH HOH I . 
QB 3 HOH 603 1203 1203 HOH HOH I . 
QB 3 HOH 604 1204 1204 HOH HOH I . 
QB 3 HOH 605 1205 1205 HOH HOH I . 
QB 3 HOH 606 1206 1206 HOH HOH I . 
QB 3 HOH 607 1207 1207 HOH HOH I . 
QB 3 HOH 608 1208 1208 HOH HOH I . 
QB 3 HOH 609 1209 1209 HOH HOH I . 
QB 3 HOH 610 1210 1210 HOH HOH I . 
QB 3 HOH 611 1211 1211 HOH HOH I . 
QB 3 HOH 612 1212 1212 HOH HOH I . 
QB 3 HOH 613 1213 1213 HOH HOH I . 
QB 3 HOH 614 1214 1214 HOH HOH I . 
QB 3 HOH 615 1215 1215 HOH HOH I . 
QB 3 HOH 616 1216 1216 HOH HOH I . 
QB 3 HOH 617 1217 1217 HOH HOH I . 
QB 3 HOH 618 1218 1218 HOH HOH I . 
QB 3 HOH 619 1219 1219 HOH HOH I . 
QB 3 HOH 620 1220 1220 HOH HOH I . 
QB 3 HOH 621 1221 1221 HOH HOH I . 
QB 3 HOH 622 1222 1222 HOH HOH I . 
QB 3 HOH 623 1223 1223 HOH HOH I . 
RB 3 HOH 1   601  601  HOH HOH J . 
RB 3 HOH 2   602  602  HOH HOH J . 
RB 3 HOH 3   603  603  HOH HOH J . 
RB 3 HOH 4   604  604  HOH HOH J . 
RB 3 HOH 5   605  605  HOH HOH J . 
RB 3 HOH 6   606  606  HOH HOH J . 
RB 3 HOH 7   607  607  HOH HOH J . 
RB 3 HOH 8   608  608  HOH HOH J . 
RB 3 HOH 9   609  609  HOH HOH J . 
RB 3 HOH 10  610  610  HOH HOH J . 
RB 3 HOH 11  611  611  HOH HOH J . 
RB 3 HOH 12  612  612  HOH HOH J . 
RB 3 HOH 13  613  613  HOH HOH J . 
RB 3 HOH 14  614  614  HOH HOH J . 
RB 3 HOH 15  615  615  HOH HOH J . 
RB 3 HOH 16  616  616  HOH HOH J . 
RB 3 HOH 17  617  617  HOH HOH J . 
RB 3 HOH 18  618  618  HOH HOH J . 
RB 3 HOH 19  619  619  HOH HOH J . 
RB 3 HOH 20  620  620  HOH HOH J . 
RB 3 HOH 21  621  621  HOH HOH J . 
RB 3 HOH 22  622  622  HOH HOH J . 
RB 3 HOH 23  623  623  HOH HOH J . 
RB 3 HOH 24  624  624  HOH HOH J . 
RB 3 HOH 25  625  625  HOH HOH J . 
RB 3 HOH 26  626  626  HOH HOH J . 
RB 3 HOH 27  627  627  HOH HOH J . 
RB 3 HOH 28  628  628  HOH HOH J . 
RB 3 HOH 29  629  629  HOH HOH J . 
RB 3 HOH 30  630  630  HOH HOH J . 
RB 3 HOH 31  631  631  HOH HOH J . 
RB 3 HOH 32  632  632  HOH HOH J . 
RB 3 HOH 33  633  633  HOH HOH J . 
RB 3 HOH 34  634  634  HOH HOH J . 
RB 3 HOH 35  635  635  HOH HOH J . 
RB 3 HOH 36  636  636  HOH HOH J . 
RB 3 HOH 37  637  637  HOH HOH J . 
RB 3 HOH 38  638  638  HOH HOH J . 
RB 3 HOH 39  639  639  HOH HOH J . 
RB 3 HOH 40  640  640  HOH HOH J . 
RB 3 HOH 41  641  641  HOH HOH J . 
RB 3 HOH 42  642  642  HOH HOH J . 
RB 3 HOH 43  643  643  HOH HOH J . 
RB 3 HOH 44  644  644  HOH HOH J . 
RB 3 HOH 45  645  645  HOH HOH J . 
RB 3 HOH 46  646  646  HOH HOH J . 
RB 3 HOH 47  647  647  HOH HOH J . 
RB 3 HOH 48  648  648  HOH HOH J . 
RB 3 HOH 49  649  649  HOH HOH J . 
RB 3 HOH 50  650  650  HOH HOH J . 
RB 3 HOH 51  651  651  HOH HOH J . 
RB 3 HOH 52  652  652  HOH HOH J . 
RB 3 HOH 53  653  653  HOH HOH J . 
RB 3 HOH 54  654  654  HOH HOH J . 
RB 3 HOH 55  655  655  HOH HOH J . 
RB 3 HOH 56  656  656  HOH HOH J . 
RB 3 HOH 57  657  657  HOH HOH J . 
RB 3 HOH 58  658  658  HOH HOH J . 
RB 3 HOH 59  659  659  HOH HOH J . 
RB 3 HOH 60  660  660  HOH HOH J . 
RB 3 HOH 61  661  661  HOH HOH J . 
RB 3 HOH 62  662  662  HOH HOH J . 
RB 3 HOH 63  663  663  HOH HOH J . 
RB 3 HOH 64  664  664  HOH HOH J . 
RB 3 HOH 65  665  665  HOH HOH J . 
RB 3 HOH 66  666  666  HOH HOH J . 
RB 3 HOH 67  667  667  HOH HOH J . 
RB 3 HOH 68  668  668  HOH HOH J . 
RB 3 HOH 69  669  669  HOH HOH J . 
RB 3 HOH 70  670  670  HOH HOH J . 
RB 3 HOH 71  671  671  HOH HOH J . 
RB 3 HOH 72  672  672  HOH HOH J . 
RB 3 HOH 73  673  673  HOH HOH J . 
RB 3 HOH 74  674  674  HOH HOH J . 
RB 3 HOH 75  675  675  HOH HOH J . 
RB 3 HOH 76  676  676  HOH HOH J . 
RB 3 HOH 77  677  677  HOH HOH J . 
RB 3 HOH 78  678  678  HOH HOH J . 
RB 3 HOH 79  679  679  HOH HOH J . 
RB 3 HOH 80  680  680  HOH HOH J . 
RB 3 HOH 81  681  681  HOH HOH J . 
RB 3 HOH 82  682  682  HOH HOH J . 
RB 3 HOH 83  683  683  HOH HOH J . 
RB 3 HOH 84  684  684  HOH HOH J . 
RB 3 HOH 85  685  685  HOH HOH J . 
RB 3 HOH 86  686  686  HOH HOH J . 
RB 3 HOH 87  687  687  HOH HOH J . 
RB 3 HOH 88  688  688  HOH HOH J . 
RB 3 HOH 89  689  689  HOH HOH J . 
RB 3 HOH 90  690  690  HOH HOH J . 
RB 3 HOH 91  691  691  HOH HOH J . 
RB 3 HOH 92  692  692  HOH HOH J . 
RB 3 HOH 93  693  693  HOH HOH J . 
RB 3 HOH 94  694  694  HOH HOH J . 
RB 3 HOH 95  695  695  HOH HOH J . 
RB 3 HOH 96  696  696  HOH HOH J . 
RB 3 HOH 97  697  697  HOH HOH J . 
RB 3 HOH 98  698  698  HOH HOH J . 
RB 3 HOH 99  699  699  HOH HOH J . 
RB 3 HOH 100 700  700  HOH HOH J . 
RB 3 HOH 101 701  701  HOH HOH J . 
RB 3 HOH 102 702  702  HOH HOH J . 
RB 3 HOH 103 703  703  HOH HOH J . 
RB 3 HOH 104 704  704  HOH HOH J . 
RB 3 HOH 105 705  705  HOH HOH J . 
RB 3 HOH 106 706  706  HOH HOH J . 
RB 3 HOH 107 707  707  HOH HOH J . 
RB 3 HOH 108 708  708  HOH HOH J . 
RB 3 HOH 109 709  709  HOH HOH J . 
RB 3 HOH 110 710  710  HOH HOH J . 
RB 3 HOH 111 711  711  HOH HOH J . 
RB 3 HOH 112 712  712  HOH HOH J . 
RB 3 HOH 113 713  713  HOH HOH J . 
RB 3 HOH 114 714  714  HOH HOH J . 
RB 3 HOH 115 715  715  HOH HOH J . 
RB 3 HOH 116 716  716  HOH HOH J . 
RB 3 HOH 117 717  717  HOH HOH J . 
RB 3 HOH 118 718  718  HOH HOH J . 
RB 3 HOH 119 719  719  HOH HOH J . 
RB 3 HOH 120 720  720  HOH HOH J . 
RB 3 HOH 121 721  721  HOH HOH J . 
RB 3 HOH 122 722  722  HOH HOH J . 
RB 3 HOH 123 723  723  HOH HOH J . 
RB 3 HOH 124 724  724  HOH HOH J . 
RB 3 HOH 125 725  725  HOH HOH J . 
RB 3 HOH 126 726  726  HOH HOH J . 
RB 3 HOH 127 727  727  HOH HOH J . 
RB 3 HOH 128 728  728  HOH HOH J . 
RB 3 HOH 129 729  729  HOH HOH J . 
RB 3 HOH 130 730  730  HOH HOH J . 
RB 3 HOH 131 731  731  HOH HOH J . 
RB 3 HOH 132 732  732  HOH HOH J . 
RB 3 HOH 133 733  733  HOH HOH J . 
RB 3 HOH 134 734  734  HOH HOH J . 
RB 3 HOH 135 735  735  HOH HOH J . 
RB 3 HOH 136 736  736  HOH HOH J . 
RB 3 HOH 137 737  737  HOH HOH J . 
RB 3 HOH 138 738  738  HOH HOH J . 
RB 3 HOH 139 739  739  HOH HOH J . 
RB 3 HOH 140 740  740  HOH HOH J . 
RB 3 HOH 141 741  741  HOH HOH J . 
RB 3 HOH 142 742  742  HOH HOH J . 
RB 3 HOH 143 743  743  HOH HOH J . 
RB 3 HOH 144 744  744  HOH HOH J . 
RB 3 HOH 145 745  745  HOH HOH J . 
RB 3 HOH 146 746  746  HOH HOH J . 
RB 3 HOH 147 747  747  HOH HOH J . 
RB 3 HOH 148 748  748  HOH HOH J . 
RB 3 HOH 149 749  749  HOH HOH J . 
RB 3 HOH 150 750  750  HOH HOH J . 
RB 3 HOH 151 751  751  HOH HOH J . 
RB 3 HOH 152 752  752  HOH HOH J . 
RB 3 HOH 153 753  753  HOH HOH J . 
RB 3 HOH 154 754  754  HOH HOH J . 
RB 3 HOH 155 755  755  HOH HOH J . 
RB 3 HOH 156 756  756  HOH HOH J . 
RB 3 HOH 157 757  757  HOH HOH J . 
RB 3 HOH 158 758  758  HOH HOH J . 
RB 3 HOH 159 759  759  HOH HOH J . 
RB 3 HOH 160 760  760  HOH HOH J . 
RB 3 HOH 161 761  761  HOH HOH J . 
RB 3 HOH 162 762  762  HOH HOH J . 
RB 3 HOH 163 763  763  HOH HOH J . 
RB 3 HOH 164 764  764  HOH HOH J . 
RB 3 HOH 165 765  765  HOH HOH J . 
RB 3 HOH 166 766  766  HOH HOH J . 
RB 3 HOH 167 767  767  HOH HOH J . 
RB 3 HOH 168 768  768  HOH HOH J . 
RB 3 HOH 169 769  769  HOH HOH J . 
RB 3 HOH 170 770  770  HOH HOH J . 
RB 3 HOH 171 771  771  HOH HOH J . 
RB 3 HOH 172 772  772  HOH HOH J . 
RB 3 HOH 173 773  773  HOH HOH J . 
RB 3 HOH 174 774  774  HOH HOH J . 
RB 3 HOH 175 775  775  HOH HOH J . 
RB 3 HOH 176 776  776  HOH HOH J . 
RB 3 HOH 177 777  777  HOH HOH J . 
RB 3 HOH 178 778  778  HOH HOH J . 
RB 3 HOH 179 779  779  HOH HOH J . 
RB 3 HOH 180 780  780  HOH HOH J . 
RB 3 HOH 181 781  781  HOH HOH J . 
RB 3 HOH 182 782  782  HOH HOH J . 
RB 3 HOH 183 783  783  HOH HOH J . 
RB 3 HOH 184 784  784  HOH HOH J . 
RB 3 HOH 185 785  785  HOH HOH J . 
RB 3 HOH 186 786  786  HOH HOH J . 
RB 3 HOH 187 787  787  HOH HOH J . 
RB 3 HOH 188 788  788  HOH HOH J . 
RB 3 HOH 189 789  789  HOH HOH J . 
RB 3 HOH 190 790  790  HOH HOH J . 
RB 3 HOH 191 791  791  HOH HOH J . 
RB 3 HOH 192 792  792  HOH HOH J . 
RB 3 HOH 193 793  793  HOH HOH J . 
RB 3 HOH 194 794  794  HOH HOH J . 
RB 3 HOH 195 795  795  HOH HOH J . 
RB 3 HOH 196 796  796  HOH HOH J . 
RB 3 HOH 197 797  797  HOH HOH J . 
RB 3 HOH 198 798  798  HOH HOH J . 
RB 3 HOH 199 799  799  HOH HOH J . 
RB 3 HOH 200 800  800  HOH HOH J . 
RB 3 HOH 201 801  801  HOH HOH J . 
RB 3 HOH 202 802  802  HOH HOH J . 
RB 3 HOH 203 803  803  HOH HOH J . 
RB 3 HOH 204 804  804  HOH HOH J . 
RB 3 HOH 205 805  805  HOH HOH J . 
RB 3 HOH 206 806  806  HOH HOH J . 
RB 3 HOH 207 807  807  HOH HOH J . 
RB 3 HOH 208 808  808  HOH HOH J . 
RB 3 HOH 209 809  809  HOH HOH J . 
RB 3 HOH 210 810  810  HOH HOH J . 
RB 3 HOH 211 811  811  HOH HOH J . 
RB 3 HOH 212 812  812  HOH HOH J . 
RB 3 HOH 213 813  813  HOH HOH J . 
RB 3 HOH 214 814  814  HOH HOH J . 
RB 3 HOH 215 815  815  HOH HOH J . 
RB 3 HOH 216 816  816  HOH HOH J . 
RB 3 HOH 217 817  817  HOH HOH J . 
RB 3 HOH 218 818  818  HOH HOH J . 
RB 3 HOH 219 819  819  HOH HOH J . 
RB 3 HOH 220 820  820  HOH HOH J . 
RB 3 HOH 221 821  821  HOH HOH J . 
RB 3 HOH 222 822  822  HOH HOH J . 
RB 3 HOH 223 823  823  HOH HOH J . 
RB 3 HOH 224 824  824  HOH HOH J . 
RB 3 HOH 225 825  825  HOH HOH J . 
RB 3 HOH 226 826  826  HOH HOH J . 
RB 3 HOH 227 827  827  HOH HOH J . 
RB 3 HOH 228 828  828  HOH HOH J . 
RB 3 HOH 229 829  829  HOH HOH J . 
RB 3 HOH 230 830  830  HOH HOH J . 
RB 3 HOH 231 831  831  HOH HOH J . 
RB 3 HOH 232 832  832  HOH HOH J . 
RB 3 HOH 233 833  833  HOH HOH J . 
RB 3 HOH 234 834  834  HOH HOH J . 
RB 3 HOH 235 835  835  HOH HOH J . 
RB 3 HOH 236 836  836  HOH HOH J . 
RB 3 HOH 237 837  837  HOH HOH J . 
RB 3 HOH 238 838  838  HOH HOH J . 
RB 3 HOH 239 839  839  HOH HOH J . 
RB 3 HOH 240 840  840  HOH HOH J . 
RB 3 HOH 241 841  841  HOH HOH J . 
RB 3 HOH 242 842  842  HOH HOH J . 
RB 3 HOH 243 843  843  HOH HOH J . 
RB 3 HOH 244 844  844  HOH HOH J . 
RB 3 HOH 245 845  845  HOH HOH J . 
RB 3 HOH 246 846  846  HOH HOH J . 
RB 3 HOH 247 847  847  HOH HOH J . 
RB 3 HOH 248 848  848  HOH HOH J . 
RB 3 HOH 249 849  849  HOH HOH J . 
RB 3 HOH 250 850  850  HOH HOH J . 
RB 3 HOH 251 851  851  HOH HOH J . 
RB 3 HOH 252 852  852  HOH HOH J . 
RB 3 HOH 253 853  853  HOH HOH J . 
RB 3 HOH 254 854  854  HOH HOH J . 
RB 3 HOH 255 855  855  HOH HOH J . 
RB 3 HOH 256 856  856  HOH HOH J . 
RB 3 HOH 257 857  857  HOH HOH J . 
RB 3 HOH 258 858  858  HOH HOH J . 
RB 3 HOH 259 859  859  HOH HOH J . 
RB 3 HOH 260 860  860  HOH HOH J . 
RB 3 HOH 261 861  861  HOH HOH J . 
RB 3 HOH 262 862  862  HOH HOH J . 
RB 3 HOH 263 863  863  HOH HOH J . 
RB 3 HOH 264 864  864  HOH HOH J . 
RB 3 HOH 265 865  865  HOH HOH J . 
RB 3 HOH 266 866  866  HOH HOH J . 
RB 3 HOH 267 867  867  HOH HOH J . 
RB 3 HOH 268 868  868  HOH HOH J . 
RB 3 HOH 269 869  869  HOH HOH J . 
RB 3 HOH 270 870  870  HOH HOH J . 
RB 3 HOH 271 871  871  HOH HOH J . 
RB 3 HOH 272 872  872  HOH HOH J . 
RB 3 HOH 273 873  873  HOH HOH J . 
RB 3 HOH 274 874  874  HOH HOH J . 
RB 3 HOH 275 875  875  HOH HOH J . 
RB 3 HOH 276 876  876  HOH HOH J . 
RB 3 HOH 277 877  877  HOH HOH J . 
RB 3 HOH 278 878  878  HOH HOH J . 
RB 3 HOH 279 879  879  HOH HOH J . 
RB 3 HOH 280 880  880  HOH HOH J . 
RB 3 HOH 281 881  881  HOH HOH J . 
RB 3 HOH 282 882  882  HOH HOH J . 
RB 3 HOH 283 883  883  HOH HOH J . 
RB 3 HOH 284 884  884  HOH HOH J . 
RB 3 HOH 285 885  885  HOH HOH J . 
RB 3 HOH 286 886  886  HOH HOH J . 
RB 3 HOH 287 887  887  HOH HOH J . 
RB 3 HOH 288 888  888  HOH HOH J . 
RB 3 HOH 289 889  889  HOH HOH J . 
RB 3 HOH 290 890  890  HOH HOH J . 
RB 3 HOH 291 891  891  HOH HOH J . 
RB 3 HOH 292 892  892  HOH HOH J . 
RB 3 HOH 293 893  893  HOH HOH J . 
RB 3 HOH 294 894  894  HOH HOH J . 
RB 3 HOH 295 895  895  HOH HOH J . 
RB 3 HOH 296 896  896  HOH HOH J . 
RB 3 HOH 297 897  897  HOH HOH J . 
RB 3 HOH 298 898  898  HOH HOH J . 
RB 3 HOH 299 899  899  HOH HOH J . 
RB 3 HOH 300 900  900  HOH HOH J . 
RB 3 HOH 301 901  901  HOH HOH J . 
RB 3 HOH 302 902  902  HOH HOH J . 
RB 3 HOH 303 903  903  HOH HOH J . 
RB 3 HOH 304 904  904  HOH HOH J . 
RB 3 HOH 305 905  905  HOH HOH J . 
RB 3 HOH 306 906  906  HOH HOH J . 
RB 3 HOH 307 907  907  HOH HOH J . 
RB 3 HOH 308 908  908  HOH HOH J . 
RB 3 HOH 309 909  909  HOH HOH J . 
RB 3 HOH 310 910  910  HOH HOH J . 
RB 3 HOH 311 911  911  HOH HOH J . 
RB 3 HOH 312 912  912  HOH HOH J . 
RB 3 HOH 313 913  913  HOH HOH J . 
RB 3 HOH 314 914  914  HOH HOH J . 
RB 3 HOH 315 915  915  HOH HOH J . 
RB 3 HOH 316 916  916  HOH HOH J . 
RB 3 HOH 317 917  917  HOH HOH J . 
RB 3 HOH 318 918  918  HOH HOH J . 
RB 3 HOH 319 919  919  HOH HOH J . 
RB 3 HOH 320 920  920  HOH HOH J . 
RB 3 HOH 321 921  921  HOH HOH J . 
RB 3 HOH 322 922  922  HOH HOH J . 
RB 3 HOH 323 923  923  HOH HOH J . 
RB 3 HOH 324 924  924  HOH HOH J . 
RB 3 HOH 325 925  925  HOH HOH J . 
RB 3 HOH 326 926  926  HOH HOH J . 
RB 3 HOH 327 927  927  HOH HOH J . 
RB 3 HOH 328 928  928  HOH HOH J . 
RB 3 HOH 329 929  929  HOH HOH J . 
RB 3 HOH 330 930  930  HOH HOH J . 
RB 3 HOH 331 931  931  HOH HOH J . 
RB 3 HOH 332 932  932  HOH HOH J . 
RB 3 HOH 333 933  933  HOH HOH J . 
RB 3 HOH 334 934  934  HOH HOH J . 
RB 3 HOH 335 935  935  HOH HOH J . 
RB 3 HOH 336 936  936  HOH HOH J . 
RB 3 HOH 337 937  937  HOH HOH J . 
RB 3 HOH 338 938  938  HOH HOH J . 
RB 3 HOH 339 939  939  HOH HOH J . 
RB 3 HOH 340 940  940  HOH HOH J . 
RB 3 HOH 341 941  941  HOH HOH J . 
RB 3 HOH 342 942  942  HOH HOH J . 
RB 3 HOH 343 943  943  HOH HOH J . 
RB 3 HOH 344 944  944  HOH HOH J . 
RB 3 HOH 345 945  945  HOH HOH J . 
RB 3 HOH 346 946  946  HOH HOH J . 
RB 3 HOH 347 947  947  HOH HOH J . 
RB 3 HOH 348 948  948  HOH HOH J . 
RB 3 HOH 349 949  949  HOH HOH J . 
RB 3 HOH 350 950  950  HOH HOH J . 
RB 3 HOH 351 951  951  HOH HOH J . 
RB 3 HOH 352 952  952  HOH HOH J . 
RB 3 HOH 353 953  953  HOH HOH J . 
RB 3 HOH 354 954  954  HOH HOH J . 
RB 3 HOH 355 955  955  HOH HOH J . 
RB 3 HOH 356 956  956  HOH HOH J . 
RB 3 HOH 357 957  957  HOH HOH J . 
RB 3 HOH 358 958  958  HOH HOH J . 
RB 3 HOH 359 959  959  HOH HOH J . 
RB 3 HOH 360 960  960  HOH HOH J . 
RB 3 HOH 361 961  961  HOH HOH J . 
RB 3 HOH 362 962  962  HOH HOH J . 
RB 3 HOH 363 963  963  HOH HOH J . 
RB 3 HOH 364 964  964  HOH HOH J . 
RB 3 HOH 365 965  965  HOH HOH J . 
RB 3 HOH 366 966  966  HOH HOH J . 
RB 3 HOH 367 967  967  HOH HOH J . 
RB 3 HOH 368 968  968  HOH HOH J . 
RB 3 HOH 369 969  969  HOH HOH J . 
RB 3 HOH 370 970  970  HOH HOH J . 
RB 3 HOH 371 971  971  HOH HOH J . 
RB 3 HOH 372 972  972  HOH HOH J . 
RB 3 HOH 373 973  973  HOH HOH J . 
RB 3 HOH 374 974  974  HOH HOH J . 
RB 3 HOH 375 975  975  HOH HOH J . 
RB 3 HOH 376 976  976  HOH HOH J . 
RB 3 HOH 377 977  977  HOH HOH J . 
RB 3 HOH 378 978  978  HOH HOH J . 
RB 3 HOH 379 979  979  HOH HOH J . 
RB 3 HOH 380 980  980  HOH HOH J . 
RB 3 HOH 381 981  981  HOH HOH J . 
RB 3 HOH 382 982  982  HOH HOH J . 
RB 3 HOH 383 983  983  HOH HOH J . 
RB 3 HOH 384 984  984  HOH HOH J . 
RB 3 HOH 385 985  985  HOH HOH J . 
RB 3 HOH 386 986  986  HOH HOH J . 
RB 3 HOH 387 987  987  HOH HOH J . 
RB 3 HOH 388 988  988  HOH HOH J . 
RB 3 HOH 389 989  989  HOH HOH J . 
RB 3 HOH 390 990  990  HOH HOH J . 
RB 3 HOH 391 991  991  HOH HOH J . 
RB 3 HOH 392 992  992  HOH HOH J . 
RB 3 HOH 393 993  993  HOH HOH J . 
RB 3 HOH 394 994  994  HOH HOH J . 
RB 3 HOH 395 995  995  HOH HOH J . 
RB 3 HOH 396 996  996  HOH HOH J . 
RB 3 HOH 397 997  997  HOH HOH J . 
RB 3 HOH 398 998  998  HOH HOH J . 
RB 3 HOH 399 999  999  HOH HOH J . 
RB 3 HOH 400 1000 1000 HOH HOH J . 
RB 3 HOH 401 1001 1001 HOH HOH J . 
RB 3 HOH 402 1002 1002 HOH HOH J . 
RB 3 HOH 403 1003 1003 HOH HOH J . 
RB 3 HOH 404 1004 1004 HOH HOH J . 
RB 3 HOH 405 1005 1005 HOH HOH J . 
RB 3 HOH 406 1006 1006 HOH HOH J . 
RB 3 HOH 407 1007 1007 HOH HOH J . 
RB 3 HOH 408 1008 1008 HOH HOH J . 
RB 3 HOH 409 1009 1009 HOH HOH J . 
RB 3 HOH 410 1010 1010 HOH HOH J . 
RB 3 HOH 411 1011 1011 HOH HOH J . 
RB 3 HOH 412 1012 1012 HOH HOH J . 
RB 3 HOH 413 1013 1013 HOH HOH J . 
RB 3 HOH 414 1014 1014 HOH HOH J . 
RB 3 HOH 415 1015 1015 HOH HOH J . 
RB 3 HOH 416 1016 1016 HOH HOH J . 
RB 3 HOH 417 1017 1017 HOH HOH J . 
RB 3 HOH 418 1018 1018 HOH HOH J . 
RB 3 HOH 419 1019 1019 HOH HOH J . 
RB 3 HOH 420 1020 1020 HOH HOH J . 
RB 3 HOH 421 1021 1021 HOH HOH J . 
RB 3 HOH 422 1022 1022 HOH HOH J . 
RB 3 HOH 423 1023 1023 HOH HOH J . 
RB 3 HOH 424 1024 1024 HOH HOH J . 
RB 3 HOH 425 1025 1025 HOH HOH J . 
RB 3 HOH 426 1026 1026 HOH HOH J . 
RB 3 HOH 427 1027 1027 HOH HOH J . 
RB 3 HOH 428 1028 1028 HOH HOH J . 
RB 3 HOH 429 1029 1029 HOH HOH J . 
RB 3 HOH 430 1030 1030 HOH HOH J . 
RB 3 HOH 431 1031 1031 HOH HOH J . 
RB 3 HOH 432 1032 1032 HOH HOH J . 
RB 3 HOH 433 1033 1033 HOH HOH J . 
RB 3 HOH 434 1034 1034 HOH HOH J . 
RB 3 HOH 435 1035 1035 HOH HOH J . 
RB 3 HOH 436 1036 1036 HOH HOH J . 
RB 3 HOH 437 1037 1037 HOH HOH J . 
RB 3 HOH 438 1038 1038 HOH HOH J . 
RB 3 HOH 439 1039 1039 HOH HOH J . 
RB 3 HOH 440 1040 1040 HOH HOH J . 
RB 3 HOH 441 1041 1041 HOH HOH J . 
RB 3 HOH 442 1042 1042 HOH HOH J . 
RB 3 HOH 443 1043 1043 HOH HOH J . 
RB 3 HOH 444 1044 1044 HOH HOH J . 
RB 3 HOH 445 1045 1045 HOH HOH J . 
RB 3 HOH 446 1046 1046 HOH HOH J . 
RB 3 HOH 447 1047 1047 HOH HOH J . 
RB 3 HOH 448 1048 1048 HOH HOH J . 
RB 3 HOH 449 1049 1049 HOH HOH J . 
RB 3 HOH 450 1050 1050 HOH HOH J . 
RB 3 HOH 451 1051 1051 HOH HOH J . 
RB 3 HOH 452 1052 1052 HOH HOH J . 
RB 3 HOH 453 1053 1053 HOH HOH J . 
RB 3 HOH 454 1054 1054 HOH HOH J . 
RB 3 HOH 455 1055 1055 HOH HOH J . 
RB 3 HOH 456 1056 1056 HOH HOH J . 
RB 3 HOH 457 1057 1057 HOH HOH J . 
RB 3 HOH 458 1058 1058 HOH HOH J . 
RB 3 HOH 459 1059 1059 HOH HOH J . 
RB 3 HOH 460 1060 1060 HOH HOH J . 
RB 3 HOH 461 1061 1061 HOH HOH J . 
RB 3 HOH 462 1062 1062 HOH HOH J . 
RB 3 HOH 463 1063 1063 HOH HOH J . 
RB 3 HOH 464 1064 1064 HOH HOH J . 
RB 3 HOH 465 1065 1065 HOH HOH J . 
RB 3 HOH 466 1066 1066 HOH HOH J . 
RB 3 HOH 467 1067 1067 HOH HOH J . 
RB 3 HOH 468 1068 1068 HOH HOH J . 
RB 3 HOH 469 1069 1069 HOH HOH J . 
RB 3 HOH 470 1070 1070 HOH HOH J . 
RB 3 HOH 471 1071 1071 HOH HOH J . 
RB 3 HOH 472 1072 1072 HOH HOH J . 
RB 3 HOH 473 1073 1073 HOH HOH J . 
RB 3 HOH 474 1074 1074 HOH HOH J . 
RB 3 HOH 475 1075 1075 HOH HOH J . 
RB 3 HOH 476 1076 1076 HOH HOH J . 
RB 3 HOH 477 1077 1077 HOH HOH J . 
RB 3 HOH 478 1078 1078 HOH HOH J . 
RB 3 HOH 479 1079 1079 HOH HOH J . 
RB 3 HOH 480 1080 1080 HOH HOH J . 
RB 3 HOH 481 1081 1081 HOH HOH J . 
RB 3 HOH 482 1082 1082 HOH HOH J . 
RB 3 HOH 483 1083 1083 HOH HOH J . 
RB 3 HOH 484 1084 1084 HOH HOH J . 
RB 3 HOH 485 1085 1085 HOH HOH J . 
RB 3 HOH 486 1086 1086 HOH HOH J . 
RB 3 HOH 487 1087 1087 HOH HOH J . 
RB 3 HOH 488 1088 1088 HOH HOH J . 
RB 3 HOH 489 1089 1089 HOH HOH J . 
RB 3 HOH 490 1090 1090 HOH HOH J . 
RB 3 HOH 491 1091 1091 HOH HOH J . 
RB 3 HOH 492 1092 1092 HOH HOH J . 
RB 3 HOH 493 1093 1093 HOH HOH J . 
RB 3 HOH 494 1094 1094 HOH HOH J . 
RB 3 HOH 495 1095 1095 HOH HOH J . 
RB 3 HOH 496 1096 1096 HOH HOH J . 
RB 3 HOH 497 1097 1097 HOH HOH J . 
RB 3 HOH 498 1098 1098 HOH HOH J . 
RB 3 HOH 499 1099 1099 HOH HOH J . 
RB 3 HOH 500 1100 1100 HOH HOH J . 
RB 3 HOH 501 1101 1101 HOH HOH J . 
RB 3 HOH 502 1102 1102 HOH HOH J . 
RB 3 HOH 503 1103 1103 HOH HOH J . 
RB 3 HOH 504 1104 1104 HOH HOH J . 
RB 3 HOH 505 1105 1105 HOH HOH J . 
RB 3 HOH 506 1106 1106 HOH HOH J . 
RB 3 HOH 507 1107 1107 HOH HOH J . 
RB 3 HOH 508 1108 1108 HOH HOH J . 
RB 3 HOH 509 1109 1109 HOH HOH J . 
RB 3 HOH 510 1110 1110 HOH HOH J . 
RB 3 HOH 511 1111 1111 HOH HOH J . 
RB 3 HOH 512 1112 1112 HOH HOH J . 
RB 3 HOH 513 1113 1113 HOH HOH J . 
RB 3 HOH 514 1114 1114 HOH HOH J . 
RB 3 HOH 515 1115 1115 HOH HOH J . 
RB 3 HOH 516 1116 1116 HOH HOH J . 
RB 3 HOH 517 1117 1117 HOH HOH J . 
RB 3 HOH 518 1118 1118 HOH HOH J . 
RB 3 HOH 519 1119 1119 HOH HOH J . 
RB 3 HOH 520 1120 1120 HOH HOH J . 
RB 3 HOH 521 1121 1121 HOH HOH J . 
RB 3 HOH 522 1122 1122 HOH HOH J . 
RB 3 HOH 523 1123 1123 HOH HOH J . 
RB 3 HOH 524 1124 1124 HOH HOH J . 
RB 3 HOH 525 1125 1125 HOH HOH J . 
RB 3 HOH 526 1126 1126 HOH HOH J . 
RB 3 HOH 527 1127 1127 HOH HOH J . 
RB 3 HOH 528 1128 1128 HOH HOH J . 
RB 3 HOH 529 1129 1129 HOH HOH J . 
RB 3 HOH 530 1130 1130 HOH HOH J . 
RB 3 HOH 531 1131 1131 HOH HOH J . 
RB 3 HOH 532 1132 1132 HOH HOH J . 
RB 3 HOH 533 1133 1133 HOH HOH J . 
RB 3 HOH 534 1134 1134 HOH HOH J . 
RB 3 HOH 535 1135 1135 HOH HOH J . 
RB 3 HOH 536 1136 1136 HOH HOH J . 
RB 3 HOH 537 1137 1137 HOH HOH J . 
RB 3 HOH 538 1138 1138 HOH HOH J . 
RB 3 HOH 539 1139 1139 HOH HOH J . 
RB 3 HOH 540 1140 1140 HOH HOH J . 
RB 3 HOH 541 1141 1141 HOH HOH J . 
RB 3 HOH 542 1142 1142 HOH HOH J . 
RB 3 HOH 543 1143 1143 HOH HOH J . 
RB 3 HOH 544 1144 1144 HOH HOH J . 
RB 3 HOH 545 1145 1145 HOH HOH J . 
RB 3 HOH 546 1146 1146 HOH HOH J . 
RB 3 HOH 547 1147 1147 HOH HOH J . 
RB 3 HOH 548 1148 1148 HOH HOH J . 
RB 3 HOH 549 1149 1149 HOH HOH J . 
RB 3 HOH 550 1150 1150 HOH HOH J . 
RB 3 HOH 551 1151 1151 HOH HOH J . 
RB 3 HOH 552 1152 1152 HOH HOH J . 
RB 3 HOH 553 1153 1153 HOH HOH J . 
RB 3 HOH 554 1154 1154 HOH HOH J . 
RB 3 HOH 555 1155 1155 HOH HOH J . 
RB 3 HOH 556 1156 1156 HOH HOH J . 
RB 3 HOH 557 1157 1157 HOH HOH J . 
RB 3 HOH 558 1158 1158 HOH HOH J . 
RB 3 HOH 559 1159 1159 HOH HOH J . 
RB 3 HOH 560 1160 1160 HOH HOH J . 
RB 3 HOH 561 1161 1161 HOH HOH J . 
RB 3 HOH 562 1162 1162 HOH HOH J . 
RB 3 HOH 563 1163 1163 HOH HOH J . 
RB 3 HOH 564 1164 1164 HOH HOH J . 
RB 3 HOH 565 1165 1165 HOH HOH J . 
RB 3 HOH 566 1166 1166 HOH HOH J . 
RB 3 HOH 567 1167 1167 HOH HOH J . 
RB 3 HOH 568 1168 1168 HOH HOH J . 
RB 3 HOH 569 1169 1169 HOH HOH J . 
RB 3 HOH 570 1170 1170 HOH HOH J . 
RB 3 HOH 571 1171 1171 HOH HOH J . 
RB 3 HOH 572 1172 1172 HOH HOH J . 
RB 3 HOH 573 1173 1173 HOH HOH J . 
RB 3 HOH 574 1174 1174 HOH HOH J . 
RB 3 HOH 575 1175 1175 HOH HOH J . 
RB 3 HOH 576 1176 1176 HOH HOH J . 
RB 3 HOH 577 1177 1177 HOH HOH J . 
RB 3 HOH 578 1178 1178 HOH HOH J . 
RB 3 HOH 579 1179 1179 HOH HOH J . 
RB 3 HOH 580 1180 1180 HOH HOH J . 
RB 3 HOH 581 1181 1181 HOH HOH J . 
RB 3 HOH 582 1182 1182 HOH HOH J . 
RB 3 HOH 583 1183 1183 HOH HOH J . 
RB 3 HOH 584 1184 1184 HOH HOH J . 
RB 3 HOH 585 1185 1185 HOH HOH J . 
RB 3 HOH 586 1186 1186 HOH HOH J . 
RB 3 HOH 587 1187 1187 HOH HOH J . 
RB 3 HOH 588 1188 1188 HOH HOH J . 
RB 3 HOH 589 1189 1189 HOH HOH J . 
RB 3 HOH 590 1190 1190 HOH HOH J . 
RB 3 HOH 591 1191 1191 HOH HOH J . 
RB 3 HOH 592 1192 1192 HOH HOH J . 
RB 3 HOH 593 1193 1193 HOH HOH J . 
RB 3 HOH 594 1194 1194 HOH HOH J . 
RB 3 HOH 595 1195 1195 HOH HOH J . 
RB 3 HOH 596 1196 1196 HOH HOH J . 
RB 3 HOH 597 1197 1197 HOH HOH J . 
RB 3 HOH 598 1198 1198 HOH HOH J . 
RB 3 HOH 599 1199 1199 HOH HOH J . 
RB 3 HOH 600 1200 1200 HOH HOH J . 
RB 3 HOH 601 1201 1201 HOH HOH J . 
RB 3 HOH 602 1202 1202 HOH HOH J . 
RB 3 HOH 603 1203 1203 HOH HOH J . 
RB 3 HOH 604 1204 1204 HOH HOH J . 
RB 3 HOH 605 1205 1205 HOH HOH J . 
RB 3 HOH 606 1206 1206 HOH HOH J . 
RB 3 HOH 607 1207 1207 HOH HOH J . 
RB 3 HOH 608 1208 1208 HOH HOH J . 
RB 3 HOH 609 1209 1209 HOH HOH J . 
RB 3 HOH 610 1210 1210 HOH HOH J . 
RB 3 HOH 611 1211 1211 HOH HOH J . 
RB 3 HOH 612 1212 1212 HOH HOH J . 
RB 3 HOH 613 1213 1213 HOH HOH J . 
RB 3 HOH 614 1214 1214 HOH HOH J . 
RB 3 HOH 615 1215 1215 HOH HOH J . 
RB 3 HOH 616 1216 1216 HOH HOH J . 
RB 3 HOH 617 1217 1217 HOH HOH J . 
RB 3 HOH 618 1218 1218 HOH HOH J . 
RB 3 HOH 619 1219 1219 HOH HOH J . 
RB 3 HOH 620 1220 1220 HOH HOH J . 
RB 3 HOH 621 1221 1221 HOH HOH J . 
RB 3 HOH 622 1222 1222 HOH HOH J . 
RB 3 HOH 623 1223 1223 HOH HOH J . 
RB 3 HOH 624 1224 1224 HOH HOH J . 
RB 3 HOH 625 1225 1225 HOH HOH J . 
RB 3 HOH 626 1226 1226 HOH HOH J . 
RB 3 HOH 627 1227 1227 HOH HOH J . 
RB 3 HOH 628 1228 1228 HOH HOH J . 
RB 3 HOH 629 1229 1229 HOH HOH J . 
RB 3 HOH 630 1230 1230 HOH HOH J . 
RB 3 HOH 631 1231 1231 HOH HOH J . 
RB 3 HOH 632 1232 1232 HOH HOH J . 
RB 3 HOH 633 1233 1233 HOH HOH J . 
RB 3 HOH 634 1234 1234 HOH HOH J . 
RB 3 HOH 635 1235 1235 HOH HOH J . 
RB 3 HOH 636 1236 1236 HOH HOH J . 
RB 3 HOH 637 1237 1237 HOH HOH J . 
RB 3 HOH 638 1238 1238 HOH HOH J . 
RB 3 HOH 639 1239 1239 HOH HOH J . 
RB 3 HOH 640 1240 1240 HOH HOH J . 
RB 3 HOH 641 1241 1241 HOH HOH J . 
RB 3 HOH 642 1242 1242 HOH HOH J . 
RB 3 HOH 643 1243 1243 HOH HOH J . 
RB 3 HOH 644 1244 1244 HOH HOH J . 
RB 3 HOH 645 1245 1245 HOH HOH J . 
RB 3 HOH 646 1246 1246 HOH HOH J . 
RB 3 HOH 647 1247 1247 HOH HOH J . 
RB 3 HOH 648 1248 1248 HOH HOH J . 
RB 3 HOH 649 1249 1249 HOH HOH J . 
RB 3 HOH 650 1250 1250 HOH HOH J . 
RB 3 HOH 651 1251 1251 HOH HOH J . 
RB 3 HOH 652 1252 1252 HOH HOH J . 
RB 3 HOH 653 1253 1253 HOH HOH J . 
RB 3 HOH 654 1254 1254 HOH HOH J . 
SB 3 HOH 1   601  601  HOH HOH K . 
SB 3 HOH 2   602  602  HOH HOH K . 
SB 3 HOH 3   603  603  HOH HOH K . 
SB 3 HOH 4   604  604  HOH HOH K . 
SB 3 HOH 5   605  605  HOH HOH K . 
SB 3 HOH 6   606  606  HOH HOH K . 
SB 3 HOH 7   607  607  HOH HOH K . 
SB 3 HOH 8   608  608  HOH HOH K . 
SB 3 HOH 9   609  609  HOH HOH K . 
SB 3 HOH 10  610  610  HOH HOH K . 
SB 3 HOH 11  611  611  HOH HOH K . 
SB 3 HOH 12  612  612  HOH HOH K . 
SB 3 HOH 13  613  613  HOH HOH K . 
SB 3 HOH 14  614  614  HOH HOH K . 
SB 3 HOH 15  615  615  HOH HOH K . 
SB 3 HOH 16  616  616  HOH HOH K . 
SB 3 HOH 17  617  617  HOH HOH K . 
SB 3 HOH 18  618  618  HOH HOH K . 
SB 3 HOH 19  619  619  HOH HOH K . 
SB 3 HOH 20  620  620  HOH HOH K . 
SB 3 HOH 21  621  621  HOH HOH K . 
SB 3 HOH 22  622  622  HOH HOH K . 
SB 3 HOH 23  623  623  HOH HOH K . 
SB 3 HOH 24  624  624  HOH HOH K . 
SB 3 HOH 25  625  625  HOH HOH K . 
SB 3 HOH 26  626  626  HOH HOH K . 
SB 3 HOH 27  627  627  HOH HOH K . 
SB 3 HOH 28  628  628  HOH HOH K . 
SB 3 HOH 29  629  629  HOH HOH K . 
SB 3 HOH 30  630  630  HOH HOH K . 
SB 3 HOH 31  631  631  HOH HOH K . 
SB 3 HOH 32  632  632  HOH HOH K . 
SB 3 HOH 33  633  633  HOH HOH K . 
SB 3 HOH 34  634  634  HOH HOH K . 
SB 3 HOH 35  635  635  HOH HOH K . 
SB 3 HOH 36  636  636  HOH HOH K . 
SB 3 HOH 37  637  637  HOH HOH K . 
SB 3 HOH 38  638  638  HOH HOH K . 
SB 3 HOH 39  639  639  HOH HOH K . 
SB 3 HOH 40  640  640  HOH HOH K . 
SB 3 HOH 41  641  641  HOH HOH K . 
SB 3 HOH 42  642  642  HOH HOH K . 
SB 3 HOH 43  643  643  HOH HOH K . 
SB 3 HOH 44  644  644  HOH HOH K . 
SB 3 HOH 45  645  645  HOH HOH K . 
SB 3 HOH 46  646  646  HOH HOH K . 
SB 3 HOH 47  647  647  HOH HOH K . 
SB 3 HOH 48  648  648  HOH HOH K . 
SB 3 HOH 49  649  649  HOH HOH K . 
SB 3 HOH 50  650  650  HOH HOH K . 
SB 3 HOH 51  651  651  HOH HOH K . 
SB 3 HOH 52  652  652  HOH HOH K . 
SB 3 HOH 53  653  653  HOH HOH K . 
SB 3 HOH 54  654  654  HOH HOH K . 
SB 3 HOH 55  655  655  HOH HOH K . 
SB 3 HOH 56  656  656  HOH HOH K . 
SB 3 HOH 57  657  657  HOH HOH K . 
SB 3 HOH 58  658  658  HOH HOH K . 
SB 3 HOH 59  659  659  HOH HOH K . 
SB 3 HOH 60  660  660  HOH HOH K . 
SB 3 HOH 61  661  661  HOH HOH K . 
SB 3 HOH 62  662  662  HOH HOH K . 
SB 3 HOH 63  663  663  HOH HOH K . 
SB 3 HOH 64  664  664  HOH HOH K . 
SB 3 HOH 65  665  665  HOH HOH K . 
SB 3 HOH 66  666  666  HOH HOH K . 
SB 3 HOH 67  667  667  HOH HOH K . 
SB 3 HOH 68  668  668  HOH HOH K . 
SB 3 HOH 69  669  669  HOH HOH K . 
SB 3 HOH 70  670  670  HOH HOH K . 
SB 3 HOH 71  671  671  HOH HOH K . 
SB 3 HOH 72  672  672  HOH HOH K . 
SB 3 HOH 73  673  673  HOH HOH K . 
SB 3 HOH 74  674  674  HOH HOH K . 
SB 3 HOH 75  675  675  HOH HOH K . 
SB 3 HOH 76  676  676  HOH HOH K . 
SB 3 HOH 77  677  677  HOH HOH K . 
SB 3 HOH 78  678  678  HOH HOH K . 
SB 3 HOH 79  679  679  HOH HOH K . 
SB 3 HOH 80  680  680  HOH HOH K . 
SB 3 HOH 81  681  681  HOH HOH K . 
SB 3 HOH 82  682  682  HOH HOH K . 
SB 3 HOH 83  683  683  HOH HOH K . 
SB 3 HOH 84  684  684  HOH HOH K . 
SB 3 HOH 85  685  685  HOH HOH K . 
SB 3 HOH 86  686  686  HOH HOH K . 
SB 3 HOH 87  687  687  HOH HOH K . 
SB 3 HOH 88  688  688  HOH HOH K . 
SB 3 HOH 89  689  689  HOH HOH K . 
SB 3 HOH 90  690  690  HOH HOH K . 
SB 3 HOH 91  691  691  HOH HOH K . 
SB 3 HOH 92  692  692  HOH HOH K . 
SB 3 HOH 93  693  693  HOH HOH K . 
SB 3 HOH 94  694  694  HOH HOH K . 
SB 3 HOH 95  695  695  HOH HOH K . 
SB 3 HOH 96  696  696  HOH HOH K . 
SB 3 HOH 97  697  697  HOH HOH K . 
SB 3 HOH 98  698  698  HOH HOH K . 
SB 3 HOH 99  699  699  HOH HOH K . 
SB 3 HOH 100 700  700  HOH HOH K . 
SB 3 HOH 101 701  701  HOH HOH K . 
SB 3 HOH 102 702  702  HOH HOH K . 
SB 3 HOH 103 703  703  HOH HOH K . 
SB 3 HOH 104 704  704  HOH HOH K . 
SB 3 HOH 105 705  705  HOH HOH K . 
SB 3 HOH 106 706  706  HOH HOH K . 
SB 3 HOH 107 707  707  HOH HOH K . 
SB 3 HOH 108 708  708  HOH HOH K . 
SB 3 HOH 109 709  709  HOH HOH K . 
SB 3 HOH 110 710  710  HOH HOH K . 
SB 3 HOH 111 711  711  HOH HOH K . 
SB 3 HOH 112 712  712  HOH HOH K . 
SB 3 HOH 113 713  713  HOH HOH K . 
SB 3 HOH 114 714  714  HOH HOH K . 
SB 3 HOH 115 715  715  HOH HOH K . 
SB 3 HOH 116 716  716  HOH HOH K . 
SB 3 HOH 117 717  717  HOH HOH K . 
SB 3 HOH 118 718  718  HOH HOH K . 
SB 3 HOH 119 719  719  HOH HOH K . 
SB 3 HOH 120 720  720  HOH HOH K . 
SB 3 HOH 121 721  721  HOH HOH K . 
SB 3 HOH 122 722  722  HOH HOH K . 
SB 3 HOH 123 723  723  HOH HOH K . 
SB 3 HOH 124 724  724  HOH HOH K . 
SB 3 HOH 125 725  725  HOH HOH K . 
SB 3 HOH 126 726  726  HOH HOH K . 
SB 3 HOH 127 727  727  HOH HOH K . 
SB 3 HOH 128 728  728  HOH HOH K . 
SB 3 HOH 129 729  729  HOH HOH K . 
SB 3 HOH 130 730  730  HOH HOH K . 
SB 3 HOH 131 731  731  HOH HOH K . 
SB 3 HOH 132 732  732  HOH HOH K . 
SB 3 HOH 133 733  733  HOH HOH K . 
SB 3 HOH 134 734  734  HOH HOH K . 
SB 3 HOH 135 735  735  HOH HOH K . 
SB 3 HOH 136 736  736  HOH HOH K . 
SB 3 HOH 137 737  737  HOH HOH K . 
SB 3 HOH 138 738  738  HOH HOH K . 
SB 3 HOH 139 739  739  HOH HOH K . 
SB 3 HOH 140 740  740  HOH HOH K . 
SB 3 HOH 141 741  741  HOH HOH K . 
SB 3 HOH 142 742  742  HOH HOH K . 
SB 3 HOH 143 743  743  HOH HOH K . 
SB 3 HOH 144 744  744  HOH HOH K . 
SB 3 HOH 145 745  745  HOH HOH K . 
SB 3 HOH 146 746  746  HOH HOH K . 
SB 3 HOH 147 747  747  HOH HOH K . 
SB 3 HOH 148 748  748  HOH HOH K . 
SB 3 HOH 149 749  749  HOH HOH K . 
SB 3 HOH 150 750  750  HOH HOH K . 
SB 3 HOH 151 751  751  HOH HOH K . 
SB 3 HOH 152 752  752  HOH HOH K . 
SB 3 HOH 153 753  753  HOH HOH K . 
SB 3 HOH 154 754  754  HOH HOH K . 
SB 3 HOH 155 755  755  HOH HOH K . 
SB 3 HOH 156 756  756  HOH HOH K . 
SB 3 HOH 157 757  757  HOH HOH K . 
SB 3 HOH 158 758  758  HOH HOH K . 
SB 3 HOH 159 759  759  HOH HOH K . 
SB 3 HOH 160 760  760  HOH HOH K . 
SB 3 HOH 161 761  761  HOH HOH K . 
SB 3 HOH 162 762  762  HOH HOH K . 
SB 3 HOH 163 763  763  HOH HOH K . 
SB 3 HOH 164 764  764  HOH HOH K . 
SB 3 HOH 165 765  765  HOH HOH K . 
SB 3 HOH 166 766  766  HOH HOH K . 
SB 3 HOH 167 767  767  HOH HOH K . 
SB 3 HOH 168 768  768  HOH HOH K . 
SB 3 HOH 169 769  769  HOH HOH K . 
SB 3 HOH 170 770  770  HOH HOH K . 
SB 3 HOH 171 771  771  HOH HOH K . 
SB 3 HOH 172 772  772  HOH HOH K . 
SB 3 HOH 173 773  773  HOH HOH K . 
SB 3 HOH 174 774  774  HOH HOH K . 
SB 3 HOH 175 775  775  HOH HOH K . 
SB 3 HOH 176 776  776  HOH HOH K . 
SB 3 HOH 177 777  777  HOH HOH K . 
SB 3 HOH 178 778  778  HOH HOH K . 
SB 3 HOH 179 779  779  HOH HOH K . 
SB 3 HOH 180 780  780  HOH HOH K . 
SB 3 HOH 181 781  781  HOH HOH K . 
SB 3 HOH 182 782  782  HOH HOH K . 
SB 3 HOH 183 783  783  HOH HOH K . 
SB 3 HOH 184 784  784  HOH HOH K . 
SB 3 HOH 185 785  785  HOH HOH K . 
SB 3 HOH 186 786  786  HOH HOH K . 
SB 3 HOH 187 787  787  HOH HOH K . 
SB 3 HOH 188 788  788  HOH HOH K . 
SB 3 HOH 189 789  789  HOH HOH K . 
SB 3 HOH 190 790  790  HOH HOH K . 
SB 3 HOH 191 791  791  HOH HOH K . 
SB 3 HOH 192 792  792  HOH HOH K . 
SB 3 HOH 193 793  794  HOH HOH K . 
SB 3 HOH 194 794  795  HOH HOH K . 
SB 3 HOH 195 795  796  HOH HOH K . 
SB 3 HOH 196 796  797  HOH HOH K . 
SB 3 HOH 197 797  798  HOH HOH K . 
SB 3 HOH 198 798  799  HOH HOH K . 
SB 3 HOH 199 799  800  HOH HOH K . 
SB 3 HOH 200 800  801  HOH HOH K . 
SB 3 HOH 201 801  802  HOH HOH K . 
SB 3 HOH 202 802  803  HOH HOH K . 
SB 3 HOH 203 803  804  HOH HOH K . 
SB 3 HOH 204 804  805  HOH HOH K . 
SB 3 HOH 205 805  806  HOH HOH K . 
SB 3 HOH 206 806  807  HOH HOH K . 
SB 3 HOH 207 807  808  HOH HOH K . 
SB 3 HOH 208 808  809  HOH HOH K . 
SB 3 HOH 209 809  810  HOH HOH K . 
SB 3 HOH 210 810  811  HOH HOH K . 
SB 3 HOH 211 811  812  HOH HOH K . 
SB 3 HOH 212 812  813  HOH HOH K . 
SB 3 HOH 213 813  814  HOH HOH K . 
SB 3 HOH 214 814  815  HOH HOH K . 
SB 3 HOH 215 815  816  HOH HOH K . 
SB 3 HOH 216 816  817  HOH HOH K . 
SB 3 HOH 217 817  818  HOH HOH K . 
SB 3 HOH 218 818  819  HOH HOH K . 
SB 3 HOH 219 819  820  HOH HOH K . 
SB 3 HOH 220 820  821  HOH HOH K . 
SB 3 HOH 221 821  822  HOH HOH K . 
SB 3 HOH 222 822  823  HOH HOH K . 
SB 3 HOH 223 823  824  HOH HOH K . 
SB 3 HOH 224 824  825  HOH HOH K . 
SB 3 HOH 225 825  826  HOH HOH K . 
SB 3 HOH 226 826  827  HOH HOH K . 
SB 3 HOH 227 827  828  HOH HOH K . 
SB 3 HOH 228 828  829  HOH HOH K . 
SB 3 HOH 229 829  830  HOH HOH K . 
SB 3 HOH 230 830  831  HOH HOH K . 
SB 3 HOH 231 831  832  HOH HOH K . 
SB 3 HOH 232 832  833  HOH HOH K . 
SB 3 HOH 233 833  834  HOH HOH K . 
SB 3 HOH 234 834  835  HOH HOH K . 
SB 3 HOH 235 835  836  HOH HOH K . 
SB 3 HOH 236 836  837  HOH HOH K . 
SB 3 HOH 237 837  838  HOH HOH K . 
SB 3 HOH 238 838  839  HOH HOH K . 
SB 3 HOH 239 839  840  HOH HOH K . 
SB 3 HOH 240 840  841  HOH HOH K . 
SB 3 HOH 241 841  842  HOH HOH K . 
SB 3 HOH 242 842  843  HOH HOH K . 
SB 3 HOH 243 843  844  HOH HOH K . 
SB 3 HOH 244 844  845  HOH HOH K . 
SB 3 HOH 245 845  846  HOH HOH K . 
SB 3 HOH 246 846  847  HOH HOH K . 
SB 3 HOH 247 847  848  HOH HOH K . 
SB 3 HOH 248 848  849  HOH HOH K . 
SB 3 HOH 249 849  850  HOH HOH K . 
SB 3 HOH 250 850  851  HOH HOH K . 
SB 3 HOH 251 851  852  HOH HOH K . 
SB 3 HOH 252 852  853  HOH HOH K . 
SB 3 HOH 253 853  854  HOH HOH K . 
SB 3 HOH 254 854  855  HOH HOH K . 
SB 3 HOH 255 855  856  HOH HOH K . 
SB 3 HOH 256 856  857  HOH HOH K . 
SB 3 HOH 257 857  858  HOH HOH K . 
SB 3 HOH 258 858  859  HOH HOH K . 
SB 3 HOH 259 859  860  HOH HOH K . 
SB 3 HOH 260 860  861  HOH HOH K . 
SB 3 HOH 261 861  862  HOH HOH K . 
SB 3 HOH 262 862  863  HOH HOH K . 
SB 3 HOH 263 863  864  HOH HOH K . 
SB 3 HOH 264 864  866  HOH HOH K . 
SB 3 HOH 265 865  867  HOH HOH K . 
SB 3 HOH 266 866  868  HOH HOH K . 
SB 3 HOH 267 867  869  HOH HOH K . 
SB 3 HOH 268 868  870  HOH HOH K . 
SB 3 HOH 269 869  871  HOH HOH K . 
SB 3 HOH 270 870  872  HOH HOH K . 
SB 3 HOH 271 871  873  HOH HOH K . 
SB 3 HOH 272 872  874  HOH HOH K . 
SB 3 HOH 273 873  875  HOH HOH K . 
SB 3 HOH 274 874  876  HOH HOH K . 
SB 3 HOH 275 875  877  HOH HOH K . 
SB 3 HOH 276 876  878  HOH HOH K . 
SB 3 HOH 277 877  879  HOH HOH K . 
SB 3 HOH 278 878  880  HOH HOH K . 
SB 3 HOH 279 879  881  HOH HOH K . 
SB 3 HOH 280 880  882  HOH HOH K . 
SB 3 HOH 281 881  883  HOH HOH K . 
SB 3 HOH 282 882  884  HOH HOH K . 
SB 3 HOH 283 883  885  HOH HOH K . 
SB 3 HOH 284 884  886  HOH HOH K . 
SB 3 HOH 285 885  887  HOH HOH K . 
SB 3 HOH 286 886  888  HOH HOH K . 
SB 3 HOH 287 887  889  HOH HOH K . 
SB 3 HOH 288 888  890  HOH HOH K . 
SB 3 HOH 289 889  891  HOH HOH K . 
SB 3 HOH 290 890  892  HOH HOH K . 
SB 3 HOH 291 891  893  HOH HOH K . 
SB 3 HOH 292 892  894  HOH HOH K . 
SB 3 HOH 293 893  895  HOH HOH K . 
SB 3 HOH 294 894  896  HOH HOH K . 
SB 3 HOH 295 895  897  HOH HOH K . 
SB 3 HOH 296 896  898  HOH HOH K . 
SB 3 HOH 297 897  899  HOH HOH K . 
SB 3 HOH 298 898  900  HOH HOH K . 
SB 3 HOH 299 899  901  HOH HOH K . 
SB 3 HOH 300 900  902  HOH HOH K . 
SB 3 HOH 301 901  903  HOH HOH K . 
SB 3 HOH 302 902  904  HOH HOH K . 
SB 3 HOH 303 903  905  HOH HOH K . 
SB 3 HOH 304 904  906  HOH HOH K . 
SB 3 HOH 305 905  907  HOH HOH K . 
SB 3 HOH 306 906  908  HOH HOH K . 
SB 3 HOH 307 907  909  HOH HOH K . 
SB 3 HOH 308 908  910  HOH HOH K . 
SB 3 HOH 309 909  911  HOH HOH K . 
SB 3 HOH 310 910  912  HOH HOH K . 
SB 3 HOH 311 911  913  HOH HOH K . 
SB 3 HOH 312 912  914  HOH HOH K . 
SB 3 HOH 313 913  915  HOH HOH K . 
SB 3 HOH 314 914  916  HOH HOH K . 
SB 3 HOH 315 915  917  HOH HOH K . 
SB 3 HOH 316 916  918  HOH HOH K . 
SB 3 HOH 317 917  919  HOH HOH K . 
SB 3 HOH 318 918  920  HOH HOH K . 
SB 3 HOH 319 919  921  HOH HOH K . 
SB 3 HOH 320 920  922  HOH HOH K . 
SB 3 HOH 321 921  923  HOH HOH K . 
SB 3 HOH 322 922  924  HOH HOH K . 
SB 3 HOH 323 923  925  HOH HOH K . 
SB 3 HOH 324 924  926  HOH HOH K . 
SB 3 HOH 325 925  927  HOH HOH K . 
SB 3 HOH 326 926  928  HOH HOH K . 
SB 3 HOH 327 927  929  HOH HOH K . 
SB 3 HOH 328 928  930  HOH HOH K . 
SB 3 HOH 329 929  931  HOH HOH K . 
SB 3 HOH 330 930  932  HOH HOH K . 
SB 3 HOH 331 931  933  HOH HOH K . 
SB 3 HOH 332 932  934  HOH HOH K . 
SB 3 HOH 333 933  935  HOH HOH K . 
SB 3 HOH 334 934  936  HOH HOH K . 
SB 3 HOH 335 935  938  HOH HOH K . 
SB 3 HOH 336 936  939  HOH HOH K . 
SB 3 HOH 337 937  940  HOH HOH K . 
SB 3 HOH 338 938  941  HOH HOH K . 
SB 3 HOH 339 939  942  HOH HOH K . 
SB 3 HOH 340 940  943  HOH HOH K . 
SB 3 HOH 341 941  944  HOH HOH K . 
SB 3 HOH 342 942  945  HOH HOH K . 
SB 3 HOH 343 943  946  HOH HOH K . 
SB 3 HOH 344 944  947  HOH HOH K . 
SB 3 HOH 345 945  948  HOH HOH K . 
SB 3 HOH 346 946  949  HOH HOH K . 
SB 3 HOH 347 947  950  HOH HOH K . 
SB 3 HOH 348 948  951  HOH HOH K . 
SB 3 HOH 349 949  952  HOH HOH K . 
SB 3 HOH 350 950  953  HOH HOH K . 
SB 3 HOH 351 951  954  HOH HOH K . 
SB 3 HOH 352 952  955  HOH HOH K . 
SB 3 HOH 353 953  956  HOH HOH K . 
SB 3 HOH 354 954  957  HOH HOH K . 
SB 3 HOH 355 955  958  HOH HOH K . 
SB 3 HOH 356 956  959  HOH HOH K . 
SB 3 HOH 357 957  960  HOH HOH K . 
SB 3 HOH 358 958  961  HOH HOH K . 
SB 3 HOH 359 959  962  HOH HOH K . 
SB 3 HOH 360 960  963  HOH HOH K . 
SB 3 HOH 361 961  964  HOH HOH K . 
SB 3 HOH 362 962  965  HOH HOH K . 
SB 3 HOH 363 963  966  HOH HOH K . 
SB 3 HOH 364 964  967  HOH HOH K . 
SB 3 HOH 365 965  968  HOH HOH K . 
SB 3 HOH 366 966  969  HOH HOH K . 
SB 3 HOH 367 967  970  HOH HOH K . 
SB 3 HOH 368 968  971  HOH HOH K . 
SB 3 HOH 369 969  972  HOH HOH K . 
SB 3 HOH 370 970  973  HOH HOH K . 
SB 3 HOH 371 971  974  HOH HOH K . 
SB 3 HOH 372 972  975  HOH HOH K . 
SB 3 HOH 373 973  976  HOH HOH K . 
SB 3 HOH 374 974  977  HOH HOH K . 
SB 3 HOH 375 975  978  HOH HOH K . 
SB 3 HOH 376 976  979  HOH HOH K . 
SB 3 HOH 377 977  980  HOH HOH K . 
SB 3 HOH 378 978  981  HOH HOH K . 
SB 3 HOH 379 979  982  HOH HOH K . 
SB 3 HOH 380 980  983  HOH HOH K . 
SB 3 HOH 381 981  984  HOH HOH K . 
SB 3 HOH 382 982  985  HOH HOH K . 
SB 3 HOH 383 983  986  HOH HOH K . 
SB 3 HOH 384 984  987  HOH HOH K . 
SB 3 HOH 385 985  988  HOH HOH K . 
SB 3 HOH 386 986  989  HOH HOH K . 
SB 3 HOH 387 987  990  HOH HOH K . 
SB 3 HOH 388 988  991  HOH HOH K . 
SB 3 HOH 389 989  992  HOH HOH K . 
SB 3 HOH 390 990  993  HOH HOH K . 
SB 3 HOH 391 991  994  HOH HOH K . 
SB 3 HOH 392 992  995  HOH HOH K . 
SB 3 HOH 393 993  996  HOH HOH K . 
SB 3 HOH 394 994  997  HOH HOH K . 
SB 3 HOH 395 995  998  HOH HOH K . 
SB 3 HOH 396 996  999  HOH HOH K . 
SB 3 HOH 397 997  1000 HOH HOH K . 
SB 3 HOH 398 998  1001 HOH HOH K . 
SB 3 HOH 399 999  1002 HOH HOH K . 
SB 3 HOH 400 1000 1003 HOH HOH K . 
SB 3 HOH 401 1001 1004 HOH HOH K . 
SB 3 HOH 402 1002 1005 HOH HOH K . 
SB 3 HOH 403 1003 1006 HOH HOH K . 
SB 3 HOH 404 1004 1007 HOH HOH K . 
SB 3 HOH 405 1005 1008 HOH HOH K . 
SB 3 HOH 406 1006 1009 HOH HOH K . 
SB 3 HOH 407 1007 1010 HOH HOH K . 
SB 3 HOH 408 1008 1011 HOH HOH K . 
SB 3 HOH 409 1009 1012 HOH HOH K . 
SB 3 HOH 410 1010 1013 HOH HOH K . 
SB 3 HOH 411 1011 1014 HOH HOH K . 
SB 3 HOH 412 1012 1015 HOH HOH K . 
SB 3 HOH 413 1013 1016 HOH HOH K . 
SB 3 HOH 414 1014 1017 HOH HOH K . 
SB 3 HOH 415 1015 1018 HOH HOH K . 
SB 3 HOH 416 1016 1019 HOH HOH K . 
SB 3 HOH 417 1017 1020 HOH HOH K . 
SB 3 HOH 418 1018 1021 HOH HOH K . 
SB 3 HOH 419 1019 1022 HOH HOH K . 
SB 3 HOH 420 1020 1023 HOH HOH K . 
SB 3 HOH 421 1021 1024 HOH HOH K . 
SB 3 HOH 422 1022 1025 HOH HOH K . 
SB 3 HOH 423 1023 1026 HOH HOH K . 
SB 3 HOH 424 1024 1027 HOH HOH K . 
SB 3 HOH 425 1025 1028 HOH HOH K . 
SB 3 HOH 426 1026 1029 HOH HOH K . 
SB 3 HOH 427 1027 1030 HOH HOH K . 
SB 3 HOH 428 1028 1031 HOH HOH K . 
SB 3 HOH 429 1029 1032 HOH HOH K . 
SB 3 HOH 430 1030 1033 HOH HOH K . 
SB 3 HOH 431 1031 1034 HOH HOH K . 
SB 3 HOH 432 1032 1035 HOH HOH K . 
SB 3 HOH 433 1033 1036 HOH HOH K . 
SB 3 HOH 434 1034 1037 HOH HOH K . 
SB 3 HOH 435 1035 1038 HOH HOH K . 
SB 3 HOH 436 1036 1039 HOH HOH K . 
SB 3 HOH 437 1037 1040 HOH HOH K . 
SB 3 HOH 438 1038 1041 HOH HOH K . 
SB 3 HOH 439 1039 1042 HOH HOH K . 
SB 3 HOH 440 1040 1043 HOH HOH K . 
SB 3 HOH 441 1041 1044 HOH HOH K . 
SB 3 HOH 442 1042 1045 HOH HOH K . 
SB 3 HOH 443 1043 1046 HOH HOH K . 
SB 3 HOH 444 1044 1047 HOH HOH K . 
SB 3 HOH 445 1045 1048 HOH HOH K . 
SB 3 HOH 446 1046 1049 HOH HOH K . 
SB 3 HOH 447 1047 1050 HOH HOH K . 
SB 3 HOH 448 1048 1051 HOH HOH K . 
SB 3 HOH 449 1049 1052 HOH HOH K . 
SB 3 HOH 450 1050 1053 HOH HOH K . 
SB 3 HOH 451 1051 1054 HOH HOH K . 
SB 3 HOH 452 1052 1055 HOH HOH K . 
SB 3 HOH 453 1053 1056 HOH HOH K . 
SB 3 HOH 454 1054 1057 HOH HOH K . 
SB 3 HOH 455 1055 1058 HOH HOH K . 
SB 3 HOH 456 1056 1059 HOH HOH K . 
SB 3 HOH 457 1057 1060 HOH HOH K . 
SB 3 HOH 458 1058 1061 HOH HOH K . 
SB 3 HOH 459 1059 1062 HOH HOH K . 
SB 3 HOH 460 1060 1063 HOH HOH K . 
SB 3 HOH 461 1061 1064 HOH HOH K . 
SB 3 HOH 462 1062 1065 HOH HOH K . 
SB 3 HOH 463 1063 1066 HOH HOH K . 
SB 3 HOH 464 1064 1067 HOH HOH K . 
SB 3 HOH 465 1065 1068 HOH HOH K . 
SB 3 HOH 466 1066 1069 HOH HOH K . 
SB 3 HOH 467 1067 1070 HOH HOH K . 
SB 3 HOH 468 1068 1071 HOH HOH K . 
SB 3 HOH 469 1069 1072 HOH HOH K . 
SB 3 HOH 470 1070 1073 HOH HOH K . 
SB 3 HOH 471 1071 1074 HOH HOH K . 
SB 3 HOH 472 1072 1075 HOH HOH K . 
SB 3 HOH 473 1073 1076 HOH HOH K . 
SB 3 HOH 474 1074 1077 HOH HOH K . 
SB 3 HOH 475 1075 1078 HOH HOH K . 
SB 3 HOH 476 1076 1079 HOH HOH K . 
SB 3 HOH 477 1077 1080 HOH HOH K . 
SB 3 HOH 478 1078 1081 HOH HOH K . 
SB 3 HOH 479 1079 1082 HOH HOH K . 
SB 3 HOH 480 1080 1083 HOH HOH K . 
SB 3 HOH 481 1081 1084 HOH HOH K . 
SB 3 HOH 482 1082 1085 HOH HOH K . 
SB 3 HOH 483 1083 1086 HOH HOH K . 
SB 3 HOH 484 1084 1087 HOH HOH K . 
SB 3 HOH 485 1085 1088 HOH HOH K . 
SB 3 HOH 486 1086 1089 HOH HOH K . 
SB 3 HOH 487 1087 1090 HOH HOH K . 
SB 3 HOH 488 1088 1091 HOH HOH K . 
SB 3 HOH 489 1089 1092 HOH HOH K . 
SB 3 HOH 490 1090 1093 HOH HOH K . 
SB 3 HOH 491 1091 1094 HOH HOH K . 
SB 3 HOH 492 1092 1095 HOH HOH K . 
SB 3 HOH 493 1093 1096 HOH HOH K . 
SB 3 HOH 494 1094 1097 HOH HOH K . 
SB 3 HOH 495 1095 1098 HOH HOH K . 
SB 3 HOH 496 1096 1099 HOH HOH K . 
SB 3 HOH 497 1097 1100 HOH HOH K . 
SB 3 HOH 498 1098 1101 HOH HOH K . 
SB 3 HOH 499 1099 1102 HOH HOH K . 
SB 3 HOH 500 1100 793  HOH HOH K . 
SB 3 HOH 501 1101 1103 HOH HOH K . 
SB 3 HOH 502 1102 1104 HOH HOH K . 
SB 3 HOH 503 1103 1105 HOH HOH K . 
SB 3 HOH 504 1104 1106 HOH HOH K . 
SB 3 HOH 505 1105 1107 HOH HOH K . 
SB 3 HOH 506 1106 1108 HOH HOH K . 
SB 3 HOH 507 1107 1109 HOH HOH K . 
SB 3 HOH 508 1108 1111 HOH HOH K . 
SB 3 HOH 509 1109 1112 HOH HOH K . 
SB 3 HOH 510 1110 1113 HOH HOH K . 
SB 3 HOH 511 1111 1114 HOH HOH K . 
SB 3 HOH 512 1112 1115 HOH HOH K . 
SB 3 HOH 513 1113 1116 HOH HOH K . 
SB 3 HOH 514 1114 1117 HOH HOH K . 
SB 3 HOH 515 1115 1118 HOH HOH K . 
SB 3 HOH 516 1116 1119 HOH HOH K . 
SB 3 HOH 517 1117 1120 HOH HOH K . 
SB 3 HOH 518 1118 1121 HOH HOH K . 
SB 3 HOH 519 1119 1123 HOH HOH K . 
SB 3 HOH 520 1120 1124 HOH HOH K . 
SB 3 HOH 521 1121 1125 HOH HOH K . 
SB 3 HOH 522 1122 1127 HOH HOH K . 
SB 3 HOH 523 1123 1110 HOH HOH K . 
SB 3 HOH 524 1124 1128 HOH HOH K . 
SB 3 HOH 525 1125 1129 HOH HOH K . 
SB 3 HOH 526 1126 1130 HOH HOH K . 
SB 3 HOH 527 1127 1131 HOH HOH K . 
SB 3 HOH 528 1128 1132 HOH HOH K . 
SB 3 HOH 529 1129 1133 HOH HOH K . 
SB 3 HOH 530 1130 1134 HOH HOH K . 
SB 3 HOH 531 1131 1135 HOH HOH K . 
SB 3 HOH 532 1132 1136 HOH HOH K . 
SB 3 HOH 533 1133 1137 HOH HOH K . 
SB 3 HOH 534 1134 1138 HOH HOH K . 
SB 3 HOH 535 1135 1139 HOH HOH K . 
SB 3 HOH 536 1136 1140 HOH HOH K . 
SB 3 HOH 537 1137 1141 HOH HOH K . 
SB 3 HOH 538 1138 1126 HOH HOH K . 
SB 3 HOH 539 1139 1142 HOH HOH K . 
SB 3 HOH 540 1140 1143 HOH HOH K . 
SB 3 HOH 541 1141 1144 HOH HOH K . 
SB 3 HOH 542 1142 1145 HOH HOH K . 
SB 3 HOH 543 1143 1122 HOH HOH K . 
SB 3 HOH 544 1144 937  HOH HOH K . 
SB 3 HOH 545 1145 865  HOH HOH K . 
TB 3 HOH 1   601  601  HOH HOH L . 
TB 3 HOH 2   602  602  HOH HOH L . 
TB 3 HOH 3   603  603  HOH HOH L . 
TB 3 HOH 4   604  604  HOH HOH L . 
TB 3 HOH 5   605  605  HOH HOH L . 
TB 3 HOH 6   606  606  HOH HOH L . 
TB 3 HOH 7   607  607  HOH HOH L . 
TB 3 HOH 8   608  608  HOH HOH L . 
TB 3 HOH 9   609  609  HOH HOH L . 
TB 3 HOH 10  610  610  HOH HOH L . 
TB 3 HOH 11  611  611  HOH HOH L . 
TB 3 HOH 12  612  612  HOH HOH L . 
TB 3 HOH 13  613  613  HOH HOH L . 
TB 3 HOH 14  614  614  HOH HOH L . 
TB 3 HOH 15  615  615  HOH HOH L . 
TB 3 HOH 16  616  616  HOH HOH L . 
TB 3 HOH 17  617  617  HOH HOH L . 
TB 3 HOH 18  618  618  HOH HOH L . 
TB 3 HOH 19  619  619  HOH HOH L . 
TB 3 HOH 20  620  620  HOH HOH L . 
TB 3 HOH 21  621  621  HOH HOH L . 
TB 3 HOH 22  622  622  HOH HOH L . 
TB 3 HOH 23  623  623  HOH HOH L . 
TB 3 HOH 24  624  624  HOH HOH L . 
TB 3 HOH 25  625  625  HOH HOH L . 
TB 3 HOH 26  626  626  HOH HOH L . 
TB 3 HOH 27  627  627  HOH HOH L . 
TB 3 HOH 28  628  628  HOH HOH L . 
TB 3 HOH 29  629  629  HOH HOH L . 
TB 3 HOH 30  630  630  HOH HOH L . 
TB 3 HOH 31  631  631  HOH HOH L . 
TB 3 HOH 32  632  632  HOH HOH L . 
TB 3 HOH 33  633  633  HOH HOH L . 
TB 3 HOH 34  634  634  HOH HOH L . 
TB 3 HOH 35  635  635  HOH HOH L . 
TB 3 HOH 36  636  636  HOH HOH L . 
TB 3 HOH 37  637  637  HOH HOH L . 
TB 3 HOH 38  638  638  HOH HOH L . 
TB 3 HOH 39  639  639  HOH HOH L . 
TB 3 HOH 40  640  640  HOH HOH L . 
TB 3 HOH 41  641  641  HOH HOH L . 
TB 3 HOH 42  642  642  HOH HOH L . 
TB 3 HOH 43  643  643  HOH HOH L . 
TB 3 HOH 44  644  644  HOH HOH L . 
TB 3 HOH 45  645  645  HOH HOH L . 
TB 3 HOH 46  646  646  HOH HOH L . 
TB 3 HOH 47  647  647  HOH HOH L . 
TB 3 HOH 48  648  648  HOH HOH L . 
TB 3 HOH 49  649  649  HOH HOH L . 
TB 3 HOH 50  650  650  HOH HOH L . 
TB 3 HOH 51  651  651  HOH HOH L . 
TB 3 HOH 52  652  652  HOH HOH L . 
TB 3 HOH 53  653  653  HOH HOH L . 
TB 3 HOH 54  654  654  HOH HOH L . 
TB 3 HOH 55  655  655  HOH HOH L . 
TB 3 HOH 56  656  656  HOH HOH L . 
TB 3 HOH 57  657  657  HOH HOH L . 
TB 3 HOH 58  658  658  HOH HOH L . 
TB 3 HOH 59  659  659  HOH HOH L . 
TB 3 HOH 60  660  660  HOH HOH L . 
TB 3 HOH 61  661  661  HOH HOH L . 
TB 3 HOH 62  662  662  HOH HOH L . 
TB 3 HOH 63  663  663  HOH HOH L . 
TB 3 HOH 64  664  664  HOH HOH L . 
TB 3 HOH 65  665  665  HOH HOH L . 
TB 3 HOH 66  666  666  HOH HOH L . 
TB 3 HOH 67  667  667  HOH HOH L . 
TB 3 HOH 68  668  668  HOH HOH L . 
TB 3 HOH 69  669  669  HOH HOH L . 
TB 3 HOH 70  670  670  HOH HOH L . 
TB 3 HOH 71  671  671  HOH HOH L . 
TB 3 HOH 72  672  672  HOH HOH L . 
TB 3 HOH 73  673  673  HOH HOH L . 
TB 3 HOH 74  674  674  HOH HOH L . 
TB 3 HOH 75  675  675  HOH HOH L . 
TB 3 HOH 76  676  676  HOH HOH L . 
TB 3 HOH 77  677  677  HOH HOH L . 
TB 3 HOH 78  678  678  HOH HOH L . 
TB 3 HOH 79  679  679  HOH HOH L . 
TB 3 HOH 80  680  680  HOH HOH L . 
TB 3 HOH 81  681  681  HOH HOH L . 
TB 3 HOH 82  682  682  HOH HOH L . 
TB 3 HOH 83  683  683  HOH HOH L . 
TB 3 HOH 84  684  684  HOH HOH L . 
TB 3 HOH 85  685  685  HOH HOH L . 
TB 3 HOH 86  686  686  HOH HOH L . 
TB 3 HOH 87  687  687  HOH HOH L . 
TB 3 HOH 88  688  688  HOH HOH L . 
TB 3 HOH 89  689  689  HOH HOH L . 
TB 3 HOH 90  690  690  HOH HOH L . 
TB 3 HOH 91  691  691  HOH HOH L . 
TB 3 HOH 92  692  692  HOH HOH L . 
TB 3 HOH 93  693  693  HOH HOH L . 
TB 3 HOH 94  694  694  HOH HOH L . 
TB 3 HOH 95  695  695  HOH HOH L . 
TB 3 HOH 96  696  696  HOH HOH L . 
TB 3 HOH 97  697  697  HOH HOH L . 
TB 3 HOH 98  698  698  HOH HOH L . 
TB 3 HOH 99  699  699  HOH HOH L . 
TB 3 HOH 100 700  700  HOH HOH L . 
TB 3 HOH 101 701  701  HOH HOH L . 
TB 3 HOH 102 702  702  HOH HOH L . 
TB 3 HOH 103 703  703  HOH HOH L . 
TB 3 HOH 104 704  704  HOH HOH L . 
TB 3 HOH 105 705  705  HOH HOH L . 
TB 3 HOH 106 706  706  HOH HOH L . 
TB 3 HOH 107 707  707  HOH HOH L . 
TB 3 HOH 108 708  708  HOH HOH L . 
TB 3 HOH 109 709  709  HOH HOH L . 
TB 3 HOH 110 710  710  HOH HOH L . 
TB 3 HOH 111 711  711  HOH HOH L . 
TB 3 HOH 112 712  712  HOH HOH L . 
TB 3 HOH 113 713  713  HOH HOH L . 
TB 3 HOH 114 714  714  HOH HOH L . 
TB 3 HOH 115 715  715  HOH HOH L . 
TB 3 HOH 116 716  716  HOH HOH L . 
TB 3 HOH 117 717  717  HOH HOH L . 
TB 3 HOH 118 718  718  HOH HOH L . 
TB 3 HOH 119 719  719  HOH HOH L . 
TB 3 HOH 120 720  720  HOH HOH L . 
TB 3 HOH 121 721  721  HOH HOH L . 
TB 3 HOH 122 722  722  HOH HOH L . 
TB 3 HOH 123 723  723  HOH HOH L . 
TB 3 HOH 124 724  724  HOH HOH L . 
TB 3 HOH 125 725  725  HOH HOH L . 
TB 3 HOH 126 726  726  HOH HOH L . 
TB 3 HOH 127 727  727  HOH HOH L . 
TB 3 HOH 128 728  728  HOH HOH L . 
TB 3 HOH 129 729  729  HOH HOH L . 
TB 3 HOH 130 730  730  HOH HOH L . 
TB 3 HOH 131 731  731  HOH HOH L . 
TB 3 HOH 132 732  732  HOH HOH L . 
TB 3 HOH 133 733  733  HOH HOH L . 
TB 3 HOH 134 734  734  HOH HOH L . 
TB 3 HOH 135 735  735  HOH HOH L . 
TB 3 HOH 136 736  736  HOH HOH L . 
TB 3 HOH 137 737  737  HOH HOH L . 
TB 3 HOH 138 738  738  HOH HOH L . 
TB 3 HOH 139 739  739  HOH HOH L . 
TB 3 HOH 140 740  740  HOH HOH L . 
TB 3 HOH 141 741  741  HOH HOH L . 
TB 3 HOH 142 742  742  HOH HOH L . 
TB 3 HOH 143 743  743  HOH HOH L . 
TB 3 HOH 144 744  744  HOH HOH L . 
TB 3 HOH 145 745  745  HOH HOH L . 
TB 3 HOH 146 746  746  HOH HOH L . 
TB 3 HOH 147 747  747  HOH HOH L . 
TB 3 HOH 148 748  748  HOH HOH L . 
TB 3 HOH 149 749  749  HOH HOH L . 
TB 3 HOH 150 750  750  HOH HOH L . 
TB 3 HOH 151 751  751  HOH HOH L . 
TB 3 HOH 152 752  752  HOH HOH L . 
TB 3 HOH 153 753  753  HOH HOH L . 
TB 3 HOH 154 754  754  HOH HOH L . 
TB 3 HOH 155 755  755  HOH HOH L . 
TB 3 HOH 156 756  756  HOH HOH L . 
TB 3 HOH 157 757  757  HOH HOH L . 
TB 3 HOH 158 758  758  HOH HOH L . 
TB 3 HOH 159 759  759  HOH HOH L . 
TB 3 HOH 160 760  760  HOH HOH L . 
TB 3 HOH 161 761  761  HOH HOH L . 
TB 3 HOH 162 762  762  HOH HOH L . 
TB 3 HOH 163 763  763  HOH HOH L . 
TB 3 HOH 164 764  764  HOH HOH L . 
TB 3 HOH 165 765  765  HOH HOH L . 
TB 3 HOH 166 766  766  HOH HOH L . 
TB 3 HOH 167 767  767  HOH HOH L . 
TB 3 HOH 168 768  768  HOH HOH L . 
TB 3 HOH 169 769  769  HOH HOH L . 
TB 3 HOH 170 770  770  HOH HOH L . 
TB 3 HOH 171 771  771  HOH HOH L . 
TB 3 HOH 172 772  772  HOH HOH L . 
TB 3 HOH 173 773  773  HOH HOH L . 
TB 3 HOH 174 774  774  HOH HOH L . 
TB 3 HOH 175 775  775  HOH HOH L . 
TB 3 HOH 176 776  776  HOH HOH L . 
TB 3 HOH 177 777  778  HOH HOH L . 
TB 3 HOH 178 778  777  HOH HOH L . 
TB 3 HOH 179 779  779  HOH HOH L . 
TB 3 HOH 180 780  780  HOH HOH L . 
TB 3 HOH 181 781  781  HOH HOH L . 
TB 3 HOH 182 782  782  HOH HOH L . 
TB 3 HOH 183 783  783  HOH HOH L . 
TB 3 HOH 184 784  784  HOH HOH L . 
TB 3 HOH 185 785  785  HOH HOH L . 
TB 3 HOH 186 786  786  HOH HOH L . 
TB 3 HOH 187 787  787  HOH HOH L . 
TB 3 HOH 188 788  788  HOH HOH L . 
TB 3 HOH 189 789  789  HOH HOH L . 
TB 3 HOH 190 790  790  HOH HOH L . 
TB 3 HOH 191 791  791  HOH HOH L . 
TB 3 HOH 192 792  792  HOH HOH L . 
TB 3 HOH 193 793  793  HOH HOH L . 
TB 3 HOH 194 794  794  HOH HOH L . 
TB 3 HOH 195 795  795  HOH HOH L . 
TB 3 HOH 196 796  796  HOH HOH L . 
TB 3 HOH 197 797  797  HOH HOH L . 
TB 3 HOH 198 798  798  HOH HOH L . 
TB 3 HOH 199 799  799  HOH HOH L . 
TB 3 HOH 200 800  800  HOH HOH L . 
TB 3 HOH 201 801  801  HOH HOH L . 
TB 3 HOH 202 802  802  HOH HOH L . 
TB 3 HOH 203 803  803  HOH HOH L . 
TB 3 HOH 204 804  804  HOH HOH L . 
TB 3 HOH 205 805  805  HOH HOH L . 
TB 3 HOH 206 806  806  HOH HOH L . 
TB 3 HOH 207 807  807  HOH HOH L . 
TB 3 HOH 208 808  808  HOH HOH L . 
TB 3 HOH 209 809  809  HOH HOH L . 
TB 3 HOH 210 810  810  HOH HOH L . 
TB 3 HOH 211 811  811  HOH HOH L . 
TB 3 HOH 212 812  812  HOH HOH L . 
TB 3 HOH 213 813  813  HOH HOH L . 
TB 3 HOH 214 814  814  HOH HOH L . 
TB 3 HOH 215 815  815  HOH HOH L . 
TB 3 HOH 216 816  816  HOH HOH L . 
TB 3 HOH 217 817  817  HOH HOH L . 
TB 3 HOH 218 818  818  HOH HOH L . 
TB 3 HOH 219 819  819  HOH HOH L . 
TB 3 HOH 220 820  820  HOH HOH L . 
TB 3 HOH 221 821  821  HOH HOH L . 
TB 3 HOH 222 822  822  HOH HOH L . 
TB 3 HOH 223 823  823  HOH HOH L . 
TB 3 HOH 224 824  824  HOH HOH L . 
TB 3 HOH 225 825  825  HOH HOH L . 
TB 3 HOH 226 826  826  HOH HOH L . 
TB 3 HOH 227 827  827  HOH HOH L . 
TB 3 HOH 228 828  828  HOH HOH L . 
TB 3 HOH 229 829  829  HOH HOH L . 
TB 3 HOH 230 830  830  HOH HOH L . 
TB 3 HOH 231 831  831  HOH HOH L . 
TB 3 HOH 232 832  832  HOH HOH L . 
TB 3 HOH 233 833  833  HOH HOH L . 
TB 3 HOH 234 834  834  HOH HOH L . 
TB 3 HOH 235 835  835  HOH HOH L . 
TB 3 HOH 236 836  836  HOH HOH L . 
TB 3 HOH 237 837  837  HOH HOH L . 
TB 3 HOH 238 838  838  HOH HOH L . 
TB 3 HOH 239 839  839  HOH HOH L . 
TB 3 HOH 240 840  840  HOH HOH L . 
TB 3 HOH 241 841  841  HOH HOH L . 
TB 3 HOH 242 842  842  HOH HOH L . 
TB 3 HOH 243 843  843  HOH HOH L . 
TB 3 HOH 244 844  844  HOH HOH L . 
TB 3 HOH 245 845  845  HOH HOH L . 
TB 3 HOH 246 846  846  HOH HOH L . 
TB 3 HOH 247 847  847  HOH HOH L . 
TB 3 HOH 248 848  848  HOH HOH L . 
TB 3 HOH 249 849  849  HOH HOH L . 
TB 3 HOH 250 850  850  HOH HOH L . 
TB 3 HOH 251 851  851  HOH HOH L . 
TB 3 HOH 252 852  852  HOH HOH L . 
TB 3 HOH 253 853  853  HOH HOH L . 
TB 3 HOH 254 854  854  HOH HOH L . 
TB 3 HOH 255 855  855  HOH HOH L . 
TB 3 HOH 256 856  856  HOH HOH L . 
TB 3 HOH 257 857  857  HOH HOH L . 
TB 3 HOH 258 858  858  HOH HOH L . 
TB 3 HOH 259 859  859  HOH HOH L . 
TB 3 HOH 260 860  860  HOH HOH L . 
TB 3 HOH 261 861  861  HOH HOH L . 
TB 3 HOH 262 862  862  HOH HOH L . 
TB 3 HOH 263 863  863  HOH HOH L . 
TB 3 HOH 264 864  864  HOH HOH L . 
TB 3 HOH 265 865  865  HOH HOH L . 
TB 3 HOH 266 866  866  HOH HOH L . 
TB 3 HOH 267 867  867  HOH HOH L . 
TB 3 HOH 268 868  868  HOH HOH L . 
TB 3 HOH 269 869  869  HOH HOH L . 
TB 3 HOH 270 870  870  HOH HOH L . 
TB 3 HOH 271 871  871  HOH HOH L . 
TB 3 HOH 272 872  872  HOH HOH L . 
TB 3 HOH 273 873  873  HOH HOH L . 
TB 3 HOH 274 874  874  HOH HOH L . 
TB 3 HOH 275 875  875  HOH HOH L . 
TB 3 HOH 276 876  876  HOH HOH L . 
TB 3 HOH 277 877  877  HOH HOH L . 
TB 3 HOH 278 878  878  HOH HOH L . 
TB 3 HOH 279 879  879  HOH HOH L . 
TB 3 HOH 280 880  880  HOH HOH L . 
TB 3 HOH 281 881  881  HOH HOH L . 
TB 3 HOH 282 882  882  HOH HOH L . 
TB 3 HOH 283 883  883  HOH HOH L . 
TB 3 HOH 284 884  884  HOH HOH L . 
TB 3 HOH 285 885  885  HOH HOH L . 
TB 3 HOH 286 886  886  HOH HOH L . 
TB 3 HOH 287 887  887  HOH HOH L . 
TB 3 HOH 288 888  888  HOH HOH L . 
TB 3 HOH 289 889  889  HOH HOH L . 
TB 3 HOH 290 890  890  HOH HOH L . 
TB 3 HOH 291 891  891  HOH HOH L . 
TB 3 HOH 292 892  892  HOH HOH L . 
TB 3 HOH 293 893  893  HOH HOH L . 
TB 3 HOH 294 894  894  HOH HOH L . 
TB 3 HOH 295 895  895  HOH HOH L . 
TB 3 HOH 296 896  896  HOH HOH L . 
TB 3 HOH 297 897  897  HOH HOH L . 
TB 3 HOH 298 898  898  HOH HOH L . 
TB 3 HOH 299 899  899  HOH HOH L . 
TB 3 HOH 300 900  900  HOH HOH L . 
TB 3 HOH 301 901  901  HOH HOH L . 
TB 3 HOH 302 902  902  HOH HOH L . 
TB 3 HOH 303 903  903  HOH HOH L . 
TB 3 HOH 304 904  904  HOH HOH L . 
TB 3 HOH 305 905  905  HOH HOH L . 
TB 3 HOH 306 906  906  HOH HOH L . 
TB 3 HOH 307 907  907  HOH HOH L . 
TB 3 HOH 308 908  909  HOH HOH L . 
TB 3 HOH 309 909  908  HOH HOH L . 
TB 3 HOH 310 910  910  HOH HOH L . 
TB 3 HOH 311 911  911  HOH HOH L . 
TB 3 HOH 312 912  912  HOH HOH L . 
TB 3 HOH 313 913  913  HOH HOH L . 
TB 3 HOH 314 914  914  HOH HOH L . 
TB 3 HOH 315 915  915  HOH HOH L . 
TB 3 HOH 316 916  916  HOH HOH L . 
TB 3 HOH 317 917  917  HOH HOH L . 
TB 3 HOH 318 918  918  HOH HOH L . 
TB 3 HOH 319 919  919  HOH HOH L . 
TB 3 HOH 320 920  920  HOH HOH L . 
TB 3 HOH 321 921  921  HOH HOH L . 
TB 3 HOH 322 922  922  HOH HOH L . 
TB 3 HOH 323 923  923  HOH HOH L . 
TB 3 HOH 324 924  924  HOH HOH L . 
TB 3 HOH 325 925  925  HOH HOH L . 
TB 3 HOH 326 926  926  HOH HOH L . 
TB 3 HOH 327 927  927  HOH HOH L . 
TB 3 HOH 328 928  928  HOH HOH L . 
TB 3 HOH 329 929  929  HOH HOH L . 
TB 3 HOH 330 930  930  HOH HOH L . 
TB 3 HOH 331 931  931  HOH HOH L . 
TB 3 HOH 332 932  932  HOH HOH L . 
TB 3 HOH 333 933  933  HOH HOH L . 
TB 3 HOH 334 934  934  HOH HOH L . 
TB 3 HOH 335 935  935  HOH HOH L . 
TB 3 HOH 336 936  936  HOH HOH L . 
TB 3 HOH 337 937  937  HOH HOH L . 
TB 3 HOH 338 938  938  HOH HOH L . 
TB 3 HOH 339 939  939  HOH HOH L . 
TB 3 HOH 340 940  940  HOH HOH L . 
TB 3 HOH 341 941  941  HOH HOH L . 
TB 3 HOH 342 942  942  HOH HOH L . 
TB 3 HOH 343 943  943  HOH HOH L . 
TB 3 HOH 344 944  944  HOH HOH L . 
TB 3 HOH 345 945  945  HOH HOH L . 
TB 3 HOH 346 946  946  HOH HOH L . 
TB 3 HOH 347 947  948  HOH HOH L . 
TB 3 HOH 348 948  947  HOH HOH L . 
TB 3 HOH 349 949  949  HOH HOH L . 
TB 3 HOH 350 950  950  HOH HOH L . 
TB 3 HOH 351 951  951  HOH HOH L . 
TB 3 HOH 352 952  952  HOH HOH L . 
TB 3 HOH 353 953  953  HOH HOH L . 
TB 3 HOH 354 954  954  HOH HOH L . 
TB 3 HOH 355 955  955  HOH HOH L . 
TB 3 HOH 356 956  956  HOH HOH L . 
TB 3 HOH 357 957  957  HOH HOH L . 
TB 3 HOH 358 958  958  HOH HOH L . 
TB 3 HOH 359 959  959  HOH HOH L . 
TB 3 HOH 360 960  960  HOH HOH L . 
TB 3 HOH 361 961  961  HOH HOH L . 
TB 3 HOH 362 962  962  HOH HOH L . 
TB 3 HOH 363 963  963  HOH HOH L . 
TB 3 HOH 364 964  964  HOH HOH L . 
TB 3 HOH 365 965  965  HOH HOH L . 
TB 3 HOH 366 966  966  HOH HOH L . 
TB 3 HOH 367 967  967  HOH HOH L . 
TB 3 HOH 368 968  968  HOH HOH L . 
TB 3 HOH 369 969  969  HOH HOH L . 
TB 3 HOH 370 970  970  HOH HOH L . 
TB 3 HOH 371 971  971  HOH HOH L . 
TB 3 HOH 372 972  972  HOH HOH L . 
TB 3 HOH 373 973  973  HOH HOH L . 
TB 3 HOH 374 974  974  HOH HOH L . 
TB 3 HOH 375 975  975  HOH HOH L . 
TB 3 HOH 376 976  976  HOH HOH L . 
TB 3 HOH 377 977  977  HOH HOH L . 
TB 3 HOH 378 978  978  HOH HOH L . 
TB 3 HOH 379 979  979  HOH HOH L . 
TB 3 HOH 380 980  980  HOH HOH L . 
TB 3 HOH 381 981  981  HOH HOH L . 
TB 3 HOH 382 982  982  HOH HOH L . 
TB 3 HOH 383 983  983  HOH HOH L . 
TB 3 HOH 384 984  984  HOH HOH L . 
TB 3 HOH 385 985  985  HOH HOH L . 
TB 3 HOH 386 986  986  HOH HOH L . 
TB 3 HOH 387 987  987  HOH HOH L . 
TB 3 HOH 388 988  988  HOH HOH L . 
TB 3 HOH 389 989  989  HOH HOH L . 
TB 3 HOH 390 990  990  HOH HOH L . 
TB 3 HOH 391 991  991  HOH HOH L . 
TB 3 HOH 392 992  992  HOH HOH L . 
TB 3 HOH 393 993  993  HOH HOH L . 
TB 3 HOH 394 994  994  HOH HOH L . 
TB 3 HOH 395 995  995  HOH HOH L . 
TB 3 HOH 396 996  996  HOH HOH L . 
TB 3 HOH 397 997  997  HOH HOH L . 
TB 3 HOH 398 998  998  HOH HOH L . 
TB 3 HOH 399 999  999  HOH HOH L . 
TB 3 HOH 400 1000 1000 HOH HOH L . 
TB 3 HOH 401 1001 1001 HOH HOH L . 
TB 3 HOH 402 1002 1002 HOH HOH L . 
TB 3 HOH 403 1003 1003 HOH HOH L . 
TB 3 HOH 404 1004 1004 HOH HOH L . 
TB 3 HOH 405 1005 1005 HOH HOH L . 
TB 3 HOH 406 1006 1006 HOH HOH L . 
TB 3 HOH 407 1007 1007 HOH HOH L . 
TB 3 HOH 408 1008 1008 HOH HOH L . 
TB 3 HOH 409 1009 1009 HOH HOH L . 
TB 3 HOH 410 1010 1010 HOH HOH L . 
TB 3 HOH 411 1011 1011 HOH HOH L . 
TB 3 HOH 412 1012 1012 HOH HOH L . 
TB 3 HOH 413 1013 1013 HOH HOH L . 
TB 3 HOH 414 1014 1014 HOH HOH L . 
TB 3 HOH 415 1015 1015 HOH HOH L . 
TB 3 HOH 416 1016 1016 HOH HOH L . 
TB 3 HOH 417 1017 1017 HOH HOH L . 
TB 3 HOH 418 1018 1018 HOH HOH L . 
TB 3 HOH 419 1019 1019 HOH HOH L . 
TB 3 HOH 420 1020 1020 HOH HOH L . 
TB 3 HOH 421 1021 1021 HOH HOH L . 
TB 3 HOH 422 1022 1022 HOH HOH L . 
TB 3 HOH 423 1023 1023 HOH HOH L . 
TB 3 HOH 424 1024 1024 HOH HOH L . 
TB 3 HOH 425 1025 1025 HOH HOH L . 
TB 3 HOH 426 1026 1026 HOH HOH L . 
TB 3 HOH 427 1027 1027 HOH HOH L . 
TB 3 HOH 428 1028 1028 HOH HOH L . 
TB 3 HOH 429 1029 1029 HOH HOH L . 
TB 3 HOH 430 1030 1030 HOH HOH L . 
TB 3 HOH 431 1031 1031 HOH HOH L . 
TB 3 HOH 432 1032 1032 HOH HOH L . 
TB 3 HOH 433 1033 1033 HOH HOH L . 
TB 3 HOH 434 1034 1034 HOH HOH L . 
TB 3 HOH 435 1035 1035 HOH HOH L . 
TB 3 HOH 436 1036 1036 HOH HOH L . 
TB 3 HOH 437 1037 1037 HOH HOH L . 
TB 3 HOH 438 1038 1038 HOH HOH L . 
TB 3 HOH 439 1039 1039 HOH HOH L . 
TB 3 HOH 440 1040 1040 HOH HOH L . 
TB 3 HOH 441 1041 1041 HOH HOH L . 
TB 3 HOH 442 1042 1042 HOH HOH L . 
TB 3 HOH 443 1043 1043 HOH HOH L . 
TB 3 HOH 444 1044 1044 HOH HOH L . 
TB 3 HOH 445 1045 1045 HOH HOH L . 
TB 3 HOH 446 1046 1046 HOH HOH L . 
TB 3 HOH 447 1047 1047 HOH HOH L . 
TB 3 HOH 448 1048 1048 HOH HOH L . 
TB 3 HOH 449 1049 1049 HOH HOH L . 
TB 3 HOH 450 1050 1050 HOH HOH L . 
TB 3 HOH 451 1051 1051 HOH HOH L . 
TB 3 HOH 452 1052 1052 HOH HOH L . 
TB 3 HOH 453 1053 1053 HOH HOH L . 
TB 3 HOH 454 1054 1054 HOH HOH L . 
TB 3 HOH 455 1055 1055 HOH HOH L . 
TB 3 HOH 456 1056 1056 HOH HOH L . 
TB 3 HOH 457 1057 1057 HOH HOH L . 
TB 3 HOH 458 1058 1058 HOH HOH L . 
TB 3 HOH 459 1059 1059 HOH HOH L . 
TB 3 HOH 460 1060 1060 HOH HOH L . 
TB 3 HOH 461 1061 1061 HOH HOH L . 
TB 3 HOH 462 1062 1062 HOH HOH L . 
TB 3 HOH 463 1063 1063 HOH HOH L . 
TB 3 HOH 464 1064 1064 HOH HOH L . 
TB 3 HOH 465 1065 1065 HOH HOH L . 
TB 3 HOH 466 1066 1066 HOH HOH L . 
TB 3 HOH 467 1067 1067 HOH HOH L . 
TB 3 HOH 468 1068 1068 HOH HOH L . 
TB 3 HOH 469 1069 1069 HOH HOH L . 
TB 3 HOH 470 1070 1070 HOH HOH L . 
TB 3 HOH 471 1071 1071 HOH HOH L . 
TB 3 HOH 472 1072 1072 HOH HOH L . 
TB 3 HOH 473 1073 1073 HOH HOH L . 
TB 3 HOH 474 1074 1074 HOH HOH L . 
TB 3 HOH 475 1075 1075 HOH HOH L . 
TB 3 HOH 476 1076 1076 HOH HOH L . 
TB 3 HOH 477 1077 1077 HOH HOH L . 
TB 3 HOH 478 1078 1078 HOH HOH L . 
TB 3 HOH 479 1079 1079 HOH HOH L . 
TB 3 HOH 480 1080 1080 HOH HOH L . 
TB 3 HOH 481 1081 1081 HOH HOH L . 
TB 3 HOH 482 1082 1082 HOH HOH L . 
TB 3 HOH 483 1083 1083 HOH HOH L . 
TB 3 HOH 484 1084 1084 HOH HOH L . 
TB 3 HOH 485 1085 1085 HOH HOH L . 
TB 3 HOH 486 1086 1086 HOH HOH L . 
TB 3 HOH 487 1087 1087 HOH HOH L . 
TB 3 HOH 488 1088 1088 HOH HOH L . 
TB 3 HOH 489 1089 1089 HOH HOH L . 
TB 3 HOH 490 1090 1090 HOH HOH L . 
TB 3 HOH 491 1091 1091 HOH HOH L . 
TB 3 HOH 492 1092 1092 HOH HOH L . 
TB 3 HOH 493 1093 1093 HOH HOH L . 
TB 3 HOH 494 1094 1094 HOH HOH L . 
TB 3 HOH 495 1095 1095 HOH HOH L . 
TB 3 HOH 496 1096 1096 HOH HOH L . 
TB 3 HOH 497 1097 1097 HOH HOH L . 
TB 3 HOH 498 1098 1098 HOH HOH L . 
TB 3 HOH 499 1099 1099 HOH HOH L . 
TB 3 HOH 500 1100 1100 HOH HOH L . 
TB 3 HOH 501 1101 1101 HOH HOH L . 
TB 3 HOH 502 1102 1102 HOH HOH L . 
TB 3 HOH 503 1103 1103 HOH HOH L . 
TB 3 HOH 504 1104 1104 HOH HOH L . 
TB 3 HOH 505 1105 1105 HOH HOH L . 
TB 3 HOH 506 1106 1106 HOH HOH L . 
TB 3 HOH 507 1107 1107 HOH HOH L . 
TB 3 HOH 508 1108 1108 HOH HOH L . 
TB 3 HOH 509 1109 1109 HOH HOH L . 
TB 3 HOH 510 1110 1110 HOH HOH L . 
TB 3 HOH 511 1111 1111 HOH HOH L . 
TB 3 HOH 512 1112 1112 HOH HOH L . 
TB 3 HOH 513 1113 1113 HOH HOH L . 
TB 3 HOH 514 1114 1114 HOH HOH L . 
UB 3 HOH 1   601  601  HOH HOH N . 
UB 3 HOH 2   602  602  HOH HOH N . 
UB 3 HOH 3   603  603  HOH HOH N . 
UB 3 HOH 4   604  604  HOH HOH N . 
UB 3 HOH 5   605  605  HOH HOH N . 
UB 3 HOH 6   606  606  HOH HOH N . 
UB 3 HOH 7   607  607  HOH HOH N . 
UB 3 HOH 8   608  608  HOH HOH N . 
UB 3 HOH 9   609  609  HOH HOH N . 
UB 3 HOH 10  610  610  HOH HOH N . 
UB 3 HOH 11  611  611  HOH HOH N . 
UB 3 HOH 12  612  612  HOH HOH N . 
UB 3 HOH 13  613  613  HOH HOH N . 
UB 3 HOH 14  614  614  HOH HOH N . 
UB 3 HOH 15  615  615  HOH HOH N . 
UB 3 HOH 16  616  616  HOH HOH N . 
UB 3 HOH 17  617  617  HOH HOH N . 
UB 3 HOH 18  618  618  HOH HOH N . 
UB 3 HOH 19  619  619  HOH HOH N . 
UB 3 HOH 20  620  620  HOH HOH N . 
UB 3 HOH 21  621  621  HOH HOH N . 
UB 3 HOH 22  622  622  HOH HOH N . 
UB 3 HOH 23  623  623  HOH HOH N . 
UB 3 HOH 24  624  624  HOH HOH N . 
UB 3 HOH 25  625  625  HOH HOH N . 
UB 3 HOH 26  626  626  HOH HOH N . 
UB 3 HOH 27  627  627  HOH HOH N . 
UB 3 HOH 28  628  628  HOH HOH N . 
UB 3 HOH 29  629  629  HOH HOH N . 
UB 3 HOH 30  630  630  HOH HOH N . 
UB 3 HOH 31  631  631  HOH HOH N . 
UB 3 HOH 32  632  632  HOH HOH N . 
UB 3 HOH 33  633  633  HOH HOH N . 
UB 3 HOH 34  634  634  HOH HOH N . 
UB 3 HOH 35  635  635  HOH HOH N . 
UB 3 HOH 36  636  636  HOH HOH N . 
UB 3 HOH 37  637  637  HOH HOH N . 
UB 3 HOH 38  638  638  HOH HOH N . 
UB 3 HOH 39  639  639  HOH HOH N . 
UB 3 HOH 40  640  640  HOH HOH N . 
UB 3 HOH 41  641  641  HOH HOH N . 
UB 3 HOH 42  642  642  HOH HOH N . 
UB 3 HOH 43  643  643  HOH HOH N . 
UB 3 HOH 44  644  644  HOH HOH N . 
UB 3 HOH 45  645  645  HOH HOH N . 
UB 3 HOH 46  646  646  HOH HOH N . 
UB 3 HOH 47  647  647  HOH HOH N . 
UB 3 HOH 48  648  648  HOH HOH N . 
UB 3 HOH 49  649  649  HOH HOH N . 
UB 3 HOH 50  650  650  HOH HOH N . 
UB 3 HOH 51  651  651  HOH HOH N . 
UB 3 HOH 52  652  652  HOH HOH N . 
UB 3 HOH 53  653  653  HOH HOH N . 
UB 3 HOH 54  654  654  HOH HOH N . 
UB 3 HOH 55  655  655  HOH HOH N . 
UB 3 HOH 56  656  656  HOH HOH N . 
UB 3 HOH 57  657  657  HOH HOH N . 
UB 3 HOH 58  658  658  HOH HOH N . 
UB 3 HOH 59  659  659  HOH HOH N . 
UB 3 HOH 60  660  660  HOH HOH N . 
UB 3 HOH 61  661  661  HOH HOH N . 
UB 3 HOH 62  662  662  HOH HOH N . 
UB 3 HOH 63  663  663  HOH HOH N . 
UB 3 HOH 64  664  664  HOH HOH N . 
UB 3 HOH 65  665  665  HOH HOH N . 
UB 3 HOH 66  666  666  HOH HOH N . 
UB 3 HOH 67  667  667  HOH HOH N . 
UB 3 HOH 68  668  668  HOH HOH N . 
UB 3 HOH 69  669  669  HOH HOH N . 
UB 3 HOH 70  670  670  HOH HOH N . 
UB 3 HOH 71  671  671  HOH HOH N . 
UB 3 HOH 72  672  672  HOH HOH N . 
UB 3 HOH 73  673  673  HOH HOH N . 
UB 3 HOH 74  674  674  HOH HOH N . 
UB 3 HOH 75  675  675  HOH HOH N . 
UB 3 HOH 76  676  676  HOH HOH N . 
UB 3 HOH 77  677  677  HOH HOH N . 
UB 3 HOH 78  678  678  HOH HOH N . 
UB 3 HOH 79  679  679  HOH HOH N . 
UB 3 HOH 80  680  680  HOH HOH N . 
UB 3 HOH 81  681  681  HOH HOH N . 
UB 3 HOH 82  682  682  HOH HOH N . 
UB 3 HOH 83  683  683  HOH HOH N . 
UB 3 HOH 84  684  684  HOH HOH N . 
UB 3 HOH 85  685  685  HOH HOH N . 
UB 3 HOH 86  686  686  HOH HOH N . 
UB 3 HOH 87  687  687  HOH HOH N . 
UB 3 HOH 88  688  688  HOH HOH N . 
UB 3 HOH 89  689  689  HOH HOH N . 
UB 3 HOH 90  690  690  HOH HOH N . 
UB 3 HOH 91  691  691  HOH HOH N . 
UB 3 HOH 92  692  692  HOH HOH N . 
UB 3 HOH 93  693  693  HOH HOH N . 
UB 3 HOH 94  694  694  HOH HOH N . 
UB 3 HOH 95  695  695  HOH HOH N . 
UB 3 HOH 96  696  696  HOH HOH N . 
UB 3 HOH 97  697  697  HOH HOH N . 
UB 3 HOH 98  698  698  HOH HOH N . 
UB 3 HOH 99  699  699  HOH HOH N . 
UB 3 HOH 100 700  700  HOH HOH N . 
UB 3 HOH 101 701  701  HOH HOH N . 
UB 3 HOH 102 702  702  HOH HOH N . 
UB 3 HOH 103 703  703  HOH HOH N . 
UB 3 HOH 104 704  704  HOH HOH N . 
UB 3 HOH 105 705  705  HOH HOH N . 
UB 3 HOH 106 706  706  HOH HOH N . 
UB 3 HOH 107 707  707  HOH HOH N . 
UB 3 HOH 108 708  708  HOH HOH N . 
UB 3 HOH 109 709  709  HOH HOH N . 
UB 3 HOH 110 710  710  HOH HOH N . 
UB 3 HOH 111 711  711  HOH HOH N . 
UB 3 HOH 112 712  712  HOH HOH N . 
UB 3 HOH 113 713  713  HOH HOH N . 
UB 3 HOH 114 714  714  HOH HOH N . 
UB 3 HOH 115 715  715  HOH HOH N . 
UB 3 HOH 116 716  716  HOH HOH N . 
UB 3 HOH 117 717  717  HOH HOH N . 
UB 3 HOH 118 718  718  HOH HOH N . 
UB 3 HOH 119 719  719  HOH HOH N . 
UB 3 HOH 120 720  720  HOH HOH N . 
UB 3 HOH 121 721  721  HOH HOH N . 
UB 3 HOH 122 722  722  HOH HOH N . 
UB 3 HOH 123 723  723  HOH HOH N . 
UB 3 HOH 124 724  724  HOH HOH N . 
UB 3 HOH 125 725  725  HOH HOH N . 
UB 3 HOH 126 726  726  HOH HOH N . 
UB 3 HOH 127 727  727  HOH HOH N . 
UB 3 HOH 128 728  728  HOH HOH N . 
UB 3 HOH 129 729  729  HOH HOH N . 
UB 3 HOH 130 730  730  HOH HOH N . 
UB 3 HOH 131 731  731  HOH HOH N . 
UB 3 HOH 132 732  732  HOH HOH N . 
UB 3 HOH 133 733  733  HOH HOH N . 
UB 3 HOH 134 734  734  HOH HOH N . 
UB 3 HOH 135 735  735  HOH HOH N . 
UB 3 HOH 136 736  736  HOH HOH N . 
UB 3 HOH 137 737  737  HOH HOH N . 
UB 3 HOH 138 738  738  HOH HOH N . 
UB 3 HOH 139 739  739  HOH HOH N . 
UB 3 HOH 140 740  740  HOH HOH N . 
UB 3 HOH 141 741  741  HOH HOH N . 
UB 3 HOH 142 742  742  HOH HOH N . 
UB 3 HOH 143 743  743  HOH HOH N . 
UB 3 HOH 144 744  744  HOH HOH N . 
UB 3 HOH 145 745  745  HOH HOH N . 
UB 3 HOH 146 746  746  HOH HOH N . 
UB 3 HOH 147 747  747  HOH HOH N . 
UB 3 HOH 148 748  748  HOH HOH N . 
UB 3 HOH 149 749  749  HOH HOH N . 
UB 3 HOH 150 750  750  HOH HOH N . 
UB 3 HOH 151 751  751  HOH HOH N . 
UB 3 HOH 152 752  752  HOH HOH N . 
UB 3 HOH 153 753  753  HOH HOH N . 
UB 3 HOH 154 754  754  HOH HOH N . 
UB 3 HOH 155 755  755  HOH HOH N . 
UB 3 HOH 156 756  756  HOH HOH N . 
UB 3 HOH 157 757  757  HOH HOH N . 
UB 3 HOH 158 758  758  HOH HOH N . 
UB 3 HOH 159 759  759  HOH HOH N . 
UB 3 HOH 160 760  760  HOH HOH N . 
UB 3 HOH 161 761  761  HOH HOH N . 
UB 3 HOH 162 762  762  HOH HOH N . 
UB 3 HOH 163 763  763  HOH HOH N . 
UB 3 HOH 164 764  764  HOH HOH N . 
UB 3 HOH 165 765  765  HOH HOH N . 
UB 3 HOH 166 766  766  HOH HOH N . 
UB 3 HOH 167 767  767  HOH HOH N . 
UB 3 HOH 168 768  768  HOH HOH N . 
UB 3 HOH 169 769  769  HOH HOH N . 
UB 3 HOH 170 770  770  HOH HOH N . 
UB 3 HOH 171 771  771  HOH HOH N . 
UB 3 HOH 172 772  772  HOH HOH N . 
UB 3 HOH 173 773  773  HOH HOH N . 
UB 3 HOH 174 774  774  HOH HOH N . 
UB 3 HOH 175 775  775  HOH HOH N . 
UB 3 HOH 176 776  776  HOH HOH N . 
UB 3 HOH 177 777  777  HOH HOH N . 
UB 3 HOH 178 778  778  HOH HOH N . 
UB 3 HOH 179 779  779  HOH HOH N . 
UB 3 HOH 180 780  780  HOH HOH N . 
UB 3 HOH 181 781  781  HOH HOH N . 
UB 3 HOH 182 782  782  HOH HOH N . 
UB 3 HOH 183 783  783  HOH HOH N . 
UB 3 HOH 184 784  784  HOH HOH N . 
UB 3 HOH 185 785  785  HOH HOH N . 
UB 3 HOH 186 786  786  HOH HOH N . 
UB 3 HOH 187 787  787  HOH HOH N . 
UB 3 HOH 188 788  788  HOH HOH N . 
UB 3 HOH 189 789  789  HOH HOH N . 
UB 3 HOH 190 790  790  HOH HOH N . 
UB 3 HOH 191 791  791  HOH HOH N . 
UB 3 HOH 192 792  792  HOH HOH N . 
UB 3 HOH 193 793  793  HOH HOH N . 
UB 3 HOH 194 794  794  HOH HOH N . 
UB 3 HOH 195 795  795  HOH HOH N . 
UB 3 HOH 196 796  796  HOH HOH N . 
UB 3 HOH 197 797  797  HOH HOH N . 
UB 3 HOH 198 798  798  HOH HOH N . 
UB 3 HOH 199 799  799  HOH HOH N . 
UB 3 HOH 200 800  800  HOH HOH N . 
UB 3 HOH 201 801  801  HOH HOH N . 
UB 3 HOH 202 802  802  HOH HOH N . 
UB 3 HOH 203 803  803  HOH HOH N . 
UB 3 HOH 204 804  804  HOH HOH N . 
UB 3 HOH 205 805  805  HOH HOH N . 
UB 3 HOH 206 806  806  HOH HOH N . 
UB 3 HOH 207 807  807  HOH HOH N . 
UB 3 HOH 208 808  808  HOH HOH N . 
UB 3 HOH 209 809  809  HOH HOH N . 
UB 3 HOH 210 810  810  HOH HOH N . 
UB 3 HOH 211 811  811  HOH HOH N . 
UB 3 HOH 212 812  812  HOH HOH N . 
UB 3 HOH 213 813  813  HOH HOH N . 
UB 3 HOH 214 814  814  HOH HOH N . 
UB 3 HOH 215 815  815  HOH HOH N . 
UB 3 HOH 216 816  816  HOH HOH N . 
UB 3 HOH 217 817  817  HOH HOH N . 
UB 3 HOH 218 818  818  HOH HOH N . 
UB 3 HOH 219 819  819  HOH HOH N . 
UB 3 HOH 220 820  820  HOH HOH N . 
UB 3 HOH 221 821  821  HOH HOH N . 
UB 3 HOH 222 822  822  HOH HOH N . 
UB 3 HOH 223 823  823  HOH HOH N . 
UB 3 HOH 224 824  824  HOH HOH N . 
UB 3 HOH 225 825  825  HOH HOH N . 
UB 3 HOH 226 826  826  HOH HOH N . 
UB 3 HOH 227 827  827  HOH HOH N . 
UB 3 HOH 228 828  828  HOH HOH N . 
UB 3 HOH 229 829  829  HOH HOH N . 
UB 3 HOH 230 830  830  HOH HOH N . 
UB 3 HOH 231 831  831  HOH HOH N . 
UB 3 HOH 232 832  832  HOH HOH N . 
UB 3 HOH 233 833  833  HOH HOH N . 
UB 3 HOH 234 834  834  HOH HOH N . 
UB 3 HOH 235 835  835  HOH HOH N . 
UB 3 HOH 236 836  836  HOH HOH N . 
UB 3 HOH 237 837  837  HOH HOH N . 
UB 3 HOH 238 838  838  HOH HOH N . 
UB 3 HOH 239 839  839  HOH HOH N . 
UB 3 HOH 240 840  840  HOH HOH N . 
UB 3 HOH 241 841  841  HOH HOH N . 
UB 3 HOH 242 842  842  HOH HOH N . 
UB 3 HOH 243 843  843  HOH HOH N . 
UB 3 HOH 244 844  844  HOH HOH N . 
UB 3 HOH 245 845  845  HOH HOH N . 
UB 3 HOH 246 846  846  HOH HOH N . 
UB 3 HOH 247 847  847  HOH HOH N . 
UB 3 HOH 248 848  848  HOH HOH N . 
UB 3 HOH 249 849  849  HOH HOH N . 
UB 3 HOH 250 850  850  HOH HOH N . 
UB 3 HOH 251 851  851  HOH HOH N . 
UB 3 HOH 252 852  852  HOH HOH N . 
UB 3 HOH 253 853  853  HOH HOH N . 
UB 3 HOH 254 854  854  HOH HOH N . 
UB 3 HOH 255 855  855  HOH HOH N . 
UB 3 HOH 256 856  856  HOH HOH N . 
UB 3 HOH 257 857  857  HOH HOH N . 
UB 3 HOH 258 858  858  HOH HOH N . 
UB 3 HOH 259 859  859  HOH HOH N . 
UB 3 HOH 260 860  860  HOH HOH N . 
UB 3 HOH 261 861  861  HOH HOH N . 
UB 3 HOH 262 862  862  HOH HOH N . 
UB 3 HOH 263 863  863  HOH HOH N . 
UB 3 HOH 264 864  864  HOH HOH N . 
UB 3 HOH 265 865  865  HOH HOH N . 
UB 3 HOH 266 866  866  HOH HOH N . 
UB 3 HOH 267 867  867  HOH HOH N . 
UB 3 HOH 268 868  868  HOH HOH N . 
UB 3 HOH 269 869  869  HOH HOH N . 
UB 3 HOH 270 870  870  HOH HOH N . 
UB 3 HOH 271 871  871  HOH HOH N . 
UB 3 HOH 272 872  872  HOH HOH N . 
UB 3 HOH 273 873  873  HOH HOH N . 
UB 3 HOH 274 874  874  HOH HOH N . 
UB 3 HOH 275 875  875  HOH HOH N . 
UB 3 HOH 276 876  876  HOH HOH N . 
UB 3 HOH 277 877  877  HOH HOH N . 
UB 3 HOH 278 878  878  HOH HOH N . 
UB 3 HOH 279 879  879  HOH HOH N . 
UB 3 HOH 280 880  880  HOH HOH N . 
UB 3 HOH 281 881  881  HOH HOH N . 
UB 3 HOH 282 882  882  HOH HOH N . 
UB 3 HOH 283 883  883  HOH HOH N . 
UB 3 HOH 284 884  884  HOH HOH N . 
UB 3 HOH 285 885  885  HOH HOH N . 
UB 3 HOH 286 886  886  HOH HOH N . 
UB 3 HOH 287 887  887  HOH HOH N . 
UB 3 HOH 288 888  888  HOH HOH N . 
UB 3 HOH 289 889  889  HOH HOH N . 
UB 3 HOH 290 890  890  HOH HOH N . 
UB 3 HOH 291 891  891  HOH HOH N . 
UB 3 HOH 292 892  892  HOH HOH N . 
UB 3 HOH 293 893  893  HOH HOH N . 
UB 3 HOH 294 894  895  HOH HOH N . 
UB 3 HOH 295 895  896  HOH HOH N . 
UB 3 HOH 296 896  897  HOH HOH N . 
UB 3 HOH 297 897  898  HOH HOH N . 
UB 3 HOH 298 898  899  HOH HOH N . 
UB 3 HOH 299 899  900  HOH HOH N . 
UB 3 HOH 300 900  901  HOH HOH N . 
UB 3 HOH 301 901  902  HOH HOH N . 
UB 3 HOH 302 902  903  HOH HOH N . 
UB 3 HOH 303 903  904  HOH HOH N . 
UB 3 HOH 304 904  905  HOH HOH N . 
UB 3 HOH 305 905  906  HOH HOH N . 
UB 3 HOH 306 906  907  HOH HOH N . 
UB 3 HOH 307 907  908  HOH HOH N . 
UB 3 HOH 308 908  909  HOH HOH N . 
UB 3 HOH 309 909  910  HOH HOH N . 
UB 3 HOH 310 910  911  HOH HOH N . 
UB 3 HOH 311 911  912  HOH HOH N . 
UB 3 HOH 312 912  913  HOH HOH N . 
UB 3 HOH 313 913  914  HOH HOH N . 
UB 3 HOH 314 914  915  HOH HOH N . 
UB 3 HOH 315 915  916  HOH HOH N . 
UB 3 HOH 316 916  917  HOH HOH N . 
UB 3 HOH 317 917  918  HOH HOH N . 
UB 3 HOH 318 918  919  HOH HOH N . 
UB 3 HOH 319 919  920  HOH HOH N . 
UB 3 HOH 320 920  921  HOH HOH N . 
UB 3 HOH 321 921  922  HOH HOH N . 
UB 3 HOH 322 922  923  HOH HOH N . 
UB 3 HOH 323 923  924  HOH HOH N . 
UB 3 HOH 324 924  925  HOH HOH N . 
UB 3 HOH 325 925  926  HOH HOH N . 
UB 3 HOH 326 926  927  HOH HOH N . 
UB 3 HOH 327 927  928  HOH HOH N . 
UB 3 HOH 328 928  929  HOH HOH N . 
UB 3 HOH 329 929  930  HOH HOH N . 
UB 3 HOH 330 930  931  HOH HOH N . 
UB 3 HOH 331 931  932  HOH HOH N . 
UB 3 HOH 332 932  933  HOH HOH N . 
UB 3 HOH 333 933  934  HOH HOH N . 
UB 3 HOH 334 934  935  HOH HOH N . 
UB 3 HOH 335 935  936  HOH HOH N . 
UB 3 HOH 336 936  937  HOH HOH N . 
UB 3 HOH 337 937  938  HOH HOH N . 
UB 3 HOH 338 938  939  HOH HOH N . 
UB 3 HOH 339 939  940  HOH HOH N . 
UB 3 HOH 340 940  941  HOH HOH N . 
UB 3 HOH 341 941  942  HOH HOH N . 
UB 3 HOH 342 942  638  HOH HOH N . 
UB 3 HOH 343 943  943  HOH HOH N . 
UB 3 HOH 344 944  944  HOH HOH N . 
UB 3 HOH 345 945  945  HOH HOH N . 
UB 3 HOH 346 946  946  HOH HOH N . 
UB 3 HOH 347 947  947  HOH HOH N . 
UB 3 HOH 348 948  948  HOH HOH N . 
UB 3 HOH 349 949  949  HOH HOH N . 
UB 3 HOH 350 950  950  HOH HOH N . 
UB 3 HOH 351 951  951  HOH HOH N . 
UB 3 HOH 352 952  952  HOH HOH N . 
UB 3 HOH 353 953  953  HOH HOH N . 
UB 3 HOH 354 954  954  HOH HOH N . 
UB 3 HOH 355 955  955  HOH HOH N . 
UB 3 HOH 356 956  956  HOH HOH N . 
UB 3 HOH 357 957  957  HOH HOH N . 
UB 3 HOH 358 958  958  HOH HOH N . 
UB 3 HOH 359 959  959  HOH HOH N . 
UB 3 HOH 360 960  960  HOH HOH N . 
UB 3 HOH 361 961  961  HOH HOH N . 
UB 3 HOH 362 962  962  HOH HOH N . 
UB 3 HOH 363 963  963  HOH HOH N . 
UB 3 HOH 364 964  964  HOH HOH N . 
UB 3 HOH 365 965  965  HOH HOH N . 
UB 3 HOH 366 966  966  HOH HOH N . 
UB 3 HOH 367 967  967  HOH HOH N . 
UB 3 HOH 368 968  968  HOH HOH N . 
UB 3 HOH 369 969  969  HOH HOH N . 
UB 3 HOH 370 970  970  HOH HOH N . 
UB 3 HOH 371 971  971  HOH HOH N . 
UB 3 HOH 372 972  972  HOH HOH N . 
UB 3 HOH 373 973  973  HOH HOH N . 
UB 3 HOH 374 974  974  HOH HOH N . 
UB 3 HOH 375 975  975  HOH HOH N . 
UB 3 HOH 376 976  976  HOH HOH N . 
UB 3 HOH 377 977  977  HOH HOH N . 
UB 3 HOH 378 978  978  HOH HOH N . 
UB 3 HOH 379 979  979  HOH HOH N . 
UB 3 HOH 380 980  980  HOH HOH N . 
UB 3 HOH 381 981  981  HOH HOH N . 
UB 3 HOH 382 982  982  HOH HOH N . 
UB 3 HOH 383 983  983  HOH HOH N . 
UB 3 HOH 384 984  984  HOH HOH N . 
UB 3 HOH 385 985  985  HOH HOH N . 
UB 3 HOH 386 986  986  HOH HOH N . 
UB 3 HOH 387 987  987  HOH HOH N . 
UB 3 HOH 388 988  988  HOH HOH N . 
UB 3 HOH 389 989  989  HOH HOH N . 
UB 3 HOH 390 990  990  HOH HOH N . 
UB 3 HOH 391 991  991  HOH HOH N . 
UB 3 HOH 392 992  992  HOH HOH N . 
UB 3 HOH 393 993  993  HOH HOH N . 
UB 3 HOH 394 994  994  HOH HOH N . 
UB 3 HOH 395 995  995  HOH HOH N . 
UB 3 HOH 396 996  996  HOH HOH N . 
UB 3 HOH 397 997  997  HOH HOH N . 
UB 3 HOH 398 998  998  HOH HOH N . 
UB 3 HOH 399 999  1000 HOH HOH N . 
UB 3 HOH 400 1000 1001 HOH HOH N . 
UB 3 HOH 401 1001 1002 HOH HOH N . 
UB 3 HOH 402 1002 1003 HOH HOH N . 
UB 3 HOH 403 1003 1004 HOH HOH N . 
UB 3 HOH 404 1004 1005 HOH HOH N . 
UB 3 HOH 405 1005 1006 HOH HOH N . 
UB 3 HOH 406 1006 1007 HOH HOH N . 
UB 3 HOH 407 1007 1008 HOH HOH N . 
UB 3 HOH 408 1008 1009 HOH HOH N . 
UB 3 HOH 409 1009 1010 HOH HOH N . 
UB 3 HOH 410 1010 1011 HOH HOH N . 
UB 3 HOH 411 1011 1012 HOH HOH N . 
UB 3 HOH 412 1012 1013 HOH HOH N . 
UB 3 HOH 413 1013 1014 HOH HOH N . 
UB 3 HOH 414 1014 1015 HOH HOH N . 
UB 3 HOH 415 1015 1016 HOH HOH N . 
UB 3 HOH 416 1016 1018 HOH HOH N . 
UB 3 HOH 417 1017 1017 HOH HOH N . 
UB 3 HOH 418 1018 1019 HOH HOH N . 
UB 3 HOH 419 1019 1020 HOH HOH N . 
UB 3 HOH 420 1020 1021 HOH HOH N . 
UB 3 HOH 421 1021 1022 HOH HOH N . 
UB 3 HOH 422 1022 1023 HOH HOH N . 
UB 3 HOH 423 1023 1024 HOH HOH N . 
UB 3 HOH 424 1024 1025 HOH HOH N . 
UB 3 HOH 425 1025 1026 HOH HOH N . 
UB 3 HOH 426 1026 1027 HOH HOH N . 
UB 3 HOH 427 1027 1028 HOH HOH N . 
UB 3 HOH 428 1028 1029 HOH HOH N . 
UB 3 HOH 429 1029 1030 HOH HOH N . 
UB 3 HOH 430 1030 1031 HOH HOH N . 
UB 3 HOH 431 1031 1032 HOH HOH N . 
UB 3 HOH 432 1032 1033 HOH HOH N . 
UB 3 HOH 433 1033 1034 HOH HOH N . 
UB 3 HOH 434 1034 1035 HOH HOH N . 
UB 3 HOH 435 1035 1036 HOH HOH N . 
UB 3 HOH 436 1036 1037 HOH HOH N . 
UB 3 HOH 437 1037 1038 HOH HOH N . 
UB 3 HOH 438 1038 1039 HOH HOH N . 
UB 3 HOH 439 1039 1040 HOH HOH N . 
UB 3 HOH 440 1040 1041 HOH HOH N . 
UB 3 HOH 441 1041 1042 HOH HOH N . 
UB 3 HOH 442 1042 1043 HOH HOH N . 
UB 3 HOH 443 1043 1044 HOH HOH N . 
UB 3 HOH 444 1044 1045 HOH HOH N . 
UB 3 HOH 445 1045 1046 HOH HOH N . 
UB 3 HOH 446 1046 1047 HOH HOH N . 
UB 3 HOH 447 1047 1048 HOH HOH N . 
UB 3 HOH 448 1048 1049 HOH HOH N . 
UB 3 HOH 449 1049 1050 HOH HOH N . 
UB 3 HOH 450 1050 1051 HOH HOH N . 
UB 3 HOH 451 1051 1052 HOH HOH N . 
UB 3 HOH 452 1052 1053 HOH HOH N . 
UB 3 HOH 453 1053 1054 HOH HOH N . 
UB 3 HOH 454 1054 1055 HOH HOH N . 
UB 3 HOH 455 1055 1056 HOH HOH N . 
UB 3 HOH 456 1056 1057 HOH HOH N . 
UB 3 HOH 457 1057 1058 HOH HOH N . 
UB 3 HOH 458 1058 1060 HOH HOH N . 
UB 3 HOH 459 1059 1061 HOH HOH N . 
UB 3 HOH 460 1060 1062 HOH HOH N . 
UB 3 HOH 461 1061 1063 HOH HOH N . 
UB 3 HOH 462 1062 1064 HOH HOH N . 
UB 3 HOH 463 1063 894  HOH HOH N . 
UB 3 HOH 464 1064 1065 HOH HOH N . 
UB 3 HOH 465 1065 1066 HOH HOH N . 
UB 3 HOH 466 1066 1067 HOH HOH N . 
UB 3 HOH 467 1067 1068 HOH HOH N . 
UB 3 HOH 468 1068 1069 HOH HOH N . 
UB 3 HOH 469 1069 1070 HOH HOH N . 
UB 3 HOH 470 1070 1071 HOH HOH N . 
UB 3 HOH 471 1071 1072 HOH HOH N . 
UB 3 HOH 472 1072 1073 HOH HOH N . 
UB 3 HOH 473 1073 1074 HOH HOH N . 
UB 3 HOH 474 1074 1075 HOH HOH N . 
UB 3 HOH 475 1075 1076 HOH HOH N . 
UB 3 HOH 476 1076 1077 HOH HOH N . 
UB 3 HOH 477 1077 1078 HOH HOH N . 
UB 3 HOH 478 1078 1079 HOH HOH N . 
UB 3 HOH 479 1079 1080 HOH HOH N . 
UB 3 HOH 480 1080 1081 HOH HOH N . 
UB 3 HOH 481 1081 1082 HOH HOH N . 
UB 3 HOH 482 1082 1083 HOH HOH N . 
UB 3 HOH 483 1083 1084 HOH HOH N . 
UB 3 HOH 484 1084 1085 HOH HOH N . 
UB 3 HOH 485 1085 1059 HOH HOH N . 
UB 3 HOH 486 1086 1086 HOH HOH N . 
UB 3 HOH 487 1087 1087 HOH HOH N . 
UB 3 HOH 488 1088 1088 HOH HOH N . 
UB 3 HOH 489 1089 1089 HOH HOH N . 
UB 3 HOH 490 1090 1090 HOH HOH N . 
UB 3 HOH 491 1091 1091 HOH HOH N . 
UB 3 HOH 492 1092 999  HOH HOH N . 
UB 3 HOH 493 1093 1092 HOH HOH N . 
UB 3 HOH 494 1094 1093 HOH HOH N . 
UB 3 HOH 495 1095 1094 HOH HOH N . 
UB 3 HOH 496 1096 1095 HOH HOH N . 
UB 3 HOH 497 1097 1096 HOH HOH N . 
UB 3 HOH 498 1098 1097 HOH HOH N . 
UB 3 HOH 499 1099 1098 HOH HOH N . 
UB 3 HOH 500 1100 1099 HOH HOH N . 
UB 3 HOH 501 1101 1100 HOH HOH N . 
UB 3 HOH 502 1102 1101 HOH HOH N . 
UB 3 HOH 503 1103 1102 HOH HOH N . 
VB 3 HOH 1   601  601  HOH HOH O . 
VB 3 HOH 2   602  602  HOH HOH O . 
VB 3 HOH 3   603  603  HOH HOH O . 
VB 3 HOH 4   604  604  HOH HOH O . 
VB 3 HOH 5   605  605  HOH HOH O . 
VB 3 HOH 6   606  606  HOH HOH O . 
VB 3 HOH 7   607  607  HOH HOH O . 
VB 3 HOH 8   608  608  HOH HOH O . 
VB 3 HOH 9   609  609  HOH HOH O . 
VB 3 HOH 10  610  610  HOH HOH O . 
VB 3 HOH 11  611  611  HOH HOH O . 
VB 3 HOH 12  612  612  HOH HOH O . 
VB 3 HOH 13  613  613  HOH HOH O . 
VB 3 HOH 14  614  614  HOH HOH O . 
VB 3 HOH 15  615  615  HOH HOH O . 
VB 3 HOH 16  616  616  HOH HOH O . 
VB 3 HOH 17  617  617  HOH HOH O . 
VB 3 HOH 18  618  618  HOH HOH O . 
VB 3 HOH 19  619  619  HOH HOH O . 
VB 3 HOH 20  620  620  HOH HOH O . 
VB 3 HOH 21  621  621  HOH HOH O . 
VB 3 HOH 22  622  622  HOH HOH O . 
VB 3 HOH 23  623  623  HOH HOH O . 
VB 3 HOH 24  624  624  HOH HOH O . 
VB 3 HOH 25  625  625  HOH HOH O . 
VB 3 HOH 26  626  626  HOH HOH O . 
VB 3 HOH 27  627  627  HOH HOH O . 
VB 3 HOH 28  628  628  HOH HOH O . 
VB 3 HOH 29  629  629  HOH HOH O . 
VB 3 HOH 30  630  630  HOH HOH O . 
VB 3 HOH 31  631  631  HOH HOH O . 
VB 3 HOH 32  632  632  HOH HOH O . 
VB 3 HOH 33  633  633  HOH HOH O . 
VB 3 HOH 34  634  634  HOH HOH O . 
VB 3 HOH 35  635  635  HOH HOH O . 
VB 3 HOH 36  636  636  HOH HOH O . 
VB 3 HOH 37  637  637  HOH HOH O . 
VB 3 HOH 38  638  638  HOH HOH O . 
VB 3 HOH 39  639  639  HOH HOH O . 
VB 3 HOH 40  640  640  HOH HOH O . 
VB 3 HOH 41  641  641  HOH HOH O . 
VB 3 HOH 42  642  642  HOH HOH O . 
VB 3 HOH 43  643  643  HOH HOH O . 
VB 3 HOH 44  644  644  HOH HOH O . 
VB 3 HOH 45  645  645  HOH HOH O . 
VB 3 HOH 46  646  646  HOH HOH O . 
VB 3 HOH 47  647  647  HOH HOH O . 
VB 3 HOH 48  648  648  HOH HOH O . 
VB 3 HOH 49  649  649  HOH HOH O . 
VB 3 HOH 50  650  650  HOH HOH O . 
VB 3 HOH 51  651  651  HOH HOH O . 
VB 3 HOH 52  652  652  HOH HOH O . 
VB 3 HOH 53  653  653  HOH HOH O . 
VB 3 HOH 54  654  654  HOH HOH O . 
VB 3 HOH 55  655  655  HOH HOH O . 
VB 3 HOH 56  656  656  HOH HOH O . 
VB 3 HOH 57  657  657  HOH HOH O . 
VB 3 HOH 58  658  658  HOH HOH O . 
VB 3 HOH 59  659  659  HOH HOH O . 
VB 3 HOH 60  660  660  HOH HOH O . 
VB 3 HOH 61  661  661  HOH HOH O . 
VB 3 HOH 62  662  662  HOH HOH O . 
VB 3 HOH 63  663  663  HOH HOH O . 
VB 3 HOH 64  664  664  HOH HOH O . 
VB 3 HOH 65  665  665  HOH HOH O . 
VB 3 HOH 66  666  666  HOH HOH O . 
VB 3 HOH 67  667  667  HOH HOH O . 
VB 3 HOH 68  668  668  HOH HOH O . 
VB 3 HOH 69  669  669  HOH HOH O . 
VB 3 HOH 70  670  670  HOH HOH O . 
VB 3 HOH 71  671  671  HOH HOH O . 
VB 3 HOH 72  672  672  HOH HOH O . 
VB 3 HOH 73  673  673  HOH HOH O . 
VB 3 HOH 74  674  674  HOH HOH O . 
VB 3 HOH 75  675  675  HOH HOH O . 
VB 3 HOH 76  676  676  HOH HOH O . 
VB 3 HOH 77  677  677  HOH HOH O . 
VB 3 HOH 78  678  678  HOH HOH O . 
VB 3 HOH 79  679  679  HOH HOH O . 
VB 3 HOH 80  680  680  HOH HOH O . 
VB 3 HOH 81  681  681  HOH HOH O . 
VB 3 HOH 82  682  682  HOH HOH O . 
VB 3 HOH 83  683  683  HOH HOH O . 
VB 3 HOH 84  684  684  HOH HOH O . 
VB 3 HOH 85  685  685  HOH HOH O . 
VB 3 HOH 86  686  686  HOH HOH O . 
VB 3 HOH 87  687  687  HOH HOH O . 
VB 3 HOH 88  688  688  HOH HOH O . 
VB 3 HOH 89  689  690  HOH HOH O . 
VB 3 HOH 90  690  691  HOH HOH O . 
VB 3 HOH 91  691  692  HOH HOH O . 
VB 3 HOH 92  692  693  HOH HOH O . 
VB 3 HOH 93  693  694  HOH HOH O . 
VB 3 HOH 94  694  695  HOH HOH O . 
VB 3 HOH 95  695  696  HOH HOH O . 
VB 3 HOH 96  696  697  HOH HOH O . 
VB 3 HOH 97  697  698  HOH HOH O . 
VB 3 HOH 98  698  699  HOH HOH O . 
VB 3 HOH 99  699  700  HOH HOH O . 
VB 3 HOH 100 700  701  HOH HOH O . 
VB 3 HOH 101 701  702  HOH HOH O . 
VB 3 HOH 102 702  703  HOH HOH O . 
VB 3 HOH 103 703  704  HOH HOH O . 
VB 3 HOH 104 704  705  HOH HOH O . 
VB 3 HOH 105 705  706  HOH HOH O . 
VB 3 HOH 106 706  707  HOH HOH O . 
VB 3 HOH 107 707  708  HOH HOH O . 
VB 3 HOH 108 708  709  HOH HOH O . 
VB 3 HOH 109 709  710  HOH HOH O . 
VB 3 HOH 110 710  711  HOH HOH O . 
VB 3 HOH 111 711  712  HOH HOH O . 
VB 3 HOH 112 712  713  HOH HOH O . 
VB 3 HOH 113 713  714  HOH HOH O . 
VB 3 HOH 114 714  715  HOH HOH O . 
VB 3 HOH 115 715  716  HOH HOH O . 
VB 3 HOH 116 716  717  HOH HOH O . 
VB 3 HOH 117 717  718  HOH HOH O . 
VB 3 HOH 118 718  719  HOH HOH O . 
VB 3 HOH 119 719  720  HOH HOH O . 
VB 3 HOH 120 720  721  HOH HOH O . 
VB 3 HOH 121 721  722  HOH HOH O . 
VB 3 HOH 122 722  723  HOH HOH O . 
VB 3 HOH 123 723  724  HOH HOH O . 
VB 3 HOH 124 724  725  HOH HOH O . 
VB 3 HOH 125 725  726  HOH HOH O . 
VB 3 HOH 126 726  727  HOH HOH O . 
VB 3 HOH 127 727  728  HOH HOH O . 
VB 3 HOH 128 728  729  HOH HOH O . 
VB 3 HOH 129 729  730  HOH HOH O . 
VB 3 HOH 130 730  731  HOH HOH O . 
VB 3 HOH 131 731  732  HOH HOH O . 
VB 3 HOH 132 732  733  HOH HOH O . 
VB 3 HOH 133 733  734  HOH HOH O . 
VB 3 HOH 134 734  735  HOH HOH O . 
VB 3 HOH 135 735  736  HOH HOH O . 
VB 3 HOH 136 736  737  HOH HOH O . 
VB 3 HOH 137 737  738  HOH HOH O . 
VB 3 HOH 138 738  739  HOH HOH O . 
VB 3 HOH 139 739  740  HOH HOH O . 
VB 3 HOH 140 740  741  HOH HOH O . 
VB 3 HOH 141 741  742  HOH HOH O . 
VB 3 HOH 142 742  743  HOH HOH O . 
VB 3 HOH 143 743  744  HOH HOH O . 
VB 3 HOH 144 744  745  HOH HOH O . 
VB 3 HOH 145 745  746  HOH HOH O . 
VB 3 HOH 146 746  747  HOH HOH O . 
VB 3 HOH 147 747  748  HOH HOH O . 
VB 3 HOH 148 748  749  HOH HOH O . 
VB 3 HOH 149 749  750  HOH HOH O . 
VB 3 HOH 150 750  751  HOH HOH O . 
VB 3 HOH 151 751  752  HOH HOH O . 
VB 3 HOH 152 752  753  HOH HOH O . 
VB 3 HOH 153 753  754  HOH HOH O . 
VB 3 HOH 154 754  755  HOH HOH O . 
VB 3 HOH 155 755  756  HOH HOH O . 
VB 3 HOH 156 756  757  HOH HOH O . 
VB 3 HOH 157 757  758  HOH HOH O . 
VB 3 HOH 158 758  759  HOH HOH O . 
VB 3 HOH 159 759  760  HOH HOH O . 
VB 3 HOH 160 760  761  HOH HOH O . 
VB 3 HOH 161 761  762  HOH HOH O . 
VB 3 HOH 162 762  763  HOH HOH O . 
VB 3 HOH 163 763  764  HOH HOH O . 
VB 3 HOH 164 764  765  HOH HOH O . 
VB 3 HOH 165 765  766  HOH HOH O . 
VB 3 HOH 166 766  767  HOH HOH O . 
VB 3 HOH 167 767  768  HOH HOH O . 
VB 3 HOH 168 768  769  HOH HOH O . 
VB 3 HOH 169 769  770  HOH HOH O . 
VB 3 HOH 170 770  771  HOH HOH O . 
VB 3 HOH 171 771  772  HOH HOH O . 
VB 3 HOH 172 772  773  HOH HOH O . 
VB 3 HOH 173 773  774  HOH HOH O . 
VB 3 HOH 174 774  775  HOH HOH O . 
VB 3 HOH 175 775  776  HOH HOH O . 
VB 3 HOH 176 776  777  HOH HOH O . 
VB 3 HOH 177 777  778  HOH HOH O . 
VB 3 HOH 178 778  779  HOH HOH O . 
VB 3 HOH 179 779  780  HOH HOH O . 
VB 3 HOH 180 780  781  HOH HOH O . 
VB 3 HOH 181 781  782  HOH HOH O . 
VB 3 HOH 182 782  783  HOH HOH O . 
VB 3 HOH 183 783  784  HOH HOH O . 
VB 3 HOH 184 784  785  HOH HOH O . 
VB 3 HOH 185 785  786  HOH HOH O . 
VB 3 HOH 186 786  787  HOH HOH O . 
VB 3 HOH 187 787  788  HOH HOH O . 
VB 3 HOH 188 788  789  HOH HOH O . 
VB 3 HOH 189 789  790  HOH HOH O . 
VB 3 HOH 190 790  791  HOH HOH O . 
VB 3 HOH 191 791  792  HOH HOH O . 
VB 3 HOH 192 792  793  HOH HOH O . 
VB 3 HOH 193 793  794  HOH HOH O . 
VB 3 HOH 194 794  795  HOH HOH O . 
VB 3 HOH 195 795  796  HOH HOH O . 
VB 3 HOH 196 796  797  HOH HOH O . 
VB 3 HOH 197 797  798  HOH HOH O . 
VB 3 HOH 198 798  799  HOH HOH O . 
VB 3 HOH 199 799  800  HOH HOH O . 
VB 3 HOH 200 800  801  HOH HOH O . 
VB 3 HOH 201 801  802  HOH HOH O . 
VB 3 HOH 202 802  803  HOH HOH O . 
VB 3 HOH 203 803  804  HOH HOH O . 
VB 3 HOH 204 804  805  HOH HOH O . 
VB 3 HOH 205 805  806  HOH HOH O . 
VB 3 HOH 206 806  807  HOH HOH O . 
VB 3 HOH 207 807  808  HOH HOH O . 
VB 3 HOH 208 808  809  HOH HOH O . 
VB 3 HOH 209 809  810  HOH HOH O . 
VB 3 HOH 210 810  811  HOH HOH O . 
VB 3 HOH 211 811  812  HOH HOH O . 
VB 3 HOH 212 812  813  HOH HOH O . 
VB 3 HOH 213 813  814  HOH HOH O . 
VB 3 HOH 214 814  815  HOH HOH O . 
VB 3 HOH 215 815  816  HOH HOH O . 
VB 3 HOH 216 816  818  HOH HOH O . 
VB 3 HOH 217 817  817  HOH HOH O . 
VB 3 HOH 218 818  819  HOH HOH O . 
VB 3 HOH 219 819  820  HOH HOH O . 
VB 3 HOH 220 820  821  HOH HOH O . 
VB 3 HOH 221 821  822  HOH HOH O . 
VB 3 HOH 222 822  823  HOH HOH O . 
VB 3 HOH 223 823  824  HOH HOH O . 
VB 3 HOH 224 824  825  HOH HOH O . 
VB 3 HOH 225 825  826  HOH HOH O . 
VB 3 HOH 226 826  827  HOH HOH O . 
VB 3 HOH 227 827  828  HOH HOH O . 
VB 3 HOH 228 828  829  HOH HOH O . 
VB 3 HOH 229 829  830  HOH HOH O . 
VB 3 HOH 230 830  831  HOH HOH O . 
VB 3 HOH 231 831  832  HOH HOH O . 
VB 3 HOH 232 832  833  HOH HOH O . 
VB 3 HOH 233 833  834  HOH HOH O . 
VB 3 HOH 234 834  835  HOH HOH O . 
VB 3 HOH 235 835  836  HOH HOH O . 
VB 3 HOH 236 836  837  HOH HOH O . 
VB 3 HOH 237 837  838  HOH HOH O . 
VB 3 HOH 238 838  839  HOH HOH O . 
VB 3 HOH 239 839  840  HOH HOH O . 
VB 3 HOH 240 840  841  HOH HOH O . 
VB 3 HOH 241 841  842  HOH HOH O . 
VB 3 HOH 242 842  843  HOH HOH O . 
VB 3 HOH 243 843  844  HOH HOH O . 
VB 3 HOH 244 844  845  HOH HOH O . 
VB 3 HOH 245 845  846  HOH HOH O . 
VB 3 HOH 246 846  847  HOH HOH O . 
VB 3 HOH 247 847  848  HOH HOH O . 
VB 3 HOH 248 848  849  HOH HOH O . 
VB 3 HOH 249 849  850  HOH HOH O . 
VB 3 HOH 250 850  851  HOH HOH O . 
VB 3 HOH 251 851  852  HOH HOH O . 
VB 3 HOH 252 852  853  HOH HOH O . 
VB 3 HOH 253 853  854  HOH HOH O . 
VB 3 HOH 254 854  855  HOH HOH O . 
VB 3 HOH 255 855  856  HOH HOH O . 
VB 3 HOH 256 856  857  HOH HOH O . 
VB 3 HOH 257 857  858  HOH HOH O . 
VB 3 HOH 258 858  859  HOH HOH O . 
VB 3 HOH 259 859  860  HOH HOH O . 
VB 3 HOH 260 860  861  HOH HOH O . 
VB 3 HOH 261 861  862  HOH HOH O . 
VB 3 HOH 262 862  863  HOH HOH O . 
VB 3 HOH 263 863  864  HOH HOH O . 
VB 3 HOH 264 864  865  HOH HOH O . 
VB 3 HOH 265 865  866  HOH HOH O . 
VB 3 HOH 266 866  867  HOH HOH O . 
VB 3 HOH 267 867  868  HOH HOH O . 
VB 3 HOH 268 868  869  HOH HOH O . 
VB 3 HOH 269 869  870  HOH HOH O . 
VB 3 HOH 270 870  871  HOH HOH O . 
VB 3 HOH 271 871  872  HOH HOH O . 
VB 3 HOH 272 872  873  HOH HOH O . 
VB 3 HOH 273 873  874  HOH HOH O . 
VB 3 HOH 274 874  875  HOH HOH O . 
VB 3 HOH 275 875  876  HOH HOH O . 
VB 3 HOH 276 876  877  HOH HOH O . 
VB 3 HOH 277 877  878  HOH HOH O . 
VB 3 HOH 278 878  879  HOH HOH O . 
VB 3 HOH 279 879  880  HOH HOH O . 
VB 3 HOH 280 880  881  HOH HOH O . 
VB 3 HOH 281 881  882  HOH HOH O . 
VB 3 HOH 282 882  883  HOH HOH O . 
VB 3 HOH 283 883  884  HOH HOH O . 
VB 3 HOH 284 884  885  HOH HOH O . 
VB 3 HOH 285 885  886  HOH HOH O . 
VB 3 HOH 286 886  887  HOH HOH O . 
VB 3 HOH 287 887  888  HOH HOH O . 
VB 3 HOH 288 888  889  HOH HOH O . 
VB 3 HOH 289 889  890  HOH HOH O . 
VB 3 HOH 290 890  891  HOH HOH O . 
VB 3 HOH 291 891  892  HOH HOH O . 
VB 3 HOH 292 892  893  HOH HOH O . 
VB 3 HOH 293 893  894  HOH HOH O . 
VB 3 HOH 294 894  895  HOH HOH O . 
VB 3 HOH 295 895  896  HOH HOH O . 
VB 3 HOH 296 896  897  HOH HOH O . 
VB 3 HOH 297 897  898  HOH HOH O . 
VB 3 HOH 298 898  899  HOH HOH O . 
VB 3 HOH 299 899  900  HOH HOH O . 
VB 3 HOH 300 900  901  HOH HOH O . 
VB 3 HOH 301 901  902  HOH HOH O . 
VB 3 HOH 302 902  903  HOH HOH O . 
VB 3 HOH 303 903  904  HOH HOH O . 
VB 3 HOH 304 904  905  HOH HOH O . 
VB 3 HOH 305 905  906  HOH HOH O . 
VB 3 HOH 306 906  907  HOH HOH O . 
VB 3 HOH 307 907  908  HOH HOH O . 
VB 3 HOH 308 908  909  HOH HOH O . 
VB 3 HOH 309 909  910  HOH HOH O . 
VB 3 HOH 310 910  911  HOH HOH O . 
VB 3 HOH 311 911  912  HOH HOH O . 
VB 3 HOH 312 912  913  HOH HOH O . 
VB 3 HOH 313 913  914  HOH HOH O . 
VB 3 HOH 314 914  915  HOH HOH O . 
VB 3 HOH 315 915  916  HOH HOH O . 
VB 3 HOH 316 916  917  HOH HOH O . 
VB 3 HOH 317 917  918  HOH HOH O . 
VB 3 HOH 318 918  919  HOH HOH O . 
VB 3 HOH 319 919  920  HOH HOH O . 
VB 3 HOH 320 920  921  HOH HOH O . 
VB 3 HOH 321 921  922  HOH HOH O . 
VB 3 HOH 322 922  923  HOH HOH O . 
VB 3 HOH 323 923  924  HOH HOH O . 
VB 3 HOH 324 924  925  HOH HOH O . 
VB 3 HOH 325 925  926  HOH HOH O . 
VB 3 HOH 326 926  927  HOH HOH O . 
VB 3 HOH 327 927  928  HOH HOH O . 
VB 3 HOH 328 928  929  HOH HOH O . 
VB 3 HOH 329 929  930  HOH HOH O . 
VB 3 HOH 330 930  931  HOH HOH O . 
VB 3 HOH 331 931  932  HOH HOH O . 
VB 3 HOH 332 932  933  HOH HOH O . 
VB 3 HOH 333 933  934  HOH HOH O . 
VB 3 HOH 334 934  935  HOH HOH O . 
VB 3 HOH 335 935  936  HOH HOH O . 
VB 3 HOH 336 936  937  HOH HOH O . 
VB 3 HOH 337 937  938  HOH HOH O . 
VB 3 HOH 338 938  939  HOH HOH O . 
VB 3 HOH 339 939  940  HOH HOH O . 
VB 3 HOH 340 940  941  HOH HOH O . 
VB 3 HOH 341 941  942  HOH HOH O . 
VB 3 HOH 342 942  943  HOH HOH O . 
VB 3 HOH 343 943  944  HOH HOH O . 
VB 3 HOH 344 944  945  HOH HOH O . 
VB 3 HOH 345 945  946  HOH HOH O . 
VB 3 HOH 346 946  947  HOH HOH O . 
VB 3 HOH 347 947  948  HOH HOH O . 
VB 3 HOH 348 948  949  HOH HOH O . 
VB 3 HOH 349 949  950  HOH HOH O . 
VB 3 HOH 350 950  951  HOH HOH O . 
VB 3 HOH 351 951  952  HOH HOH O . 
VB 3 HOH 352 952  953  HOH HOH O . 
VB 3 HOH 353 953  954  HOH HOH O . 
VB 3 HOH 354 954  955  HOH HOH O . 
VB 3 HOH 355 955  956  HOH HOH O . 
VB 3 HOH 356 956  957  HOH HOH O . 
VB 3 HOH 357 957  958  HOH HOH O . 
VB 3 HOH 358 958  959  HOH HOH O . 
VB 3 HOH 359 959  960  HOH HOH O . 
VB 3 HOH 360 960  961  HOH HOH O . 
VB 3 HOH 361 961  962  HOH HOH O . 
VB 3 HOH 362 962  963  HOH HOH O . 
VB 3 HOH 363 963  964  HOH HOH O . 
VB 3 HOH 364 964  965  HOH HOH O . 
VB 3 HOH 365 965  966  HOH HOH O . 
VB 3 HOH 366 966  967  HOH HOH O . 
VB 3 HOH 367 967  968  HOH HOH O . 
VB 3 HOH 368 968  969  HOH HOH O . 
VB 3 HOH 369 969  970  HOH HOH O . 
VB 3 HOH 370 970  971  HOH HOH O . 
VB 3 HOH 371 971  972  HOH HOH O . 
VB 3 HOH 372 972  973  HOH HOH O . 
VB 3 HOH 373 973  974  HOH HOH O . 
VB 3 HOH 374 974  975  HOH HOH O . 
VB 3 HOH 375 975  976  HOH HOH O . 
VB 3 HOH 376 976  977  HOH HOH O . 
VB 3 HOH 377 977  978  HOH HOH O . 
VB 3 HOH 378 978  979  HOH HOH O . 
VB 3 HOH 379 979  980  HOH HOH O . 
VB 3 HOH 380 980  981  HOH HOH O . 
VB 3 HOH 381 981  982  HOH HOH O . 
VB 3 HOH 382 982  983  HOH HOH O . 
VB 3 HOH 383 983  984  HOH HOH O . 
VB 3 HOH 384 984  985  HOH HOH O . 
VB 3 HOH 385 985  986  HOH HOH O . 
VB 3 HOH 386 986  987  HOH HOH O . 
VB 3 HOH 387 987  988  HOH HOH O . 
VB 3 HOH 388 988  989  HOH HOH O . 
VB 3 HOH 389 989  990  HOH HOH O . 
VB 3 HOH 390 990  991  HOH HOH O . 
VB 3 HOH 391 991  992  HOH HOH O . 
VB 3 HOH 392 992  993  HOH HOH O . 
VB 3 HOH 393 993  994  HOH HOH O . 
VB 3 HOH 394 994  995  HOH HOH O . 
VB 3 HOH 395 995  996  HOH HOH O . 
VB 3 HOH 396 996  997  HOH HOH O . 
VB 3 HOH 397 997  998  HOH HOH O . 
VB 3 HOH 398 998  999  HOH HOH O . 
VB 3 HOH 399 999  1000 HOH HOH O . 
VB 3 HOH 400 1000 1001 HOH HOH O . 
VB 3 HOH 401 1001 1002 HOH HOH O . 
VB 3 HOH 402 1002 1003 HOH HOH O . 
VB 3 HOH 403 1003 1004 HOH HOH O . 
VB 3 HOH 404 1004 1005 HOH HOH O . 
VB 3 HOH 405 1005 1006 HOH HOH O . 
VB 3 HOH 406 1006 1007 HOH HOH O . 
VB 3 HOH 407 1007 1008 HOH HOH O . 
VB 3 HOH 408 1008 1009 HOH HOH O . 
VB 3 HOH 409 1009 1010 HOH HOH O . 
VB 3 HOH 410 1010 1011 HOH HOH O . 
VB 3 HOH 411 1011 1012 HOH HOH O . 
VB 3 HOH 412 1012 1013 HOH HOH O . 
VB 3 HOH 413 1013 1014 HOH HOH O . 
VB 3 HOH 414 1014 1015 HOH HOH O . 
VB 3 HOH 415 1015 1016 HOH HOH O . 
VB 3 HOH 416 1016 1017 HOH HOH O . 
VB 3 HOH 417 1017 1018 HOH HOH O . 
VB 3 HOH 418 1018 1019 HOH HOH O . 
VB 3 HOH 419 1019 1020 HOH HOH O . 
VB 3 HOH 420 1020 1021 HOH HOH O . 
VB 3 HOH 421 1021 1022 HOH HOH O . 
VB 3 HOH 422 1022 1023 HOH HOH O . 
VB 3 HOH 423 1023 1024 HOH HOH O . 
VB 3 HOH 424 1024 1025 HOH HOH O . 
VB 3 HOH 425 1025 1026 HOH HOH O . 
VB 3 HOH 426 1026 1027 HOH HOH O . 
VB 3 HOH 427 1027 1028 HOH HOH O . 
VB 3 HOH 428 1028 1030 HOH HOH O . 
VB 3 HOH 429 1029 1029 HOH HOH O . 
VB 3 HOH 430 1030 1031 HOH HOH O . 
VB 3 HOH 431 1031 1032 HOH HOH O . 
VB 3 HOH 432 1032 1033 HOH HOH O . 
VB 3 HOH 433 1033 1034 HOH HOH O . 
VB 3 HOH 434 1034 1035 HOH HOH O . 
VB 3 HOH 435 1035 1036 HOH HOH O . 
VB 3 HOH 436 1036 1037 HOH HOH O . 
VB 3 HOH 437 1037 1038 HOH HOH O . 
VB 3 HOH 438 1038 1040 HOH HOH O . 
VB 3 HOH 439 1039 1039 HOH HOH O . 
VB 3 HOH 440 1040 1042 HOH HOH O . 
VB 3 HOH 441 1041 1041 HOH HOH O . 
VB 3 HOH 442 1042 1043 HOH HOH O . 
VB 3 HOH 443 1043 1044 HOH HOH O . 
VB 3 HOH 444 1044 1045 HOH HOH O . 
VB 3 HOH 445 1045 1046 HOH HOH O . 
VB 3 HOH 446 1046 689  HOH HOH O . 
VB 3 HOH 447 1047 1047 HOH HOH O . 
VB 3 HOH 448 1048 1048 HOH HOH O . 
VB 3 HOH 449 1049 1049 HOH HOH O . 
VB 3 HOH 450 1050 1050 HOH HOH O . 
VB 3 HOH 451 1051 1051 HOH HOH O . 
VB 3 HOH 452 1052 1052 HOH HOH O . 
VB 3 HOH 453 1053 1053 HOH HOH O . 
VB 3 HOH 454 1054 1054 HOH HOH O . 
VB 3 HOH 455 1055 1055 HOH HOH O . 
VB 3 HOH 456 1056 1056 HOH HOH O . 
VB 3 HOH 457 1057 1057 HOH HOH O . 
VB 3 HOH 458 1058 1058 HOH HOH O . 
VB 3 HOH 459 1059 1059 HOH HOH O . 
VB 3 HOH 460 1060 1060 HOH HOH O . 
VB 3 HOH 461 1061 1061 HOH HOH O . 
VB 3 HOH 462 1062 1062 HOH HOH O . 
VB 3 HOH 463 1063 1063 HOH HOH O . 
VB 3 HOH 464 1064 1064 HOH HOH O . 
VB 3 HOH 465 1065 1065 HOH HOH O . 
VB 3 HOH 466 1066 1066 HOH HOH O . 
VB 3 HOH 467 1067 1067 HOH HOH O . 
VB 3 HOH 468 1068 1068 HOH HOH O . 
VB 3 HOH 469 1069 1069 HOH HOH O . 
VB 3 HOH 470 1070 1070 HOH HOH O . 
VB 3 HOH 471 1071 1071 HOH HOH O . 
VB 3 HOH 472 1072 1072 HOH HOH O . 
VB 3 HOH 473 1073 1073 HOH HOH O . 
VB 3 HOH 474 1074 1074 HOH HOH O . 
VB 3 HOH 475 1075 1075 HOH HOH O . 
VB 3 HOH 476 1076 1076 HOH HOH O . 
VB 3 HOH 477 1077 1077 HOH HOH O . 
VB 3 HOH 478 1078 1078 HOH HOH O . 
VB 3 HOH 479 1079 1079 HOH HOH O . 
VB 3 HOH 480 1080 1080 HOH HOH O . 
VB 3 HOH 481 1081 1081 HOH HOH O . 
VB 3 HOH 482 1082 1082 HOH HOH O . 
VB 3 HOH 483 1083 1083 HOH HOH O . 
VB 3 HOH 484 1084 1084 HOH HOH O . 
VB 3 HOH 485 1085 1085 HOH HOH O . 
VB 3 HOH 486 1086 1086 HOH HOH O . 
VB 3 HOH 487 1087 1087 HOH HOH O . 
VB 3 HOH 488 1088 1088 HOH HOH O . 
VB 3 HOH 489 1089 1089 HOH HOH O . 
VB 3 HOH 490 1090 1090 HOH HOH O . 
VB 3 HOH 491 1091 1091 HOH HOH O . 
VB 3 HOH 492 1092 1092 HOH HOH O . 
VB 3 HOH 493 1093 1093 HOH HOH O . 
VB 3 HOH 494 1094 1094 HOH HOH O . 
VB 3 HOH 495 1095 1095 HOH HOH O . 
VB 3 HOH 496 1096 1096 HOH HOH O . 
VB 3 HOH 497 1097 1097 HOH HOH O . 
VB 3 HOH 498 1098 1098 HOH HOH O . 
VB 3 HOH 499 1099 1099 HOH HOH O . 
VB 3 HOH 500 1100 1100 HOH HOH O . 
VB 3 HOH 501 1101 1101 HOH HOH O . 
VB 3 HOH 502 1102 1102 HOH HOH O . 
VB 3 HOH 503 1103 1103 HOH HOH O . 
VB 3 HOH 504 1104 1104 HOH HOH O . 
VB 3 HOH 505 1105 1105 HOH HOH O . 
VB 3 HOH 506 1106 1106 HOH HOH O . 
VB 3 HOH 507 1107 1107 HOH HOH O . 
VB 3 HOH 508 1108 1108 HOH HOH O . 
VB 3 HOH 509 1109 1109 HOH HOH O . 
VB 3 HOH 510 1110 1110 HOH HOH O . 
VB 3 HOH 511 1111 1111 HOH HOH O . 
VB 3 HOH 512 1112 1112 HOH HOH O . 
VB 3 HOH 513 1113 1113 HOH HOH O . 
VB 3 HOH 514 1114 1114 HOH HOH O . 
VB 3 HOH 515 1115 1115 HOH HOH O . 
VB 3 HOH 516 1116 1116 HOH HOH O . 
VB 3 HOH 517 1117 1117 HOH HOH O . 
VB 3 HOH 518 1118 1118 HOH HOH O . 
VB 3 HOH 519 1119 1119 HOH HOH O . 
VB 3 HOH 520 1120 1120 HOH HOH O . 
VB 3 HOH 521 1121 1121 HOH HOH O . 
VB 3 HOH 522 1122 1122 HOH HOH O . 
VB 3 HOH 523 1123 1123 HOH HOH O . 
VB 3 HOH 524 1124 1124 HOH HOH O . 
VB 3 HOH 525 1125 1125 HOH HOH O . 
VB 3 HOH 526 1126 1126 HOH HOH O . 
VB 3 HOH 527 1127 1127 HOH HOH O . 
VB 3 HOH 528 1128 1128 HOH HOH O . 
VB 3 HOH 529 1129 1129 HOH HOH O . 
VB 3 HOH 530 1130 1130 HOH HOH O . 
VB 3 HOH 531 1131 1131 HOH HOH O . 
VB 3 HOH 532 1132 1132 HOH HOH O . 
VB 3 HOH 533 1133 1133 HOH HOH O . 
VB 3 HOH 534 1134 1134 HOH HOH O . 
VB 3 HOH 535 1135 1135 HOH HOH O . 
VB 3 HOH 536 1136 1136 HOH HOH O . 
VB 3 HOH 537 1137 1137 HOH HOH O . 
VB 3 HOH 538 1138 1138 HOH HOH O . 
VB 3 HOH 539 1139 1139 HOH HOH O . 
VB 3 HOH 540 1140 1140 HOH HOH O . 
VB 3 HOH 541 1141 1141 HOH HOH O . 
VB 3 HOH 542 1142 1142 HOH HOH O . 
VB 3 HOH 543 1143 1143 HOH HOH O . 
VB 3 HOH 544 1144 1144 HOH HOH O . 
VB 3 HOH 545 1145 1145 HOH HOH O . 
VB 3 HOH 546 1146 1146 HOH HOH O . 
VB 3 HOH 547 1147 1147 HOH HOH O . 
VB 3 HOH 548 1148 1148 HOH HOH O . 
VB 3 HOH 549 1149 1149 HOH HOH O . 
VB 3 HOH 550 1150 1150 HOH HOH O . 
VB 3 HOH 551 1151 1151 HOH HOH O . 
VB 3 HOH 552 1152 1152 HOH HOH O . 
VB 3 HOH 553 1153 1153 HOH HOH O . 
VB 3 HOH 554 1154 1154 HOH HOH O . 
VB 3 HOH 555 1155 1155 HOH HOH O . 
VB 3 HOH 556 1156 1156 HOH HOH O . 
VB 3 HOH 557 1157 1157 HOH HOH O . 
VB 3 HOH 558 1158 1158 HOH HOH O . 
VB 3 HOH 559 1159 1159 HOH HOH O . 
VB 3 HOH 560 1160 1160 HOH HOH O . 
VB 3 HOH 561 1161 1161 HOH HOH O . 
VB 3 HOH 562 1162 1162 HOH HOH O . 
VB 3 HOH 563 1163 1163 HOH HOH O . 
VB 3 HOH 564 1164 1164 HOH HOH O . 
VB 3 HOH 565 1165 1165 HOH HOH O . 
VB 3 HOH 566 1166 1166 HOH HOH O . 
VB 3 HOH 567 1167 1167 HOH HOH O . 
VB 3 HOH 568 1168 1168 HOH HOH O . 
VB 3 HOH 569 1169 1169 HOH HOH O . 
VB 3 HOH 570 1170 1170 HOH HOH O . 
VB 3 HOH 571 1171 1171 HOH HOH O . 
VB 3 HOH 572 1172 1172 HOH HOH O . 
VB 3 HOH 573 1173 1173 HOH HOH O . 
VB 3 HOH 574 1174 1174 HOH HOH O . 
VB 3 HOH 575 1175 1175 HOH HOH O . 
VB 3 HOH 576 1176 1176 HOH HOH O . 
VB 3 HOH 577 1177 1177 HOH HOH O . 
VB 3 HOH 578 1178 1178 HOH HOH O . 
VB 3 HOH 579 1179 1179 HOH HOH O . 
VB 3 HOH 580 1180 1180 HOH HOH O . 
VB 3 HOH 581 1181 1181 HOH HOH O . 
VB 3 HOH 582 1182 1182 HOH HOH O . 
VB 3 HOH 583 1183 1183 HOH HOH O . 
VB 3 HOH 584 1184 1184 HOH HOH O . 
VB 3 HOH 585 1185 1185 HOH HOH O . 
VB 3 HOH 586 1186 1186 HOH HOH O . 
VB 3 HOH 587 1187 1187 HOH HOH O . 
VB 3 HOH 588 1188 1188 HOH HOH O . 
VB 3 HOH 589 1189 1189 HOH HOH O . 
VB 3 HOH 590 1190 1190 HOH HOH O . 
VB 3 HOH 591 1191 1191 HOH HOH O . 
VB 3 HOH 592 1192 1192 HOH HOH O . 
VB 3 HOH 593 1193 1193 HOH HOH O . 
VB 3 HOH 594 1194 1194 HOH HOH O . 
VB 3 HOH 595 1195 1195 HOH HOH O . 
VB 3 HOH 596 1196 1196 HOH HOH O . 
VB 3 HOH 597 1197 1197 HOH HOH O . 
VB 3 HOH 598 1198 1198 HOH HOH O . 
VB 3 HOH 599 1199 1199 HOH HOH O . 
VB 3 HOH 600 1200 1200 HOH HOH O . 
VB 3 HOH 601 1201 1201 HOH HOH O . 
VB 3 HOH 602 1202 1202 HOH HOH O . 
VB 3 HOH 603 1203 1203 HOH HOH O . 
WB 3 HOH 1   601  601  HOH HOH P . 
WB 3 HOH 2   602  602  HOH HOH P . 
WB 3 HOH 3   603  603  HOH HOH P . 
WB 3 HOH 4   604  604  HOH HOH P . 
WB 3 HOH 5   605  605  HOH HOH P . 
WB 3 HOH 6   606  606  HOH HOH P . 
WB 3 HOH 7   607  607  HOH HOH P . 
WB 3 HOH 8   608  608  HOH HOH P . 
WB 3 HOH 9   609  609  HOH HOH P . 
WB 3 HOH 10  610  610  HOH HOH P . 
WB 3 HOH 11  611  611  HOH HOH P . 
WB 3 HOH 12  612  612  HOH HOH P . 
WB 3 HOH 13  613  613  HOH HOH P . 
WB 3 HOH 14  614  614  HOH HOH P . 
WB 3 HOH 15  615  615  HOH HOH P . 
WB 3 HOH 16  616  616  HOH HOH P . 
WB 3 HOH 17  617  617  HOH HOH P . 
WB 3 HOH 18  618  618  HOH HOH P . 
WB 3 HOH 19  619  619  HOH HOH P . 
WB 3 HOH 20  620  620  HOH HOH P . 
WB 3 HOH 21  621  621  HOH HOH P . 
WB 3 HOH 22  622  622  HOH HOH P . 
WB 3 HOH 23  623  623  HOH HOH P . 
WB 3 HOH 24  624  624  HOH HOH P . 
WB 3 HOH 25  625  625  HOH HOH P . 
WB 3 HOH 26  626  626  HOH HOH P . 
WB 3 HOH 27  627  627  HOH HOH P . 
WB 3 HOH 28  628  628  HOH HOH P . 
WB 3 HOH 29  629  629  HOH HOH P . 
WB 3 HOH 30  630  630  HOH HOH P . 
WB 3 HOH 31  631  631  HOH HOH P . 
WB 3 HOH 32  632  632  HOH HOH P . 
WB 3 HOH 33  633  633  HOH HOH P . 
WB 3 HOH 34  634  634  HOH HOH P . 
WB 3 HOH 35  635  635  HOH HOH P . 
WB 3 HOH 36  636  636  HOH HOH P . 
WB 3 HOH 37  637  637  HOH HOH P . 
WB 3 HOH 38  638  638  HOH HOH P . 
WB 3 HOH 39  639  639  HOH HOH P . 
WB 3 HOH 40  640  640  HOH HOH P . 
WB 3 HOH 41  641  641  HOH HOH P . 
WB 3 HOH 42  642  642  HOH HOH P . 
WB 3 HOH 43  643  643  HOH HOH P . 
WB 3 HOH 44  644  644  HOH HOH P . 
WB 3 HOH 45  645  645  HOH HOH P . 
WB 3 HOH 46  646  646  HOH HOH P . 
WB 3 HOH 47  647  647  HOH HOH P . 
WB 3 HOH 48  648  648  HOH HOH P . 
WB 3 HOH 49  649  649  HOH HOH P . 
WB 3 HOH 50  650  650  HOH HOH P . 
WB 3 HOH 51  651  651  HOH HOH P . 
WB 3 HOH 52  652  652  HOH HOH P . 
WB 3 HOH 53  653  653  HOH HOH P . 
WB 3 HOH 54  654  654  HOH HOH P . 
WB 3 HOH 55  655  655  HOH HOH P . 
WB 3 HOH 56  656  656  HOH HOH P . 
WB 3 HOH 57  657  657  HOH HOH P . 
WB 3 HOH 58  658  658  HOH HOH P . 
WB 3 HOH 59  659  659  HOH HOH P . 
WB 3 HOH 60  660  660  HOH HOH P . 
WB 3 HOH 61  661  661  HOH HOH P . 
WB 3 HOH 62  662  662  HOH HOH P . 
WB 3 HOH 63  663  663  HOH HOH P . 
WB 3 HOH 64  664  664  HOH HOH P . 
WB 3 HOH 65  665  665  HOH HOH P . 
WB 3 HOH 66  666  666  HOH HOH P . 
WB 3 HOH 67  667  667  HOH HOH P . 
WB 3 HOH 68  668  668  HOH HOH P . 
WB 3 HOH 69  669  669  HOH HOH P . 
WB 3 HOH 70  670  670  HOH HOH P . 
WB 3 HOH 71  671  671  HOH HOH P . 
WB 3 HOH 72  672  672  HOH HOH P . 
WB 3 HOH 73  673  673  HOH HOH P . 
WB 3 HOH 74  674  674  HOH HOH P . 
WB 3 HOH 75  675  675  HOH HOH P . 
WB 3 HOH 76  676  676  HOH HOH P . 
WB 3 HOH 77  677  677  HOH HOH P . 
WB 3 HOH 78  678  678  HOH HOH P . 
WB 3 HOH 79  679  679  HOH HOH P . 
WB 3 HOH 80  680  680  HOH HOH P . 
WB 3 HOH 81  681  681  HOH HOH P . 
WB 3 HOH 82  682  682  HOH HOH P . 
WB 3 HOH 83  683  683  HOH HOH P . 
WB 3 HOH 84  684  684  HOH HOH P . 
WB 3 HOH 85  685  685  HOH HOH P . 
WB 3 HOH 86  686  686  HOH HOH P . 
WB 3 HOH 87  687  687  HOH HOH P . 
WB 3 HOH 88  688  688  HOH HOH P . 
WB 3 HOH 89  689  689  HOH HOH P . 
WB 3 HOH 90  690  690  HOH HOH P . 
WB 3 HOH 91  691  691  HOH HOH P . 
WB 3 HOH 92  692  692  HOH HOH P . 
WB 3 HOH 93  693  693  HOH HOH P . 
WB 3 HOH 94  694  694  HOH HOH P . 
WB 3 HOH 95  695  695  HOH HOH P . 
WB 3 HOH 96  696  696  HOH HOH P . 
WB 3 HOH 97  697  697  HOH HOH P . 
WB 3 HOH 98  698  698  HOH HOH P . 
WB 3 HOH 99  699  699  HOH HOH P . 
WB 3 HOH 100 700  700  HOH HOH P . 
WB 3 HOH 101 701  701  HOH HOH P . 
WB 3 HOH 102 702  702  HOH HOH P . 
WB 3 HOH 103 703  703  HOH HOH P . 
WB 3 HOH 104 704  704  HOH HOH P . 
WB 3 HOH 105 705  705  HOH HOH P . 
WB 3 HOH 106 706  706  HOH HOH P . 
WB 3 HOH 107 707  707  HOH HOH P . 
WB 3 HOH 108 708  708  HOH HOH P . 
WB 3 HOH 109 709  709  HOH HOH P . 
WB 3 HOH 110 710  710  HOH HOH P . 
WB 3 HOH 111 711  711  HOH HOH P . 
WB 3 HOH 112 712  712  HOH HOH P . 
WB 3 HOH 113 713  713  HOH HOH P . 
WB 3 HOH 114 714  714  HOH HOH P . 
WB 3 HOH 115 715  715  HOH HOH P . 
WB 3 HOH 116 716  716  HOH HOH P . 
WB 3 HOH 117 717  717  HOH HOH P . 
WB 3 HOH 118 718  718  HOH HOH P . 
WB 3 HOH 119 719  719  HOH HOH P . 
WB 3 HOH 120 720  720  HOH HOH P . 
WB 3 HOH 121 721  721  HOH HOH P . 
WB 3 HOH 122 722  722  HOH HOH P . 
WB 3 HOH 123 723  723  HOH HOH P . 
WB 3 HOH 124 724  724  HOH HOH P . 
WB 3 HOH 125 725  725  HOH HOH P . 
WB 3 HOH 126 726  726  HOH HOH P . 
WB 3 HOH 127 727  727  HOH HOH P . 
WB 3 HOH 128 728  729  HOH HOH P . 
WB 3 HOH 129 729  728  HOH HOH P . 
WB 3 HOH 130 730  730  HOH HOH P . 
WB 3 HOH 131 731  731  HOH HOH P . 
WB 3 HOH 132 732  732  HOH HOH P . 
WB 3 HOH 133 733  733  HOH HOH P . 
WB 3 HOH 134 734  734  HOH HOH P . 
WB 3 HOH 135 735  735  HOH HOH P . 
WB 3 HOH 136 736  736  HOH HOH P . 
WB 3 HOH 137 737  737  HOH HOH P . 
WB 3 HOH 138 738  738  HOH HOH P . 
WB 3 HOH 139 739  739  HOH HOH P . 
WB 3 HOH 140 740  740  HOH HOH P . 
WB 3 HOH 141 741  741  HOH HOH P . 
WB 3 HOH 142 742  742  HOH HOH P . 
WB 3 HOH 143 743  743  HOH HOH P . 
WB 3 HOH 144 744  744  HOH HOH P . 
WB 3 HOH 145 745  745  HOH HOH P . 
WB 3 HOH 146 746  746  HOH HOH P . 
WB 3 HOH 147 747  747  HOH HOH P . 
WB 3 HOH 148 748  748  HOH HOH P . 
WB 3 HOH 149 749  749  HOH HOH P . 
WB 3 HOH 150 750  750  HOH HOH P . 
WB 3 HOH 151 751  751  HOH HOH P . 
WB 3 HOH 152 752  752  HOH HOH P . 
WB 3 HOH 153 753  753  HOH HOH P . 
WB 3 HOH 154 754  754  HOH HOH P . 
WB 3 HOH 155 755  755  HOH HOH P . 
WB 3 HOH 156 756  756  HOH HOH P . 
WB 3 HOH 157 757  757  HOH HOH P . 
WB 3 HOH 158 758  758  HOH HOH P . 
WB 3 HOH 159 759  759  HOH HOH P . 
WB 3 HOH 160 760  760  HOH HOH P . 
WB 3 HOH 161 761  761  HOH HOH P . 
WB 3 HOH 162 762  762  HOH HOH P . 
WB 3 HOH 163 763  763  HOH HOH P . 
WB 3 HOH 164 764  764  HOH HOH P . 
WB 3 HOH 165 765  765  HOH HOH P . 
WB 3 HOH 166 766  766  HOH HOH P . 
WB 3 HOH 167 767  767  HOH HOH P . 
WB 3 HOH 168 768  768  HOH HOH P . 
WB 3 HOH 169 769  769  HOH HOH P . 
WB 3 HOH 170 770  770  HOH HOH P . 
WB 3 HOH 171 771  771  HOH HOH P . 
WB 3 HOH 172 772  772  HOH HOH P . 
WB 3 HOH 173 773  773  HOH HOH P . 
WB 3 HOH 174 774  774  HOH HOH P . 
WB 3 HOH 175 775  775  HOH HOH P . 
WB 3 HOH 176 776  776  HOH HOH P . 
WB 3 HOH 177 777  777  HOH HOH P . 
WB 3 HOH 178 778  778  HOH HOH P . 
WB 3 HOH 179 779  779  HOH HOH P . 
WB 3 HOH 180 780  780  HOH HOH P . 
WB 3 HOH 181 781  781  HOH HOH P . 
WB 3 HOH 182 782  782  HOH HOH P . 
WB 3 HOH 183 783  783  HOH HOH P . 
WB 3 HOH 184 784  784  HOH HOH P . 
WB 3 HOH 185 785  785  HOH HOH P . 
WB 3 HOH 186 786  786  HOH HOH P . 
WB 3 HOH 187 787  787  HOH HOH P . 
WB 3 HOH 188 788  788  HOH HOH P . 
WB 3 HOH 189 789  789  HOH HOH P . 
WB 3 HOH 190 790  790  HOH HOH P . 
WB 3 HOH 191 791  791  HOH HOH P . 
WB 3 HOH 192 792  792  HOH HOH P . 
WB 3 HOH 193 793  793  HOH HOH P . 
WB 3 HOH 194 794  794  HOH HOH P . 
WB 3 HOH 195 795  795  HOH HOH P . 
WB 3 HOH 196 796  796  HOH HOH P . 
WB 3 HOH 197 797  797  HOH HOH P . 
WB 3 HOH 198 798  798  HOH HOH P . 
WB 3 HOH 199 799  799  HOH HOH P . 
WB 3 HOH 200 800  800  HOH HOH P . 
WB 3 HOH 201 801  801  HOH HOH P . 
WB 3 HOH 202 802  802  HOH HOH P . 
WB 3 HOH 203 803  803  HOH HOH P . 
WB 3 HOH 204 804  804  HOH HOH P . 
WB 3 HOH 205 805  805  HOH HOH P . 
WB 3 HOH 206 806  806  HOH HOH P . 
WB 3 HOH 207 807  807  HOH HOH P . 
WB 3 HOH 208 808  808  HOH HOH P . 
WB 3 HOH 209 809  809  HOH HOH P . 
WB 3 HOH 210 810  810  HOH HOH P . 
WB 3 HOH 211 811  811  HOH HOH P . 
WB 3 HOH 212 812  812  HOH HOH P . 
WB 3 HOH 213 813  813  HOH HOH P . 
WB 3 HOH 214 814  814  HOH HOH P . 
WB 3 HOH 215 815  815  HOH HOH P . 
WB 3 HOH 216 816  816  HOH HOH P . 
WB 3 HOH 217 817  817  HOH HOH P . 
WB 3 HOH 218 818  818  HOH HOH P . 
WB 3 HOH 219 819  819  HOH HOH P . 
WB 3 HOH 220 820  820  HOH HOH P . 
WB 3 HOH 221 821  821  HOH HOH P . 
WB 3 HOH 222 822  822  HOH HOH P . 
WB 3 HOH 223 823  823  HOH HOH P . 
WB 3 HOH 224 824  824  HOH HOH P . 
WB 3 HOH 225 825  825  HOH HOH P . 
WB 3 HOH 226 826  826  HOH HOH P . 
WB 3 HOH 227 827  827  HOH HOH P . 
WB 3 HOH 228 828  828  HOH HOH P . 
WB 3 HOH 229 829  829  HOH HOH P . 
WB 3 HOH 230 830  830  HOH HOH P . 
WB 3 HOH 231 831  831  HOH HOH P . 
WB 3 HOH 232 832  832  HOH HOH P . 
WB 3 HOH 233 833  833  HOH HOH P . 
WB 3 HOH 234 834  834  HOH HOH P . 
WB 3 HOH 235 835  835  HOH HOH P . 
WB 3 HOH 236 836  836  HOH HOH P . 
WB 3 HOH 237 837  837  HOH HOH P . 
WB 3 HOH 238 838  838  HOH HOH P . 
WB 3 HOH 239 839  839  HOH HOH P . 
WB 3 HOH 240 840  840  HOH HOH P . 
WB 3 HOH 241 841  841  HOH HOH P . 
WB 3 HOH 242 842  842  HOH HOH P . 
WB 3 HOH 243 843  843  HOH HOH P . 
WB 3 HOH 244 844  844  HOH HOH P . 
WB 3 HOH 245 845  845  HOH HOH P . 
WB 3 HOH 246 846  846  HOH HOH P . 
WB 3 HOH 247 847  847  HOH HOH P . 
WB 3 HOH 248 848  848  HOH HOH P . 
WB 3 HOH 249 849  849  HOH HOH P . 
WB 3 HOH 250 850  850  HOH HOH P . 
WB 3 HOH 251 851  851  HOH HOH P . 
WB 3 HOH 252 852  852  HOH HOH P . 
WB 3 HOH 253 853  853  HOH HOH P . 
WB 3 HOH 254 854  854  HOH HOH P . 
WB 3 HOH 255 855  855  HOH HOH P . 
WB 3 HOH 256 856  856  HOH HOH P . 
WB 3 HOH 257 857  857  HOH HOH P . 
WB 3 HOH 258 858  858  HOH HOH P . 
WB 3 HOH 259 859  859  HOH HOH P . 
WB 3 HOH 260 860  860  HOH HOH P . 
WB 3 HOH 261 861  861  HOH HOH P . 
WB 3 HOH 262 862  862  HOH HOH P . 
WB 3 HOH 263 863  863  HOH HOH P . 
WB 3 HOH 264 864  864  HOH HOH P . 
WB 3 HOH 265 865  865  HOH HOH P . 
WB 3 HOH 266 866  866  HOH HOH P . 
WB 3 HOH 267 867  867  HOH HOH P . 
WB 3 HOH 268 868  868  HOH HOH P . 
WB 3 HOH 269 869  869  HOH HOH P . 
WB 3 HOH 270 870  870  HOH HOH P . 
WB 3 HOH 271 871  871  HOH HOH P . 
WB 3 HOH 272 872  872  HOH HOH P . 
WB 3 HOH 273 873  873  HOH HOH P . 
WB 3 HOH 274 874  874  HOH HOH P . 
WB 3 HOH 275 875  875  HOH HOH P . 
WB 3 HOH 276 876  876  HOH HOH P . 
WB 3 HOH 277 877  877  HOH HOH P . 
WB 3 HOH 278 878  878  HOH HOH P . 
WB 3 HOH 279 879  879  HOH HOH P . 
WB 3 HOH 280 880  880  HOH HOH P . 
WB 3 HOH 281 881  881  HOH HOH P . 
WB 3 HOH 282 882  882  HOH HOH P . 
WB 3 HOH 283 883  883  HOH HOH P . 
WB 3 HOH 284 884  884  HOH HOH P . 
WB 3 HOH 285 885  885  HOH HOH P . 
WB 3 HOH 286 886  886  HOH HOH P . 
WB 3 HOH 287 887  887  HOH HOH P . 
WB 3 HOH 288 888  888  HOH HOH P . 
WB 3 HOH 289 889  889  HOH HOH P . 
WB 3 HOH 290 890  890  HOH HOH P . 
WB 3 HOH 291 891  891  HOH HOH P . 
WB 3 HOH 292 892  892  HOH HOH P . 
WB 3 HOH 293 893  893  HOH HOH P . 
WB 3 HOH 294 894  894  HOH HOH P . 
WB 3 HOH 295 895  895  HOH HOH P . 
WB 3 HOH 296 896  896  HOH HOH P . 
WB 3 HOH 297 897  897  HOH HOH P . 
WB 3 HOH 298 898  898  HOH HOH P . 
WB 3 HOH 299 899  899  HOH HOH P . 
WB 3 HOH 300 900  900  HOH HOH P . 
WB 3 HOH 301 901  901  HOH HOH P . 
WB 3 HOH 302 902  902  HOH HOH P . 
WB 3 HOH 303 903  903  HOH HOH P . 
WB 3 HOH 304 904  904  HOH HOH P . 
WB 3 HOH 305 905  905  HOH HOH P . 
WB 3 HOH 306 906  906  HOH HOH P . 
WB 3 HOH 307 907  907  HOH HOH P . 
WB 3 HOH 308 908  908  HOH HOH P . 
WB 3 HOH 309 909  909  HOH HOH P . 
WB 3 HOH 310 910  910  HOH HOH P . 
WB 3 HOH 311 911  911  HOH HOH P . 
WB 3 HOH 312 912  912  HOH HOH P . 
WB 3 HOH 313 913  913  HOH HOH P . 
WB 3 HOH 314 914  914  HOH HOH P . 
WB 3 HOH 315 915  915  HOH HOH P . 
WB 3 HOH 316 916  916  HOH HOH P . 
WB 3 HOH 317 917  917  HOH HOH P . 
WB 3 HOH 318 918  918  HOH HOH P . 
WB 3 HOH 319 919  919  HOH HOH P . 
WB 3 HOH 320 920  920  HOH HOH P . 
WB 3 HOH 321 921  921  HOH HOH P . 
WB 3 HOH 322 922  922  HOH HOH P . 
WB 3 HOH 323 923  923  HOH HOH P . 
WB 3 HOH 324 924  924  HOH HOH P . 
WB 3 HOH 325 925  925  HOH HOH P . 
WB 3 HOH 326 926  926  HOH HOH P . 
WB 3 HOH 327 927  927  HOH HOH P . 
WB 3 HOH 328 928  928  HOH HOH P . 
WB 3 HOH 329 929  929  HOH HOH P . 
WB 3 HOH 330 930  930  HOH HOH P . 
WB 3 HOH 331 931  931  HOH HOH P . 
WB 3 HOH 332 932  932  HOH HOH P . 
WB 3 HOH 333 933  933  HOH HOH P . 
WB 3 HOH 334 934  934  HOH HOH P . 
WB 3 HOH 335 935  935  HOH HOH P . 
WB 3 HOH 336 936  936  HOH HOH P . 
WB 3 HOH 337 937  937  HOH HOH P . 
WB 3 HOH 338 938  938  HOH HOH P . 
WB 3 HOH 339 939  939  HOH HOH P . 
WB 3 HOH 340 940  940  HOH HOH P . 
WB 3 HOH 341 941  941  HOH HOH P . 
WB 3 HOH 342 942  942  HOH HOH P . 
WB 3 HOH 343 943  943  HOH HOH P . 
WB 3 HOH 344 944  944  HOH HOH P . 
WB 3 HOH 345 945  945  HOH HOH P . 
WB 3 HOH 346 946  946  HOH HOH P . 
WB 3 HOH 347 947  947  HOH HOH P . 
WB 3 HOH 348 948  948  HOH HOH P . 
WB 3 HOH 349 949  949  HOH HOH P . 
WB 3 HOH 350 950  950  HOH HOH P . 
WB 3 HOH 351 951  951  HOH HOH P . 
WB 3 HOH 352 952  952  HOH HOH P . 
WB 3 HOH 353 953  953  HOH HOH P . 
WB 3 HOH 354 954  954  HOH HOH P . 
WB 3 HOH 355 955  955  HOH HOH P . 
WB 3 HOH 356 956  956  HOH HOH P . 
WB 3 HOH 357 957  957  HOH HOH P . 
WB 3 HOH 358 958  958  HOH HOH P . 
WB 3 HOH 359 959  959  HOH HOH P . 
WB 3 HOH 360 960  960  HOH HOH P . 
WB 3 HOH 361 961  961  HOH HOH P . 
WB 3 HOH 362 962  962  HOH HOH P . 
WB 3 HOH 363 963  963  HOH HOH P . 
WB 3 HOH 364 964  964  HOH HOH P . 
WB 3 HOH 365 965  965  HOH HOH P . 
WB 3 HOH 366 966  966  HOH HOH P . 
WB 3 HOH 367 967  967  HOH HOH P . 
WB 3 HOH 368 968  968  HOH HOH P . 
WB 3 HOH 369 969  969  HOH HOH P . 
WB 3 HOH 370 970  970  HOH HOH P . 
WB 3 HOH 371 971  971  HOH HOH P . 
WB 3 HOH 372 972  972  HOH HOH P . 
WB 3 HOH 373 973  973  HOH HOH P . 
WB 3 HOH 374 974  974  HOH HOH P . 
WB 3 HOH 375 975  975  HOH HOH P . 
WB 3 HOH 376 976  976  HOH HOH P . 
WB 3 HOH 377 977  977  HOH HOH P . 
WB 3 HOH 378 978  978  HOH HOH P . 
WB 3 HOH 379 979  979  HOH HOH P . 
WB 3 HOH 380 980  980  HOH HOH P . 
WB 3 HOH 381 981  981  HOH HOH P . 
WB 3 HOH 382 982  982  HOH HOH P . 
WB 3 HOH 383 983  983  HOH HOH P . 
WB 3 HOH 384 984  984  HOH HOH P . 
WB 3 HOH 385 985  985  HOH HOH P . 
WB 3 HOH 386 986  986  HOH HOH P . 
WB 3 HOH 387 987  987  HOH HOH P . 
WB 3 HOH 388 988  988  HOH HOH P . 
WB 3 HOH 389 989  989  HOH HOH P . 
WB 3 HOH 390 990  990  HOH HOH P . 
WB 3 HOH 391 991  991  HOH HOH P . 
WB 3 HOH 392 992  992  HOH HOH P . 
WB 3 HOH 393 993  993  HOH HOH P . 
WB 3 HOH 394 994  994  HOH HOH P . 
WB 3 HOH 395 995  995  HOH HOH P . 
WB 3 HOH 396 996  996  HOH HOH P . 
WB 3 HOH 397 997  997  HOH HOH P . 
WB 3 HOH 398 998  998  HOH HOH P . 
WB 3 HOH 399 999  999  HOH HOH P . 
WB 3 HOH 400 1000 1000 HOH HOH P . 
WB 3 HOH 401 1001 1001 HOH HOH P . 
WB 3 HOH 402 1002 1002 HOH HOH P . 
WB 3 HOH 403 1003 1003 HOH HOH P . 
WB 3 HOH 404 1004 1004 HOH HOH P . 
WB 3 HOH 405 1005 1005 HOH HOH P . 
WB 3 HOH 406 1006 1006 HOH HOH P . 
WB 3 HOH 407 1007 1007 HOH HOH P . 
WB 3 HOH 408 1008 1008 HOH HOH P . 
WB 3 HOH 409 1009 1009 HOH HOH P . 
WB 3 HOH 410 1010 1010 HOH HOH P . 
WB 3 HOH 411 1011 1011 HOH HOH P . 
WB 3 HOH 412 1012 1012 HOH HOH P . 
WB 3 HOH 413 1013 1013 HOH HOH P . 
WB 3 HOH 414 1014 1014 HOH HOH P . 
WB 3 HOH 415 1015 1015 HOH HOH P . 
WB 3 HOH 416 1016 1016 HOH HOH P . 
WB 3 HOH 417 1017 1017 HOH HOH P . 
WB 3 HOH 418 1018 1018 HOH HOH P . 
WB 3 HOH 419 1019 1019 HOH HOH P . 
WB 3 HOH 420 1020 1020 HOH HOH P . 
WB 3 HOH 421 1021 1021 HOH HOH P . 
WB 3 HOH 422 1022 1022 HOH HOH P . 
WB 3 HOH 423 1023 1023 HOH HOH P . 
WB 3 HOH 424 1024 1024 HOH HOH P . 
WB 3 HOH 425 1025 1025 HOH HOH P . 
WB 3 HOH 426 1026 1026 HOH HOH P . 
WB 3 HOH 427 1027 1027 HOH HOH P . 
WB 3 HOH 428 1028 1028 HOH HOH P . 
WB 3 HOH 429 1029 1029 HOH HOH P . 
WB 3 HOH 430 1030 1030 HOH HOH P . 
WB 3 HOH 431 1031 1031 HOH HOH P . 
WB 3 HOH 432 1032 1032 HOH HOH P . 
WB 3 HOH 433 1033 1033 HOH HOH P . 
WB 3 HOH 434 1034 1034 HOH HOH P . 
WB 3 HOH 435 1035 1035 HOH HOH P . 
WB 3 HOH 436 1036 1036 HOH HOH P . 
WB 3 HOH 437 1037 1037 HOH HOH P . 
WB 3 HOH 438 1038 1038 HOH HOH P . 
WB 3 HOH 439 1039 1039 HOH HOH P . 
WB 3 HOH 440 1040 1040 HOH HOH P . 
WB 3 HOH 441 1041 1041 HOH HOH P . 
WB 3 HOH 442 1042 1042 HOH HOH P . 
WB 3 HOH 443 1043 1043 HOH HOH P . 
WB 3 HOH 444 1044 1044 HOH HOH P . 
WB 3 HOH 445 1045 1045 HOH HOH P . 
WB 3 HOH 446 1046 1046 HOH HOH P . 
WB 3 HOH 447 1047 1047 HOH HOH P . 
WB 3 HOH 448 1048 1048 HOH HOH P . 
WB 3 HOH 449 1049 1049 HOH HOH P . 
WB 3 HOH 450 1050 1050 HOH HOH P . 
WB 3 HOH 451 1051 1051 HOH HOH P . 
WB 3 HOH 452 1052 1052 HOH HOH P . 
WB 3 HOH 453 1053 1053 HOH HOH P . 
WB 3 HOH 454 1054 1054 HOH HOH P . 
WB 3 HOH 455 1055 1055 HOH HOH P . 
WB 3 HOH 456 1056 1056 HOH HOH P . 
WB 3 HOH 457 1057 1057 HOH HOH P . 
WB 3 HOH 458 1058 1058 HOH HOH P . 
WB 3 HOH 459 1059 1059 HOH HOH P . 
WB 3 HOH 460 1060 1060 HOH HOH P . 
WB 3 HOH 461 1061 1061 HOH HOH P . 
WB 3 HOH 462 1062 1062 HOH HOH P . 
WB 3 HOH 463 1063 1063 HOH HOH P . 
WB 3 HOH 464 1064 1064 HOH HOH P . 
WB 3 HOH 465 1065 1065 HOH HOH P . 
WB 3 HOH 466 1066 1066 HOH HOH P . 
WB 3 HOH 467 1067 1067 HOH HOH P . 
WB 3 HOH 468 1068 1068 HOH HOH P . 
WB 3 HOH 469 1069 1069 HOH HOH P . 
WB 3 HOH 470 1070 1070 HOH HOH P . 
WB 3 HOH 471 1071 1071 HOH HOH P . 
WB 3 HOH 472 1072 1072 HOH HOH P . 
WB 3 HOH 473 1073 1073 HOH HOH P . 
WB 3 HOH 474 1074 1074 HOH HOH P . 
WB 3 HOH 475 1075 1075 HOH HOH P . 
WB 3 HOH 476 1076 1076 HOH HOH P . 
WB 3 HOH 477 1077 1077 HOH HOH P . 
WB 3 HOH 478 1078 1078 HOH HOH P . 
WB 3 HOH 479 1079 1079 HOH HOH P . 
WB 3 HOH 480 1080 1080 HOH HOH P . 
WB 3 HOH 481 1081 1081 HOH HOH P . 
WB 3 HOH 482 1082 1082 HOH HOH P . 
WB 3 HOH 483 1083 1083 HOH HOH P . 
WB 3 HOH 484 1084 1084 HOH HOH P . 
WB 3 HOH 485 1085 1085 HOH HOH P . 
WB 3 HOH 486 1086 1086 HOH HOH P . 
WB 3 HOH 487 1087 1087 HOH HOH P . 
WB 3 HOH 488 1088 1088 HOH HOH P . 
WB 3 HOH 489 1089 1089 HOH HOH P . 
WB 3 HOH 490 1090 1090 HOH HOH P . 
WB 3 HOH 491 1091 1091 HOH HOH P . 
WB 3 HOH 492 1092 1092 HOH HOH P . 
WB 3 HOH 493 1093 1093 HOH HOH P . 
WB 3 HOH 494 1094 1094 HOH HOH P . 
WB 3 HOH 495 1095 1095 HOH HOH P . 
WB 3 HOH 496 1096 1096 HOH HOH P . 
WB 3 HOH 497 1097 1097 HOH HOH P . 
WB 3 HOH 498 1098 1098 HOH HOH P . 
WB 3 HOH 499 1099 1099 HOH HOH P . 
WB 3 HOH 500 1100 1100 HOH HOH P . 
WB 3 HOH 501 1101 1101 HOH HOH P . 
WB 3 HOH 502 1102 1102 HOH HOH P . 
WB 3 HOH 503 1103 1103 HOH HOH P . 
WB 3 HOH 504 1104 1104 HOH HOH P . 
WB 3 HOH 505 1105 1105 HOH HOH P . 
WB 3 HOH 506 1106 1106 HOH HOH P . 
WB 3 HOH 507 1107 1107 HOH HOH P . 
WB 3 HOH 508 1108 1108 HOH HOH P . 
WB 3 HOH 509 1109 1109 HOH HOH P . 
WB 3 HOH 510 1110 1110 HOH HOH P . 
WB 3 HOH 511 1111 1111 HOH HOH P . 
XB 3 HOH 1   601  601  HOH HOH Q . 
XB 3 HOH 2   602  602  HOH HOH Q . 
XB 3 HOH 3   603  603  HOH HOH Q . 
XB 3 HOH 4   604  604  HOH HOH Q . 
XB 3 HOH 5   605  605  HOH HOH Q . 
XB 3 HOH 6   606  606  HOH HOH Q . 
XB 3 HOH 7   607  607  HOH HOH Q . 
XB 3 HOH 8   608  608  HOH HOH Q . 
XB 3 HOH 9   609  609  HOH HOH Q . 
XB 3 HOH 10  610  610  HOH HOH Q . 
XB 3 HOH 11  611  611  HOH HOH Q . 
XB 3 HOH 12  612  612  HOH HOH Q . 
XB 3 HOH 13  613  613  HOH HOH Q . 
XB 3 HOH 14  614  614  HOH HOH Q . 
XB 3 HOH 15  615  615  HOH HOH Q . 
XB 3 HOH 16  616  616  HOH HOH Q . 
XB 3 HOH 17  617  617  HOH HOH Q . 
XB 3 HOH 18  618  618  HOH HOH Q . 
XB 3 HOH 19  619  619  HOH HOH Q . 
XB 3 HOH 20  620  620  HOH HOH Q . 
XB 3 HOH 21  621  621  HOH HOH Q . 
XB 3 HOH 22  622  622  HOH HOH Q . 
XB 3 HOH 23  623  623  HOH HOH Q . 
XB 3 HOH 24  624  624  HOH HOH Q . 
XB 3 HOH 25  625  625  HOH HOH Q . 
XB 3 HOH 26  626  626  HOH HOH Q . 
XB 3 HOH 27  627  627  HOH HOH Q . 
XB 3 HOH 28  628  628  HOH HOH Q . 
XB 3 HOH 29  629  629  HOH HOH Q . 
XB 3 HOH 30  630  630  HOH HOH Q . 
XB 3 HOH 31  631  631  HOH HOH Q . 
XB 3 HOH 32  632  632  HOH HOH Q . 
XB 3 HOH 33  633  633  HOH HOH Q . 
XB 3 HOH 34  634  634  HOH HOH Q . 
XB 3 HOH 35  635  635  HOH HOH Q . 
XB 3 HOH 36  636  636  HOH HOH Q . 
XB 3 HOH 37  637  637  HOH HOH Q . 
XB 3 HOH 38  638  638  HOH HOH Q . 
XB 3 HOH 39  639  639  HOH HOH Q . 
XB 3 HOH 40  640  640  HOH HOH Q . 
XB 3 HOH 41  641  641  HOH HOH Q . 
XB 3 HOH 42  642  642  HOH HOH Q . 
XB 3 HOH 43  643  643  HOH HOH Q . 
XB 3 HOH 44  644  644  HOH HOH Q . 
XB 3 HOH 45  645  645  HOH HOH Q . 
XB 3 HOH 46  646  646  HOH HOH Q . 
XB 3 HOH 47  647  647  HOH HOH Q . 
XB 3 HOH 48  648  648  HOH HOH Q . 
XB 3 HOH 49  649  649  HOH HOH Q . 
XB 3 HOH 50  650  650  HOH HOH Q . 
XB 3 HOH 51  651  651  HOH HOH Q . 
XB 3 HOH 52  652  652  HOH HOH Q . 
XB 3 HOH 53  653  653  HOH HOH Q . 
XB 3 HOH 54  654  654  HOH HOH Q . 
XB 3 HOH 55  655  655  HOH HOH Q . 
XB 3 HOH 56  656  656  HOH HOH Q . 
XB 3 HOH 57  657  657  HOH HOH Q . 
XB 3 HOH 58  658  658  HOH HOH Q . 
XB 3 HOH 59  659  659  HOH HOH Q . 
XB 3 HOH 60  660  660  HOH HOH Q . 
XB 3 HOH 61  661  661  HOH HOH Q . 
XB 3 HOH 62  662  662  HOH HOH Q . 
XB 3 HOH 63  663  663  HOH HOH Q . 
XB 3 HOH 64  664  664  HOH HOH Q . 
XB 3 HOH 65  665  665  HOH HOH Q . 
XB 3 HOH 66  666  666  HOH HOH Q . 
XB 3 HOH 67  667  667  HOH HOH Q . 
XB 3 HOH 68  668  668  HOH HOH Q . 
XB 3 HOH 69  669  669  HOH HOH Q . 
XB 3 HOH 70  670  670  HOH HOH Q . 
XB 3 HOH 71  671  671  HOH HOH Q . 
XB 3 HOH 72  672  672  HOH HOH Q . 
XB 3 HOH 73  673  673  HOH HOH Q . 
XB 3 HOH 74  674  674  HOH HOH Q . 
XB 3 HOH 75  675  675  HOH HOH Q . 
XB 3 HOH 76  676  676  HOH HOH Q . 
XB 3 HOH 77  677  677  HOH HOH Q . 
XB 3 HOH 78  678  678  HOH HOH Q . 
XB 3 HOH 79  679  679  HOH HOH Q . 
XB 3 HOH 80  680  680  HOH HOH Q . 
XB 3 HOH 81  681  681  HOH HOH Q . 
XB 3 HOH 82  682  682  HOH HOH Q . 
XB 3 HOH 83  683  683  HOH HOH Q . 
XB 3 HOH 84  684  684  HOH HOH Q . 
XB 3 HOH 85  685  685  HOH HOH Q . 
XB 3 HOH 86  686  686  HOH HOH Q . 
XB 3 HOH 87  687  687  HOH HOH Q . 
XB 3 HOH 88  688  688  HOH HOH Q . 
XB 3 HOH 89  689  689  HOH HOH Q . 
XB 3 HOH 90  690  690  HOH HOH Q . 
XB 3 HOH 91  691  691  HOH HOH Q . 
XB 3 HOH 92  692  692  HOH HOH Q . 
XB 3 HOH 93  693  693  HOH HOH Q . 
XB 3 HOH 94  694  694  HOH HOH Q . 
XB 3 HOH 95  695  695  HOH HOH Q . 
XB 3 HOH 96  696  696  HOH HOH Q . 
XB 3 HOH 97  697  697  HOH HOH Q . 
XB 3 HOH 98  698  698  HOH HOH Q . 
XB 3 HOH 99  699  699  HOH HOH Q . 
XB 3 HOH 100 700  700  HOH HOH Q . 
XB 3 HOH 101 701  701  HOH HOH Q . 
XB 3 HOH 102 702  702  HOH HOH Q . 
XB 3 HOH 103 703  703  HOH HOH Q . 
XB 3 HOH 104 704  704  HOH HOH Q . 
XB 3 HOH 105 705  705  HOH HOH Q . 
XB 3 HOH 106 706  706  HOH HOH Q . 
XB 3 HOH 107 707  707  HOH HOH Q . 
XB 3 HOH 108 708  708  HOH HOH Q . 
XB 3 HOH 109 709  709  HOH HOH Q . 
XB 3 HOH 110 710  710  HOH HOH Q . 
XB 3 HOH 111 711  711  HOH HOH Q . 
XB 3 HOH 112 712  712  HOH HOH Q . 
XB 3 HOH 113 713  713  HOH HOH Q . 
XB 3 HOH 114 714  714  HOH HOH Q . 
XB 3 HOH 115 715  715  HOH HOH Q . 
XB 3 HOH 116 716  716  HOH HOH Q . 
XB 3 HOH 117 717  717  HOH HOH Q . 
XB 3 HOH 118 718  718  HOH HOH Q . 
XB 3 HOH 119 719  719  HOH HOH Q . 
XB 3 HOH 120 720  720  HOH HOH Q . 
XB 3 HOH 121 721  721  HOH HOH Q . 
XB 3 HOH 122 722  722  HOH HOH Q . 
XB 3 HOH 123 723  723  HOH HOH Q . 
XB 3 HOH 124 724  724  HOH HOH Q . 
XB 3 HOH 125 725  725  HOH HOH Q . 
XB 3 HOH 126 726  726  HOH HOH Q . 
XB 3 HOH 127 727  727  HOH HOH Q . 
XB 3 HOH 128 728  728  HOH HOH Q . 
XB 3 HOH 129 729  729  HOH HOH Q . 
XB 3 HOH 130 730  730  HOH HOH Q . 
XB 3 HOH 131 731  731  HOH HOH Q . 
XB 3 HOH 132 732  732  HOH HOH Q . 
XB 3 HOH 133 733  733  HOH HOH Q . 
XB 3 HOH 134 734  734  HOH HOH Q . 
XB 3 HOH 135 735  735  HOH HOH Q . 
XB 3 HOH 136 736  736  HOH HOH Q . 
XB 3 HOH 137 737  737  HOH HOH Q . 
XB 3 HOH 138 738  738  HOH HOH Q . 
XB 3 HOH 139 739  739  HOH HOH Q . 
XB 3 HOH 140 740  740  HOH HOH Q . 
XB 3 HOH 141 741  741  HOH HOH Q . 
XB 3 HOH 142 742  742  HOH HOH Q . 
XB 3 HOH 143 743  743  HOH HOH Q . 
XB 3 HOH 144 744  744  HOH HOH Q . 
XB 3 HOH 145 745  745  HOH HOH Q . 
XB 3 HOH 146 746  746  HOH HOH Q . 
XB 3 HOH 147 747  747  HOH HOH Q . 
XB 3 HOH 148 748  748  HOH HOH Q . 
XB 3 HOH 149 749  749  HOH HOH Q . 
XB 3 HOH 150 750  750  HOH HOH Q . 
XB 3 HOH 151 751  751  HOH HOH Q . 
XB 3 HOH 152 752  752  HOH HOH Q . 
XB 3 HOH 153 753  753  HOH HOH Q . 
XB 3 HOH 154 754  754  HOH HOH Q . 
XB 3 HOH 155 755  755  HOH HOH Q . 
XB 3 HOH 156 756  756  HOH HOH Q . 
XB 3 HOH 157 757  757  HOH HOH Q . 
XB 3 HOH 158 758  758  HOH HOH Q . 
XB 3 HOH 159 759  759  HOH HOH Q . 
XB 3 HOH 160 760  760  HOH HOH Q . 
XB 3 HOH 161 761  761  HOH HOH Q . 
XB 3 HOH 162 762  762  HOH HOH Q . 
XB 3 HOH 163 763  763  HOH HOH Q . 
XB 3 HOH 164 764  764  HOH HOH Q . 
XB 3 HOH 165 765  765  HOH HOH Q . 
XB 3 HOH 166 766  766  HOH HOH Q . 
XB 3 HOH 167 767  767  HOH HOH Q . 
XB 3 HOH 168 768  768  HOH HOH Q . 
XB 3 HOH 169 769  769  HOH HOH Q . 
XB 3 HOH 170 770  770  HOH HOH Q . 
XB 3 HOH 171 771  771  HOH HOH Q . 
XB 3 HOH 172 772  772  HOH HOH Q . 
XB 3 HOH 173 773  773  HOH HOH Q . 
XB 3 HOH 174 774  774  HOH HOH Q . 
XB 3 HOH 175 775  775  HOH HOH Q . 
XB 3 HOH 176 776  776  HOH HOH Q . 
XB 3 HOH 177 777  777  HOH HOH Q . 
XB 3 HOH 178 778  778  HOH HOH Q . 
XB 3 HOH 179 779  779  HOH HOH Q . 
XB 3 HOH 180 780  780  HOH HOH Q . 
XB 3 HOH 181 781  781  HOH HOH Q . 
XB 3 HOH 182 782  782  HOH HOH Q . 
XB 3 HOH 183 783  783  HOH HOH Q . 
XB 3 HOH 184 784  784  HOH HOH Q . 
XB 3 HOH 185 785  785  HOH HOH Q . 
XB 3 HOH 186 786  786  HOH HOH Q . 
XB 3 HOH 187 787  787  HOH HOH Q . 
XB 3 HOH 188 788  788  HOH HOH Q . 
XB 3 HOH 189 789  789  HOH HOH Q . 
XB 3 HOH 190 790  790  HOH HOH Q . 
XB 3 HOH 191 791  791  HOH HOH Q . 
XB 3 HOH 192 792  792  HOH HOH Q . 
XB 3 HOH 193 793  793  HOH HOH Q . 
XB 3 HOH 194 794  794  HOH HOH Q . 
XB 3 HOH 195 795  795  HOH HOH Q . 
XB 3 HOH 196 796  796  HOH HOH Q . 
XB 3 HOH 197 797  797  HOH HOH Q . 
XB 3 HOH 198 798  798  HOH HOH Q . 
XB 3 HOH 199 799  799  HOH HOH Q . 
XB 3 HOH 200 800  800  HOH HOH Q . 
XB 3 HOH 201 801  801  HOH HOH Q . 
XB 3 HOH 202 802  802  HOH HOH Q . 
XB 3 HOH 203 803  803  HOH HOH Q . 
XB 3 HOH 204 804  804  HOH HOH Q . 
XB 3 HOH 205 805  805  HOH HOH Q . 
XB 3 HOH 206 806  806  HOH HOH Q . 
XB 3 HOH 207 807  807  HOH HOH Q . 
XB 3 HOH 208 808  808  HOH HOH Q . 
XB 3 HOH 209 809  809  HOH HOH Q . 
XB 3 HOH 210 810  810  HOH HOH Q . 
XB 3 HOH 211 811  811  HOH HOH Q . 
XB 3 HOH 212 812  812  HOH HOH Q . 
XB 3 HOH 213 813  813  HOH HOH Q . 
XB 3 HOH 214 814  814  HOH HOH Q . 
XB 3 HOH 215 815  815  HOH HOH Q . 
XB 3 HOH 216 816  816  HOH HOH Q . 
XB 3 HOH 217 817  817  HOH HOH Q . 
XB 3 HOH 218 818  818  HOH HOH Q . 
XB 3 HOH 219 819  819  HOH HOH Q . 
XB 3 HOH 220 820  820  HOH HOH Q . 
XB 3 HOH 221 821  821  HOH HOH Q . 
XB 3 HOH 222 822  822  HOH HOH Q . 
XB 3 HOH 223 823  823  HOH HOH Q . 
XB 3 HOH 224 824  824  HOH HOH Q . 
XB 3 HOH 225 825  825  HOH HOH Q . 
XB 3 HOH 226 826  826  HOH HOH Q . 
XB 3 HOH 227 827  827  HOH HOH Q . 
XB 3 HOH 228 828  828  HOH HOH Q . 
XB 3 HOH 229 829  829  HOH HOH Q . 
XB 3 HOH 230 830  830  HOH HOH Q . 
XB 3 HOH 231 831  831  HOH HOH Q . 
XB 3 HOH 232 832  832  HOH HOH Q . 
XB 3 HOH 233 833  833  HOH HOH Q . 
XB 3 HOH 234 834  834  HOH HOH Q . 
XB 3 HOH 235 835  835  HOH HOH Q . 
XB 3 HOH 236 836  836  HOH HOH Q . 
XB 3 HOH 237 837  837  HOH HOH Q . 
XB 3 HOH 238 838  838  HOH HOH Q . 
XB 3 HOH 239 839  839  HOH HOH Q . 
XB 3 HOH 240 840  840  HOH HOH Q . 
XB 3 HOH 241 841  841  HOH HOH Q . 
XB 3 HOH 242 842  842  HOH HOH Q . 
XB 3 HOH 243 843  843  HOH HOH Q . 
XB 3 HOH 244 844  844  HOH HOH Q . 
XB 3 HOH 245 845  845  HOH HOH Q . 
XB 3 HOH 246 846  846  HOH HOH Q . 
XB 3 HOH 247 847  847  HOH HOH Q . 
XB 3 HOH 248 848  848  HOH HOH Q . 
XB 3 HOH 249 849  849  HOH HOH Q . 
XB 3 HOH 250 850  850  HOH HOH Q . 
XB 3 HOH 251 851  851  HOH HOH Q . 
XB 3 HOH 252 852  852  HOH HOH Q . 
XB 3 HOH 253 853  853  HOH HOH Q . 
XB 3 HOH 254 854  854  HOH HOH Q . 
XB 3 HOH 255 855  855  HOH HOH Q . 
XB 3 HOH 256 856  856  HOH HOH Q . 
XB 3 HOH 257 857  857  HOH HOH Q . 
XB 3 HOH 258 858  858  HOH HOH Q . 
XB 3 HOH 259 859  859  HOH HOH Q . 
XB 3 HOH 260 860  860  HOH HOH Q . 
XB 3 HOH 261 861  861  HOH HOH Q . 
XB 3 HOH 262 862  862  HOH HOH Q . 
XB 3 HOH 263 863  863  HOH HOH Q . 
XB 3 HOH 264 864  864  HOH HOH Q . 
XB 3 HOH 265 865  865  HOH HOH Q . 
XB 3 HOH 266 866  866  HOH HOH Q . 
XB 3 HOH 267 867  867  HOH HOH Q . 
XB 3 HOH 268 868  868  HOH HOH Q . 
XB 3 HOH 269 869  869  HOH HOH Q . 
XB 3 HOH 270 870  870  HOH HOH Q . 
XB 3 HOH 271 871  871  HOH HOH Q . 
XB 3 HOH 272 872  872  HOH HOH Q . 
XB 3 HOH 273 873  873  HOH HOH Q . 
XB 3 HOH 274 874  874  HOH HOH Q . 
XB 3 HOH 275 875  875  HOH HOH Q . 
XB 3 HOH 276 876  876  HOH HOH Q . 
XB 3 HOH 277 877  877  HOH HOH Q . 
XB 3 HOH 278 878  878  HOH HOH Q . 
XB 3 HOH 279 879  879  HOH HOH Q . 
XB 3 HOH 280 880  880  HOH HOH Q . 
XB 3 HOH 281 881  881  HOH HOH Q . 
XB 3 HOH 282 882  882  HOH HOH Q . 
XB 3 HOH 283 883  883  HOH HOH Q . 
XB 3 HOH 284 884  884  HOH HOH Q . 
XB 3 HOH 285 885  885  HOH HOH Q . 
XB 3 HOH 286 886  886  HOH HOH Q . 
XB 3 HOH 287 887  887  HOH HOH Q . 
XB 3 HOH 288 888  888  HOH HOH Q . 
XB 3 HOH 289 889  889  HOH HOH Q . 
XB 3 HOH 290 890  890  HOH HOH Q . 
XB 3 HOH 291 891  891  HOH HOH Q . 
XB 3 HOH 292 892  892  HOH HOH Q . 
XB 3 HOH 293 893  893  HOH HOH Q . 
XB 3 HOH 294 894  894  HOH HOH Q . 
XB 3 HOH 295 895  895  HOH HOH Q . 
XB 3 HOH 296 896  896  HOH HOH Q . 
XB 3 HOH 297 897  897  HOH HOH Q . 
XB 3 HOH 298 898  898  HOH HOH Q . 
XB 3 HOH 299 899  899  HOH HOH Q . 
XB 3 HOH 300 900  900  HOH HOH Q . 
XB 3 HOH 301 901  901  HOH HOH Q . 
XB 3 HOH 302 902  902  HOH HOH Q . 
XB 3 HOH 303 903  903  HOH HOH Q . 
XB 3 HOH 304 904  904  HOH HOH Q . 
XB 3 HOH 305 905  905  HOH HOH Q . 
XB 3 HOH 306 906  906  HOH HOH Q . 
XB 3 HOH 307 907  907  HOH HOH Q . 
XB 3 HOH 308 908  908  HOH HOH Q . 
XB 3 HOH 309 909  909  HOH HOH Q . 
XB 3 HOH 310 910  910  HOH HOH Q . 
XB 3 HOH 311 911  911  HOH HOH Q . 
XB 3 HOH 312 912  912  HOH HOH Q . 
XB 3 HOH 313 913  913  HOH HOH Q . 
XB 3 HOH 314 914  914  HOH HOH Q . 
XB 3 HOH 315 915  915  HOH HOH Q . 
XB 3 HOH 316 916  916  HOH HOH Q . 
XB 3 HOH 317 917  917  HOH HOH Q . 
XB 3 HOH 318 918  918  HOH HOH Q . 
XB 3 HOH 319 919  919  HOH HOH Q . 
XB 3 HOH 320 920  920  HOH HOH Q . 
XB 3 HOH 321 921  921  HOH HOH Q . 
XB 3 HOH 322 922  922  HOH HOH Q . 
XB 3 HOH 323 923  923  HOH HOH Q . 
XB 3 HOH 324 924  924  HOH HOH Q . 
XB 3 HOH 325 925  925  HOH HOH Q . 
XB 3 HOH 326 926  926  HOH HOH Q . 
XB 3 HOH 327 927  927  HOH HOH Q . 
XB 3 HOH 328 928  928  HOH HOH Q . 
XB 3 HOH 329 929  929  HOH HOH Q . 
XB 3 HOH 330 930  930  HOH HOH Q . 
XB 3 HOH 331 931  931  HOH HOH Q . 
XB 3 HOH 332 932  932  HOH HOH Q . 
XB 3 HOH 333 933  933  HOH HOH Q . 
XB 3 HOH 334 934  934  HOH HOH Q . 
XB 3 HOH 335 935  935  HOH HOH Q . 
XB 3 HOH 336 936  936  HOH HOH Q . 
XB 3 HOH 337 937  937  HOH HOH Q . 
XB 3 HOH 338 938  938  HOH HOH Q . 
XB 3 HOH 339 939  939  HOH HOH Q . 
XB 3 HOH 340 940  940  HOH HOH Q . 
XB 3 HOH 341 941  941  HOH HOH Q . 
XB 3 HOH 342 942  942  HOH HOH Q . 
XB 3 HOH 343 943  943  HOH HOH Q . 
XB 3 HOH 344 944  944  HOH HOH Q . 
XB 3 HOH 345 945  945  HOH HOH Q . 
XB 3 HOH 346 946  946  HOH HOH Q . 
XB 3 HOH 347 947  947  HOH HOH Q . 
XB 3 HOH 348 948  948  HOH HOH Q . 
XB 3 HOH 349 949  949  HOH HOH Q . 
XB 3 HOH 350 950  950  HOH HOH Q . 
XB 3 HOH 351 951  951  HOH HOH Q . 
XB 3 HOH 352 952  952  HOH HOH Q . 
XB 3 HOH 353 953  953  HOH HOH Q . 
XB 3 HOH 354 954  954  HOH HOH Q . 
XB 3 HOH 355 955  955  HOH HOH Q . 
XB 3 HOH 356 956  956  HOH HOH Q . 
XB 3 HOH 357 957  957  HOH HOH Q . 
XB 3 HOH 358 958  958  HOH HOH Q . 
XB 3 HOH 359 959  959  HOH HOH Q . 
XB 3 HOH 360 960  960  HOH HOH Q . 
XB 3 HOH 361 961  961  HOH HOH Q . 
XB 3 HOH 362 962  962  HOH HOH Q . 
XB 3 HOH 363 963  963  HOH HOH Q . 
XB 3 HOH 364 964  964  HOH HOH Q . 
XB 3 HOH 365 965  965  HOH HOH Q . 
XB 3 HOH 366 966  966  HOH HOH Q . 
XB 3 HOH 367 967  967  HOH HOH Q . 
XB 3 HOH 368 968  968  HOH HOH Q . 
XB 3 HOH 369 969  969  HOH HOH Q . 
XB 3 HOH 370 970  970  HOH HOH Q . 
XB 3 HOH 371 971  971  HOH HOH Q . 
XB 3 HOH 372 972  972  HOH HOH Q . 
XB 3 HOH 373 973  973  HOH HOH Q . 
XB 3 HOH 374 974  974  HOH HOH Q . 
XB 3 HOH 375 975  975  HOH HOH Q . 
XB 3 HOH 376 976  976  HOH HOH Q . 
XB 3 HOH 377 977  977  HOH HOH Q . 
XB 3 HOH 378 978  978  HOH HOH Q . 
XB 3 HOH 379 979  979  HOH HOH Q . 
XB 3 HOH 380 980  980  HOH HOH Q . 
XB 3 HOH 381 981  981  HOH HOH Q . 
XB 3 HOH 382 982  982  HOH HOH Q . 
XB 3 HOH 383 983  983  HOH HOH Q . 
XB 3 HOH 384 984  984  HOH HOH Q . 
XB 3 HOH 385 985  985  HOH HOH Q . 
XB 3 HOH 386 986  986  HOH HOH Q . 
XB 3 HOH 387 987  987  HOH HOH Q . 
XB 3 HOH 388 988  988  HOH HOH Q . 
XB 3 HOH 389 989  989  HOH HOH Q . 
XB 3 HOH 390 990  990  HOH HOH Q . 
XB 3 HOH 391 991  991  HOH HOH Q . 
XB 3 HOH 392 992  992  HOH HOH Q . 
XB 3 HOH 393 993  993  HOH HOH Q . 
XB 3 HOH 394 994  994  HOH HOH Q . 
XB 3 HOH 395 995  995  HOH HOH Q . 
XB 3 HOH 396 996  996  HOH HOH Q . 
XB 3 HOH 397 997  997  HOH HOH Q . 
XB 3 HOH 398 998  998  HOH HOH Q . 
XB 3 HOH 399 999  999  HOH HOH Q . 
XB 3 HOH 400 1000 1000 HOH HOH Q . 
XB 3 HOH 401 1001 1001 HOH HOH Q . 
XB 3 HOH 402 1002 1002 HOH HOH Q . 
XB 3 HOH 403 1003 1003 HOH HOH Q . 
XB 3 HOH 404 1004 1004 HOH HOH Q . 
XB 3 HOH 405 1005 1005 HOH HOH Q . 
XB 3 HOH 406 1006 1006 HOH HOH Q . 
XB 3 HOH 407 1007 1007 HOH HOH Q . 
XB 3 HOH 408 1008 1008 HOH HOH Q . 
XB 3 HOH 409 1009 1009 HOH HOH Q . 
XB 3 HOH 410 1010 1010 HOH HOH Q . 
XB 3 HOH 411 1011 1011 HOH HOH Q . 
XB 3 HOH 412 1012 1012 HOH HOH Q . 
XB 3 HOH 413 1013 1013 HOH HOH Q . 
XB 3 HOH 414 1014 1014 HOH HOH Q . 
XB 3 HOH 415 1015 1015 HOH HOH Q . 
XB 3 HOH 416 1016 1016 HOH HOH Q . 
XB 3 HOH 417 1017 1017 HOH HOH Q . 
XB 3 HOH 418 1018 1018 HOH HOH Q . 
XB 3 HOH 419 1019 1019 HOH HOH Q . 
XB 3 HOH 420 1020 1020 HOH HOH Q . 
XB 3 HOH 421 1021 1021 HOH HOH Q . 
XB 3 HOH 422 1022 1022 HOH HOH Q . 
XB 3 HOH 423 1023 1023 HOH HOH Q . 
XB 3 HOH 424 1024 1024 HOH HOH Q . 
XB 3 HOH 425 1025 1025 HOH HOH Q . 
XB 3 HOH 426 1026 1026 HOH HOH Q . 
XB 3 HOH 427 1027 1027 HOH HOH Q . 
XB 3 HOH 428 1028 1028 HOH HOH Q . 
XB 3 HOH 429 1029 1029 HOH HOH Q . 
XB 3 HOH 430 1030 1030 HOH HOH Q . 
XB 3 HOH 431 1031 1031 HOH HOH Q . 
XB 3 HOH 432 1032 1032 HOH HOH Q . 
XB 3 HOH 433 1033 1033 HOH HOH Q . 
XB 3 HOH 434 1034 1034 HOH HOH Q . 
XB 3 HOH 435 1035 1035 HOH HOH Q . 
XB 3 HOH 436 1036 1036 HOH HOH Q . 
XB 3 HOH 437 1037 1037 HOH HOH Q . 
XB 3 HOH 438 1038 1038 HOH HOH Q . 
XB 3 HOH 439 1039 1039 HOH HOH Q . 
XB 3 HOH 440 1040 1040 HOH HOH Q . 
XB 3 HOH 441 1041 1041 HOH HOH Q . 
XB 3 HOH 442 1042 1042 HOH HOH Q . 
XB 3 HOH 443 1043 1043 HOH HOH Q . 
XB 3 HOH 444 1044 1044 HOH HOH Q . 
XB 3 HOH 445 1045 1045 HOH HOH Q . 
XB 3 HOH 446 1046 1046 HOH HOH Q . 
XB 3 HOH 447 1047 1047 HOH HOH Q . 
XB 3 HOH 448 1048 1048 HOH HOH Q . 
XB 3 HOH 449 1049 1049 HOH HOH Q . 
XB 3 HOH 450 1050 1050 HOH HOH Q . 
XB 3 HOH 451 1051 1051 HOH HOH Q . 
XB 3 HOH 452 1052 1052 HOH HOH Q . 
XB 3 HOH 453 1053 1053 HOH HOH Q . 
XB 3 HOH 454 1054 1054 HOH HOH Q . 
XB 3 HOH 455 1055 1055 HOH HOH Q . 
XB 3 HOH 456 1056 1056 HOH HOH Q . 
XB 3 HOH 457 1057 1057 HOH HOH Q . 
XB 3 HOH 458 1058 1058 HOH HOH Q . 
XB 3 HOH 459 1059 1059 HOH HOH Q . 
XB 3 HOH 460 1060 1060 HOH HOH Q . 
XB 3 HOH 461 1061 1061 HOH HOH Q . 
XB 3 HOH 462 1062 1062 HOH HOH Q . 
XB 3 HOH 463 1063 1063 HOH HOH Q . 
XB 3 HOH 464 1064 1064 HOH HOH Q . 
XB 3 HOH 465 1065 1065 HOH HOH Q . 
XB 3 HOH 466 1066 1066 HOH HOH Q . 
XB 3 HOH 467 1067 1067 HOH HOH Q . 
XB 3 HOH 468 1068 1068 HOH HOH Q . 
XB 3 HOH 469 1069 1069 HOH HOH Q . 
XB 3 HOH 470 1070 1070 HOH HOH Q . 
XB 3 HOH 471 1071 1071 HOH HOH Q . 
XB 3 HOH 472 1072 1072 HOH HOH Q . 
XB 3 HOH 473 1073 1073 HOH HOH Q . 
XB 3 HOH 474 1074 1074 HOH HOH Q . 
XB 3 HOH 475 1075 1075 HOH HOH Q . 
XB 3 HOH 476 1076 1076 HOH HOH Q . 
XB 3 HOH 477 1077 1077 HOH HOH Q . 
XB 3 HOH 478 1078 1078 HOH HOH Q . 
XB 3 HOH 479 1079 1079 HOH HOH Q . 
XB 3 HOH 480 1080 1080 HOH HOH Q . 
XB 3 HOH 481 1081 1081 HOH HOH Q . 
XB 3 HOH 482 1082 1082 HOH HOH Q . 
XB 3 HOH 483 1083 1083 HOH HOH Q . 
XB 3 HOH 484 1084 1084 HOH HOH Q . 
XB 3 HOH 485 1085 1085 HOH HOH Q . 
XB 3 HOH 486 1086 1086 HOH HOH Q . 
XB 3 HOH 487 1087 1087 HOH HOH Q . 
XB 3 HOH 488 1088 1088 HOH HOH Q . 
XB 3 HOH 489 1089 1089 HOH HOH Q . 
XB 3 HOH 490 1090 1090 HOH HOH Q . 
XB 3 HOH 491 1091 1091 HOH HOH Q . 
XB 3 HOH 492 1092 1092 HOH HOH Q . 
XB 3 HOH 493 1093 1093 HOH HOH Q . 
XB 3 HOH 494 1094 1094 HOH HOH Q . 
XB 3 HOH 495 1095 1095 HOH HOH Q . 
XB 3 HOH 496 1096 1096 HOH HOH Q . 
XB 3 HOH 497 1097 1097 HOH HOH Q . 
XB 3 HOH 498 1098 1098 HOH HOH Q . 
XB 3 HOH 499 1099 1099 HOH HOH Q . 
XB 3 HOH 500 1100 1100 HOH HOH Q . 
XB 3 HOH 501 1101 1101 HOH HOH Q . 
XB 3 HOH 502 1102 1102 HOH HOH Q . 
XB 3 HOH 503 1103 1103 HOH HOH Q . 
XB 3 HOH 504 1104 1105 HOH HOH Q . 
XB 3 HOH 505 1105 1106 HOH HOH Q . 
XB 3 HOH 506 1106 1107 HOH HOH Q . 
XB 3 HOH 507 1107 1108 HOH HOH Q . 
XB 3 HOH 508 1108 1109 HOH HOH Q . 
XB 3 HOH 509 1109 1110 HOH HOH Q . 
XB 3 HOH 510 1110 1111 HOH HOH Q . 
XB 3 HOH 511 1111 1112 HOH HOH Q . 
XB 3 HOH 512 1112 1113 HOH HOH Q . 
XB 3 HOH 513 1113 1114 HOH HOH Q . 
XB 3 HOH 514 1114 1115 HOH HOH Q . 
XB 3 HOH 515 1115 1116 HOH HOH Q . 
XB 3 HOH 516 1116 1117 HOH HOH Q . 
XB 3 HOH 517 1117 1104 HOH HOH Q . 
XB 3 HOH 518 1118 1118 HOH HOH Q . 
XB 3 HOH 519 1119 1119 HOH HOH Q . 
XB 3 HOH 520 1120 1120 HOH HOH Q . 
XB 3 HOH 521 1121 1121 HOH HOH Q . 
XB 3 HOH 522 1122 1122 HOH HOH Q . 
XB 3 HOH 523 1123 1123 HOH HOH Q . 
XB 3 HOH 524 1124 1124 HOH HOH Q . 
XB 3 HOH 525 1125 1125 HOH HOH Q . 
XB 3 HOH 526 1126 1126 HOH HOH Q . 
XB 3 HOH 527 1127 1127 HOH HOH Q . 
XB 3 HOH 528 1128 1128 HOH HOH Q . 
XB 3 HOH 529 1129 1129 HOH HOH Q . 
XB 3 HOH 530 1130 1130 HOH HOH Q . 
XB 3 HOH 531 1131 1131 HOH HOH Q . 
XB 3 HOH 532 1132 1132 HOH HOH Q . 
XB 3 HOH 533 1133 1133 HOH HOH Q . 
XB 3 HOH 534 1134 1134 HOH HOH Q . 
XB 3 HOH 535 1135 1135 HOH HOH Q . 
XB 3 HOH 536 1136 1136 HOH HOH Q . 
XB 3 HOH 537 1137 1137 HOH HOH Q . 
XB 3 HOH 538 1138 1138 HOH HOH Q . 
XB 3 HOH 539 1139 1139 HOH HOH Q . 
XB 3 HOH 540 1140 1140 HOH HOH Q . 
XB 3 HOH 541 1141 1141 HOH HOH Q . 
XB 3 HOH 542 1142 1142 HOH HOH Q . 
XB 3 HOH 543 1143 1143 HOH HOH Q . 
XB 3 HOH 544 1144 1144 HOH HOH Q . 
XB 3 HOH 545 1145 1145 HOH HOH Q . 
XB 3 HOH 546 1146 1146 HOH HOH Q . 
XB 3 HOH 547 1147 1147 HOH HOH Q . 
XB 3 HOH 548 1148 1148 HOH HOH Q . 
XB 3 HOH 549 1149 1149 HOH HOH Q . 
XB 3 HOH 550 1150 1150 HOH HOH Q . 
XB 3 HOH 551 1151 1151 HOH HOH Q . 
XB 3 HOH 552 1152 1152 HOH HOH Q . 
XB 3 HOH 553 1153 1153 HOH HOH Q . 
XB 3 HOH 554 1154 1154 HOH HOH Q . 
XB 3 HOH 555 1155 1155 HOH HOH Q . 
XB 3 HOH 556 1156 1156 HOH HOH Q . 
XB 3 HOH 557 1157 1157 HOH HOH Q . 
YB 3 HOH 1   601  601  HOH HOH R . 
YB 3 HOH 2   602  602  HOH HOH R . 
YB 3 HOH 3   603  603  HOH HOH R . 
YB 3 HOH 4   604  604  HOH HOH R . 
YB 3 HOH 5   605  605  HOH HOH R . 
YB 3 HOH 6   606  606  HOH HOH R . 
YB 3 HOH 7   607  607  HOH HOH R . 
YB 3 HOH 8   608  608  HOH HOH R . 
YB 3 HOH 9   609  609  HOH HOH R . 
YB 3 HOH 10  610  610  HOH HOH R . 
YB 3 HOH 11  611  611  HOH HOH R . 
YB 3 HOH 12  612  612  HOH HOH R . 
YB 3 HOH 13  613  613  HOH HOH R . 
YB 3 HOH 14  614  614  HOH HOH R . 
YB 3 HOH 15  615  615  HOH HOH R . 
YB 3 HOH 16  616  616  HOH HOH R . 
YB 3 HOH 17  617  617  HOH HOH R . 
YB 3 HOH 18  618  618  HOH HOH R . 
YB 3 HOH 19  619  619  HOH HOH R . 
YB 3 HOH 20  620  620  HOH HOH R . 
YB 3 HOH 21  621  621  HOH HOH R . 
YB 3 HOH 22  622  622  HOH HOH R . 
YB 3 HOH 23  623  623  HOH HOH R . 
YB 3 HOH 24  624  624  HOH HOH R . 
YB 3 HOH 25  625  625  HOH HOH R . 
YB 3 HOH 26  626  626  HOH HOH R . 
YB 3 HOH 27  627  627  HOH HOH R . 
YB 3 HOH 28  628  628  HOH HOH R . 
YB 3 HOH 29  629  629  HOH HOH R . 
YB 3 HOH 30  630  630  HOH HOH R . 
YB 3 HOH 31  631  631  HOH HOH R . 
YB 3 HOH 32  632  632  HOH HOH R . 
YB 3 HOH 33  633  633  HOH HOH R . 
YB 3 HOH 34  634  634  HOH HOH R . 
YB 3 HOH 35  635  635  HOH HOH R . 
YB 3 HOH 36  636  636  HOH HOH R . 
YB 3 HOH 37  637  637  HOH HOH R . 
YB 3 HOH 38  638  638  HOH HOH R . 
YB 3 HOH 39  639  639  HOH HOH R . 
YB 3 HOH 40  640  640  HOH HOH R . 
YB 3 HOH 41  641  641  HOH HOH R . 
YB 3 HOH 42  642  642  HOH HOH R . 
YB 3 HOH 43  643  643  HOH HOH R . 
YB 3 HOH 44  644  644  HOH HOH R . 
YB 3 HOH 45  645  645  HOH HOH R . 
YB 3 HOH 46  646  646  HOH HOH R . 
YB 3 HOH 47  647  647  HOH HOH R . 
YB 3 HOH 48  648  648  HOH HOH R . 
YB 3 HOH 49  649  649  HOH HOH R . 
YB 3 HOH 50  650  650  HOH HOH R . 
YB 3 HOH 51  651  651  HOH HOH R . 
YB 3 HOH 52  652  652  HOH HOH R . 
YB 3 HOH 53  653  653  HOH HOH R . 
YB 3 HOH 54  654  654  HOH HOH R . 
YB 3 HOH 55  655  655  HOH HOH R . 
YB 3 HOH 56  656  656  HOH HOH R . 
YB 3 HOH 57  657  657  HOH HOH R . 
YB 3 HOH 58  658  658  HOH HOH R . 
YB 3 HOH 59  659  659  HOH HOH R . 
YB 3 HOH 60  660  660  HOH HOH R . 
YB 3 HOH 61  661  661  HOH HOH R . 
YB 3 HOH 62  662  662  HOH HOH R . 
YB 3 HOH 63  663  663  HOH HOH R . 
YB 3 HOH 64  664  664  HOH HOH R . 
YB 3 HOH 65  665  665  HOH HOH R . 
YB 3 HOH 66  666  666  HOH HOH R . 
YB 3 HOH 67  667  667  HOH HOH R . 
YB 3 HOH 68  668  668  HOH HOH R . 
YB 3 HOH 69  669  669  HOH HOH R . 
YB 3 HOH 70  670  670  HOH HOH R . 
YB 3 HOH 71  671  671  HOH HOH R . 
YB 3 HOH 72  672  672  HOH HOH R . 
YB 3 HOH 73  673  673  HOH HOH R . 
YB 3 HOH 74  674  674  HOH HOH R . 
YB 3 HOH 75  675  675  HOH HOH R . 
YB 3 HOH 76  676  676  HOH HOH R . 
YB 3 HOH 77  677  677  HOH HOH R . 
YB 3 HOH 78  678  678  HOH HOH R . 
YB 3 HOH 79  679  679  HOH HOH R . 
YB 3 HOH 80  680  680  HOH HOH R . 
YB 3 HOH 81  681  681  HOH HOH R . 
YB 3 HOH 82  682  682  HOH HOH R . 
YB 3 HOH 83  683  683  HOH HOH R . 
YB 3 HOH 84  684  684  HOH HOH R . 
YB 3 HOH 85  685  685  HOH HOH R . 
YB 3 HOH 86  686  686  HOH HOH R . 
YB 3 HOH 87  687  687  HOH HOH R . 
YB 3 HOH 88  688  688  HOH HOH R . 
YB 3 HOH 89  689  689  HOH HOH R . 
YB 3 HOH 90  690  690  HOH HOH R . 
YB 3 HOH 91  691  691  HOH HOH R . 
YB 3 HOH 92  692  692  HOH HOH R . 
YB 3 HOH 93  693  693  HOH HOH R . 
YB 3 HOH 94  694  694  HOH HOH R . 
YB 3 HOH 95  695  695  HOH HOH R . 
YB 3 HOH 96  696  696  HOH HOH R . 
YB 3 HOH 97  697  697  HOH HOH R . 
YB 3 HOH 98  698  698  HOH HOH R . 
YB 3 HOH 99  699  699  HOH HOH R . 
YB 3 HOH 100 700  700  HOH HOH R . 
YB 3 HOH 101 701  701  HOH HOH R . 
YB 3 HOH 102 702  702  HOH HOH R . 
YB 3 HOH 103 703  703  HOH HOH R . 
YB 3 HOH 104 704  704  HOH HOH R . 
YB 3 HOH 105 705  705  HOH HOH R . 
YB 3 HOH 106 706  706  HOH HOH R . 
YB 3 HOH 107 707  707  HOH HOH R . 
YB 3 HOH 108 708  708  HOH HOH R . 
YB 3 HOH 109 709  709  HOH HOH R . 
YB 3 HOH 110 710  710  HOH HOH R . 
YB 3 HOH 111 711  711  HOH HOH R . 
YB 3 HOH 112 712  712  HOH HOH R . 
YB 3 HOH 113 713  713  HOH HOH R . 
YB 3 HOH 114 714  714  HOH HOH R . 
YB 3 HOH 115 715  715  HOH HOH R . 
YB 3 HOH 116 716  716  HOH HOH R . 
YB 3 HOH 117 717  717  HOH HOH R . 
YB 3 HOH 118 718  718  HOH HOH R . 
YB 3 HOH 119 719  719  HOH HOH R . 
YB 3 HOH 120 720  720  HOH HOH R . 
YB 3 HOH 121 721  721  HOH HOH R . 
YB 3 HOH 122 722  722  HOH HOH R . 
YB 3 HOH 123 723  723  HOH HOH R . 
YB 3 HOH 124 724  724  HOH HOH R . 
YB 3 HOH 125 725  725  HOH HOH R . 
YB 3 HOH 126 726  726  HOH HOH R . 
YB 3 HOH 127 727  727  HOH HOH R . 
YB 3 HOH 128 728  728  HOH HOH R . 
YB 3 HOH 129 729  729  HOH HOH R . 
YB 3 HOH 130 730  730  HOH HOH R . 
YB 3 HOH 131 731  731  HOH HOH R . 
YB 3 HOH 132 732  732  HOH HOH R . 
YB 3 HOH 133 733  733  HOH HOH R . 
YB 3 HOH 134 734  734  HOH HOH R . 
YB 3 HOH 135 735  735  HOH HOH R . 
YB 3 HOH 136 736  736  HOH HOH R . 
YB 3 HOH 137 737  737  HOH HOH R . 
YB 3 HOH 138 738  738  HOH HOH R . 
YB 3 HOH 139 739  739  HOH HOH R . 
YB 3 HOH 140 740  740  HOH HOH R . 
YB 3 HOH 141 741  741  HOH HOH R . 
YB 3 HOH 142 742  742  HOH HOH R . 
YB 3 HOH 143 743  743  HOH HOH R . 
YB 3 HOH 144 744  744  HOH HOH R . 
YB 3 HOH 145 745  745  HOH HOH R . 
YB 3 HOH 146 746  746  HOH HOH R . 
YB 3 HOH 147 747  747  HOH HOH R . 
YB 3 HOH 148 748  748  HOH HOH R . 
YB 3 HOH 149 749  749  HOH HOH R . 
YB 3 HOH 150 750  750  HOH HOH R . 
YB 3 HOH 151 751  751  HOH HOH R . 
YB 3 HOH 152 752  752  HOH HOH R . 
YB 3 HOH 153 753  753  HOH HOH R . 
YB 3 HOH 154 754  754  HOH HOH R . 
YB 3 HOH 155 755  755  HOH HOH R . 
YB 3 HOH 156 756  756  HOH HOH R . 
YB 3 HOH 157 757  757  HOH HOH R . 
YB 3 HOH 158 758  758  HOH HOH R . 
YB 3 HOH 159 759  759  HOH HOH R . 
YB 3 HOH 160 760  760  HOH HOH R . 
YB 3 HOH 161 761  761  HOH HOH R . 
YB 3 HOH 162 762  762  HOH HOH R . 
YB 3 HOH 163 763  763  HOH HOH R . 
YB 3 HOH 164 764  764  HOH HOH R . 
YB 3 HOH 165 765  765  HOH HOH R . 
YB 3 HOH 166 766  766  HOH HOH R . 
YB 3 HOH 167 767  767  HOH HOH R . 
YB 3 HOH 168 768  768  HOH HOH R . 
YB 3 HOH 169 769  769  HOH HOH R . 
YB 3 HOH 170 770  770  HOH HOH R . 
YB 3 HOH 171 771  771  HOH HOH R . 
YB 3 HOH 172 772  772  HOH HOH R . 
YB 3 HOH 173 773  773  HOH HOH R . 
YB 3 HOH 174 774  774  HOH HOH R . 
YB 3 HOH 175 775  775  HOH HOH R . 
YB 3 HOH 176 776  776  HOH HOH R . 
YB 3 HOH 177 777  777  HOH HOH R . 
YB 3 HOH 178 778  778  HOH HOH R . 
YB 3 HOH 179 779  779  HOH HOH R . 
YB 3 HOH 180 780  780  HOH HOH R . 
YB 3 HOH 181 781  781  HOH HOH R . 
YB 3 HOH 182 782  782  HOH HOH R . 
YB 3 HOH 183 783  783  HOH HOH R . 
YB 3 HOH 184 784  784  HOH HOH R . 
YB 3 HOH 185 785  785  HOH HOH R . 
YB 3 HOH 186 786  786  HOH HOH R . 
YB 3 HOH 187 787  787  HOH HOH R . 
YB 3 HOH 188 788  788  HOH HOH R . 
YB 3 HOH 189 789  789  HOH HOH R . 
YB 3 HOH 190 790  790  HOH HOH R . 
YB 3 HOH 191 791  791  HOH HOH R . 
YB 3 HOH 192 792  792  HOH HOH R . 
YB 3 HOH 193 793  793  HOH HOH R . 
YB 3 HOH 194 794  794  HOH HOH R . 
YB 3 HOH 195 795  795  HOH HOH R . 
YB 3 HOH 196 796  796  HOH HOH R . 
YB 3 HOH 197 797  797  HOH HOH R . 
YB 3 HOH 198 798  798  HOH HOH R . 
YB 3 HOH 199 799  799  HOH HOH R . 
YB 3 HOH 200 800  800  HOH HOH R . 
YB 3 HOH 201 801  801  HOH HOH R . 
YB 3 HOH 202 802  802  HOH HOH R . 
YB 3 HOH 203 803  803  HOH HOH R . 
YB 3 HOH 204 804  805  HOH HOH R . 
YB 3 HOH 205 805  804  HOH HOH R . 
YB 3 HOH 206 806  806  HOH HOH R . 
YB 3 HOH 207 807  807  HOH HOH R . 
YB 3 HOH 208 808  808  HOH HOH R . 
YB 3 HOH 209 809  809  HOH HOH R . 
YB 3 HOH 210 810  810  HOH HOH R . 
YB 3 HOH 211 811  811  HOH HOH R . 
YB 3 HOH 212 812  812  HOH HOH R . 
YB 3 HOH 213 813  813  HOH HOH R . 
YB 3 HOH 214 814  814  HOH HOH R . 
YB 3 HOH 215 815  815  HOH HOH R . 
YB 3 HOH 216 816  816  HOH HOH R . 
YB 3 HOH 217 817  817  HOH HOH R . 
YB 3 HOH 218 818  818  HOH HOH R . 
YB 3 HOH 219 819  819  HOH HOH R . 
YB 3 HOH 220 820  820  HOH HOH R . 
YB 3 HOH 221 821  821  HOH HOH R . 
YB 3 HOH 222 822  822  HOH HOH R . 
YB 3 HOH 223 823  823  HOH HOH R . 
YB 3 HOH 224 824  824  HOH HOH R . 
YB 3 HOH 225 825  825  HOH HOH R . 
YB 3 HOH 226 826  826  HOH HOH R . 
YB 3 HOH 227 827  827  HOH HOH R . 
YB 3 HOH 228 828  828  HOH HOH R . 
YB 3 HOH 229 829  829  HOH HOH R . 
YB 3 HOH 230 830  830  HOH HOH R . 
YB 3 HOH 231 831  831  HOH HOH R . 
YB 3 HOH 232 832  832  HOH HOH R . 
YB 3 HOH 233 833  833  HOH HOH R . 
YB 3 HOH 234 834  834  HOH HOH R . 
YB 3 HOH 235 835  835  HOH HOH R . 
YB 3 HOH 236 836  836  HOH HOH R . 
YB 3 HOH 237 837  837  HOH HOH R . 
YB 3 HOH 238 838  838  HOH HOH R . 
YB 3 HOH 239 839  839  HOH HOH R . 
YB 3 HOH 240 840  840  HOH HOH R . 
YB 3 HOH 241 841  841  HOH HOH R . 
YB 3 HOH 242 842  842  HOH HOH R . 
YB 3 HOH 243 843  843  HOH HOH R . 
YB 3 HOH 244 844  844  HOH HOH R . 
YB 3 HOH 245 845  845  HOH HOH R . 
YB 3 HOH 246 846  846  HOH HOH R . 
YB 3 HOH 247 847  847  HOH HOH R . 
YB 3 HOH 248 848  848  HOH HOH R . 
YB 3 HOH 249 849  849  HOH HOH R . 
YB 3 HOH 250 850  850  HOH HOH R . 
YB 3 HOH 251 851  851  HOH HOH R . 
YB 3 HOH 252 852  852  HOH HOH R . 
YB 3 HOH 253 853  853  HOH HOH R . 
YB 3 HOH 254 854  854  HOH HOH R . 
YB 3 HOH 255 855  855  HOH HOH R . 
YB 3 HOH 256 856  856  HOH HOH R . 
YB 3 HOH 257 857  857  HOH HOH R . 
YB 3 HOH 258 858  858  HOH HOH R . 
YB 3 HOH 259 859  859  HOH HOH R . 
YB 3 HOH 260 860  860  HOH HOH R . 
YB 3 HOH 261 861  861  HOH HOH R . 
YB 3 HOH 262 862  862  HOH HOH R . 
YB 3 HOH 263 863  863  HOH HOH R . 
YB 3 HOH 264 864  864  HOH HOH R . 
YB 3 HOH 265 865  865  HOH HOH R . 
YB 3 HOH 266 866  866  HOH HOH R . 
YB 3 HOH 267 867  867  HOH HOH R . 
YB 3 HOH 268 868  868  HOH HOH R . 
YB 3 HOH 269 869  869  HOH HOH R . 
YB 3 HOH 270 870  870  HOH HOH R . 
YB 3 HOH 271 871  871  HOH HOH R . 
YB 3 HOH 272 872  872  HOH HOH R . 
YB 3 HOH 273 873  873  HOH HOH R . 
YB 3 HOH 274 874  874  HOH HOH R . 
YB 3 HOH 275 875  875  HOH HOH R . 
YB 3 HOH 276 876  876  HOH HOH R . 
YB 3 HOH 277 877  877  HOH HOH R . 
YB 3 HOH 278 878  878  HOH HOH R . 
YB 3 HOH 279 879  879  HOH HOH R . 
YB 3 HOH 280 880  880  HOH HOH R . 
YB 3 HOH 281 881  881  HOH HOH R . 
YB 3 HOH 282 882  882  HOH HOH R . 
YB 3 HOH 283 883  883  HOH HOH R . 
YB 3 HOH 284 884  884  HOH HOH R . 
YB 3 HOH 285 885  885  HOH HOH R . 
YB 3 HOH 286 886  886  HOH HOH R . 
YB 3 HOH 287 887  887  HOH HOH R . 
YB 3 HOH 288 888  888  HOH HOH R . 
YB 3 HOH 289 889  889  HOH HOH R . 
YB 3 HOH 290 890  890  HOH HOH R . 
YB 3 HOH 291 891  891  HOH HOH R . 
YB 3 HOH 292 892  892  HOH HOH R . 
YB 3 HOH 293 893  893  HOH HOH R . 
YB 3 HOH 294 894  894  HOH HOH R . 
YB 3 HOH 295 895  895  HOH HOH R . 
YB 3 HOH 296 896  896  HOH HOH R . 
YB 3 HOH 297 897  897  HOH HOH R . 
YB 3 HOH 298 898  898  HOH HOH R . 
YB 3 HOH 299 899  899  HOH HOH R . 
YB 3 HOH 300 900  900  HOH HOH R . 
YB 3 HOH 301 901  901  HOH HOH R . 
YB 3 HOH 302 902  902  HOH HOH R . 
YB 3 HOH 303 903  903  HOH HOH R . 
YB 3 HOH 304 904  904  HOH HOH R . 
YB 3 HOH 305 905  905  HOH HOH R . 
YB 3 HOH 306 906  906  HOH HOH R . 
YB 3 HOH 307 907  907  HOH HOH R . 
YB 3 HOH 308 908  908  HOH HOH R . 
YB 3 HOH 309 909  909  HOH HOH R . 
YB 3 HOH 310 910  910  HOH HOH R . 
YB 3 HOH 311 911  911  HOH HOH R . 
YB 3 HOH 312 912  912  HOH HOH R . 
YB 3 HOH 313 913  913  HOH HOH R . 
YB 3 HOH 314 914  914  HOH HOH R . 
YB 3 HOH 315 915  915  HOH HOH R . 
YB 3 HOH 316 916  916  HOH HOH R . 
YB 3 HOH 317 917  917  HOH HOH R . 
YB 3 HOH 318 918  918  HOH HOH R . 
YB 3 HOH 319 919  919  HOH HOH R . 
YB 3 HOH 320 920  920  HOH HOH R . 
YB 3 HOH 321 921  921  HOH HOH R . 
YB 3 HOH 322 922  922  HOH HOH R . 
YB 3 HOH 323 923  923  HOH HOH R . 
YB 3 HOH 324 924  924  HOH HOH R . 
YB 3 HOH 325 925  925  HOH HOH R . 
YB 3 HOH 326 926  926  HOH HOH R . 
YB 3 HOH 327 927  927  HOH HOH R . 
YB 3 HOH 328 928  928  HOH HOH R . 
YB 3 HOH 329 929  929  HOH HOH R . 
YB 3 HOH 330 930  930  HOH HOH R . 
YB 3 HOH 331 931  931  HOH HOH R . 
YB 3 HOH 332 932  932  HOH HOH R . 
YB 3 HOH 333 933  933  HOH HOH R . 
YB 3 HOH 334 934  934  HOH HOH R . 
YB 3 HOH 335 935  935  HOH HOH R . 
YB 3 HOH 336 936  936  HOH HOH R . 
YB 3 HOH 337 937  937  HOH HOH R . 
YB 3 HOH 338 938  938  HOH HOH R . 
YB 3 HOH 339 939  939  HOH HOH R . 
YB 3 HOH 340 940  940  HOH HOH R . 
YB 3 HOH 341 941  941  HOH HOH R . 
YB 3 HOH 342 942  942  HOH HOH R . 
YB 3 HOH 343 943  943  HOH HOH R . 
YB 3 HOH 344 944  944  HOH HOH R . 
YB 3 HOH 345 945  945  HOH HOH R . 
YB 3 HOH 346 946  946  HOH HOH R . 
YB 3 HOH 347 947  947  HOH HOH R . 
YB 3 HOH 348 948  948  HOH HOH R . 
YB 3 HOH 349 949  949  HOH HOH R . 
YB 3 HOH 350 950  950  HOH HOH R . 
YB 3 HOH 351 951  951  HOH HOH R . 
YB 3 HOH 352 952  952  HOH HOH R . 
YB 3 HOH 353 953  953  HOH HOH R . 
YB 3 HOH 354 954  954  HOH HOH R . 
YB 3 HOH 355 955  955  HOH HOH R . 
YB 3 HOH 356 956  957  HOH HOH R . 
YB 3 HOH 357 957  956  HOH HOH R . 
YB 3 HOH 358 958  958  HOH HOH R . 
YB 3 HOH 359 959  959  HOH HOH R . 
YB 3 HOH 360 960  960  HOH HOH R . 
YB 3 HOH 361 961  961  HOH HOH R . 
YB 3 HOH 362 962  962  HOH HOH R . 
YB 3 HOH 363 963  963  HOH HOH R . 
YB 3 HOH 364 964  964  HOH HOH R . 
YB 3 HOH 365 965  965  HOH HOH R . 
YB 3 HOH 366 966  966  HOH HOH R . 
YB 3 HOH 367 967  967  HOH HOH R . 
YB 3 HOH 368 968  968  HOH HOH R . 
YB 3 HOH 369 969  969  HOH HOH R . 
YB 3 HOH 370 970  970  HOH HOH R . 
YB 3 HOH 371 971  971  HOH HOH R . 
YB 3 HOH 372 972  972  HOH HOH R . 
YB 3 HOH 373 973  973  HOH HOH R . 
YB 3 HOH 374 974  974  HOH HOH R . 
YB 3 HOH 375 975  975  HOH HOH R . 
YB 3 HOH 376 976  976  HOH HOH R . 
YB 3 HOH 377 977  977  HOH HOH R . 
YB 3 HOH 378 978  978  HOH HOH R . 
YB 3 HOH 379 979  979  HOH HOH R . 
YB 3 HOH 380 980  980  HOH HOH R . 
YB 3 HOH 381 981  981  HOH HOH R . 
YB 3 HOH 382 982  982  HOH HOH R . 
YB 3 HOH 383 983  983  HOH HOH R . 
YB 3 HOH 384 984  984  HOH HOH R . 
YB 3 HOH 385 985  985  HOH HOH R . 
YB 3 HOH 386 986  986  HOH HOH R . 
YB 3 HOH 387 987  987  HOH HOH R . 
YB 3 HOH 388 988  988  HOH HOH R . 
YB 3 HOH 389 989  989  HOH HOH R . 
YB 3 HOH 390 990  990  HOH HOH R . 
YB 3 HOH 391 991  991  HOH HOH R . 
YB 3 HOH 392 992  992  HOH HOH R . 
YB 3 HOH 393 993  993  HOH HOH R . 
YB 3 HOH 394 994  994  HOH HOH R . 
YB 3 HOH 395 995  995  HOH HOH R . 
YB 3 HOH 396 996  996  HOH HOH R . 
YB 3 HOH 397 997  997  HOH HOH R . 
YB 3 HOH 398 998  998  HOH HOH R . 
YB 3 HOH 399 999  999  HOH HOH R . 
YB 3 HOH 400 1000 1000 HOH HOH R . 
YB 3 HOH 401 1001 1001 HOH HOH R . 
YB 3 HOH 402 1002 1002 HOH HOH R . 
YB 3 HOH 403 1003 1003 HOH HOH R . 
YB 3 HOH 404 1004 1004 HOH HOH R . 
YB 3 HOH 405 1005 1005 HOH HOH R . 
YB 3 HOH 406 1006 1006 HOH HOH R . 
YB 3 HOH 407 1007 1007 HOH HOH R . 
YB 3 HOH 408 1008 1008 HOH HOH R . 
YB 3 HOH 409 1009 1009 HOH HOH R . 
YB 3 HOH 410 1010 1010 HOH HOH R . 
YB 3 HOH 411 1011 1011 HOH HOH R . 
YB 3 HOH 412 1012 1012 HOH HOH R . 
YB 3 HOH 413 1013 1013 HOH HOH R . 
YB 3 HOH 414 1014 1014 HOH HOH R . 
YB 3 HOH 415 1015 1015 HOH HOH R . 
YB 3 HOH 416 1016 1016 HOH HOH R . 
YB 3 HOH 417 1017 1017 HOH HOH R . 
YB 3 HOH 418 1018 1018 HOH HOH R . 
YB 3 HOH 419 1019 1019 HOH HOH R . 
YB 3 HOH 420 1020 1020 HOH HOH R . 
YB 3 HOH 421 1021 1021 HOH HOH R . 
YB 3 HOH 422 1022 1022 HOH HOH R . 
YB 3 HOH 423 1023 1023 HOH HOH R . 
YB 3 HOH 424 1024 1025 HOH HOH R . 
YB 3 HOH 425 1025 1024 HOH HOH R . 
YB 3 HOH 426 1026 1026 HOH HOH R . 
YB 3 HOH 427 1027 1027 HOH HOH R . 
YB 3 HOH 428 1028 1028 HOH HOH R . 
YB 3 HOH 429 1029 1029 HOH HOH R . 
YB 3 HOH 430 1030 1030 HOH HOH R . 
YB 3 HOH 431 1031 1031 HOH HOH R . 
YB 3 HOH 432 1032 1032 HOH HOH R . 
YB 3 HOH 433 1033 1033 HOH HOH R . 
YB 3 HOH 434 1034 1034 HOH HOH R . 
YB 3 HOH 435 1035 1035 HOH HOH R . 
YB 3 HOH 436 1036 1036 HOH HOH R . 
YB 3 HOH 437 1037 1037 HOH HOH R . 
YB 3 HOH 438 1038 1038 HOH HOH R . 
YB 3 HOH 439 1039 1039 HOH HOH R . 
YB 3 HOH 440 1040 1040 HOH HOH R . 
YB 3 HOH 441 1041 1041 HOH HOH R . 
YB 3 HOH 442 1042 1042 HOH HOH R . 
YB 3 HOH 443 1043 1043 HOH HOH R . 
YB 3 HOH 444 1044 1044 HOH HOH R . 
YB 3 HOH 445 1045 1045 HOH HOH R . 
YB 3 HOH 446 1046 1046 HOH HOH R . 
YB 3 HOH 447 1047 1047 HOH HOH R . 
YB 3 HOH 448 1048 1048 HOH HOH R . 
YB 3 HOH 449 1049 1049 HOH HOH R . 
YB 3 HOH 450 1050 1050 HOH HOH R . 
YB 3 HOH 451 1051 1051 HOH HOH R . 
YB 3 HOH 452 1052 1052 HOH HOH R . 
YB 3 HOH 453 1053 1053 HOH HOH R . 
YB 3 HOH 454 1054 1054 HOH HOH R . 
YB 3 HOH 455 1055 1055 HOH HOH R . 
YB 3 HOH 456 1056 1056 HOH HOH R . 
YB 3 HOH 457 1057 1057 HOH HOH R . 
YB 3 HOH 458 1058 1058 HOH HOH R . 
YB 3 HOH 459 1059 1059 HOH HOH R . 
YB 3 HOH 460 1060 1060 HOH HOH R . 
YB 3 HOH 461 1061 1061 HOH HOH R . 
YB 3 HOH 462 1062 1062 HOH HOH R . 
YB 3 HOH 463 1063 1063 HOH HOH R . 
YB 3 HOH 464 1064 1064 HOH HOH R . 
YB 3 HOH 465 1065 1065 HOH HOH R . 
YB 3 HOH 466 1066 1066 HOH HOH R . 
YB 3 HOH 467 1067 1067 HOH HOH R . 
YB 3 HOH 468 1068 1068 HOH HOH R . 
YB 3 HOH 469 1069 1069 HOH HOH R . 
YB 3 HOH 470 1070 1070 HOH HOH R . 
YB 3 HOH 471 1071 1071 HOH HOH R . 
YB 3 HOH 472 1072 1072 HOH HOH R . 
YB 3 HOH 473 1073 1073 HOH HOH R . 
YB 3 HOH 474 1074 1074 HOH HOH R . 
YB 3 HOH 475 1075 1075 HOH HOH R . 
YB 3 HOH 476 1076 1076 HOH HOH R . 
YB 3 HOH 477 1077 1077 HOH HOH R . 
YB 3 HOH 478 1078 1078 HOH HOH R . 
YB 3 HOH 479 1079 1079 HOH HOH R . 
YB 3 HOH 480 1080 1080 HOH HOH R . 
YB 3 HOH 481 1081 1081 HOH HOH R . 
YB 3 HOH 482 1082 1082 HOH HOH R . 
YB 3 HOH 483 1083 1083 HOH HOH R . 
YB 3 HOH 484 1084 1084 HOH HOH R . 
YB 3 HOH 485 1085 1085 HOH HOH R . 
YB 3 HOH 486 1086 1086 HOH HOH R . 
YB 3 HOH 487 1087 1087 HOH HOH R . 
YB 3 HOH 488 1088 1088 HOH HOH R . 
YB 3 HOH 489 1089 1089 HOH HOH R . 
YB 3 HOH 490 1090 1090 HOH HOH R . 
YB 3 HOH 491 1091 1091 HOH HOH R . 
YB 3 HOH 492 1092 1092 HOH HOH R . 
YB 3 HOH 493 1093 1093 HOH HOH R . 
YB 3 HOH 494 1094 1094 HOH HOH R . 
YB 3 HOH 495 1095 1095 HOH HOH R . 
YB 3 HOH 496 1096 1096 HOH HOH R . 
YB 3 HOH 497 1097 1097 HOH HOH R . 
YB 3 HOH 498 1098 1098 HOH HOH R . 
YB 3 HOH 499 1099 1099 HOH HOH R . 
YB 3 HOH 500 1100 1100 HOH HOH R . 
YB 3 HOH 501 1101 1101 HOH HOH R . 
YB 3 HOH 502 1102 1102 HOH HOH R . 
YB 3 HOH 503 1103 1103 HOH HOH R . 
YB 3 HOH 504 1104 1104 HOH HOH R . 
YB 3 HOH 505 1105 1105 HOH HOH R . 
YB 3 HOH 506 1106 1106 HOH HOH R . 
YB 3 HOH 507 1107 1107 HOH HOH R . 
YB 3 HOH 508 1108 1108 HOH HOH R . 
YB 3 HOH 509 1109 1109 HOH HOH R . 
YB 3 HOH 510 1110 1110 HOH HOH R . 
YB 3 HOH 511 1111 1111 HOH HOH R . 
YB 3 HOH 512 1112 1112 HOH HOH R . 
YB 3 HOH 513 1113 1113 HOH HOH R . 
YB 3 HOH 514 1114 1114 HOH HOH R . 
YB 3 HOH 515 1115 1115 HOH HOH R . 
YB 3 HOH 516 1116 1116 HOH HOH R . 
YB 3 HOH 517 1117 1117 HOH HOH R . 
YB 3 HOH 518 1118 1118 HOH HOH R . 
YB 3 HOH 519 1119 1119 HOH HOH R . 
YB 3 HOH 520 1120 1120 HOH HOH R . 
YB 3 HOH 521 1121 1121 HOH HOH R . 
YB 3 HOH 522 1122 1122 HOH HOH R . 
YB 3 HOH 523 1123 1123 HOH HOH R . 
YB 3 HOH 524 1124 1124 HOH HOH R . 
YB 3 HOH 525 1125 1125 HOH HOH R . 
YB 3 HOH 526 1126 1126 HOH HOH R . 
YB 3 HOH 527 1127 1127 HOH HOH R . 
YB 3 HOH 528 1128 1128 HOH HOH R . 
YB 3 HOH 529 1129 1129 HOH HOH R . 
YB 3 HOH 530 1130 1130 HOH HOH R . 
YB 3 HOH 531 1131 1131 HOH HOH R . 
YB 3 HOH 532 1132 1132 HOH HOH R . 
YB 3 HOH 533 1133 1133 HOH HOH R . 
YB 3 HOH 534 1134 1134 HOH HOH R . 
YB 3 HOH 535 1135 1135 HOH HOH R . 
YB 3 HOH 536 1136 1136 HOH HOH R . 
YB 3 HOH 537 1137 1137 HOH HOH R . 
YB 3 HOH 538 1138 1138 HOH HOH R . 
YB 3 HOH 539 1139 1139 HOH HOH R . 
YB 3 HOH 540 1140 1140 HOH HOH R . 
YB 3 HOH 541 1141 1141 HOH HOH R . 
YB 3 HOH 542 1142 1142 HOH HOH R . 
YB 3 HOH 543 1143 1143 HOH HOH R . 
YB 3 HOH 544 1144 1144 HOH HOH R . 
YB 3 HOH 545 1145 1145 HOH HOH R . 
YB 3 HOH 546 1146 1146 HOH HOH R . 
YB 3 HOH 547 1147 1147 HOH HOH R . 
YB 3 HOH 548 1148 1148 HOH HOH R . 
YB 3 HOH 549 1149 1149 HOH HOH R . 
YB 3 HOH 550 1150 1150 HOH HOH R . 
YB 3 HOH 551 1151 1151 HOH HOH R . 
YB 3 HOH 552 1152 1152 HOH HOH R . 
YB 3 HOH 553 1153 1153 HOH HOH R . 
YB 3 HOH 554 1154 1154 HOH HOH R . 
YB 3 HOH 555 1155 1155 HOH HOH R . 
YB 3 HOH 556 1156 1156 HOH HOH R . 
YB 3 HOH 557 1157 1157 HOH HOH R . 
YB 3 HOH 558 1158 1158 HOH HOH R . 
YB 3 HOH 559 1159 1159 HOH HOH R . 
YB 3 HOH 560 1160 1160 HOH HOH R . 
YB 3 HOH 561 1161 1161 HOH HOH R . 
YB 3 HOH 562 1162 1162 HOH HOH R . 
YB 3 HOH 563 1163 1163 HOH HOH R . 
YB 3 HOH 564 1164 1164 HOH HOH R . 
YB 3 HOH 565 1165 1165 HOH HOH R . 
YB 3 HOH 566 1166 1166 HOH HOH R . 
YB 3 HOH 567 1167 1167 HOH HOH R . 
YB 3 HOH 568 1168 1168 HOH HOH R . 
YB 3 HOH 569 1169 1169 HOH HOH R . 
YB 3 HOH 570 1170 1170 HOH HOH R . 
YB 3 HOH 571 1171 1171 HOH HOH R . 
YB 3 HOH 572 1172 1172 HOH HOH R . 
YB 3 HOH 573 1173 1173 HOH HOH R . 
YB 3 HOH 574 1174 1174 HOH HOH R . 
YB 3 HOH 575 1175 1175 HOH HOH R . 
YB 3 HOH 576 1176 1176 HOH HOH R . 
YB 3 HOH 577 1177 1177 HOH HOH R . 
YB 3 HOH 578 1178 1178 HOH HOH R . 
YB 3 HOH 579 1179 1179 HOH HOH R . 
YB 3 HOH 580 1180 1180 HOH HOH R . 
YB 3 HOH 581 1181 1181 HOH HOH R . 
YB 3 HOH 582 1182 1182 HOH HOH R . 
YB 3 HOH 583 1183 1183 HOH HOH R . 
YB 3 HOH 584 1184 1184 HOH HOH R . 
YB 3 HOH 585 1185 1185 HOH HOH R . 
YB 3 HOH 586 1186 1186 HOH HOH R . 
YB 3 HOH 587 1187 1187 HOH HOH R . 
YB 3 HOH 588 1188 1188 HOH HOH R . 
YB 3 HOH 589 1189 1189 HOH HOH R . 
YB 3 HOH 590 1190 1190 HOH HOH R . 
YB 3 HOH 591 1191 1191 HOH HOH R . 
YB 3 HOH 592 1192 1192 HOH HOH R . 
YB 3 HOH 593 1193 1193 HOH HOH R . 
YB 3 HOH 594 1194 1194 HOH HOH R . 
YB 3 HOH 595 1195 1195 HOH HOH R . 
YB 3 HOH 596 1196 1196 HOH HOH R . 
YB 3 HOH 597 1197 1197 HOH HOH R . 
ZB 3 HOH 1   601  601  HOH HOH F . 
ZB 3 HOH 2   602  602  HOH HOH F . 
ZB 3 HOH 3   603  603  HOH HOH F . 
ZB 3 HOH 4   604  604  HOH HOH F . 
ZB 3 HOH 5   605  605  HOH HOH F . 
ZB 3 HOH 6   606  606  HOH HOH F . 
ZB 3 HOH 7   607  607  HOH HOH F . 
ZB 3 HOH 8   608  608  HOH HOH F . 
ZB 3 HOH 9   609  609  HOH HOH F . 
ZB 3 HOH 10  610  610  HOH HOH F . 
ZB 3 HOH 11  611  611  HOH HOH F . 
ZB 3 HOH 12  612  612  HOH HOH F . 
ZB 3 HOH 13  613  613  HOH HOH F . 
ZB 3 HOH 14  614  614  HOH HOH F . 
ZB 3 HOH 15  615  615  HOH HOH F . 
ZB 3 HOH 16  616  616  HOH HOH F . 
ZB 3 HOH 17  617  617  HOH HOH F . 
ZB 3 HOH 18  618  618  HOH HOH F . 
ZB 3 HOH 19  619  619  HOH HOH F . 
ZB 3 HOH 20  620  620  HOH HOH F . 
ZB 3 HOH 21  621  621  HOH HOH F . 
ZB 3 HOH 22  622  622  HOH HOH F . 
ZB 3 HOH 23  623  623  HOH HOH F . 
ZB 3 HOH 24  624  624  HOH HOH F . 
ZB 3 HOH 25  625  625  HOH HOH F . 
ZB 3 HOH 26  626  626  HOH HOH F . 
ZB 3 HOH 27  627  627  HOH HOH F . 
ZB 3 HOH 28  628  628  HOH HOH F . 
ZB 3 HOH 29  629  629  HOH HOH F . 
ZB 3 HOH 30  630  630  HOH HOH F . 
ZB 3 HOH 31  631  631  HOH HOH F . 
ZB 3 HOH 32  632  632  HOH HOH F . 
ZB 3 HOH 33  633  633  HOH HOH F . 
ZB 3 HOH 34  634  634  HOH HOH F . 
ZB 3 HOH 35  635  635  HOH HOH F . 
ZB 3 HOH 36  636  636  HOH HOH F . 
ZB 3 HOH 37  637  637  HOH HOH F . 
ZB 3 HOH 38  638  638  HOH HOH F . 
ZB 3 HOH 39  639  639  HOH HOH F . 
ZB 3 HOH 40  640  640  HOH HOH F . 
ZB 3 HOH 41  641  641  HOH HOH F . 
ZB 3 HOH 42  642  642  HOH HOH F . 
ZB 3 HOH 43  643  643  HOH HOH F . 
ZB 3 HOH 44  644  644  HOH HOH F . 
ZB 3 HOH 45  645  645  HOH HOH F . 
ZB 3 HOH 46  646  646  HOH HOH F . 
ZB 3 HOH 47  647  647  HOH HOH F . 
ZB 3 HOH 48  648  648  HOH HOH F . 
ZB 3 HOH 49  649  649  HOH HOH F . 
ZB 3 HOH 50  650  650  HOH HOH F . 
ZB 3 HOH 51  651  651  HOH HOH F . 
ZB 3 HOH 52  652  652  HOH HOH F . 
ZB 3 HOH 53  653  653  HOH HOH F . 
ZB 3 HOH 54  654  654  HOH HOH F . 
ZB 3 HOH 55  655  655  HOH HOH F . 
ZB 3 HOH 56  656  656  HOH HOH F . 
ZB 3 HOH 57  657  657  HOH HOH F . 
ZB 3 HOH 58  658  658  HOH HOH F . 
ZB 3 HOH 59  659  659  HOH HOH F . 
ZB 3 HOH 60  660  660  HOH HOH F . 
ZB 3 HOH 61  661  661  HOH HOH F . 
ZB 3 HOH 62  662  662  HOH HOH F . 
ZB 3 HOH 63  663  663  HOH HOH F . 
ZB 3 HOH 64  664  664  HOH HOH F . 
ZB 3 HOH 65  665  665  HOH HOH F . 
ZB 3 HOH 66  666  666  HOH HOH F . 
ZB 3 HOH 67  667  667  HOH HOH F . 
ZB 3 HOH 68  668  668  HOH HOH F . 
ZB 3 HOH 69  669  669  HOH HOH F . 
ZB 3 HOH 70  670  670  HOH HOH F . 
ZB 3 HOH 71  671  671  HOH HOH F . 
ZB 3 HOH 72  672  672  HOH HOH F . 
ZB 3 HOH 73  673  673  HOH HOH F . 
ZB 3 HOH 74  674  674  HOH HOH F . 
ZB 3 HOH 75  675  675  HOH HOH F . 
ZB 3 HOH 76  676  676  HOH HOH F . 
ZB 3 HOH 77  677  677  HOH HOH F . 
ZB 3 HOH 78  678  678  HOH HOH F . 
ZB 3 HOH 79  679  679  HOH HOH F . 
ZB 3 HOH 80  680  680  HOH HOH F . 
ZB 3 HOH 81  681  681  HOH HOH F . 
ZB 3 HOH 82  682  682  HOH HOH F . 
ZB 3 HOH 83  683  683  HOH HOH F . 
ZB 3 HOH 84  684  684  HOH HOH F . 
ZB 3 HOH 85  685  685  HOH HOH F . 
ZB 3 HOH 86  686  686  HOH HOH F . 
ZB 3 HOH 87  687  687  HOH HOH F . 
ZB 3 HOH 88  688  688  HOH HOH F . 
ZB 3 HOH 89  689  689  HOH HOH F . 
ZB 3 HOH 90  690  690  HOH HOH F . 
ZB 3 HOH 91  691  691  HOH HOH F . 
ZB 3 HOH 92  692  692  HOH HOH F . 
ZB 3 HOH 93  693  693  HOH HOH F . 
ZB 3 HOH 94  694  694  HOH HOH F . 
ZB 3 HOH 95  695  695  HOH HOH F . 
ZB 3 HOH 96  696  696  HOH HOH F . 
ZB 3 HOH 97  697  697  HOH HOH F . 
ZB 3 HOH 98  698  698  HOH HOH F . 
ZB 3 HOH 99  699  699  HOH HOH F . 
ZB 3 HOH 100 700  700  HOH HOH F . 
ZB 3 HOH 101 701  701  HOH HOH F . 
ZB 3 HOH 102 702  702  HOH HOH F . 
ZB 3 HOH 103 703  703  HOH HOH F . 
ZB 3 HOH 104 704  704  HOH HOH F . 
ZB 3 HOH 105 705  705  HOH HOH F . 
ZB 3 HOH 106 706  706  HOH HOH F . 
ZB 3 HOH 107 707  707  HOH HOH F . 
ZB 3 HOH 108 708  708  HOH HOH F . 
ZB 3 HOH 109 709  709  HOH HOH F . 
ZB 3 HOH 110 710  710  HOH HOH F . 
ZB 3 HOH 111 711  711  HOH HOH F . 
ZB 3 HOH 112 712  712  HOH HOH F . 
ZB 3 HOH 113 713  713  HOH HOH F . 
ZB 3 HOH 114 714  714  HOH HOH F . 
ZB 3 HOH 115 715  715  HOH HOH F . 
ZB 3 HOH 116 716  716  HOH HOH F . 
ZB 3 HOH 117 717  717  HOH HOH F . 
ZB 3 HOH 118 718  718  HOH HOH F . 
ZB 3 HOH 119 719  719  HOH HOH F . 
ZB 3 HOH 120 720  720  HOH HOH F . 
ZB 3 HOH 121 721  721  HOH HOH F . 
ZB 3 HOH 122 722  722  HOH HOH F . 
ZB 3 HOH 123 723  723  HOH HOH F . 
ZB 3 HOH 124 724  724  HOH HOH F . 
ZB 3 HOH 125 725  725  HOH HOH F . 
ZB 3 HOH 126 726  726  HOH HOH F . 
ZB 3 HOH 127 727  727  HOH HOH F . 
ZB 3 HOH 128 728  728  HOH HOH F . 
ZB 3 HOH 129 729  729  HOH HOH F . 
ZB 3 HOH 130 730  730  HOH HOH F . 
ZB 3 HOH 131 731  731  HOH HOH F . 
ZB 3 HOH 132 732  732  HOH HOH F . 
ZB 3 HOH 133 733  733  HOH HOH F . 
ZB 3 HOH 134 734  734  HOH HOH F . 
ZB 3 HOH 135 735  735  HOH HOH F . 
ZB 3 HOH 136 736  736  HOH HOH F . 
ZB 3 HOH 137 737  737  HOH HOH F . 
ZB 3 HOH 138 738  738  HOH HOH F . 
ZB 3 HOH 139 739  739  HOH HOH F . 
ZB 3 HOH 140 740  740  HOH HOH F . 
ZB 3 HOH 141 741  741  HOH HOH F . 
ZB 3 HOH 142 742  742  HOH HOH F . 
ZB 3 HOH 143 743  743  HOH HOH F . 
ZB 3 HOH 144 744  744  HOH HOH F . 
ZB 3 HOH 145 745  745  HOH HOH F . 
ZB 3 HOH 146 746  746  HOH HOH F . 
ZB 3 HOH 147 747  747  HOH HOH F . 
ZB 3 HOH 148 748  748  HOH HOH F . 
ZB 3 HOH 149 749  749  HOH HOH F . 
ZB 3 HOH 150 750  750  HOH HOH F . 
ZB 3 HOH 151 751  751  HOH HOH F . 
ZB 3 HOH 152 752  752  HOH HOH F . 
ZB 3 HOH 153 753  753  HOH HOH F . 
ZB 3 HOH 154 754  754  HOH HOH F . 
ZB 3 HOH 155 755  755  HOH HOH F . 
ZB 3 HOH 156 756  756  HOH HOH F . 
ZB 3 HOH 157 757  757  HOH HOH F . 
ZB 3 HOH 158 758  758  HOH HOH F . 
ZB 3 HOH 159 759  759  HOH HOH F . 
ZB 3 HOH 160 760  760  HOH HOH F . 
ZB 3 HOH 161 761  761  HOH HOH F . 
ZB 3 HOH 162 762  762  HOH HOH F . 
ZB 3 HOH 163 763  763  HOH HOH F . 
ZB 3 HOH 164 764  764  HOH HOH F . 
ZB 3 HOH 165 765  765  HOH HOH F . 
ZB 3 HOH 166 766  766  HOH HOH F . 
ZB 3 HOH 167 767  767  HOH HOH F . 
ZB 3 HOH 168 768  768  HOH HOH F . 
ZB 3 HOH 169 769  769  HOH HOH F . 
ZB 3 HOH 170 770  770  HOH HOH F . 
ZB 3 HOH 171 771  771  HOH HOH F . 
ZB 3 HOH 172 772  772  HOH HOH F . 
ZB 3 HOH 173 773  773  HOH HOH F . 
ZB 3 HOH 174 774  774  HOH HOH F . 
ZB 3 HOH 175 775  775  HOH HOH F . 
ZB 3 HOH 176 776  776  HOH HOH F . 
ZB 3 HOH 177 777  777  HOH HOH F . 
ZB 3 HOH 178 778  778  HOH HOH F . 
ZB 3 HOH 179 779  779  HOH HOH F . 
ZB 3 HOH 180 780  780  HOH HOH F . 
ZB 3 HOH 181 781  781  HOH HOH F . 
ZB 3 HOH 182 782  782  HOH HOH F . 
ZB 3 HOH 183 783  783  HOH HOH F . 
ZB 3 HOH 184 784  784  HOH HOH F . 
ZB 3 HOH 185 785  785  HOH HOH F . 
ZB 3 HOH 186 786  786  HOH HOH F . 
ZB 3 HOH 187 787  787  HOH HOH F . 
ZB 3 HOH 188 788  788  HOH HOH F . 
ZB 3 HOH 189 789  789  HOH HOH F . 
ZB 3 HOH 190 790  790  HOH HOH F . 
ZB 3 HOH 191 791  791  HOH HOH F . 
ZB 3 HOH 192 792  792  HOH HOH F . 
ZB 3 HOH 193 793  793  HOH HOH F . 
ZB 3 HOH 194 794  794  HOH HOH F . 
ZB 3 HOH 195 795  795  HOH HOH F . 
ZB 3 HOH 196 796  796  HOH HOH F . 
ZB 3 HOH 197 797  797  HOH HOH F . 
ZB 3 HOH 198 798  798  HOH HOH F . 
ZB 3 HOH 199 799  799  HOH HOH F . 
ZB 3 HOH 200 800  800  HOH HOH F . 
ZB 3 HOH 201 801  801  HOH HOH F . 
ZB 3 HOH 202 802  802  HOH HOH F . 
ZB 3 HOH 203 803  803  HOH HOH F . 
ZB 3 HOH 204 804  804  HOH HOH F . 
ZB 3 HOH 205 805  805  HOH HOH F . 
ZB 3 HOH 206 806  806  HOH HOH F . 
ZB 3 HOH 207 807  807  HOH HOH F . 
ZB 3 HOH 208 808  808  HOH HOH F . 
ZB 3 HOH 209 809  809  HOH HOH F . 
ZB 3 HOH 210 810  810  HOH HOH F . 
ZB 3 HOH 211 811  811  HOH HOH F . 
ZB 3 HOH 212 812  812  HOH HOH F . 
ZB 3 HOH 213 813  813  HOH HOH F . 
ZB 3 HOH 214 814  814  HOH HOH F . 
ZB 3 HOH 215 815  815  HOH HOH F . 
ZB 3 HOH 216 816  816  HOH HOH F . 
ZB 3 HOH 217 817  817  HOH HOH F . 
ZB 3 HOH 218 818  818  HOH HOH F . 
ZB 3 HOH 219 819  819  HOH HOH F . 
ZB 3 HOH 220 820  820  HOH HOH F . 
ZB 3 HOH 221 821  821  HOH HOH F . 
ZB 3 HOH 222 822  822  HOH HOH F . 
ZB 3 HOH 223 823  823  HOH HOH F . 
ZB 3 HOH 224 824  824  HOH HOH F . 
ZB 3 HOH 225 825  825  HOH HOH F . 
ZB 3 HOH 226 826  826  HOH HOH F . 
ZB 3 HOH 227 827  827  HOH HOH F . 
ZB 3 HOH 228 828  828  HOH HOH F . 
ZB 3 HOH 229 829  829  HOH HOH F . 
ZB 3 HOH 230 830  830  HOH HOH F . 
ZB 3 HOH 231 831  831  HOH HOH F . 
ZB 3 HOH 232 832  832  HOH HOH F . 
ZB 3 HOH 233 833  833  HOH HOH F . 
ZB 3 HOH 234 834  834  HOH HOH F . 
ZB 3 HOH 235 835  835  HOH HOH F . 
ZB 3 HOH 236 836  836  HOH HOH F . 
ZB 3 HOH 237 837  837  HOH HOH F . 
ZB 3 HOH 238 838  838  HOH HOH F . 
ZB 3 HOH 239 839  839  HOH HOH F . 
ZB 3 HOH 240 840  840  HOH HOH F . 
ZB 3 HOH 241 841  841  HOH HOH F . 
ZB 3 HOH 242 842  842  HOH HOH F . 
ZB 3 HOH 243 843  843  HOH HOH F . 
ZB 3 HOH 244 844  844  HOH HOH F . 
ZB 3 HOH 245 845  845  HOH HOH F . 
ZB 3 HOH 246 846  846  HOH HOH F . 
ZB 3 HOH 247 847  847  HOH HOH F . 
ZB 3 HOH 248 848  848  HOH HOH F . 
ZB 3 HOH 249 849  849  HOH HOH F . 
ZB 3 HOH 250 850  850  HOH HOH F . 
ZB 3 HOH 251 851  851  HOH HOH F . 
ZB 3 HOH 252 852  852  HOH HOH F . 
ZB 3 HOH 253 853  853  HOH HOH F . 
ZB 3 HOH 254 854  854  HOH HOH F . 
ZB 3 HOH 255 855  855  HOH HOH F . 
ZB 3 HOH 256 856  856  HOH HOH F . 
ZB 3 HOH 257 857  857  HOH HOH F . 
ZB 3 HOH 258 858  858  HOH HOH F . 
ZB 3 HOH 259 859  859  HOH HOH F . 
ZB 3 HOH 260 860  860  HOH HOH F . 
ZB 3 HOH 261 861  861  HOH HOH F . 
ZB 3 HOH 262 862  862  HOH HOH F . 
ZB 3 HOH 263 863  863  HOH HOH F . 
ZB 3 HOH 264 864  864  HOH HOH F . 
ZB 3 HOH 265 865  865  HOH HOH F . 
ZB 3 HOH 266 866  866  HOH HOH F . 
ZB 3 HOH 267 867  867  HOH HOH F . 
ZB 3 HOH 268 868  868  HOH HOH F . 
ZB 3 HOH 269 869  869  HOH HOH F . 
ZB 3 HOH 270 870  870  HOH HOH F . 
ZB 3 HOH 271 871  871  HOH HOH F . 
ZB 3 HOH 272 872  872  HOH HOH F . 
ZB 3 HOH 273 873  873  HOH HOH F . 
ZB 3 HOH 274 874  874  HOH HOH F . 
ZB 3 HOH 275 875  875  HOH HOH F . 
ZB 3 HOH 276 876  876  HOH HOH F . 
ZB 3 HOH 277 877  877  HOH HOH F . 
ZB 3 HOH 278 878  878  HOH HOH F . 
ZB 3 HOH 279 879  879  HOH HOH F . 
ZB 3 HOH 280 880  880  HOH HOH F . 
ZB 3 HOH 281 881  881  HOH HOH F . 
ZB 3 HOH 282 882  882  HOH HOH F . 
ZB 3 HOH 283 883  883  HOH HOH F . 
ZB 3 HOH 284 884  884  HOH HOH F . 
ZB 3 HOH 285 885  885  HOH HOH F . 
ZB 3 HOH 286 886  886  HOH HOH F . 
ZB 3 HOH 287 887  887  HOH HOH F . 
ZB 3 HOH 288 888  888  HOH HOH F . 
ZB 3 HOH 289 889  889  HOH HOH F . 
ZB 3 HOH 290 890  890  HOH HOH F . 
ZB 3 HOH 291 891  891  HOH HOH F . 
ZB 3 HOH 292 892  892  HOH HOH F . 
ZB 3 HOH 293 893  893  HOH HOH F . 
ZB 3 HOH 294 894  894  HOH HOH F . 
ZB 3 HOH 295 895  895  HOH HOH F . 
ZB 3 HOH 296 896  896  HOH HOH F . 
ZB 3 HOH 297 897  897  HOH HOH F . 
ZB 3 HOH 298 898  898  HOH HOH F . 
ZB 3 HOH 299 899  899  HOH HOH F . 
ZB 3 HOH 300 900  900  HOH HOH F . 
ZB 3 HOH 301 901  901  HOH HOH F . 
ZB 3 HOH 302 902  902  HOH HOH F . 
ZB 3 HOH 303 903  903  HOH HOH F . 
ZB 3 HOH 304 904  904  HOH HOH F . 
ZB 3 HOH 305 905  905  HOH HOH F . 
ZB 3 HOH 306 906  906  HOH HOH F . 
ZB 3 HOH 307 907  907  HOH HOH F . 
ZB 3 HOH 308 908  908  HOH HOH F . 
ZB 3 HOH 309 909  909  HOH HOH F . 
ZB 3 HOH 310 910  910  HOH HOH F . 
ZB 3 HOH 311 911  911  HOH HOH F . 
ZB 3 HOH 312 912  912  HOH HOH F . 
ZB 3 HOH 313 913  913  HOH HOH F . 
ZB 3 HOH 314 914  914  HOH HOH F . 
ZB 3 HOH 315 915  915  HOH HOH F . 
ZB 3 HOH 316 916  916  HOH HOH F . 
ZB 3 HOH 317 917  917  HOH HOH F . 
ZB 3 HOH 318 918  918  HOH HOH F . 
ZB 3 HOH 319 919  919  HOH HOH F . 
ZB 3 HOH 320 920  920  HOH HOH F . 
ZB 3 HOH 321 921  921  HOH HOH F . 
ZB 3 HOH 322 922  922  HOH HOH F . 
ZB 3 HOH 323 923  923  HOH HOH F . 
ZB 3 HOH 324 924  924  HOH HOH F . 
ZB 3 HOH 325 925  925  HOH HOH F . 
ZB 3 HOH 326 926  926  HOH HOH F . 
ZB 3 HOH 327 927  927  HOH HOH F . 
ZB 3 HOH 328 928  928  HOH HOH F . 
ZB 3 HOH 329 929  929  HOH HOH F . 
ZB 3 HOH 330 930  930  HOH HOH F . 
ZB 3 HOH 331 931  931  HOH HOH F . 
ZB 3 HOH 332 932  932  HOH HOH F . 
ZB 3 HOH 333 933  933  HOH HOH F . 
ZB 3 HOH 334 934  934  HOH HOH F . 
ZB 3 HOH 335 935  935  HOH HOH F . 
ZB 3 HOH 336 936  936  HOH HOH F . 
ZB 3 HOH 337 937  937  HOH HOH F . 
ZB 3 HOH 338 938  938  HOH HOH F . 
ZB 3 HOH 339 939  939  HOH HOH F . 
ZB 3 HOH 340 940  940  HOH HOH F . 
ZB 3 HOH 341 941  941  HOH HOH F . 
ZB 3 HOH 342 942  942  HOH HOH F . 
ZB 3 HOH 343 943  943  HOH HOH F . 
ZB 3 HOH 344 944  944  HOH HOH F . 
ZB 3 HOH 345 945  945  HOH HOH F . 
ZB 3 HOH 346 946  946  HOH HOH F . 
ZB 3 HOH 347 947  947  HOH HOH F . 
ZB 3 HOH 348 948  948  HOH HOH F . 
ZB 3 HOH 349 949  949  HOH HOH F . 
ZB 3 HOH 350 950  950  HOH HOH F . 
ZB 3 HOH 351 951  951  HOH HOH F . 
ZB 3 HOH 352 952  952  HOH HOH F . 
ZB 3 HOH 353 953  953  HOH HOH F . 
ZB 3 HOH 354 954  954  HOH HOH F . 
ZB 3 HOH 355 955  955  HOH HOH F . 
ZB 3 HOH 356 956  956  HOH HOH F . 
ZB 3 HOH 357 957  957  HOH HOH F . 
ZB 3 HOH 358 958  958  HOH HOH F . 
ZB 3 HOH 359 959  959  HOH HOH F . 
ZB 3 HOH 360 960  960  HOH HOH F . 
ZB 3 HOH 361 961  961  HOH HOH F . 
ZB 3 HOH 362 962  962  HOH HOH F . 
ZB 3 HOH 363 963  963  HOH HOH F . 
ZB 3 HOH 364 964  964  HOH HOH F . 
ZB 3 HOH 365 965  965  HOH HOH F . 
ZB 3 HOH 366 966  966  HOH HOH F . 
ZB 3 HOH 367 967  967  HOH HOH F . 
ZB 3 HOH 368 968  968  HOH HOH F . 
ZB 3 HOH 369 969  969  HOH HOH F . 
ZB 3 HOH 370 970  970  HOH HOH F . 
ZB 3 HOH 371 971  971  HOH HOH F . 
ZB 3 HOH 372 972  972  HOH HOH F . 
ZB 3 HOH 373 973  973  HOH HOH F . 
ZB 3 HOH 374 974  974  HOH HOH F . 
ZB 3 HOH 375 975  975  HOH HOH F . 
ZB 3 HOH 376 976  976  HOH HOH F . 
ZB 3 HOH 377 977  977  HOH HOH F . 
ZB 3 HOH 378 978  978  HOH HOH F . 
ZB 3 HOH 379 979  979  HOH HOH F . 
ZB 3 HOH 380 980  980  HOH HOH F . 
ZB 3 HOH 381 981  981  HOH HOH F . 
ZB 3 HOH 382 982  982  HOH HOH F . 
ZB 3 HOH 383 983  983  HOH HOH F . 
ZB 3 HOH 384 984  984  HOH HOH F . 
ZB 3 HOH 385 985  985  HOH HOH F . 
ZB 3 HOH 386 986  986  HOH HOH F . 
ZB 3 HOH 387 987  987  HOH HOH F . 
ZB 3 HOH 388 988  988  HOH HOH F . 
ZB 3 HOH 389 989  989  HOH HOH F . 
ZB 3 HOH 390 990  990  HOH HOH F . 
ZB 3 HOH 391 991  991  HOH HOH F . 
ZB 3 HOH 392 992  992  HOH HOH F . 
ZB 3 HOH 393 993  993  HOH HOH F . 
ZB 3 HOH 394 994  994  HOH HOH F . 
ZB 3 HOH 395 995  995  HOH HOH F . 
ZB 3 HOH 396 996  996  HOH HOH F . 
ZB 3 HOH 397 997  997  HOH HOH F . 
ZB 3 HOH 398 998  998  HOH HOH F . 
ZB 3 HOH 399 999  999  HOH HOH F . 
ZB 3 HOH 400 1000 1000 HOH HOH F . 
ZB 3 HOH 401 1001 1001 HOH HOH F . 
ZB 3 HOH 402 1002 1002 HOH HOH F . 
ZB 3 HOH 403 1003 1003 HOH HOH F . 
ZB 3 HOH 404 1004 1004 HOH HOH F . 
ZB 3 HOH 405 1005 1005 HOH HOH F . 
ZB 3 HOH 406 1006 1006 HOH HOH F . 
ZB 3 HOH 407 1007 1007 HOH HOH F . 
ZB 3 HOH 408 1008 1008 HOH HOH F . 
ZB 3 HOH 409 1009 1009 HOH HOH F . 
ZB 3 HOH 410 1010 1010 HOH HOH F . 
ZB 3 HOH 411 1011 1011 HOH HOH F . 
ZB 3 HOH 412 1012 1012 HOH HOH F . 
ZB 3 HOH 413 1013 1013 HOH HOH F . 
ZB 3 HOH 414 1014 1014 HOH HOH F . 
ZB 3 HOH 415 1015 1015 HOH HOH F . 
ZB 3 HOH 416 1016 1016 HOH HOH F . 
ZB 3 HOH 417 1017 1017 HOH HOH F . 
ZB 3 HOH 418 1018 1018 HOH HOH F . 
ZB 3 HOH 419 1019 1019 HOH HOH F . 
ZB 3 HOH 420 1020 1020 HOH HOH F . 
ZB 3 HOH 421 1021 1021 HOH HOH F . 
ZB 3 HOH 422 1022 1022 HOH HOH F . 
ZB 3 HOH 423 1023 1023 HOH HOH F . 
ZB 3 HOH 424 1024 1024 HOH HOH F . 
ZB 3 HOH 425 1025 1025 HOH HOH F . 
ZB 3 HOH 426 1026 1026 HOH HOH F . 
ZB 3 HOH 427 1027 1027 HOH HOH F . 
ZB 3 HOH 428 1028 1028 HOH HOH F . 
ZB 3 HOH 429 1029 1029 HOH HOH F . 
ZB 3 HOH 430 1030 1030 HOH HOH F . 
ZB 3 HOH 431 1031 1031 HOH HOH F . 
ZB 3 HOH 432 1032 1032 HOH HOH F . 
ZB 3 HOH 433 1033 1033 HOH HOH F . 
ZB 3 HOH 434 1034 1034 HOH HOH F . 
ZB 3 HOH 435 1035 1035 HOH HOH F . 
ZB 3 HOH 436 1036 1036 HOH HOH F . 
ZB 3 HOH 437 1037 1037 HOH HOH F . 
ZB 3 HOH 438 1038 1038 HOH HOH F . 
ZB 3 HOH 439 1039 1039 HOH HOH F . 
ZB 3 HOH 440 1040 1040 HOH HOH F . 
ZB 3 HOH 441 1041 1041 HOH HOH F . 
ZB 3 HOH 442 1042 1042 HOH HOH F . 
ZB 3 HOH 443 1043 1043 HOH HOH F . 
ZB 3 HOH 444 1044 1044 HOH HOH F . 
ZB 3 HOH 445 1045 1045 HOH HOH F . 
ZB 3 HOH 446 1046 1046 HOH HOH F . 
ZB 3 HOH 447 1047 1047 HOH HOH F . 
ZB 3 HOH 448 1048 1048 HOH HOH F . 
ZB 3 HOH 449 1049 1049 HOH HOH F . 
ZB 3 HOH 450 1050 1050 HOH HOH F . 
ZB 3 HOH 451 1051 1051 HOH HOH F . 
ZB 3 HOH 452 1052 1052 HOH HOH F . 
ZB 3 HOH 453 1053 1053 HOH HOH F . 
ZB 3 HOH 454 1054 1054 HOH HOH F . 
ZB 3 HOH 455 1055 1055 HOH HOH F . 
ZB 3 HOH 456 1056 1056 HOH HOH F . 
ZB 3 HOH 457 1057 1057 HOH HOH F . 
ZB 3 HOH 458 1058 1058 HOH HOH F . 
ZB 3 HOH 459 1059 1059 HOH HOH F . 
ZB 3 HOH 460 1060 1060 HOH HOH F . 
ZB 3 HOH 461 1061 1061 HOH HOH F . 
ZB 3 HOH 462 1062 1062 HOH HOH F . 
ZB 3 HOH 463 1063 1063 HOH HOH F . 
ZB 3 HOH 464 1064 1064 HOH HOH F . 
ZB 3 HOH 465 1065 1065 HOH HOH F . 
ZB 3 HOH 466 1066 1066 HOH HOH F . 
ZB 3 HOH 467 1067 1067 HOH HOH F . 
ZB 3 HOH 468 1068 1068 HOH HOH F . 
ZB 3 HOH 469 1069 1069 HOH HOH F . 
ZB 3 HOH 470 1070 1070 HOH HOH F . 
ZB 3 HOH 471 1071 1071 HOH HOH F . 
ZB 3 HOH 472 1072 1072 HOH HOH F . 
ZB 3 HOH 473 1073 1073 HOH HOH F . 
ZB 3 HOH 474 1074 1074 HOH HOH F . 
ZB 3 HOH 475 1075 1075 HOH HOH F . 
ZB 3 HOH 476 1076 1076 HOH HOH F . 
ZB 3 HOH 477 1077 1077 HOH HOH F . 
ZB 3 HOH 478 1078 1078 HOH HOH F . 
ZB 3 HOH 479 1079 1079 HOH HOH F . 
ZB 3 HOH 480 1080 1080 HOH HOH F . 
ZB 3 HOH 481 1081 1081 HOH HOH F . 
ZB 3 HOH 482 1082 1082 HOH HOH F . 
ZB 3 HOH 483 1083 1083 HOH HOH F . 
ZB 3 HOH 484 1084 1084 HOH HOH F . 
ZB 3 HOH 485 1085 1085 HOH HOH F . 
ZB 3 HOH 486 1086 1086 HOH HOH F . 
ZB 3 HOH 487 1087 1087 HOH HOH F . 
ZB 3 HOH 488 1088 1088 HOH HOH F . 
ZB 3 HOH 489 1089 1089 HOH HOH F . 
ZB 3 HOH 490 1090 1090 HOH HOH F . 
ZB 3 HOH 491 1091 1091 HOH HOH F . 
ZB 3 HOH 492 1092 1092 HOH HOH F . 
ZB 3 HOH 493 1093 1093 HOH HOH F . 
ZB 3 HOH 494 1094 1094 HOH HOH F . 
ZB 3 HOH 495 1095 1095 HOH HOH F . 
ZB 3 HOH 496 1096 1096 HOH HOH F . 
ZB 3 HOH 497 1097 1097 HOH HOH F . 
ZB 3 HOH 498 1098 1098 HOH HOH F . 
ZB 3 HOH 499 1099 1099 HOH HOH F . 
ZB 3 HOH 500 1100 1100 HOH HOH F . 
ZB 3 HOH 501 1101 1101 HOH HOH F . 
ZB 3 HOH 502 1102 1102 HOH HOH F . 
ZB 3 HOH 503 1103 1103 HOH HOH F . 
ZB 3 HOH 504 1104 1104 HOH HOH F . 
ZB 3 HOH 505 1105 1105 HOH HOH F . 
ZB 3 HOH 506 1106 1106 HOH HOH F . 
ZB 3 HOH 507 1107 1107 HOH HOH F . 
ZB 3 HOH 508 1108 1108 HOH HOH F . 
ZB 3 HOH 509 1109 1109 HOH HOH F . 
ZB 3 HOH 510 1110 1110 HOH HOH F . 
ZB 3 HOH 511 1111 1111 HOH HOH F . 
ZB 3 HOH 512 1112 1112 HOH HOH F . 
ZB 3 HOH 513 1113 1113 HOH HOH F . 
ZB 3 HOH 514 1114 1114 HOH HOH F . 
ZB 3 HOH 515 1115 1115 HOH HOH F . 
ZB 3 HOH 516 1116 1116 HOH HOH F . 
ZB 3 HOH 517 1117 1117 HOH HOH F . 
ZB 3 HOH 518 1118 1118 HOH HOH F . 
ZB 3 HOH 519 1119 1119 HOH HOH F . 
ZB 3 HOH 520 1120 1120 HOH HOH F . 
ZB 3 HOH 521 1121 1121 HOH HOH F . 
ZB 3 HOH 522 1122 1122 HOH HOH F . 
ZB 3 HOH 523 1123 1123 HOH HOH F . 
ZB 3 HOH 524 1124 1124 HOH HOH F . 
ZB 3 HOH 525 1125 1125 HOH HOH F . 
ZB 3 HOH 526 1126 1126 HOH HOH F . 
ZB 3 HOH 527 1127 1127 HOH HOH F . 
ZB 3 HOH 528 1128 1128 HOH HOH F . 
ZB 3 HOH 529 1129 1129 HOH HOH F . 
ZB 3 HOH 530 1130 1130 HOH HOH F . 
ZB 3 HOH 531 1131 1131 HOH HOH F . 
ZB 3 HOH 532 1132 1132 HOH HOH F . 
ZB 3 HOH 533 1133 1133 HOH HOH F . 
ZB 3 HOH 534 1134 1134 HOH HOH F . 
ZB 3 HOH 535 1135 1135 HOH HOH F . 
ZB 3 HOH 536 1136 1136 HOH HOH F . 
ZB 3 HOH 537 1137 1137 HOH HOH F . 
ZB 3 HOH 538 1138 1138 HOH HOH F . 
ZB 3 HOH 539 1139 1139 HOH HOH F . 
ZB 3 HOH 540 1140 1140 HOH HOH F . 
ZB 3 HOH 541 1141 1141 HOH HOH F . 
ZB 3 HOH 542 1142 1142 HOH HOH F . 
ZB 3 HOH 543 1143 1143 HOH HOH F . 
ZB 3 HOH 544 1144 1144 HOH HOH F . 
ZB 3 HOH 545 1145 1145 HOH HOH F . 
AC 3 HOH 1   601  601  HOH HOH G . 
AC 3 HOH 2   602  602  HOH HOH G . 
AC 3 HOH 3   603  603  HOH HOH G . 
AC 3 HOH 4   604  604  HOH HOH G . 
AC 3 HOH 5   605  605  HOH HOH G . 
AC 3 HOH 6   606  606  HOH HOH G . 
AC 3 HOH 7   607  607  HOH HOH G . 
AC 3 HOH 8   608  608  HOH HOH G . 
AC 3 HOH 9   609  609  HOH HOH G . 
AC 3 HOH 10  610  610  HOH HOH G . 
AC 3 HOH 11  611  611  HOH HOH G . 
AC 3 HOH 12  612  612  HOH HOH G . 
AC 3 HOH 13  613  613  HOH HOH G . 
AC 3 HOH 14  614  614  HOH HOH G . 
AC 3 HOH 15  615  615  HOH HOH G . 
AC 3 HOH 16  616  616  HOH HOH G . 
AC 3 HOH 17  617  617  HOH HOH G . 
AC 3 HOH 18  618  618  HOH HOH G . 
AC 3 HOH 19  619  619  HOH HOH G . 
AC 3 HOH 20  620  620  HOH HOH G . 
AC 3 HOH 21  621  621  HOH HOH G . 
AC 3 HOH 22  622  622  HOH HOH G . 
AC 3 HOH 23  623  623  HOH HOH G . 
AC 3 HOH 24  624  624  HOH HOH G . 
AC 3 HOH 25  625  625  HOH HOH G . 
AC 3 HOH 26  626  626  HOH HOH G . 
AC 3 HOH 27  627  627  HOH HOH G . 
AC 3 HOH 28  628  628  HOH HOH G . 
AC 3 HOH 29  629  629  HOH HOH G . 
AC 3 HOH 30  630  630  HOH HOH G . 
AC 3 HOH 31  631  631  HOH HOH G . 
AC 3 HOH 32  632  632  HOH HOH G . 
AC 3 HOH 33  633  633  HOH HOH G . 
AC 3 HOH 34  634  634  HOH HOH G . 
AC 3 HOH 35  635  635  HOH HOH G . 
AC 3 HOH 36  636  636  HOH HOH G . 
AC 3 HOH 37  637  637  HOH HOH G . 
AC 3 HOH 38  638  639  HOH HOH G . 
AC 3 HOH 39  639  640  HOH HOH G . 
AC 3 HOH 40  640  641  HOH HOH G . 
AC 3 HOH 41  641  642  HOH HOH G . 
AC 3 HOH 42  642  643  HOH HOH G . 
AC 3 HOH 43  643  644  HOH HOH G . 
AC 3 HOH 44  644  645  HOH HOH G . 
AC 3 HOH 45  645  646  HOH HOH G . 
AC 3 HOH 46  646  647  HOH HOH G . 
AC 3 HOH 47  647  648  HOH HOH G . 
AC 3 HOH 48  648  649  HOH HOH G . 
AC 3 HOH 49  649  650  HOH HOH G . 
AC 3 HOH 50  650  651  HOH HOH G . 
AC 3 HOH 51  651  652  HOH HOH G . 
AC 3 HOH 52  652  653  HOH HOH G . 
AC 3 HOH 53  653  654  HOH HOH G . 
AC 3 HOH 54  654  655  HOH HOH G . 
AC 3 HOH 55  655  656  HOH HOH G . 
AC 3 HOH 56  656  657  HOH HOH G . 
AC 3 HOH 57  657  658  HOH HOH G . 
AC 3 HOH 58  658  659  HOH HOH G . 
AC 3 HOH 59  659  660  HOH HOH G . 
AC 3 HOH 60  660  661  HOH HOH G . 
AC 3 HOH 61  661  662  HOH HOH G . 
AC 3 HOH 62  662  663  HOH HOH G . 
AC 3 HOH 63  663  664  HOH HOH G . 
AC 3 HOH 64  664  665  HOH HOH G . 
AC 3 HOH 65  665  666  HOH HOH G . 
AC 3 HOH 66  666  667  HOH HOH G . 
AC 3 HOH 67  667  668  HOH HOH G . 
AC 3 HOH 68  668  669  HOH HOH G . 
AC 3 HOH 69  669  670  HOH HOH G . 
AC 3 HOH 70  670  671  HOH HOH G . 
AC 3 HOH 71  671  672  HOH HOH G . 
AC 3 HOH 72  672  673  HOH HOH G . 
AC 3 HOH 73  673  674  HOH HOH G . 
AC 3 HOH 74  674  675  HOH HOH G . 
AC 3 HOH 75  675  676  HOH HOH G . 
AC 3 HOH 76  676  677  HOH HOH G . 
AC 3 HOH 77  677  678  HOH HOH G . 
AC 3 HOH 78  678  679  HOH HOH G . 
AC 3 HOH 79  679  680  HOH HOH G . 
AC 3 HOH 80  680  681  HOH HOH G . 
AC 3 HOH 81  681  682  HOH HOH G . 
AC 3 HOH 82  682  683  HOH HOH G . 
AC 3 HOH 83  683  684  HOH HOH G . 
AC 3 HOH 84  684  685  HOH HOH G . 
AC 3 HOH 85  685  686  HOH HOH G . 
AC 3 HOH 86  686  687  HOH HOH G . 
AC 3 HOH 87  687  688  HOH HOH G . 
AC 3 HOH 88  688  689  HOH HOH G . 
AC 3 HOH 89  689  690  HOH HOH G . 
AC 3 HOH 90  690  691  HOH HOH G . 
AC 3 HOH 91  691  692  HOH HOH G . 
AC 3 HOH 92  692  693  HOH HOH G . 
AC 3 HOH 93  693  694  HOH HOH G . 
AC 3 HOH 94  694  695  HOH HOH G . 
AC 3 HOH 95  695  696  HOH HOH G . 
AC 3 HOH 96  696  697  HOH HOH G . 
AC 3 HOH 97  697  698  HOH HOH G . 
AC 3 HOH 98  698  699  HOH HOH G . 
AC 3 HOH 99  699  700  HOH HOH G . 
AC 3 HOH 100 700  701  HOH HOH G . 
AC 3 HOH 101 701  702  HOH HOH G . 
AC 3 HOH 102 702  703  HOH HOH G . 
AC 3 HOH 103 703  704  HOH HOH G . 
AC 3 HOH 104 704  705  HOH HOH G . 
AC 3 HOH 105 705  706  HOH HOH G . 
AC 3 HOH 106 706  707  HOH HOH G . 
AC 3 HOH 107 707  708  HOH HOH G . 
AC 3 HOH 108 708  709  HOH HOH G . 
AC 3 HOH 109 709  710  HOH HOH G . 
AC 3 HOH 110 710  711  HOH HOH G . 
AC 3 HOH 111 711  712  HOH HOH G . 
AC 3 HOH 112 712  713  HOH HOH G . 
AC 3 HOH 113 713  714  HOH HOH G . 
AC 3 HOH 114 714  715  HOH HOH G . 
AC 3 HOH 115 715  716  HOH HOH G . 
AC 3 HOH 116 716  717  HOH HOH G . 
AC 3 HOH 117 717  718  HOH HOH G . 
AC 3 HOH 118 718  719  HOH HOH G . 
AC 3 HOH 119 719  720  HOH HOH G . 
AC 3 HOH 120 720  721  HOH HOH G . 
AC 3 HOH 121 721  722  HOH HOH G . 
AC 3 HOH 122 722  723  HOH HOH G . 
AC 3 HOH 123 723  724  HOH HOH G . 
AC 3 HOH 124 724  725  HOH HOH G . 
AC 3 HOH 125 725  726  HOH HOH G . 
AC 3 HOH 126 726  727  HOH HOH G . 
AC 3 HOH 127 727  728  HOH HOH G . 
AC 3 HOH 128 728  729  HOH HOH G . 
AC 3 HOH 129 729  730  HOH HOH G . 
AC 3 HOH 130 730  731  HOH HOH G . 
AC 3 HOH 131 731  732  HOH HOH G . 
AC 3 HOH 132 732  733  HOH HOH G . 
AC 3 HOH 133 733  734  HOH HOH G . 
AC 3 HOH 134 734  735  HOH HOH G . 
AC 3 HOH 135 735  736  HOH HOH G . 
AC 3 HOH 136 736  737  HOH HOH G . 
AC 3 HOH 137 737  738  HOH HOH G . 
AC 3 HOH 138 738  739  HOH HOH G . 
AC 3 HOH 139 739  740  HOH HOH G . 
AC 3 HOH 140 740  741  HOH HOH G . 
AC 3 HOH 141 741  742  HOH HOH G . 
AC 3 HOH 142 742  743  HOH HOH G . 
AC 3 HOH 143 743  744  HOH HOH G . 
AC 3 HOH 144 744  745  HOH HOH G . 
AC 3 HOH 145 745  746  HOH HOH G . 
AC 3 HOH 146 746  747  HOH HOH G . 
AC 3 HOH 147 747  748  HOH HOH G . 
AC 3 HOH 148 748  749  HOH HOH G . 
AC 3 HOH 149 749  750  HOH HOH G . 
AC 3 HOH 150 750  751  HOH HOH G . 
AC 3 HOH 151 751  752  HOH HOH G . 
AC 3 HOH 152 752  753  HOH HOH G . 
AC 3 HOH 153 753  754  HOH HOH G . 
AC 3 HOH 154 754  755  HOH HOH G . 
AC 3 HOH 155 755  756  HOH HOH G . 
AC 3 HOH 156 756  757  HOH HOH G . 
AC 3 HOH 157 757  758  HOH HOH G . 
AC 3 HOH 158 758  759  HOH HOH G . 
AC 3 HOH 159 759  760  HOH HOH G . 
AC 3 HOH 160 760  761  HOH HOH G . 
AC 3 HOH 161 761  762  HOH HOH G . 
AC 3 HOH 162 762  763  HOH HOH G . 
AC 3 HOH 163 763  764  HOH HOH G . 
AC 3 HOH 164 764  765  HOH HOH G . 
AC 3 HOH 165 765  766  HOH HOH G . 
AC 3 HOH 166 766  767  HOH HOH G . 
AC 3 HOH 167 767  768  HOH HOH G . 
AC 3 HOH 168 768  769  HOH HOH G . 
AC 3 HOH 169 769  770  HOH HOH G . 
AC 3 HOH 170 770  771  HOH HOH G . 
AC 3 HOH 171 771  772  HOH HOH G . 
AC 3 HOH 172 772  773  HOH HOH G . 
AC 3 HOH 173 773  774  HOH HOH G . 
AC 3 HOH 174 774  775  HOH HOH G . 
AC 3 HOH 175 775  776  HOH HOH G . 
AC 3 HOH 176 776  777  HOH HOH G . 
AC 3 HOH 177 777  778  HOH HOH G . 
AC 3 HOH 178 778  779  HOH HOH G . 
AC 3 HOH 179 779  780  HOH HOH G . 
AC 3 HOH 180 780  781  HOH HOH G . 
AC 3 HOH 181 781  782  HOH HOH G . 
AC 3 HOH 182 782  783  HOH HOH G . 
AC 3 HOH 183 783  784  HOH HOH G . 
AC 3 HOH 184 784  785  HOH HOH G . 
AC 3 HOH 185 785  786  HOH HOH G . 
AC 3 HOH 186 786  787  HOH HOH G . 
AC 3 HOH 187 787  788  HOH HOH G . 
AC 3 HOH 188 788  789  HOH HOH G . 
AC 3 HOH 189 789  790  HOH HOH G . 
AC 3 HOH 190 790  791  HOH HOH G . 
AC 3 HOH 191 791  792  HOH HOH G . 
AC 3 HOH 192 792  793  HOH HOH G . 
AC 3 HOH 193 793  794  HOH HOH G . 
AC 3 HOH 194 794  795  HOH HOH G . 
AC 3 HOH 195 795  796  HOH HOH G . 
AC 3 HOH 196 796  797  HOH HOH G . 
AC 3 HOH 197 797  798  HOH HOH G . 
AC 3 HOH 198 798  799  HOH HOH G . 
AC 3 HOH 199 799  800  HOH HOH G . 
AC 3 HOH 200 800  801  HOH HOH G . 
AC 3 HOH 201 801  802  HOH HOH G . 
AC 3 HOH 202 802  803  HOH HOH G . 
AC 3 HOH 203 803  804  HOH HOH G . 
AC 3 HOH 204 804  805  HOH HOH G . 
AC 3 HOH 205 805  806  HOH HOH G . 
AC 3 HOH 206 806  807  HOH HOH G . 
AC 3 HOH 207 807  808  HOH HOH G . 
AC 3 HOH 208 808  809  HOH HOH G . 
AC 3 HOH 209 809  810  HOH HOH G . 
AC 3 HOH 210 810  811  HOH HOH G . 
AC 3 HOH 211 811  812  HOH HOH G . 
AC 3 HOH 212 812  813  HOH HOH G . 
AC 3 HOH 213 813  814  HOH HOH G . 
AC 3 HOH 214 814  815  HOH HOH G . 
AC 3 HOH 215 815  816  HOH HOH G . 
AC 3 HOH 216 816  817  HOH HOH G . 
AC 3 HOH 217 817  818  HOH HOH G . 
AC 3 HOH 218 818  819  HOH HOH G . 
AC 3 HOH 219 819  820  HOH HOH G . 
AC 3 HOH 220 820  821  HOH HOH G . 
AC 3 HOH 221 821  822  HOH HOH G . 
AC 3 HOH 222 822  823  HOH HOH G . 
AC 3 HOH 223 823  824  HOH HOH G . 
AC 3 HOH 224 824  825  HOH HOH G . 
AC 3 HOH 225 825  826  HOH HOH G . 
AC 3 HOH 226 826  827  HOH HOH G . 
AC 3 HOH 227 827  828  HOH HOH G . 
AC 3 HOH 228 828  829  HOH HOH G . 
AC 3 HOH 229 829  830  HOH HOH G . 
AC 3 HOH 230 830  831  HOH HOH G . 
AC 3 HOH 231 831  832  HOH HOH G . 
AC 3 HOH 232 832  833  HOH HOH G . 
AC 3 HOH 233 833  834  HOH HOH G . 
AC 3 HOH 234 834  835  HOH HOH G . 
AC 3 HOH 235 835  836  HOH HOH G . 
AC 3 HOH 236 836  837  HOH HOH G . 
AC 3 HOH 237 837  838  HOH HOH G . 
AC 3 HOH 238 838  839  HOH HOH G . 
AC 3 HOH 239 839  840  HOH HOH G . 
AC 3 HOH 240 840  841  HOH HOH G . 
AC 3 HOH 241 841  842  HOH HOH G . 
AC 3 HOH 242 842  843  HOH HOH G . 
AC 3 HOH 243 843  844  HOH HOH G . 
AC 3 HOH 244 844  845  HOH HOH G . 
AC 3 HOH 245 845  846  HOH HOH G . 
AC 3 HOH 246 846  847  HOH HOH G . 
AC 3 HOH 247 847  848  HOH HOH G . 
AC 3 HOH 248 848  849  HOH HOH G . 
AC 3 HOH 249 849  850  HOH HOH G . 
AC 3 HOH 250 850  851  HOH HOH G . 
AC 3 HOH 251 851  852  HOH HOH G . 
AC 3 HOH 252 852  853  HOH HOH G . 
AC 3 HOH 253 853  854  HOH HOH G . 
AC 3 HOH 254 854  855  HOH HOH G . 
AC 3 HOH 255 855  856  HOH HOH G . 
AC 3 HOH 256 856  857  HOH HOH G . 
AC 3 HOH 257 857  858  HOH HOH G . 
AC 3 HOH 258 858  859  HOH HOH G . 
AC 3 HOH 259 859  860  HOH HOH G . 
AC 3 HOH 260 860  861  HOH HOH G . 
AC 3 HOH 261 861  862  HOH HOH G . 
AC 3 HOH 262 862  863  HOH HOH G . 
AC 3 HOH 263 863  864  HOH HOH G . 
AC 3 HOH 264 864  865  HOH HOH G . 
AC 3 HOH 265 865  866  HOH HOH G . 
AC 3 HOH 266 866  867  HOH HOH G . 
AC 3 HOH 267 867  868  HOH HOH G . 
AC 3 HOH 268 868  869  HOH HOH G . 
AC 3 HOH 269 869  870  HOH HOH G . 
AC 3 HOH 270 870  871  HOH HOH G . 
AC 3 HOH 271 871  872  HOH HOH G . 
AC 3 HOH 272 872  873  HOH HOH G . 
AC 3 HOH 273 873  874  HOH HOH G . 
AC 3 HOH 274 874  875  HOH HOH G . 
AC 3 HOH 275 875  876  HOH HOH G . 
AC 3 HOH 276 876  877  HOH HOH G . 
AC 3 HOH 277 877  878  HOH HOH G . 
AC 3 HOH 278 878  879  HOH HOH G . 
AC 3 HOH 279 879  880  HOH HOH G . 
AC 3 HOH 280 880  881  HOH HOH G . 
AC 3 HOH 281 881  882  HOH HOH G . 
AC 3 HOH 282 882  883  HOH HOH G . 
AC 3 HOH 283 883  884  HOH HOH G . 
AC 3 HOH 284 884  885  HOH HOH G . 
AC 3 HOH 285 885  886  HOH HOH G . 
AC 3 HOH 286 886  887  HOH HOH G . 
AC 3 HOH 287 887  888  HOH HOH G . 
AC 3 HOH 288 888  889  HOH HOH G . 
AC 3 HOH 289 889  890  HOH HOH G . 
AC 3 HOH 290 890  891  HOH HOH G . 
AC 3 HOH 291 891  892  HOH HOH G . 
AC 3 HOH 292 892  893  HOH HOH G . 
AC 3 HOH 293 893  894  HOH HOH G . 
AC 3 HOH 294 894  895  HOH HOH G . 
AC 3 HOH 295 895  896  HOH HOH G . 
AC 3 HOH 296 896  897  HOH HOH G . 
AC 3 HOH 297 897  898  HOH HOH G . 
AC 3 HOH 298 898  899  HOH HOH G . 
AC 3 HOH 299 899  900  HOH HOH G . 
AC 3 HOH 300 900  901  HOH HOH G . 
AC 3 HOH 301 901  902  HOH HOH G . 
AC 3 HOH 302 902  903  HOH HOH G . 
AC 3 HOH 303 903  904  HOH HOH G . 
AC 3 HOH 304 904  905  HOH HOH G . 
AC 3 HOH 305 905  906  HOH HOH G . 
AC 3 HOH 306 906  907  HOH HOH G . 
AC 3 HOH 307 907  908  HOH HOH G . 
AC 3 HOH 308 908  909  HOH HOH G . 
AC 3 HOH 309 909  910  HOH HOH G . 
AC 3 HOH 310 910  911  HOH HOH G . 
AC 3 HOH 311 911  912  HOH HOH G . 
AC 3 HOH 312 912  913  HOH HOH G . 
AC 3 HOH 313 913  914  HOH HOH G . 
AC 3 HOH 314 914  915  HOH HOH G . 
AC 3 HOH 315 915  916  HOH HOH G . 
AC 3 HOH 316 916  917  HOH HOH G . 
AC 3 HOH 317 917  918  HOH HOH G . 
AC 3 HOH 318 918  919  HOH HOH G . 
AC 3 HOH 319 919  920  HOH HOH G . 
AC 3 HOH 320 920  921  HOH HOH G . 
AC 3 HOH 321 921  922  HOH HOH G . 
AC 3 HOH 322 922  923  HOH HOH G . 
AC 3 HOH 323 923  924  HOH HOH G . 
AC 3 HOH 324 924  925  HOH HOH G . 
AC 3 HOH 325 925  926  HOH HOH G . 
AC 3 HOH 326 926  927  HOH HOH G . 
AC 3 HOH 327 927  928  HOH HOH G . 
AC 3 HOH 328 928  929  HOH HOH G . 
AC 3 HOH 329 929  930  HOH HOH G . 
AC 3 HOH 330 930  931  HOH HOH G . 
AC 3 HOH 331 931  932  HOH HOH G . 
AC 3 HOH 332 932  933  HOH HOH G . 
AC 3 HOH 333 933  934  HOH HOH G . 
AC 3 HOH 334 934  935  HOH HOH G . 
AC 3 HOH 335 935  936  HOH HOH G . 
AC 3 HOH 336 936  937  HOH HOH G . 
AC 3 HOH 337 937  938  HOH HOH G . 
AC 3 HOH 338 938  939  HOH HOH G . 
AC 3 HOH 339 939  940  HOH HOH G . 
AC 3 HOH 340 940  941  HOH HOH G . 
AC 3 HOH 341 941  942  HOH HOH G . 
AC 3 HOH 342 942  943  HOH HOH G . 
AC 3 HOH 343 943  944  HOH HOH G . 
AC 3 HOH 344 944  945  HOH HOH G . 
AC 3 HOH 345 945  946  HOH HOH G . 
AC 3 HOH 346 946  947  HOH HOH G . 
AC 3 HOH 347 947  948  HOH HOH G . 
AC 3 HOH 348 948  949  HOH HOH G . 
AC 3 HOH 349 949  950  HOH HOH G . 
AC 3 HOH 350 950  951  HOH HOH G . 
AC 3 HOH 351 951  952  HOH HOH G . 
AC 3 HOH 352 952  953  HOH HOH G . 
AC 3 HOH 353 953  954  HOH HOH G . 
AC 3 HOH 354 954  955  HOH HOH G . 
AC 3 HOH 355 955  956  HOH HOH G . 
AC 3 HOH 356 956  957  HOH HOH G . 
AC 3 HOH 357 957  958  HOH HOH G . 
AC 3 HOH 358 958  959  HOH HOH G . 
AC 3 HOH 359 959  960  HOH HOH G . 
AC 3 HOH 360 960  961  HOH HOH G . 
AC 3 HOH 361 961  962  HOH HOH G . 
AC 3 HOH 362 962  963  HOH HOH G . 
AC 3 HOH 363 963  964  HOH HOH G . 
AC 3 HOH 364 964  965  HOH HOH G . 
AC 3 HOH 365 965  966  HOH HOH G . 
AC 3 HOH 366 966  967  HOH HOH G . 
AC 3 HOH 367 967  968  HOH HOH G . 
AC 3 HOH 368 968  969  HOH HOH G . 
AC 3 HOH 369 969  970  HOH HOH G . 
AC 3 HOH 370 970  971  HOH HOH G . 
AC 3 HOH 371 971  972  HOH HOH G . 
AC 3 HOH 372 972  973  HOH HOH G . 
AC 3 HOH 373 973  974  HOH HOH G . 
AC 3 HOH 374 974  975  HOH HOH G . 
AC 3 HOH 375 975  976  HOH HOH G . 
AC 3 HOH 376 976  977  HOH HOH G . 
AC 3 HOH 377 977  978  HOH HOH G . 
AC 3 HOH 378 978  979  HOH HOH G . 
AC 3 HOH 379 979  980  HOH HOH G . 
AC 3 HOH 380 980  981  HOH HOH G . 
AC 3 HOH 381 981  982  HOH HOH G . 
AC 3 HOH 382 982  983  HOH HOH G . 
AC 3 HOH 383 983  984  HOH HOH G . 
AC 3 HOH 384 984  985  HOH HOH G . 
AC 3 HOH 385 985  986  HOH HOH G . 
AC 3 HOH 386 986  987  HOH HOH G . 
AC 3 HOH 387 987  988  HOH HOH G . 
AC 3 HOH 388 988  989  HOH HOH G . 
AC 3 HOH 389 989  990  HOH HOH G . 
AC 3 HOH 390 990  991  HOH HOH G . 
AC 3 HOH 391 991  992  HOH HOH G . 
AC 3 HOH 392 992  993  HOH HOH G . 
AC 3 HOH 393 993  994  HOH HOH G . 
AC 3 HOH 394 994  995  HOH HOH G . 
AC 3 HOH 395 995  996  HOH HOH G . 
AC 3 HOH 396 996  997  HOH HOH G . 
AC 3 HOH 397 997  998  HOH HOH G . 
AC 3 HOH 398 998  999  HOH HOH G . 
AC 3 HOH 399 999  1000 HOH HOH G . 
AC 3 HOH 400 1000 1001 HOH HOH G . 
AC 3 HOH 401 1001 1002 HOH HOH G . 
AC 3 HOH 402 1002 1003 HOH HOH G . 
AC 3 HOH 403 1003 1004 HOH HOH G . 
AC 3 HOH 404 1004 1005 HOH HOH G . 
AC 3 HOH 405 1005 1006 HOH HOH G . 
AC 3 HOH 406 1006 1007 HOH HOH G . 
AC 3 HOH 407 1007 1008 HOH HOH G . 
AC 3 HOH 408 1008 1009 HOH HOH G . 
AC 3 HOH 409 1009 1010 HOH HOH G . 
AC 3 HOH 410 1010 1011 HOH HOH G . 
AC 3 HOH 411 1011 1012 HOH HOH G . 
AC 3 HOH 412 1012 1013 HOH HOH G . 
AC 3 HOH 413 1013 1014 HOH HOH G . 
AC 3 HOH 414 1014 1015 HOH HOH G . 
AC 3 HOH 415 1015 1016 HOH HOH G . 
AC 3 HOH 416 1016 1017 HOH HOH G . 
AC 3 HOH 417 1017 1018 HOH HOH G . 
AC 3 HOH 418 1018 1019 HOH HOH G . 
AC 3 HOH 419 1019 1020 HOH HOH G . 
AC 3 HOH 420 1020 1021 HOH HOH G . 
AC 3 HOH 421 1021 1022 HOH HOH G . 
AC 3 HOH 422 1022 1023 HOH HOH G . 
AC 3 HOH 423 1023 1024 HOH HOH G . 
AC 3 HOH 424 1024 1025 HOH HOH G . 
AC 3 HOH 425 1025 1026 HOH HOH G . 
AC 3 HOH 426 1026 1027 HOH HOH G . 
AC 3 HOH 427 1027 1028 HOH HOH G . 
AC 3 HOH 428 1028 1029 HOH HOH G . 
AC 3 HOH 429 1029 1030 HOH HOH G . 
AC 3 HOH 430 1030 1031 HOH HOH G . 
AC 3 HOH 431 1031 1032 HOH HOH G . 
AC 3 HOH 432 1032 1033 HOH HOH G . 
AC 3 HOH 433 1033 1034 HOH HOH G . 
AC 3 HOH 434 1034 1035 HOH HOH G . 
AC 3 HOH 435 1035 1036 HOH HOH G . 
AC 3 HOH 436 1036 1037 HOH HOH G . 
AC 3 HOH 437 1037 1038 HOH HOH G . 
AC 3 HOH 438 1038 1039 HOH HOH G . 
AC 3 HOH 439 1039 1040 HOH HOH G . 
AC 3 HOH 440 1040 1041 HOH HOH G . 
AC 3 HOH 441 1041 1042 HOH HOH G . 
AC 3 HOH 442 1042 1043 HOH HOH G . 
AC 3 HOH 443 1043 1044 HOH HOH G . 
AC 3 HOH 444 1044 1045 HOH HOH G . 
AC 3 HOH 445 1045 1046 HOH HOH G . 
AC 3 HOH 446 1046 1047 HOH HOH G . 
AC 3 HOH 447 1047 1048 HOH HOH G . 
AC 3 HOH 448 1048 1049 HOH HOH G . 
AC 3 HOH 449 1049 1050 HOH HOH G . 
AC 3 HOH 450 1050 1051 HOH HOH G . 
AC 3 HOH 451 1051 1052 HOH HOH G . 
AC 3 HOH 452 1052 1053 HOH HOH G . 
AC 3 HOH 453 1053 1054 HOH HOH G . 
AC 3 HOH 454 1054 1055 HOH HOH G . 
AC 3 HOH 455 1055 1056 HOH HOH G . 
AC 3 HOH 456 1056 1057 HOH HOH G . 
AC 3 HOH 457 1057 1058 HOH HOH G . 
AC 3 HOH 458 1058 1059 HOH HOH G . 
AC 3 HOH 459 1059 1060 HOH HOH G . 
AC 3 HOH 460 1060 1061 HOH HOH G . 
AC 3 HOH 461 1061 1062 HOH HOH G . 
AC 3 HOH 462 1062 1063 HOH HOH G . 
AC 3 HOH 463 1063 1064 HOH HOH G . 
AC 3 HOH 464 1064 1065 HOH HOH G . 
AC 3 HOH 465 1065 1066 HOH HOH G . 
AC 3 HOH 466 1066 1067 HOH HOH G . 
AC 3 HOH 467 1067 1068 HOH HOH G . 
AC 3 HOH 468 1068 1069 HOH HOH G . 
AC 3 HOH 469 1069 1070 HOH HOH G . 
AC 3 HOH 470 1070 1071 HOH HOH G . 
AC 3 HOH 471 1071 1072 HOH HOH G . 
AC 3 HOH 472 1072 1073 HOH HOH G . 
AC 3 HOH 473 1073 1075 HOH HOH G . 
AC 3 HOH 474 1074 1076 HOH HOH G . 
AC 3 HOH 475 1075 1077 HOH HOH G . 
AC 3 HOH 476 1076 1074 HOH HOH G . 
AC 3 HOH 477 1077 1078 HOH HOH G . 
AC 3 HOH 478 1078 1079 HOH HOH G . 
AC 3 HOH 479 1079 1080 HOH HOH G . 
AC 3 HOH 480 1080 1081 HOH HOH G . 
AC 3 HOH 481 1081 1082 HOH HOH G . 
AC 3 HOH 482 1082 1083 HOH HOH G . 
AC 3 HOH 483 1083 1084 HOH HOH G . 
AC 3 HOH 484 1084 1085 HOH HOH G . 
AC 3 HOH 485 1085 1086 HOH HOH G . 
AC 3 HOH 486 1086 1087 HOH HOH G . 
AC 3 HOH 487 1087 1088 HOH HOH G . 
AC 3 HOH 488 1088 1089 HOH HOH G . 
AC 3 HOH 489 1089 1090 HOH HOH G . 
BC 3 HOH 1   601  601  HOH HOH M . 
BC 3 HOH 2   602  602  HOH HOH M . 
BC 3 HOH 3   603  603  HOH HOH M . 
BC 3 HOH 4   604  604  HOH HOH M . 
BC 3 HOH 5   605  605  HOH HOH M . 
BC 3 HOH 6   606  606  HOH HOH M . 
BC 3 HOH 7   607  607  HOH HOH M . 
BC 3 HOH 8   608  608  HOH HOH M . 
BC 3 HOH 9   609  609  HOH HOH M . 
BC 3 HOH 10  610  610  HOH HOH M . 
BC 3 HOH 11  611  611  HOH HOH M . 
BC 3 HOH 12  612  612  HOH HOH M . 
BC 3 HOH 13  613  613  HOH HOH M . 
BC 3 HOH 14  614  614  HOH HOH M . 
BC 3 HOH 15  615  615  HOH HOH M . 
BC 3 HOH 16  616  616  HOH HOH M . 
BC 3 HOH 17  617  617  HOH HOH M . 
BC 3 HOH 18  618  618  HOH HOH M . 
BC 3 HOH 19  619  619  HOH HOH M . 
BC 3 HOH 20  620  620  HOH HOH M . 
BC 3 HOH 21  621  621  HOH HOH M . 
BC 3 HOH 22  622  622  HOH HOH M . 
BC 3 HOH 23  623  623  HOH HOH M . 
BC 3 HOH 24  624  624  HOH HOH M . 
BC 3 HOH 25  625  625  HOH HOH M . 
BC 3 HOH 26  626  626  HOH HOH M . 
BC 3 HOH 27  627  627  HOH HOH M . 
BC 3 HOH 28  628  628  HOH HOH M . 
BC 3 HOH 29  629  629  HOH HOH M . 
BC 3 HOH 30  630  630  HOH HOH M . 
BC 3 HOH 31  631  631  HOH HOH M . 
BC 3 HOH 32  632  632  HOH HOH M . 
BC 3 HOH 33  633  633  HOH HOH M . 
BC 3 HOH 34  634  634  HOH HOH M . 
BC 3 HOH 35  635  635  HOH HOH M . 
BC 3 HOH 36  636  636  HOH HOH M . 
BC 3 HOH 37  637  637  HOH HOH M . 
BC 3 HOH 38  638  638  HOH HOH M . 
BC 3 HOH 39  639  639  HOH HOH M . 
BC 3 HOH 40  640  640  HOH HOH M . 
BC 3 HOH 41  641  641  HOH HOH M . 
BC 3 HOH 42  642  642  HOH HOH M . 
BC 3 HOH 43  643  643  HOH HOH M . 
BC 3 HOH 44  644  644  HOH HOH M . 
BC 3 HOH 45  645  645  HOH HOH M . 
BC 3 HOH 46  646  646  HOH HOH M . 
BC 3 HOH 47  647  647  HOH HOH M . 
BC 3 HOH 48  648  648  HOH HOH M . 
BC 3 HOH 49  649  649  HOH HOH M . 
BC 3 HOH 50  650  650  HOH HOH M . 
BC 3 HOH 51  651  651  HOH HOH M . 
BC 3 HOH 52  652  652  HOH HOH M . 
BC 3 HOH 53  653  653  HOH HOH M . 
BC 3 HOH 54  654  654  HOH HOH M . 
BC 3 HOH 55  655  655  HOH HOH M . 
BC 3 HOH 56  656  656  HOH HOH M . 
BC 3 HOH 57  657  657  HOH HOH M . 
BC 3 HOH 58  658  658  HOH HOH M . 
BC 3 HOH 59  659  659  HOH HOH M . 
BC 3 HOH 60  660  660  HOH HOH M . 
BC 3 HOH 61  661  661  HOH HOH M . 
BC 3 HOH 62  662  662  HOH HOH M . 
BC 3 HOH 63  663  663  HOH HOH M . 
BC 3 HOH 64  664  664  HOH HOH M . 
BC 3 HOH 65  665  665  HOH HOH M . 
BC 3 HOH 66  666  666  HOH HOH M . 
BC 3 HOH 67  667  667  HOH HOH M . 
BC 3 HOH 68  668  668  HOH HOH M . 
BC 3 HOH 69  669  669  HOH HOH M . 
BC 3 HOH 70  670  670  HOH HOH M . 
BC 3 HOH 71  671  671  HOH HOH M . 
BC 3 HOH 72  672  672  HOH HOH M . 
BC 3 HOH 73  673  673  HOH HOH M . 
BC 3 HOH 74  674  674  HOH HOH M . 
BC 3 HOH 75  675  675  HOH HOH M . 
BC 3 HOH 76  676  676  HOH HOH M . 
BC 3 HOH 77  677  677  HOH HOH M . 
BC 3 HOH 78  678  678  HOH HOH M . 
BC 3 HOH 79  679  679  HOH HOH M . 
BC 3 HOH 80  680  680  HOH HOH M . 
BC 3 HOH 81  681  681  HOH HOH M . 
BC 3 HOH 82  682  682  HOH HOH M . 
BC 3 HOH 83  683  683  HOH HOH M . 
BC 3 HOH 84  684  684  HOH HOH M . 
BC 3 HOH 85  685  685  HOH HOH M . 
BC 3 HOH 86  686  686  HOH HOH M . 
BC 3 HOH 87  687  687  HOH HOH M . 
BC 3 HOH 88  688  688  HOH HOH M . 
BC 3 HOH 89  689  689  HOH HOH M . 
BC 3 HOH 90  690  690  HOH HOH M . 
BC 3 HOH 91  691  691  HOH HOH M . 
BC 3 HOH 92  692  692  HOH HOH M . 
BC 3 HOH 93  693  693  HOH HOH M . 
BC 3 HOH 94  694  694  HOH HOH M . 
BC 3 HOH 95  695  695  HOH HOH M . 
BC 3 HOH 96  696  696  HOH HOH M . 
BC 3 HOH 97  697  697  HOH HOH M . 
BC 3 HOH 98  698  698  HOH HOH M . 
BC 3 HOH 99  699  699  HOH HOH M . 
BC 3 HOH 100 700  700  HOH HOH M . 
BC 3 HOH 101 701  701  HOH HOH M . 
BC 3 HOH 102 702  702  HOH HOH M . 
BC 3 HOH 103 703  703  HOH HOH M . 
BC 3 HOH 104 704  704  HOH HOH M . 
BC 3 HOH 105 705  705  HOH HOH M . 
BC 3 HOH 106 706  706  HOH HOH M . 
BC 3 HOH 107 707  707  HOH HOH M . 
BC 3 HOH 108 708  708  HOH HOH M . 
BC 3 HOH 109 709  709  HOH HOH M . 
BC 3 HOH 110 710  710  HOH HOH M . 
BC 3 HOH 111 711  711  HOH HOH M . 
BC 3 HOH 112 712  712  HOH HOH M . 
BC 3 HOH 113 713  713  HOH HOH M . 
BC 3 HOH 114 714  714  HOH HOH M . 
BC 3 HOH 115 715  715  HOH HOH M . 
BC 3 HOH 116 716  716  HOH HOH M . 
BC 3 HOH 117 717  717  HOH HOH M . 
BC 3 HOH 118 718  718  HOH HOH M . 
BC 3 HOH 119 719  719  HOH HOH M . 
BC 3 HOH 120 720  720  HOH HOH M . 
BC 3 HOH 121 721  721  HOH HOH M . 
BC 3 HOH 122 722  722  HOH HOH M . 
BC 3 HOH 123 723  723  HOH HOH M . 
BC 3 HOH 124 724  724  HOH HOH M . 
BC 3 HOH 125 725  725  HOH HOH M . 
BC 3 HOH 126 726  726  HOH HOH M . 
BC 3 HOH 127 727  727  HOH HOH M . 
BC 3 HOH 128 728  728  HOH HOH M . 
BC 3 HOH 129 729  729  HOH HOH M . 
BC 3 HOH 130 730  730  HOH HOH M . 
BC 3 HOH 131 731  731  HOH HOH M . 
BC 3 HOH 132 732  732  HOH HOH M . 
BC 3 HOH 133 733  733  HOH HOH M . 
BC 3 HOH 134 734  734  HOH HOH M . 
BC 3 HOH 135 735  735  HOH HOH M . 
BC 3 HOH 136 736  736  HOH HOH M . 
BC 3 HOH 137 737  737  HOH HOH M . 
BC 3 HOH 138 738  738  HOH HOH M . 
BC 3 HOH 139 739  739  HOH HOH M . 
BC 3 HOH 140 740  740  HOH HOH M . 
BC 3 HOH 141 741  741  HOH HOH M . 
BC 3 HOH 142 742  742  HOH HOH M . 
BC 3 HOH 143 743  743  HOH HOH M . 
BC 3 HOH 144 744  744  HOH HOH M . 
BC 3 HOH 145 745  745  HOH HOH M . 
BC 3 HOH 146 746  746  HOH HOH M . 
BC 3 HOH 147 747  747  HOH HOH M . 
BC 3 HOH 148 748  748  HOH HOH M . 
BC 3 HOH 149 749  749  HOH HOH M . 
BC 3 HOH 150 750  750  HOH HOH M . 
BC 3 HOH 151 751  751  HOH HOH M . 
BC 3 HOH 152 752  752  HOH HOH M . 
BC 3 HOH 153 753  753  HOH HOH M . 
BC 3 HOH 154 754  754  HOH HOH M . 
BC 3 HOH 155 755  755  HOH HOH M . 
BC 3 HOH 156 756  756  HOH HOH M . 
BC 3 HOH 157 757  757  HOH HOH M . 
BC 3 HOH 158 758  758  HOH HOH M . 
BC 3 HOH 159 759  759  HOH HOH M . 
BC 3 HOH 160 760  760  HOH HOH M . 
BC 3 HOH 161 761  761  HOH HOH M . 
BC 3 HOH 162 762  762  HOH HOH M . 
BC 3 HOH 163 763  763  HOH HOH M . 
BC 3 HOH 164 764  764  HOH HOH M . 
BC 3 HOH 165 765  765  HOH HOH M . 
BC 3 HOH 166 766  766  HOH HOH M . 
BC 3 HOH 167 767  767  HOH HOH M . 
BC 3 HOH 168 768  768  HOH HOH M . 
BC 3 HOH 169 769  769  HOH HOH M . 
BC 3 HOH 170 770  770  HOH HOH M . 
BC 3 HOH 171 771  771  HOH HOH M . 
BC 3 HOH 172 772  772  HOH HOH M . 
BC 3 HOH 173 773  773  HOH HOH M . 
BC 3 HOH 174 774  774  HOH HOH M . 
BC 3 HOH 175 775  775  HOH HOH M . 
BC 3 HOH 176 776  776  HOH HOH M . 
BC 3 HOH 177 777  777  HOH HOH M . 
BC 3 HOH 178 778  778  HOH HOH M . 
BC 3 HOH 179 779  779  HOH HOH M . 
BC 3 HOH 180 780  780  HOH HOH M . 
BC 3 HOH 181 781  781  HOH HOH M . 
BC 3 HOH 182 782  782  HOH HOH M . 
BC 3 HOH 183 783  783  HOH HOH M . 
BC 3 HOH 184 784  784  HOH HOH M . 
BC 3 HOH 185 785  785  HOH HOH M . 
BC 3 HOH 186 786  786  HOH HOH M . 
BC 3 HOH 187 787  787  HOH HOH M . 
BC 3 HOH 188 788  788  HOH HOH M . 
BC 3 HOH 189 789  789  HOH HOH M . 
BC 3 HOH 190 790  790  HOH HOH M . 
BC 3 HOH 191 791  791  HOH HOH M . 
BC 3 HOH 192 792  792  HOH HOH M . 
BC 3 HOH 193 793  793  HOH HOH M . 
BC 3 HOH 194 794  794  HOH HOH M . 
BC 3 HOH 195 795  795  HOH HOH M . 
BC 3 HOH 196 796  796  HOH HOH M . 
BC 3 HOH 197 797  797  HOH HOH M . 
BC 3 HOH 198 798  798  HOH HOH M . 
BC 3 HOH 199 799  799  HOH HOH M . 
BC 3 HOH 200 800  800  HOH HOH M . 
BC 3 HOH 201 801  801  HOH HOH M . 
BC 3 HOH 202 802  802  HOH HOH M . 
BC 3 HOH 203 803  803  HOH HOH M . 
BC 3 HOH 204 804  804  HOH HOH M . 
BC 3 HOH 205 805  805  HOH HOH M . 
BC 3 HOH 206 806  806  HOH HOH M . 
BC 3 HOH 207 807  807  HOH HOH M . 
BC 3 HOH 208 808  808  HOH HOH M . 
BC 3 HOH 209 809  809  HOH HOH M . 
BC 3 HOH 210 810  810  HOH HOH M . 
BC 3 HOH 211 811  811  HOH HOH M . 
BC 3 HOH 212 812  812  HOH HOH M . 
BC 3 HOH 213 813  813  HOH HOH M . 
BC 3 HOH 214 814  814  HOH HOH M . 
BC 3 HOH 215 815  815  HOH HOH M . 
BC 3 HOH 216 816  816  HOH HOH M . 
BC 3 HOH 217 817  817  HOH HOH M . 
BC 3 HOH 218 818  818  HOH HOH M . 
BC 3 HOH 219 819  819  HOH HOH M . 
BC 3 HOH 220 820  820  HOH HOH M . 
BC 3 HOH 221 821  821  HOH HOH M . 
BC 3 HOH 222 822  822  HOH HOH M . 
BC 3 HOH 223 823  823  HOH HOH M . 
BC 3 HOH 224 824  824  HOH HOH M . 
BC 3 HOH 225 825  825  HOH HOH M . 
BC 3 HOH 226 826  826  HOH HOH M . 
BC 3 HOH 227 827  827  HOH HOH M . 
BC 3 HOH 228 828  828  HOH HOH M . 
BC 3 HOH 229 829  829  HOH HOH M . 
BC 3 HOH 230 830  830  HOH HOH M . 
BC 3 HOH 231 831  831  HOH HOH M . 
BC 3 HOH 232 832  832  HOH HOH M . 
BC 3 HOH 233 833  833  HOH HOH M . 
BC 3 HOH 234 834  834  HOH HOH M . 
BC 3 HOH 235 835  835  HOH HOH M . 
BC 3 HOH 236 836  836  HOH HOH M . 
BC 3 HOH 237 837  837  HOH HOH M . 
BC 3 HOH 238 838  838  HOH HOH M . 
BC 3 HOH 239 839  839  HOH HOH M . 
BC 3 HOH 240 840  840  HOH HOH M . 
BC 3 HOH 241 841  841  HOH HOH M . 
BC 3 HOH 242 842  842  HOH HOH M . 
BC 3 HOH 243 843  843  HOH HOH M . 
BC 3 HOH 244 844  844  HOH HOH M . 
BC 3 HOH 245 845  845  HOH HOH M . 
BC 3 HOH 246 846  846  HOH HOH M . 
BC 3 HOH 247 847  847  HOH HOH M . 
BC 3 HOH 248 848  848  HOH HOH M . 
BC 3 HOH 249 849  849  HOH HOH M . 
BC 3 HOH 250 850  850  HOH HOH M . 
BC 3 HOH 251 851  851  HOH HOH M . 
BC 3 HOH 252 852  852  HOH HOH M . 
BC 3 HOH 253 853  853  HOH HOH M . 
BC 3 HOH 254 854  854  HOH HOH M . 
BC 3 HOH 255 855  855  HOH HOH M . 
BC 3 HOH 256 856  856  HOH HOH M . 
BC 3 HOH 257 857  857  HOH HOH M . 
BC 3 HOH 258 858  858  HOH HOH M . 
BC 3 HOH 259 859  859  HOH HOH M . 
BC 3 HOH 260 860  860  HOH HOH M . 
BC 3 HOH 261 861  861  HOH HOH M . 
BC 3 HOH 262 862  862  HOH HOH M . 
BC 3 HOH 263 863  863  HOH HOH M . 
BC 3 HOH 264 864  864  HOH HOH M . 
BC 3 HOH 265 865  865  HOH HOH M . 
BC 3 HOH 266 866  866  HOH HOH M . 
BC 3 HOH 267 867  867  HOH HOH M . 
BC 3 HOH 268 868  868  HOH HOH M . 
BC 3 HOH 269 869  869  HOH HOH M . 
BC 3 HOH 270 870  870  HOH HOH M . 
BC 3 HOH 271 871  871  HOH HOH M . 
BC 3 HOH 272 872  872  HOH HOH M . 
BC 3 HOH 273 873  873  HOH HOH M . 
BC 3 HOH 274 874  874  HOH HOH M . 
BC 3 HOH 275 875  875  HOH HOH M . 
BC 3 HOH 276 876  876  HOH HOH M . 
BC 3 HOH 277 877  877  HOH HOH M . 
BC 3 HOH 278 878  878  HOH HOH M . 
BC 3 HOH 279 879  879  HOH HOH M . 
BC 3 HOH 280 880  880  HOH HOH M . 
BC 3 HOH 281 881  881  HOH HOH M . 
BC 3 HOH 282 882  882  HOH HOH M . 
BC 3 HOH 283 883  883  HOH HOH M . 
BC 3 HOH 284 884  884  HOH HOH M . 
BC 3 HOH 285 885  885  HOH HOH M . 
BC 3 HOH 286 886  886  HOH HOH M . 
BC 3 HOH 287 887  887  HOH HOH M . 
BC 3 HOH 288 888  888  HOH HOH M . 
BC 3 HOH 289 889  889  HOH HOH M . 
BC 3 HOH 290 890  890  HOH HOH M . 
BC 3 HOH 291 891  891  HOH HOH M . 
BC 3 HOH 292 892  892  HOH HOH M . 
BC 3 HOH 293 893  893  HOH HOH M . 
BC 3 HOH 294 894  894  HOH HOH M . 
BC 3 HOH 295 895  895  HOH HOH M . 
BC 3 HOH 296 896  896  HOH HOH M . 
BC 3 HOH 297 897  897  HOH HOH M . 
BC 3 HOH 298 898  898  HOH HOH M . 
BC 3 HOH 299 899  899  HOH HOH M . 
BC 3 HOH 300 900  900  HOH HOH M . 
BC 3 HOH 301 901  901  HOH HOH M . 
BC 3 HOH 302 902  902  HOH HOH M . 
BC 3 HOH 303 903  903  HOH HOH M . 
BC 3 HOH 304 904  904  HOH HOH M . 
BC 3 HOH 305 905  905  HOH HOH M . 
BC 3 HOH 306 906  906  HOH HOH M . 
BC 3 HOH 307 907  907  HOH HOH M . 
BC 3 HOH 308 908  908  HOH HOH M . 
BC 3 HOH 309 909  909  HOH HOH M . 
BC 3 HOH 310 910  910  HOH HOH M . 
BC 3 HOH 311 911  911  HOH HOH M . 
BC 3 HOH 312 912  912  HOH HOH M . 
BC 3 HOH 313 913  913  HOH HOH M . 
BC 3 HOH 314 914  914  HOH HOH M . 
BC 3 HOH 315 915  915  HOH HOH M . 
BC 3 HOH 316 916  916  HOH HOH M . 
BC 3 HOH 317 917  917  HOH HOH M . 
BC 3 HOH 318 918  918  HOH HOH M . 
BC 3 HOH 319 919  919  HOH HOH M . 
BC 3 HOH 320 920  920  HOH HOH M . 
BC 3 HOH 321 921  921  HOH HOH M . 
BC 3 HOH 322 922  922  HOH HOH M . 
BC 3 HOH 323 923  923  HOH HOH M . 
BC 3 HOH 324 924  924  HOH HOH M . 
BC 3 HOH 325 925  925  HOH HOH M . 
BC 3 HOH 326 926  926  HOH HOH M . 
BC 3 HOH 327 927  927  HOH HOH M . 
BC 3 HOH 328 928  929  HOH HOH M . 
BC 3 HOH 329 929  930  HOH HOH M . 
BC 3 HOH 330 930  931  HOH HOH M . 
BC 3 HOH 331 931  932  HOH HOH M . 
BC 3 HOH 332 932  933  HOH HOH M . 
BC 3 HOH 333 933  934  HOH HOH M . 
BC 3 HOH 334 934  935  HOH HOH M . 
BC 3 HOH 335 935  936  HOH HOH M . 
BC 3 HOH 336 936  937  HOH HOH M . 
BC 3 HOH 337 937  938  HOH HOH M . 
BC 3 HOH 338 938  939  HOH HOH M . 
BC 3 HOH 339 939  940  HOH HOH M . 
BC 3 HOH 340 940  941  HOH HOH M . 
BC 3 HOH 341 941  942  HOH HOH M . 
BC 3 HOH 342 942  943  HOH HOH M . 
BC 3 HOH 343 943  944  HOH HOH M . 
BC 3 HOH 344 944  945  HOH HOH M . 
BC 3 HOH 345 945  946  HOH HOH M . 
BC 3 HOH 346 946  947  HOH HOH M . 
BC 3 HOH 347 947  948  HOH HOH M . 
BC 3 HOH 348 948  949  HOH HOH M . 
BC 3 HOH 349 949  950  HOH HOH M . 
BC 3 HOH 350 950  951  HOH HOH M . 
BC 3 HOH 351 951  952  HOH HOH M . 
BC 3 HOH 352 952  953  HOH HOH M . 
BC 3 HOH 353 953  954  HOH HOH M . 
BC 3 HOH 354 954  955  HOH HOH M . 
BC 3 HOH 355 955  956  HOH HOH M . 
BC 3 HOH 356 956  957  HOH HOH M . 
BC 3 HOH 357 957  958  HOH HOH M . 
BC 3 HOH 358 958  959  HOH HOH M . 
BC 3 HOH 359 959  960  HOH HOH M . 
BC 3 HOH 360 960  961  HOH HOH M . 
BC 3 HOH 361 961  962  HOH HOH M . 
BC 3 HOH 362 962  963  HOH HOH M . 
BC 3 HOH 363 963  964  HOH HOH M . 
BC 3 HOH 364 964  965  HOH HOH M . 
BC 3 HOH 365 965  966  HOH HOH M . 
BC 3 HOH 366 966  967  HOH HOH M . 
BC 3 HOH 367 967  968  HOH HOH M . 
BC 3 HOH 368 968  969  HOH HOH M . 
BC 3 HOH 369 969  970  HOH HOH M . 
BC 3 HOH 370 970  971  HOH HOH M . 
BC 3 HOH 371 971  972  HOH HOH M . 
BC 3 HOH 372 972  973  HOH HOH M . 
BC 3 HOH 373 973  974  HOH HOH M . 
BC 3 HOH 374 974  975  HOH HOH M . 
BC 3 HOH 375 975  976  HOH HOH M . 
BC 3 HOH 376 976  977  HOH HOH M . 
BC 3 HOH 377 977  978  HOH HOH M . 
BC 3 HOH 378 978  979  HOH HOH M . 
BC 3 HOH 379 979  980  HOH HOH M . 
BC 3 HOH 380 980  981  HOH HOH M . 
BC 3 HOH 381 981  982  HOH HOH M . 
BC 3 HOH 382 982  983  HOH HOH M . 
BC 3 HOH 383 983  984  HOH HOH M . 
BC 3 HOH 384 984  985  HOH HOH M . 
BC 3 HOH 385 985  986  HOH HOH M . 
BC 3 HOH 386 986  987  HOH HOH M . 
BC 3 HOH 387 987  988  HOH HOH M . 
BC 3 HOH 388 988  989  HOH HOH M . 
BC 3 HOH 389 989  990  HOH HOH M . 
BC 3 HOH 390 990  991  HOH HOH M . 
BC 3 HOH 391 991  992  HOH HOH M . 
BC 3 HOH 392 992  993  HOH HOH M . 
BC 3 HOH 393 993  994  HOH HOH M . 
BC 3 HOH 394 994  995  HOH HOH M . 
BC 3 HOH 395 995  996  HOH HOH M . 
BC 3 HOH 396 996  997  HOH HOH M . 
BC 3 HOH 397 997  998  HOH HOH M . 
BC 3 HOH 398 998  999  HOH HOH M . 
BC 3 HOH 399 999  1000 HOH HOH M . 
BC 3 HOH 400 1000 1001 HOH HOH M . 
BC 3 HOH 401 1001 1002 HOH HOH M . 
BC 3 HOH 402 1002 1003 HOH HOH M . 
BC 3 HOH 403 1003 1004 HOH HOH M . 
BC 3 HOH 404 1004 1005 HOH HOH M . 
BC 3 HOH 405 1005 1006 HOH HOH M . 
BC 3 HOH 406 1006 1007 HOH HOH M . 
BC 3 HOH 407 1007 1008 HOH HOH M . 
BC 3 HOH 408 1008 1009 HOH HOH M . 
BC 3 HOH 409 1009 1010 HOH HOH M . 
BC 3 HOH 410 1010 1011 HOH HOH M . 
BC 3 HOH 411 1011 1012 HOH HOH M . 
BC 3 HOH 412 1012 1013 HOH HOH M . 
BC 3 HOH 413 1013 1014 HOH HOH M . 
BC 3 HOH 414 1014 1015 HOH HOH M . 
BC 3 HOH 415 1015 1016 HOH HOH M . 
BC 3 HOH 416 1016 1017 HOH HOH M . 
BC 3 HOH 417 1017 1018 HOH HOH M . 
BC 3 HOH 418 1018 1019 HOH HOH M . 
BC 3 HOH 419 1019 1020 HOH HOH M . 
BC 3 HOH 420 1020 1021 HOH HOH M . 
BC 3 HOH 421 1021 1023 HOH HOH M . 
BC 3 HOH 422 1022 1024 HOH HOH M . 
BC 3 HOH 423 1023 1025 HOH HOH M . 
BC 3 HOH 424 1024 1026 HOH HOH M . 
BC 3 HOH 425 1025 1027 HOH HOH M . 
BC 3 HOH 426 1026 1028 HOH HOH M . 
BC 3 HOH 427 1027 1029 HOH HOH M . 
BC 3 HOH 428 1028 1030 HOH HOH M . 
BC 3 HOH 429 1029 1031 HOH HOH M . 
BC 3 HOH 430 1030 1032 HOH HOH M . 
BC 3 HOH 431 1031 1033 HOH HOH M . 
BC 3 HOH 432 1032 1034 HOH HOH M . 
BC 3 HOH 433 1033 1035 HOH HOH M . 
BC 3 HOH 434 1034 1036 HOH HOH M . 
BC 3 HOH 435 1035 1037 HOH HOH M . 
BC 3 HOH 436 1036 1038 HOH HOH M . 
BC 3 HOH 437 1037 1039 HOH HOH M . 
BC 3 HOH 438 1038 1040 HOH HOH M . 
BC 3 HOH 439 1039 1041 HOH HOH M . 
BC 3 HOH 440 1040 1042 HOH HOH M . 
BC 3 HOH 441 1041 1043 HOH HOH M . 
BC 3 HOH 442 1042 1044 HOH HOH M . 
BC 3 HOH 443 1043 1045 HOH HOH M . 
BC 3 HOH 444 1044 1046 HOH HOH M . 
BC 3 HOH 445 1045 1047 HOH HOH M . 
BC 3 HOH 446 1046 1048 HOH HOH M . 
BC 3 HOH 447 1047 1049 HOH HOH M . 
BC 3 HOH 448 1048 1050 HOH HOH M . 
BC 3 HOH 449 1049 1051 HOH HOH M . 
BC 3 HOH 450 1050 1052 HOH HOH M . 
BC 3 HOH 451 1051 1053 HOH HOH M . 
BC 3 HOH 452 1052 1054 HOH HOH M . 
BC 3 HOH 453 1053 1055 HOH HOH M . 
BC 3 HOH 454 1054 1056 HOH HOH M . 
BC 3 HOH 455 1055 1057 HOH HOH M . 
BC 3 HOH 456 1056 1058 HOH HOH M . 
BC 3 HOH 457 1057 1059 HOH HOH M . 
BC 3 HOH 458 1058 1060 HOH HOH M . 
BC 3 HOH 459 1059 1061 HOH HOH M . 
BC 3 HOH 460 1060 1062 HOH HOH M . 
BC 3 HOH 461 1061 1063 HOH HOH M . 
BC 3 HOH 462 1062 1064 HOH HOH M . 
BC 3 HOH 463 1063 1065 HOH HOH M . 
BC 3 HOH 464 1064 1066 HOH HOH M . 
BC 3 HOH 465 1065 1067 HOH HOH M . 
BC 3 HOH 466 1066 1068 HOH HOH M . 
BC 3 HOH 467 1067 1069 HOH HOH M . 
BC 3 HOH 468 1068 1070 HOH HOH M . 
BC 3 HOH 469 1069 1071 HOH HOH M . 
BC 3 HOH 470 1070 1072 HOH HOH M . 
BC 3 HOH 471 1071 1073 HOH HOH M . 
BC 3 HOH 472 1072 1074 HOH HOH M . 
BC 3 HOH 473 1073 1075 HOH HOH M . 
BC 3 HOH 474 1074 1076 HOH HOH M . 
BC 3 HOH 475 1075 1077 HOH HOH M . 
BC 3 HOH 476 1076 1078 HOH HOH M . 
BC 3 HOH 477 1077 1079 HOH HOH M . 
BC 3 HOH 478 1078 1080 HOH HOH M . 
BC 3 HOH 479 1079 1081 HOH HOH M . 
BC 3 HOH 480 1080 1082 HOH HOH M . 
BC 3 HOH 481 1081 1083 HOH HOH M . 
BC 3 HOH 482 1082 1084 HOH HOH M . 
BC 3 HOH 483 1083 1085 HOH HOH M . 
BC 3 HOH 484 1084 1086 HOH HOH M . 
BC 3 HOH 485 1085 1087 HOH HOH M . 
BC 3 HOH 486 1086 1088 HOH HOH M . 
BC 3 HOH 487 1087 1089 HOH HOH M . 
BC 3 HOH 488 1088 1090 HOH HOH M . 
BC 3 HOH 489 1089 1091 HOH HOH M . 
BC 3 HOH 490 1090 1092 HOH HOH M . 
BC 3 HOH 491 1091 1093 HOH HOH M . 
BC 3 HOH 492 1092 1094 HOH HOH M . 
BC 3 HOH 493 1093 1095 HOH HOH M . 
BC 3 HOH 494 1094 1096 HOH HOH M . 
BC 3 HOH 495 1095 1097 HOH HOH M . 
BC 3 HOH 496 1096 1098 HOH HOH M . 
BC 3 HOH 497 1097 1099 HOH HOH M . 
BC 3 HOH 498 1098 1100 HOH HOH M . 
BC 3 HOH 499 1099 1101 HOH HOH M . 
BC 3 HOH 500 1100 1102 HOH HOH M . 
BC 3 HOH 501 1101 1103 HOH HOH M . 
BC 3 HOH 502 1102 1104 HOH HOH M . 
BC 3 HOH 503 1103 1105 HOH HOH M . 
BC 3 HOH 504 1104 1106 HOH HOH M . 
BC 3 HOH 505 1105 1107 HOH HOH M . 
BC 3 HOH 506 1106 1108 HOH HOH M . 
BC 3 HOH 507 1107 1109 HOH HOH M . 
BC 3 HOH 508 1108 1110 HOH HOH M . 
BC 3 HOH 509 1109 1111 HOH HOH M . 
BC 3 HOH 510 1110 1112 HOH HOH M . 
BC 3 HOH 511 1111 1113 HOH HOH M . 
BC 3 HOH 512 1112 1114 HOH HOH M . 
BC 3 HOH 513 1113 1115 HOH HOH M . 
BC 3 HOH 514 1114 1116 HOH HOH M . 
BC 3 HOH 515 1115 1117 HOH HOH M . 
BC 3 HOH 516 1116 1118 HOH HOH M . 
BC 3 HOH 517 1117 1119 HOH HOH M . 
BC 3 HOH 518 1118 1120 HOH HOH M . 
BC 3 HOH 519 1119 1121 HOH HOH M . 
BC 3 HOH 520 1120 1122 HOH HOH M . 
BC 3 HOH 521 1121 1123 HOH HOH M . 
BC 3 HOH 522 1122 1124 HOH HOH M . 
BC 3 HOH 523 1123 1125 HOH HOH M . 
BC 3 HOH 524 1124 1126 HOH HOH M . 
BC 3 HOH 525 1125 1127 HOH HOH M . 
BC 3 HOH 526 1126 1128 HOH HOH M . 
BC 3 HOH 527 1127 1129 HOH HOH M . 
BC 3 HOH 528 1128 1130 HOH HOH M . 
BC 3 HOH 529 1129 1131 HOH HOH M . 
BC 3 HOH 530 1130 1132 HOH HOH M . 
BC 3 HOH 531 1131 1133 HOH HOH M . 
BC 3 HOH 532 1132 1134 HOH HOH M . 
BC 3 HOH 533 1133 1135 HOH HOH M . 
BC 3 HOH 534 1134 1136 HOH HOH M . 
BC 3 HOH 535 1135 1137 HOH HOH M . 
BC 3 HOH 536 1136 1138 HOH HOH M . 
BC 3 HOH 537 1137 1139 HOH HOH M . 
BC 3 HOH 538 1138 1140 HOH HOH M . 
BC 3 HOH 539 1139 1141 HOH HOH M . 
BC 3 HOH 540 1140 1142 HOH HOH M . 
BC 3 HOH 541 1141 1143 HOH HOH M . 
BC 3 HOH 542 1142 1144 HOH HOH M . 
BC 3 HOH 543 1143 1145 HOH HOH M . 
BC 3 HOH 544 1144 1146 HOH HOH M . 
BC 3 HOH 545 1145 1022 HOH HOH M . 
BC 3 HOH 546 1146 1147 HOH HOH M . 
BC 3 HOH 547 1147 928  HOH HOH M . 
BC 3 HOH 548 1148 1148 HOH HOH M . 
BC 3 HOH 549 1149 1149 HOH HOH M . 
BC 3 HOH 550 1150 1151 HOH HOH M . 
BC 3 HOH 551 1151 1152 HOH HOH M . 
BC 3 HOH 552 1152 1153 HOH HOH M . 
BC 3 HOH 553 1153 1154 HOH HOH M . 
BC 3 HOH 554 1154 1155 HOH HOH M . 
BC 3 HOH 555 1155 1156 HOH HOH M . 
BC 3 HOH 556 1156 1157 HOH HOH M . 
BC 3 HOH 557 1157 1150 HOH HOH M . 
BC 3 HOH 558 1158 1158 HOH HOH M . 
BC 3 HOH 559 1159 1159 HOH HOH M . 
CC 3 HOH 1   601  601  HOH HOH T . 
CC 3 HOH 2   602  602  HOH HOH T . 
CC 3 HOH 3   603  603  HOH HOH T . 
CC 3 HOH 4   604  604  HOH HOH T . 
CC 3 HOH 5   605  605  HOH HOH T . 
CC 3 HOH 6   606  606  HOH HOH T . 
CC 3 HOH 7   607  607  HOH HOH T . 
CC 3 HOH 8   608  608  HOH HOH T . 
CC 3 HOH 9   609  609  HOH HOH T . 
CC 3 HOH 10  610  610  HOH HOH T . 
CC 3 HOH 11  611  611  HOH HOH T . 
CC 3 HOH 12  612  612  HOH HOH T . 
CC 3 HOH 13  613  613  HOH HOH T . 
CC 3 HOH 14  614  614  HOH HOH T . 
CC 3 HOH 15  615  615  HOH HOH T . 
CC 3 HOH 16  616  616  HOH HOH T . 
CC 3 HOH 17  617  617  HOH HOH T . 
CC 3 HOH 18  618  618  HOH HOH T . 
CC 3 HOH 19  619  619  HOH HOH T . 
CC 3 HOH 20  620  620  HOH HOH T . 
CC 3 HOH 21  621  621  HOH HOH T . 
CC 3 HOH 22  622  622  HOH HOH T . 
CC 3 HOH 23  623  623  HOH HOH T . 
CC 3 HOH 24  624  624  HOH HOH T . 
CC 3 HOH 25  625  625  HOH HOH T . 
CC 3 HOH 26  626  626  HOH HOH T . 
CC 3 HOH 27  627  627  HOH HOH T . 
CC 3 HOH 28  628  628  HOH HOH T . 
CC 3 HOH 29  629  629  HOH HOH T . 
CC 3 HOH 30  630  630  HOH HOH T . 
CC 3 HOH 31  631  631  HOH HOH T . 
CC 3 HOH 32  632  632  HOH HOH T . 
CC 3 HOH 33  633  633  HOH HOH T . 
CC 3 HOH 34  634  634  HOH HOH T . 
CC 3 HOH 35  635  635  HOH HOH T . 
CC 3 HOH 36  636  636  HOH HOH T . 
CC 3 HOH 37  637  637  HOH HOH T . 
CC 3 HOH 38  638  638  HOH HOH T . 
CC 3 HOH 39  639  639  HOH HOH T . 
CC 3 HOH 40  640  640  HOH HOH T . 
CC 3 HOH 41  641  641  HOH HOH T . 
CC 3 HOH 42  642  642  HOH HOH T . 
CC 3 HOH 43  643  643  HOH HOH T . 
CC 3 HOH 44  644  644  HOH HOH T . 
CC 3 HOH 45  645  645  HOH HOH T . 
CC 3 HOH 46  646  646  HOH HOH T . 
CC 3 HOH 47  647  647  HOH HOH T . 
CC 3 HOH 48  648  648  HOH HOH T . 
CC 3 HOH 49  649  649  HOH HOH T . 
CC 3 HOH 50  650  650  HOH HOH T . 
CC 3 HOH 51  651  651  HOH HOH T . 
CC 3 HOH 52  652  652  HOH HOH T . 
CC 3 HOH 53  653  653  HOH HOH T . 
CC 3 HOH 54  654  654  HOH HOH T . 
CC 3 HOH 55  655  655  HOH HOH T . 
CC 3 HOH 56  656  656  HOH HOH T . 
CC 3 HOH 57  657  657  HOH HOH T . 
CC 3 HOH 58  658  658  HOH HOH T . 
CC 3 HOH 59  659  659  HOH HOH T . 
CC 3 HOH 60  660  660  HOH HOH T . 
CC 3 HOH 61  661  661  HOH HOH T . 
CC 3 HOH 62  662  662  HOH HOH T . 
CC 3 HOH 63  663  663  HOH HOH T . 
CC 3 HOH 64  664  664  HOH HOH T . 
CC 3 HOH 65  665  665  HOH HOH T . 
CC 3 HOH 66  666  666  HOH HOH T . 
CC 3 HOH 67  667  667  HOH HOH T . 
CC 3 HOH 68  668  668  HOH HOH T . 
CC 3 HOH 69  669  669  HOH HOH T . 
CC 3 HOH 70  670  670  HOH HOH T . 
CC 3 HOH 71  671  671  HOH HOH T . 
CC 3 HOH 72  672  672  HOH HOH T . 
CC 3 HOH 73  673  673  HOH HOH T . 
CC 3 HOH 74  674  674  HOH HOH T . 
CC 3 HOH 75  675  675  HOH HOH T . 
CC 3 HOH 76  676  676  HOH HOH T . 
CC 3 HOH 77  677  677  HOH HOH T . 
CC 3 HOH 78  678  678  HOH HOH T . 
CC 3 HOH 79  679  679  HOH HOH T . 
CC 3 HOH 80  680  680  HOH HOH T . 
CC 3 HOH 81  681  681  HOH HOH T . 
CC 3 HOH 82  682  682  HOH HOH T . 
CC 3 HOH 83  683  683  HOH HOH T . 
CC 3 HOH 84  684  684  HOH HOH T . 
CC 3 HOH 85  685  685  HOH HOH T . 
CC 3 HOH 86  686  686  HOH HOH T . 
CC 3 HOH 87  687  687  HOH HOH T . 
CC 3 HOH 88  688  688  HOH HOH T . 
CC 3 HOH 89  689  689  HOH HOH T . 
CC 3 HOH 90  690  690  HOH HOH T . 
CC 3 HOH 91  691  691  HOH HOH T . 
CC 3 HOH 92  692  692  HOH HOH T . 
CC 3 HOH 93  693  693  HOH HOH T . 
CC 3 HOH 94  694  694  HOH HOH T . 
CC 3 HOH 95  695  695  HOH HOH T . 
CC 3 HOH 96  696  696  HOH HOH T . 
CC 3 HOH 97  697  697  HOH HOH T . 
CC 3 HOH 98  698  698  HOH HOH T . 
CC 3 HOH 99  699  699  HOH HOH T . 
CC 3 HOH 100 700  700  HOH HOH T . 
CC 3 HOH 101 701  701  HOH HOH T . 
CC 3 HOH 102 702  702  HOH HOH T . 
CC 3 HOH 103 703  703  HOH HOH T . 
CC 3 HOH 104 704  704  HOH HOH T . 
CC 3 HOH 105 705  705  HOH HOH T . 
CC 3 HOH 106 706  706  HOH HOH T . 
CC 3 HOH 107 707  707  HOH HOH T . 
CC 3 HOH 108 708  708  HOH HOH T . 
CC 3 HOH 109 709  709  HOH HOH T . 
CC 3 HOH 110 710  710  HOH HOH T . 
CC 3 HOH 111 711  711  HOH HOH T . 
CC 3 HOH 112 712  712  HOH HOH T . 
CC 3 HOH 113 713  713  HOH HOH T . 
CC 3 HOH 114 714  714  HOH HOH T . 
CC 3 HOH 115 715  715  HOH HOH T . 
CC 3 HOH 116 716  716  HOH HOH T . 
CC 3 HOH 117 717  717  HOH HOH T . 
CC 3 HOH 118 718  718  HOH HOH T . 
CC 3 HOH 119 719  719  HOH HOH T . 
CC 3 HOH 120 720  720  HOH HOH T . 
CC 3 HOH 121 721  721  HOH HOH T . 
CC 3 HOH 122 722  722  HOH HOH T . 
CC 3 HOH 123 723  723  HOH HOH T . 
CC 3 HOH 124 724  724  HOH HOH T . 
CC 3 HOH 125 725  725  HOH HOH T . 
CC 3 HOH 126 726  726  HOH HOH T . 
CC 3 HOH 127 727  727  HOH HOH T . 
CC 3 HOH 128 728  728  HOH HOH T . 
CC 3 HOH 129 729  729  HOH HOH T . 
CC 3 HOH 130 730  730  HOH HOH T . 
CC 3 HOH 131 731  731  HOH HOH T . 
CC 3 HOH 132 732  732  HOH HOH T . 
CC 3 HOH 133 733  733  HOH HOH T . 
CC 3 HOH 134 734  734  HOH HOH T . 
CC 3 HOH 135 735  735  HOH HOH T . 
CC 3 HOH 136 736  736  HOH HOH T . 
CC 3 HOH 137 737  737  HOH HOH T . 
CC 3 HOH 138 738  738  HOH HOH T . 
CC 3 HOH 139 739  739  HOH HOH T . 
CC 3 HOH 140 740  740  HOH HOH T . 
CC 3 HOH 141 741  741  HOH HOH T . 
CC 3 HOH 142 742  742  HOH HOH T . 
CC 3 HOH 143 743  743  HOH HOH T . 
CC 3 HOH 144 744  744  HOH HOH T . 
CC 3 HOH 145 745  745  HOH HOH T . 
CC 3 HOH 146 746  746  HOH HOH T . 
CC 3 HOH 147 747  747  HOH HOH T . 
CC 3 HOH 148 748  748  HOH HOH T . 
CC 3 HOH 149 749  749  HOH HOH T . 
CC 3 HOH 150 750  750  HOH HOH T . 
CC 3 HOH 151 751  751  HOH HOH T . 
CC 3 HOH 152 752  752  HOH HOH T . 
CC 3 HOH 153 753  753  HOH HOH T . 
CC 3 HOH 154 754  754  HOH HOH T . 
CC 3 HOH 155 755  755  HOH HOH T . 
CC 3 HOH 156 756  756  HOH HOH T . 
CC 3 HOH 157 757  757  HOH HOH T . 
CC 3 HOH 158 758  758  HOH HOH T . 
CC 3 HOH 159 759  759  HOH HOH T . 
CC 3 HOH 160 760  760  HOH HOH T . 
CC 3 HOH 161 761  761  HOH HOH T . 
CC 3 HOH 162 762  762  HOH HOH T . 
CC 3 HOH 163 763  763  HOH HOH T . 
CC 3 HOH 164 764  764  HOH HOH T . 
CC 3 HOH 165 765  765  HOH HOH T . 
CC 3 HOH 166 766  766  HOH HOH T . 
CC 3 HOH 167 767  767  HOH HOH T . 
CC 3 HOH 168 768  768  HOH HOH T . 
CC 3 HOH 169 769  769  HOH HOH T . 
CC 3 HOH 170 770  770  HOH HOH T . 
CC 3 HOH 171 771  771  HOH HOH T . 
CC 3 HOH 172 772  772  HOH HOH T . 
CC 3 HOH 173 773  773  HOH HOH T . 
CC 3 HOH 174 774  774  HOH HOH T . 
CC 3 HOH 175 775  775  HOH HOH T . 
CC 3 HOH 176 776  776  HOH HOH T . 
CC 3 HOH 177 777  777  HOH HOH T . 
CC 3 HOH 178 778  778  HOH HOH T . 
CC 3 HOH 179 779  779  HOH HOH T . 
CC 3 HOH 180 780  780  HOH HOH T . 
CC 3 HOH 181 781  781  HOH HOH T . 
CC 3 HOH 182 782  782  HOH HOH T . 
CC 3 HOH 183 783  783  HOH HOH T . 
CC 3 HOH 184 784  784  HOH HOH T . 
CC 3 HOH 185 785  785  HOH HOH T . 
CC 3 HOH 186 786  786  HOH HOH T . 
CC 3 HOH 187 787  787  HOH HOH T . 
CC 3 HOH 188 788  788  HOH HOH T . 
CC 3 HOH 189 789  789  HOH HOH T . 
CC 3 HOH 190 790  790  HOH HOH T . 
CC 3 HOH 191 791  791  HOH HOH T . 
CC 3 HOH 192 792  792  HOH HOH T . 
CC 3 HOH 193 793  793  HOH HOH T . 
CC 3 HOH 194 794  794  HOH HOH T . 
CC 3 HOH 195 795  795  HOH HOH T . 
CC 3 HOH 196 796  796  HOH HOH T . 
CC 3 HOH 197 797  797  HOH HOH T . 
CC 3 HOH 198 798  798  HOH HOH T . 
CC 3 HOH 199 799  799  HOH HOH T . 
CC 3 HOH 200 800  800  HOH HOH T . 
CC 3 HOH 201 801  801  HOH HOH T . 
CC 3 HOH 202 802  802  HOH HOH T . 
CC 3 HOH 203 803  803  HOH HOH T . 
CC 3 HOH 204 804  804  HOH HOH T . 
CC 3 HOH 205 805  805  HOH HOH T . 
CC 3 HOH 206 806  806  HOH HOH T . 
CC 3 HOH 207 807  807  HOH HOH T . 
CC 3 HOH 208 808  808  HOH HOH T . 
CC 3 HOH 209 809  809  HOH HOH T . 
CC 3 HOH 210 810  810  HOH HOH T . 
CC 3 HOH 211 811  811  HOH HOH T . 
CC 3 HOH 212 812  812  HOH HOH T . 
CC 3 HOH 213 813  813  HOH HOH T . 
CC 3 HOH 214 814  814  HOH HOH T . 
CC 3 HOH 215 815  815  HOH HOH T . 
CC 3 HOH 216 816  816  HOH HOH T . 
CC 3 HOH 217 817  817  HOH HOH T . 
CC 3 HOH 218 818  818  HOH HOH T . 
CC 3 HOH 219 819  819  HOH HOH T . 
CC 3 HOH 220 820  820  HOH HOH T . 
CC 3 HOH 221 821  821  HOH HOH T . 
CC 3 HOH 222 822  822  HOH HOH T . 
CC 3 HOH 223 823  823  HOH HOH T . 
CC 3 HOH 224 824  824  HOH HOH T . 
CC 3 HOH 225 825  825  HOH HOH T . 
CC 3 HOH 226 826  826  HOH HOH T . 
CC 3 HOH 227 827  827  HOH HOH T . 
CC 3 HOH 228 828  828  HOH HOH T . 
CC 3 HOH 229 829  829  HOH HOH T . 
CC 3 HOH 230 830  830  HOH HOH T . 
CC 3 HOH 231 831  831  HOH HOH T . 
CC 3 HOH 232 832  832  HOH HOH T . 
CC 3 HOH 233 833  833  HOH HOH T . 
CC 3 HOH 234 834  834  HOH HOH T . 
CC 3 HOH 235 835  835  HOH HOH T . 
CC 3 HOH 236 836  836  HOH HOH T . 
CC 3 HOH 237 837  837  HOH HOH T . 
CC 3 HOH 238 838  838  HOH HOH T . 
CC 3 HOH 239 839  839  HOH HOH T . 
CC 3 HOH 240 840  840  HOH HOH T . 
CC 3 HOH 241 841  841  HOH HOH T . 
CC 3 HOH 242 842  842  HOH HOH T . 
CC 3 HOH 243 843  843  HOH HOH T . 
CC 3 HOH 244 844  844  HOH HOH T . 
CC 3 HOH 245 845  845  HOH HOH T . 
CC 3 HOH 246 846  846  HOH HOH T . 
CC 3 HOH 247 847  847  HOH HOH T . 
CC 3 HOH 248 848  848  HOH HOH T . 
CC 3 HOH 249 849  849  HOH HOH T . 
CC 3 HOH 250 850  850  HOH HOH T . 
CC 3 HOH 251 851  851  HOH HOH T . 
CC 3 HOH 252 852  852  HOH HOH T . 
CC 3 HOH 253 853  853  HOH HOH T . 
CC 3 HOH 254 854  854  HOH HOH T . 
CC 3 HOH 255 855  855  HOH HOH T . 
CC 3 HOH 256 856  856  HOH HOH T . 
CC 3 HOH 257 857  857  HOH HOH T . 
CC 3 HOH 258 858  858  HOH HOH T . 
CC 3 HOH 259 859  859  HOH HOH T . 
CC 3 HOH 260 860  860  HOH HOH T . 
CC 3 HOH 261 861  861  HOH HOH T . 
CC 3 HOH 262 862  862  HOH HOH T . 
CC 3 HOH 263 863  863  HOH HOH T . 
CC 3 HOH 264 864  864  HOH HOH T . 
CC 3 HOH 265 865  865  HOH HOH T . 
CC 3 HOH 266 866  866  HOH HOH T . 
CC 3 HOH 267 867  867  HOH HOH T . 
CC 3 HOH 268 868  868  HOH HOH T . 
CC 3 HOH 269 869  869  HOH HOH T . 
CC 3 HOH 270 870  870  HOH HOH T . 
CC 3 HOH 271 871  871  HOH HOH T . 
CC 3 HOH 272 872  872  HOH HOH T . 
CC 3 HOH 273 873  873  HOH HOH T . 
CC 3 HOH 274 874  874  HOH HOH T . 
CC 3 HOH 275 875  875  HOH HOH T . 
CC 3 HOH 276 876  876  HOH HOH T . 
CC 3 HOH 277 877  877  HOH HOH T . 
CC 3 HOH 278 878  878  HOH HOH T . 
CC 3 HOH 279 879  879  HOH HOH T . 
CC 3 HOH 280 880  880  HOH HOH T . 
CC 3 HOH 281 881  881  HOH HOH T . 
CC 3 HOH 282 882  882  HOH HOH T . 
CC 3 HOH 283 883  883  HOH HOH T . 
CC 3 HOH 284 884  884  HOH HOH T . 
CC 3 HOH 285 885  885  HOH HOH T . 
CC 3 HOH 286 886  886  HOH HOH T . 
CC 3 HOH 287 887  887  HOH HOH T . 
CC 3 HOH 288 888  888  HOH HOH T . 
CC 3 HOH 289 889  889  HOH HOH T . 
CC 3 HOH 290 890  890  HOH HOH T . 
CC 3 HOH 291 891  891  HOH HOH T . 
CC 3 HOH 292 892  892  HOH HOH T . 
CC 3 HOH 293 893  893  HOH HOH T . 
CC 3 HOH 294 894  894  HOH HOH T . 
CC 3 HOH 295 895  895  HOH HOH T . 
CC 3 HOH 296 896  896  HOH HOH T . 
CC 3 HOH 297 897  897  HOH HOH T . 
CC 3 HOH 298 898  898  HOH HOH T . 
CC 3 HOH 299 899  899  HOH HOH T . 
CC 3 HOH 300 900  900  HOH HOH T . 
CC 3 HOH 301 901  901  HOH HOH T . 
CC 3 HOH 302 902  902  HOH HOH T . 
CC 3 HOH 303 903  903  HOH HOH T . 
CC 3 HOH 304 904  904  HOH HOH T . 
CC 3 HOH 305 905  905  HOH HOH T . 
CC 3 HOH 306 906  906  HOH HOH T . 
CC 3 HOH 307 907  907  HOH HOH T . 
CC 3 HOH 308 908  908  HOH HOH T . 
CC 3 HOH 309 909  909  HOH HOH T . 
CC 3 HOH 310 910  910  HOH HOH T . 
CC 3 HOH 311 911  911  HOH HOH T . 
CC 3 HOH 312 912  912  HOH HOH T . 
CC 3 HOH 313 913  913  HOH HOH T . 
CC 3 HOH 314 914  914  HOH HOH T . 
CC 3 HOH 315 915  915  HOH HOH T . 
CC 3 HOH 316 916  916  HOH HOH T . 
CC 3 HOH 317 917  917  HOH HOH T . 
CC 3 HOH 318 918  918  HOH HOH T . 
CC 3 HOH 319 919  919  HOH HOH T . 
CC 3 HOH 320 920  920  HOH HOH T . 
CC 3 HOH 321 921  921  HOH HOH T . 
CC 3 HOH 322 922  922  HOH HOH T . 
CC 3 HOH 323 923  923  HOH HOH T . 
CC 3 HOH 324 924  924  HOH HOH T . 
CC 3 HOH 325 925  925  HOH HOH T . 
CC 3 HOH 326 926  926  HOH HOH T . 
CC 3 HOH 327 927  927  HOH HOH T . 
CC 3 HOH 328 928  928  HOH HOH T . 
CC 3 HOH 329 929  929  HOH HOH T . 
CC 3 HOH 330 930  930  HOH HOH T . 
CC 3 HOH 331 931  931  HOH HOH T . 
CC 3 HOH 332 932  932  HOH HOH T . 
CC 3 HOH 333 933  933  HOH HOH T . 
CC 3 HOH 334 934  934  HOH HOH T . 
CC 3 HOH 335 935  935  HOH HOH T . 
CC 3 HOH 336 936  936  HOH HOH T . 
CC 3 HOH 337 937  937  HOH HOH T . 
CC 3 HOH 338 938  938  HOH HOH T . 
CC 3 HOH 339 939  939  HOH HOH T . 
CC 3 HOH 340 940  940  HOH HOH T . 
CC 3 HOH 341 941  941  HOH HOH T . 
CC 3 HOH 342 942  942  HOH HOH T . 
CC 3 HOH 343 943  943  HOH HOH T . 
CC 3 HOH 344 944  944  HOH HOH T . 
CC 3 HOH 345 945  945  HOH HOH T . 
CC 3 HOH 346 946  946  HOH HOH T . 
CC 3 HOH 347 947  947  HOH HOH T . 
CC 3 HOH 348 948  948  HOH HOH T . 
CC 3 HOH 349 949  949  HOH HOH T . 
CC 3 HOH 350 950  950  HOH HOH T . 
CC 3 HOH 351 951  951  HOH HOH T . 
CC 3 HOH 352 952  952  HOH HOH T . 
CC 3 HOH 353 953  953  HOH HOH T . 
CC 3 HOH 354 954  954  HOH HOH T . 
CC 3 HOH 355 955  955  HOH HOH T . 
CC 3 HOH 356 956  956  HOH HOH T . 
CC 3 HOH 357 957  957  HOH HOH T . 
CC 3 HOH 358 958  958  HOH HOH T . 
CC 3 HOH 359 959  959  HOH HOH T . 
CC 3 HOH 360 960  960  HOH HOH T . 
CC 3 HOH 361 961  961  HOH HOH T . 
CC 3 HOH 362 962  962  HOH HOH T . 
CC 3 HOH 363 963  963  HOH HOH T . 
CC 3 HOH 364 964  964  HOH HOH T . 
CC 3 HOH 365 965  965  HOH HOH T . 
CC 3 HOH 366 966  966  HOH HOH T . 
CC 3 HOH 367 967  967  HOH HOH T . 
CC 3 HOH 368 968  968  HOH HOH T . 
CC 3 HOH 369 969  969  HOH HOH T . 
CC 3 HOH 370 970  970  HOH HOH T . 
CC 3 HOH 371 971  971  HOH HOH T . 
CC 3 HOH 372 972  972  HOH HOH T . 
CC 3 HOH 373 973  973  HOH HOH T . 
CC 3 HOH 374 974  974  HOH HOH T . 
CC 3 HOH 375 975  975  HOH HOH T . 
CC 3 HOH 376 976  976  HOH HOH T . 
CC 3 HOH 377 977  977  HOH HOH T . 
CC 3 HOH 378 978  978  HOH HOH T . 
CC 3 HOH 379 979  979  HOH HOH T . 
CC 3 HOH 380 980  980  HOH HOH T . 
CC 3 HOH 381 981  981  HOH HOH T . 
CC 3 HOH 382 982  982  HOH HOH T . 
CC 3 HOH 383 983  983  HOH HOH T . 
CC 3 HOH 384 984  984  HOH HOH T . 
CC 3 HOH 385 985  985  HOH HOH T . 
CC 3 HOH 386 986  986  HOH HOH T . 
CC 3 HOH 387 987  987  HOH HOH T . 
CC 3 HOH 388 988  988  HOH HOH T . 
CC 3 HOH 389 989  989  HOH HOH T . 
CC 3 HOH 390 990  990  HOH HOH T . 
CC 3 HOH 391 991  991  HOH HOH T . 
CC 3 HOH 392 992  992  HOH HOH T . 
CC 3 HOH 393 993  993  HOH HOH T . 
CC 3 HOH 394 994  994  HOH HOH T . 
CC 3 HOH 395 995  995  HOH HOH T . 
CC 3 HOH 396 996  996  HOH HOH T . 
CC 3 HOH 397 997  997  HOH HOH T . 
CC 3 HOH 398 998  998  HOH HOH T . 
CC 3 HOH 399 999  999  HOH HOH T . 
CC 3 HOH 400 1000 1000 HOH HOH T . 
CC 3 HOH 401 1001 1001 HOH HOH T . 
CC 3 HOH 402 1002 1002 HOH HOH T . 
CC 3 HOH 403 1003 1003 HOH HOH T . 
CC 3 HOH 404 1004 1004 HOH HOH T . 
CC 3 HOH 405 1005 1005 HOH HOH T . 
CC 3 HOH 406 1006 1006 HOH HOH T . 
CC 3 HOH 407 1007 1007 HOH HOH T . 
CC 3 HOH 408 1008 1008 HOH HOH T . 
CC 3 HOH 409 1009 1009 HOH HOH T . 
CC 3 HOH 410 1010 1010 HOH HOH T . 
CC 3 HOH 411 1011 1011 HOH HOH T . 
CC 3 HOH 412 1012 1012 HOH HOH T . 
CC 3 HOH 413 1013 1013 HOH HOH T . 
CC 3 HOH 414 1014 1014 HOH HOH T . 
CC 3 HOH 415 1015 1015 HOH HOH T . 
CC 3 HOH 416 1016 1016 HOH HOH T . 
CC 3 HOH 417 1017 1017 HOH HOH T . 
CC 3 HOH 418 1018 1018 HOH HOH T . 
CC 3 HOH 419 1019 1019 HOH HOH T . 
CC 3 HOH 420 1020 1020 HOH HOH T . 
CC 3 HOH 421 1021 1021 HOH HOH T . 
CC 3 HOH 422 1022 1022 HOH HOH T . 
CC 3 HOH 423 1023 1023 HOH HOH T . 
CC 3 HOH 424 1024 1024 HOH HOH T . 
CC 3 HOH 425 1025 1025 HOH HOH T . 
CC 3 HOH 426 1026 1026 HOH HOH T . 
CC 3 HOH 427 1027 1027 HOH HOH T . 
CC 3 HOH 428 1028 1028 HOH HOH T . 
CC 3 HOH 429 1029 1029 HOH HOH T . 
CC 3 HOH 430 1030 1030 HOH HOH T . 
CC 3 HOH 431 1031 1031 HOH HOH T . 
CC 3 HOH 432 1032 1032 HOH HOH T . 
CC 3 HOH 433 1033 1033 HOH HOH T . 
CC 3 HOH 434 1034 1034 HOH HOH T . 
CC 3 HOH 435 1035 1035 HOH HOH T . 
CC 3 HOH 436 1036 1036 HOH HOH T . 
CC 3 HOH 437 1037 1037 HOH HOH T . 
CC 3 HOH 438 1038 1038 HOH HOH T . 
CC 3 HOH 439 1039 1039 HOH HOH T . 
CC 3 HOH 440 1040 1040 HOH HOH T . 
CC 3 HOH 441 1041 1041 HOH HOH T . 
CC 3 HOH 442 1042 1042 HOH HOH T . 
CC 3 HOH 443 1043 1043 HOH HOH T . 
CC 3 HOH 444 1044 1044 HOH HOH T . 
CC 3 HOH 445 1045 1045 HOH HOH T . 
CC 3 HOH 446 1046 1046 HOH HOH T . 
CC 3 HOH 447 1047 1047 HOH HOH T . 
CC 3 HOH 448 1048 1048 HOH HOH T . 
CC 3 HOH 449 1049 1049 HOH HOH T . 
CC 3 HOH 450 1050 1050 HOH HOH T . 
CC 3 HOH 451 1051 1051 HOH HOH T . 
CC 3 HOH 452 1052 1052 HOH HOH T . 
CC 3 HOH 453 1053 1053 HOH HOH T . 
CC 3 HOH 454 1054 1054 HOH HOH T . 
CC 3 HOH 455 1055 1055 HOH HOH T . 
CC 3 HOH 456 1056 1056 HOH HOH T . 
CC 3 HOH 457 1057 1057 HOH HOH T . 
CC 3 HOH 458 1058 1058 HOH HOH T . 
CC 3 HOH 459 1059 1059 HOH HOH T . 
CC 3 HOH 460 1060 1060 HOH HOH T . 
CC 3 HOH 461 1061 1061 HOH HOH T . 
CC 3 HOH 462 1062 1062 HOH HOH T . 
CC 3 HOH 463 1063 1063 HOH HOH T . 
CC 3 HOH 464 1064 1064 HOH HOH T . 
CC 3 HOH 465 1065 1065 HOH HOH T . 
CC 3 HOH 466 1066 1066 HOH HOH T . 
CC 3 HOH 467 1067 1067 HOH HOH T . 
CC 3 HOH 468 1068 1068 HOH HOH T . 
CC 3 HOH 469 1069 1069 HOH HOH T . 
CC 3 HOH 470 1070 1070 HOH HOH T . 
CC 3 HOH 471 1071 1071 HOH HOH T . 
CC 3 HOH 472 1072 1072 HOH HOH T . 
CC 3 HOH 473 1073 1073 HOH HOH T . 
CC 3 HOH 474 1074 1074 HOH HOH T . 
CC 3 HOH 475 1075 1075 HOH HOH T . 
CC 3 HOH 476 1076 1076 HOH HOH T . 
CC 3 HOH 477 1077 1077 HOH HOH T . 
CC 3 HOH 478 1078 1078 HOH HOH T . 
CC 3 HOH 479 1079 1079 HOH HOH T . 
CC 3 HOH 480 1080 1080 HOH HOH T . 
CC 3 HOH 481 1081 1081 HOH HOH T . 
CC 3 HOH 482 1082 1082 HOH HOH T . 
CC 3 HOH 483 1083 1083 HOH HOH T . 
CC 3 HOH 484 1084 1084 HOH HOH T . 
CC 3 HOH 485 1085 1085 HOH HOH T . 
CC 3 HOH 486 1086 1086 HOH HOH T . 
CC 3 HOH 487 1087 1087 HOH HOH T . 
CC 3 HOH 488 1088 1088 HOH HOH T . 
CC 3 HOH 489 1089 1089 HOH HOH T . 
CC 3 HOH 490 1090 1090 HOH HOH T . 
CC 3 HOH 491 1091 1091 HOH HOH T . 
CC 3 HOH 492 1092 1092 HOH HOH T . 
CC 3 HOH 493 1093 1093 HOH HOH T . 
CC 3 HOH 494 1094 1094 HOH HOH T . 
CC 3 HOH 495 1095 1095 HOH HOH T . 
CC 3 HOH 496 1096 1096 HOH HOH T . 
CC 3 HOH 497 1097 1097 HOH HOH T . 
CC 3 HOH 498 1098 1098 HOH HOH T . 
CC 3 HOH 499 1099 1099 HOH HOH T . 
CC 3 HOH 500 1100 1100 HOH HOH T . 
CC 3 HOH 501 1101 1101 HOH HOH T . 
CC 3 HOH 502 1102 1102 HOH HOH T . 
CC 3 HOH 503 1103 1103 HOH HOH T . 
CC 3 HOH 504 1104 1104 HOH HOH T . 
CC 3 HOH 505 1105 1105 HOH HOH T . 
CC 3 HOH 506 1106 1106 HOH HOH T . 
CC 3 HOH 507 1107 1107 HOH HOH T . 
CC 3 HOH 508 1108 1108 HOH HOH T . 
CC 3 HOH 509 1109 1109 HOH HOH T . 
CC 3 HOH 510 1110 1110 HOH HOH T . 
CC 3 HOH 511 1111 1111 HOH HOH T . 
CC 3 HOH 512 1112 1112 HOH HOH T . 
CC 3 HOH 513 1113 1113 HOH HOH T . 
CC 3 HOH 514 1114 1114 HOH HOH T . 
CC 3 HOH 515 1115 1115 HOH HOH T . 
CC 3 HOH 516 1116 1116 HOH HOH T . 
CC 3 HOH 517 1117 1117 HOH HOH T . 
CC 3 HOH 518 1118 1118 HOH HOH T . 
CC 3 HOH 519 1119 1119 HOH HOH T . 
CC 3 HOH 520 1120 1120 HOH HOH T . 
CC 3 HOH 521 1121 1121 HOH HOH T . 
CC 3 HOH 522 1122 1122 HOH HOH T . 
CC 3 HOH 523 1123 1123 HOH HOH T . 
CC 3 HOH 524 1124 1124 HOH HOH T . 
CC 3 HOH 525 1125 1125 HOH HOH T . 
CC 3 HOH 526 1126 1126 HOH HOH T . 
CC 3 HOH 527 1127 1127 HOH HOH T . 
CC 3 HOH 528 1128 1128 HOH HOH T . 
CC 3 HOH 529 1129 1129 HOH HOH T . 
CC 3 HOH 530 1130 1130 HOH HOH T . 
CC 3 HOH 531 1131 1131 HOH HOH T . 
CC 3 HOH 532 1132 1132 HOH HOH T . 
CC 3 HOH 533 1133 1133 HOH HOH T . 
CC 3 HOH 534 1134 1134 HOH HOH T . 
CC 3 HOH 535 1135 1135 HOH HOH T . 
CC 3 HOH 536 1136 1136 HOH HOH T . 
CC 3 HOH 537 1137 1137 HOH HOH T . 
CC 3 HOH 538 1138 1138 HOH HOH T . 
CC 3 HOH 539 1139 1139 HOH HOH T . 
CC 3 HOH 540 1140 1140 HOH HOH T . 
CC 3 HOH 541 1141 1141 HOH HOH T . 
CC 3 HOH 542 1142 1142 HOH HOH T . 
CC 3 HOH 543 1143 1143 HOH HOH T . 
CC 3 HOH 544 1144 1144 HOH HOH T . 
CC 3 HOH 545 1145 1145 HOH HOH T . 
CC 3 HOH 546 1146 1146 HOH HOH T . 
CC 3 HOH 547 1147 1147 HOH HOH T . 
CC 3 HOH 548 1148 1148 HOH HOH T . 
CC 3 HOH 549 1149 1149 HOH HOH T . 
CC 3 HOH 550 1150 1150 HOH HOH T . 
CC 3 HOH 551 1151 1151 HOH HOH T . 
CC 3 HOH 552 1152 1152 HOH HOH T . 
CC 3 HOH 553 1153 1153 HOH HOH T . 
CC 3 HOH 554 1154 1154 HOH HOH T . 
CC 3 HOH 555 1155 1155 HOH HOH T . 
CC 3 HOH 556 1156 1156 HOH HOH T . 
CC 3 HOH 557 1157 1157 HOH HOH T . 
CC 3 HOH 558 1158 1158 HOH HOH T . 
CC 3 HOH 559 1159 1159 HOH HOH T . 
CC 3 HOH 560 1160 1160 HOH HOH T . 
CC 3 HOH 561 1161 1161 HOH HOH T . 
CC 3 HOH 562 1162 1162 HOH HOH T . 
CC 3 HOH 563 1163 1163 HOH HOH T . 
CC 3 HOH 564 1164 1164 HOH HOH T . 
CC 3 HOH 565 1165 1165 HOH HOH T . 
CC 3 HOH 566 1166 1166 HOH HOH T . 
CC 3 HOH 567 1167 1167 HOH HOH T . 
CC 3 HOH 568 1168 1168 HOH HOH T . 
CC 3 HOH 569 1169 1169 HOH HOH T . 
CC 3 HOH 570 1170 1170 HOH HOH T . 
CC 3 HOH 571 1171 1171 HOH HOH T . 
CC 3 HOH 572 1172 1172 HOH HOH T . 
CC 3 HOH 573 1173 1173 HOH HOH T . 
CC 3 HOH 574 1174 1174 HOH HOH T . 
CC 3 HOH 575 1175 1175 HOH HOH T . 
CC 3 HOH 576 1176 1176 HOH HOH T . 
CC 3 HOH 577 1177 1177 HOH HOH T . 
CC 3 HOH 578 1178 1178 HOH HOH T . 
CC 3 HOH 579 1179 1179 HOH HOH T . 
CC 3 HOH 580 1180 1180 HOH HOH T . 
CC 3 HOH 581 1181 1181 HOH HOH T . 
CC 3 HOH 582 1182 1182 HOH HOH T . 
CC 3 HOH 583 1183 1183 HOH HOH T . 
CC 3 HOH 584 1184 1184 HOH HOH T . 
CC 3 HOH 585 1185 1185 HOH HOH T . 
CC 3 HOH 586 1186 1186 HOH HOH T . 
CC 3 HOH 587 1187 1187 HOH HOH T . 
CC 3 HOH 588 1188 1188 HOH HOH T . 
CC 3 HOH 589 1189 1189 HOH HOH T . 
DC 3 HOH 1   601  601  HOH HOH U . 
DC 3 HOH 2   602  602  HOH HOH U . 
DC 3 HOH 3   603  603  HOH HOH U . 
DC 3 HOH 4   604  604  HOH HOH U . 
DC 3 HOH 5   605  605  HOH HOH U . 
DC 3 HOH 6   606  606  HOH HOH U . 
DC 3 HOH 7   607  607  HOH HOH U . 
DC 3 HOH 8   608  608  HOH HOH U . 
DC 3 HOH 9   609  609  HOH HOH U . 
DC 3 HOH 10  610  610  HOH HOH U . 
DC 3 HOH 11  611  611  HOH HOH U . 
DC 3 HOH 12  612  612  HOH HOH U . 
DC 3 HOH 13  613  613  HOH HOH U . 
DC 3 HOH 14  614  614  HOH HOH U . 
DC 3 HOH 15  615  615  HOH HOH U . 
DC 3 HOH 16  616  616  HOH HOH U . 
DC 3 HOH 17  617  617  HOH HOH U . 
DC 3 HOH 18  618  618  HOH HOH U . 
DC 3 HOH 19  619  619  HOH HOH U . 
DC 3 HOH 20  620  620  HOH HOH U . 
DC 3 HOH 21  621  621  HOH HOH U . 
DC 3 HOH 22  622  622  HOH HOH U . 
DC 3 HOH 23  623  623  HOH HOH U . 
DC 3 HOH 24  624  624  HOH HOH U . 
DC 3 HOH 25  625  625  HOH HOH U . 
DC 3 HOH 26  626  626  HOH HOH U . 
DC 3 HOH 27  627  627  HOH HOH U . 
DC 3 HOH 28  628  628  HOH HOH U . 
DC 3 HOH 29  629  629  HOH HOH U . 
DC 3 HOH 30  630  630  HOH HOH U . 
DC 3 HOH 31  631  631  HOH HOH U . 
DC 3 HOH 32  632  632  HOH HOH U . 
DC 3 HOH 33  633  633  HOH HOH U . 
DC 3 HOH 34  634  634  HOH HOH U . 
DC 3 HOH 35  635  635  HOH HOH U . 
DC 3 HOH 36  636  636  HOH HOH U . 
DC 3 HOH 37  637  637  HOH HOH U . 
DC 3 HOH 38  638  638  HOH HOH U . 
DC 3 HOH 39  639  639  HOH HOH U . 
DC 3 HOH 40  640  640  HOH HOH U . 
DC 3 HOH 41  641  641  HOH HOH U . 
DC 3 HOH 42  642  642  HOH HOH U . 
DC 3 HOH 43  643  643  HOH HOH U . 
DC 3 HOH 44  644  644  HOH HOH U . 
DC 3 HOH 45  645  645  HOH HOH U . 
DC 3 HOH 46  646  646  HOH HOH U . 
DC 3 HOH 47  647  647  HOH HOH U . 
DC 3 HOH 48  648  648  HOH HOH U . 
DC 3 HOH 49  649  649  HOH HOH U . 
DC 3 HOH 50  650  650  HOH HOH U . 
DC 3 HOH 51  651  651  HOH HOH U . 
DC 3 HOH 52  652  652  HOH HOH U . 
DC 3 HOH 53  653  653  HOH HOH U . 
DC 3 HOH 54  654  654  HOH HOH U . 
DC 3 HOH 55  655  655  HOH HOH U . 
DC 3 HOH 56  656  656  HOH HOH U . 
DC 3 HOH 57  657  657  HOH HOH U . 
DC 3 HOH 58  658  658  HOH HOH U . 
DC 3 HOH 59  659  659  HOH HOH U . 
DC 3 HOH 60  660  660  HOH HOH U . 
DC 3 HOH 61  661  661  HOH HOH U . 
DC 3 HOH 62  662  662  HOH HOH U . 
DC 3 HOH 63  663  663  HOH HOH U . 
DC 3 HOH 64  664  664  HOH HOH U . 
DC 3 HOH 65  665  665  HOH HOH U . 
DC 3 HOH 66  666  666  HOH HOH U . 
DC 3 HOH 67  667  667  HOH HOH U . 
DC 3 HOH 68  668  668  HOH HOH U . 
DC 3 HOH 69  669  669  HOH HOH U . 
DC 3 HOH 70  670  670  HOH HOH U . 
DC 3 HOH 71  671  671  HOH HOH U . 
DC 3 HOH 72  672  672  HOH HOH U . 
DC 3 HOH 73  673  673  HOH HOH U . 
DC 3 HOH 74  674  674  HOH HOH U . 
DC 3 HOH 75  675  675  HOH HOH U . 
DC 3 HOH 76  676  676  HOH HOH U . 
DC 3 HOH 77  677  677  HOH HOH U . 
DC 3 HOH 78  678  678  HOH HOH U . 
DC 3 HOH 79  679  679  HOH HOH U . 
DC 3 HOH 80  680  680  HOH HOH U . 
DC 3 HOH 81  681  681  HOH HOH U . 
DC 3 HOH 82  682  682  HOH HOH U . 
DC 3 HOH 83  683  683  HOH HOH U . 
DC 3 HOH 84  684  684  HOH HOH U . 
DC 3 HOH 85  685  685  HOH HOH U . 
DC 3 HOH 86  686  686  HOH HOH U . 
DC 3 HOH 87  687  687  HOH HOH U . 
DC 3 HOH 88  688  688  HOH HOH U . 
DC 3 HOH 89  689  689  HOH HOH U . 
DC 3 HOH 90  690  690  HOH HOH U . 
DC 3 HOH 91  691  691  HOH HOH U . 
DC 3 HOH 92  692  692  HOH HOH U . 
DC 3 HOH 93  693  693  HOH HOH U . 
DC 3 HOH 94  694  694  HOH HOH U . 
DC 3 HOH 95  695  695  HOH HOH U . 
DC 3 HOH 96  696  696  HOH HOH U . 
DC 3 HOH 97  697  697  HOH HOH U . 
DC 3 HOH 98  698  698  HOH HOH U . 
DC 3 HOH 99  699  699  HOH HOH U . 
DC 3 HOH 100 700  700  HOH HOH U . 
DC 3 HOH 101 701  701  HOH HOH U . 
DC 3 HOH 102 702  702  HOH HOH U . 
DC 3 HOH 103 703  703  HOH HOH U . 
DC 3 HOH 104 704  704  HOH HOH U . 
DC 3 HOH 105 705  705  HOH HOH U . 
DC 3 HOH 106 706  706  HOH HOH U . 
DC 3 HOH 107 707  707  HOH HOH U . 
DC 3 HOH 108 708  708  HOH HOH U . 
DC 3 HOH 109 709  709  HOH HOH U . 
DC 3 HOH 110 710  710  HOH HOH U . 
DC 3 HOH 111 711  711  HOH HOH U . 
DC 3 HOH 112 712  712  HOH HOH U . 
DC 3 HOH 113 713  713  HOH HOH U . 
DC 3 HOH 114 714  714  HOH HOH U . 
DC 3 HOH 115 715  715  HOH HOH U . 
DC 3 HOH 116 716  716  HOH HOH U . 
DC 3 HOH 117 717  717  HOH HOH U . 
DC 3 HOH 118 718  718  HOH HOH U . 
DC 3 HOH 119 719  719  HOH HOH U . 
DC 3 HOH 120 720  720  HOH HOH U . 
DC 3 HOH 121 721  721  HOH HOH U . 
DC 3 HOH 122 722  722  HOH HOH U . 
DC 3 HOH 123 723  723  HOH HOH U . 
DC 3 HOH 124 724  724  HOH HOH U . 
DC 3 HOH 125 725  725  HOH HOH U . 
DC 3 HOH 126 726  726  HOH HOH U . 
DC 3 HOH 127 727  727  HOH HOH U . 
DC 3 HOH 128 728  728  HOH HOH U . 
DC 3 HOH 129 729  729  HOH HOH U . 
DC 3 HOH 130 730  730  HOH HOH U . 
DC 3 HOH 131 731  731  HOH HOH U . 
DC 3 HOH 132 732  732  HOH HOH U . 
DC 3 HOH 133 733  733  HOH HOH U . 
DC 3 HOH 134 734  734  HOH HOH U . 
DC 3 HOH 135 735  735  HOH HOH U . 
DC 3 HOH 136 736  736  HOH HOH U . 
DC 3 HOH 137 737  737  HOH HOH U . 
DC 3 HOH 138 738  738  HOH HOH U . 
DC 3 HOH 139 739  739  HOH HOH U . 
DC 3 HOH 140 740  740  HOH HOH U . 
DC 3 HOH 141 741  741  HOH HOH U . 
DC 3 HOH 142 742  742  HOH HOH U . 
DC 3 HOH 143 743  743  HOH HOH U . 
DC 3 HOH 144 744  744  HOH HOH U . 
DC 3 HOH 145 745  745  HOH HOH U . 
DC 3 HOH 146 746  746  HOH HOH U . 
DC 3 HOH 147 747  747  HOH HOH U . 
DC 3 HOH 148 748  748  HOH HOH U . 
DC 3 HOH 149 749  749  HOH HOH U . 
DC 3 HOH 150 750  750  HOH HOH U . 
DC 3 HOH 151 751  751  HOH HOH U . 
DC 3 HOH 152 752  752  HOH HOH U . 
DC 3 HOH 153 753  753  HOH HOH U . 
DC 3 HOH 154 754  754  HOH HOH U . 
DC 3 HOH 155 755  755  HOH HOH U . 
DC 3 HOH 156 756  756  HOH HOH U . 
DC 3 HOH 157 757  757  HOH HOH U . 
DC 3 HOH 158 758  758  HOH HOH U . 
DC 3 HOH 159 759  759  HOH HOH U . 
DC 3 HOH 160 760  760  HOH HOH U . 
DC 3 HOH 161 761  761  HOH HOH U . 
DC 3 HOH 162 762  762  HOH HOH U . 
DC 3 HOH 163 763  763  HOH HOH U . 
DC 3 HOH 164 764  764  HOH HOH U . 
DC 3 HOH 165 765  765  HOH HOH U . 
DC 3 HOH 166 766  766  HOH HOH U . 
DC 3 HOH 167 767  767  HOH HOH U . 
DC 3 HOH 168 768  768  HOH HOH U . 
DC 3 HOH 169 769  769  HOH HOH U . 
DC 3 HOH 170 770  770  HOH HOH U . 
DC 3 HOH 171 771  771  HOH HOH U . 
DC 3 HOH 172 772  772  HOH HOH U . 
DC 3 HOH 173 773  773  HOH HOH U . 
DC 3 HOH 174 774  774  HOH HOH U . 
DC 3 HOH 175 775  775  HOH HOH U . 
DC 3 HOH 176 776  776  HOH HOH U . 
DC 3 HOH 177 777  777  HOH HOH U . 
DC 3 HOH 178 778  778  HOH HOH U . 
DC 3 HOH 179 779  779  HOH HOH U . 
DC 3 HOH 180 780  780  HOH HOH U . 
DC 3 HOH 181 781  781  HOH HOH U . 
DC 3 HOH 182 782  782  HOH HOH U . 
DC 3 HOH 183 783  783  HOH HOH U . 
DC 3 HOH 184 784  784  HOH HOH U . 
DC 3 HOH 185 785  785  HOH HOH U . 
DC 3 HOH 186 786  786  HOH HOH U . 
DC 3 HOH 187 787  787  HOH HOH U . 
DC 3 HOH 188 788  788  HOH HOH U . 
DC 3 HOH 189 789  789  HOH HOH U . 
DC 3 HOH 190 790  790  HOH HOH U . 
DC 3 HOH 191 791  791  HOH HOH U . 
DC 3 HOH 192 792  792  HOH HOH U . 
DC 3 HOH 193 793  793  HOH HOH U . 
DC 3 HOH 194 794  794  HOH HOH U . 
DC 3 HOH 195 795  795  HOH HOH U . 
DC 3 HOH 196 796  796  HOH HOH U . 
DC 3 HOH 197 797  797  HOH HOH U . 
DC 3 HOH 198 798  798  HOH HOH U . 
DC 3 HOH 199 799  799  HOH HOH U . 
DC 3 HOH 200 800  800  HOH HOH U . 
DC 3 HOH 201 801  801  HOH HOH U . 
DC 3 HOH 202 802  802  HOH HOH U . 
DC 3 HOH 203 803  803  HOH HOH U . 
DC 3 HOH 204 804  804  HOH HOH U . 
DC 3 HOH 205 805  805  HOH HOH U . 
DC 3 HOH 206 806  806  HOH HOH U . 
DC 3 HOH 207 807  807  HOH HOH U . 
DC 3 HOH 208 808  808  HOH HOH U . 
DC 3 HOH 209 809  809  HOH HOH U . 
DC 3 HOH 210 810  810  HOH HOH U . 
DC 3 HOH 211 811  811  HOH HOH U . 
DC 3 HOH 212 812  812  HOH HOH U . 
DC 3 HOH 213 813  813  HOH HOH U . 
DC 3 HOH 214 814  814  HOH HOH U . 
DC 3 HOH 215 815  815  HOH HOH U . 
DC 3 HOH 216 816  816  HOH HOH U . 
DC 3 HOH 217 817  817  HOH HOH U . 
DC 3 HOH 218 818  818  HOH HOH U . 
DC 3 HOH 219 819  819  HOH HOH U . 
DC 3 HOH 220 820  820  HOH HOH U . 
DC 3 HOH 221 821  821  HOH HOH U . 
DC 3 HOH 222 822  822  HOH HOH U . 
DC 3 HOH 223 823  823  HOH HOH U . 
DC 3 HOH 224 824  824  HOH HOH U . 
DC 3 HOH 225 825  825  HOH HOH U . 
DC 3 HOH 226 826  826  HOH HOH U . 
DC 3 HOH 227 827  827  HOH HOH U . 
DC 3 HOH 228 828  828  HOH HOH U . 
DC 3 HOH 229 829  829  HOH HOH U . 
DC 3 HOH 230 830  830  HOH HOH U . 
DC 3 HOH 231 831  831  HOH HOH U . 
DC 3 HOH 232 832  832  HOH HOH U . 
DC 3 HOH 233 833  833  HOH HOH U . 
DC 3 HOH 234 834  834  HOH HOH U . 
DC 3 HOH 235 835  835  HOH HOH U . 
DC 3 HOH 236 836  836  HOH HOH U . 
DC 3 HOH 237 837  837  HOH HOH U . 
DC 3 HOH 238 838  838  HOH HOH U . 
DC 3 HOH 239 839  839  HOH HOH U . 
DC 3 HOH 240 840  840  HOH HOH U . 
DC 3 HOH 241 841  841  HOH HOH U . 
DC 3 HOH 242 842  842  HOH HOH U . 
DC 3 HOH 243 843  843  HOH HOH U . 
DC 3 HOH 244 844  844  HOH HOH U . 
DC 3 HOH 245 845  845  HOH HOH U . 
DC 3 HOH 246 846  846  HOH HOH U . 
DC 3 HOH 247 847  847  HOH HOH U . 
DC 3 HOH 248 848  848  HOH HOH U . 
DC 3 HOH 249 849  849  HOH HOH U . 
DC 3 HOH 250 850  850  HOH HOH U . 
DC 3 HOH 251 851  851  HOH HOH U . 
DC 3 HOH 252 852  852  HOH HOH U . 
DC 3 HOH 253 853  853  HOH HOH U . 
DC 3 HOH 254 854  854  HOH HOH U . 
DC 3 HOH 255 855  855  HOH HOH U . 
DC 3 HOH 256 856  856  HOH HOH U . 
DC 3 HOH 257 857  857  HOH HOH U . 
DC 3 HOH 258 858  858  HOH HOH U . 
DC 3 HOH 259 859  859  HOH HOH U . 
DC 3 HOH 260 860  860  HOH HOH U . 
DC 3 HOH 261 861  861  HOH HOH U . 
DC 3 HOH 262 862  862  HOH HOH U . 
DC 3 HOH 263 863  863  HOH HOH U . 
DC 3 HOH 264 864  864  HOH HOH U . 
DC 3 HOH 265 865  865  HOH HOH U . 
DC 3 HOH 266 866  866  HOH HOH U . 
DC 3 HOH 267 867  867  HOH HOH U . 
DC 3 HOH 268 868  868  HOH HOH U . 
DC 3 HOH 269 869  869  HOH HOH U . 
DC 3 HOH 270 870  870  HOH HOH U . 
DC 3 HOH 271 871  871  HOH HOH U . 
DC 3 HOH 272 872  872  HOH HOH U . 
DC 3 HOH 273 873  873  HOH HOH U . 
DC 3 HOH 274 874  874  HOH HOH U . 
DC 3 HOH 275 875  875  HOH HOH U . 
DC 3 HOH 276 876  876  HOH HOH U . 
DC 3 HOH 277 877  877  HOH HOH U . 
DC 3 HOH 278 878  878  HOH HOH U . 
DC 3 HOH 279 879  879  HOH HOH U . 
DC 3 HOH 280 880  880  HOH HOH U . 
DC 3 HOH 281 881  881  HOH HOH U . 
DC 3 HOH 282 882  882  HOH HOH U . 
DC 3 HOH 283 883  883  HOH HOH U . 
DC 3 HOH 284 884  884  HOH HOH U . 
DC 3 HOH 285 885  885  HOH HOH U . 
DC 3 HOH 286 886  886  HOH HOH U . 
DC 3 HOH 287 887  887  HOH HOH U . 
DC 3 HOH 288 888  888  HOH HOH U . 
DC 3 HOH 289 889  889  HOH HOH U . 
DC 3 HOH 290 890  890  HOH HOH U . 
DC 3 HOH 291 891  891  HOH HOH U . 
DC 3 HOH 292 892  892  HOH HOH U . 
DC 3 HOH 293 893  893  HOH HOH U . 
DC 3 HOH 294 894  894  HOH HOH U . 
DC 3 HOH 295 895  895  HOH HOH U . 
DC 3 HOH 296 896  896  HOH HOH U . 
DC 3 HOH 297 897  897  HOH HOH U . 
DC 3 HOH 298 898  898  HOH HOH U . 
DC 3 HOH 299 899  899  HOH HOH U . 
DC 3 HOH 300 900  900  HOH HOH U . 
DC 3 HOH 301 901  901  HOH HOH U . 
DC 3 HOH 302 902  902  HOH HOH U . 
DC 3 HOH 303 903  903  HOH HOH U . 
DC 3 HOH 304 904  904  HOH HOH U . 
DC 3 HOH 305 905  905  HOH HOH U . 
DC 3 HOH 306 906  906  HOH HOH U . 
DC 3 HOH 307 907  907  HOH HOH U . 
DC 3 HOH 308 908  908  HOH HOH U . 
DC 3 HOH 309 909  909  HOH HOH U . 
DC 3 HOH 310 910  910  HOH HOH U . 
DC 3 HOH 311 911  911  HOH HOH U . 
DC 3 HOH 312 912  912  HOH HOH U . 
DC 3 HOH 313 913  913  HOH HOH U . 
DC 3 HOH 314 914  914  HOH HOH U . 
DC 3 HOH 315 915  915  HOH HOH U . 
DC 3 HOH 316 916  916  HOH HOH U . 
DC 3 HOH 317 917  917  HOH HOH U . 
DC 3 HOH 318 918  918  HOH HOH U . 
DC 3 HOH 319 919  919  HOH HOH U . 
DC 3 HOH 320 920  920  HOH HOH U . 
DC 3 HOH 321 921  921  HOH HOH U . 
DC 3 HOH 322 922  922  HOH HOH U . 
DC 3 HOH 323 923  923  HOH HOH U . 
DC 3 HOH 324 924  924  HOH HOH U . 
DC 3 HOH 325 925  925  HOH HOH U . 
DC 3 HOH 326 926  926  HOH HOH U . 
DC 3 HOH 327 927  927  HOH HOH U . 
DC 3 HOH 328 928  928  HOH HOH U . 
DC 3 HOH 329 929  929  HOH HOH U . 
DC 3 HOH 330 930  930  HOH HOH U . 
DC 3 HOH 331 931  931  HOH HOH U . 
DC 3 HOH 332 932  932  HOH HOH U . 
DC 3 HOH 333 933  933  HOH HOH U . 
DC 3 HOH 334 934  934  HOH HOH U . 
DC 3 HOH 335 935  935  HOH HOH U . 
DC 3 HOH 336 936  936  HOH HOH U . 
DC 3 HOH 337 937  937  HOH HOH U . 
DC 3 HOH 338 938  938  HOH HOH U . 
DC 3 HOH 339 939  939  HOH HOH U . 
DC 3 HOH 340 940  940  HOH HOH U . 
DC 3 HOH 341 941  941  HOH HOH U . 
DC 3 HOH 342 942  942  HOH HOH U . 
DC 3 HOH 343 943  943  HOH HOH U . 
DC 3 HOH 344 944  944  HOH HOH U . 
DC 3 HOH 345 945  945  HOH HOH U . 
DC 3 HOH 346 946  946  HOH HOH U . 
DC 3 HOH 347 947  947  HOH HOH U . 
DC 3 HOH 348 948  948  HOH HOH U . 
DC 3 HOH 349 949  949  HOH HOH U . 
DC 3 HOH 350 950  950  HOH HOH U . 
DC 3 HOH 351 951  951  HOH HOH U . 
DC 3 HOH 352 952  952  HOH HOH U . 
DC 3 HOH 353 953  953  HOH HOH U . 
DC 3 HOH 354 954  954  HOH HOH U . 
DC 3 HOH 355 955  955  HOH HOH U . 
DC 3 HOH 356 956  956  HOH HOH U . 
DC 3 HOH 357 957  957  HOH HOH U . 
DC 3 HOH 358 958  958  HOH HOH U . 
DC 3 HOH 359 959  959  HOH HOH U . 
DC 3 HOH 360 960  960  HOH HOH U . 
DC 3 HOH 361 961  961  HOH HOH U . 
DC 3 HOH 362 962  962  HOH HOH U . 
DC 3 HOH 363 963  963  HOH HOH U . 
DC 3 HOH 364 964  964  HOH HOH U . 
DC 3 HOH 365 965  965  HOH HOH U . 
DC 3 HOH 366 966  966  HOH HOH U . 
DC 3 HOH 367 967  967  HOH HOH U . 
DC 3 HOH 368 968  968  HOH HOH U . 
DC 3 HOH 369 969  969  HOH HOH U . 
DC 3 HOH 370 970  970  HOH HOH U . 
DC 3 HOH 371 971  971  HOH HOH U . 
DC 3 HOH 372 972  972  HOH HOH U . 
DC 3 HOH 373 973  973  HOH HOH U . 
DC 3 HOH 374 974  974  HOH HOH U . 
DC 3 HOH 375 975  975  HOH HOH U . 
DC 3 HOH 376 976  976  HOH HOH U . 
DC 3 HOH 377 977  977  HOH HOH U . 
DC 3 HOH 378 978  978  HOH HOH U . 
DC 3 HOH 379 979  979  HOH HOH U . 
DC 3 HOH 380 980  980  HOH HOH U . 
DC 3 HOH 381 981  981  HOH HOH U . 
DC 3 HOH 382 982  982  HOH HOH U . 
DC 3 HOH 383 983  983  HOH HOH U . 
DC 3 HOH 384 984  984  HOH HOH U . 
DC 3 HOH 385 985  985  HOH HOH U . 
DC 3 HOH 386 986  986  HOH HOH U . 
DC 3 HOH 387 987  987  HOH HOH U . 
DC 3 HOH 388 988  988  HOH HOH U . 
DC 3 HOH 389 989  989  HOH HOH U . 
DC 3 HOH 390 990  990  HOH HOH U . 
DC 3 HOH 391 991  991  HOH HOH U . 
DC 3 HOH 392 992  992  HOH HOH U . 
DC 3 HOH 393 993  993  HOH HOH U . 
DC 3 HOH 394 994  994  HOH HOH U . 
DC 3 HOH 395 995  995  HOH HOH U . 
DC 3 HOH 396 996  996  HOH HOH U . 
DC 3 HOH 397 997  997  HOH HOH U . 
DC 3 HOH 398 998  998  HOH HOH U . 
DC 3 HOH 399 999  999  HOH HOH U . 
DC 3 HOH 400 1000 1000 HOH HOH U . 
DC 3 HOH 401 1001 1001 HOH HOH U . 
DC 3 HOH 402 1002 1002 HOH HOH U . 
DC 3 HOH 403 1003 1003 HOH HOH U . 
DC 3 HOH 404 1004 1004 HOH HOH U . 
DC 3 HOH 405 1005 1005 HOH HOH U . 
DC 3 HOH 406 1006 1006 HOH HOH U . 
DC 3 HOH 407 1007 1007 HOH HOH U . 
DC 3 HOH 408 1008 1008 HOH HOH U . 
DC 3 HOH 409 1009 1009 HOH HOH U . 
DC 3 HOH 410 1010 1010 HOH HOH U . 
DC 3 HOH 411 1011 1011 HOH HOH U . 
DC 3 HOH 412 1012 1012 HOH HOH U . 
DC 3 HOH 413 1013 1013 HOH HOH U . 
DC 3 HOH 414 1014 1014 HOH HOH U . 
DC 3 HOH 415 1015 1015 HOH HOH U . 
DC 3 HOH 416 1016 1016 HOH HOH U . 
DC 3 HOH 417 1017 1017 HOH HOH U . 
DC 3 HOH 418 1018 1018 HOH HOH U . 
DC 3 HOH 419 1019 1019 HOH HOH U . 
DC 3 HOH 420 1020 1020 HOH HOH U . 
DC 3 HOH 421 1021 1021 HOH HOH U . 
DC 3 HOH 422 1022 1022 HOH HOH U . 
DC 3 HOH 423 1023 1023 HOH HOH U . 
DC 3 HOH 424 1024 1024 HOH HOH U . 
DC 3 HOH 425 1025 1025 HOH HOH U . 
DC 3 HOH 426 1026 1026 HOH HOH U . 
DC 3 HOH 427 1027 1027 HOH HOH U . 
DC 3 HOH 428 1028 1028 HOH HOH U . 
DC 3 HOH 429 1029 1029 HOH HOH U . 
DC 3 HOH 430 1030 1030 HOH HOH U . 
DC 3 HOH 431 1031 1031 HOH HOH U . 
DC 3 HOH 432 1032 1032 HOH HOH U . 
DC 3 HOH 433 1033 1033 HOH HOH U . 
DC 3 HOH 434 1034 1034 HOH HOH U . 
DC 3 HOH 435 1035 1035 HOH HOH U . 
DC 3 HOH 436 1036 1036 HOH HOH U . 
DC 3 HOH 437 1037 1037 HOH HOH U . 
DC 3 HOH 438 1038 1038 HOH HOH U . 
DC 3 HOH 439 1039 1039 HOH HOH U . 
DC 3 HOH 440 1040 1040 HOH HOH U . 
DC 3 HOH 441 1041 1041 HOH HOH U . 
DC 3 HOH 442 1042 1042 HOH HOH U . 
DC 3 HOH 443 1043 1043 HOH HOH U . 
DC 3 HOH 444 1044 1044 HOH HOH U . 
DC 3 HOH 445 1045 1045 HOH HOH U . 
DC 3 HOH 446 1046 1046 HOH HOH U . 
DC 3 HOH 447 1047 1047 HOH HOH U . 
DC 3 HOH 448 1048 1048 HOH HOH U . 
DC 3 HOH 449 1049 1049 HOH HOH U . 
DC 3 HOH 450 1050 1050 HOH HOH U . 
DC 3 HOH 451 1051 1051 HOH HOH U . 
DC 3 HOH 452 1052 1052 HOH HOH U . 
DC 3 HOH 453 1053 1053 HOH HOH U . 
DC 3 HOH 454 1054 1054 HOH HOH U . 
DC 3 HOH 455 1055 1055 HOH HOH U . 
DC 3 HOH 456 1056 1056 HOH HOH U . 
DC 3 HOH 457 1057 1057 HOH HOH U . 
DC 3 HOH 458 1058 1058 HOH HOH U . 
DC 3 HOH 459 1059 1059 HOH HOH U . 
DC 3 HOH 460 1060 1060 HOH HOH U . 
DC 3 HOH 461 1061 1061 HOH HOH U . 
DC 3 HOH 462 1062 1062 HOH HOH U . 
DC 3 HOH 463 1063 1063 HOH HOH U . 
DC 3 HOH 464 1064 1064 HOH HOH U . 
DC 3 HOH 465 1065 1065 HOH HOH U . 
DC 3 HOH 466 1066 1066 HOH HOH U . 
DC 3 HOH 467 1067 1067 HOH HOH U . 
DC 3 HOH 468 1068 1068 HOH HOH U . 
DC 3 HOH 469 1069 1069 HOH HOH U . 
DC 3 HOH 470 1070 1070 HOH HOH U . 
DC 3 HOH 471 1071 1071 HOH HOH U . 
DC 3 HOH 472 1072 1072 HOH HOH U . 
DC 3 HOH 473 1073 1073 HOH HOH U . 
DC 3 HOH 474 1074 1074 HOH HOH U . 
DC 3 HOH 475 1075 1075 HOH HOH U . 
DC 3 HOH 476 1076 1076 HOH HOH U . 
DC 3 HOH 477 1077 1077 HOH HOH U . 
DC 3 HOH 478 1078 1078 HOH HOH U . 
DC 3 HOH 479 1079 1079 HOH HOH U . 
DC 3 HOH 480 1080 1080 HOH HOH U . 
DC 3 HOH 481 1081 1081 HOH HOH U . 
DC 3 HOH 482 1082 1082 HOH HOH U . 
DC 3 HOH 483 1083 1083 HOH HOH U . 
DC 3 HOH 484 1084 1084 HOH HOH U . 
DC 3 HOH 485 1085 1085 HOH HOH U . 
DC 3 HOH 486 1086 1086 HOH HOH U . 
DC 3 HOH 487 1087 1087 HOH HOH U . 
DC 3 HOH 488 1088 1088 HOH HOH U . 
DC 3 HOH 489 1089 1089 HOH HOH U . 
DC 3 HOH 490 1090 1090 HOH HOH U . 
DC 3 HOH 491 1091 1091 HOH HOH U . 
DC 3 HOH 492 1092 1092 HOH HOH U . 
DC 3 HOH 493 1093 1093 HOH HOH U . 
DC 3 HOH 494 1094 1094 HOH HOH U . 
DC 3 HOH 495 1095 1095 HOH HOH U . 
DC 3 HOH 496 1096 1096 HOH HOH U . 
DC 3 HOH 497 1097 1097 HOH HOH U . 
DC 3 HOH 498 1098 1098 HOH HOH U . 
DC 3 HOH 499 1099 1099 HOH HOH U . 
DC 3 HOH 500 1100 1100 HOH HOH U . 
DC 3 HOH 501 1101 1101 HOH HOH U . 
DC 3 HOH 502 1102 1102 HOH HOH U . 
DC 3 HOH 503 1103 1103 HOH HOH U . 
DC 3 HOH 504 1104 1104 HOH HOH U . 
DC 3 HOH 505 1105 1105 HOH HOH U . 
DC 3 HOH 506 1106 1106 HOH HOH U . 
DC 3 HOH 507 1107 1107 HOH HOH U . 
DC 3 HOH 508 1108 1108 HOH HOH U . 
DC 3 HOH 509 1109 1109 HOH HOH U . 
DC 3 HOH 510 1110 1110 HOH HOH U . 
DC 3 HOH 511 1111 1111 HOH HOH U . 
DC 3 HOH 512 1112 1112 HOH HOH U . 
DC 3 HOH 513 1113 1113 HOH HOH U . 
DC 3 HOH 514 1114 1114 HOH HOH U . 
DC 3 HOH 515 1115 1115 HOH HOH U . 
DC 3 HOH 516 1116 1116 HOH HOH U . 
DC 3 HOH 517 1117 1117 HOH HOH U . 
DC 3 HOH 518 1118 1118 HOH HOH U . 
DC 3 HOH 519 1119 1119 HOH HOH U . 
DC 3 HOH 520 1120 1120 HOH HOH U . 
DC 3 HOH 521 1121 1121 HOH HOH U . 
DC 3 HOH 522 1122 1122 HOH HOH U . 
DC 3 HOH 523 1123 1123 HOH HOH U . 
DC 3 HOH 524 1124 1124 HOH HOH U . 
DC 3 HOH 525 1125 1125 HOH HOH U . 
DC 3 HOH 526 1126 1126 HOH HOH U . 
DC 3 HOH 527 1127 1127 HOH HOH U . 
DC 3 HOH 528 1128 1128 HOH HOH U . 
DC 3 HOH 529 1129 1129 HOH HOH U . 
DC 3 HOH 530 1130 1130 HOH HOH U . 
DC 3 HOH 531 1131 1131 HOH HOH U . 
DC 3 HOH 532 1132 1132 HOH HOH U . 
DC 3 HOH 533 1133 1133 HOH HOH U . 
DC 3 HOH 534 1134 1134 HOH HOH U . 
DC 3 HOH 535 1135 1135 HOH HOH U . 
DC 3 HOH 536 1136 1136 HOH HOH U . 
DC 3 HOH 537 1137 1137 HOH HOH U . 
DC 3 HOH 538 1138 1138 HOH HOH U . 
DC 3 HOH 539 1139 1139 HOH HOH U . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 4   ? CG  ? A GLU 3   CG  
2   1 Y 1 A GLU 4   ? CD  ? A GLU 3   CD  
3   1 Y 1 A GLU 4   ? OE1 ? A GLU 3   OE1 
4   1 Y 1 A GLU 4   ? OE2 ? A GLU 3   OE2 
5   1 Y 1 A LYS 5   ? CG  ? A LYS 4   CG  
6   1 Y 1 A LYS 5   ? CD  ? A LYS 4   CD  
7   1 Y 1 A LYS 5   ? CE  ? A LYS 4   CE  
8   1 Y 1 A LYS 5   ? NZ  ? A LYS 4   NZ  
9   1 Y 1 A ARG 6   ? CG  ? A ARG 5   CG  
10  1 Y 1 A ARG 6   ? CD  ? A ARG 5   CD  
11  1 Y 1 A ARG 6   ? NE  ? A ARG 5   NE  
12  1 Y 1 A ARG 6   ? CZ  ? A ARG 5   CZ  
13  1 Y 1 A ARG 6   ? NH1 ? A ARG 5   NH1 
14  1 Y 1 A ARG 6   ? NH2 ? A ARG 5   NH2 
15  1 Y 1 A SER 99  ? OG  ? A SER 98  OG  
16  1 Y 1 A GLN 100 ? CG  ? A GLN 99  CG  
17  1 Y 1 A GLN 100 ? CD  ? A GLN 99  CD  
18  1 Y 1 A GLN 100 ? OE1 ? A GLN 99  OE1 
19  1 Y 1 A GLN 100 ? NE2 ? A GLN 99  NE2 
20  1 Y 1 A GLU 104 ? CB  ? A GLU 103 CB  
21  1 Y 1 A GLU 104 ? CG  ? A GLU 103 CG  
22  1 Y 1 A GLU 104 ? CD  ? A GLU 103 CD  
23  1 Y 1 A GLU 104 ? OE1 ? A GLU 103 OE1 
24  1 Y 1 A GLU 104 ? OE2 ? A GLU 103 OE2 
25  1 Y 1 A THR 105 ? CB  ? A THR 104 CB  
26  1 Y 1 A THR 105 ? OG1 ? A THR 104 OG1 
27  1 Y 1 A THR 105 ? CG2 ? A THR 104 CG2 
28  1 Y 1 A LYS 399 ? CG  ? A LYS 398 CG  
29  1 Y 1 A LYS 399 ? CD  ? A LYS 398 CD  
30  1 Y 1 A LYS 399 ? CE  ? A LYS 398 CE  
31  1 Y 1 A LYS 399 ? NZ  ? A LYS 398 NZ  
32  1 Y 1 B ARG 61  ? CG  ? B ARG 60  CG  
33  1 Y 1 B ARG 61  ? CD  ? B ARG 60  CD  
34  1 Y 1 B ARG 61  ? NE  ? B ARG 60  NE  
35  1 Y 1 B ARG 61  ? CZ  ? B ARG 60  CZ  
36  1 Y 1 B ARG 61  ? NH1 ? B ARG 60  NH1 
37  1 Y 1 B ARG 61  ? NH2 ? B ARG 60  NH2 
38  1 Y 1 B GLN 100 ? CG  ? B GLN 99  CG  
39  1 Y 1 B GLN 100 ? CD  ? B GLN 99  CD  
40  1 Y 1 B GLN 100 ? OE1 ? B GLN 99  OE1 
41  1 Y 1 B GLN 100 ? NE2 ? B GLN 99  NE2 
42  1 Y 1 B VAL 102 ? CG1 ? B VAL 101 CG1 
43  1 Y 1 B VAL 102 ? CG2 ? B VAL 101 CG2 
44  1 Y 1 B SER 103 ? OG  ? B SER 102 OG  
45  1 Y 1 B GLU 104 ? CG  ? B GLU 103 CG  
46  1 Y 1 B GLU 104 ? CD  ? B GLU 103 CD  
47  1 Y 1 B GLU 104 ? OE1 ? B GLU 103 OE1 
48  1 Y 1 B GLU 104 ? OE2 ? B GLU 103 OE2 
49  1 Y 1 B THR 105 ? CB  ? B THR 104 CB  
50  1 Y 1 B THR 105 ? OG1 ? B THR 104 OG1 
51  1 Y 1 B THR 105 ? CG2 ? B THR 104 CG2 
52  1 Y 1 B VAL 271 ? CG1 ? B VAL 270 CG1 
53  1 Y 1 B VAL 271 ? CG2 ? B VAL 270 CG2 
54  1 Y 1 B LYS 399 ? CG  ? B LYS 398 CG  
55  1 Y 1 B LYS 399 ? CD  ? B LYS 398 CD  
56  1 Y 1 B LYS 399 ? CE  ? B LYS 398 CE  
57  1 Y 1 B LYS 399 ? NZ  ? B LYS 398 NZ  
58  1 Y 1 C ARG 61  ? CG  ? C ARG 60  CG  
59  1 Y 1 C ARG 61  ? CD  ? C ARG 60  CD  
60  1 Y 1 C ARG 61  ? NE  ? C ARG 60  NE  
61  1 Y 1 C ARG 61  ? CZ  ? C ARG 60  CZ  
62  1 Y 1 C ARG 61  ? NH1 ? C ARG 60  NH1 
63  1 Y 1 C ARG 61  ? NH2 ? C ARG 60  NH2 
64  1 Y 1 C SER 99  ? CB  ? C SER 98  CB  
65  1 Y 1 C SER 99  ? OG  ? C SER 98  OG  
66  1 Y 1 C GLN 100 ? CB  ? C GLN 99  CB  
67  1 Y 1 C GLN 100 ? CG  ? C GLN 99  CG  
68  1 Y 1 C GLN 100 ? CD  ? C GLN 99  CD  
69  1 Y 1 C GLN 100 ? OE1 ? C GLN 99  OE1 
70  1 Y 1 C GLN 100 ? NE2 ? C GLN 99  NE2 
71  1 Y 1 C GLU 104 ? CG  ? C GLU 103 CG  
72  1 Y 1 C GLU 104 ? CD  ? C GLU 103 CD  
73  1 Y 1 C GLU 104 ? OE1 ? C GLU 103 OE1 
74  1 Y 1 C GLU 104 ? OE2 ? C GLU 103 OE2 
75  1 Y 1 C THR 105 ? OG1 ? C THR 104 OG1 
76  1 Y 1 C THR 105 ? CG2 ? C THR 104 CG2 
77  1 Y 1 C LYS 399 ? CG  ? C LYS 398 CG  
78  1 Y 1 C LYS 399 ? CD  ? C LYS 398 CD  
79  1 Y 1 C LYS 399 ? CE  ? C LYS 398 CE  
80  1 Y 1 C LYS 399 ? NZ  ? C LYS 398 NZ  
81  1 Y 1 D ARG 61  ? CG  ? D ARG 60  CG  
82  1 Y 1 D ARG 61  ? CD  ? D ARG 60  CD  
83  1 Y 1 D ARG 61  ? NE  ? D ARG 60  NE  
84  1 Y 1 D ARG 61  ? CZ  ? D ARG 60  CZ  
85  1 Y 1 D ARG 61  ? NH1 ? D ARG 60  NH1 
86  1 Y 1 D ARG 61  ? NH2 ? D ARG 60  NH2 
87  1 Y 1 D SER 99  ? OG  ? D SER 98  OG  
88  1 Y 1 D GLN 100 ? CB  ? D GLN 99  CB  
89  1 Y 1 D GLN 100 ? CG  ? D GLN 99  CG  
90  1 Y 1 D GLN 100 ? CD  ? D GLN 99  CD  
91  1 Y 1 D GLN 100 ? OE1 ? D GLN 99  OE1 
92  1 Y 1 D GLN 100 ? NE2 ? D GLN 99  NE2 
93  1 Y 1 D ARG 101 ? CG  ? D ARG 100 CG  
94  1 Y 1 D ARG 101 ? CD  ? D ARG 100 CD  
95  1 Y 1 D ARG 101 ? NE  ? D ARG 100 NE  
96  1 Y 1 D ARG 101 ? CZ  ? D ARG 100 CZ  
97  1 Y 1 D ARG 101 ? NH1 ? D ARG 100 NH1 
98  1 Y 1 D ARG 101 ? NH2 ? D ARG 100 NH2 
99  1 Y 1 D THR 105 ? OG1 ? D THR 104 OG1 
100 1 Y 1 D THR 105 ? CG2 ? D THR 104 CG2 
101 1 Y 1 D LYS 399 ? CG  ? D LYS 398 CG  
102 1 Y 1 D LYS 399 ? CD  ? D LYS 398 CD  
103 1 Y 1 D LYS 399 ? CE  ? D LYS 398 CE  
104 1 Y 1 D LYS 399 ? NZ  ? D LYS 398 NZ  
105 1 Y 1 E ARG 33  ? CG  ? E ARG 32  CG  
106 1 Y 1 E ARG 33  ? CD  ? E ARG 32  CD  
107 1 Y 1 E ARG 33  ? NE  ? E ARG 32  NE  
108 1 Y 1 E ARG 33  ? CZ  ? E ARG 32  CZ  
109 1 Y 1 E ARG 33  ? NH1 ? E ARG 32  NH1 
110 1 Y 1 E ARG 33  ? NH2 ? E ARG 32  NH2 
111 1 Y 1 E ARG 61  ? CG  ? E ARG 60  CG  
112 1 Y 1 E ARG 61  ? CD  ? E ARG 60  CD  
113 1 Y 1 E ARG 61  ? NE  ? E ARG 60  NE  
114 1 Y 1 E ARG 61  ? CZ  ? E ARG 60  CZ  
115 1 Y 1 E ARG 61  ? NH1 ? E ARG 60  NH1 
116 1 Y 1 E ARG 61  ? NH2 ? E ARG 60  NH2 
117 1 Y 1 E GLU 168 ? CG  ? E GLU 167 CG  
118 1 Y 1 E GLU 168 ? CD  ? E GLU 167 CD  
119 1 Y 1 E GLU 168 ? OE1 ? E GLU 167 OE1 
120 1 Y 1 E GLU 168 ? OE2 ? E GLU 167 OE2 
121 1 Y 1 E ARG 269 ? CG  ? E ARG 268 CG  
122 1 Y 1 E ARG 269 ? CD  ? E ARG 268 CD  
123 1 Y 1 E ARG 269 ? NE  ? E ARG 268 NE  
124 1 Y 1 E ARG 269 ? CZ  ? E ARG 268 CZ  
125 1 Y 1 E ARG 269 ? NH1 ? E ARG 268 NH1 
126 1 Y 1 E ARG 269 ? NH2 ? E ARG 268 NH2 
127 1 Y 1 E LYS 399 ? CG  ? E LYS 398 CG  
128 1 Y 1 E LYS 399 ? CD  ? E LYS 398 CD  
129 1 Y 1 E LYS 399 ? CE  ? E LYS 398 CE  
130 1 Y 1 E LYS 399 ? NZ  ? E LYS 398 NZ  
131 1 Y 1 H ARG 33  ? CG  ? F ARG 32  CG  
132 1 Y 1 H ARG 33  ? CD  ? F ARG 32  CD  
133 1 Y 1 H ARG 33  ? NE  ? F ARG 32  NE  
134 1 Y 1 H ARG 33  ? CZ  ? F ARG 32  CZ  
135 1 Y 1 H ARG 33  ? NH1 ? F ARG 32  NH1 
136 1 Y 1 H ARG 33  ? NH2 ? F ARG 32  NH2 
137 1 Y 1 H ARG 61  ? CG  ? F ARG 60  CG  
138 1 Y 1 H ARG 61  ? CD  ? F ARG 60  CD  
139 1 Y 1 H ARG 61  ? NE  ? F ARG 60  NE  
140 1 Y 1 H ARG 61  ? CZ  ? F ARG 60  CZ  
141 1 Y 1 H ARG 61  ? NH1 ? F ARG 60  NH1 
142 1 Y 1 H ARG 61  ? NH2 ? F ARG 60  NH2 
143 1 Y 1 H ARG 86  ? CG  ? F ARG 85  CG  
144 1 Y 1 H ARG 86  ? CD  ? F ARG 85  CD  
145 1 Y 1 H ARG 86  ? NE  ? F ARG 85  NE  
146 1 Y 1 H ARG 86  ? CZ  ? F ARG 85  CZ  
147 1 Y 1 H ARG 86  ? NH1 ? F ARG 85  NH1 
148 1 Y 1 H ARG 86  ? NH2 ? F ARG 85  NH2 
149 1 Y 1 H LYS 399 ? CG  ? F LYS 398 CG  
150 1 Y 1 H LYS 399 ? CD  ? F LYS 398 CD  
151 1 Y 1 H LYS 399 ? CE  ? F LYS 398 CE  
152 1 Y 1 H LYS 399 ? NZ  ? F LYS 398 NZ  
153 1 Y 1 I ARG 33  ? CG  ? G ARG 32  CG  
154 1 Y 1 I ARG 33  ? CD  ? G ARG 32  CD  
155 1 Y 1 I ARG 33  ? NE  ? G ARG 32  NE  
156 1 Y 1 I ARG 33  ? CZ  ? G ARG 32  CZ  
157 1 Y 1 I ARG 33  ? NH1 ? G ARG 32  NH1 
158 1 Y 1 I ARG 33  ? NH2 ? G ARG 32  NH2 
159 1 Y 1 I ARG 61  ? CG  ? G ARG 60  CG  
160 1 Y 1 I ARG 61  ? CD  ? G ARG 60  CD  
161 1 Y 1 I ARG 61  ? NE  ? G ARG 60  NE  
162 1 Y 1 I ARG 61  ? CZ  ? G ARG 60  CZ  
163 1 Y 1 I ARG 61  ? NH1 ? G ARG 60  NH1 
164 1 Y 1 I ARG 61  ? NH2 ? G ARG 60  NH2 
165 1 Y 1 I LYS 399 ? CG  ? G LYS 398 CG  
166 1 Y 1 I LYS 399 ? CD  ? G LYS 398 CD  
167 1 Y 1 I LYS 399 ? CE  ? G LYS 398 CE  
168 1 Y 1 I LYS 399 ? NZ  ? G LYS 398 NZ  
169 1 Y 1 J ARG 61  ? CG  ? H ARG 60  CG  
170 1 Y 1 J ARG 61  ? CD  ? H ARG 60  CD  
171 1 Y 1 J ARG 61  ? NE  ? H ARG 60  NE  
172 1 Y 1 J ARG 61  ? CZ  ? H ARG 60  CZ  
173 1 Y 1 J ARG 61  ? NH1 ? H ARG 60  NH1 
174 1 Y 1 J ARG 61  ? NH2 ? H ARG 60  NH2 
175 1 Y 1 J GLN 100 ? CG  ? H GLN 99  CG  
176 1 Y 1 J GLN 100 ? CD  ? H GLN 99  CD  
177 1 Y 1 J GLN 100 ? OE1 ? H GLN 99  OE1 
178 1 Y 1 J GLN 100 ? NE2 ? H GLN 99  NE2 
179 1 Y 1 J ARG 101 ? CG  ? H ARG 100 CG  
180 1 Y 1 J ARG 101 ? CD  ? H ARG 100 CD  
181 1 Y 1 J ARG 101 ? NE  ? H ARG 100 NE  
182 1 Y 1 J ARG 101 ? CZ  ? H ARG 100 CZ  
183 1 Y 1 J ARG 101 ? NH1 ? H ARG 100 NH1 
184 1 Y 1 J ARG 101 ? NH2 ? H ARG 100 NH2 
185 1 Y 1 J VAL 102 ? CG1 ? H VAL 101 CG1 
186 1 Y 1 J VAL 102 ? CG2 ? H VAL 101 CG2 
187 1 Y 1 J SER 103 ? OG  ? H SER 102 OG  
188 1 Y 1 J GLU 104 ? CG  ? H GLU 103 CG  
189 1 Y 1 J GLU 104 ? CD  ? H GLU 103 CD  
190 1 Y 1 J GLU 104 ? OE1 ? H GLU 103 OE1 
191 1 Y 1 J GLU 104 ? OE2 ? H GLU 103 OE2 
192 1 Y 1 J THR 105 ? OG1 ? H THR 104 OG1 
193 1 Y 1 J THR 105 ? CG2 ? H THR 104 CG2 
194 1 Y 0 J SER 256 ? CA  A H SER 255 CA  
195 1 Y 0 J SER 256 ? CB  A H SER 255 CB  
196 1 Y 0 J SER 256 ? OG  A H SER 255 OG  
197 1 Y 1 J LYS 399 ? CG  ? H LYS 398 CG  
198 1 Y 1 J LYS 399 ? CD  ? H LYS 398 CD  
199 1 Y 1 J LYS 399 ? CE  ? H LYS 398 CE  
200 1 Y 1 J LYS 399 ? NZ  ? H LYS 398 NZ  
201 1 Y 1 K ARG 33  ? CG  ? I ARG 32  CG  
202 1 Y 1 K ARG 33  ? CD  ? I ARG 32  CD  
203 1 Y 1 K ARG 33  ? NE  ? I ARG 32  NE  
204 1 Y 1 K ARG 33  ? CZ  ? I ARG 32  CZ  
205 1 Y 1 K ARG 33  ? NH1 ? I ARG 32  NH1 
206 1 Y 1 K ARG 33  ? NH2 ? I ARG 32  NH2 
207 1 Y 1 K ARG 61  ? CG  ? I ARG 60  CG  
208 1 Y 1 K ARG 61  ? CD  ? I ARG 60  CD  
209 1 Y 1 K ARG 61  ? NE  ? I ARG 60  NE  
210 1 Y 1 K ARG 61  ? CZ  ? I ARG 60  CZ  
211 1 Y 1 K ARG 61  ? NH1 ? I ARG 60  NH1 
212 1 Y 1 K ARG 61  ? NH2 ? I ARG 60  NH2 
213 1 Y 1 K SER 99  ? OG  ? I SER 98  OG  
214 1 Y 1 K LYS 399 ? CG  ? I LYS 398 CG  
215 1 Y 1 K LYS 399 ? CD  ? I LYS 398 CD  
216 1 Y 1 K LYS 399 ? CE  ? I LYS 398 CE  
217 1 Y 1 K LYS 399 ? NZ  ? I LYS 398 NZ  
218 1 Y 1 L ARG 33  ? CG  ? J ARG 32  CG  
219 1 Y 1 L ARG 33  ? CD  ? J ARG 32  CD  
220 1 Y 1 L ARG 33  ? NE  ? J ARG 32  NE  
221 1 Y 1 L ARG 33  ? CZ  ? J ARG 32  CZ  
222 1 Y 1 L ARG 33  ? NH1 ? J ARG 32  NH1 
223 1 Y 1 L ARG 33  ? NH2 ? J ARG 32  NH2 
224 1 Y 1 L ARG 61  ? CG  ? J ARG 60  CG  
225 1 Y 1 L ARG 61  ? CD  ? J ARG 60  CD  
226 1 Y 1 L ARG 61  ? NE  ? J ARG 60  NE  
227 1 Y 1 L ARG 61  ? CZ  ? J ARG 60  CZ  
228 1 Y 1 L ARG 61  ? NH1 ? J ARG 60  NH1 
229 1 Y 1 L ARG 61  ? NH2 ? J ARG 60  NH2 
230 1 Y 1 L SER 99  ? OG  ? J SER 98  OG  
231 1 Y 1 L LYS 399 ? CG  ? J LYS 398 CG  
232 1 Y 1 L LYS 399 ? CD  ? J LYS 398 CD  
233 1 Y 1 L LYS 399 ? CE  ? J LYS 398 CE  
234 1 Y 1 L LYS 399 ? NZ  ? J LYS 398 NZ  
235 1 Y 1 N ARG 33  ? CG  ? K ARG 32  CG  
236 1 Y 1 N ARG 33  ? CD  ? K ARG 32  CD  
237 1 Y 1 N ARG 33  ? NE  ? K ARG 32  NE  
238 1 Y 1 N ARG 33  ? CZ  ? K ARG 32  CZ  
239 1 Y 1 N ARG 33  ? NH1 ? K ARG 32  NH1 
240 1 Y 1 N ARG 33  ? NH2 ? K ARG 32  NH2 
241 1 Y 1 N ARG 61  ? CG  ? K ARG 60  CG  
242 1 Y 1 N ARG 61  ? CD  ? K ARG 60  CD  
243 1 Y 1 N ARG 61  ? NE  ? K ARG 60  NE  
244 1 Y 1 N ARG 61  ? CZ  ? K ARG 60  CZ  
245 1 Y 1 N ARG 61  ? NH1 ? K ARG 60  NH1 
246 1 Y 1 N ARG 61  ? NH2 ? K ARG 60  NH2 
247 1 Y 1 N ILE 196 ? CG1 ? K ILE 195 CG1 
248 1 Y 1 N ILE 196 ? CG2 ? K ILE 195 CG2 
249 1 Y 1 N ILE 196 ? CD1 ? K ILE 195 CD1 
250 1 Y 1 N LYS 399 ? CG  ? K LYS 398 CG  
251 1 Y 1 N LYS 399 ? CD  ? K LYS 398 CD  
252 1 Y 1 N LYS 399 ? CE  ? K LYS 398 CE  
253 1 Y 1 N LYS 399 ? NZ  ? K LYS 398 NZ  
254 1 Y 1 O ARG 33  ? CG  ? L ARG 32  CG  
255 1 Y 1 O ARG 33  ? CD  ? L ARG 32  CD  
256 1 Y 1 O ARG 33  ? NE  ? L ARG 32  NE  
257 1 Y 1 O ARG 33  ? CZ  ? L ARG 32  CZ  
258 1 Y 1 O ARG 33  ? NH1 ? L ARG 32  NH1 
259 1 Y 1 O ARG 33  ? NH2 ? L ARG 32  NH2 
260 1 Y 1 O ARG 61  ? CG  ? L ARG 60  CG  
261 1 Y 1 O ARG 61  ? CD  ? L ARG 60  CD  
262 1 Y 1 O ARG 61  ? NE  ? L ARG 60  NE  
263 1 Y 1 O ARG 61  ? CZ  ? L ARG 60  CZ  
264 1 Y 1 O ARG 61  ? NH1 ? L ARG 60  NH1 
265 1 Y 1 O ARG 61  ? NH2 ? L ARG 60  NH2 
266 1 Y 1 O ARG 86  ? CG  ? L ARG 85  CG  
267 1 Y 1 O ARG 86  ? CD  ? L ARG 85  CD  
268 1 Y 1 O ARG 86  ? NE  ? L ARG 85  NE  
269 1 Y 1 O ARG 86  ? CZ  ? L ARG 85  CZ  
270 1 Y 1 O ARG 86  ? NH1 ? L ARG 85  NH1 
271 1 Y 1 O ARG 86  ? NH2 ? L ARG 85  NH2 
272 1 Y 1 O SER 99  ? OG  ? L SER 98  OG  
273 1 Y 1 O GLN 100 ? CG  ? L GLN 99  CG  
274 1 Y 1 O GLN 100 ? CD  ? L GLN 99  CD  
275 1 Y 1 O GLN 100 ? OE1 ? L GLN 99  OE1 
276 1 Y 1 O GLN 100 ? NE2 ? L GLN 99  NE2 
277 1 Y 1 O LYS 399 ? CG  ? L LYS 398 CG  
278 1 Y 1 O LYS 399 ? CD  ? L LYS 398 CD  
279 1 Y 1 O LYS 399 ? CE  ? L LYS 398 CE  
280 1 Y 1 O LYS 399 ? NZ  ? L LYS 398 NZ  
281 1 Y 1 P ARG 33  ? CG  ? M ARG 32  CG  
282 1 Y 1 P ARG 33  ? CD  ? M ARG 32  CD  
283 1 Y 1 P ARG 33  ? NE  ? M ARG 32  NE  
284 1 Y 1 P ARG 33  ? CZ  ? M ARG 32  CZ  
285 1 Y 1 P ARG 33  ? NH1 ? M ARG 32  NH1 
286 1 Y 1 P ARG 33  ? NH2 ? M ARG 32  NH2 
287 1 Y 1 P ARG 61  ? CG  ? M ARG 60  CG  
288 1 Y 1 P ARG 61  ? CD  ? M ARG 60  CD  
289 1 Y 1 P ARG 61  ? NE  ? M ARG 60  NE  
290 1 Y 1 P ARG 61  ? CZ  ? M ARG 60  CZ  
291 1 Y 1 P ARG 61  ? NH1 ? M ARG 60  NH1 
292 1 Y 1 P ARG 61  ? NH2 ? M ARG 60  NH2 
293 1 Y 1 P LYS 399 ? CG  ? M LYS 398 CG  
294 1 Y 1 P LYS 399 ? CD  ? M LYS 398 CD  
295 1 Y 1 P LYS 399 ? CE  ? M LYS 398 CE  
296 1 Y 1 P LYS 399 ? NZ  ? M LYS 398 NZ  
297 1 Y 1 Q ARG 33  ? CG  ? N ARG 32  CG  
298 1 Y 1 Q ARG 33  ? CD  ? N ARG 32  CD  
299 1 Y 1 Q ARG 33  ? NE  ? N ARG 32  NE  
300 1 Y 1 Q ARG 33  ? CZ  ? N ARG 32  CZ  
301 1 Y 1 Q ARG 33  ? NH1 ? N ARG 32  NH1 
302 1 Y 1 Q ARG 33  ? NH2 ? N ARG 32  NH2 
303 1 Y 1 Q ARG 61  ? CG  ? N ARG 60  CG  
304 1 Y 1 Q ARG 61  ? CD  ? N ARG 60  CD  
305 1 Y 1 Q ARG 61  ? NE  ? N ARG 60  NE  
306 1 Y 1 Q ARG 61  ? CZ  ? N ARG 60  CZ  
307 1 Y 1 Q ARG 61  ? NH1 ? N ARG 60  NH1 
308 1 Y 1 Q ARG 61  ? NH2 ? N ARG 60  NH2 
309 1 Y 1 Q LYS 399 ? CG  ? N LYS 398 CG  
310 1 Y 1 Q LYS 399 ? CD  ? N LYS 398 CD  
311 1 Y 1 Q LYS 399 ? CE  ? N LYS 398 CE  
312 1 Y 1 Q LYS 399 ? NZ  ? N LYS 398 NZ  
313 1 Y 1 R ARG 33  ? CG  ? O ARG 32  CG  
314 1 Y 1 R ARG 33  ? CD  ? O ARG 32  CD  
315 1 Y 1 R ARG 33  ? NE  ? O ARG 32  NE  
316 1 Y 1 R ARG 33  ? CZ  ? O ARG 32  CZ  
317 1 Y 1 R ARG 33  ? NH1 ? O ARG 32  NH1 
318 1 Y 1 R ARG 33  ? NH2 ? O ARG 32  NH2 
319 1 Y 1 R ARG 61  ? CG  ? O ARG 60  CG  
320 1 Y 1 R ARG 61  ? CD  ? O ARG 60  CD  
321 1 Y 1 R ARG 61  ? NE  ? O ARG 60  NE  
322 1 Y 1 R ARG 61  ? CZ  ? O ARG 60  CZ  
323 1 Y 1 R ARG 61  ? NH1 ? O ARG 60  NH1 
324 1 Y 1 R ARG 61  ? NH2 ? O ARG 60  NH2 
325 1 Y 1 R ARG 269 ? CG  ? O ARG 268 CG  
326 1 Y 1 R ARG 269 ? CD  ? O ARG 268 CD  
327 1 Y 1 R ARG 269 ? NE  ? O ARG 268 NE  
328 1 Y 1 R ARG 269 ? CZ  ? O ARG 268 CZ  
329 1 Y 1 R ARG 269 ? NH1 ? O ARG 268 NH1 
330 1 Y 1 R ARG 269 ? NH2 ? O ARG 268 NH2 
331 1 Y 1 R LYS 399 ? CG  ? O LYS 398 CG  
332 1 Y 1 R LYS 399 ? CD  ? O LYS 398 CD  
333 1 Y 1 R LYS 399 ? CE  ? O LYS 398 CE  
334 1 Y 1 R LYS 399 ? NZ  ? O LYS 398 NZ  
335 1 Y 1 F ARG 61  ? CG  ? P ARG 60  CG  
336 1 Y 1 F ARG 61  ? CD  ? P ARG 60  CD  
337 1 Y 1 F ARG 61  ? NE  ? P ARG 60  NE  
338 1 Y 1 F ARG 61  ? CZ  ? P ARG 60  CZ  
339 1 Y 1 F ARG 61  ? NH1 ? P ARG 60  NH1 
340 1 Y 1 F ARG 61  ? NH2 ? P ARG 60  NH2 
341 1 Y 0 F ILE 367 ? CA  A P ILE 366 CA  
342 1 Y 0 F ILE 367 ? CB  A P ILE 366 CB  
343 1 Y 0 F ILE 367 ? CG1 A P ILE 366 CG1 
344 1 Y 0 F ILE 367 ? CG2 A P ILE 366 CG2 
345 1 Y 0 F ILE 367 ? CD1 A P ILE 366 CD1 
346 1 Y 1 F LYS 399 ? CG  ? P LYS 398 CG  
347 1 Y 1 F LYS 399 ? CD  ? P LYS 398 CD  
348 1 Y 1 F LYS 399 ? CE  ? P LYS 398 CE  
349 1 Y 1 F LYS 399 ? NZ  ? P LYS 398 NZ  
350 1 Y 1 G ARG 6   ? CG  ? Q ARG 5   CG  
351 1 Y 1 G ARG 6   ? CD  ? Q ARG 5   CD  
352 1 Y 1 G ARG 6   ? NE  ? Q ARG 5   NE  
353 1 Y 1 G ARG 6   ? CZ  ? Q ARG 5   CZ  
354 1 Y 1 G ARG 6   ? NH1 ? Q ARG 5   NH1 
355 1 Y 1 G ARG 6   ? NH2 ? Q ARG 5   NH2 
356 1 Y 1 G ARG 61  ? CG  ? Q ARG 60  CG  
357 1 Y 1 G ARG 61  ? CD  ? Q ARG 60  CD  
358 1 Y 1 G ARG 61  ? NE  ? Q ARG 60  NE  
359 1 Y 1 G ARG 61  ? CZ  ? Q ARG 60  CZ  
360 1 Y 1 G ARG 61  ? NH1 ? Q ARG 60  NH1 
361 1 Y 1 G ARG 61  ? NH2 ? Q ARG 60  NH2 
362 1 Y 1 G LYS 399 ? CG  ? Q LYS 398 CG  
363 1 Y 1 G LYS 399 ? CD  ? Q LYS 398 CD  
364 1 Y 1 G LYS 399 ? CE  ? Q LYS 398 CE  
365 1 Y 1 G LYS 399 ? NZ  ? Q LYS 398 NZ  
366 1 Y 1 M ARG 6   ? CG  ? R ARG 5   CG  
367 1 Y 1 M ARG 6   ? CD  ? R ARG 5   CD  
368 1 Y 1 M ARG 6   ? NE  ? R ARG 5   NE  
369 1 Y 1 M ARG 6   ? CZ  ? R ARG 5   CZ  
370 1 Y 1 M ARG 6   ? NH1 ? R ARG 5   NH1 
371 1 Y 1 M ARG 6   ? NH2 ? R ARG 5   NH2 
372 1 Y 1 M ARG 61  ? CG  ? R ARG 60  CG  
373 1 Y 1 M ARG 61  ? CD  ? R ARG 60  CD  
374 1 Y 1 M ARG 61  ? NE  ? R ARG 60  NE  
375 1 Y 1 M ARG 61  ? CZ  ? R ARG 60  CZ  
376 1 Y 1 M ARG 61  ? NH1 ? R ARG 60  NH1 
377 1 Y 1 M ARG 61  ? NH2 ? R ARG 60  NH2 
378 1 Y 1 M TYR 108 ? CG  ? R TYR 107 CG  
379 1 Y 1 M TYR 108 ? CD1 ? R TYR 107 CD1 
380 1 Y 1 M TYR 108 ? CD2 ? R TYR 107 CD2 
381 1 Y 1 M TYR 108 ? CE1 ? R TYR 107 CE1 
382 1 Y 1 M TYR 108 ? CE2 ? R TYR 107 CE2 
383 1 Y 1 M TYR 108 ? CZ  ? R TYR 107 CZ  
384 1 Y 1 M TYR 108 ? OH  ? R TYR 107 OH  
385 1 Y 1 M ARG 269 ? CG  ? R ARG 268 CG  
386 1 Y 1 M ARG 269 ? CD  ? R ARG 268 CD  
387 1 Y 1 M ARG 269 ? NE  ? R ARG 268 NE  
388 1 Y 1 M ARG 269 ? CZ  ? R ARG 268 CZ  
389 1 Y 1 M ARG 269 ? NH1 ? R ARG 268 NH1 
390 1 Y 1 M ARG 269 ? NH2 ? R ARG 268 NH2 
391 1 Y 0 M THR 346 ? CA  A R THR 345 CA  
392 1 Y 0 M THR 346 ? CB  A R THR 345 CB  
393 1 Y 0 M THR 346 ? OG1 A R THR 345 OG1 
394 1 Y 0 M THR 346 ? CG2 A R THR 345 CG2 
395 1 Y 1 M LYS 399 ? CG  ? R LYS 398 CG  
396 1 Y 1 M LYS 399 ? CD  ? R LYS 398 CD  
397 1 Y 1 M LYS 399 ? CE  ? R LYS 398 CE  
398 1 Y 1 M LYS 399 ? NZ  ? R LYS 398 NZ  
399 1 Y 1 T ARG 33  ? CG  ? S ARG 32  CG  
400 1 Y 1 T ARG 33  ? CD  ? S ARG 32  CD  
401 1 Y 1 T ARG 33  ? NE  ? S ARG 32  NE  
402 1 Y 1 T ARG 33  ? CZ  ? S ARG 32  CZ  
403 1 Y 1 T ARG 33  ? NH1 ? S ARG 32  NH1 
404 1 Y 1 T ARG 33  ? NH2 ? S ARG 32  NH2 
405 1 Y 1 T ARG 61  ? CG  ? S ARG 60  CG  
406 1 Y 1 T ARG 61  ? CD  ? S ARG 60  CD  
407 1 Y 1 T ARG 61  ? NE  ? S ARG 60  NE  
408 1 Y 1 T ARG 61  ? CZ  ? S ARG 60  CZ  
409 1 Y 1 T ARG 61  ? NH1 ? S ARG 60  NH1 
410 1 Y 1 T ARG 61  ? NH2 ? S ARG 60  NH2 
411 1 Y 1 T VAL 102 ? CG1 ? S VAL 101 CG1 
412 1 Y 1 T VAL 102 ? CG2 ? S VAL 101 CG2 
413 1 Y 1 T SER 103 ? CB  ? S SER 102 CB  
414 1 Y 1 T SER 103 ? OG  ? S SER 102 OG  
415 1 Y 1 T GLU 104 ? CG  ? S GLU 103 CG  
416 1 Y 1 T GLU 104 ? CD  ? S GLU 103 CD  
417 1 Y 1 T GLU 104 ? OE1 ? S GLU 103 OE1 
418 1 Y 1 T GLU 104 ? OE2 ? S GLU 103 OE2 
419 1 Y 1 T LYS 399 ? CG  ? S LYS 398 CG  
420 1 Y 1 T LYS 399 ? CD  ? S LYS 398 CD  
421 1 Y 1 T LYS 399 ? CE  ? S LYS 398 CE  
422 1 Y 1 T LYS 399 ? NZ  ? S LYS 398 NZ  
423 1 Y 1 U ARG 33  ? CG  ? T ARG 32  CG  
424 1 Y 1 U ARG 33  ? CD  ? T ARG 32  CD  
425 1 Y 1 U ARG 33  ? NE  ? T ARG 32  NE  
426 1 Y 1 U ARG 33  ? CZ  ? T ARG 32  CZ  
427 1 Y 1 U ARG 33  ? NH1 ? T ARG 32  NH1 
428 1 Y 1 U ARG 33  ? NH2 ? T ARG 32  NH2 
429 1 Y 1 U ARG 61  ? CG  ? T ARG 60  CG  
430 1 Y 1 U ARG 61  ? CD  ? T ARG 60  CD  
431 1 Y 1 U ARG 61  ? NE  ? T ARG 60  NE  
432 1 Y 1 U ARG 61  ? CZ  ? T ARG 60  CZ  
433 1 Y 1 U ARG 61  ? NH1 ? T ARG 60  NH1 
434 1 Y 1 U ARG 61  ? NH2 ? T ARG 60  NH2 
435 1 Y 1 U ARG 86  ? CG  ? T ARG 85  CG  
436 1 Y 1 U ARG 86  ? CD  ? T ARG 85  CD  
437 1 Y 1 U ARG 86  ? NE  ? T ARG 85  NE  
438 1 Y 1 U ARG 86  ? CZ  ? T ARG 85  CZ  
439 1 Y 1 U ARG 86  ? NH1 ? T ARG 85  NH1 
440 1 Y 1 U ARG 86  ? NH2 ? T ARG 85  NH2 
441 1 Y 1 U VAL 102 ? CG1 ? T VAL 101 CG1 
442 1 Y 1 U VAL 102 ? CG2 ? T VAL 101 CG2 
443 1 Y 1 U SER 103 ? OG  ? T SER 102 OG  
444 1 Y 1 U GLU 104 ? CB  ? T GLU 103 CB  
445 1 Y 1 U GLU 104 ? CG  ? T GLU 103 CG  
446 1 Y 1 U GLU 104 ? CD  ? T GLU 103 CD  
447 1 Y 1 U GLU 104 ? OE1 ? T GLU 103 OE1 
448 1 Y 1 U GLU 104 ? OE2 ? T GLU 103 OE2 
449 1 Y 1 U THR 105 ? OG1 ? T THR 104 OG1 
450 1 Y 1 U THR 105 ? CG2 ? T THR 104 CG2 
451 1 Y 1 U LYS 399 ? CG  ? T LYS 398 CG  
452 1 Y 1 U LYS 399 ? CD  ? T LYS 398 CD  
453 1 Y 1 U LYS 399 ? CE  ? T LYS 398 CE  
454 1 Y 1 U LYS 399 ? NZ  ? T LYS 398 NZ  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.11.1_2575 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-3000    ? ? ? .           2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22        3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-3000    ? ? ? .           4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .           5 
# 
_cell.entry_id           5W6J 
_cell.length_a           93.439 
_cell.length_b           140.685 
_cell.length_c           228.490 
_cell.angle_alpha        72.04 
_cell.angle_beta         78.19 
_cell.angle_gamma        89.98 
_cell.Z_PDB              20 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5W6J 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5W6J 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.96 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.51 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '50mM HEPES pH 7.5, 1.5M Li2SO4' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           80 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         MARRESEARCH 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-04-15 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5W6J 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.780 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       1003131 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.300 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.000 
_reflns.pdbx_Rmerge_I_obs                0.049 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.200 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.077 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.067 
_reflns.pdbx_Rpim_I_all                  0.049 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         1967391 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.780 1.810  ? ? ? ? ? ? ? 96.100 ? ? ? ? 0.729 ? ? ? ? ? ? ? ? 2.000 ? 1.047 ? ? ?     0.729 ? 1  1 0.561 ? 
1.810 1.840  ? ? ? ? ? ? ? 96.200 ? ? ? ? 0.612 ? ? ? ? ? ? ? ? 2.000 ? 1.072 ? ? 0.866 0.612 ? 2  1 0.628 ? 
1.840 1.880  ? ? ? ? ? ? ? 96.400 ? ? ? ? 0.495 ? ? ? ? ? ? ? ? 2.000 ? 1.072 ? ? 0.701 0.495 ? 3  1 0.754 ? 
1.880 1.920  ? ? ? ? ? ? ? 96.500 ? ? ? ? 0.398 ? ? ? ? ? ? ? ? 2.000 ? 1.092 ? ? 0.562 0.398 ? 4  1 0.811 ? 
1.920 1.960  ? ? ? ? ? ? ? 96.600 ? ? ? ? 0.311 ? ? ? ? ? ? ? ? 2.000 ? 1.078 ? ? 0.440 0.311 ? 5  1 0.876 ? 
1.960 2.000  ? ? ? ? ? ? ? 96.800 ? ? ? ? 0.255 ? ? ? ? ? ? ? ? 2.000 ? 1.087 ? ? 0.361 0.255 ? 6  1 0.901 ? 
2.000 2.050  ? ? ? ? ? ? ? 97.000 ? ? ? ? 0.205 ? ? ? ? ? ? ? ? 2.000 ? 1.116 ? ? 0.290 0.205 ? 7  1 0.941 ? 
2.050 2.110  ? ? ? ? ? ? ? 97.100 ? ? ? ? 0.169 ? ? ? ? ? ? ? ? 2.000 ? 1.121 ? ? 0.239 0.169 ? 8  1 0.956 ? 
2.110 2.170  ? ? ? ? ? ? ? 97.200 ? ? ? ? 0.140 ? ? ? ? ? ? ? ? 2.000 ? 1.159 ? ? 0.198 0.140 ? 9  1 0.972 ? 
2.170 2.240  ? ? ? ? ? ? ? 97.400 ? ? ? ? 0.115 ? ? ? ? ? ? ? ? 2.000 ? 1.120 ? ? 0.162 0.115 ? 10 1 0.978 ? 
2.240 2.320  ? ? ? ? ? ? ? 97.600 ? ? ? ? 0.093 ? ? ? ? ? ? ? ? 2.000 ? 1.129 ? ? 0.132 0.093 ? 11 1 0.988 ? 
2.320 2.420  ? ? ? ? ? ? ? 97.700 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 2.000 ? 1.134 ? ? 0.117 0.082 ? 12 1 0.989 ? 
2.420 2.530  ? ? ? ? ? ? ? 97.900 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 2.000 ? 1.122 ? ? 0.100 0.070 ? 13 1 0.991 ? 
2.530 2.660  ? ? ? ? ? ? ? 98.100 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 2.000 ? 1.063 ? ? 0.088 0.062 ? 14 1 0.992 ? 
2.660 2.830  ? ? ? ? ? ? ? 98.200 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 2.000 ? 1.068 ? ? 0.074 0.052 ? 15 1 0.994 ? 
2.830 3.040  ? ? ? ? ? ? ? 98.300 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 2.000 ? 1.017 ? ? 0.062 0.044 ? 16 1 0.995 ? 
3.040 3.350  ? ? ? ? ? ? ? 98.300 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 2.000 ? 1.055 ? ? 0.054 0.038 ? 17 1 0.996 ? 
3.350 3.830  ? ? ? ? ? ? ? 98.300 ? ? ? ? 0.034 ? ? ? ? ? ? ? ? 1.900 ? 0.978 ? ? 0.048 0.034 ? 18 1 0.996 ? 
3.830 4.830  ? ? ? ? ? ? ? 97.700 ? ? ? ? 0.027 ? ? ? ? ? ? ? ? 1.900 ? 1.045 ? ? 0.038 0.027 ? 19 1 0.997 ? 
4.830 50.000 ? ? ? ? ? ? ? 95.800 ? ? ? ? 0.023 ? ? ? ? ? ? ? ? 2.000 ? 0.961 ? ? 0.032 0.023 ? 20 1 0.998 ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5W6J 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     1003101 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          69.510 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             36.55 
_refine.ls_d_res_high                            1.78 
_refine.ls_percent_reflns_obs                    97.0 
_refine.ls_R_factor_obs                          0.202 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.200 
_refine.ls_R_factor_R_free                       0.229 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 0.200 
_refine.ls_number_reflns_R_free                  2036 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               33.58 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 25.690 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        64436 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         210 
_refine_hist.number_atoms_solvent             11196 
_refine_hist.number_atoms_total               75842 
_refine_hist.d_res_high                       1.78 
_refine_hist.d_res_low                        36.55 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007 ? ? 66376 'X-RAY DIFFRACTION' ? 
f_angle_d          0.763 ? ? 90245 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 3.309 ? ? 49898 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.051 ? ? 9832  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005 ? ? 11835 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.7831 1.8277  70155 0.3498 95.00 0.2944 . . 140 . . 
'X-RAY DIFFRACTION' . 1.8277 1.8771  70764 0.3263 96.00 0.3638 . . 136 . . 
'X-RAY DIFFRACTION' . 1.8771 1.9324  70814 0.2997 96.00 0.3684 . . 144 . . 
'X-RAY DIFFRACTION' . 1.9324 1.9947  71028 0.2789 97.00 0.2888 . . 141 . . 
'X-RAY DIFFRACTION' . 1.9947 2.0660  71262 0.2524 97.00 0.2296 . . 137 . . 
'X-RAY DIFFRACTION' . 2.0660 2.1487  71366 0.2453 97.00 0.2761 . . 145 . . 
'X-RAY DIFFRACTION' . 2.1487 2.2465  71525 0.2355 97.00 0.2592 . . 145 . . 
'X-RAY DIFFRACTION' . 2.2465 2.3649  71589 0.2258 97.00 0.2731 . . 142 . . 
'X-RAY DIFFRACTION' . 2.3649 2.5130  72100 0.2258 98.00 0.2575 . . 140 . . 
'X-RAY DIFFRACTION' . 2.5130 2.7069  71884 0.2138 98.00 0.2313 . . 150 . . 
'X-RAY DIFFRACTION' . 2.7069 2.9791  72187 0.1938 98.00 0.2091 . . 139 . . 
'X-RAY DIFFRACTION' . 2.9791 3.4096  72262 0.1688 98.00 0.1726 . . 143 . . 
'X-RAY DIFFRACTION' . 3.4096 4.2939  72140 0.1425 98.00 0.1953 . . 144 . . 
'X-RAY DIFFRACTION' . 4.2939 30.4235 70827 0.1832 96.00 0.2288 . . 136 . . 
# 
_struct.entry_id                     5W6J 
_struct.title                        'Agrobacterium tumefaciens ADP-glucose pyrophosphorylase' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5W6J 
_struct_keywords.text            
'Glucose-1-phosphate adenylyltransferase, glycogen biosynthesis, starch biosynthesis, allosterism, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 2 ? 
EA N N 2 ? 
FA N N 2 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 2 ? 
JA N N 2 ? 
KA N N 2 ? 
LA N N 2 ? 
MA N N 2 ? 
NA N N 2 ? 
OA N N 2 ? 
PA N N 2 ? 
QA N N 2 ? 
RA N N 2 ? 
SA N N 2 ? 
TA N N 2 ? 
UA N N 2 ? 
VA N N 2 ? 
WA N N 2 ? 
XA N N 2 ? 
YA N N 2 ? 
ZA N N 2 ? 
AB N N 2 ? 
BB N N 2 ? 
CB N N 2 ? 
DB N N 2 ? 
EB N N 2 ? 
FB N N 2 ? 
GB N N 2 ? 
HB N N 2 ? 
IB N N 2 ? 
JB N N 2 ? 
KB N N 3 ? 
LB N N 3 ? 
MB N N 3 ? 
NB N N 3 ? 
OB N N 3 ? 
PB N N 3 ? 
QB N N 3 ? 
RB N N 3 ? 
SB N N 3 ? 
TB N N 3 ? 
UB N N 3 ? 
VB N N 3 ? 
WB N N 3 ? 
XB N N 3 ? 
YB N N 3 ? 
ZB N N 3 ? 
AC N N 3 ? 
BC N N 3 ? 
CC N N 3 ? 
DC N N 3 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GLGC_RHIRD 
_struct_ref.pdbx_db_accession          P39669 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSEKRVQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRG
WDFFRPERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKMDYEYMLQQHVDSGADVTIGC
LEVPRMEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEAVRRDAADPTSSRDFGKDIIPY
IVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIWTYAEITPPAKFVHDDEDRRG
SAVSSVVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHGVVIPEGLIVGEDPELDAKRF
RRTESGICLITQSMIDKLDL
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5W6J A 1 ? 420 ? P39669 1 ? 420 ? 2 421 
2  1 5W6J B 1 ? 420 ? P39669 1 ? 420 ? 2 421 
3  1 5W6J C 1 ? 420 ? P39669 1 ? 420 ? 2 421 
4  1 5W6J D 1 ? 420 ? P39669 1 ? 420 ? 2 421 
5  1 5W6J E 1 ? 420 ? P39669 1 ? 420 ? 2 421 
6  1 5W6J H 1 ? 420 ? P39669 1 ? 420 ? 2 421 
7  1 5W6J I 1 ? 420 ? P39669 1 ? 420 ? 2 421 
8  1 5W6J J 1 ? 420 ? P39669 1 ? 420 ? 2 421 
9  1 5W6J K 1 ? 420 ? P39669 1 ? 420 ? 2 421 
10 1 5W6J L 1 ? 420 ? P39669 1 ? 420 ? 2 421 
11 1 5W6J N 1 ? 420 ? P39669 1 ? 420 ? 2 421 
12 1 5W6J O 1 ? 420 ? P39669 1 ? 420 ? 2 421 
13 1 5W6J P 1 ? 420 ? P39669 1 ? 420 ? 2 421 
14 1 5W6J Q 1 ? 420 ? P39669 1 ? 420 ? 2 421 
15 1 5W6J R 1 ? 420 ? P39669 1 ? 420 ? 2 421 
16 1 5W6J F 1 ? 420 ? P39669 1 ? 420 ? 2 421 
17 1 5W6J G 1 ? 420 ? P39669 1 ? 420 ? 2 421 
18 1 5W6J M 1 ? 420 ? P39669 1 ? 420 ? 2 421 
19 1 5W6J T 1 ? 420 ? P39669 1 ? 420 ? 2 421 
20 1 5W6J U 1 ? 420 ? P39669 1 ? 420 ? 2 421 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  5W6J LEU A 220 ? UNP P39669 VAL 220 conflict 221 1  
2  5W6J LEU B 220 ? UNP P39669 VAL 220 conflict 221 2  
3  5W6J LEU C 220 ? UNP P39669 VAL 220 conflict 221 3  
4  5W6J LEU D 220 ? UNP P39669 VAL 220 conflict 221 4  
5  5W6J LEU E 220 ? UNP P39669 VAL 220 conflict 221 5  
6  5W6J LEU H 220 ? UNP P39669 VAL 220 conflict 221 6  
7  5W6J LEU I 220 ? UNP P39669 VAL 220 conflict 221 7  
8  5W6J LEU J 220 ? UNP P39669 VAL 220 conflict 221 8  
9  5W6J LEU K 220 ? UNP P39669 VAL 220 conflict 221 9  
10 5W6J LEU L 220 ? UNP P39669 VAL 220 conflict 221 10 
11 5W6J LEU N 220 ? UNP P39669 VAL 220 conflict 221 11 
12 5W6J LEU O 220 ? UNP P39669 VAL 220 conflict 221 12 
13 5W6J LEU P 220 ? UNP P39669 VAL 220 conflict 221 13 
14 5W6J LEU Q 220 ? UNP P39669 VAL 220 conflict 221 14 
15 5W6J LEU R 220 ? UNP P39669 VAL 220 conflict 221 15 
16 5W6J LEU F 220 ? UNP P39669 VAL 220 conflict 221 16 
17 5W6J LEU G 220 ? UNP P39669 VAL 220 conflict 221 17 
18 5W6J LEU M 220 ? UNP P39669 VAL 220 conflict 221 18 
19 5W6J LEU T 220 ? UNP P39669 VAL 220 conflict 221 19 
20 5W6J LEU U 220 ? UNP P39669 VAL 220 conflict 221 20 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 author_and_software_defined_assembly PISA tetrameric 4 
3 author_and_software_defined_assembly PISA tetrameric 4 
4 author_and_software_defined_assembly PISA tetrameric 4 
5 author_and_software_defined_assembly PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 13930 ? 
1 MORE         -172  ? 
1 'SSA (A^2)'  62950 ? 
2 'ABSA (A^2)' 14010 ? 
2 MORE         -165  ? 
2 'SSA (A^2)'  61980 ? 
3 'ABSA (A^2)' 13900 ? 
3 MORE         -163  ? 
3 'SSA (A^2)'  62760 ? 
4 'ABSA (A^2)' 14070 ? 
4 MORE         -164  ? 
4 'SSA (A^2)'  62410 ? 
5 'ABSA (A^2)' 14280 ? 
5 MORE         -179  ? 
5 'SSA (A^2)'  62800 ? 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E,M,U,V,CA,DA,EA,TA,UA,KB,OB,WB              
1 2 L,RA,SA,VB                                     
2 1 B,D,I,R,W,X,AA,BA,LA,MA,DB,EB,LB,NB,SB,BC      
3 1 C,F,G,Q,Y,Z,FA,GA,HA,IA,BB,CB,MB,PB,QB,AC      
4 1 J,O,NA,OA,XA,YA,TB,YB                          
4 3 H,JA,KA,RB                                     
4 4 K,PA,QA,UB                                     
5 1 N,P,S,T,VA,WA,ZA,AB,FB,GB,HB,IB,JB,XB,ZB,CC,DC 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000 0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000 
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000    
2 'crystal symmetry operation' 1_654 x+1,y,z-1   1.0000000000 0.0000000000 0.0000000000 46.6746615465  0.0000000000 1.0000000000 
0.0000000000 -70.4392474706 0.0000000000 0.0000000000 1.0000000000 -212.2712631629 
3 'crystal symmetry operation' 1_564 x,y+1,z-1   1.0000000000 0.0000000000 0.0000000000 -46.7152301254 0.0000000000 1.0000000000 
0.0000000000 70.2457439584  0.0000000000 0.0000000000 1.0000000000 -212.2712631629 
4 'crystal symmetry operation' 1_664 x+1,y+1,z-1 1.0000000000 0.0000000000 0.0000000000 46.7237698746  0.0000000000 1.0000000000 
0.0000000000 70.2457439584  0.0000000000 0.0000000000 1.0000000000 -212.2712631629 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 PRO A 8   ? ARG A 11  ? PRO A 9   ARG A 12  5 ? 4  
HELX_P HELX_P2   AA2 GLY A 23  ? ASP A 31  ? GLY A 24  ASP A 32  5 ? 9  
HELX_P HELX_P3   AA3 ALA A 34  ? ALA A 37  ? ALA A 35  ALA A 38  5 ? 4  
HELX_P HELX_P4   AA4 ILE A 47  ? GLY A 58  ? ILE A 48  GLY A 59  1 ? 12 
HELX_P HELX_P5   AA5 ALA A 70  ? TRP A 81  ? ALA A 71  TRP A 82  1 ? 12 
HELX_P HELX_P6   AA6 ARG A 85  ? ASN A 89  ? ARG A 86  ASN A 90  5 ? 5  
HELX_P HELX_P7   AA7 ALA A 111 ? GLN A 116 ? ALA A 112 GLN A 117 1 ? 6  
HELX_P HELX_P8   AA8 ASN A 117 ? ALA A 125 ? ASN A 118 ALA A 126 1 ? 9  
HELX_P HELX_P9   AA9 ASP A 141 ? GLY A 153 ? ASP A 142 GLY A 154 1 ? 13 
HELX_P HELX_P10  AB1 MET A 166 ? GLY A 170 ? MET A 167 GLY A 171 5 ? 5  
HELX_P HELX_P11  AB2 THR A 213 ? ALA A 225 ? THR A 214 ALA A 226 1 ? 13 
HELX_P HELX_P12  AB3 ASP A 236 ? GLY A 245 ? ASP A 237 GLY A 246 1 ? 10 
HELX_P HELX_P13  AB4 PHE A 252 ? CYS A 256 ? PHE A 253 CYS A 257 1 ? 5  
HELX_P HELX_P14  AB5 THR A 272 ? ASP A 282 ? THR A 273 ASP A 283 1 ? 11 
HELX_P HELX_P15  AB6 LEU A 283 ? ASP A 285 ? LEU A 284 ASP A 286 5 ? 3  
HELX_P HELX_P16  AB7 ASP A 392 ? PHE A 400 ? ASP A 393 PHE A 401 1 ? 9  
HELX_P HELX_P17  AB8 THR A 411 ? ASP A 416 ? THR A 412 ASP A 417 1 ? 6  
HELX_P HELX_P18  AB9 PRO B 8   ? ARG B 11  ? PRO B 9   ARG B 12  5 ? 4  
HELX_P HELX_P19  AC1 GLY B 23  ? THR B 30  ? GLY B 24  THR B 31  5 ? 8  
HELX_P HELX_P20  AC2 ALA B 34  ? VAL B 38  ? ALA B 35  VAL B 39  5 ? 5  
HELX_P HELX_P21  AC3 ILE B 47  ? SER B 57  ? ILE B 48  SER B 58  1 ? 11 
HELX_P HELX_P22  AC4 ALA B 70  ? TRP B 81  ? ALA B 71  TRP B 82  1 ? 12 
HELX_P HELX_P23  AC5 ARG B 85  ? ASN B 89  ? ARG B 86  ASN B 90  5 ? 5  
HELX_P HELX_P24  AC6 GLY B 109 ? GLN B 116 ? GLY B 110 GLN B 117 1 ? 8  
HELX_P HELX_P25  AC7 ASN B 117 ? GLU B 122 ? ASN B 118 GLU B 123 1 ? 6  
HELX_P HELX_P26  AC8 PRO B 123 ? ALA B 125 ? PRO B 124 ALA B 126 5 ? 3  
HELX_P HELX_P27  AC9 ASP B 141 ? GLY B 153 ? ASP B 142 GLY B 154 1 ? 13 
HELX_P HELX_P28  AD1 MET B 166 ? GLY B 170 ? MET B 167 GLY B 171 5 ? 5  
HELX_P HELX_P29  AD2 THR B 213 ? ASP B 226 ? THR B 214 ASP B 227 1 ? 14 
HELX_P HELX_P30  AD3 ASP B 236 ? HIS B 244 ? ASP B 237 HIS B 245 1 ? 9  
HELX_P HELX_P31  AD4 PHE B 252 ? CYS B 256 ? PHE B 253 CYS B 257 1 ? 5  
HELX_P HELX_P32  AD5 THR B 272 ? ASP B 282 ? THR B 273 ASP B 283 1 ? 11 
HELX_P HELX_P33  AD6 LEU B 283 ? ASP B 285 ? LEU B 284 ASP B 286 5 ? 3  
HELX_P HELX_P34  AD7 ASP B 392 ? PHE B 400 ? ASP B 393 PHE B 401 1 ? 9  
HELX_P HELX_P35  AD8 THR B 411 ? LYS B 417 ? THR B 412 LYS B 418 1 ? 7  
HELX_P HELX_P36  AD9 PRO C 8   ? ARG C 11  ? PRO C 9   ARG C 12  5 ? 4  
HELX_P HELX_P37  AE1 GLY C 23  ? ASP C 31  ? GLY C 24  ASP C 32  5 ? 9  
HELX_P HELX_P38  AE2 ALA C 34  ? VAL C 38  ? ALA C 35  VAL C 39  5 ? 5  
HELX_P HELX_P39  AE3 ILE C 47  ? GLY C 58  ? ILE C 48  GLY C 59  1 ? 12 
HELX_P HELX_P40  AE4 ALA C 70  ? TRP C 81  ? ALA C 71  TRP C 82  1 ? 12 
HELX_P HELX_P41  AE5 ARG C 85  ? ASN C 89  ? ARG C 86  ASN C 90  5 ? 5  
HELX_P HELX_P42  AE6 GLY C 109 ? GLN C 116 ? GLY C 110 GLN C 117 1 ? 8  
HELX_P HELX_P43  AE7 ASN C 117 ? GLU C 122 ? ASN C 118 GLU C 123 1 ? 6  
HELX_P HELX_P44  AE8 ASP C 141 ? GLY C 153 ? ASP C 142 GLY C 154 1 ? 13 
HELX_P HELX_P45  AE9 GLU C 167 ? GLY C 170 ? GLU C 168 GLY C 171 5 ? 4  
HELX_P HELX_P46  AF1 THR C 213 ? ALA C 225 ? THR C 214 ALA C 226 1 ? 13 
HELX_P HELX_P47  AF2 ASP C 236 ? GLY C 245 ? ASP C 237 GLY C 246 1 ? 10 
HELX_P HELX_P48  AF3 PHE C 252 ? CYS C 256 ? PHE C 253 CYS C 257 1 ? 5  
HELX_P HELX_P49  AF4 THR C 272 ? ASP C 282 ? THR C 273 ASP C 283 1 ? 11 
HELX_P HELX_P50  AF5 LEU C 283 ? ASP C 285 ? LEU C 284 ASP C 286 5 ? 3  
HELX_P HELX_P51  AF6 ASP C 392 ? PHE C 400 ? ASP C 393 PHE C 401 1 ? 9  
HELX_P HELX_P52  AF7 THR C 411 ? LYS C 417 ? THR C 412 LYS C 418 1 ? 7  
HELX_P HELX_P53  AF8 PRO D 8   ? ARG D 11  ? PRO D 9   ARG D 12  5 ? 4  
HELX_P HELX_P54  AF9 GLY D 23  ? ASP D 31  ? GLY D 24  ASP D 32  5 ? 9  
HELX_P HELX_P55  AG1 ALA D 34  ? ALA D 37  ? ALA D 35  ALA D 38  5 ? 4  
HELX_P HELX_P56  AG2 ILE D 46  ? SER D 57  ? ILE D 47  SER D 58  1 ? 12 
HELX_P HELX_P57  AG3 ALA D 70  ? TRP D 81  ? ALA D 71  TRP D 82  1 ? 12 
HELX_P HELX_P58  AG4 ARG D 85  ? ASN D 89  ? ARG D 86  ASN D 90  5 ? 5  
HELX_P HELX_P59  AG5 GLY D 109 ? GLN D 116 ? GLY D 110 GLN D 117 1 ? 8  
HELX_P HELX_P60  AG6 ASN D 117 ? GLU D 122 ? ASN D 118 GLU D 123 1 ? 6  
HELX_P HELX_P61  AG7 ASP D 141 ? GLY D 153 ? ASP D 142 GLY D 154 1 ? 13 
HELX_P HELX_P62  AG8 GLU D 167 ? GLY D 170 ? GLU D 168 GLY D 171 5 ? 4  
HELX_P HELX_P63  AG9 THR D 213 ? ALA D 225 ? THR D 214 ALA D 226 1 ? 13 
HELX_P HELX_P64  AH1 ASP D 236 ? GLY D 245 ? ASP D 237 GLY D 246 1 ? 10 
HELX_P HELX_P65  AH2 ALA D 253 ? SER D 255 ? ALA D 254 SER D 256 5 ? 3  
HELX_P HELX_P66  AH3 THR D 272 ? ASP D 282 ? THR D 273 ASP D 283 1 ? 11 
HELX_P HELX_P67  AH4 LEU D 283 ? ASP D 285 ? LEU D 284 ASP D 286 5 ? 3  
HELX_P HELX_P68  AH5 ASP D 392 ? PHE D 400 ? ASP D 393 PHE D 401 1 ? 9  
HELX_P HELX_P69  AH6 THR D 411 ? ASP D 416 ? THR D 412 ASP D 417 1 ? 6  
HELX_P HELX_P70  AH7 PRO E 8   ? ARG E 11  ? PRO E 9   ARG E 12  5 ? 4  
HELX_P HELX_P71  AH8 LEU E 26  ? ASP E 31  ? LEU E 27  ASP E 32  5 ? 6  
HELX_P HELX_P72  AH9 ALA E 34  ? VAL E 38  ? ALA E 35  VAL E 39  5 ? 5  
HELX_P HELX_P73  AI1 ILE E 47  ? GLY E 58  ? ILE E 48  GLY E 59  1 ? 12 
HELX_P HELX_P74  AI2 ALA E 70  ? TRP E 81  ? ALA E 71  TRP E 82  1 ? 12 
HELX_P HELX_P75  AI3 ARG E 85  ? ASN E 89  ? ARG E 86  ASN E 90  5 ? 5  
HELX_P HELX_P76  AI4 ALA E 111 ? GLN E 116 ? ALA E 112 GLN E 117 1 ? 6  
HELX_P HELX_P77  AI5 ASN E 117 ? ALA E 125 ? ASN E 118 ALA E 126 1 ? 9  
HELX_P HELX_P78  AI6 ASP E 141 ? GLY E 153 ? ASP E 142 GLY E 154 1 ? 13 
HELX_P HELX_P79  AI7 GLU E 167 ? GLY E 170 ? GLU E 168 GLY E 171 5 ? 4  
HELX_P HELX_P80  AI8 THR E 213 ? ALA E 225 ? THR E 214 ALA E 226 1 ? 13 
HELX_P HELX_P81  AI9 ASP E 236 ? GLY E 245 ? ASP E 237 GLY E 246 1 ? 10 
HELX_P HELX_P82  AJ1 PHE E 252 ? CYS E 256 ? PHE E 253 CYS E 257 1 ? 5  
HELX_P HELX_P83  AJ2 THR E 272 ? ASP E 282 ? THR E 273 ASP E 283 1 ? 11 
HELX_P HELX_P84  AJ3 LEU E 283 ? ASP E 285 ? LEU E 284 ASP E 286 5 ? 3  
HELX_P HELX_P85  AJ4 ASP E 392 ? PHE E 400 ? ASP E 393 PHE E 401 1 ? 9  
HELX_P HELX_P86  AJ5 THR E 411 ? LYS E 417 ? THR E 412 LYS E 418 1 ? 7  
HELX_P HELX_P87  AJ6 PRO F 8   ? ARG F 11  ? PRO H 9   ARG H 12  5 ? 4  
HELX_P HELX_P88  AJ7 GLY F 23  ? ASP F 31  ? GLY H 24  ASP H 32  5 ? 9  
HELX_P HELX_P89  AJ8 ALA F 34  ? ALA F 37  ? ALA H 35  ALA H 38  5 ? 4  
HELX_P HELX_P90  AJ9 ILE F 46  ? GLY F 58  ? ILE H 47  GLY H 59  1 ? 13 
HELX_P HELX_P91  AK1 ALA F 70  ? TRP F 81  ? ALA H 71  TRP H 82  1 ? 12 
HELX_P HELX_P92  AK2 ARG F 85  ? ASN F 89  ? ARG H 86  ASN H 90  5 ? 5  
HELX_P HELX_P93  AK3 THR F 110 ? GLN F 116 ? THR H 111 GLN H 117 1 ? 7  
HELX_P HELX_P94  AK4 ASN F 117 ? ALA F 125 ? ASN H 118 ALA H 126 1 ? 9  
HELX_P HELX_P95  AK5 ASP F 141 ? GLY F 153 ? ASP H 142 GLY H 154 1 ? 13 
HELX_P HELX_P96  AK6 MET F 166 ? GLY F 170 ? MET H 167 GLY H 171 5 ? 5  
HELX_P HELX_P97  AK7 THR F 213 ? ARG F 221 ? THR H 214 ARG H 222 1 ? 9  
HELX_P HELX_P98  AK8 ASP F 236 ? GLY F 245 ? ASP H 237 GLY H 246 1 ? 10 
HELX_P HELX_P99  AK9 ALA F 253 ? SER F 255 ? ALA H 254 SER H 256 5 ? 3  
HELX_P HELX_P100 AL1 THR F 272 ? ASP F 282 ? THR H 273 ASP H 283 1 ? 11 
HELX_P HELX_P101 AL2 LEU F 283 ? ASP F 285 ? LEU H 284 ASP H 286 5 ? 3  
HELX_P HELX_P102 AL3 ASP F 392 ? PHE F 400 ? ASP H 393 PHE H 401 1 ? 9  
HELX_P HELX_P103 AL4 THR F 411 ? ASP F 416 ? THR H 412 ASP H 417 1 ? 6  
HELX_P HELX_P104 AL5 PRO G 8   ? ARG G 11  ? PRO I 9   ARG I 12  5 ? 4  
HELX_P HELX_P105 AL6 GLY G 23  ? ASP G 31  ? GLY I 24  ASP I 32  5 ? 9  
HELX_P HELX_P106 AL7 ALA G 34  ? VAL G 38  ? ALA I 35  VAL I 39  5 ? 5  
HELX_P HELX_P107 AL8 ILE G 47  ? GLY G 58  ? ILE I 48  GLY I 59  1 ? 12 
HELX_P HELX_P108 AL9 ALA G 70  ? TRP G 81  ? ALA I 71  TRP I 82  1 ? 12 
HELX_P HELX_P109 AM1 ARG G 85  ? ASN G 89  ? ARG I 86  ASN I 90  5 ? 5  
HELX_P HELX_P110 AM2 ALA G 111 ? GLN G 116 ? ALA I 112 GLN I 117 1 ? 6  
HELX_P HELX_P111 AM3 ASN G 117 ? GLU G 122 ? ASN I 118 GLU I 123 1 ? 6  
HELX_P HELX_P112 AM4 PRO G 123 ? ALA G 125 ? PRO I 124 ALA I 126 5 ? 3  
HELX_P HELX_P113 AM5 ASP G 141 ? GLY G 153 ? ASP I 142 GLY I 154 1 ? 13 
HELX_P HELX_P114 AM6 MET G 166 ? GLY G 170 ? MET I 167 GLY I 171 5 ? 5  
HELX_P HELX_P115 AM7 THR G 213 ? ALA G 225 ? THR I 214 ALA I 226 1 ? 13 
HELX_P HELX_P116 AM8 ASP G 232 ? ILE G 237 ? ASP I 233 ILE I 238 1 ? 6  
HELX_P HELX_P117 AM9 ILE G 237 ? GLY G 245 ? ILE I 238 GLY I 246 1 ? 9  
HELX_P HELX_P118 AN1 PHE G 252 ? CYS G 256 ? PHE I 253 CYS I 257 1 ? 5  
HELX_P HELX_P119 AN2 THR G 272 ? ASP G 282 ? THR I 273 ASP I 283 1 ? 11 
HELX_P HELX_P120 AN3 LEU G 283 ? ASP G 285 ? LEU I 284 ASP I 286 5 ? 3  
HELX_P HELX_P121 AN4 ASP G 392 ? PHE G 400 ? ASP I 393 PHE I 401 1 ? 9  
HELX_P HELX_P122 AN5 THR G 411 ? ASP G 416 ? THR I 412 ASP I 417 1 ? 6  
HELX_P HELX_P123 AN6 PRO H 8   ? ARG H 11  ? PRO J 9   ARG J 12  5 ? 4  
HELX_P HELX_P124 AN7 GLY H 23  ? ASP H 31  ? GLY J 24  ASP J 32  5 ? 9  
HELX_P HELX_P125 AN8 ALA H 34  ? ALA H 37  ? ALA J 35  ALA J 38  5 ? 4  
HELX_P HELX_P126 AN9 ILE H 47  ? SER H 57  ? ILE J 48  SER J 58  1 ? 11 
HELX_P HELX_P127 AO1 ALA H 70  ? TRP H 81  ? ALA J 71  TRP J 82  1 ? 12 
HELX_P HELX_P128 AO2 ARG H 85  ? ASN H 89  ? ARG J 86  ASN J 90  5 ? 5  
HELX_P HELX_P129 AO3 GLY H 109 ? GLN H 116 ? GLY J 110 GLN J 117 1 ? 8  
HELX_P HELX_P130 AO4 ASN H 117 ? GLU H 122 ? ASN J 118 GLU J 123 1 ? 6  
HELX_P HELX_P131 AO5 ASP H 141 ? GLY H 153 ? ASP J 142 GLY J 154 1 ? 13 
HELX_P HELX_P132 AO6 ARG H 165 ? THR H 169 ? ARG J 166 THR J 170 1 ? 5  
HELX_P HELX_P133 AO7 THR H 213 ? ALA H 225 ? THR J 214 ALA J 226 1 ? 13 
HELX_P HELX_P134 AO8 ASP H 236 ? GLY H 245 ? ASP J 237 GLY J 246 1 ? 10 
HELX_P HELX_P135 AO9 PHE H 252 ? CYS H 256 ? PHE J 253 CYS J 257 1 ? 5  
HELX_P HELX_P136 AP1 THR H 272 ? ASP H 282 ? THR J 273 ASP J 283 1 ? 11 
HELX_P HELX_P137 AP2 LEU H 283 ? ASP H 285 ? LEU J 284 ASP J 286 5 ? 3  
HELX_P HELX_P138 AP3 ASP H 392 ? PHE H 400 ? ASP J 393 PHE J 401 1 ? 9  
HELX_P HELX_P139 AP4 THR H 411 ? ASP H 416 ? THR J 412 ASP J 417 1 ? 6  
HELX_P HELX_P140 AP5 PRO I 8   ? ARG I 11  ? PRO K 9   ARG K 12  5 ? 4  
HELX_P HELX_P141 AP6 GLY I 23  ? ASP I 31  ? GLY K 24  ASP K 32  5 ? 9  
HELX_P HELX_P142 AP7 ALA I 34  ? ALA I 37  ? ALA K 35  ALA K 38  5 ? 4  
HELX_P HELX_P143 AP8 ILE I 47  ? GLY I 58  ? ILE K 48  GLY K 59  1 ? 12 
HELX_P HELX_P144 AP9 ALA I 70  ? TRP I 81  ? ALA K 71  TRP K 82  1 ? 12 
HELX_P HELX_P145 AQ1 ARG I 85  ? ASN I 89  ? ARG K 86  ASN K 90  5 ? 5  
HELX_P HELX_P146 AQ2 ALA I 111 ? GLN I 116 ? ALA K 112 GLN K 117 1 ? 6  
HELX_P HELX_P147 AQ3 ASN I 117 ? ALA I 125 ? ASN K 118 ALA K 126 1 ? 9  
HELX_P HELX_P148 AQ4 ASP I 141 ? GLY I 153 ? ASP K 142 GLY K 154 1 ? 13 
HELX_P HELX_P149 AQ5 GLU I 167 ? GLY I 170 ? GLU K 168 GLY K 171 5 ? 4  
HELX_P HELX_P150 AQ6 THR I 213 ? ASP I 226 ? THR K 214 ASP K 227 1 ? 14 
HELX_P HELX_P151 AQ7 ILE I 238 ? GLU I 243 ? ILE K 239 GLU K 244 1 ? 6  
HELX_P HELX_P152 AQ8 PHE I 252 ? CYS I 256 ? PHE K 253 CYS K 257 1 ? 5  
HELX_P HELX_P153 AQ9 THR I 272 ? ASP I 282 ? THR K 273 ASP K 283 1 ? 11 
HELX_P HELX_P154 AR1 LEU I 283 ? ASP I 285 ? LEU K 284 ASP K 286 5 ? 3  
HELX_P HELX_P155 AR2 ASP I 392 ? PHE I 400 ? ASP K 393 PHE K 401 1 ? 9  
HELX_P HELX_P156 AR3 THR I 411 ? ASP I 416 ? THR K 412 ASP K 417 1 ? 6  
HELX_P HELX_P157 AR4 PRO J 8   ? ARG J 11  ? PRO L 9   ARG L 12  5 ? 4  
HELX_P HELX_P158 AR5 GLY J 23  ? ASP J 31  ? GLY L 24  ASP L 32  5 ? 9  
HELX_P HELX_P159 AR6 ALA J 34  ? VAL J 38  ? ALA L 35  VAL L 39  5 ? 5  
HELX_P HELX_P160 AR7 ILE J 47  ? SER J 57  ? ILE L 48  SER L 58  1 ? 11 
HELX_P HELX_P161 AR8 ALA J 70  ? TRP J 81  ? ALA L 71  TRP L 82  1 ? 12 
HELX_P HELX_P162 AR9 ARG J 85  ? ASN J 89  ? ARG L 86  ASN L 90  5 ? 5  
HELX_P HELX_P163 AS1 ALA J 111 ? GLN J 116 ? ALA L 112 GLN L 117 1 ? 6  
HELX_P HELX_P164 AS2 ASN J 117 ? ALA J 125 ? ASN L 118 ALA L 126 1 ? 9  
HELX_P HELX_P165 AS3 TYR J 142 ? GLY J 153 ? TYR L 143 GLY L 154 1 ? 12 
HELX_P HELX_P166 AS4 THR J 213 ? ARG J 222 ? THR L 214 ARG L 223 1 ? 10 
HELX_P HELX_P167 AS5 ASP J 236 ? HIS J 244 ? ASP L 237 HIS L 245 1 ? 9  
HELX_P HELX_P168 AS6 PHE J 252 ? CYS J 256 ? PHE L 253 CYS L 257 1 ? 5  
HELX_P HELX_P169 AS7 THR J 272 ? ASP J 282 ? THR L 273 ASP L 283 1 ? 11 
HELX_P HELX_P170 AS8 LEU J 283 ? ASP J 285 ? LEU L 284 ASP L 286 5 ? 3  
HELX_P HELX_P171 AS9 ASP J 392 ? PHE J 400 ? ASP L 393 PHE L 401 1 ? 9  
HELX_P HELX_P172 AT1 THR J 411 ? LYS J 417 ? THR L 412 LYS L 418 1 ? 7  
HELX_P HELX_P173 AT2 PRO K 8   ? ARG K 11  ? PRO N 9   ARG N 12  5 ? 4  
HELX_P HELX_P174 AT3 GLY K 23  ? ASP K 31  ? GLY N 24  ASP N 32  5 ? 9  
HELX_P HELX_P175 AT4 ALA K 34  ? VAL K 38  ? ALA N 35  VAL N 39  5 ? 5  
HELX_P HELX_P176 AT5 ILE K 47  ? SER K 57  ? ILE N 48  SER N 58  1 ? 11 
HELX_P HELX_P177 AT6 ALA K 70  ? TRP K 81  ? ALA N 71  TRP N 82  1 ? 12 
HELX_P HELX_P178 AT7 ARG K 85  ? ASN K 89  ? ARG N 86  ASN N 90  5 ? 5  
HELX_P HELX_P179 AT8 ALA K 111 ? GLN K 116 ? ALA N 112 GLN N 117 1 ? 6  
HELX_P HELX_P180 AT9 ASN K 117 ? GLU K 122 ? ASN N 118 GLU N 123 1 ? 6  
HELX_P HELX_P181 AU1 PRO K 123 ? ALA K 125 ? PRO N 124 ALA N 126 5 ? 3  
HELX_P HELX_P182 AU2 ASP K 141 ? GLY K 153 ? ASP N 142 GLY N 154 1 ? 13 
HELX_P HELX_P183 AU3 MET K 166 ? PHE K 171 ? MET N 167 PHE N 172 5 ? 6  
HELX_P HELX_P184 AU4 THR K 213 ? ALA K 224 ? THR N 214 ALA N 225 1 ? 12 
HELX_P HELX_P185 AU5 ASP K 236 ? HIS K 244 ? ASP N 237 HIS N 245 1 ? 9  
HELX_P HELX_P186 AU6 ALA K 253 ? SER K 255 ? ALA N 254 SER N 256 5 ? 3  
HELX_P HELX_P187 AU7 THR K 272 ? ASP K 282 ? THR N 273 ASP N 283 1 ? 11 
HELX_P HELX_P188 AU8 LEU K 283 ? ASP K 285 ? LEU N 284 ASP N 286 5 ? 3  
HELX_P HELX_P189 AU9 ASP K 392 ? PHE K 400 ? ASP N 393 PHE N 401 1 ? 9  
HELX_P HELX_P190 AV1 THR K 411 ? LYS K 417 ? THR N 412 LYS N 418 1 ? 7  
HELX_P HELX_P191 AV2 PRO L 8   ? ARG L 11  ? PRO O 9   ARG O 12  5 ? 4  
HELX_P HELX_P192 AV3 GLY L 23  ? ASP L 31  ? GLY O 24  ASP O 32  5 ? 9  
HELX_P HELX_P193 AV4 ALA L 34  ? ALA L 37  ? ALA O 35  ALA O 38  5 ? 4  
HELX_P HELX_P194 AV5 ILE L 47  ? SER L 57  ? ILE O 48  SER O 58  1 ? 11 
HELX_P HELX_P195 AV6 ALA L 70  ? TRP L 81  ? ALA O 71  TRP O 82  1 ? 12 
HELX_P HELX_P196 AV7 ARG L 85  ? ASN L 89  ? ARG O 86  ASN O 90  5 ? 5  
HELX_P HELX_P197 AV8 GLY L 109 ? GLN L 116 ? GLY O 110 GLN O 117 1 ? 8  
HELX_P HELX_P198 AV9 ASN L 117 ? GLU L 122 ? ASN O 118 GLU O 123 1 ? 6  
HELX_P HELX_P199 AW1 PRO L 123 ? ALA L 125 ? PRO O 124 ALA O 126 5 ? 3  
HELX_P HELX_P200 AW2 ASP L 141 ? GLY L 153 ? ASP O 142 GLY O 154 1 ? 13 
HELX_P HELX_P201 AW3 MET L 166 ? GLY L 170 ? MET O 167 GLY O 171 5 ? 5  
HELX_P HELX_P202 AW4 THR L 213 ? ALA L 225 ? THR O 214 ALA O 226 1 ? 13 
HELX_P HELX_P203 AW5 ILE L 237 ? GLY L 245 ? ILE O 238 GLY O 246 1 ? 9  
HELX_P HELX_P204 AW6 PHE L 252 ? CYS L 256 ? PHE O 253 CYS O 257 1 ? 5  
HELX_P HELX_P205 AW7 THR L 272 ? ASP L 282 ? THR O 273 ASP O 283 1 ? 11 
HELX_P HELX_P206 AW8 LEU L 283 ? ASP L 285 ? LEU O 284 ASP O 286 5 ? 3  
HELX_P HELX_P207 AW9 ASP L 392 ? PHE L 400 ? ASP O 393 PHE O 401 1 ? 9  
HELX_P HELX_P208 AX1 THR L 411 ? ASP L 416 ? THR O 412 ASP O 417 1 ? 6  
HELX_P HELX_P209 AX2 PRO M 8   ? ARG M 11  ? PRO P 9   ARG P 12  5 ? 4  
HELX_P HELX_P210 AX3 GLY M 23  ? ASP M 31  ? GLY P 24  ASP P 32  5 ? 9  
HELX_P HELX_P211 AX4 ALA M 34  ? ALA M 37  ? ALA P 35  ALA P 38  5 ? 4  
HELX_P HELX_P212 AX5 ILE M 47  ? GLY M 58  ? ILE P 48  GLY P 59  1 ? 12 
HELX_P HELX_P213 AX6 ALA M 70  ? TRP M 81  ? ALA P 71  TRP P 82  1 ? 12 
HELX_P HELX_P214 AX7 ARG M 85  ? ASN M 89  ? ARG P 86  ASN P 90  5 ? 5  
HELX_P HELX_P215 AX8 THR M 110 ? GLN M 116 ? THR P 111 GLN P 117 1 ? 7  
HELX_P HELX_P216 AX9 ASN M 117 ? GLU M 122 ? ASN P 118 GLU P 123 1 ? 6  
HELX_P HELX_P217 AY1 ASP M 141 ? GLY M 153 ? ASP P 142 GLY P 154 1 ? 13 
HELX_P HELX_P218 AY2 GLU M 167 ? GLY M 170 ? GLU P 168 GLY P 171 5 ? 4  
HELX_P HELX_P219 AY3 THR M 213 ? ALA M 224 ? THR P 214 ALA P 225 1 ? 12 
HELX_P HELX_P220 AY4 ASP M 236 ? GLY M 245 ? ASP P 237 GLY P 246 1 ? 10 
HELX_P HELX_P221 AY5 PHE M 252 ? CYS M 256 ? PHE P 253 CYS P 257 1 ? 5  
HELX_P HELX_P222 AY6 THR M 272 ? ASP M 282 ? THR P 273 ASP P 283 1 ? 11 
HELX_P HELX_P223 AY7 LEU M 283 ? ASP M 285 ? LEU P 284 ASP P 286 5 ? 3  
HELX_P HELX_P224 AY8 ASP M 392 ? PHE M 400 ? ASP P 393 PHE P 401 1 ? 9  
HELX_P HELX_P225 AY9 THR M 411 ? LYS M 417 ? THR P 412 LYS P 418 1 ? 7  
HELX_P HELX_P226 AZ1 PRO N 8   ? ARG N 11  ? PRO Q 9   ARG Q 12  5 ? 4  
HELX_P HELX_P227 AZ2 GLY N 23  ? ASP N 31  ? GLY Q 24  ASP Q 32  5 ? 9  
HELX_P HELX_P228 AZ3 ALA N 34  ? ALA N 37  ? ALA Q 35  ALA Q 38  5 ? 4  
HELX_P HELX_P229 AZ4 ILE N 47  ? GLY N 58  ? ILE Q 48  GLY Q 59  1 ? 12 
HELX_P HELX_P230 AZ5 ALA N 70  ? TRP N 81  ? ALA Q 71  TRP Q 82  1 ? 12 
HELX_P HELX_P231 AZ6 ARG N 85  ? ASN N 89  ? ARG Q 86  ASN Q 90  5 ? 5  
HELX_P HELX_P232 AZ7 ALA N 111 ? GLN N 116 ? ALA Q 112 GLN Q 117 1 ? 6  
HELX_P HELX_P233 AZ8 ASN N 117 ? GLU N 122 ? ASN Q 118 GLU Q 123 1 ? 6  
HELX_P HELX_P234 AZ9 ASP N 141 ? SER N 152 ? ASP Q 142 SER Q 153 1 ? 12 
HELX_P HELX_P235 BA1 MET N 166 ? GLY N 170 ? MET Q 167 GLY Q 171 5 ? 5  
HELX_P HELX_P236 BA2 THR N 213 ? ARG N 222 ? THR Q 214 ARG Q 223 1 ? 10 
HELX_P HELX_P237 BA3 ILE N 237 ? GLY N 245 ? ILE Q 238 GLY Q 246 1 ? 9  
HELX_P HELX_P238 BA4 ALA N 253 ? SER N 255 ? ALA Q 254 SER Q 256 5 ? 3  
HELX_P HELX_P239 BA5 THR N 272 ? ASP N 282 ? THR Q 273 ASP Q 283 1 ? 11 
HELX_P HELX_P240 BA6 LEU N 283 ? ASP N 285 ? LEU Q 284 ASP Q 286 5 ? 3  
HELX_P HELX_P241 BA7 GLU N 394 ? PHE N 400 ? GLU Q 395 PHE Q 401 1 ? 7  
HELX_P HELX_P242 BA8 THR N 411 ? LYS N 417 ? THR Q 412 LYS Q 418 1 ? 7  
HELX_P HELX_P243 BA9 PRO O 8   ? ARG O 11  ? PRO R 9   ARG R 12  5 ? 4  
HELX_P HELX_P244 BB1 GLY O 23  ? ASP O 31  ? GLY R 24  ASP R 32  5 ? 9  
HELX_P HELX_P245 BB2 ALA O 34  ? VAL O 38  ? ALA R 35  VAL R 39  5 ? 5  
HELX_P HELX_P246 BB3 ILE O 47  ? SER O 57  ? ILE R 48  SER R 58  1 ? 11 
HELX_P HELX_P247 BB4 ALA O 70  ? TRP O 81  ? ALA R 71  TRP R 82  1 ? 12 
HELX_P HELX_P248 BB5 ARG O 85  ? ASN O 89  ? ARG R 86  ASN R 90  5 ? 5  
HELX_P HELX_P249 BB6 GLY O 109 ? GLN O 116 ? GLY R 110 GLN R 117 1 ? 8  
HELX_P HELX_P250 BB7 ASN O 117 ? ALA O 125 ? ASN R 118 ALA R 126 1 ? 9  
HELX_P HELX_P251 BB8 ASP O 141 ? GLY O 153 ? ASP R 142 GLY R 154 1 ? 13 
HELX_P HELX_P252 BB9 MET O 166 ? GLY O 170 ? MET R 167 GLY R 171 5 ? 5  
HELX_P HELX_P253 BC1 THR O 213 ? LEU O 220 ? THR R 214 LEU R 221 1 ? 8  
HELX_P HELX_P254 BC2 ASP O 236 ? GLY O 245 ? ASP R 237 GLY R 246 1 ? 10 
HELX_P HELX_P255 BC3 PHE O 252 ? CYS O 256 ? PHE R 253 CYS R 257 1 ? 5  
HELX_P HELX_P256 BC4 THR O 272 ? ASP O 282 ? THR R 273 ASP R 283 1 ? 11 
HELX_P HELX_P257 BC5 LEU O 283 ? ASP O 285 ? LEU R 284 ASP R 286 5 ? 3  
HELX_P HELX_P258 BC6 ASP O 392 ? PHE O 400 ? ASP R 393 PHE R 401 1 ? 9  
HELX_P HELX_P259 BC7 THR O 411 ? LYS O 417 ? THR R 412 LYS R 418 1 ? 7  
HELX_P HELX_P260 BC8 PRO P 8   ? ARG P 11  ? PRO F 9   ARG F 12  5 ? 4  
HELX_P HELX_P261 BC9 GLY P 23  ? ASP P 31  ? GLY F 24  ASP F 32  5 ? 9  
HELX_P HELX_P262 BD1 ALA P 34  ? ALA P 37  ? ALA F 35  ALA F 38  5 ? 4  
HELX_P HELX_P263 BD2 ILE P 46  ? GLY P 58  ? ILE F 47  GLY F 59  1 ? 13 
HELX_P HELX_P264 BD3 ALA P 70  ? TRP P 81  ? ALA F 71  TRP F 82  1 ? 12 
HELX_P HELX_P265 BD4 ARG P 85  ? ASN P 89  ? ARG F 86  ASN F 90  5 ? 5  
HELX_P HELX_P266 BD5 GLY P 109 ? GLN P 116 ? GLY F 110 GLN F 117 1 ? 8  
HELX_P HELX_P267 BD6 ASN P 117 ? ALA P 125 ? ASN F 118 ALA F 126 1 ? 9  
HELX_P HELX_P268 BD7 ASP P 141 ? GLY P 153 ? ASP F 142 GLY F 154 1 ? 13 
HELX_P HELX_P269 BD8 ARG P 165 ? THR P 169 ? ARG F 166 THR F 170 1 ? 5  
HELX_P HELX_P270 BD9 THR P 213 ? ALA P 225 ? THR F 214 ALA F 226 1 ? 13 
HELX_P HELX_P271 BE1 ASP P 236 ? GLY P 245 ? ASP F 237 GLY F 246 1 ? 10 
HELX_P HELX_P272 BE2 PHE P 252 ? CYS P 256 ? PHE F 253 CYS F 257 1 ? 5  
HELX_P HELX_P273 BE3 THR P 272 ? ASP P 282 ? THR F 273 ASP F 283 1 ? 11 
HELX_P HELX_P274 BE4 LEU P 283 ? ASP P 285 ? LEU F 284 ASP F 286 5 ? 3  
HELX_P HELX_P275 BE5 ASP P 392 ? PHE P 400 ? ASP F 393 PHE F 401 1 ? 9  
HELX_P HELX_P276 BE6 THR P 411 ? LYS P 417 ? THR F 412 LYS F 418 1 ? 7  
HELX_P HELX_P277 BE7 PRO Q 8   ? ARG Q 11  ? PRO G 9   ARG G 12  5 ? 4  
HELX_P HELX_P278 BE8 GLY Q 23  ? ASP Q 31  ? GLY G 24  ASP G 32  5 ? 9  
HELX_P HELX_P279 BE9 ALA Q 34  ? ALA Q 37  ? ALA G 35  ALA G 38  5 ? 4  
HELX_P HELX_P280 BF1 ILE Q 46  ? SER Q 57  ? ILE G 47  SER G 58  1 ? 12 
HELX_P HELX_P281 BF2 ALA Q 70  ? TRP Q 81  ? ALA G 71  TRP G 82  1 ? 12 
HELX_P HELX_P282 BF3 ARG Q 85  ? ASN Q 89  ? ARG G 86  ASN G 90  5 ? 5  
HELX_P HELX_P283 BF4 GLY Q 109 ? GLN Q 116 ? GLY G 110 GLN G 117 1 ? 8  
HELX_P HELX_P284 BF5 ASN Q 117 ? ALA Q 125 ? ASN G 118 ALA G 126 1 ? 9  
HELX_P HELX_P285 BF6 ASP Q 141 ? GLY Q 153 ? ASP G 142 GLY G 154 1 ? 13 
HELX_P HELX_P286 BF7 MET Q 166 ? GLY Q 170 ? MET G 167 GLY G 171 5 ? 5  
HELX_P HELX_P287 BF8 THR Q 213 ? ALA Q 225 ? THR G 214 ALA G 226 1 ? 13 
HELX_P HELX_P288 BF9 ASP Q 232 ? ILE Q 237 ? ASP G 233 ILE G 238 1 ? 6  
HELX_P HELX_P289 BG1 ILE Q 237 ? HIS Q 244 ? ILE G 238 HIS G 245 1 ? 8  
HELX_P HELX_P290 BG2 PHE Q 252 ? CYS Q 256 ? PHE G 253 CYS G 257 1 ? 5  
HELX_P HELX_P291 BG3 THR Q 272 ? ASP Q 282 ? THR G 273 ASP G 283 1 ? 11 
HELX_P HELX_P292 BG4 LEU Q 283 ? ASP Q 285 ? LEU G 284 ASP G 286 5 ? 3  
HELX_P HELX_P293 BG5 ASP Q 392 ? PHE Q 400 ? ASP G 393 PHE G 401 1 ? 9  
HELX_P HELX_P294 BG6 THR Q 411 ? LEU Q 418 ? THR G 412 LEU G 419 1 ? 8  
HELX_P HELX_P295 BG7 PRO R 8   ? ARG R 11  ? PRO M 9   ARG M 12  5 ? 4  
HELX_P HELX_P296 BG8 GLY R 23  ? ASP R 31  ? GLY M 24  ASP M 32  5 ? 9  
HELX_P HELX_P297 BG9 ALA R 34  ? ALA R 37  ? ALA M 35  ALA M 38  5 ? 4  
HELX_P HELX_P298 BH1 ILE R 46  ? SER R 57  ? ILE M 47  SER M 58  1 ? 12 
HELX_P HELX_P299 BH2 ALA R 70  ? TRP R 81  ? ALA M 71  TRP M 82  1 ? 12 
HELX_P HELX_P300 BH3 ARG R 85  ? ASN R 89  ? ARG M 86  ASN M 90  5 ? 5  
HELX_P HELX_P301 BH4 ALA R 111 ? GLN R 116 ? ALA M 112 GLN M 117 1 ? 6  
HELX_P HELX_P302 BH5 ASN R 117 ? ALA R 125 ? ASN M 118 ALA M 126 1 ? 9  
HELX_P HELX_P303 BH6 ASP R 141 ? VAL R 150 ? ASP M 142 VAL M 151 1 ? 10 
HELX_P HELX_P304 BH7 GLU R 167 ? GLY R 170 ? GLU M 168 GLY M 171 5 ? 4  
HELX_P HELX_P305 BH8 THR R 213 ? ASP R 226 ? THR M 214 ASP M 227 1 ? 14 
HELX_P HELX_P306 BH9 ASP R 236 ? HIS R 244 ? ASP M 237 HIS M 245 1 ? 9  
HELX_P HELX_P307 BI1 ALA R 253 ? SER R 255 ? ALA M 254 SER M 256 5 ? 3  
HELX_P HELX_P308 BI2 THR R 272 ? ASP R 282 ? THR M 273 ASP M 283 1 ? 11 
HELX_P HELX_P309 BI3 LEU R 283 ? ASP R 285 ? LEU M 284 ASP M 286 5 ? 3  
HELX_P HELX_P310 BI4 ASP R 392 ? PHE R 400 ? ASP M 393 PHE M 401 1 ? 9  
HELX_P HELX_P311 BI5 THR R 411 ? LYS R 417 ? THR M 412 LYS M 418 1 ? 7  
HELX_P HELX_P312 BI6 PRO S 8   ? ARG S 11  ? PRO T 9   ARG T 12  5 ? 4  
HELX_P HELX_P313 BI7 GLY S 23  ? ASP S 31  ? GLY T 24  ASP T 32  5 ? 9  
HELX_P HELX_P314 BI8 ALA S 34  ? VAL S 38  ? ALA T 35  VAL T 39  5 ? 5  
HELX_P HELX_P315 BI9 ILE S 46  ? GLY S 58  ? ILE T 47  GLY T 59  1 ? 13 
HELX_P HELX_P316 BJ1 ALA S 70  ? TRP S 81  ? ALA T 71  TRP T 82  1 ? 12 
HELX_P HELX_P317 BJ2 ARG S 85  ? ASN S 89  ? ARG T 86  ASN T 90  5 ? 5  
HELX_P HELX_P318 BJ3 SER S 98  ? SER S 102 ? SER T 99  SER T 103 5 ? 5  
HELX_P HELX_P319 BJ4 ALA S 111 ? GLN S 116 ? ALA T 112 GLN T 117 1 ? 6  
HELX_P HELX_P320 BJ5 ASN S 117 ? GLU S 122 ? ASN T 118 GLU T 123 1 ? 6  
HELX_P HELX_P321 BJ6 PRO S 123 ? ALA S 125 ? PRO T 124 ALA T 126 5 ? 3  
HELX_P HELX_P322 BJ7 ASP S 141 ? GLY S 153 ? ASP T 142 GLY T 154 1 ? 13 
HELX_P HELX_P323 BJ8 ARG S 165 ? THR S 169 ? ARG T 166 THR T 170 1 ? 5  
HELX_P HELX_P324 BJ9 THR S 213 ? ASP S 226 ? THR T 214 ASP T 227 1 ? 14 
HELX_P HELX_P325 BK1 ASP S 236 ? HIS S 244 ? ASP T 237 HIS T 245 1 ? 9  
HELX_P HELX_P326 BK2 PHE S 252 ? CYS S 256 ? PHE T 253 CYS T 257 1 ? 5  
HELX_P HELX_P327 BK3 THR S 272 ? ASP S 282 ? THR T 273 ASP T 283 1 ? 11 
HELX_P HELX_P328 BK4 LEU S 283 ? ASP S 285 ? LEU T 284 ASP T 286 5 ? 3  
HELX_P HELX_P329 BK5 ASP S 392 ? PHE S 400 ? ASP T 393 PHE T 401 1 ? 9  
HELX_P HELX_P330 BK6 THR S 411 ? ASP S 416 ? THR T 412 ASP T 417 1 ? 6  
HELX_P HELX_P331 BK7 PRO T 8   ? ARG T 11  ? PRO U 9   ARG U 12  5 ? 4  
HELX_P HELX_P332 BK8 GLY T 23  ? ASP T 31  ? GLY U 24  ASP U 32  5 ? 9  
HELX_P HELX_P333 BK9 ALA T 34  ? ALA T 37  ? ALA U 35  ALA U 38  5 ? 4  
HELX_P HELX_P334 BL1 ILE T 46  ? GLY T 58  ? ILE U 47  GLY U 59  1 ? 13 
HELX_P HELX_P335 BL2 ALA T 70  ? TRP T 81  ? ALA U 71  TRP U 82  1 ? 12 
HELX_P HELX_P336 BL3 ARG T 85  ? ASN T 89  ? ARG U 86  ASN U 90  5 ? 5  
HELX_P HELX_P337 BL4 ALA T 111 ? GLN T 116 ? ALA U 112 GLN U 117 1 ? 6  
HELX_P HELX_P338 BL5 ASN T 117 ? GLU T 122 ? ASN U 118 GLU U 123 1 ? 6  
HELX_P HELX_P339 BL6 PRO T 123 ? ALA T 125 ? PRO U 124 ALA U 126 5 ? 3  
HELX_P HELX_P340 BL7 ASP T 141 ? GLY T 153 ? ASP U 142 GLY U 154 1 ? 13 
HELX_P HELX_P341 BL8 MET T 166 ? GLY T 170 ? MET U 167 GLY U 171 5 ? 5  
HELX_P HELX_P342 BL9 THR T 213 ? ALA T 225 ? THR U 214 ALA U 226 1 ? 13 
HELX_P HELX_P343 BM1 ASP T 236 ? GLY T 245 ? ASP U 237 GLY U 246 1 ? 10 
HELX_P HELX_P344 BM2 PHE T 252 ? CYS T 256 ? PHE U 253 CYS U 257 1 ? 5  
HELX_P HELX_P345 BM3 THR T 272 ? ASP T 282 ? THR U 273 ASP U 283 1 ? 11 
HELX_P HELX_P346 BM4 LEU T 283 ? ASP T 285 ? LEU U 284 ASP U 286 5 ? 3  
HELX_P HELX_P347 BM5 ASP T 392 ? PHE T 400 ? ASP U 393 PHE U 401 1 ? 9  
HELX_P HELX_P348 BM6 THR T 411 ? LYS T 417 ? THR U 412 LYS U 418 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 104 D . ? THR 105 D GLN 105 D ? GLN 106 D 1 -1.37 
2 ALA 97  H . ? ALA 98  J SER 98  H ? SER 99  J 1 3.74  
3 GLU 103 H . ? GLU 104 J THR 104 H ? THR 105 J 1 -1.77 
4 SER 98  L . ? SER 99  O GLN 99  L ? GLN 100 O 1 2.42  
5 PRO 96  O . ? PRO 97  R ALA 97  O ? ALA 98  R 1 4.23  
6 VAL 101 S . ? VAL 102 T SER 102 S ? SER 103 T 1 -4.71 
7 GLU 103 T . ? GLU 104 U THR 104 T ? THR 105 U 1 -2.52 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7  ? 
AA2 ? 7  ? 
AA3 ? 2  ? 
AA4 ? 2  ? 
AA5 ? 10 ? 
AA6 ? 6  ? 
AA7 ? 6  ? 
AA8 ? 10 ? 
AA9 ? 7  ? 
AB1 ? 7  ? 
AB2 ? 2  ? 
AB3 ? 10 ? 
AB4 ? 6  ? 
AB5 ? 6  ? 
AB6 ? 10 ? 
AB7 ? 7  ? 
AB8 ? 7  ? 
AB9 ? 2  ? 
AC1 ? 10 ? 
AC2 ? 6  ? 
AC3 ? 6  ? 
AC4 ? 10 ? 
AC5 ? 7  ? 
AC6 ? 7  ? 
AC7 ? 2  ? 
AC8 ? 2  ? 
AC9 ? 10 ? 
AD1 ? 6  ? 
AD2 ? 6  ? 
AD3 ? 10 ? 
AD4 ? 7  ? 
AD5 ? 7  ? 
AD6 ? 2  ? 
AD7 ? 5  ? 
AD8 ? 5  ? 
AD9 ? 6  ? 
AE1 ? 7  ? 
AE2 ? 7  ? 
AE3 ? 2  ? 
AE4 ? 2  ? 
AE5 ? 10 ? 
AE6 ? 6  ? 
AE7 ? 6  ? 
AE8 ? 10 ? 
AE9 ? 7  ? 
AF1 ? 7  ? 
AF2 ? 2  ? 
AF3 ? 7  ? 
AF4 ? 7  ? 
AF5 ? 2  ? 
AF6 ? 2  ? 
AF7 ? 5  ? 
AF8 ? 5  ? 
AF9 ? 6  ? 
AG1 ? 7  ? 
AG2 ? 7  ? 
AG3 ? 2  ? 
AG4 ? 2  ? 
AG5 ? 7  ? 
AG6 ? 2  ? 
AG7 ? 2  ? 
AG8 ? 5  ? 
AG9 ? 5  ? 
AH1 ? 6  ? 
AH2 ? 7  ? 
AH3 ? 2  ? 
AH4 ? 5  ? 
AH5 ? 5  ? 
AH6 ? 6  ? 
AH7 ? 7  ? 
AH8 ? 7  ? 
AH9 ? 2  ? 
AI1 ? 2  ? 
AI2 ? 5  ? 
AI3 ? 5  ? 
AI4 ? 6  ? 
AI5 ? 7  ? 
AI6 ? 7  ? 
AI7 ? 2  ? 
AI8 ? 2  ? 
AI9 ? 7  ? 
AJ1 ? 7  ? 
AJ2 ? 2  ? 
AJ3 ? 2  ? 
AJ4 ? 10 ? 
AJ5 ? 6  ? 
AJ6 ? 6  ? 
AJ7 ? 10 ? 
AJ8 ? 7  ? 
AJ9 ? 7  ? 
AK1 ? 2  ? 
AK2 ? 5  ? 
AK3 ? 5  ? 
AK4 ? 6  ? 
AK5 ? 7  ? 
AK6 ? 7  ? 
AK7 ? 2  ? 
AK8 ? 2  ? 
AK9 ? 7  ? 
AL1 ? 7  ? 
AL2 ? 2  ? 
AL3 ? 2  ? 
AL4 ? 7  ? 
AL5 ? 7  ? 
AL6 ? 2  ? 
AL7 ? 2  ? 
AL8 ? 7  ? 
AL9 ? 2  ? 
AM1 ? 2  ? 
AM2 ? 10 ? 
AM3 ? 6  ? 
AM4 ? 6  ? 
AM5 ? 10 ? 
AM6 ? 7  ? 
AM7 ? 7  ? 
AM8 ? 2  ? 
AM9 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? parallel      
AA1 2 3  ? parallel      
AA1 3 4  ? parallel      
AA1 4 5  ? anti-parallel 
AA1 5 6  ? anti-parallel 
AA1 6 7  ? anti-parallel 
AA2 1 2  ? parallel      
AA2 2 3  ? parallel      
AA2 3 4  ? parallel      
AA2 4 5  ? anti-parallel 
AA2 5 6  ? anti-parallel 
AA2 6 7  ? parallel      
AA3 1 2  ? anti-parallel 
AA4 1 2  ? anti-parallel 
AA5 1 2  ? parallel      
AA5 2 3  ? parallel      
AA5 3 4  ? parallel      
AA5 4 5  ? parallel      
AA5 5 6  ? anti-parallel 
AA5 6 7  ? parallel      
AA5 7 8  ? parallel      
AA5 8 9  ? parallel      
AA5 9 10 ? parallel      
AA6 1 2  ? parallel      
AA6 2 3  ? parallel      
AA6 3 4  ? parallel      
AA6 4 5  ? parallel      
AA6 5 6  ? anti-parallel 
AA7 1 2  ? parallel      
AA7 2 3  ? parallel      
AA7 3 4  ? parallel      
AA7 4 5  ? parallel      
AA7 5 6  ? anti-parallel 
AA8 1 2  ? parallel      
AA8 2 3  ? parallel      
AA8 3 4  ? parallel      
AA8 4 5  ? parallel      
AA8 5 6  ? anti-parallel 
AA8 6 7  ? parallel      
AA8 7 8  ? parallel      
AA8 8 9  ? parallel      
AA8 9 10 ? parallel      
AA9 1 2  ? parallel      
AA9 2 3  ? parallel      
AA9 3 4  ? parallel      
AA9 4 5  ? anti-parallel 
AA9 5 6  ? anti-parallel 
AA9 6 7  ? anti-parallel 
AB1 1 2  ? parallel      
AB1 2 3  ? parallel      
AB1 3 4  ? parallel      
AB1 4 5  ? anti-parallel 
AB1 5 6  ? anti-parallel 
AB1 6 7  ? parallel      
AB2 1 2  ? anti-parallel 
AB3 1 2  ? parallel      
AB3 2 3  ? parallel      
AB3 3 4  ? parallel      
AB3 4 5  ? parallel      
AB3 5 6  ? anti-parallel 
AB3 6 7  ? parallel      
AB3 7 8  ? parallel      
AB3 8 9  ? parallel      
AB3 9 10 ? parallel      
AB4 1 2  ? parallel      
AB4 2 3  ? parallel      
AB4 3 4  ? parallel      
AB4 4 5  ? parallel      
AB4 5 6  ? anti-parallel 
AB5 1 2  ? parallel      
AB5 2 3  ? parallel      
AB5 3 4  ? parallel      
AB5 4 5  ? parallel      
AB5 5 6  ? anti-parallel 
AB6 1 2  ? parallel      
AB6 2 3  ? parallel      
AB6 3 4  ? parallel      
AB6 4 5  ? parallel      
AB6 5 6  ? anti-parallel 
AB6 6 7  ? parallel      
AB6 7 8  ? parallel      
AB6 8 9  ? parallel      
AB6 9 10 ? parallel      
AB7 1 2  ? parallel      
AB7 2 3  ? parallel      
AB7 3 4  ? parallel      
AB7 4 5  ? anti-parallel 
AB7 5 6  ? anti-parallel 
AB7 6 7  ? anti-parallel 
AB8 1 2  ? parallel      
AB8 2 3  ? parallel      
AB8 3 4  ? parallel      
AB8 4 5  ? anti-parallel 
AB8 5 6  ? anti-parallel 
AB8 6 7  ? parallel      
AB9 1 2  ? anti-parallel 
AC1 1 2  ? parallel      
AC1 2 3  ? parallel      
AC1 3 4  ? parallel      
AC1 4 5  ? parallel      
AC1 5 6  ? anti-parallel 
AC1 6 7  ? parallel      
AC1 7 8  ? parallel      
AC1 8 9  ? parallel      
AC1 9 10 ? parallel      
AC2 1 2  ? parallel      
AC2 2 3  ? parallel      
AC2 3 4  ? parallel      
AC2 4 5  ? parallel      
AC2 5 6  ? anti-parallel 
AC3 1 2  ? parallel      
AC3 2 3  ? parallel      
AC3 3 4  ? parallel      
AC3 4 5  ? parallel      
AC3 5 6  ? anti-parallel 
AC4 1 2  ? parallel      
AC4 2 3  ? parallel      
AC4 3 4  ? parallel      
AC4 4 5  ? parallel      
AC4 5 6  ? anti-parallel 
AC4 6 7  ? parallel      
AC4 7 8  ? parallel      
AC4 8 9  ? parallel      
AC4 9 10 ? parallel      
AC5 1 2  ? parallel      
AC5 2 3  ? parallel      
AC5 3 4  ? parallel      
AC5 4 5  ? anti-parallel 
AC5 5 6  ? anti-parallel 
AC5 6 7  ? anti-parallel 
AC6 1 2  ? parallel      
AC6 2 3  ? parallel      
AC6 3 4  ? parallel      
AC6 4 5  ? anti-parallel 
AC6 5 6  ? anti-parallel 
AC6 6 7  ? parallel      
AC7 1 2  ? anti-parallel 
AC8 1 2  ? anti-parallel 
AC9 1 2  ? parallel      
AC9 2 3  ? parallel      
AC9 3 4  ? parallel      
AC9 4 5  ? parallel      
AC9 5 6  ? anti-parallel 
AC9 6 7  ? parallel      
AC9 7 8  ? parallel      
AC9 8 9  ? parallel      
AC9 9 10 ? parallel      
AD1 1 2  ? parallel      
AD1 2 3  ? parallel      
AD1 3 4  ? parallel      
AD1 4 5  ? parallel      
AD1 5 6  ? anti-parallel 
AD2 1 2  ? parallel      
AD2 2 3  ? parallel      
AD2 3 4  ? parallel      
AD2 4 5  ? parallel      
AD2 5 6  ? anti-parallel 
AD3 1 2  ? parallel      
AD3 2 3  ? parallel      
AD3 3 4  ? parallel      
AD3 4 5  ? parallel      
AD3 5 6  ? anti-parallel 
AD3 6 7  ? parallel      
AD3 7 8  ? parallel      
AD3 8 9  ? parallel      
AD3 9 10 ? parallel      
AD4 1 2  ? parallel      
AD4 2 3  ? parallel      
AD4 3 4  ? parallel      
AD4 4 5  ? anti-parallel 
AD4 5 6  ? anti-parallel 
AD4 6 7  ? anti-parallel 
AD5 1 2  ? parallel      
AD5 2 3  ? parallel      
AD5 3 4  ? parallel      
AD5 4 5  ? anti-parallel 
AD5 5 6  ? anti-parallel 
AD5 6 7  ? parallel      
AD6 1 2  ? anti-parallel 
AD7 1 2  ? parallel      
AD7 2 3  ? parallel      
AD7 3 4  ? parallel      
AD7 4 5  ? parallel      
AD8 1 2  ? parallel      
AD8 2 3  ? parallel      
AD8 3 4  ? parallel      
AD8 4 5  ? parallel      
AD9 1 2  ? parallel      
AD9 2 3  ? parallel      
AD9 3 4  ? parallel      
AD9 4 5  ? parallel      
AD9 5 6  ? anti-parallel 
AE1 1 2  ? parallel      
AE1 2 3  ? parallel      
AE1 3 4  ? parallel      
AE1 4 5  ? anti-parallel 
AE1 5 6  ? anti-parallel 
AE1 6 7  ? anti-parallel 
AE2 1 2  ? parallel      
AE2 2 3  ? parallel      
AE2 3 4  ? parallel      
AE2 4 5  ? anti-parallel 
AE2 5 6  ? anti-parallel 
AE2 6 7  ? parallel      
AE3 1 2  ? anti-parallel 
AE4 1 2  ? anti-parallel 
AE5 1 2  ? parallel      
AE5 2 3  ? parallel      
AE5 3 4  ? parallel      
AE5 4 5  ? parallel      
AE5 5 6  ? anti-parallel 
AE5 6 7  ? parallel      
AE5 7 8  ? parallel      
AE5 8 9  ? parallel      
AE5 9 10 ? parallel      
AE6 1 2  ? parallel      
AE6 2 3  ? parallel      
AE6 3 4  ? parallel      
AE6 4 5  ? parallel      
AE6 5 6  ? anti-parallel 
AE7 1 2  ? parallel      
AE7 2 3  ? parallel      
AE7 3 4  ? parallel      
AE7 4 5  ? parallel      
AE7 5 6  ? anti-parallel 
AE8 1 2  ? parallel      
AE8 2 3  ? parallel      
AE8 3 4  ? parallel      
AE8 4 5  ? parallel      
AE8 5 6  ? anti-parallel 
AE8 6 7  ? parallel      
AE8 7 8  ? parallel      
AE8 8 9  ? parallel      
AE8 9 10 ? parallel      
AE9 1 2  ? parallel      
AE9 2 3  ? parallel      
AE9 3 4  ? parallel      
AE9 4 5  ? anti-parallel 
AE9 5 6  ? anti-parallel 
AE9 6 7  ? anti-parallel 
AF1 1 2  ? parallel      
AF1 2 3  ? parallel      
AF1 3 4  ? parallel      
AF1 4 5  ? anti-parallel 
AF1 5 6  ? anti-parallel 
AF1 6 7  ? parallel      
AF2 1 2  ? anti-parallel 
AF3 1 2  ? parallel      
AF3 2 3  ? parallel      
AF3 3 4  ? parallel      
AF3 4 5  ? anti-parallel 
AF3 5 6  ? anti-parallel 
AF3 6 7  ? anti-parallel 
AF4 1 2  ? parallel      
AF4 2 3  ? parallel      
AF4 3 4  ? parallel      
AF4 4 5  ? anti-parallel 
AF4 5 6  ? anti-parallel 
AF4 6 7  ? parallel      
AF5 1 2  ? anti-parallel 
AF6 1 2  ? anti-parallel 
AF7 1 2  ? parallel      
AF7 2 3  ? parallel      
AF7 3 4  ? parallel      
AF7 4 5  ? parallel      
AF8 1 2  ? parallel      
AF8 2 3  ? parallel      
AF8 3 4  ? parallel      
AF8 4 5  ? parallel      
AF9 1 2  ? parallel      
AF9 2 3  ? parallel      
AF9 3 4  ? parallel      
AF9 4 5  ? parallel      
AF9 5 6  ? anti-parallel 
AG1 1 2  ? parallel      
AG1 2 3  ? parallel      
AG1 3 4  ? parallel      
AG1 4 5  ? anti-parallel 
AG1 5 6  ? anti-parallel 
AG1 6 7  ? anti-parallel 
AG2 1 2  ? parallel      
AG2 2 3  ? parallel      
AG2 3 4  ? parallel      
AG2 4 5  ? anti-parallel 
AG2 5 6  ? anti-parallel 
AG2 6 7  ? parallel      
AG3 1 2  ? anti-parallel 
AG4 1 2  ? anti-parallel 
AG5 1 2  ? parallel      
AG5 2 3  ? parallel      
AG5 3 4  ? parallel      
AG5 4 5  ? anti-parallel 
AG5 5 6  ? anti-parallel 
AG5 6 7  ? parallel      
AG6 1 2  ? anti-parallel 
AG7 1 2  ? anti-parallel 
AG8 1 2  ? parallel      
AG8 2 3  ? parallel      
AG8 3 4  ? parallel      
AG8 4 5  ? parallel      
AG9 1 2  ? parallel      
AG9 2 3  ? parallel      
AG9 3 4  ? parallel      
AG9 4 5  ? parallel      
AH1 1 2  ? parallel      
AH1 2 3  ? parallel      
AH1 3 4  ? parallel      
AH1 4 5  ? parallel      
AH1 5 6  ? anti-parallel 
AH2 1 2  ? parallel      
AH2 2 3  ? parallel      
AH2 3 4  ? parallel      
AH2 4 5  ? anti-parallel 
AH2 5 6  ? anti-parallel 
AH2 6 7  ? parallel      
AH3 1 2  ? anti-parallel 
AH4 1 2  ? parallel      
AH4 2 3  ? parallel      
AH4 3 4  ? parallel      
AH4 4 5  ? parallel      
AH5 1 2  ? parallel      
AH5 2 3  ? parallel      
AH5 3 4  ? parallel      
AH5 4 5  ? parallel      
AH6 1 2  ? parallel      
AH6 2 3  ? parallel      
AH6 3 4  ? parallel      
AH6 4 5  ? parallel      
AH6 5 6  ? anti-parallel 
AH7 1 2  ? parallel      
AH7 2 3  ? parallel      
AH7 3 4  ? parallel      
AH7 4 5  ? anti-parallel 
AH7 5 6  ? anti-parallel 
AH7 6 7  ? anti-parallel 
AH8 1 2  ? parallel      
AH8 2 3  ? parallel      
AH8 3 4  ? parallel      
AH8 4 5  ? anti-parallel 
AH8 5 6  ? anti-parallel 
AH8 6 7  ? parallel      
AH9 1 2  ? anti-parallel 
AI1 1 2  ? anti-parallel 
AI2 1 2  ? parallel      
AI2 2 3  ? parallel      
AI2 3 4  ? parallel      
AI2 4 5  ? parallel      
AI3 1 2  ? parallel      
AI3 2 3  ? parallel      
AI3 3 4  ? parallel      
AI3 4 5  ? parallel      
AI4 1 2  ? parallel      
AI4 2 3  ? parallel      
AI4 3 4  ? parallel      
AI4 4 5  ? parallel      
AI4 5 6  ? anti-parallel 
AI5 1 2  ? parallel      
AI5 2 3  ? parallel      
AI5 3 4  ? parallel      
AI5 4 5  ? anti-parallel 
AI5 5 6  ? anti-parallel 
AI5 6 7  ? anti-parallel 
AI6 1 2  ? parallel      
AI6 2 3  ? parallel      
AI6 3 4  ? parallel      
AI6 4 5  ? anti-parallel 
AI6 5 6  ? anti-parallel 
AI6 6 7  ? parallel      
AI7 1 2  ? anti-parallel 
AI8 1 2  ? anti-parallel 
AI9 1 2  ? parallel      
AI9 2 3  ? parallel      
AI9 3 4  ? parallel      
AI9 4 5  ? anti-parallel 
AI9 5 6  ? anti-parallel 
AI9 6 7  ? anti-parallel 
AJ1 1 2  ? parallel      
AJ1 2 3  ? parallel      
AJ1 3 4  ? parallel      
AJ1 4 5  ? anti-parallel 
AJ1 5 6  ? anti-parallel 
AJ1 6 7  ? parallel      
AJ2 1 2  ? anti-parallel 
AJ3 1 2  ? anti-parallel 
AJ4 1 2  ? parallel      
AJ4 2 3  ? parallel      
AJ4 3 4  ? parallel      
AJ4 4 5  ? parallel      
AJ4 5 6  ? anti-parallel 
AJ4 6 7  ? parallel      
AJ4 7 8  ? parallel      
AJ4 8 9  ? parallel      
AJ4 9 10 ? parallel      
AJ5 1 2  ? parallel      
AJ5 2 3  ? parallel      
AJ5 3 4  ? parallel      
AJ5 4 5  ? parallel      
AJ5 5 6  ? anti-parallel 
AJ6 1 2  ? parallel      
AJ6 2 3  ? parallel      
AJ6 3 4  ? parallel      
AJ6 4 5  ? parallel      
AJ6 5 6  ? anti-parallel 
AJ7 1 2  ? parallel      
AJ7 2 3  ? parallel      
AJ7 3 4  ? parallel      
AJ7 4 5  ? parallel      
AJ7 5 6  ? anti-parallel 
AJ7 6 7  ? parallel      
AJ7 7 8  ? parallel      
AJ7 8 9  ? parallel      
AJ7 9 10 ? parallel      
AJ8 1 2  ? parallel      
AJ8 2 3  ? parallel      
AJ8 3 4  ? parallel      
AJ8 4 5  ? anti-parallel 
AJ8 5 6  ? anti-parallel 
AJ8 6 7  ? anti-parallel 
AJ9 1 2  ? parallel      
AJ9 2 3  ? parallel      
AJ9 3 4  ? parallel      
AJ9 4 5  ? anti-parallel 
AJ9 5 6  ? anti-parallel 
AJ9 6 7  ? parallel      
AK1 1 2  ? anti-parallel 
AK2 1 2  ? parallel      
AK2 2 3  ? parallel      
AK2 3 4  ? parallel      
AK2 4 5  ? parallel      
AK3 1 2  ? parallel      
AK3 2 3  ? parallel      
AK3 3 4  ? parallel      
AK3 4 5  ? parallel      
AK4 1 2  ? parallel      
AK4 2 3  ? parallel      
AK4 3 4  ? parallel      
AK4 4 5  ? parallel      
AK4 5 6  ? anti-parallel 
AK5 1 2  ? parallel      
AK5 2 3  ? parallel      
AK5 3 4  ? parallel      
AK5 4 5  ? anti-parallel 
AK5 5 6  ? anti-parallel 
AK5 6 7  ? anti-parallel 
AK6 1 2  ? parallel      
AK6 2 3  ? parallel      
AK6 3 4  ? parallel      
AK6 4 5  ? anti-parallel 
AK6 5 6  ? anti-parallel 
AK6 6 7  ? parallel      
AK7 1 2  ? anti-parallel 
AK8 1 2  ? anti-parallel 
AK9 1 2  ? parallel      
AK9 2 3  ? parallel      
AK9 3 4  ? parallel      
AK9 4 5  ? anti-parallel 
AK9 5 6  ? anti-parallel 
AK9 6 7  ? anti-parallel 
AL1 1 2  ? parallel      
AL1 2 3  ? parallel      
AL1 3 4  ? parallel      
AL1 4 5  ? anti-parallel 
AL1 5 6  ? anti-parallel 
AL1 6 7  ? parallel      
AL2 1 2  ? anti-parallel 
AL3 1 2  ? anti-parallel 
AL4 1 2  ? parallel      
AL4 2 3  ? parallel      
AL4 3 4  ? parallel      
AL4 4 5  ? anti-parallel 
AL4 5 6  ? anti-parallel 
AL4 6 7  ? anti-parallel 
AL5 1 2  ? parallel      
AL5 2 3  ? parallel      
AL5 3 4  ? parallel      
AL5 4 5  ? anti-parallel 
AL5 5 6  ? anti-parallel 
AL5 6 7  ? parallel      
AL6 1 2  ? anti-parallel 
AL7 1 2  ? anti-parallel 
AL8 1 2  ? parallel      
AL8 2 3  ? parallel      
AL8 3 4  ? parallel      
AL8 4 5  ? anti-parallel 
AL8 5 6  ? anti-parallel 
AL8 6 7  ? parallel      
AL9 1 2  ? anti-parallel 
AM1 1 2  ? anti-parallel 
AM2 1 2  ? parallel      
AM2 2 3  ? parallel      
AM2 3 4  ? parallel      
AM2 4 5  ? parallel      
AM2 5 6  ? anti-parallel 
AM2 6 7  ? parallel      
AM2 7 8  ? parallel      
AM2 8 9  ? parallel      
AM2 9 10 ? parallel      
AM3 1 2  ? parallel      
AM3 2 3  ? parallel      
AM3 3 4  ? parallel      
AM3 4 5  ? parallel      
AM3 5 6  ? anti-parallel 
AM4 1 2  ? parallel      
AM4 2 3  ? parallel      
AM4 3 4  ? parallel      
AM4 4 5  ? parallel      
AM4 5 6  ? anti-parallel 
AM5 1 2  ? parallel      
AM5 2 3  ? parallel      
AM5 3 4  ? parallel      
AM5 4 5  ? parallel      
AM5 5 6  ? anti-parallel 
AM5 6 7  ? parallel      
AM5 7 8  ? parallel      
AM5 8 9  ? parallel      
AM5 9 10 ? parallel      
AM6 1 2  ? parallel      
AM6 2 3  ? parallel      
AM6 3 4  ? parallel      
AM6 4 5  ? anti-parallel 
AM6 5 6  ? anti-parallel 
AM6 6 7  ? anti-parallel 
AM7 1 2  ? parallel      
AM7 2 3  ? parallel      
AM7 3 4  ? parallel      
AM7 4 5  ? anti-parallel 
AM7 5 6  ? anti-parallel 
AM7 6 7  ? parallel      
AM8 1 2  ? anti-parallel 
AM9 1 2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  SER A 91  ? LEU A 95  ? SER A 92  LEU A 96  
AA1 2  ARG A 61  ? THR A 66  ? ARG A 62  THR A 67  
AA1 3  ALA A 13  ? ALA A 19  ? ALA A 14  ALA A 20  
AA1 4  TYR A 128 ? ALA A 133 ? TYR A 129 ALA A 134 
AA1 5  PHE A 201 ? HIS A 212 ? PHE A 202 HIS A 213 
AA1 6  GLY A 172 ? VAL A 176 ? GLY A 173 VAL A 177 
AA1 7  ILE A 182 ? GLU A 187 ? ILE A 183 GLU A 188 
AA2 1  SER A 91  ? LEU A 95  ? SER A 92  LEU A 96  
AA2 2  ARG A 61  ? THR A 66  ? ARG A 62  THR A 67  
AA2 3  ALA A 13  ? ALA A 19  ? ALA A 14  ALA A 20  
AA2 4  TYR A 128 ? ALA A 133 ? TYR A 129 ALA A 134 
AA2 5  PHE A 201 ? HIS A 212 ? PHE A 202 HIS A 213 
AA2 6  VAL A 156 ? PRO A 164 ? VAL A 157 PRO A 165 
AA2 7  ALA A 247 ? ARG A 251 ? ALA A 248 ARG A 252 
AA3 1  TYR A 39  ? PHE A 40  ? TYR A 40  PHE A 41  
AA3 2  ALA A 44  ? ARG A 45  ? ALA A 45  ARG A 46  
AA4 1  ILE A 137 ? TYR A 138 ? ILE A 138 TYR A 139 
AA4 2  TRP A 267 ? ARG A 268 ? TRP A 268 ARG A 269 
AA5 1  VAL A 382 ? ILE A 383 ? VAL A 383 ILE A 384 
AA5 2  LYS A 365 ? ILE A 366 ? LYS A 366 ILE A 367 
AA5 3  ARG A 348 ? ALA A 349 ? ARG A 349 ALA A 350 
AA5 4  ILE A 332 ? SER A 334 ? ILE A 333 SER A 335 
AA5 5  ALA A 309 ? VAL A 312 ? ALA A 310 VAL A 313 
AA5 6  SER M 325 ? VAL M 327 ? SER P 326 VAL P 328 
AA5 7  LEU M 342 ? LEU M 343 ? LEU P 343 LEU P 344 
AA5 8  ARG M 354 ? VAL M 360 ? ARG P 355 VAL P 361 
AA5 9  GLN M 371 ? ILE M 377 ? GLN P 372 ILE P 378 
AA5 10 ILE M 388 ? VAL M 389 ? ILE P 389 VAL P 390 
AA6 1  SER M 321 ? VAL M 323 ? SER P 322 VAL P 324 
AA6 2  ALA M 337 ? ASN M 339 ? ALA P 338 ASN P 340 
AA6 3  ARG M 354 ? VAL M 360 ? ARG P 355 VAL P 361 
AA6 4  GLN M 371 ? ILE M 377 ? GLN P 372 ILE P 378 
AA6 5  CYS M 408 ? ILE M 410 ? CYS P 409 ILE P 411 
AA6 6  ARG M 401 ? ARG M 402 ? ARG P 402 ARG P 403 
AA7 1  SER A 321 ? VAL A 323 ? SER A 322 VAL A 324 
AA7 2  ALA A 337 ? ASN A 339 ? ALA A 338 ASN A 340 
AA7 3  ARG A 354 ? VAL A 360 ? ARG A 355 VAL A 361 
AA7 4  GLN A 371 ? ILE A 377 ? GLN A 372 ILE A 378 
AA7 5  CYS A 408 ? ILE A 410 ? CYS A 409 ILE A 411 
AA7 6  ARG A 401 ? ARG A 402 ? ARG A 402 ARG A 403 
AA8 1  ILE A 388 ? VAL A 389 ? ILE A 389 VAL A 390 
AA8 2  GLN A 371 ? ILE A 377 ? GLN A 372 ILE A 378 
AA8 3  ARG A 354 ? VAL A 360 ? ARG A 355 VAL A 361 
AA8 4  LEU A 342 ? LEU A 343 ? LEU A 343 LEU A 344 
AA8 5  SER A 325 ? VAL A 327 ? SER A 326 VAL A 328 
AA8 6  ALA M 309 ? VAL M 312 ? ALA P 310 VAL P 313 
AA8 7  ILE M 332 ? SER M 334 ? ILE P 333 SER P 335 
AA8 8  ARG M 348 ? ALA M 349 ? ARG P 349 ALA P 350 
AA8 9  LYS M 365 ? ILE M 366 ? LYS P 366 ILE P 367 
AA8 10 VAL M 382 ? ILE M 383 ? VAL P 383 ILE P 384 
AA9 1  SER B 91  ? PRO B 96  ? SER B 92  PRO B 97  
AA9 2  ARG B 61  ? THR B 66  ? ARG B 62  THR B 67  
AA9 3  ALA B 13  ? LEU B 18  ? ALA B 14  LEU B 19  
AA9 4  TYR B 128 ? ALA B 133 ? TYR B 129 ALA B 134 
AA9 5  PHE B 201 ? HIS B 212 ? PHE B 202 HIS B 213 
AA9 6  GLY B 172 ? VAL B 176 ? GLY B 173 VAL B 177 
AA9 7  ILE B 182 ? GLU B 187 ? ILE B 183 GLU B 188 
AB1 1  SER B 91  ? PRO B 96  ? SER B 92  PRO B 97  
AB1 2  ARG B 61  ? THR B 66  ? ARG B 62  THR B 67  
AB1 3  ALA B 13  ? LEU B 18  ? ALA B 14  LEU B 19  
AB1 4  TYR B 128 ? ALA B 133 ? TYR B 129 ALA B 134 
AB1 5  PHE B 201 ? HIS B 212 ? PHE B 202 HIS B 213 
AB1 6  VAL B 156 ? PRO B 164 ? VAL B 157 PRO B 165 
AB1 7  ALA B 247 ? ARG B 251 ? ALA B 248 ARG B 252 
AB2 1  ILE B 137 ? TYR B 138 ? ILE B 138 TYR B 139 
AB2 2  TRP B 267 ? ARG B 268 ? TRP B 268 ARG B 269 
AB3 1  VAL B 382 ? ILE B 383 ? VAL B 383 ILE B 384 
AB3 2  LYS B 365 ? ILE B 366 ? LYS B 366 ILE B 367 
AB3 3  ARG B 348 ? ALA B 349 ? ARG B 349 ALA B 350 
AB3 4  ILE B 332 ? SER B 334 ? ILE B 333 SER B 335 
AB3 5  ALA B 309 ? VAL B 312 ? ALA B 310 VAL B 313 
AB3 6  VAL I 326 ? VAL I 327 ? VAL K 327 VAL K 328 
AB3 7  LEU I 342 ? LEU I 343 ? LEU K 343 LEU K 344 
AB3 8  ARG I 354 ? VAL I 360 ? ARG K 355 VAL K 361 
AB3 9  GLN I 371 ? ILE I 377 ? GLN K 372 ILE K 378 
AB3 10 ILE I 388 ? VAL I 389 ? ILE K 389 VAL K 390 
AB4 1  SER I 321 ? VAL I 323 ? SER K 322 VAL K 324 
AB4 2  ALA I 337 ? ASN I 339 ? ALA K 338 ASN K 340 
AB4 3  ARG I 354 ? VAL I 360 ? ARG K 355 VAL K 361 
AB4 4  GLN I 371 ? ILE I 377 ? GLN K 372 ILE K 378 
AB4 5  CYS I 408 ? ILE I 410 ? CYS K 409 ILE K 411 
AB4 6  ARG I 401 ? ARG I 402 ? ARG K 402 ARG K 403 
AB5 1  SER B 321 ? VAL B 323 ? SER B 322 VAL B 324 
AB5 2  ALA B 337 ? LEU B 343 ? ALA B 338 LEU B 344 
AB5 3  ARG B 354 ? VAL B 360 ? ARG B 355 VAL B 361 
AB5 4  GLN B 371 ? ILE B 377 ? GLN B 372 ILE B 378 
AB5 5  CYS B 408 ? ILE B 410 ? CYS B 409 ILE B 411 
AB5 6  ARG B 401 ? ARG B 402 ? ARG B 402 ARG B 403 
AB6 1  ILE B 388 ? VAL B 389 ? ILE B 389 VAL B 390 
AB6 2  GLN B 371 ? ILE B 377 ? GLN B 372 ILE B 378 
AB6 3  ARG B 354 ? VAL B 360 ? ARG B 355 VAL B 361 
AB6 4  ALA B 337 ? LEU B 343 ? ALA B 338 LEU B 344 
AB6 5  SER B 325 ? VAL B 327 ? SER B 326 VAL B 328 
AB6 6  ALA I 309 ? VAL I 312 ? ALA K 310 VAL K 313 
AB6 7  ILE I 332 ? SER I 334 ? ILE K 333 SER K 335 
AB6 8  ARG I 348 ? ALA I 349 ? ARG K 349 ALA K 350 
AB6 9  LYS I 365 ? ILE I 366 ? LYS K 366 ILE K 367 
AB6 10 VAL I 382 ? ILE I 383 ? VAL K 383 ILE K 384 
AB7 1  SER C 91  ? PRO C 96  ? SER C 92  PRO C 97  
AB7 2  ARG C 61  ? THR C 66  ? ARG C 62  THR C 67  
AB7 3  ALA C 13  ? ALA C 19  ? ALA C 14  ALA C 20  
AB7 4  TYR C 128 ? ALA C 133 ? TYR C 129 ALA C 134 
AB7 5  PHE C 201 ? HIS C 212 ? PHE C 202 HIS C 213 
AB7 6  GLY C 172 ? VAL C 176 ? GLY C 173 VAL C 177 
AB7 7  ILE C 182 ? GLU C 187 ? ILE C 183 GLU C 188 
AB8 1  SER C 91  ? PRO C 96  ? SER C 92  PRO C 97  
AB8 2  ARG C 61  ? THR C 66  ? ARG C 62  THR C 67  
AB8 3  ALA C 13  ? ALA C 19  ? ALA C 14  ALA C 20  
AB8 4  TYR C 128 ? ALA C 133 ? TYR C 129 ALA C 134 
AB8 5  PHE C 201 ? HIS C 212 ? PHE C 202 HIS C 213 
AB8 6  VAL C 156 ? PRO C 164 ? VAL C 157 PRO C 165 
AB8 7  ALA C 247 ? ARG C 251 ? ALA C 248 ARG C 252 
AB9 1  ILE C 137 ? TYR C 138 ? ILE C 138 TYR C 139 
AB9 2  TRP C 267 ? ARG C 268 ? TRP C 268 ARG C 269 
AC1 1  VAL C 382 ? ILE C 383 ? VAL C 383 ILE C 384 
AC1 2  LYS C 365 ? ILE C 366 ? LYS C 366 ILE C 367 
AC1 3  ARG C 348 ? ALA C 349 ? ARG C 349 ALA C 350 
AC1 4  ILE C 332 ? ILE C 333 ? ILE C 333 ILE C 334 
AC1 5  ALA C 309 ? PHE C 311 ? ALA C 310 PHE C 312 
AC1 6  SER G 325 ? VAL G 327 ? SER I 326 VAL I 328 
AC1 7  LEU G 342 ? LEU G 343 ? LEU I 343 LEU I 344 
AC1 8  ARG G 354 ? VAL G 360 ? ARG I 355 VAL I 361 
AC1 9  GLN G 371 ? ILE G 377 ? GLN I 372 ILE I 378 
AC1 10 ILE G 388 ? VAL G 389 ? ILE I 389 VAL I 390 
AC2 1  SER G 321 ? VAL G 323 ? SER I 322 VAL I 324 
AC2 2  ALA G 337 ? ASN G 339 ? ALA I 338 ASN I 340 
AC2 3  ARG G 354 ? VAL G 360 ? ARG I 355 VAL I 361 
AC2 4  GLN G 371 ? ILE G 377 ? GLN I 372 ILE I 378 
AC2 5  CYS G 408 ? ILE G 410 ? CYS I 409 ILE I 411 
AC2 6  ARG G 401 ? ARG G 402 ? ARG I 402 ARG I 403 
AC3 1  SER C 321 ? VAL C 323 ? SER C 322 VAL C 324 
AC3 2  ALA C 337 ? ASN C 339 ? ALA C 338 ASN C 340 
AC3 3  ARG C 354 ? VAL C 360 ? ARG C 355 VAL C 361 
AC3 4  GLN C 371 ? ILE C 377 ? GLN C 372 ILE C 378 
AC3 5  CYS C 408 ? ILE C 410 ? CYS C 409 ILE C 411 
AC3 6  ARG C 401 ? ARG C 402 ? ARG C 402 ARG C 403 
AC4 1  ILE C 388 ? VAL C 389 ? ILE C 389 VAL C 390 
AC4 2  GLN C 371 ? ILE C 377 ? GLN C 372 ILE C 378 
AC4 3  ARG C 354 ? VAL C 360 ? ARG C 355 VAL C 361 
AC4 4  LEU C 342 ? LEU C 343 ? LEU C 343 LEU C 344 
AC4 5  SER C 325 ? VAL C 327 ? SER C 326 VAL C 328 
AC4 6  ALA G 309 ? VAL G 312 ? ALA I 310 VAL I 313 
AC4 7  ILE G 332 ? SER G 334 ? ILE I 333 SER I 335 
AC4 8  ARG G 348 ? ALA G 349 ? ARG I 349 ALA I 350 
AC4 9  LYS G 365 ? ILE G 366 ? LYS I 366 ILE I 367 
AC4 10 VAL G 382 ? ILE G 383 ? VAL I 383 ILE I 384 
AC5 1  SER D 91  ? PRO D 96  ? SER D 92  PRO D 97  
AC5 2  ARG D 61  ? THR D 66  ? ARG D 62  THR D 67  
AC5 3  ALA D 13  ? LEU D 18  ? ALA D 14  LEU D 19  
AC5 4  TYR D 128 ? ALA D 133 ? TYR D 129 ALA D 134 
AC5 5  PHE D 201 ? HIS D 212 ? PHE D 202 HIS D 213 
AC5 6  GLY D 172 ? VAL D 176 ? GLY D 173 VAL D 177 
AC5 7  ILE D 182 ? GLU D 187 ? ILE D 183 GLU D 188 
AC6 1  SER D 91  ? PRO D 96  ? SER D 92  PRO D 97  
AC6 2  ARG D 61  ? THR D 66  ? ARG D 62  THR D 67  
AC6 3  ALA D 13  ? LEU D 18  ? ALA D 14  LEU D 19  
AC6 4  TYR D 128 ? ALA D 133 ? TYR D 129 ALA D 134 
AC6 5  PHE D 201 ? HIS D 212 ? PHE D 202 HIS D 213 
AC6 6  VAL D 156 ? PRO D 164 ? VAL D 157 PRO D 165 
AC6 7  ALA D 247 ? ARG D 251 ? ALA D 248 ARG D 252 
AC7 1  TYR D 39  ? PHE D 40  ? TYR D 40  PHE D 41  
AC7 2  ALA D 44  ? ARG D 45  ? ALA D 45  ARG D 46  
AC8 1  ILE D 137 ? TYR D 138 ? ILE D 138 TYR D 139 
AC8 2  TRP D 267 ? ARG D 268 ? TRP D 268 ARG D 269 
AC9 1  VAL D 382 ? ILE D 383 ? VAL D 383 ILE D 384 
AC9 2  LYS D 365 ? ILE D 366 ? LYS D 366 ILE D 367 
AC9 3  ARG D 348 ? ALA D 349 ? ARG D 349 ALA D 350 
AC9 4  ILE D 332 ? SER D 334 ? ILE D 333 SER D 335 
AC9 5  ALA D 309 ? VAL D 312 ? ALA D 310 VAL D 313 
AC9 6  SER R 325 ? VAL R 327 ? SER M 326 VAL M 328 
AC9 7  LEU R 342 ? LEU R 343 ? LEU M 343 LEU M 344 
AC9 8  ARG R 354 ? VAL R 360 ? ARG M 355 VAL M 361 
AC9 9  GLN R 371 ? ILE R 377 ? GLN M 372 ILE M 378 
AC9 10 ILE R 388 ? VAL R 389 ? ILE M 389 VAL M 390 
AD1 1  SER R 321 ? VAL R 323 ? SER M 322 VAL M 324 
AD1 2  ALA R 337 ? ASN R 339 ? ALA M 338 ASN M 340 
AD1 3  ARG R 354 ? VAL R 360 ? ARG M 355 VAL M 361 
AD1 4  GLN R 371 ? ILE R 377 ? GLN M 372 ILE M 378 
AD1 5  CYS R 408 ? ILE R 410 ? CYS M 409 ILE M 411 
AD1 6  ARG R 401 ? ARG R 402 ? ARG M 402 ARG M 403 
AD2 1  SER D 321 ? VAL D 323 ? SER D 322 VAL D 324 
AD2 2  ALA D 337 ? ASN D 339 ? ALA D 338 ASN D 340 
AD2 3  ARG D 354 ? VAL D 360 ? ARG D 355 VAL D 361 
AD2 4  GLN D 371 ? ILE D 377 ? GLN D 372 ILE D 378 
AD2 5  CYS D 408 ? ILE D 410 ? CYS D 409 ILE D 411 
AD2 6  ARG D 401 ? ARG D 402 ? ARG D 402 ARG D 403 
AD3 1  ILE D 388 ? VAL D 389 ? ILE D 389 VAL D 390 
AD3 2  GLN D 371 ? ILE D 377 ? GLN D 372 ILE D 378 
AD3 3  ARG D 354 ? VAL D 360 ? ARG D 355 VAL D 361 
AD3 4  LEU D 342 ? LEU D 343 ? LEU D 343 LEU D 344 
AD3 5  SER D 325 ? VAL D 327 ? SER D 326 VAL D 328 
AD3 6  ALA R 309 ? VAL R 312 ? ALA M 310 VAL M 313 
AD3 7  ILE R 332 ? SER R 334 ? ILE M 333 SER M 335 
AD3 8  ARG R 348 ? ALA R 349 ? ARG M 349 ALA M 350 
AD3 9  LYS R 365 ? ILE R 366 ? LYS M 366 ILE M 367 
AD3 10 VAL R 382 ? ILE R 383 ? VAL M 383 ILE M 384 
AD4 1  SER E 91  ? LEU E 95  ? SER E 92  LEU E 96  
AD4 2  ARG E 61  ? ALA E 65  ? ARG E 62  ALA E 66  
AD4 3  ALA E 13  ? LEU E 18  ? ALA E 14  LEU E 19  
AD4 4  TYR E 128 ? ALA E 133 ? TYR E 129 ALA E 134 
AD4 5  PHE E 201 ? HIS E 212 ? PHE E 202 HIS E 213 
AD4 6  GLY E 172 ? VAL E 176 ? GLY E 173 VAL E 177 
AD4 7  ILE E 182 ? GLU E 187 ? ILE E 183 GLU E 188 
AD5 1  SER E 91  ? LEU E 95  ? SER E 92  LEU E 96  
AD5 2  ARG E 61  ? ALA E 65  ? ARG E 62  ALA E 66  
AD5 3  ALA E 13  ? LEU E 18  ? ALA E 14  LEU E 19  
AD5 4  TYR E 128 ? ALA E 133 ? TYR E 129 ALA E 134 
AD5 5  PHE E 201 ? HIS E 212 ? PHE E 202 HIS E 213 
AD5 6  VAL E 156 ? PRO E 164 ? VAL E 157 PRO E 165 
AD5 7  ALA E 247 ? ARG E 251 ? ALA E 248 ARG E 252 
AD6 1  ILE E 137 ? TYR E 138 ? ILE E 138 TYR E 139 
AD6 2  TRP E 267 ? ARG E 268 ? TRP E 268 ARG E 269 
AD7 1  LYS E 310 ? VAL E 312 ? LYS E 311 VAL E 313 
AD7 2  ILE E 332 ? SER E 334 ? ILE E 333 SER E 335 
AD7 3  ARG E 348 ? ALA E 349 ? ARG E 349 ALA E 350 
AD7 4  LYS E 365 ? ILE E 366 ? LYS E 366 ILE E 367 
AD7 5  VAL E 382 ? ILE E 383 ? VAL E 383 ILE E 384 
AD8 1  SER E 321 ? VAL E 323 ? SER E 322 VAL E 324 
AD8 2  ALA E 337 ? ASN E 339 ? ALA E 338 ASN E 340 
AD8 3  ARG E 354 ? VAL E 360 ? ARG E 355 VAL E 361 
AD8 4  GLN E 371 ? ILE E 377 ? GLN E 372 ILE E 378 
AD8 5  ILE E 388 ? VAL E 389 ? ILE E 389 VAL E 390 
AD9 1  VAL E 326 ? VAL E 327 ? VAL E 327 VAL E 328 
AD9 2  LEU E 342 ? LEU E 343 ? LEU E 343 LEU E 344 
AD9 3  ARG E 354 ? VAL E 360 ? ARG E 355 VAL E 361 
AD9 4  GLN E 371 ? ILE E 377 ? GLN E 372 ILE E 378 
AD9 5  CYS E 408 ? ILE E 410 ? CYS E 409 ILE E 411 
AD9 6  ARG E 401 ? ARG E 402 ? ARG E 402 ARG E 403 
AE1 1  SER F 91  ? LEU F 95  ? SER H 92  LEU H 96  
AE1 2  ARG F 61  ? ALA F 65  ? ARG H 62  ALA H 66  
AE1 3  ALA F 13  ? LEU F 18  ? ALA H 14  LEU H 19  
AE1 4  TYR F 128 ? ALA F 133 ? TYR H 129 ALA H 134 
AE1 5  PHE F 201 ? HIS F 212 ? PHE H 202 HIS H 213 
AE1 6  GLY F 172 ? HIS F 175 ? GLY H 173 HIS H 176 
AE1 7  ASP F 184 ? GLU F 187 ? ASP H 185 GLU H 188 
AE2 1  SER F 91  ? LEU F 95  ? SER H 92  LEU H 96  
AE2 2  ARG F 61  ? ALA F 65  ? ARG H 62  ALA H 66  
AE2 3  ALA F 13  ? LEU F 18  ? ALA H 14  LEU H 19  
AE2 4  TYR F 128 ? ALA F 133 ? TYR H 129 ALA H 134 
AE2 5  PHE F 201 ? HIS F 212 ? PHE H 202 HIS H 213 
AE2 6  VAL F 156 ? PRO F 164 ? VAL H 157 PRO H 165 
AE2 7  ALA F 247 ? ARG F 251 ? ALA H 248 ARG H 252 
AE3 1  TYR F 39  ? PHE F 40  ? TYR H 40  PHE H 41  
AE3 2  ALA F 44  ? ARG F 45  ? ALA H 45  ARG H 46  
AE4 1  ILE F 137 ? TYR F 138 ? ILE H 138 TYR H 139 
AE4 2  TRP F 267 ? ARG F 268 ? TRP H 268 ARG H 269 
AE5 1  VAL F 382 ? ILE F 383 ? VAL H 383 ILE H 384 
AE5 2  LYS F 365 ? ILE F 366 ? LYS H 366 ILE H 367 
AE5 3  ARG F 348 ? ALA F 349 ? ARG H 349 ALA H 350 
AE5 4  ILE F 332 ? SER F 334 ? ILE H 333 SER H 335 
AE5 5  ALA F 309 ? VAL F 312 ? ALA H 310 VAL H 313 
AE5 6  VAL Q 326 ? VAL Q 327 ? VAL G 327 VAL G 328 
AE5 7  LEU Q 342 ? LEU Q 343 ? LEU G 343 LEU G 344 
AE5 8  ARG Q 354 ? VAL Q 360 ? ARG G 355 VAL G 361 
AE5 9  GLN Q 371 ? ILE Q 377 ? GLN G 372 ILE G 378 
AE5 10 ILE Q 388 ? VAL Q 389 ? ILE G 389 VAL G 390 
AE6 1  SER Q 321 ? VAL Q 323 ? SER G 322 VAL G 324 
AE6 2  ALA Q 337 ? ASN Q 339 ? ALA G 338 ASN G 340 
AE6 3  ARG Q 354 ? VAL Q 360 ? ARG G 355 VAL G 361 
AE6 4  GLN Q 371 ? ILE Q 377 ? GLN G 372 ILE G 378 
AE6 5  CYS Q 408 ? ILE Q 410 ? CYS G 409 ILE G 411 
AE6 6  ARG Q 401 ? ARG Q 402 ? ARG G 402 ARG G 403 
AE7 1  SER F 321 ? VAL F 323 ? SER H 322 VAL H 324 
AE7 2  ALA F 337 ? LEU F 343 ? ALA H 338 LEU H 344 
AE7 3  ARG F 354 ? VAL F 360 ? ARG H 355 VAL H 361 
AE7 4  GLN F 371 ? ILE F 377 ? GLN H 372 ILE H 378 
AE7 5  CYS F 408 ? ILE F 410 ? CYS H 409 ILE H 411 
AE7 6  ARG F 401 ? ARG F 402 ? ARG H 402 ARG H 403 
AE8 1  ILE F 388 ? VAL F 389 ? ILE H 389 VAL H 390 
AE8 2  GLN F 371 ? ILE F 377 ? GLN H 372 ILE H 378 
AE8 3  ARG F 354 ? VAL F 360 ? ARG H 355 VAL H 361 
AE8 4  ALA F 337 ? LEU F 343 ? ALA H 338 LEU H 344 
AE8 5  SER F 325 ? VAL F 327 ? SER H 326 VAL H 328 
AE8 6  ALA Q 309 ? VAL Q 312 ? ALA G 310 VAL G 313 
AE8 7  ILE Q 332 ? SER Q 334 ? ILE G 333 SER G 335 
AE8 8  ARG Q 348 ? ALA Q 349 ? ARG G 349 ALA G 350 
AE8 9  LYS Q 365 ? ILE Q 366 ? LYS G 366 ILE G 367 
AE8 10 VAL Q 382 ? ILE Q 383 ? VAL G 383 ILE G 384 
AE9 1  SER G 91  ? LEU G 95  ? SER I 92  LEU I 96  
AE9 2  ARG G 61  ? ALA G 65  ? ARG I 62  ALA I 66  
AE9 3  ALA G 13  ? LEU G 18  ? ALA I 14  LEU I 19  
AE9 4  TYR G 128 ? ALA G 133 ? TYR I 129 ALA I 134 
AE9 5  PHE G 201 ? HIS G 212 ? PHE I 202 HIS I 213 
AE9 6  GLY G 172 ? VAL G 176 ? GLY I 173 VAL I 177 
AE9 7  ILE G 182 ? GLU G 187 ? ILE I 183 GLU I 188 
AF1 1  SER G 91  ? LEU G 95  ? SER I 92  LEU I 96  
AF1 2  ARG G 61  ? ALA G 65  ? ARG I 62  ALA I 66  
AF1 3  ALA G 13  ? LEU G 18  ? ALA I 14  LEU I 19  
AF1 4  TYR G 128 ? ALA G 133 ? TYR I 129 ALA I 134 
AF1 5  PHE G 201 ? HIS G 212 ? PHE I 202 HIS I 213 
AF1 6  VAL G 156 ? PRO G 164 ? VAL I 157 PRO I 165 
AF1 7  ALA G 247 ? ARG G 251 ? ALA I 248 ARG I 252 
AF2 1  ILE G 137 ? TYR G 138 ? ILE I 138 TYR I 139 
AF2 2  TRP G 267 ? ARG G 268 ? TRP I 268 ARG I 269 
AF3 1  SER H 91  ? LEU H 95  ? SER J 92  LEU J 96  
AF3 2  ARG H 61  ? THR H 66  ? ARG J 62  THR J 67  
AF3 3  ALA H 13  ? ALA H 19  ? ALA J 14  ALA J 20  
AF3 4  TYR H 128 ? ALA H 133 ? TYR J 129 ALA J 134 
AF3 5  PHE H 201 ? HIS H 212 ? PHE J 202 HIS J 213 
AF3 6  GLY H 172 ? VAL H 176 ? GLY J 173 VAL J 177 
AF3 7  ILE H 182 ? GLU H 187 ? ILE J 183 GLU J 188 
AF4 1  SER H 91  ? LEU H 95  ? SER J 92  LEU J 96  
AF4 2  ARG H 61  ? THR H 66  ? ARG J 62  THR J 67  
AF4 3  ALA H 13  ? ALA H 19  ? ALA J 14  ALA J 20  
AF4 4  TYR H 128 ? ALA H 133 ? TYR J 129 ALA J 134 
AF4 5  PHE H 201 ? HIS H 212 ? PHE J 202 HIS J 213 
AF4 6  VAL H 156 ? PRO H 164 ? VAL J 157 PRO J 165 
AF4 7  ALA H 247 ? ARG H 251 ? ALA J 248 ARG J 252 
AF5 1  TYR H 39  ? PHE H 40  ? TYR J 40  PHE J 41  
AF5 2  ALA H 44  ? ARG H 45  ? ALA J 45  ARG J 46  
AF6 1  ILE H 137 ? TYR H 138 ? ILE J 138 TYR J 139 
AF6 2  TRP H 267 ? ARG H 268 ? TRP J 268 ARG J 269 
AF7 1  LYS H 310 ? VAL H 312 ? LYS J 311 VAL J 313 
AF7 2  ILE H 332 ? SER H 334 ? ILE J 333 SER J 335 
AF7 3  ARG H 348 ? ALA H 349 ? ARG J 349 ALA J 350 
AF7 4  LYS H 365 ? ILE H 366 ? LYS J 366 ILE J 367 
AF7 5  VAL H 382 ? ILE H 383 ? VAL J 383 ILE J 384 
AF8 1  SER H 321 ? VAL H 323 ? SER J 322 VAL J 324 
AF8 2  ALA H 337 ? ASN H 339 ? ALA J 338 ASN J 340 
AF8 3  ARG H 354 ? VAL H 360 ? ARG J 355 VAL J 361 
AF8 4  GLN H 371 ? ILE H 377 ? GLN J 372 ILE J 378 
AF8 5  ILE H 388 ? VAL H 389 ? ILE J 389 VAL J 390 
AF9 1  VAL H 326 ? VAL H 327 ? VAL J 327 VAL J 328 
AF9 2  LEU H 342 ? LEU H 343 ? LEU J 343 LEU J 344 
AF9 3  ARG H 354 ? VAL H 360 ? ARG J 355 VAL J 361 
AF9 4  GLN H 371 ? ILE H 377 ? GLN J 372 ILE J 378 
AF9 5  CYS H 408 ? ILE H 410 ? CYS J 409 ILE J 411 
AF9 6  ARG H 401 ? ARG H 402 ? ARG J 402 ARG J 403 
AG1 1  SER I 91  ? PRO I 96  ? SER K 92  PRO K 97  
AG1 2  ARG I 61  ? THR I 66  ? ARG K 62  THR K 67  
AG1 3  ALA I 13  ? ALA I 19  ? ALA K 14  ALA K 20  
AG1 4  TYR I 128 ? ALA I 133 ? TYR K 129 ALA K 134 
AG1 5  PHE I 201 ? HIS I 212 ? PHE K 202 HIS K 213 
AG1 6  GLY I 172 ? VAL I 176 ? GLY K 173 VAL K 177 
AG1 7  ILE I 182 ? GLU I 187 ? ILE K 183 GLU K 188 
AG2 1  SER I 91  ? PRO I 96  ? SER K 92  PRO K 97  
AG2 2  ARG I 61  ? THR I 66  ? ARG K 62  THR K 67  
AG2 3  ALA I 13  ? ALA I 19  ? ALA K 14  ALA K 20  
AG2 4  TYR I 128 ? ALA I 133 ? TYR K 129 ALA K 134 
AG2 5  PHE I 201 ? HIS I 212 ? PHE K 202 HIS K 213 
AG2 6  VAL I 156 ? PRO I 164 ? VAL K 157 PRO K 165 
AG2 7  ALA I 247 ? ARG I 251 ? ALA K 248 ARG K 252 
AG3 1  TYR I 39  ? PHE I 40  ? TYR K 40  PHE K 41  
AG3 2  ALA I 44  ? ARG I 45  ? ALA K 45  ARG K 46  
AG4 1  ILE I 137 ? TYR I 138 ? ILE K 138 TYR K 139 
AG4 2  TRP I 267 ? ARG I 268 ? TRP K 268 ARG K 269 
AG5 1  SER J 91  ? PRO J 96  ? SER L 92  PRO L 97  
AG5 2  ARG J 61  ? THR J 66  ? ARG L 62  THR L 67  
AG5 3  ALA J 13  ? LEU J 18  ? ALA L 14  LEU L 19  
AG5 4  TYR J 128 ? ALA J 133 ? TYR L 129 ALA L 134 
AG5 5  PHE J 201 ? HIS J 212 ? PHE L 202 HIS L 213 
AG5 6  VAL J 156 ? PRO J 164 ? VAL L 157 PRO L 165 
AG5 7  ALA J 247 ? ARG J 251 ? ALA L 248 ARG L 252 
AG6 1  ILE J 137 ? TYR J 138 ? ILE L 138 TYR L 139 
AG6 2  TRP J 267 ? ARG J 268 ? TRP L 268 ARG L 269 
AG7 1  GLY J 172 ? VAL J 176 ? GLY L 173 VAL L 177 
AG7 2  ILE J 182 ? GLU J 187 ? ILE L 183 GLU L 188 
AG8 1  LYS J 310 ? VAL J 312 ? LYS L 311 VAL L 313 
AG8 2  ILE J 332 ? SER J 334 ? ILE L 333 SER L 335 
AG8 3  ARG J 348 ? ALA J 349 ? ARG L 349 ALA L 350 
AG8 4  LYS J 365 ? ILE J 366 ? LYS L 366 ILE L 367 
AG8 5  VAL J 382 ? ILE J 383 ? VAL L 383 ILE L 384 
AG9 1  SER J 321 ? VAL J 323 ? SER L 322 VAL L 324 
AG9 2  ALA J 337 ? ASN J 339 ? ALA L 338 ASN L 340 
AG9 3  ARG J 354 ? VAL J 360 ? ARG L 355 VAL L 361 
AG9 4  GLN J 371 ? ILE J 377 ? GLN L 372 ILE L 378 
AG9 5  ILE J 388 ? VAL J 389 ? ILE L 389 VAL L 390 
AH1 1  VAL J 326 ? VAL J 327 ? VAL L 327 VAL L 328 
AH1 2  LEU J 342 ? LEU J 343 ? LEU L 343 LEU L 344 
AH1 3  ARG J 354 ? VAL J 360 ? ARG L 355 VAL L 361 
AH1 4  GLN J 371 ? ILE J 377 ? GLN L 372 ILE L 378 
AH1 5  CYS J 408 ? ILE J 410 ? CYS L 409 ILE L 411 
AH1 6  ARG J 401 ? ARG J 402 ? ARG L 402 ARG L 403 
AH2 1  SER K 91  ? PRO K 96  ? SER N 92  PRO N 97  
AH2 2  ARG K 61  ? THR K 66  ? ARG N 62  THR N 67  
AH2 3  ALA K 13  ? LEU K 18  ? ALA N 14  LEU N 19  
AH2 4  TYR K 128 ? ALA K 133 ? TYR N 129 ALA N 134 
AH2 5  PHE K 201 ? HIS K 212 ? PHE N 202 HIS N 213 
AH2 6  VAL K 156 ? PRO K 164 ? VAL N 157 PRO N 165 
AH2 7  ALA K 247 ? ARG K 251 ? ALA N 248 ARG N 252 
AH3 1  ILE K 137 ? TYR K 138 ? ILE N 138 TYR N 139 
AH3 2  TRP K 267 ? ARG K 268 ? TRP N 268 ARG N 269 
AH4 1  LYS K 310 ? VAL K 312 ? LYS N 311 VAL N 313 
AH4 2  ILE K 332 ? SER K 334 ? ILE N 333 SER N 335 
AH4 3  ARG K 348 ? ALA K 349 ? ARG N 349 ALA N 350 
AH4 4  LYS K 365 ? ILE K 366 ? LYS N 366 ILE N 367 
AH4 5  VAL K 382 ? ILE K 383 ? VAL N 383 ILE N 384 
AH5 1  SER K 321 ? VAL K 323 ? SER N 322 VAL N 324 
AH5 2  ALA K 337 ? ASN K 339 ? ALA N 338 ASN N 340 
AH5 3  ARG K 354 ? VAL K 360 ? ARG N 355 VAL N 361 
AH5 4  GLN K 371 ? ILE K 377 ? GLN N 372 ILE N 378 
AH5 5  ILE K 388 ? VAL K 389 ? ILE N 389 VAL N 390 
AH6 1  VAL K 326 ? VAL K 327 ? VAL N 327 VAL N 328 
AH6 2  LEU K 342 ? LEU K 343 ? LEU N 343 LEU N 344 
AH6 3  ARG K 354 ? VAL K 360 ? ARG N 355 VAL N 361 
AH6 4  GLN K 371 ? ILE K 377 ? GLN N 372 ILE N 378 
AH6 5  CYS K 408 ? ILE K 410 ? CYS N 409 ILE N 411 
AH6 6  ARG K 401 ? ARG K 402 ? ARG N 402 ARG N 403 
AH7 1  SER L 91  ? PRO L 96  ? SER O 92  PRO O 97  
AH7 2  ARG L 61  ? THR L 66  ? ARG O 62  THR O 67  
AH7 3  ALA L 13  ? ALA L 19  ? ALA O 14  ALA O 20  
AH7 4  TYR L 128 ? ALA L 133 ? TYR O 129 ALA O 134 
AH7 5  PHE L 201 ? HIS L 212 ? PHE O 202 HIS O 213 
AH7 6  GLY L 172 ? VAL L 176 ? GLY O 173 VAL O 177 
AH7 7  ILE L 182 ? GLU L 187 ? ILE O 183 GLU O 188 
AH8 1  SER L 91  ? PRO L 96  ? SER O 92  PRO O 97  
AH8 2  ARG L 61  ? THR L 66  ? ARG O 62  THR O 67  
AH8 3  ALA L 13  ? ALA L 19  ? ALA O 14  ALA O 20  
AH8 4  TYR L 128 ? ALA L 133 ? TYR O 129 ALA O 134 
AH8 5  PHE L 201 ? HIS L 212 ? PHE O 202 HIS O 213 
AH8 6  VAL L 156 ? PRO L 164 ? VAL O 157 PRO O 165 
AH8 7  ALA L 247 ? ARG L 251 ? ALA O 248 ARG O 252 
AH9 1  TYR L 39  ? PHE L 40  ? TYR O 40  PHE O 41  
AH9 2  ALA L 44  ? ARG L 45  ? ALA O 45  ARG O 46  
AI1 1  ILE L 137 ? TYR L 138 ? ILE O 138 TYR O 139 
AI1 2  TRP L 267 ? ARG L 268 ? TRP O 268 ARG O 269 
AI2 1  LYS L 310 ? VAL L 312 ? LYS O 311 VAL O 313 
AI2 2  ILE L 332 ? SER L 334 ? ILE O 333 SER O 335 
AI2 3  ARG L 348 ? ALA L 349 ? ARG O 349 ALA O 350 
AI2 4  LYS L 365 ? ILE L 366 ? LYS O 366 ILE O 367 
AI2 5  VAL L 382 ? ILE L 383 ? VAL O 383 ILE O 384 
AI3 1  SER L 321 ? VAL L 323 ? SER O 322 VAL O 324 
AI3 2  ALA L 337 ? ASN L 339 ? ALA O 338 ASN O 340 
AI3 3  ARG L 354 ? VAL L 360 ? ARG O 355 VAL O 361 
AI3 4  GLN L 371 ? ILE L 377 ? GLN O 372 ILE O 378 
AI3 5  ILE L 388 ? VAL L 389 ? ILE O 389 VAL O 390 
AI4 1  VAL L 326 ? VAL L 327 ? VAL O 327 VAL O 328 
AI4 2  LEU L 342 ? LEU L 343 ? LEU O 343 LEU O 344 
AI4 3  ARG L 354 ? VAL L 360 ? ARG O 355 VAL O 361 
AI4 4  GLN L 371 ? ILE L 377 ? GLN O 372 ILE O 378 
AI4 5  CYS L 408 ? ILE L 410 ? CYS O 409 ILE O 411 
AI4 6  ARG L 401 ? ARG L 402 ? ARG O 402 ARG O 403 
AI5 1  SER M 91  ? LEU M 95  ? SER P 92  LEU P 96  
AI5 2  ARG M 61  ? ALA M 65  ? ARG P 62  ALA P 66  
AI5 3  ALA M 13  ? LEU M 18  ? ALA P 14  LEU P 19  
AI5 4  TYR M 128 ? ALA M 133 ? TYR P 129 ALA P 134 
AI5 5  PHE M 201 ? HIS M 212 ? PHE P 202 HIS P 213 
AI5 6  GLY M 172 ? VAL M 176 ? GLY P 173 VAL P 177 
AI5 7  ILE M 182 ? GLU M 187 ? ILE P 183 GLU P 188 
AI6 1  SER M 91  ? LEU M 95  ? SER P 92  LEU P 96  
AI6 2  ARG M 61  ? ALA M 65  ? ARG P 62  ALA P 66  
AI6 3  ALA M 13  ? LEU M 18  ? ALA P 14  LEU P 19  
AI6 4  TYR M 128 ? ALA M 133 ? TYR P 129 ALA P 134 
AI6 5  PHE M 201 ? HIS M 212 ? PHE P 202 HIS P 213 
AI6 6  VAL M 156 ? PRO M 164 ? VAL P 157 PRO P 165 
AI6 7  ALA M 247 ? ARG M 251 ? ALA P 248 ARG P 252 
AI7 1  TYR M 39  ? PHE M 40  ? TYR P 40  PHE P 41  
AI7 2  ALA M 44  ? ARG M 45  ? ALA P 45  ARG P 46  
AI8 1  ILE M 137 ? TYR M 138 ? ILE P 138 TYR P 139 
AI8 2  TRP M 267 ? ARG M 268 ? TRP P 268 ARG P 269 
AI9 1  SER N 91  ? LEU N 95  ? SER Q 92  LEU Q 96  
AI9 2  ARG N 61  ? THR N 66  ? ARG Q 62  THR Q 67  
AI9 3  ALA N 13  ? ALA N 19  ? ALA Q 14  ALA Q 20  
AI9 4  TYR N 128 ? ALA N 133 ? TYR Q 129 ALA Q 134 
AI9 5  PHE N 201 ? HIS N 212 ? PHE Q 202 HIS Q 213 
AI9 6  GLY N 172 ? VAL N 176 ? GLY Q 173 VAL Q 177 
AI9 7  ILE N 182 ? GLU N 187 ? ILE Q 183 GLU Q 188 
AJ1 1  SER N 91  ? LEU N 95  ? SER Q 92  LEU Q 96  
AJ1 2  ARG N 61  ? THR N 66  ? ARG Q 62  THR Q 67  
AJ1 3  ALA N 13  ? ALA N 19  ? ALA Q 14  ALA Q 20  
AJ1 4  TYR N 128 ? ALA N 133 ? TYR Q 129 ALA Q 134 
AJ1 5  PHE N 201 ? HIS N 212 ? PHE Q 202 HIS Q 213 
AJ1 6  VAL N 156 ? PRO N 164 ? VAL Q 157 PRO Q 165 
AJ1 7  ALA N 247 ? ARG N 251 ? ALA Q 248 ARG Q 252 
AJ2 1  TYR N 39  ? PHE N 40  ? TYR Q 40  PHE Q 41  
AJ2 2  ALA N 44  ? ARG N 45  ? ALA Q 45  ARG Q 46  
AJ3 1  ILE N 137 ? TYR N 138 ? ILE Q 138 TYR Q 139 
AJ3 2  TRP N 267 ? ARG N 268 ? TRP Q 268 ARG Q 269 
AJ4 1  VAL N 382 ? ILE N 383 ? VAL Q 383 ILE Q 384 
AJ4 2  LYS N 365 ? ILE N 366 ? LYS Q 366 ILE Q 367 
AJ4 3  ARG N 348 ? ALA N 349 ? ARG Q 349 ALA Q 350 
AJ4 4  ILE N 332 ? SER N 334 ? ILE Q 333 SER Q 335 
AJ4 5  ALA N 309 ? VAL N 312 ? ALA Q 310 VAL Q 313 
AJ4 6  SER P 325 ? VAL P 327 ? SER F 326 VAL F 328 
AJ4 7  LEU P 342 ? LEU P 343 ? LEU F 343 LEU F 344 
AJ4 8  ARG P 354 ? VAL P 360 ? ARG F 355 VAL F 361 
AJ4 9  GLN P 371 ? ILE P 377 ? GLN F 372 ILE F 378 
AJ4 10 ILE P 388 ? VAL P 389 ? ILE F 389 VAL F 390 
AJ5 1  SER P 321 ? VAL P 323 ? SER F 322 VAL F 324 
AJ5 2  ALA P 337 ? ASN P 339 ? ALA F 338 ASN F 340 
AJ5 3  ARG P 354 ? VAL P 360 ? ARG F 355 VAL F 361 
AJ5 4  GLN P 371 ? ILE P 377 ? GLN F 372 ILE F 378 
AJ5 5  CYS P 408 ? ILE P 410 ? CYS F 409 ILE F 411 
AJ5 6  ARG P 401 ? ARG P 402 ? ARG F 402 ARG F 403 
AJ6 1  SER N 321 ? VAL N 323 ? SER Q 322 VAL Q 324 
AJ6 2  ALA N 337 ? ASN N 339 ? ALA Q 338 ASN Q 340 
AJ6 3  ARG N 354 ? VAL N 360 ? ARG Q 355 VAL Q 361 
AJ6 4  GLN N 371 ? ILE N 377 ? GLN Q 372 ILE Q 378 
AJ6 5  CYS N 408 ? ILE N 410 ? CYS Q 409 ILE Q 411 
AJ6 6  ARG N 401 ? ARG N 402 ? ARG Q 402 ARG Q 403 
AJ7 1  ILE N 388 ? VAL N 389 ? ILE Q 389 VAL Q 390 
AJ7 2  GLN N 371 ? ILE N 377 ? GLN Q 372 ILE Q 378 
AJ7 3  ARG N 354 ? VAL N 360 ? ARG Q 355 VAL Q 361 
AJ7 4  LEU N 342 ? LEU N 343 ? LEU Q 343 LEU Q 344 
AJ7 5  SER N 325 ? VAL N 327 ? SER Q 326 VAL Q 328 
AJ7 6  ALA P 309 ? VAL P 312 ? ALA F 310 VAL F 313 
AJ7 7  ILE P 332 ? SER P 334 ? ILE F 333 SER F 335 
AJ7 8  ARG P 348 ? ALA P 349 ? ARG F 349 ALA F 350 
AJ7 9  LYS P 365 ? ILE P 366 ? LYS F 366 ILE F 367 
AJ7 10 VAL P 382 ? ILE P 383 ? VAL F 383 ILE F 384 
AJ8 1  SER O 91  ? LEU O 95  ? SER R 92  LEU R 96  
AJ8 2  ARG O 61  ? ALA O 65  ? ARG R 62  ALA R 66  
AJ8 3  ALA O 13  ? LEU O 18  ? ALA R 14  LEU R 19  
AJ8 4  TYR O 128 ? ALA O 133 ? TYR R 129 ALA R 134 
AJ8 5  PHE O 201 ? HIS O 212 ? PHE R 202 HIS R 213 
AJ8 6  GLY O 172 ? VAL O 176 ? GLY R 173 VAL R 177 
AJ8 7  ILE O 182 ? GLU O 187 ? ILE R 183 GLU R 188 
AJ9 1  SER O 91  ? LEU O 95  ? SER R 92  LEU R 96  
AJ9 2  ARG O 61  ? ALA O 65  ? ARG R 62  ALA R 66  
AJ9 3  ALA O 13  ? LEU O 18  ? ALA R 14  LEU R 19  
AJ9 4  TYR O 128 ? ALA O 133 ? TYR R 129 ALA R 134 
AJ9 5  PHE O 201 ? HIS O 212 ? PHE R 202 HIS R 213 
AJ9 6  VAL O 156 ? PRO O 164 ? VAL R 157 PRO R 165 
AJ9 7  ALA O 247 ? ARG O 251 ? ALA R 248 ARG R 252 
AK1 1  ILE O 137 ? TYR O 138 ? ILE R 138 TYR R 139 
AK1 2  TRP O 267 ? ARG O 268 ? TRP R 268 ARG R 269 
AK2 1  LYS O 310 ? VAL O 312 ? LYS R 311 VAL R 313 
AK2 2  ILE O 332 ? SER O 334 ? ILE R 333 SER R 335 
AK2 3  ARG O 348 ? ALA O 349 ? ARG R 349 ALA R 350 
AK2 4  LYS O 365 ? ILE O 366 ? LYS R 366 ILE R 367 
AK2 5  VAL O 382 ? ILE O 383 ? VAL R 383 ILE R 384 
AK3 1  SER O 321 ? VAL O 323 ? SER R 322 VAL R 324 
AK3 2  ALA O 337 ? ASN O 339 ? ALA R 338 ASN R 340 
AK3 3  ARG O 354 ? VAL O 360 ? ARG R 355 VAL R 361 
AK3 4  GLN O 371 ? ILE O 377 ? GLN R 372 ILE R 378 
AK3 5  ILE O 388 ? VAL O 389 ? ILE R 389 VAL R 390 
AK4 1  VAL O 326 ? VAL O 327 ? VAL R 327 VAL R 328 
AK4 2  LEU O 342 ? LEU O 343 ? LEU R 343 LEU R 344 
AK4 3  ARG O 354 ? VAL O 360 ? ARG R 355 VAL R 361 
AK4 4  GLN O 371 ? ILE O 377 ? GLN R 372 ILE R 378 
AK4 5  CYS O 408 ? ILE O 410 ? CYS R 409 ILE R 411 
AK4 6  ARG O 401 ? ARG O 402 ? ARG R 402 ARG R 403 
AK5 1  SER P 91  ? LEU P 95  ? SER F 92  LEU F 96  
AK5 2  ARG P 61  ? THR P 66  ? ARG F 62  THR F 67  
AK5 3  ALA P 13  ? ALA P 19  ? ALA F 14  ALA F 20  
AK5 4  TYR P 128 ? ALA P 133 ? TYR F 129 ALA F 134 
AK5 5  PHE P 201 ? HIS P 212 ? PHE F 202 HIS F 213 
AK5 6  GLY P 172 ? VAL P 176 ? GLY F 173 VAL F 177 
AK5 7  ILE P 182 ? GLU P 187 ? ILE F 183 GLU F 188 
AK6 1  SER P 91  ? LEU P 95  ? SER F 92  LEU F 96  
AK6 2  ARG P 61  ? THR P 66  ? ARG F 62  THR F 67  
AK6 3  ALA P 13  ? ALA P 19  ? ALA F 14  ALA F 20  
AK6 4  TYR P 128 ? ALA P 133 ? TYR F 129 ALA F 134 
AK6 5  PHE P 201 ? HIS P 212 ? PHE F 202 HIS F 213 
AK6 6  VAL P 156 ? PRO P 164 ? VAL F 157 PRO F 165 
AK6 7  ALA P 247 ? ARG P 251 ? ALA F 248 ARG F 252 
AK7 1  TYR P 39  ? PHE P 40  ? TYR F 40  PHE F 41  
AK7 2  ALA P 44  ? ARG P 45  ? ALA F 45  ARG F 46  
AK8 1  ILE P 137 ? TYR P 138 ? ILE F 138 TYR F 139 
AK8 2  TRP P 267 ? ARG P 268 ? TRP F 268 ARG F 269 
AK9 1  SER Q 91  ? PRO Q 96  ? SER G 92  PRO G 97  
AK9 2  ARG Q 61  ? THR Q 66  ? ARG G 62  THR G 67  
AK9 3  ALA Q 13  ? LEU Q 18  ? ALA G 14  LEU G 19  
AK9 4  TYR Q 128 ? ALA Q 133 ? TYR G 129 ALA G 134 
AK9 5  PHE Q 201 ? HIS Q 212 ? PHE G 202 HIS G 213 
AK9 6  GLY Q 172 ? VAL Q 176 ? GLY G 173 VAL G 177 
AK9 7  ILE Q 182 ? GLU Q 187 ? ILE G 183 GLU G 188 
AL1 1  SER Q 91  ? PRO Q 96  ? SER G 92  PRO G 97  
AL1 2  ARG Q 61  ? THR Q 66  ? ARG G 62  THR G 67  
AL1 3  ALA Q 13  ? LEU Q 18  ? ALA G 14  LEU G 19  
AL1 4  TYR Q 128 ? ALA Q 133 ? TYR G 129 ALA G 134 
AL1 5  PHE Q 201 ? HIS Q 212 ? PHE G 202 HIS G 213 
AL1 6  VAL Q 156 ? PRO Q 164 ? VAL G 157 PRO G 165 
AL1 7  ALA Q 247 ? ARG Q 251 ? ALA G 248 ARG G 252 
AL2 1  TYR Q 39  ? PHE Q 40  ? TYR G 40  PHE G 41  
AL2 2  ALA Q 44  ? ARG Q 45  ? ALA G 45  ARG G 46  
AL3 1  ILE Q 137 ? TYR Q 138 ? ILE G 138 TYR G 139 
AL3 2  TRP Q 267 ? ARG Q 268 ? TRP G 268 ARG G 269 
AL4 1  SER R 91  ? LEU R 95  ? SER M 92  LEU M 96  
AL4 2  ARG R 61  ? THR R 66  ? ARG M 62  THR M 67  
AL4 3  ALA R 13  ? ALA R 19  ? ALA M 14  ALA M 20  
AL4 4  TYR R 128 ? ALA R 133 ? TYR M 129 ALA M 134 
AL4 5  PHE R 201 ? HIS R 212 ? PHE M 202 HIS M 213 
AL4 6  GLY R 172 ? VAL R 176 ? GLY M 173 VAL M 177 
AL4 7  ILE R 182 ? GLU R 187 ? ILE M 183 GLU M 188 
AL5 1  SER R 91  ? LEU R 95  ? SER M 92  LEU M 96  
AL5 2  ARG R 61  ? THR R 66  ? ARG M 62  THR M 67  
AL5 3  ALA R 13  ? ALA R 19  ? ALA M 14  ALA M 20  
AL5 4  TYR R 128 ? ALA R 133 ? TYR M 129 ALA M 134 
AL5 5  PHE R 201 ? HIS R 212 ? PHE M 202 HIS M 213 
AL5 6  VAL R 156 ? PRO R 164 ? VAL M 157 PRO M 165 
AL5 7  ALA R 247 ? ARG R 251 ? ALA M 248 ARG M 252 
AL6 1  TYR R 39  ? PHE R 40  ? TYR M 40  PHE M 41  
AL6 2  ALA R 44  ? ARG R 45  ? ALA M 45  ARG M 46  
AL7 1  ILE R 137 ? TYR R 138 ? ILE M 138 TYR M 139 
AL7 2  TRP R 267 ? ARG R 268 ? TRP M 268 ARG M 269 
AL8 1  SER S 91  ? PRO S 96  ? SER T 92  PRO T 97  
AL8 2  ARG S 61  ? THR S 66  ? ARG T 62  THR T 67  
AL8 3  ALA S 13  ? ALA S 19  ? ALA T 14  ALA T 20  
AL8 4  TYR S 128 ? ALA S 133 ? TYR T 129 ALA T 134 
AL8 5  PHE S 201 ? HIS S 212 ? PHE T 202 HIS T 213 
AL8 6  VAL S 156 ? PRO S 164 ? VAL T 157 PRO T 165 
AL8 7  ALA S 247 ? ARG S 251 ? ALA T 248 ARG T 252 
AL9 1  ILE S 137 ? TYR S 138 ? ILE T 138 TYR T 139 
AL9 2  TRP S 267 ? ARG S 268 ? TRP T 268 ARG T 269 
AM1 1  GLY S 172 ? VAL S 176 ? GLY T 173 VAL T 177 
AM1 2  ILE S 182 ? GLU S 187 ? ILE T 183 GLU T 188 
AM2 1  VAL S 382 ? ILE S 383 ? VAL T 383 ILE T 384 
AM2 2  LYS S 365 ? ILE S 366 ? LYS T 366 ILE T 367 
AM2 3  ARG S 348 ? ALA S 349 ? ARG T 349 ALA T 350 
AM2 4  ILE S 332 ? SER S 334 ? ILE T 333 SER T 335 
AM2 5  ALA S 309 ? VAL S 312 ? ALA T 310 VAL T 313 
AM2 6  SER T 325 ? VAL T 327 ? SER U 326 VAL U 328 
AM2 7  LEU T 342 ? LEU T 343 ? LEU U 343 LEU U 344 
AM2 8  ARG T 354 ? VAL T 360 ? ARG U 355 VAL U 361 
AM2 9  GLN T 371 ? ILE T 377 ? GLN U 372 ILE U 378 
AM2 10 ILE T 388 ? VAL T 389 ? ILE U 389 VAL U 390 
AM3 1  SER T 321 ? VAL T 323 ? SER U 322 VAL U 324 
AM3 2  ALA T 337 ? ASN T 339 ? ALA U 338 ASN U 340 
AM3 3  ARG T 354 ? VAL T 360 ? ARG U 355 VAL U 361 
AM3 4  GLN T 371 ? ILE T 377 ? GLN U 372 ILE U 378 
AM3 5  CYS T 408 ? ILE T 410 ? CYS U 409 ILE U 411 
AM3 6  ARG T 401 ? ARG T 402 ? ARG U 402 ARG U 403 
AM4 1  SER S 321 ? VAL S 323 ? SER T 322 VAL T 324 
AM4 2  ALA S 337 ? ASN S 339 ? ALA T 338 ASN T 340 
AM4 3  ARG S 354 ? VAL S 360 ? ARG T 355 VAL T 361 
AM4 4  GLN S 371 ? ILE S 377 ? GLN T 372 ILE T 378 
AM4 5  CYS S 408 ? ILE S 410 ? CYS T 409 ILE T 411 
AM4 6  ARG S 401 ? ARG S 402 ? ARG T 402 ARG T 403 
AM5 1  ILE S 388 ? VAL S 389 ? ILE T 389 VAL T 390 
AM5 2  GLN S 371 ? ILE S 377 ? GLN T 372 ILE T 378 
AM5 3  ARG S 354 ? VAL S 360 ? ARG T 355 VAL T 361 
AM5 4  LEU S 342 ? LEU S 343 ? LEU T 343 LEU T 344 
AM5 5  VAL S 326 ? VAL S 327 ? VAL T 327 VAL T 328 
AM5 6  ALA T 309 ? VAL T 312 ? ALA U 310 VAL U 313 
AM5 7  ILE T 332 ? SER T 334 ? ILE U 333 SER U 335 
AM5 8  ARG T 348 ? ALA T 349 ? ARG U 349 ALA U 350 
AM5 9  LYS T 365 ? ILE T 366 ? LYS U 366 ILE U 367 
AM5 10 VAL T 382 ? ILE T 383 ? VAL U 383 ILE U 384 
AM6 1  SER T 91  ? PRO T 96  ? SER U 92  PRO U 97  
AM6 2  ARG T 61  ? THR T 66  ? ARG U 62  THR U 67  
AM6 3  ALA T 13  ? LEU T 18  ? ALA U 14  LEU U 19  
AM6 4  TYR T 128 ? ALA T 133 ? TYR U 129 ALA U 134 
AM6 5  PHE T 201 ? HIS T 212 ? PHE U 202 HIS U 213 
AM6 6  GLY T 172 ? VAL T 176 ? GLY U 173 VAL U 177 
AM6 7  ILE T 182 ? GLU T 187 ? ILE U 183 GLU U 188 
AM7 1  SER T 91  ? PRO T 96  ? SER U 92  PRO U 97  
AM7 2  ARG T 61  ? THR T 66  ? ARG U 62  THR U 67  
AM7 3  ALA T 13  ? LEU T 18  ? ALA U 14  LEU U 19  
AM7 4  TYR T 128 ? ALA T 133 ? TYR U 129 ALA U 134 
AM7 5  PHE T 201 ? HIS T 212 ? PHE U 202 HIS U 213 
AM7 6  VAL T 156 ? PRO T 164 ? VAL U 157 PRO U 165 
AM7 7  ALA T 247 ? ARG T 251 ? ALA U 248 ARG U 252 
AM8 1  TYR T 39  ? PHE T 40  ? TYR U 40  PHE U 41  
AM8 2  ALA T 44  ? ARG T 45  ? ALA U 45  ARG U 46  
AM9 1  ILE T 137 ? TYR T 138 ? ILE U 138 TYR U 139 
AM9 2  TRP T 267 ? ARG T 268 ? TRP U 268 ARG U 269 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  O SER A 91  ? O SER A 92  N ILE A 62  ? N ILE A 63  
AA1 2 3  O GLY A 63  ? O GLY A 64  N VAL A 17  ? N VAL A 18  
AA1 3 4  N LEU A 18  ? N LEU A 19  O LEU A 132 ? O LEU A 133 
AA1 4 5  N ILE A 131 ? N ILE A 132 O TYR A 209 ? O TYR A 210 
AA1 5 6  O SER A 205 ? O SER A 206 N GLY A 172 ? N GLY A 173 
AA1 6 7  N HIS A 175 ? N HIS A 176 O ILE A 183 ? O ILE A 184 
AA2 1 2  O SER A 91  ? O SER A 92  N ILE A 62  ? N ILE A 63  
AA2 2 3  O GLY A 63  ? O GLY A 64  N VAL A 17  ? N VAL A 18  
AA2 3 4  N LEU A 18  ? N LEU A 19  O LEU A 132 ? O LEU A 133 
AA2 4 5  N ILE A 131 ? N ILE A 132 O TYR A 209 ? O TYR A 210 
AA2 5 6  O ALA A 202 ? O ALA A 203 N VAL A 163 ? N VAL A 164 
AA2 6 7  N ILE A 158 ? N ILE A 159 O HIS A 250 ? O HIS A 251 
AA3 1 2  N PHE A 40  ? N PHE A 41  O ALA A 44  ? O ALA A 45  
AA4 1 2  N ILE A 137 ? N ILE A 138 O ARG A 268 ? O ARG A 269 
AA5 1 2  O ILE A 383 ? O ILE A 384 N LYS A 365 ? N LYS A 366 
AA5 2 3  O ILE A 366 ? O ILE A 367 N ARG A 348 ? N ARG A 349 
AA5 3 4  O ALA A 349 ? O ALA A 350 N SER A 334 ? N SER A 335 
AA5 4 5  O ILE A 333 ? O ILE A 334 N LYS A 310 ? N LYS A 311 
AA5 5 6  N PHE A 311 ? N PHE A 312 O SER M 325 ? O SER P 326 
AA5 6 7  N VAL M 326 ? N VAL P 327 O LEU M 343 ? O LEU P 344 
AA5 7 8  N LEU M 342 ? N LEU P 343 O VAL M 360 ? O VAL P 361 
AA5 8 9  N VAL M 359 ? N VAL P 360 O VAL M 375 ? O VAL P 376 
AA5 9 10 N GLN M 371 ? N GLN P 372 O VAL M 389 ? O VAL P 390 
AA6 1 2  N SER M 321 ? N SER P 322 O LEU M 338 ? O LEU P 339 
AA6 2 3  N ALA M 337 ? N ALA P 338 O LEU M 355 ? O LEU P 356 
AA6 3 4  N VAL M 359 ? N VAL P 360 O VAL M 375 ? O VAL P 376 
AA6 4 5  N VAL M 376 ? N VAL P 377 O CYS M 408 ? O CYS P 409 
AA6 5 6  O LEU M 409 ? O LEU P 410 N ARG M 401 ? N ARG P 402 
AA7 1 2  N VAL A 323 ? N VAL A 324 O LEU A 338 ? O LEU A 339 
AA7 2 3  N ALA A 337 ? N ALA A 338 O LEU A 355 ? O LEU A 356 
AA7 3 4  N VAL A 359 ? N VAL A 360 O ILE A 377 ? O ILE A 378 
AA7 4 5  N VAL A 376 ? N VAL A 377 O ILE A 410 ? O ILE A 411 
AA7 5 6  O LEU A 409 ? O LEU A 410 N ARG A 401 ? N ARG A 402 
AA8 1 2  O VAL A 389 ? O VAL A 390 N GLN A 371 ? N GLN A 372 
AA8 2 3  O ILE A 377 ? O ILE A 378 N VAL A 359 ? N VAL A 360 
AA8 3 4  O VAL A 360 ? O VAL A 361 N LEU A 342 ? N LEU A 343 
AA8 4 5  O LEU A 343 ? O LEU A 344 N VAL A 326 ? N VAL A 327 
AA8 5 6  N SER A 325 ? N SER A 326 O PHE M 311 ? O PHE P 312 
AA8 6 7  N LYS M 310 ? N LYS P 311 O ILE M 333 ? O ILE P 334 
AA8 7 8  N SER M 334 ? N SER P 335 O ALA M 349 ? O ALA P 350 
AA8 8 9  N ARG M 348 ? N ARG P 349 O ILE M 366 ? O ILE P 367 
AA8 9 10 N LYS M 365 ? N LYS P 366 O ILE M 383 ? O ILE P 384 
AA9 1 2  O LEU B 95  ? O LEU B 96  N VAL B 64  ? N VAL B 65  
AA9 2 3  O GLY B 63  ? O GLY B 64  N VAL B 17  ? N VAL B 18  
AA9 3 4  N LEU B 18  ? N LEU B 19  O LEU B 132 ? O LEU B 133 
AA9 4 5  N ILE B 131 ? N ILE B 132 O TYR B 209 ? O TYR B 210 
AA9 5 6  O SER B 205 ? O SER B 206 N GLY B 172 ? N GLY B 173 
AA9 6 7  N VAL B 173 ? N VAL B 174 O ILE B 186 ? O ILE B 187 
AB1 1 2  O LEU B 95  ? O LEU B 96  N VAL B 64  ? N VAL B 65  
AB1 2 3  O GLY B 63  ? O GLY B 64  N VAL B 17  ? N VAL B 18  
AB1 3 4  N LEU B 18  ? N LEU B 19  O LEU B 132 ? O LEU B 133 
AB1 4 5  N ILE B 131 ? N ILE B 132 O TYR B 209 ? O TYR B 210 
AB1 5 6  O ALA B 204 ? O ALA B 205 N LEU B 161 ? N LEU B 162 
AB1 6 7  N ILE B 158 ? N ILE B 159 O HIS B 250 ? O HIS B 251 
AB2 1 2  N ILE B 137 ? N ILE B 138 O ARG B 268 ? O ARG B 269 
AB3 1 2  O ILE B 383 ? O ILE B 384 N LYS B 365 ? N LYS B 366 
AB3 2 3  O ILE B 366 ? O ILE B 367 N ARG B 348 ? N ARG B 349 
AB3 3 4  O ALA B 349 ? O ALA B 350 N SER B 334 ? N SER B 335 
AB3 4 5  O ILE B 333 ? O ILE B 334 N LYS B 310 ? N LYS B 311 
AB3 5 6  N ALA B 309 ? N ALA B 310 O VAL I 327 ? O VAL K 328 
AB3 6 7  N VAL I 326 ? N VAL K 327 O LEU I 343 ? O LEU K 344 
AB3 7 8  N LEU I 342 ? N LEU K 343 O VAL I 360 ? O VAL K 361 
AB3 8 9  N VAL I 359 ? N VAL K 360 O ILE I 377 ? O ILE K 378 
AB3 9 10 N GLN I 371 ? N GLN K 372 O VAL I 389 ? O VAL K 390 
AB4 1 2  N SER I 321 ? N SER K 322 O LEU I 338 ? O LEU K 339 
AB4 2 3  N ALA I 337 ? N ALA K 338 O LEU I 355 ? O LEU K 356 
AB4 3 4  N VAL I 359 ? N VAL K 360 O ILE I 377 ? O ILE K 378 
AB4 4 5  N VAL I 376 ? N VAL K 377 O ILE I 410 ? O ILE K 411 
AB4 5 6  O LEU I 409 ? O LEU K 410 N ARG I 401 ? N ARG K 402 
AB5 1 2  N VAL B 323 ? N VAL B 324 O LEU B 338 ? O LEU B 339 
AB5 2 3  N LEU B 342 ? N LEU B 343 O VAL B 360 ? O VAL B 361 
AB5 3 4  N VAL B 359 ? N VAL B 360 O ILE B 377 ? O ILE B 378 
AB5 4 5  N VAL B 376 ? N VAL B 377 O CYS B 408 ? O CYS B 409 
AB5 5 6  O LEU B 409 ? O LEU B 410 N ARG B 401 ? N ARG B 402 
AB6 1 2  O VAL B 389 ? O VAL B 390 N GLN B 371 ? N GLN B 372 
AB6 2 3  O ILE B 377 ? O ILE B 378 N VAL B 359 ? N VAL B 360 
AB6 3 4  O VAL B 360 ? O VAL B 361 N LEU B 342 ? N LEU B 343 
AB6 4 5  O LEU B 343 ? O LEU B 344 N VAL B 326 ? N VAL B 327 
AB6 5 6  N VAL B 327 ? N VAL B 328 O ALA I 309 ? O ALA K 310 
AB6 6 7  N LYS I 310 ? N LYS K 311 O ILE I 333 ? O ILE K 334 
AB6 7 8  N SER I 334 ? N SER K 335 O ALA I 349 ? O ALA K 350 
AB6 8 9  N ARG I 348 ? N ARG K 349 O ILE I 366 ? O ILE K 367 
AB6 9 10 N LYS I 365 ? N LYS K 366 O ILE I 383 ? O ILE K 384 
AB7 1 2  O LEU C 95  ? O LEU C 96  N VAL C 64  ? N VAL C 65  
AB7 2 3  O GLY C 63  ? O GLY C 64  N VAL C 17  ? N VAL C 18  
AB7 3 4  N TYR C 16  ? N TYR C 17  O VAL C 130 ? O VAL C 131 
AB7 4 5  N ILE C 131 ? N ILE C 132 O TYR C 209 ? O TYR C 210 
AB7 5 6  O SER C 205 ? O SER C 206 N GLY C 172 ? N GLY C 173 
AB7 6 7  N VAL C 173 ? N VAL C 174 O ILE C 186 ? O ILE C 187 
AB8 1 2  O LEU C 95  ? O LEU C 96  N VAL C 64  ? N VAL C 65  
AB8 2 3  O GLY C 63  ? O GLY C 64  N VAL C 17  ? N VAL C 18  
AB8 3 4  N TYR C 16  ? N TYR C 17  O VAL C 130 ? O VAL C 131 
AB8 4 5  N ILE C 131 ? N ILE C 132 O TYR C 209 ? O TYR C 210 
AB8 5 6  O ALA C 202 ? O ALA C 203 N VAL C 163 ? N VAL C 164 
AB8 6 7  N CYS C 160 ? N CYS C 161 O HIS C 250 ? O HIS C 251 
AB9 1 2  N ILE C 137 ? N ILE C 138 O ARG C 268 ? O ARG C 269 
AC1 1 2  O ILE C 383 ? O ILE C 384 N LYS C 365 ? N LYS C 366 
AC1 2 3  O ILE C 366 ? O ILE C 367 N ARG C 348 ? N ARG C 349 
AC1 3 4  O ALA C 349 ? O ALA C 350 N ILE C 332 ? N ILE C 333 
AC1 4 5  O ILE C 333 ? O ILE C 334 N LYS C 310 ? N LYS C 311 
AC1 5 6  N PHE C 311 ? N PHE C 312 O SER G 325 ? O SER I 326 
AC1 6 7  N VAL G 326 ? N VAL I 327 O LEU G 343 ? O LEU I 344 
AC1 7 8  N LEU G 342 ? N LEU I 343 O VAL G 360 ? O VAL I 361 
AC1 8 9  N VAL G 359 ? N VAL I 360 O ILE G 377 ? O ILE I 378 
AC1 9 10 N GLN G 371 ? N GLN I 372 O VAL G 389 ? O VAL I 390 
AC2 1 2  N SER G 321 ? N SER I 322 O LEU G 338 ? O LEU I 339 
AC2 2 3  N ALA G 337 ? N ALA I 338 O LEU G 355 ? O LEU I 356 
AC2 3 4  N VAL G 359 ? N VAL I 360 O ILE G 377 ? O ILE I 378 
AC2 4 5  N VAL G 376 ? N VAL I 377 O ILE G 410 ? O ILE I 411 
AC2 5 6  O LEU G 409 ? O LEU I 410 N ARG G 401 ? N ARG I 402 
AC3 1 2  N SER C 321 ? N SER C 322 O LEU C 338 ? O LEU C 339 
AC3 2 3  N ASN C 339 ? N ASN C 340 O LEU C 355 ? O LEU C 356 
AC3 3 4  N VAL C 359 ? N VAL C 360 O ILE C 377 ? O ILE C 378 
AC3 4 5  N VAL C 376 ? N VAL C 377 O CYS C 408 ? O CYS C 409 
AC3 5 6  O LEU C 409 ? O LEU C 410 N ARG C 401 ? N ARG C 402 
AC4 1 2  O VAL C 389 ? O VAL C 390 N GLN C 371 ? N GLN C 372 
AC4 2 3  O ILE C 377 ? O ILE C 378 N VAL C 359 ? N VAL C 360 
AC4 3 4  O VAL C 360 ? O VAL C 361 N LEU C 342 ? N LEU C 343 
AC4 4 5  O LEU C 343 ? O LEU C 344 N VAL C 326 ? N VAL C 327 
AC4 5 6  N SER C 325 ? N SER C 326 O PHE G 311 ? O PHE I 312 
AC4 6 7  N LYS G 310 ? N LYS I 311 O ILE G 333 ? O ILE I 334 
AC4 7 8  N SER G 334 ? N SER I 335 O ALA G 349 ? O ALA I 350 
AC4 8 9  N ARG G 348 ? N ARG I 349 O ILE G 366 ? O ILE I 367 
AC4 9 10 N LYS G 365 ? N LYS I 366 O ILE G 383 ? O ILE I 384 
AC5 1 2  O LEU D 95  ? O LEU D 96  N VAL D 64  ? N VAL D 65  
AC5 2 3  O GLY D 63  ? O GLY D 64  N VAL D 17  ? N VAL D 18  
AC5 3 4  N TYR D 16  ? N TYR D 17  O VAL D 130 ? O VAL D 131 
AC5 4 5  N ILE D 131 ? N ILE D 132 O TYR D 209 ? O TYR D 210 
AC5 5 6  O SER D 205 ? O SER D 206 N GLY D 172 ? N GLY D 173 
AC5 6 7  N HIS D 175 ? N HIS D 176 O ASP D 184 ? O ASP D 185 
AC6 1 2  O LEU D 95  ? O LEU D 96  N VAL D 64  ? N VAL D 65  
AC6 2 3  O GLY D 63  ? O GLY D 64  N VAL D 17  ? N VAL D 18  
AC6 3 4  N TYR D 16  ? N TYR D 17  O VAL D 130 ? O VAL D 131 
AC6 4 5  N ILE D 131 ? N ILE D 132 O TYR D 209 ? O TYR D 210 
AC6 5 6  O ALA D 202 ? O ALA D 203 N VAL D 163 ? N VAL D 164 
AC6 6 7  N ILE D 158 ? N ILE D 159 O HIS D 250 ? O HIS D 251 
AC7 1 2  N PHE D 40  ? N PHE D 41  O ALA D 44  ? O ALA D 45  
AC8 1 2  N ILE D 137 ? N ILE D 138 O ARG D 268 ? O ARG D 269 
AC9 1 2  O ILE D 383 ? O ILE D 384 N LYS D 365 ? N LYS D 366 
AC9 2 3  O ILE D 366 ? O ILE D 367 N ARG D 348 ? N ARG D 349 
AC9 3 4  O ALA D 349 ? O ALA D 350 N SER D 334 ? N SER D 335 
AC9 4 5  O ILE D 333 ? O ILE D 334 N LYS D 310 ? N LYS D 311 
AC9 5 6  N PHE D 311 ? N PHE D 312 O SER R 325 ? O SER M 326 
AC9 6 7  N VAL R 326 ? N VAL M 327 O LEU R 343 ? O LEU M 344 
AC9 7 8  N LEU R 342 ? N LEU M 343 O VAL R 360 ? O VAL M 361 
AC9 8 9  N VAL R 359 ? N VAL M 360 O ILE R 377 ? O ILE M 378 
AC9 9 10 N GLN R 371 ? N GLN M 372 O VAL R 389 ? O VAL M 390 
AD1 1 2  N SER R 321 ? N SER M 322 O LEU R 338 ? O LEU M 339 
AD1 2 3  N ALA R 337 ? N ALA M 338 O LEU R 355 ? O LEU M 356 
AD1 3 4  N VAL R 359 ? N VAL M 360 O ILE R 377 ? O ILE M 378 
AD1 4 5  N VAL R 376 ? N VAL M 377 O ILE R 410 ? O ILE M 411 
AD1 5 6  O LEU R 409 ? O LEU M 410 N ARG R 401 ? N ARG M 402 
AD2 1 2  N SER D 321 ? N SER D 322 O LEU D 338 ? O LEU D 339 
AD2 2 3  N ALA D 337 ? N ALA D 338 O LEU D 355 ? O LEU D 356 
AD2 3 4  N VAL D 359 ? N VAL D 360 O ILE D 377 ? O ILE D 378 
AD2 4 5  N VAL D 376 ? N VAL D 377 O CYS D 408 ? O CYS D 409 
AD2 5 6  O LEU D 409 ? O LEU D 410 N ARG D 401 ? N ARG D 402 
AD3 1 2  O VAL D 389 ? O VAL D 390 N GLN D 371 ? N GLN D 372 
AD3 2 3  O ILE D 377 ? O ILE D 378 N VAL D 359 ? N VAL D 360 
AD3 3 4  O VAL D 360 ? O VAL D 361 N LEU D 342 ? N LEU D 343 
AD3 4 5  O LEU D 343 ? O LEU D 344 N VAL D 326 ? N VAL D 327 
AD3 5 6  N SER D 325 ? N SER D 326 O PHE R 311 ? O PHE M 312 
AD3 6 7  N LYS R 310 ? N LYS M 311 O ILE R 333 ? O ILE M 334 
AD3 7 8  N SER R 334 ? N SER M 335 O ALA R 349 ? O ALA M 350 
AD3 8 9  N ARG R 348 ? N ARG M 349 O ILE R 366 ? O ILE M 367 
AD3 9 10 N LYS R 365 ? N LYS M 366 O ILE R 383 ? O ILE M 384 
AD4 1 2  O LEU E 95  ? O LEU E 96  N VAL E 64  ? N VAL E 65  
AD4 2 3  O GLY E 63  ? O GLY E 64  N VAL E 17  ? N VAL E 18  
AD4 3 4  N LEU E 18  ? N LEU E 19  O LEU E 132 ? O LEU E 133 
AD4 4 5  N ILE E 131 ? N ILE E 132 O TYR E 209 ? O TYR E 210 
AD4 5 6  O SER E 205 ? O SER E 206 N GLY E 172 ? N GLY E 173 
AD4 6 7  N VAL E 173 ? N VAL E 174 O ILE E 186 ? O ILE E 187 
AD5 1 2  O LEU E 95  ? O LEU E 96  N VAL E 64  ? N VAL E 65  
AD5 2 3  O GLY E 63  ? O GLY E 64  N VAL E 17  ? N VAL E 18  
AD5 3 4  N LEU E 18  ? N LEU E 19  O LEU E 132 ? O LEU E 133 
AD5 4 5  N ILE E 131 ? N ILE E 132 O TYR E 209 ? O TYR E 210 
AD5 5 6  O VAL E 210 ? O VAL E 211 N THR E 157 ? N THR E 158 
AD5 6 7  N ILE E 158 ? N ILE E 159 O HIS E 250 ? O HIS E 251 
AD6 1 2  N ILE E 137 ? N ILE E 138 O ARG E 268 ? O ARG E 269 
AD7 1 2  N LYS E 310 ? N LYS E 311 O ILE E 333 ? O ILE E 334 
AD7 2 3  N SER E 334 ? N SER E 335 O ALA E 349 ? O ALA E 350 
AD7 3 4  N ARG E 348 ? N ARG E 349 O ILE E 366 ? O ILE E 367 
AD7 4 5  N LYS E 365 ? N LYS E 366 O ILE E 383 ? O ILE E 384 
AD8 1 2  N SER E 321 ? N SER E 322 O LEU E 338 ? O LEU E 339 
AD8 2 3  N ALA E 337 ? N ALA E 338 O LEU E 355 ? O LEU E 356 
AD8 3 4  N VAL E 359 ? N VAL E 360 O ILE E 377 ? O ILE E 378 
AD8 4 5  N GLN E 371 ? N GLN E 372 O VAL E 389 ? O VAL E 390 
AD9 1 2  N VAL E 326 ? N VAL E 327 O LEU E 343 ? O LEU E 344 
AD9 2 3  N LEU E 342 ? N LEU E 343 O VAL E 360 ? O VAL E 361 
AD9 3 4  N VAL E 359 ? N VAL E 360 O ILE E 377 ? O ILE E 378 
AD9 4 5  N VAL E 376 ? N VAL E 377 O ILE E 410 ? O ILE E 411 
AD9 5 6  O LEU E 409 ? O LEU E 410 N ARG E 401 ? N ARG E 402 
AE1 1 2  O LEU F 95  ? O LEU H 96  N VAL F 64  ? N VAL H 65  
AE1 2 3  O GLY F 63  ? O GLY H 64  N VAL F 17  ? N VAL H 18  
AE1 3 4  N LEU F 18  ? N LEU H 19  O LEU F 132 ? O LEU H 133 
AE1 4 5  N ILE F 131 ? N ILE H 132 O TYR F 209 ? O TYR H 210 
AE1 5 6  O LEU F 203 ? O LEU H 204 N MET F 174 ? N MET H 175 
AE1 6 7  N VAL F 173 ? N VAL H 174 O ILE F 186 ? O ILE H 187 
AE2 1 2  O LEU F 95  ? O LEU H 96  N VAL F 64  ? N VAL H 65  
AE2 2 3  O GLY F 63  ? O GLY H 64  N VAL F 17  ? N VAL H 18  
AE2 3 4  N LEU F 18  ? N LEU H 19  O LEU F 132 ? O LEU H 133 
AE2 4 5  N ILE F 131 ? N ILE H 132 O TYR F 209 ? O TYR H 210 
AE2 5 6  O ALA F 204 ? O ALA H 205 N LEU F 161 ? N LEU H 162 
AE2 6 7  N ILE F 158 ? N ILE H 159 O HIS F 250 ? O HIS H 251 
AE3 1 2  N PHE F 40  ? N PHE H 41  O ALA F 44  ? O ALA H 45  
AE4 1 2  N ILE F 137 ? N ILE H 138 O ARG F 268 ? O ARG H 269 
AE5 1 2  O ILE F 383 ? O ILE H 384 N LYS F 365 ? N LYS H 366 
AE5 2 3  O ILE F 366 ? O ILE H 367 N ARG F 348 ? N ARG H 349 
AE5 3 4  O ALA F 349 ? O ALA H 350 N SER F 334 ? N SER H 335 
AE5 4 5  O ILE F 333 ? O ILE H 334 N LYS F 310 ? N LYS H 311 
AE5 5 6  N ALA F 309 ? N ALA H 310 O VAL Q 327 ? O VAL G 328 
AE5 6 7  N VAL Q 326 ? N VAL G 327 O LEU Q 343 ? O LEU G 344 
AE5 7 8  N LEU Q 342 ? N LEU G 343 O VAL Q 360 ? O VAL G 361 
AE5 8 9  N GLU Q 356 ? N GLU G 357 O ASN Q 374 ? O ASN G 375 
AE5 9 10 N GLN Q 371 ? N GLN G 372 O VAL Q 389 ? O VAL G 390 
AE6 1 2  N SER Q 321 ? N SER G 322 O LEU Q 338 ? O LEU G 339 
AE6 2 3  N ALA Q 337 ? N ALA G 338 O LEU Q 355 ? O LEU G 356 
AE6 3 4  N GLU Q 356 ? N GLU G 357 O ASN Q 374 ? O ASN G 375 
AE6 4 5  N VAL Q 376 ? N VAL G 377 O ILE Q 410 ? O ILE G 411 
AE6 5 6  O LEU Q 409 ? O LEU G 410 N ARG Q 401 ? N ARG G 402 
AE7 1 2  N SER F 321 ? N SER H 322 O LEU F 338 ? O LEU H 339 
AE7 2 3  N LEU F 342 ? N LEU H 343 O VAL F 360 ? O VAL H 361 
AE7 3 4  N VAL F 359 ? N VAL H 360 O VAL F 375 ? O VAL H 376 
AE7 4 5  N VAL F 376 ? N VAL H 377 O ILE F 410 ? O ILE H 411 
AE7 5 6  O LEU F 409 ? O LEU H 410 N ARG F 401 ? N ARG H 402 
AE8 1 2  O VAL F 389 ? O VAL H 390 N GLN F 371 ? N GLN H 372 
AE8 2 3  O VAL F 375 ? O VAL H 376 N VAL F 359 ? N VAL H 360 
AE8 3 4  O VAL F 360 ? O VAL H 361 N LEU F 342 ? N LEU H 343 
AE8 4 5  O LEU F 343 ? O LEU H 344 N VAL F 326 ? N VAL H 327 
AE8 5 6  N SER F 325 ? N SER H 326 O PHE Q 311 ? O PHE G 312 
AE8 6 7  N LYS Q 310 ? N LYS G 311 O ILE Q 333 ? O ILE G 334 
AE8 7 8  N SER Q 334 ? N SER G 335 O ALA Q 349 ? O ALA G 350 
AE8 8 9  N ARG Q 348 ? N ARG G 349 O ILE Q 366 ? O ILE G 367 
AE8 9 10 N LYS Q 365 ? N LYS G 366 O ILE Q 383 ? O ILE G 384 
AE9 1 2  O LEU G 95  ? O LEU I 96  N VAL G 64  ? N VAL I 65  
AE9 2 3  O GLY G 63  ? O GLY I 64  N VAL G 17  ? N VAL I 18  
AE9 3 4  N LEU G 18  ? N LEU I 19  O LEU G 132 ? O LEU I 133 
AE9 4 5  N ILE G 131 ? N ILE I 132 O TYR G 209 ? O TYR I 210 
AE9 5 6  O SER G 205 ? O SER I 206 N GLY G 172 ? N GLY I 173 
AE9 6 7  N HIS G 175 ? N HIS I 176 O ASP G 184 ? O ASP I 185 
AF1 1 2  O LEU G 95  ? O LEU I 96  N VAL G 64  ? N VAL I 65  
AF1 2 3  O GLY G 63  ? O GLY I 64  N VAL G 17  ? N VAL I 18  
AF1 3 4  N LEU G 18  ? N LEU I 19  O LEU G 132 ? O LEU I 133 
AF1 4 5  N ILE G 131 ? N ILE I 132 O TYR G 209 ? O TYR I 210 
AF1 5 6  O ALA G 204 ? O ALA I 205 N LEU G 161 ? N LEU I 162 
AF1 6 7  N CYS G 160 ? N CYS I 161 O HIS G 250 ? O HIS I 251 
AF2 1 2  N ILE G 137 ? N ILE I 138 O ARG G 268 ? O ARG I 269 
AF3 1 2  O LEU H 95  ? O LEU J 96  N VAL H 64  ? N VAL J 65  
AF3 2 3  O GLY H 63  ? O GLY J 64  N VAL H 17  ? N VAL J 18  
AF3 3 4  N LEU H 18  ? N LEU J 19  O LEU H 132 ? O LEU J 133 
AF3 4 5  N ILE H 131 ? N ILE J 132 O TYR H 209 ? O TYR J 210 
AF3 5 6  O LEU H 203 ? O LEU J 204 N MET H 174 ? N MET J 175 
AF3 6 7  N HIS H 175 ? N HIS J 176 O ILE H 183 ? O ILE J 184 
AF4 1 2  O LEU H 95  ? O LEU J 96  N VAL H 64  ? N VAL J 65  
AF4 2 3  O GLY H 63  ? O GLY J 64  N VAL H 17  ? N VAL J 18  
AF4 3 4  N LEU H 18  ? N LEU J 19  O LEU H 132 ? O LEU J 133 
AF4 4 5  N ILE H 131 ? N ILE J 132 O TYR H 209 ? O TYR J 210 
AF4 5 6  O MET H 206 ? O MET J 207 N GLY H 159 ? N GLY J 160 
AF4 6 7  N ILE H 158 ? N ILE J 159 O HIS H 250 ? O HIS J 251 
AF5 1 2  N PHE H 40  ? N PHE J 41  O ALA H 44  ? O ALA J 45  
AF6 1 2  N ILE H 137 ? N ILE J 138 O ARG H 268 ? O ARG J 269 
AF7 1 2  N LYS H 310 ? N LYS J 311 O ILE H 333 ? O ILE J 334 
AF7 2 3  N SER H 334 ? N SER J 335 O ALA H 349 ? O ALA J 350 
AF7 3 4  N ARG H 348 ? N ARG J 349 O ILE H 366 ? O ILE J 367 
AF7 4 5  N LYS H 365 ? N LYS J 366 O ILE H 383 ? O ILE J 384 
AF8 1 2  N SER H 321 ? N SER J 322 O LEU H 338 ? O LEU J 339 
AF8 2 3  N ALA H 337 ? N ALA J 338 O LEU H 355 ? O LEU J 356 
AF8 3 4  N VAL H 359 ? N VAL J 360 O ILE H 377 ? O ILE J 378 
AF8 4 5  N GLN H 371 ? N GLN J 372 O VAL H 389 ? O VAL J 390 
AF9 1 2  N VAL H 326 ? N VAL J 327 O LEU H 343 ? O LEU J 344 
AF9 2 3  N LEU H 342 ? N LEU J 343 O VAL H 360 ? O VAL J 361 
AF9 3 4  N VAL H 359 ? N VAL J 360 O ILE H 377 ? O ILE J 378 
AF9 4 5  N VAL H 376 ? N VAL J 377 O CYS H 408 ? O CYS J 409 
AF9 5 6  O LEU H 409 ? O LEU J 410 N ARG H 401 ? N ARG J 402 
AG1 1 2  O LEU I 95  ? O LEU K 96  N VAL I 64  ? N VAL K 65  
AG1 2 3  O GLY I 63  ? O GLY K 64  N VAL I 17  ? N VAL K 18  
AG1 3 4  N LEU I 18  ? N LEU K 19  O LEU I 132 ? O LEU K 133 
AG1 4 5  N ILE I 131 ? N ILE K 132 O TYR I 209 ? O TYR K 210 
AG1 5 6  O SER I 205 ? O SER K 206 N GLY I 172 ? N GLY K 173 
AG1 6 7  N HIS I 175 ? N HIS K 176 O ILE I 183 ? O ILE K 184 
AG2 1 2  O LEU I 95  ? O LEU K 96  N VAL I 64  ? N VAL K 65  
AG2 2 3  O GLY I 63  ? O GLY K 64  N VAL I 17  ? N VAL K 18  
AG2 3 4  N LEU I 18  ? N LEU K 19  O LEU I 132 ? O LEU K 133 
AG2 4 5  N ILE I 131 ? N ILE K 132 O TYR I 209 ? O TYR K 210 
AG2 5 6  O ALA I 202 ? O ALA K 203 N VAL I 163 ? N VAL K 164 
AG2 6 7  N ILE I 158 ? N ILE K 159 O HIS I 250 ? O HIS K 251 
AG3 1 2  N PHE I 40  ? N PHE K 41  O ALA I 44  ? O ALA K 45  
AG4 1 2  N ILE I 137 ? N ILE K 138 O ARG I 268 ? O ARG K 269 
AG5 1 2  O LEU J 95  ? O LEU L 96  N VAL J 64  ? N VAL L 65  
AG5 2 3  O GLY J 63  ? O GLY L 64  N VAL J 17  ? N VAL L 18  
AG5 3 4  N MET J 14  ? N MET L 15  O VAL J 130 ? O VAL L 131 
AG5 4 5  N ILE J 131 ? N ILE L 132 O TYR J 209 ? O TYR L 210 
AG5 5 6  O ALA J 202 ? O ALA L 203 N VAL J 163 ? N VAL L 164 
AG5 6 7  N ILE J 158 ? N ILE L 159 O HIS J 250 ? O HIS L 251 
AG6 1 2  N ILE J 137 ? N ILE L 138 O ARG J 268 ? O ARG L 269 
AG7 1 2  N HIS J 175 ? N HIS L 176 O ASP J 184 ? O ASP L 185 
AG8 1 2  N LYS J 310 ? N LYS L 311 O ILE J 333 ? O ILE L 334 
AG8 2 3  N SER J 334 ? N SER L 335 O ALA J 349 ? O ALA L 350 
AG8 3 4  N ARG J 348 ? N ARG L 349 O ILE J 366 ? O ILE L 367 
AG8 4 5  N LYS J 365 ? N LYS L 366 O ILE J 383 ? O ILE L 384 
AG9 1 2  N SER J 321 ? N SER L 322 O LEU J 338 ? O LEU L 339 
AG9 2 3  N ASN J 339 ? N ASN L 340 O LEU J 355 ? O LEU L 356 
AG9 3 4  N ARG J 354 ? N ARG L 355 O LEU J 372 ? O LEU L 373 
AG9 4 5  N GLN J 371 ? N GLN L 372 O VAL J 389 ? O VAL L 390 
AH1 1 2  N VAL J 326 ? N VAL L 327 O LEU J 343 ? O LEU L 344 
AH1 2 3  N LEU J 342 ? N LEU L 343 O VAL J 360 ? O VAL L 361 
AH1 3 4  N ARG J 354 ? N ARG L 355 O LEU J 372 ? O LEU L 373 
AH1 4 5  N VAL J 376 ? N VAL L 377 O ILE J 410 ? O ILE L 411 
AH1 5 6  O LEU J 409 ? O LEU L 410 N ARG J 401 ? N ARG L 402 
AH2 1 2  O LEU K 95  ? O LEU N 96  N VAL K 64  ? N VAL N 65  
AH2 2 3  O GLY K 63  ? O GLY N 64  N ALA K 15  ? N ALA N 16  
AH2 3 4  N LEU K 18  ? N LEU N 19  O LEU K 132 ? O LEU N 133 
AH2 4 5  N ILE K 131 ? N ILE N 132 O TYR K 209 ? O TYR N 210 
AH2 5 6  O ALA K 202 ? O ALA N 203 N VAL K 163 ? N VAL N 164 
AH2 6 7  N ILE K 158 ? N ILE N 159 O HIS K 250 ? O HIS N 251 
AH3 1 2  N ILE K 137 ? N ILE N 138 O ARG K 268 ? O ARG N 269 
AH4 1 2  N LYS K 310 ? N LYS N 311 O ILE K 333 ? O ILE N 334 
AH4 2 3  N SER K 334 ? N SER N 335 O ALA K 349 ? O ALA N 350 
AH4 3 4  N ARG K 348 ? N ARG N 349 O ILE K 366 ? O ILE N 367 
AH4 4 5  N LYS K 365 ? N LYS N 366 O ILE K 383 ? O ILE N 384 
AH5 1 2  N SER K 321 ? N SER N 322 O LEU K 338 ? O LEU N 339 
AH5 2 3  N ALA K 337 ? N ALA N 338 O LEU K 355 ? O LEU N 356 
AH5 3 4  N VAL K 359 ? N VAL N 360 O VAL K 375 ? O VAL N 376 
AH5 4 5  N GLN K 371 ? N GLN N 372 O VAL K 389 ? O VAL N 390 
AH6 1 2  N VAL K 326 ? N VAL N 327 O LEU K 343 ? O LEU N 344 
AH6 2 3  N LEU K 342 ? N LEU N 343 O VAL K 360 ? O VAL N 361 
AH6 3 4  N VAL K 359 ? N VAL N 360 O VAL K 375 ? O VAL N 376 
AH6 4 5  N VAL K 376 ? N VAL N 377 O ILE K 410 ? O ILE N 411 
AH6 5 6  O LEU K 409 ? O LEU N 410 N ARG K 401 ? N ARG N 402 
AH7 1 2  O LEU L 95  ? O LEU O 96  N VAL L 64  ? N VAL O 65  
AH7 2 3  O GLY L 63  ? O GLY O 64  N VAL L 17  ? N VAL O 18  
AH7 3 4  N TYR L 16  ? N TYR O 17  O VAL L 130 ? O VAL O 131 
AH7 4 5  N MET L 129 ? N MET O 130 O PHE L 211 ? O PHE O 212 
AH7 5 6  O SER L 205 ? O SER O 206 N GLY L 172 ? N GLY O 173 
AH7 6 7  N HIS L 175 ? N HIS O 176 O ASP L 184 ? O ASP O 185 
AH8 1 2  O LEU L 95  ? O LEU O 96  N VAL L 64  ? N VAL O 65  
AH8 2 3  O GLY L 63  ? O GLY O 64  N VAL L 17  ? N VAL O 18  
AH8 3 4  N TYR L 16  ? N TYR O 17  O VAL L 130 ? O VAL O 131 
AH8 4 5  N MET L 129 ? N MET O 130 O PHE L 211 ? O PHE O 212 
AH8 5 6  O ALA L 202 ? O ALA O 203 N VAL L 163 ? N VAL O 164 
AH8 6 7  N ILE L 158 ? N ILE O 159 O HIS L 250 ? O HIS O 251 
AH9 1 2  N PHE L 40  ? N PHE O 41  O ALA L 44  ? O ALA O 45  
AI1 1 2  N ILE L 137 ? N ILE O 138 O ARG L 268 ? O ARG O 269 
AI2 1 2  N LYS L 310 ? N LYS O 311 O ILE L 333 ? O ILE O 334 
AI2 2 3  N SER L 334 ? N SER O 335 O ALA L 349 ? O ALA O 350 
AI2 3 4  N ARG L 348 ? N ARG O 349 O ILE L 366 ? O ILE O 367 
AI2 4 5  N LYS L 365 ? N LYS O 366 O ILE L 383 ? O ILE O 384 
AI3 1 2  N SER L 321 ? N SER O 322 O LEU L 338 ? O LEU O 339 
AI3 2 3  N ALA L 337 ? N ALA O 338 O LEU L 355 ? O LEU O 356 
AI3 3 4  N VAL L 359 ? N VAL O 360 O ILE L 377 ? O ILE O 378 
AI3 4 5  N GLN L 371 ? N GLN O 372 O VAL L 389 ? O VAL O 390 
AI4 1 2  N VAL L 326 ? N VAL O 327 O LEU L 343 ? O LEU O 344 
AI4 2 3  N LEU L 342 ? N LEU O 343 O ALA L 358 ? O ALA O 359 
AI4 3 4  N VAL L 359 ? N VAL O 360 O ILE L 377 ? O ILE O 378 
AI4 4 5  N VAL L 376 ? N VAL O 377 O ILE L 410 ? O ILE O 411 
AI4 5 6  O LEU L 409 ? O LEU O 410 N ARG L 401 ? N ARG O 402 
AI5 1 2  O LEU M 95  ? O LEU P 96  N VAL M 64  ? N VAL P 65  
AI5 2 3  O ALA M 65  ? O ALA P 66  N VAL M 17  ? N VAL P 18  
AI5 3 4  N LEU M 18  ? N LEU P 19  O LEU M 132 ? O LEU P 133 
AI5 4 5  N ILE M 131 ? N ILE P 132 O TYR M 209 ? O TYR P 210 
AI5 5 6  O LEU M 203 ? O LEU P 204 N MET M 174 ? N MET P 175 
AI5 6 7  N VAL M 173 ? N VAL P 174 O ILE M 186 ? O ILE P 187 
AI6 1 2  O LEU M 95  ? O LEU P 96  N VAL M 64  ? N VAL P 65  
AI6 2 3  O ALA M 65  ? O ALA P 66  N VAL M 17  ? N VAL P 18  
AI6 3 4  N LEU M 18  ? N LEU P 19  O LEU M 132 ? O LEU P 133 
AI6 4 5  N ILE M 131 ? N ILE P 132 O TYR M 209 ? O TYR P 210 
AI6 5 6  O ALA M 204 ? O ALA P 205 N LEU M 161 ? N LEU P 162 
AI6 6 7  N CYS M 160 ? N CYS P 161 O HIS M 250 ? O HIS P 251 
AI7 1 2  N PHE M 40  ? N PHE P 41  O ALA M 44  ? O ALA P 45  
AI8 1 2  N ILE M 137 ? N ILE P 138 O ARG M 268 ? O ARG P 269 
AI9 1 2  O SER N 91  ? O SER Q 92  N ILE N 62  ? N ILE Q 63  
AI9 2 3  O GLY N 63  ? O GLY Q 64  N VAL N 17  ? N VAL Q 18  
AI9 3 4  N LEU N 18  ? N LEU Q 19  O LEU N 132 ? O LEU Q 133 
AI9 4 5  N ILE N 131 ? N ILE Q 132 O TYR N 209 ? O TYR Q 210 
AI9 5 6  O SER N 205 ? O SER Q 206 N GLY N 172 ? N GLY Q 173 
AI9 6 7  N VAL N 173 ? N VAL Q 174 O ILE N 186 ? O ILE Q 187 
AJ1 1 2  O SER N 91  ? O SER Q 92  N ILE N 62  ? N ILE Q 63  
AJ1 2 3  O GLY N 63  ? O GLY Q 64  N VAL N 17  ? N VAL Q 18  
AJ1 3 4  N LEU N 18  ? N LEU Q 19  O LEU N 132 ? O LEU Q 133 
AJ1 4 5  N ILE N 131 ? N ILE Q 132 O TYR N 209 ? O TYR Q 210 
AJ1 5 6  O ALA N 202 ? O ALA Q 203 N VAL N 163 ? N VAL Q 164 
AJ1 6 7  N CYS N 160 ? N CYS Q 161 O HIS N 250 ? O HIS Q 251 
AJ2 1 2  N PHE N 40  ? N PHE Q 41  O ALA N 44  ? O ALA Q 45  
AJ3 1 2  N ILE N 137 ? N ILE Q 138 O ARG N 268 ? O ARG Q 269 
AJ4 1 2  O ILE N 383 ? O ILE Q 384 N LYS N 365 ? N LYS Q 366 
AJ4 2 3  O ILE N 366 ? O ILE Q 367 N ARG N 348 ? N ARG Q 349 
AJ4 3 4  O ALA N 349 ? O ALA Q 350 N SER N 334 ? N SER Q 335 
AJ4 4 5  O ILE N 333 ? O ILE Q 334 N LYS N 310 ? N LYS Q 311 
AJ4 5 6  N PHE N 311 ? N PHE Q 312 O SER P 325 ? O SER F 326 
AJ4 6 7  N VAL P 326 ? N VAL F 327 O LEU P 343 ? O LEU F 344 
AJ4 7 8  N LEU P 342 ? N LEU F 343 O VAL P 360 ? O VAL F 361 
AJ4 8 9  N VAL P 359 ? N VAL F 360 O ILE P 377 ? O ILE F 378 
AJ4 9 10 N GLN P 371 ? N GLN F 372 O VAL P 389 ? O VAL F 390 
AJ5 1 2  N SER P 321 ? N SER F 322 O LEU P 338 ? O LEU F 339 
AJ5 2 3  N ALA P 337 ? N ALA F 338 O LEU P 355 ? O LEU F 356 
AJ5 3 4  N VAL P 359 ? N VAL F 360 O ILE P 377 ? O ILE F 378 
AJ5 4 5  N VAL P 376 ? N VAL F 377 O ILE P 410 ? O ILE F 411 
AJ5 5 6  O LEU P 409 ? O LEU F 410 N ARG P 401 ? N ARG F 402 
AJ6 1 2  N SER N 321 ? N SER Q 322 O LEU N 338 ? O LEU Q 339 
AJ6 2 3  N ALA N 337 ? N ALA Q 338 O LEU N 355 ? O LEU Q 356 
AJ6 3 4  N VAL N 359 ? N VAL Q 360 O ILE N 377 ? O ILE Q 378 
AJ6 4 5  N VAL N 376 ? N VAL Q 377 O ILE N 410 ? O ILE Q 411 
AJ6 5 6  O LEU N 409 ? O LEU Q 410 N ARG N 401 ? N ARG Q 402 
AJ7 1 2  O VAL N 389 ? O VAL Q 390 N GLN N 371 ? N GLN Q 372 
AJ7 2 3  O ILE N 377 ? O ILE Q 378 N VAL N 359 ? N VAL Q 360 
AJ7 3 4  O VAL N 360 ? O VAL Q 361 N LEU N 342 ? N LEU Q 343 
AJ7 4 5  O LEU N 343 ? O LEU Q 344 N VAL N 326 ? N VAL Q 327 
AJ7 5 6  N SER N 325 ? N SER Q 326 O PHE P 311 ? O PHE F 312 
AJ7 6 7  N LYS P 310 ? N LYS F 311 O ILE P 333 ? O ILE F 334 
AJ7 7 8  N SER P 334 ? N SER F 335 O ALA P 349 ? O ALA F 350 
AJ7 8 9  N ARG P 348 ? N ARG F 349 O ILE P 366 ? O ILE F 367 
AJ7 9 10 N LYS P 365 ? N LYS F 366 O ILE P 383 ? O ILE F 384 
AJ8 1 2  O LEU O 95  ? O LEU R 96  N VAL O 64  ? N VAL R 65  
AJ8 2 3  O GLY O 63  ? O GLY R 64  N VAL O 17  ? N VAL R 18  
AJ8 3 4  N TYR O 16  ? N TYR R 17  O LEU O 132 ? O LEU R 133 
AJ8 4 5  N ILE O 131 ? N ILE R 132 O TYR O 209 ? O TYR R 210 
AJ8 5 6  O SER O 205 ? O SER R 206 N GLY O 172 ? N GLY R 173 
AJ8 6 7  N VAL O 173 ? N VAL R 174 O ILE O 186 ? O ILE R 187 
AJ9 1 2  O LEU O 95  ? O LEU R 96  N VAL O 64  ? N VAL R 65  
AJ9 2 3  O GLY O 63  ? O GLY R 64  N VAL O 17  ? N VAL R 18  
AJ9 3 4  N TYR O 16  ? N TYR R 17  O LEU O 132 ? O LEU R 133 
AJ9 4 5  N ILE O 131 ? N ILE R 132 O TYR O 209 ? O TYR R 210 
AJ9 5 6  O MET O 206 ? O MET R 207 N GLY O 159 ? N GLY R 160 
AJ9 6 7  N ILE O 158 ? N ILE R 159 O HIS O 250 ? O HIS R 251 
AK1 1 2  N ILE O 137 ? N ILE R 138 O ARG O 268 ? O ARG R 269 
AK2 1 2  N LYS O 310 ? N LYS R 311 O ILE O 333 ? O ILE R 334 
AK2 2 3  N SER O 334 ? N SER R 335 O ALA O 349 ? O ALA R 350 
AK2 3 4  N ARG O 348 ? N ARG R 349 O ILE O 366 ? O ILE R 367 
AK2 4 5  N LYS O 365 ? N LYS R 366 O ILE O 383 ? O ILE R 384 
AK3 1 2  N SER O 321 ? N SER R 322 O LEU O 338 ? O LEU R 339 
AK3 2 3  N ALA O 337 ? N ALA R 338 O LEU O 355 ? O LEU R 356 
AK3 3 4  N ARG O 354 ? N ARG R 355 O LEU O 372 ? O LEU R 373 
AK3 4 5  N GLN O 371 ? N GLN R 372 O VAL O 389 ? O VAL R 390 
AK4 1 2  N VAL O 326 ? N VAL R 327 O LEU O 343 ? O LEU R 344 
AK4 2 3  N LEU O 342 ? N LEU R 343 O VAL O 360 ? O VAL R 361 
AK4 3 4  N ARG O 354 ? N ARG R 355 O LEU O 372 ? O LEU R 373 
AK4 4 5  N VAL O 376 ? N VAL R 377 O CYS O 408 ? O CYS R 409 
AK4 5 6  O LEU O 409 ? O LEU R 410 N ARG O 401 ? N ARG R 402 
AK5 1 2  O LEU P 95  ? O LEU F 96  N VAL P 64  ? N VAL F 65  
AK5 2 3  O GLY P 63  ? O GLY F 64  N VAL P 17  ? N VAL F 18  
AK5 3 4  N TYR P 16  ? N TYR F 17  O VAL P 130 ? O VAL F 131 
AK5 4 5  N ILE P 131 ? N ILE F 132 O TYR P 209 ? O TYR F 210 
AK5 5 6  O SER P 205 ? O SER F 206 N GLY P 172 ? N GLY F 173 
AK5 6 7  N VAL P 173 ? N VAL F 174 O ILE P 186 ? O ILE F 187 
AK6 1 2  O LEU P 95  ? O LEU F 96  N VAL P 64  ? N VAL F 65  
AK6 2 3  O GLY P 63  ? O GLY F 64  N VAL P 17  ? N VAL F 18  
AK6 3 4  N TYR P 16  ? N TYR F 17  O VAL P 130 ? O VAL F 131 
AK6 4 5  N ILE P 131 ? N ILE F 132 O TYR P 209 ? O TYR F 210 
AK6 5 6  O ALA P 204 ? O ALA F 205 N LEU P 161 ? N LEU F 162 
AK6 6 7  N ILE P 158 ? N ILE F 159 O HIS P 250 ? O HIS F 251 
AK7 1 2  N PHE P 40  ? N PHE F 41  O ALA P 44  ? O ALA F 45  
AK8 1 2  N ILE P 137 ? N ILE F 138 O ARG P 268 ? O ARG F 269 
AK9 1 2  O LEU Q 95  ? O LEU G 96  N VAL Q 64  ? N VAL G 65  
AK9 2 3  O GLY Q 63  ? O GLY G 64  N VAL Q 17  ? N VAL G 18  
AK9 3 4  N LEU Q 18  ? N LEU G 19  O LEU Q 132 ? O LEU G 133 
AK9 4 5  N ILE Q 131 ? N ILE G 132 O TYR Q 209 ? O TYR G 210 
AK9 5 6  O SER Q 205 ? O SER G 206 N GLY Q 172 ? N GLY G 173 
AK9 6 7  N VAL Q 173 ? N VAL G 174 O ILE Q 186 ? O ILE G 187 
AL1 1 2  O LEU Q 95  ? O LEU G 96  N VAL Q 64  ? N VAL G 65  
AL1 2 3  O GLY Q 63  ? O GLY G 64  N VAL Q 17  ? N VAL G 18  
AL1 3 4  N LEU Q 18  ? N LEU G 19  O LEU Q 132 ? O LEU G 133 
AL1 4 5  N ILE Q 131 ? N ILE G 132 O TYR Q 209 ? O TYR G 210 
AL1 5 6  O ALA Q 202 ? O ALA G 203 N VAL Q 163 ? N VAL G 164 
AL1 6 7  N ILE Q 158 ? N ILE G 159 O HIS Q 250 ? O HIS G 251 
AL2 1 2  N PHE Q 40  ? N PHE G 41  O ALA Q 44  ? O ALA G 45  
AL3 1 2  N ILE Q 137 ? N ILE G 138 O ARG Q 268 ? O ARG G 269 
AL4 1 2  O SER R 91  ? O SER M 92  N ILE R 62  ? N ILE M 63  
AL4 2 3  O GLY R 63  ? O GLY M 64  N VAL R 17  ? N VAL M 18  
AL4 3 4  N LEU R 18  ? N LEU M 19  O LEU R 132 ? O LEU M 133 
AL4 4 5  N ILE R 131 ? N ILE M 132 O TYR R 209 ? O TYR M 210 
AL4 5 6  O LEU R 203 ? O LEU M 204 N MET R 174 ? N MET M 175 
AL4 6 7  N VAL R 173 ? N VAL M 174 O ILE R 186 ? O ILE M 187 
AL5 1 2  O SER R 91  ? O SER M 92  N ILE R 62  ? N ILE M 63  
AL5 2 3  O GLY R 63  ? O GLY M 64  N VAL R 17  ? N VAL M 18  
AL5 3 4  N LEU R 18  ? N LEU M 19  O LEU R 132 ? O LEU M 133 
AL5 4 5  N ILE R 131 ? N ILE M 132 O TYR R 209 ? O TYR M 210 
AL5 5 6  O ALA R 204 ? O ALA M 205 N LEU R 161 ? N LEU M 162 
AL5 6 7  N ILE R 158 ? N ILE M 159 O HIS R 250 ? O HIS M 251 
AL6 1 2  N PHE R 40  ? N PHE M 41  O ALA R 44  ? O ALA M 45  
AL7 1 2  N ILE R 137 ? N ILE M 138 O ARG R 268 ? O ARG M 269 
AL8 1 2  O LEU S 95  ? O LEU T 96  N VAL S 64  ? N VAL T 65  
AL8 2 3  O GLY S 63  ? O GLY T 64  N VAL S 17  ? N VAL T 18  
AL8 3 4  N TYR S 16  ? N TYR T 17  O VAL S 130 ? O VAL T 131 
AL8 4 5  N ILE S 131 ? N ILE T 132 O TYR S 209 ? O TYR T 210 
AL8 5 6  O ALA S 204 ? O ALA T 205 N LEU S 161 ? N LEU T 162 
AL8 6 7  N ILE S 158 ? N ILE T 159 O HIS S 250 ? O HIS T 251 
AL9 1 2  N ILE S 137 ? N ILE T 138 O ARG S 268 ? O ARG T 269 
AM1 1 2  N HIS S 175 ? N HIS T 176 O ASP S 184 ? O ASP T 185 
AM2 1 2  O ILE S 383 ? O ILE T 384 N LYS S 365 ? N LYS T 366 
AM2 2 3  O ILE S 366 ? O ILE T 367 N ARG S 348 ? N ARG T 349 
AM2 3 4  O ALA S 349 ? O ALA T 350 N SER S 334 ? N SER T 335 
AM2 4 5  O ILE S 333 ? O ILE T 334 N LYS S 310 ? N LYS T 311 
AM2 5 6  N PHE S 311 ? N PHE T 312 O SER T 325 ? O SER U 326 
AM2 6 7  N VAL T 326 ? N VAL U 327 O LEU T 343 ? O LEU U 344 
AM2 7 8  N LEU T 342 ? N LEU U 343 O VAL T 360 ? O VAL U 361 
AM2 8 9  N VAL T 359 ? N VAL U 360 O ILE T 377 ? O ILE U 378 
AM2 9 10 N GLN T 371 ? N GLN U 372 O VAL T 389 ? O VAL U 390 
AM3 1 2  N SER T 321 ? N SER U 322 O LEU T 338 ? O LEU U 339 
AM3 2 3  N ALA T 337 ? N ALA U 338 O LEU T 355 ? O LEU U 356 
AM3 3 4  N VAL T 359 ? N VAL U 360 O ILE T 377 ? O ILE U 378 
AM3 4 5  N VAL T 376 ? N VAL U 377 O ILE T 410 ? O ILE U 411 
AM3 5 6  O LEU T 409 ? O LEU U 410 N ARG T 401 ? N ARG U 402 
AM4 1 2  N SER S 321 ? N SER T 322 O LEU S 338 ? O LEU T 339 
AM4 2 3  N ASN S 339 ? N ASN T 340 O LEU S 355 ? O LEU T 356 
AM4 3 4  N VAL S 359 ? N VAL T 360 O ILE S 377 ? O ILE T 378 
AM4 4 5  N VAL S 376 ? N VAL T 377 O ILE S 410 ? O ILE T 411 
AM4 5 6  O LEU S 409 ? O LEU T 410 N ARG S 401 ? N ARG T 402 
AM5 1 2  O VAL S 389 ? O VAL T 390 N GLN S 371 ? N GLN T 372 
AM5 2 3  O ILE S 377 ? O ILE T 378 N VAL S 359 ? N VAL T 360 
AM5 3 4  O VAL S 360 ? O VAL T 361 N LEU S 342 ? N LEU T 343 
AM5 4 5  O LEU S 343 ? O LEU T 344 N VAL S 326 ? N VAL T 327 
AM5 5 6  N VAL S 327 ? N VAL T 328 O ALA T 309 ? O ALA U 310 
AM5 6 7  N LYS T 310 ? N LYS U 311 O ILE T 333 ? O ILE U 334 
AM5 7 8  N SER T 334 ? N SER U 335 O ALA T 349 ? O ALA U 350 
AM5 8 9  N ARG T 348 ? N ARG U 349 O ILE T 366 ? O ILE U 367 
AM5 9 10 N LYS T 365 ? N LYS U 366 O ILE T 383 ? O ILE U 384 
AM6 1 2  O LEU T 95  ? O LEU U 96  N VAL T 64  ? N VAL U 65  
AM6 2 3  O GLY T 63  ? O GLY U 64  N VAL T 17  ? N VAL U 18  
AM6 3 4  N LEU T 18  ? N LEU U 19  O LEU T 132 ? O LEU U 133 
AM6 4 5  N ILE T 131 ? N ILE U 132 O TYR T 209 ? O TYR U 210 
AM6 5 6  O SER T 205 ? O SER U 206 N GLY T 172 ? N GLY U 173 
AM6 6 7  N HIS T 175 ? N HIS U 176 O ILE T 183 ? O ILE U 184 
AM7 1 2  O LEU T 95  ? O LEU U 96  N VAL T 64  ? N VAL U 65  
AM7 2 3  O GLY T 63  ? O GLY U 64  N VAL T 17  ? N VAL U 18  
AM7 3 4  N LEU T 18  ? N LEU U 19  O LEU T 132 ? O LEU U 133 
AM7 4 5  N ILE T 131 ? N ILE U 132 O TYR T 209 ? O TYR U 210 
AM7 5 6  O ALA T 202 ? O ALA U 203 N VAL T 163 ? N VAL U 164 
AM7 6 7  N ILE T 158 ? N ILE U 159 O HIS T 250 ? O HIS U 251 
AM8 1 2  N PHE T 40  ? N PHE U 41  O ALA T 44  ? O ALA U 45  
AM9 1 2  N ILE T 137 ? N ILE U 138 O ARG T 268 ? O ARG U 269 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 501 ? 5 'binding site for residue SO4 A 501' 
AC2 Software A SO4 502 ? 5 'binding site for residue SO4 A 502' 
AC3 Software B SO4 501 ? 5 'binding site for residue SO4 B 501' 
AC4 Software B SO4 502 ? 6 'binding site for residue SO4 B 502' 
AC5 Software C SO4 501 ? 7 'binding site for residue SO4 C 501' 
AC6 Software C SO4 502 ? 5 'binding site for residue SO4 C 502' 
AC7 Software D SO4 501 ? 6 'binding site for residue SO4 D 501' 
AC8 Software D SO4 502 ? 7 'binding site for residue SO4 D 502' 
AC9 Software E SO4 501 ? 7 'binding site for residue SO4 E 501' 
AD1 Software E SO4 502 ? 6 'binding site for residue SO4 E 502' 
AD2 Software E SO4 503 ? 5 'binding site for residue SO4 E 503' 
AD3 Software H SO4 501 ? 6 'binding site for residue SO4 H 501' 
AD4 Software H SO4 502 ? 7 'binding site for residue SO4 H 502' 
AD5 Software I SO4 501 ? 7 'binding site for residue SO4 I 501' 
AD6 Software I SO4 502 ? 5 'binding site for residue SO4 I 502' 
AD7 Software J SO4 501 ? 7 'binding site for residue SO4 J 501' 
AD8 Software J SO4 502 ? 7 'binding site for residue SO4 J 502' 
AD9 Software K SO4 501 ? 6 'binding site for residue SO4 K 501' 
AE1 Software K SO4 502 ? 6 'binding site for residue SO4 K 502' 
AE2 Software L SO4 501 ? 7 'binding site for residue SO4 L 501' 
AE3 Software L SO4 502 ? 8 'binding site for residue SO4 L 502' 
AE4 Software N SO4 501 ? 6 'binding site for residue SO4 N 501' 
AE5 Software N SO4 502 ? 6 'binding site for residue SO4 N 502' 
AE6 Software O SO4 501 ? 7 'binding site for residue SO4 O 501' 
AE7 Software O SO4 502 ? 5 'binding site for residue SO4 O 502' 
AE8 Software P SO4 501 ? 4 'binding site for residue SO4 P 501' 
AE9 Software P SO4 502 ? 6 'binding site for residue SO4 P 502' 
AF1 Software Q SO4 501 ? 7 'binding site for residue SO4 Q 501' 
AF2 Software Q SO4 502 ? 8 'binding site for residue SO4 Q 502' 
AF3 Software R SO4 501 ? 6 'binding site for residue SO4 R 501' 
AF4 Software R SO4 502 ? 8 'binding site for residue SO4 R 502' 
AF5 Software F SO4 501 ? 5 'binding site for residue SO4 F 501' 
AF6 Software F SO4 502 ? 8 'binding site for residue SO4 F 502' 
AF7 Software G SO4 501 ? 7 'binding site for residue SO4 G 501' 
AF8 Software G SO4 502 ? 6 'binding site for residue SO4 G 502' 
AF9 Software M SO4 501 ? 7 'binding site for residue SO4 M 501' 
AG1 Software M SO4 502 ? 7 'binding site for residue SO4 M 502' 
AG2 Software T SO4 501 ? 8 'binding site for residue SO4 T 501' 
AG3 Software T SO4 502 ? 5 'binding site for residue SO4 T 502' 
AG4 Software T SO4 503 ? 7 'binding site for residue SO4 T 503' 
AG5 Software U SO4 501 ? 4 'binding site for residue SO4 U 501' 
AG6 Software U SO4 502 ? 7 'binding site for residue SO4 U 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5 SER A  334 ? SER A 335 . ? 1_555 ? 
2   AC1 5 ASN A  350 ? ASN A 351 . ? 1_555 ? 
3   AC1 5 SER A  351 ? SER A 352 . ? 1_555 ? 
4   AC1 5 ARG A  368 ? ARG A 369 . ? 1_555 ? 
5   AC1 5 HOH KB .   ? HOH A 604 . ? 1_555 ? 
6   AC2 5 ARG A  33  ? ARG A 34  . ? 1_555 ? 
7   AC2 5 TYR A  39  ? TYR A 40  . ? 1_555 ? 
8   AC2 5 ARG A  45  ? ARG A 46  . ? 1_555 ? 
9   AC2 5 SER A  72  ? SER A 73  . ? 1_555 ? 
10  AC2 5 HIS A  379 ? HIS A 380 . ? 1_555 ? 
11  AC3 5 SER B  334 ? SER B 335 . ? 1_555 ? 
12  AC3 5 ASN B  350 ? ASN B 351 . ? 1_555 ? 
13  AC3 5 SER B  351 ? SER B 352 . ? 1_555 ? 
14  AC3 5 ARG B  368 ? ARG B 369 . ? 1_555 ? 
15  AC3 5 HOH LB .   ? HOH B 624 . ? 1_555 ? 
16  AC4 6 ARG B  33  ? ARG B 34  . ? 1_555 ? 
17  AC4 6 TYR B  39  ? TYR B 40  . ? 1_555 ? 
18  AC4 6 ARG B  45  ? ARG B 46  . ? 1_555 ? 
19  AC4 6 SER B  72  ? SER B 73  . ? 1_555 ? 
20  AC4 6 HIS B  379 ? HIS B 380 . ? 1_555 ? 
21  AC4 6 HOH LB .   ? HOH B 615 . ? 1_555 ? 
22  AC5 7 SER C  334 ? SER C 335 . ? 1_555 ? 
23  AC5 7 ASN C  350 ? ASN C 351 . ? 1_555 ? 
24  AC5 7 SER C  351 ? SER C 352 . ? 1_555 ? 
25  AC5 7 ARG C  368 ? ARG C 369 . ? 1_555 ? 
26  AC5 7 HOH MB .   ? HOH C 654 . ? 1_555 ? 
27  AC5 7 HOH MB .   ? HOH C 748 . ? 1_555 ? 
28  AC5 7 HOH MB .   ? HOH C 789 . ? 1_555 ? 
29  AC6 5 ARG C  33  ? ARG C 34  . ? 1_555 ? 
30  AC6 5 TYR C  39  ? TYR C 40  . ? 1_555 ? 
31  AC6 5 ARG C  45  ? ARG C 46  . ? 1_555 ? 
32  AC6 5 SER C  72  ? SER C 73  . ? 1_555 ? 
33  AC6 5 HOH MB .   ? HOH C 886 . ? 1_555 ? 
34  AC7 6 SER D  334 ? SER D 335 . ? 1_555 ? 
35  AC7 6 ASN D  350 ? ASN D 351 . ? 1_555 ? 
36  AC7 6 SER D  351 ? SER D 352 . ? 1_555 ? 
37  AC7 6 ARG D  368 ? ARG D 369 . ? 1_555 ? 
38  AC7 6 HOH NB .   ? HOH D 677 . ? 1_555 ? 
39  AC7 6 HOH NB .   ? HOH D 864 . ? 1_555 ? 
40  AC8 7 ARG D  33  ? ARG D 34  . ? 1_555 ? 
41  AC8 7 TYR D  39  ? TYR D 40  . ? 1_555 ? 
42  AC8 7 ARG D  45  ? ARG D 46  . ? 1_555 ? 
43  AC8 7 SER D  72  ? SER D 73  . ? 1_555 ? 
44  AC8 7 HIS D  379 ? HIS D 380 . ? 1_555 ? 
45  AC8 7 HOH NB .   ? HOH D 742 . ? 1_555 ? 
46  AC8 7 HOH NB .   ? HOH D 801 . ? 1_555 ? 
47  AC9 7 ARG E  318 ? ARG E 319 . ? 1_555 ? 
48  AC9 7 SER E  334 ? SER E 335 . ? 1_555 ? 
49  AC9 7 ASN E  350 ? ASN E 351 . ? 1_555 ? 
50  AC9 7 SER E  351 ? SER E 352 . ? 1_555 ? 
51  AC9 7 ARG E  368 ? ARG E 369 . ? 1_555 ? 
52  AC9 7 HOH OB .   ? HOH E 691 . ? 1_555 ? 
53  AC9 7 HOH OB .   ? HOH E 789 . ? 1_555 ? 
54  AD1 6 ARG E  33  ? ARG E 34  . ? 1_555 ? 
55  AD1 6 TYR E  39  ? TYR E 40  . ? 1_555 ? 
56  AD1 6 ARG E  45  ? ARG E 46  . ? 1_555 ? 
57  AD1 6 SER E  72  ? SER E 73  . ? 1_555 ? 
58  AD1 6 HIS E  379 ? HIS E 380 . ? 1_555 ? 
59  AD1 6 HOH OB .   ? HOH E 605 . ? 1_555 ? 
60  AD2 5 ASP E  285 ? ASP E 286 . ? 1_555 ? 
61  AD2 5 VAL E  286 ? VAL E 287 . ? 1_555 ? 
62  AD2 5 HOH OB .   ? HOH E 630 . ? 1_555 ? 
63  AD2 5 HOH OB .   ? HOH E 631 . ? 1_555 ? 
64  AD2 5 HOH OB .   ? HOH E 704 . ? 1_555 ? 
65  AD3 6 SER F  334 ? SER H 335 . ? 1_555 ? 
66  AD3 6 ASN F  350 ? ASN H 351 . ? 1_555 ? 
67  AD3 6 SER F  351 ? SER H 352 . ? 1_555 ? 
68  AD3 6 ARG F  368 ? ARG H 369 . ? 1_555 ? 
69  AD3 6 HOH PB .   ? HOH H 794 . ? 1_555 ? 
70  AD3 6 HOH PB .   ? HOH H 830 . ? 1_555 ? 
71  AD4 7 ARG F  33  ? ARG H 34  . ? 1_555 ? 
72  AD4 7 TYR F  39  ? TYR H 40  . ? 1_555 ? 
73  AD4 7 ARG F  45  ? ARG H 46  . ? 1_555 ? 
74  AD4 7 SER F  72  ? SER H 73  . ? 1_555 ? 
75  AD4 7 ARG F  75  ? ARG H 76  . ? 1_555 ? 
76  AD4 7 HOH PB .   ? HOH H 639 . ? 1_555 ? 
77  AD4 7 HOH PB .   ? HOH H 899 . ? 1_555 ? 
78  AD5 7 ARG G  318 ? ARG I 319 . ? 1_555 ? 
79  AD5 7 SER G  334 ? SER I 335 . ? 1_555 ? 
80  AD5 7 ASN G  350 ? ASN I 351 . ? 1_555 ? 
81  AD5 7 SER G  351 ? SER I 352 . ? 1_555 ? 
82  AD5 7 ARG G  368 ? ARG I 369 . ? 1_555 ? 
83  AD5 7 HOH QB .   ? HOH I 873 . ? 1_555 ? 
84  AD5 7 HOH QB .   ? HOH I 898 . ? 1_555 ? 
85  AD6 5 ARG G  33  ? ARG I 34  . ? 1_555 ? 
86  AD6 5 TYR G  39  ? TYR I 40  . ? 1_555 ? 
87  AD6 5 ARG G  45  ? ARG I 46  . ? 1_555 ? 
88  AD6 5 SER G  72  ? SER I 73  . ? 1_555 ? 
89  AD6 5 HIS G  379 ? HIS I 380 . ? 1_555 ? 
90  AD7 7 SER H  334 ? SER J 335 . ? 1_555 ? 
91  AD7 7 ASN H  350 ? ASN J 351 . ? 1_555 ? 
92  AD7 7 SER H  351 ? SER J 352 . ? 1_555 ? 
93  AD7 7 ARG H  368 ? ARG J 369 . ? 1_555 ? 
94  AD7 7 HOH RB .   ? HOH J 679 . ? 1_555 ? 
95  AD7 7 HOH RB .   ? HOH J 784 . ? 1_555 ? 
96  AD7 7 HOH RB .   ? HOH J 810 . ? 1_555 ? 
97  AD8 7 ARG H  33  ? ARG J 34  . ? 1_555 ? 
98  AD8 7 TYR H  39  ? TYR J 40  . ? 1_555 ? 
99  AD8 7 ARG H  45  ? ARG J 46  . ? 1_555 ? 
100 AD8 7 SER H  72  ? SER J 73  . ? 1_555 ? 
101 AD8 7 ARG H  75  ? ARG J 76  . ? 1_555 ? 
102 AD8 7 HOH RB .   ? HOH J 676 . ? 1_555 ? 
103 AD8 7 HOH RB .   ? HOH J 730 . ? 1_555 ? 
104 AD9 6 ARG I  318 ? ARG K 319 . ? 1_555 ? 
105 AD9 6 SER I  334 ? SER K 335 . ? 1_555 ? 
106 AD9 6 ASN I  350 ? ASN K 351 . ? 1_555 ? 
107 AD9 6 SER I  351 ? SER K 352 . ? 1_555 ? 
108 AD9 6 ARG I  368 ? ARG K 369 . ? 1_555 ? 
109 AD9 6 HOH SB .   ? HOH K 740 . ? 1_555 ? 
110 AE1 6 ARG I  33  ? ARG K 34  . ? 1_555 ? 
111 AE1 6 TYR I  39  ? TYR K 40  . ? 1_555 ? 
112 AE1 6 ARG I  45  ? ARG K 46  . ? 1_555 ? 
113 AE1 6 SER I  72  ? SER K 73  . ? 1_555 ? 
114 AE1 6 HOH SB .   ? HOH K 607 . ? 1_555 ? 
115 AE1 6 HOH SB .   ? HOH K 810 . ? 1_555 ? 
116 AE2 7 ARG J  33  ? ARG L 34  . ? 1_555 ? 
117 AE2 7 TYR J  39  ? TYR L 40  . ? 1_555 ? 
118 AE2 7 ARG J  45  ? ARG L 46  . ? 1_555 ? 
119 AE2 7 SER J  72  ? SER L 73  . ? 1_555 ? 
120 AE2 7 HIS J  379 ? HIS L 380 . ? 1_555 ? 
121 AE2 7 HOH TB .   ? HOH L 642 . ? 1_555 ? 
122 AE2 7 HOH TB .   ? HOH L 767 . ? 1_555 ? 
123 AE3 8 HIS J  313 ? HIS L 314 . ? 1_555 ? 
124 AE3 8 ARG J  318 ? ARG L 319 . ? 1_555 ? 
125 AE3 8 SER J  334 ? SER L 335 . ? 1_555 ? 
126 AE3 8 ASN J  350 ? ASN L 351 . ? 1_555 ? 
127 AE3 8 SER J  351 ? SER L 352 . ? 1_555 ? 
128 AE3 8 ARG J  368 ? ARG L 369 . ? 1_555 ? 
129 AE3 8 HOH TB .   ? HOH L 626 . ? 1_555 ? 
130 AE3 8 HOH TB .   ? HOH L 738 . ? 1_555 ? 
131 AE4 6 ARG K  33  ? ARG N 34  . ? 1_555 ? 
132 AE4 6 TYR K  39  ? TYR N 40  . ? 1_555 ? 
133 AE4 6 ARG K  45  ? ARG N 46  . ? 1_555 ? 
134 AE4 6 SER K  72  ? SER N 73  . ? 1_555 ? 
135 AE4 6 HIS K  379 ? HIS N 380 . ? 1_555 ? 
136 AE4 6 HOH UB .   ? HOH N 614 . ? 1_555 ? 
137 AE5 6 ARG K  318 ? ARG N 319 . ? 1_555 ? 
138 AE5 6 SER K  334 ? SER N 335 . ? 1_555 ? 
139 AE5 6 ASN K  350 ? ASN N 351 . ? 1_555 ? 
140 AE5 6 SER K  351 ? SER N 352 . ? 1_555 ? 
141 AE5 6 ARG K  368 ? ARG N 369 . ? 1_555 ? 
142 AE5 6 HOH UB .   ? HOH N 822 . ? 1_555 ? 
143 AE6 7 SER L  334 ? SER O 335 . ? 1_555 ? 
144 AE6 7 ASN L  350 ? ASN O 351 . ? 1_555 ? 
145 AE6 7 SER L  351 ? SER O 352 . ? 1_555 ? 
146 AE6 7 ARG L  368 ? ARG O 369 . ? 1_555 ? 
147 AE6 7 HOH VB .   ? HOH O 794 . ? 1_555 ? 
148 AE6 7 HOH VB .   ? HOH O 827 . ? 1_555 ? 
149 AE6 7 HOH VB .   ? HOH O 841 . ? 1_555 ? 
150 AE7 5 ARG L  33  ? ARG O 34  . ? 1_555 ? 
151 AE7 5 TYR L  39  ? TYR O 40  . ? 1_555 ? 
152 AE7 5 ARG L  45  ? ARG O 46  . ? 1_555 ? 
153 AE7 5 SER L  72  ? SER O 73  . ? 1_555 ? 
154 AE7 5 HOH VB .   ? HOH O 898 . ? 1_555 ? 
155 AE8 4 SER M  334 ? SER P 335 . ? 1_555 ? 
156 AE8 4 ASN M  350 ? ASN P 351 . ? 1_555 ? 
157 AE8 4 SER M  351 ? SER P 352 . ? 1_555 ? 
158 AE8 4 ARG M  368 ? ARG P 369 . ? 1_555 ? 
159 AE9 6 ARG M  33  ? ARG P 34  . ? 1_555 ? 
160 AE9 6 TYR M  39  ? TYR P 40  . ? 1_555 ? 
161 AE9 6 ARG M  45  ? ARG P 46  . ? 1_555 ? 
162 AE9 6 SER M  72  ? SER P 73  . ? 1_555 ? 
163 AE9 6 ARG M  75  ? ARG P 76  . ? 1_555 ? 
164 AE9 6 HIS M  379 ? HIS P 380 . ? 1_555 ? 
165 AF1 7 SER N  334 ? SER Q 335 . ? 1_555 ? 
166 AF1 7 ASN N  350 ? ASN Q 351 . ? 1_555 ? 
167 AF1 7 SER N  351 ? SER Q 352 . ? 1_555 ? 
168 AF1 7 ARG N  368 ? ARG Q 369 . ? 1_555 ? 
169 AF1 7 HOH XB .   ? HOH Q 742 . ? 1_555 ? 
170 AF1 7 HOH XB .   ? HOH Q 808 . ? 1_555 ? 
171 AF1 7 HOH XB .   ? HOH Q 860 . ? 1_555 ? 
172 AF2 8 TYR N  39  ? TYR Q 40  . ? 1_555 ? 
173 AF2 8 ARG N  45  ? ARG Q 46  . ? 1_555 ? 
174 AF2 8 SER N  72  ? SER Q 73  . ? 1_555 ? 
175 AF2 8 ARG N  75  ? ARG Q 76  . ? 1_555 ? 
176 AF2 8 HIS N  379 ? HIS Q 380 . ? 1_555 ? 
177 AF2 8 HOH XB .   ? HOH Q 781 . ? 1_555 ? 
178 AF2 8 HOH XB .   ? HOH Q 791 . ? 1_555 ? 
179 AF2 8 HOH XB .   ? HOH Q 878 . ? 1_555 ? 
180 AF3 6 SER O  334 ? SER R 335 . ? 1_555 ? 
181 AF3 6 ASN O  350 ? ASN R 351 . ? 1_555 ? 
182 AF3 6 SER O  351 ? SER R 352 . ? 1_555 ? 
183 AF3 6 ARG O  368 ? ARG R 369 . ? 1_555 ? 
184 AF3 6 HOH YB .   ? HOH R 738 . ? 1_555 ? 
185 AF3 6 HOH YB .   ? HOH R 845 . ? 1_555 ? 
186 AF4 8 ARG O  33  ? ARG R 34  . ? 1_555 ? 
187 AF4 8 TYR O  39  ? TYR R 40  . ? 1_555 ? 
188 AF4 8 ARG O  45  ? ARG R 46  . ? 1_555 ? 
189 AF4 8 SER O  72  ? SER R 73  . ? 1_555 ? 
190 AF4 8 HIS O  379 ? HIS R 380 . ? 1_555 ? 
191 AF4 8 HOH YB .   ? HOH R 662 . ? 1_555 ? 
192 AF4 8 HOH YB .   ? HOH R 667 . ? 1_555 ? 
193 AF4 8 HOH YB .   ? HOH R 872 . ? 1_555 ? 
194 AF5 5 SER P  334 ? SER F 335 . ? 1_555 ? 
195 AF5 5 ASN P  350 ? ASN F 351 . ? 1_555 ? 
196 AF5 5 SER P  351 ? SER F 352 . ? 1_555 ? 
197 AF5 5 ARG P  368 ? ARG F 369 . ? 1_555 ? 
198 AF5 5 HOH ZB .   ? HOH F 669 . ? 1_555 ? 
199 AF6 8 ARG P  33  ? ARG F 34  . ? 1_555 ? 
200 AF6 8 TYR P  39  ? TYR F 40  . ? 1_555 ? 
201 AF6 8 ARG P  45  ? ARG F 46  . ? 1_555 ? 
202 AF6 8 SER P  72  ? SER F 73  . ? 1_555 ? 
203 AF6 8 HOH ZB .   ? HOH F 640 . ? 1_555 ? 
204 AF6 8 HOH ZB .   ? HOH F 668 . ? 1_555 ? 
205 AF6 8 HOH ZB .   ? HOH F 696 . ? 1_555 ? 
206 AF6 8 HOH CC .   ? HOH T 735 . ? 1_555 ? 
207 AF7 7 ARG Q  33  ? ARG G 34  . ? 1_555 ? 
208 AF7 7 TYR Q  39  ? TYR G 40  . ? 1_555 ? 
209 AF7 7 ARG Q  45  ? ARG G 46  . ? 1_555 ? 
210 AF7 7 SER Q  72  ? SER G 73  . ? 1_555 ? 
211 AF7 7 HIS Q  379 ? HIS G 380 . ? 1_555 ? 
212 AF7 7 HOH AC .   ? HOH G 645 . ? 1_555 ? 
213 AF7 7 HOH AC .   ? HOH G 695 . ? 1_555 ? 
214 AF8 6 SER Q  334 ? SER G 335 . ? 1_555 ? 
215 AF8 6 ASN Q  350 ? ASN G 351 . ? 1_555 ? 
216 AF8 6 SER Q  351 ? SER G 352 . ? 1_555 ? 
217 AF8 6 ARG Q  368 ? ARG G 369 . ? 1_555 ? 
218 AF8 6 HOH AC .   ? HOH G 682 . ? 1_555 ? 
219 AF8 6 HOH AC .   ? HOH G 702 . ? 1_555 ? 
220 AF9 7 SER R  334 ? SER M 335 . ? 1_555 ? 
221 AF9 7 ASN R  350 ? ASN M 351 . ? 1_555 ? 
222 AF9 7 SER R  351 ? SER M 352 . ? 1_555 ? 
223 AF9 7 ARG R  368 ? ARG M 369 . ? 1_555 ? 
224 AF9 7 HOH BC .   ? HOH M 642 . ? 1_555 ? 
225 AF9 7 HOH BC .   ? HOH M 668 . ? 1_555 ? 
226 AF9 7 HOH BC .   ? HOH M 837 . ? 1_555 ? 
227 AG1 7 ARG R  33  ? ARG M 34  . ? 1_555 ? 
228 AG1 7 TYR R  39  ? TYR M 40  . ? 1_555 ? 
229 AG1 7 ARG R  45  ? ARG M 46  . ? 1_555 ? 
230 AG1 7 SER R  72  ? SER M 73  . ? 1_555 ? 
231 AG1 7 ARG R  75  ? ARG M 76  . ? 1_555 ? 
232 AG1 7 HIS R  379 ? HIS M 380 . ? 1_555 ? 
233 AG1 7 HOH BC .   ? HOH M 770 . ? 1_555 ? 
234 AG2 8 ARG S  33  ? ARG T 34  . ? 1_555 ? 
235 AG2 8 TYR S  39  ? TYR T 40  . ? 1_555 ? 
236 AG2 8 ARG S  45  ? ARG T 46  . ? 1_555 ? 
237 AG2 8 SER S  72  ? SER T 73  . ? 1_555 ? 
238 AG2 8 HIS S  379 ? HIS T 380 . ? 1_555 ? 
239 AG2 8 HOH CC .   ? HOH T 624 . ? 1_555 ? 
240 AG2 8 HOH CC .   ? HOH T 637 . ? 1_555 ? 
241 AG2 8 HOH CC .   ? HOH T 791 . ? 1_555 ? 
242 AG3 5 ARG S  318 ? ARG T 319 . ? 1_555 ? 
243 AG3 5 SER S  334 ? SER T 335 . ? 1_555 ? 
244 AG3 5 ASN S  350 ? ASN T 351 . ? 1_555 ? 
245 AG3 5 SER S  351 ? SER T 352 . ? 1_555 ? 
246 AG3 5 ARG S  368 ? ARG T 369 . ? 1_555 ? 
247 AG4 7 ARG S  268 ? ARG T 269 . ? 1_555 ? 
248 AG4 7 ASP S  269 ? ASP T 270 . ? 1_555 ? 
249 AG4 7 VAL S  270 ? VAL T 271 . ? 1_555 ? 
250 AG4 7 ALA S  275 ? ALA T 276 . ? 1_555 ? 
251 AG4 7 HOH CC .   ? HOH T 627 . ? 1_555 ? 
252 AG4 7 HOH CC .   ? HOH T 665 . ? 1_555 ? 
253 AG4 7 HOH CC .   ? HOH T 870 . ? 1_555 ? 
254 AG5 4 SER T  334 ? SER U 335 . ? 1_555 ? 
255 AG5 4 ASN T  350 ? ASN U 351 . ? 1_555 ? 
256 AG5 4 SER T  351 ? SER U 352 . ? 1_555 ? 
257 AG5 4 ARG T  368 ? ARG U 369 . ? 1_555 ? 
258 AG6 7 ARG T  33  ? ARG U 34  . ? 1_555 ? 
259 AG6 7 TYR T  39  ? TYR U 40  . ? 1_555 ? 
260 AG6 7 ARG T  45  ? ARG U 46  . ? 1_555 ? 
261 AG6 7 SER T  72  ? SER U 73  . ? 1_555 ? 
262 AG6 7 ARG T  75  ? ARG U 76  . ? 1_555 ? 
263 AG6 7 HIS T  379 ? HIS U 380 . ? 1_555 ? 
264 AG6 7 HOH DC .   ? HOH U 792 . ? 1_555 ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1    1 O   L HOH 851  ? ? O   L HOH 1002 ? ? 1.64 
2    1 O   N HOH 642  ? ? O   N HOH 899  ? ? 1.69 
3    1 O   O HOH 615  ? ? O   O HOH 637  ? ? 1.71 
4    1 O   P HOH 729  ? ? O   P HOH 815  ? ? 1.76 
5    1 O   D HOH 675  ? ? O   D HOH 785  ? ? 1.77 
6    1 O   N LYS 296  ? ? O   N HOH 601  ? ? 1.77 
7    1 O   O HOH 987  ? ? O   O HOH 1039 ? ? 1.80 
8    1 O   T HOH 1066 ? ? O   T HOH 1095 ? ? 1.80 
9    1 O   G HOH 809  ? ? O   G HOH 886  ? ? 1.80 
10   1 O   K HOH 841  ? ? O   K HOH 968  ? ? 1.80 
11   1 O   T HOH 682  ? ? O   T HOH 775  ? ? 1.80 
12   1 OE1 M GLU 395  ? ? O   M HOH 601  ? ? 1.80 
13   1 O   M HOH 1128 ? ? O   M HOH 1140 ? ? 1.81 
14   1 O   I HOH 869  ? ? O   I HOH 1116 ? ? 1.81 
15   1 O   A HOH 723  ? ? O   A HOH 925  ? ? 1.81 
16   1 O   H HOH 854  ? ? O   H HOH 1094 ? ? 1.81 
17   1 O   F HOH 625  ? ? O   F HOH 695  ? ? 1.81 
18   1 NH2 A ARG 223  ? ? O   A HOH 601  ? ? 1.81 
19   1 O   C HOH 705  ? ? O   C HOH 1061 ? ? 1.81 
20   1 O   N HOH 831  ? ? O   N HOH 919  ? ? 1.81 
21   1 O   Q HOH 1147 ? ? O   Q HOH 1152 ? ? 1.81 
22   1 O   H HOH 1088 ? ? O   H HOH 1132 ? ? 1.81 
23   1 O   P HOH 898  ? ? O   P HOH 1014 ? ? 1.81 
24   1 O   Q HOH 898  ? ? O   Q HOH 943  ? ? 1.81 
25   1 O   R HOH 963  ? ? O   R HOH 978  ? ? 1.81 
26   1 O   H HOH 1019 ? ? O   H HOH 1122 ? ? 1.81 
27   1 O   I HOH 768  ? ? O   I HOH 812  ? ? 1.81 
28   1 NH2 C ARG 259  ? ? O   C HOH 601  ? ? 1.81 
29   1 O   E HOH 980  ? ? O   E HOH 1104 ? ? 1.81 
30   1 O   C HOH 856  ? ? O   C HOH 1030 ? ? 1.81 
31   1 O   L HOH 808  ? ? O   L HOH 1009 ? ? 1.81 
32   1 O   B HOH 732  ? ? O   B HOH 960  ? ? 1.81 
33   1 O   L HOH 949  ? ? O   L HOH 1007 ? ? 1.81 
34   1 O   G HOH 895  ? ? O   G HOH 1033 ? ? 1.81 
35   1 O   I HOH 881  ? ? O   I HOH 931  ? ? 1.81 
36   1 O   R HOH 1033 ? ? O   R HOH 1122 ? ? 1.81 
37   1 O   N HOH 732  ? ? O   N HOH 852  ? ? 1.81 
38   1 O   F HOH 1065 ? ? O   F HOH 1102 ? ? 1.81 
39   1 O   D HOH 888  ? ? O   D HOH 950  ? ? 1.82 
40   1 O   H HOH 1028 ? ? O   H HOH 1068 ? ? 1.82 
41   1 O   P HOH 728  ? ? O   P HOH 949  ? ? 1.82 
42   1 O   F HOH 1038 ? ? O   F HOH 1094 ? ? 1.82 
43   1 O   E HOH 643  ? ? O   E HOH 677  ? ? 1.82 
44   1 O   Q HOH 1120 ? ? O   Q HOH 1129 ? ? 1.82 
45   1 O   R HOH 673  ? ? O   R HOH 1094 ? ? 1.82 
46   1 O   I HOH 698  ? ? O   I HOH 789  ? ? 1.82 
47   1 O   K HOH 669  ? ? O   K HOH 933  ? ? 1.82 
48   1 O   C HOH 991  ? ? O   C HOH 1137 ? ? 1.82 
49   1 NH1 J ARG 23   ? ? O   J HOH 601  ? ? 1.82 
50   1 O   D HOH 988  ? ? O   D HOH 1116 ? ? 1.82 
51   1 O   C HOH 943  ? ? O   C HOH 952  ? ? 1.82 
52   1 OD1 N ASP 113  ? ? NH1 N ARG 232  ? ? 1.82 
53   1 O   K HOH 1062 ? ? O   K HOH 1089 ? ? 1.82 
54   1 O   Q HOH 1018 ? ? O   Q HOH 1089 ? ? 1.82 
55   1 O   Q HOH 719  ? ? O   U HOH 892  ? ? 1.82 
56   1 O   E HOH 791  ? ? O   E HOH 1015 ? ? 1.82 
57   1 O   C HOH 750  ? ? O   C HOH 950  ? ? 1.82 
58   1 O   U HOH 838  ? ? O   U HOH 869  ? ? 1.83 
59   1 O   C HOH 883  ? ? O   C HOH 1034 ? ? 1.83 
60   1 O   C HOH 901  ? ? O   C HOH 996  ? ? 1.83 
61   1 O   T HOH 810  ? ? O   T HOH 1044 ? ? 1.83 
62   1 O   B HOH 782  ? ? O   B HOH 951  ? ? 1.83 
63   1 O   T LEU 396  ? ? O   T HOH 601  ? ? 1.83 
64   1 O   F HOH 932  ? ? O   F HOH 1106 ? ? 1.83 
65   1 O   C HOH 613  ? ? O   C HOH 871  ? ? 1.83 
66   1 O   T HOH 789  ? ? O   T HOH 956  ? ? 1.83 
67   1 O   L HOH 670  ? ? O   L HOH 741  ? ? 1.83 
68   1 O   N HOH 1075 ? ? O   N HOH 1091 ? ? 1.83 
69   1 O   F HOH 909  ? ? O   F HOH 1067 ? ? 1.83 
70   1 O   G HOH 1031 ? ? O   G HOH 1047 ? ? 1.83 
71   1 O   R ILE 238  ? ? O   R HOH 601  ? ? 1.83 
72   1 O   C HOH 1079 ? ? O   C HOH 1196 ? ? 1.83 
73   1 O   Q HOH 1013 ? ? O   Q HOH 1116 ? ? 1.83 
74   1 O   H HOH 898  ? ? O   H HOH 987  ? ? 1.84 
75   1 O   Q HOH 773  ? ? O   Q HOH 1059 ? ? 1.84 
76   1 O   I HOH 726  ? ? O   I HOH 987  ? ? 1.84 
77   1 NZ  T LYS 215  ? ? O   T HOH 602  ? ? 1.84 
78   1 O   T HOH 684  ? ? O   T HOH 874  ? ? 1.84 
79   1 O   B HOH 729  ? ? O   B HOH 1007 ? ? 1.84 
80   1 OG1 P THR 105  ? ? O   P HOH 601  ? ? 1.84 
81   1 O   U HOH 758  ? ? O   U HOH 806  ? ? 1.84 
82   1 OD1 A ASP 113  ? ? O   A HOH 602  ? ? 1.84 
83   1 O   T HOH 996  ? ? O   T HOH 1039 ? ? 1.84 
84   1 O   O HOH 907  ? ? O   O HOH 965  ? ? 1.84 
85   1 O   E HOH 1123 ? ? O   E HOH 1168 ? ? 1.84 
86   1 O   L HOH 674  ? ? O   L HOH 991  ? ? 1.84 
87   1 O   E HOH 970  ? ? O   E HOH 981  ? ? 1.84 
88   1 O   E HOH 699  ? ? O   E HOH 931  ? ? 1.84 
89   1 O   I HOH 1068 ? ? O   G HOH 976  ? ? 1.84 
90   1 OE1 O GLU 91   ? ? O   O HOH 601  ? ? 1.84 
91   1 O   I HOH 1076 ? ? O   I HOH 1099 ? ? 1.84 
92   1 O   J HOH 732  ? ? O   J HOH 737  ? ? 1.84 
93   1 OG1 B THR 346  ? B O   B HOH 601  ? ? 1.84 
94   1 O   I HOH 1101 ? ? O   I HOH 1146 ? ? 1.84 
95   1 O   D HOH 1144 ? ? O   D HOH 1159 ? ? 1.85 
96   1 O   I HOH 1044 ? ? O   I HOH 1139 ? ? 1.85 
97   1 O   G HOH 943  ? ? O   G HOH 1052 ? ? 1.85 
98   1 O   K HOH 1011 ? ? O   K HOH 1046 ? ? 1.85 
99   1 O   O HOH 747  ? ? O   O HOH 1001 ? ? 1.85 
100  1 O   P HOH 1084 ? ? O   P HOH 1104 ? ? 1.85 
101  1 O   C HOH 1119 ? ? O   C HOH 1174 ? ? 1.85 
102  1 O   I HOH 726  ? ? O   I HOH 955  ? ? 1.85 
103  1 O   L ALA 254  ? ? O   L HOH 601  ? ? 1.85 
104  1 O   D HOH 830  ? ? O   D HOH 1043 ? ? 1.85 
105  1 OD2 N ASP 113  ? ? NH2 N ARG 232  ? ? 1.85 
106  1 O   E HOH 609  ? ? O   E HOH 649  ? ? 1.85 
107  1 OD1 A ASN 358  ? ? O   A HOH 603  ? ? 1.85 
108  1 O   B HOH 938  ? ? O   B HOH 1004 ? ? 1.85 
109  1 O   A HOH 799  ? ? O   A HOH 947  ? ? 1.85 
110  1 O   G HOH 666  ? ? O   G HOH 961  ? ? 1.85 
111  1 NH2 P ARG 259  ? ? O   P HOH 602  ? ? 1.85 
112  1 O   Q HOH 745  ? ? O   Q HOH 1065 ? ? 1.85 
113  1 O   F GLU 265  ? ? O   F HOH 601  ? ? 1.85 
114  1 NH2 U ARG 166  ? ? O   U HOH 601  ? ? 1.85 
115  1 O   L HOH 1055 ? ? O   L HOH 1072 ? ? 1.85 
116  1 O   C VAL 115  ? ? O   C HOH 602  ? ? 1.85 
117  1 O   P HOH 695  ? ? O   P HOH 1020 ? ? 1.85 
118  1 O   A HOH 866  ? ? O   A HOH 977  ? ? 1.85 
119  1 O   Q HOH 898  ? ? O   Q HOH 1025 ? ? 1.85 
120  1 O   J HOH 1229 ? ? O   J HOH 1236 ? ? 1.85 
121  1 O   N HOH 1073 ? ? O   N HOH 1080 ? ? 1.85 
122  1 O   Q MET 167  ? ? O   Q HOH 601  ? ? 1.85 
123  1 O   T HOH 900  ? ? O   T HOH 952  ? ? 1.85 
124  1 OE1 H GLU 182  ? ? O   H HOH 601  ? ? 1.85 
125  1 O   L HOH 686  ? ? O   L HOH 950  ? ? 1.86 
126  1 O   K HOH 728  ? ? O   K HOH 839  ? ? 1.86 
127  1 O   G HOH 1072 ? ? O   G HOH 1082 ? ? 1.86 
128  1 O   A HOH 890  ? ? O   A HOH 965  ? ? 1.86 
129  1 O   I HOH 643  ? ? O   I HOH 978  ? ? 1.86 
130  1 O   J HOH 611  ? ? O   J HOH 850  ? ? 1.86 
131  1 O   M HOH 915  ? ? O   M HOH 1072 ? ? 1.86 
132  1 O   Q HOH 1044 ? ? O   Q HOH 1113 ? ? 1.86 
133  1 O   C HOH 750  ? ? O   C HOH 1006 ? ? 1.86 
134  1 O   E HOH 1006 ? ? O   E HOH 1087 ? ? 1.86 
135  1 O   P HOH 757  ? ? O   P HOH 955  ? ? 1.86 
136  1 O   A HOH 905  ? ? O   A HOH 912  ? ? 1.86 
137  1 O   H TYR 241  ? ? O   H HOH 602  ? ? 1.86 
138  1 O   P HOH 852  ? ? O   P HOH 972  ? ? 1.86 
139  1 O   C HOH 1016 ? ? O   C HOH 1152 ? ? 1.86 
140  1 O   I HOH 1030 ? ? O   I HOH 1132 ? ? 1.86 
141  1 O   K HOH 802  ? ? O   K HOH 1015 ? ? 1.86 
142  1 O   C HOH 968  ? ? O   C HOH 1041 ? ? 1.86 
143  1 O   H HOH 946  ? ? O   H HOH 969  ? ? 1.87 
144  1 NH2 I ARG 80   ? ? O   I HOH 601  ? ? 1.87 
145  1 OD2 M ASP 192  ? ? O   M HOH 602  ? ? 1.87 
146  1 O   N HOH 816  ? ? O   N HOH 950  ? ? 1.87 
147  1 O   F HOH 607  ? ? O   F HOH 725  ? ? 1.87 
148  1 O   E HOH 806  ? ? O   E HOH 1081 ? ? 1.87 
149  1 O   Q HOH 880  ? ? O   Q HOH 1009 ? ? 1.87 
150  1 O   U HOH 644  ? ? O   U HOH 1032 ? ? 1.87 
151  1 O   U HOH 935  ? ? O   U HOH 1069 ? ? 1.87 
152  1 O   A HOH 630  ? ? O   A HOH 731  ? ? 1.87 
153  1 O   R LEU 419  ? ? O   R HOH 602  ? ? 1.87 
154  1 O   J HOH 614  ? ? O   J HOH 974  ? ? 1.87 
155  1 O   K HOH 1011 ? ? O   K HOH 1078 ? ? 1.87 
156  1 O   K HOH 739  ? ? O   K HOH 1028 ? ? 1.87 
157  1 O   C HOH 973  ? ? O   C HOH 1107 ? ? 1.87 
158  1 O   C HOH 1100 ? ? O   G HOH 919  ? ? 1.87 
159  1 O   P HOH 998  ? ? O   P HOH 1057 ? ? 1.87 
160  1 OG  E SER 414  ? ? O   E HOH 601  ? ? 1.87 
161  1 O   N HOH 623  ? ? O   N HOH 818  ? ? 1.87 
162  1 O   I HOH 811  ? ? O   I HOH 1071 ? ? 1.87 
163  1 O   T HOH 769  ? ? O   T HOH 1121 ? ? 1.87 
164  1 O   H HOH 1135 ? ? O   H HOH 1139 ? ? 1.87 
165  1 NZ  N LYS 189  ? ? O   N HOH 602  ? ? 1.87 
166  1 O   R HOH 902  ? ? O   R HOH 1025 ? ? 1.87 
167  1 O   L HOH 1023 ? ? O   L HOH 1085 ? ? 1.87 
168  1 O   U HOH 737  ? ? O   U HOH 924  ? ? 1.87 
169  1 OD1 A ASN 351  ? ? O   A HOH 604  ? ? 1.87 
170  1 O   F HOH 1057 ? ? O   F HOH 1083 ? ? 1.87 
171  1 O   N HOH 853  ? ? O   N HOH 934  ? ? 1.87 
172  1 O   K HOH 680  ? ? O   K HOH 969  ? ? 1.87 
173  1 O   O LEU 147  ? ? O   O HOH 602  ? ? 1.87 
174  1 O   U HOH 671  ? ? O   U HOH 938  ? ? 1.87 
175  1 O   J HOH 1074 ? ? O   J HOH 1112 ? ? 1.87 
176  1 O   F HOH 925  ? ? O   F HOH 1051 ? ? 1.88 
177  1 O   N HOH 941  ? ? O   N HOH 981  ? ? 1.88 
178  1 OE1 H GLU 123  ? ? O   H HOH 603  ? ? 1.88 
179  1 O   E HOH 861  ? ? O   E HOH 892  ? ? 1.88 
180  1 O   R HOH 822  ? ? O   R HOH 916  ? ? 1.88 
181  1 O   L HOH 944  ? ? O   L HOH 1033 ? ? 1.88 
182  1 O   E HOH 846  ? ? O   E HOH 1125 ? ? 1.88 
183  1 NZ  H LYS 236  ? ? O   H HOH 604  ? ? 1.88 
184  1 OE1 C GLN 68   ? ? O   C HOH 603  ? ? 1.88 
185  1 O   U ALA 323  ? ? O   U HOH 602  ? ? 1.88 
186  1 O   T HOH 615  ? ? O   T HOH 951  ? ? 1.88 
187  1 O   G HOH 798  ? ? O   G HOH 919  ? ? 1.88 
188  1 NH1 M ARG 222  ? ? O   M HOH 603  ? ? 1.88 
189  1 O   Q HOH 683  ? ? O   Q HOH 856  ? ? 1.88 
190  1 O   A HOH 1052 ? ? O   P HOH 1061 ? ? 1.88 
191  1 O   N HOH 898  ? ? O   N HOH 1052 ? ? 1.88 
192  1 O   J HOH 870  ? ? O   J HOH 1043 ? ? 1.88 
193  1 O   J HOH 642  ? ? O   J HOH 931  ? ? 1.88 
194  1 O   U HOH 890  ? ? O   U HOH 1088 ? ? 1.88 
195  1 O   N HOH 983  ? ? O   N HOH 1016 ? ? 1.88 
196  1 O   M HOH 1031 ? ? O   M HOH 1080 ? ? 1.88 
197  1 NH2 F ARG 26   ? ? O   F HOH 602  ? ? 1.88 
198  1 O   A HOH 885  ? ? O   A HOH 1034 ? ? 1.88 
199  1 NH1 E ARG 76   ? ? O   E HOH 602  ? ? 1.88 
200  1 O   B HOH 932  ? ? O   B HOH 949  ? ? 1.88 
201  1 OH  U TYR 69   ? ? O   U HOH 603  ? ? 1.88 
202  1 O   I HOH 852  ? ? O   I HOH 970  ? ? 1.88 
203  1 OE2 M GLU 109  ? ? O   M HOH 604  ? ? 1.88 
204  1 O   F HOH 1075 ? ? O   U HOH 1019 ? ? 1.89 
205  1 O   F HOH 914  ? ? O   F HOH 959  ? ? 1.89 
206  1 O   I HOH 618  ? ? O   I HOH 961  ? ? 1.89 
207  1 O   O HOH 931  ? ? O   O HOH 1013 ? ? 1.89 
208  1 O   K HOH 873  ? ? O   K HOH 1005 ? ? 1.89 
209  1 OG  N SER 322  ? ? O   N HOH 603  ? ? 1.89 
210  1 O   A HOH 745  ? ? O   A HOH 811  ? ? 1.89 
211  1 O   M HOH 1019 ? ? O   M HOH 1021 ? ? 1.89 
212  1 O   C HOH 736  ? ? O   H HOH 959  ? ? 1.89 
213  1 O   B HOH 922  ? ? O   K HOH 1034 ? ? 1.89 
214  1 O   E HOH 940  ? ? O   E HOH 978  ? ? 1.89 
215  1 O   B HOH 785  ? ? O   B HOH 1017 ? ? 1.89 
216  1 O   M HOH 781  ? ? O   M HOH 976  ? ? 1.89 
217  1 O   M HOH 928  ? ? O   M HOH 1093 ? ? 1.89 
218  1 O   E HOH 656  ? ? O   E HOH 766  ? ? 1.89 
219  1 O   K HOH 836  ? ? O   K HOH 1010 ? ? 1.89 
220  1 NE2 H GLN 372  ? ? O   H HOH 605  ? ? 1.89 
221  1 O   U HOH 752  ? ? O   U HOH 892  ? ? 1.89 
222  1 O   I HOH 914  ? ? O   I HOH 986  ? ? 1.89 
223  1 O   I HOH 825  ? ? O   I HOH 865  ? ? 1.89 
224  1 O   K PHE 41   ? ? O   K HOH 601  ? ? 1.89 
225  1 NZ  U LYS 44   ? ? O   U HOH 604  ? ? 1.89 
226  1 OD1 I ASP 224  ? ? O   I HOH 602  ? ? 1.89 
227  1 O   D HOH 849  ? ? O   D HOH 851  ? ? 1.89 
228  1 O   B ARG 166  ? ? O   B HOH 602  ? ? 1.89 
229  1 OD1 D ASP 32   ? ? O   D HOH 601  ? ? 1.89 
230  1 O   O HOH 1106 ? ? O   O HOH 1129 ? ? 1.89 
231  1 O   H HOH 688  ? ? O   H HOH 1034 ? ? 1.89 
232  1 O   Q HOH 958  ? ? O   Q HOH 968  ? ? 1.89 
233  1 O   G ALA 98   ? ? O   G HOH 601  ? ? 1.89 
234  1 O   F HOH 620  ? ? O   F HOH 649  ? ? 1.89 
235  1 O   J HOH 869  ? ? O   J HOH 897  ? ? 1.89 
236  1 O   I HOH 908  ? ? O   I HOH 1095 ? ? 1.89 
237  1 O   F HOH 816  ? ? O   F HOH 978  ? ? 1.89 
238  1 O   K HOH 926  ? ? O   Q HOH 704  ? ? 1.89 
239  1 O   G HOH 949  ? ? O   G HOH 1042 ? ? 1.89 
240  1 O   E HOH 941  ? ? O   E HOH 1082 ? ? 1.89 
241  1 O   N HOH 797  ? ? O   N HOH 830  ? ? 1.90 
242  1 O   R HOH 958  ? ? O   R HOH 1010 ? ? 1.90 
243  1 O   A HOH 873  ? ? O   A HOH 913  ? ? 1.90 
244  1 O   P GLY 235  ? ? O   P HOH 603  ? ? 1.90 
245  1 OD1 I ASP 316  ? ? O   I HOH 603  ? ? 1.90 
246  1 O   K GLY 235  ? ? O   K HOH 602  ? ? 1.90 
247  1 O   I HOH 975  ? ? O   I HOH 1155 ? ? 1.90 
248  1 O   B GLN 68   ? ? O   B HOH 603  ? ? 1.90 
249  1 O   N HOH 730  ? ? O   N HOH 1043 ? ? 1.90 
250  1 O   U ARG 76   ? ? O   U HOH 605  ? ? 1.90 
251  1 O   O HOH 741  ? ? O   O HOH 1001 ? ? 1.90 
252  1 OD1 O ASN 375  ? ? O   O HOH 603  ? ? 1.90 
253  1 O   G HOH 1018 ? ? O   G HOH 1037 ? ? 1.90 
254  1 O   U GLU 200  ? ? O   U HOH 606  ? ? 1.90 
255  1 O   G HOH 943  ? ? O   G HOH 1007 ? ? 1.90 
256  1 O   B HOH 770  ? ? O   B HOH 1026 ? ? 1.90 
257  1 OE1 I GLU 179  ? ? O   I HOH 604  ? ? 1.90 
258  1 O   D THR 158  ? ? O   D HOH 602  ? ? 1.90 
259  1 OG1 B THR 346  ? A O   B HOH 601  ? ? 1.90 
260  1 O   C HOH 680  ? ? O   C HOH 1030 ? ? 1.90 
261  1 OE1 Q GLU 392  ? ? O   Q HOH 602  ? ? 1.90 
262  1 O   M HOH 742  ? ? O   M HOH 825  ? ? 1.90 
263  1 O   C HOH 956  ? ? O   C HOH 962  ? ? 1.90 
264  1 O   T HOH 837  ? ? O   T HOH 1107 ? ? 1.90 
265  1 O   L HOH 855  ? ? O   L HOH 1026 ? ? 1.90 
266  1 O   D HOH 794  ? ? O   D HOH 986  ? ? 1.90 
267  1 OD2 R ASP 233  ? ? O   R HOH 603  ? ? 1.90 
268  1 O   O HOH 1086 ? ? O   O HOH 1124 ? ? 1.90 
269  1 O   J HOH 948  ? ? O   J HOH 950  ? ? 1.90 
270  1 NH1 P ARG 349  ? ? O   P HOH 604  ? ? 1.90 
271  1 O   M HOH 1042 ? ? O   M HOH 1115 ? ? 1.90 
272  1 O   E HOH 635  ? ? O   E HOH 666  ? ? 1.90 
273  1 O   B HOH 726  ? ? O   B HOH 821  ? ? 1.90 
274  1 O   L HOH 618  ? ? O   L HOH 692  ? ? 1.91 
275  1 OD1 K ASP 397  ? ? O   K HOH 603  ? ? 1.91 
276  1 O   T HOH 713  ? ? O   T HOH 842  ? ? 1.91 
277  1 O   H HOH 687  ? ? O   H HOH 913  ? ? 1.91 
278  1 O   A HOH 861  ? ? O   A HOH 990  ? ? 1.91 
279  1 O   K GLY 407  ? ? O   K HOH 604  ? ? 1.91 
280  1 O   T HOH 727  ? ? O   T HOH 1014 ? ? 1.91 
281  1 O   D HOH 1077 ? ? O   K HOH 1112 ? ? 1.91 
282  1 O   D HOH 929  ? ? O   K HOH 1014 ? ? 1.91 
283  1 O   I HOH 666  ? ? O   I HOH 897  ? ? 1.91 
284  1 O   Q HOH 714  ? ? O   Q HOH 737  ? ? 1.91 
285  1 O   U HOH 819  ? ? O   U HOH 903  ? ? 1.91 
286  1 O   O HOH 1050 ? ? O   O HOH 1195 ? ? 1.91 
287  1 O   B HOH 653  ? ? O   B HOH 830  ? ? 1.91 
288  1 O   T HOH 779  ? ? O   T HOH 1103 ? ? 1.91 
289  1 O   L LEU 291  ? ? O   L HOH 602  ? ? 1.91 
290  1 O   N HOH 954  ? ? O   N HOH 1070 ? ? 1.91 
291  1 O   M HOH 685  ? ? O   M HOH 708  ? ? 1.91 
292  1 O   C HOH 1046 ? ? O   H HOH 808  ? ? 1.91 
293  1 OE1 Q GLU 128  ? ? O   Q HOH 603  ? ? 1.91 
294  1 O   C HOH 793  ? ? O   C HOH 867  ? ? 1.91 
295  1 O   Q HOH 953  ? ? O   Q HOH 1118 ? ? 1.91 
296  1 OE1 M GLU 163  ? ? O   M HOH 605  ? ? 1.91 
297  1 O   P HOH 879  ? ? O   P HOH 1027 ? ? 1.91 
298  1 O   J HOH 883  ? ? O   J HOH 983  ? ? 1.91 
299  1 OD1 E ASP 224  ? ? O   E HOH 603  ? ? 1.91 
300  1 OD1 P ASP 420  ? ? O   P HOH 605  ? ? 1.91 
301  1 O   R HOH 1111 ? ? O   R HOH 1113 ? ? 1.91 
302  1 O   E HOH 1042 ? ? O   E HOH 1138 ? ? 1.91 
303  1 OD2 M ASP 397  ? ? O   M HOH 606  ? ? 1.91 
304  1 O   D HOH 1166 ? ? O   D HOH 1171 ? ? 1.91 
305  1 O   F HOH 991  ? ? O   F HOH 1016 ? ? 1.92 
306  1 O   J HOH 1226 ? ? O   J HOH 1238 ? ? 1.92 
307  1 NE  R ARG 232  ? ? O   R HOH 604  ? ? 1.92 
308  1 O   I HOH 646  ? ? O   I HOH 774  ? ? 1.92 
309  1 O   M HOH 1136 ? ? O   M HOH 1146 ? ? 1.92 
310  1 O   K HOH 910  ? ? O   K HOH 944  ? ? 1.92 
311  1 O   D HOH 1013 ? ? O   D HOH 1038 ? ? 1.92 
312  1 OG1 N THR 346  ? ? O   N HOH 604  ? ? 1.92 
313  1 O   T HOH 806  ? ? O   T HOH 1045 ? ? 1.92 
314  1 O   F HOH 702  ? ? O   F HOH 1066 ? ? 1.92 
315  1 O   Q HOH 993  ? ? O   Q HOH 1018 ? ? 1.92 
316  1 O   G HOH 981  ? ? O   G HOH 1018 ? ? 1.92 
317  1 O   F HOH 1068 ? ? O   F HOH 1095 ? ? 1.92 
318  1 O   R HOH 906  ? ? O   R HOH 1083 ? ? 1.92 
319  1 O   F HOH 948  ? ? O   F HOH 985  ? ? 1.92 
320  1 O   J VAL 243  ? ? O   J HOH 602  ? ? 1.92 
321  1 O   O VAL 115  ? ? O   O HOH 604  ? ? 1.92 
322  1 O   O HOH 727  ? ? O   O HOH 1087 ? ? 1.92 
323  1 O   L HOH 863  ? ? O   L HOH 978  ? ? 1.92 
324  1 O   C HOH 1000 ? ? O   I HOH 1013 ? ? 1.92 
325  1 O   B HOH 623  ? ? O   B HOH 900  ? ? 1.92 
326  1 O   J HOH 975  ? ? O   J HOH 1187 ? ? 1.92 
327  1 O4  A SO4 501  ? ? O   A HOH 604  ? ? 1.92 
328  1 O   R HOH 880  ? ? O   R HOH 1015 ? ? 1.92 
329  1 O   F HOH 1100 ? ? O   F HOH 1128 ? ? 1.92 
330  1 O   R THR 105  ? ? O   R HOH 605  ? ? 1.92 
331  1 O   E HOH 934  ? ? O   E HOH 1031 ? ? 1.92 
332  1 OE2 E GLU 405  ? ? O   E HOH 604  ? ? 1.92 
333  1 O   E HOH 762  ? ? O   E HOH 901  ? ? 1.92 
334  1 O   H HOH 960  ? ? O   H HOH 1007 ? ? 1.92 
335  1 O   M HOH 1053 ? ? O   M HOH 1140 ? ? 1.92 
336  1 O   E HOH 660  ? ? O   E HOH 986  ? ? 1.92 
337  1 O   O HOH 858  ? ? O   O HOH 1160 ? ? 1.92 
338  1 O   C HOH 652  ? ? O   C HOH 897  ? ? 1.92 
339  1 O   M ASP 255  ? ? O   M HOH 607  ? ? 1.92 
340  1 O   U HOH 885  ? ? O   U HOH 905  ? ? 1.92 
341  1 OG1 C THR 346  ? ? O   C HOH 604  ? ? 1.92 
342  1 O   P HOH 761  ? ? O   P HOH 944  ? ? 1.92 
343  1 O   G HOH 952  ? ? O   G HOH 999  ? ? 1.92 
344  1 O   N HOH 1031 ? ? O   N HOH 1066 ? ? 1.92 
345  1 OE1 U GLN 149  ? ? O   U HOH 607  ? ? 1.92 
346  1 O   G HIS 264  ? ? O   G HOH 602  ? ? 1.92 
347  1 O   L HOH 914  ? ? O   L HOH 1033 ? ? 1.92 
348  1 OH  B TYR 241  ? ? O   B HOH 604  ? ? 1.92 
349  1 NE2 H GLN 149  ? ? O   H HOH 606  ? ? 1.93 
350  1 O   K HOH 614  ? ? O   K HOH 830  ? ? 1.93 
351  1 O   M HOH 1040 ? ? O   M HOH 1130 ? ? 1.93 
352  1 O   O HOH 658  ? ? O   O HOH 1074 ? ? 1.93 
353  1 O   K HOH 864  ? ? O   K HOH 1097 ? ? 1.93 
354  1 O   I HOH 947  ? ? O   I HOH 990  ? ? 1.93 
355  1 O   H HOH 1108 ? ? O   K HOH 1088 ? ? 1.93 
356  1 O   U GLY 235  ? ? O   U HOH 608  ? ? 1.93 
357  1 O   K HOH 992  ? ? O   K HOH 1045 ? ? 1.93 
358  1 O   D HOH 678  ? ? O   D HOH 968  ? ? 1.93 
359  1 O   G HOH 991  ? ? O   G HOH 1051 ? ? 1.93 
360  1 O   F HOH 1057 ? ? O   F HOH 1059 ? ? 1.93 
361  1 O   T HOH 1037 ? ? O   T HOH 1047 ? ? 1.93 
362  1 O   H PRO 240  ? ? O   H HOH 607  ? ? 1.93 
363  1 O   U HOH 659  ? ? O   U HOH 770  ? ? 1.93 
364  1 O   C HOH 1164 ? ? O   H HOH 1052 ? ? 1.93 
365  1 O   A HOH 849  ? ? O   A HOH 960  ? ? 1.93 
366  1 O   H HOH 800  ? ? O   H HOH 1052 ? ? 1.93 
367  1 O   U HOH 972  ? ? O   U HOH 1060 ? ? 1.93 
368  1 O   T HOH 662  ? ? O   T HOH 860  ? ? 1.93 
369  1 NE2 T GLN 79   ? ? O   T HOH 603  ? ? 1.93 
370  1 O   O HOH 667  ? ? O   O HOH 1008 ? ? 1.93 
371  1 O   F HOH 900  ? ? O   F HOH 949  ? ? 1.93 
372  1 O   F HOH 789  ? ? O   F HOH 981  ? ? 1.93 
373  1 O   U HOH 859  ? ? O   U HOH 1103 ? ? 1.93 
374  1 O   N HOH 674  ? ? O   N HOH 941  ? ? 1.93 
375  1 O   R HOH 1159 ? ? O   R HOH 1175 ? ? 1.93 
376  1 O   F HOH 1123 ? ? O   U HOH 1100 ? ? 1.93 
377  1 O   N HOH 808  ? ? O   N HOH 1010 ? ? 1.93 
378  1 N   D ARG 319  ? ? O   D HOH 603  ? ? 1.93 
379  1 O   D HOH 841  ? ? O   D HOH 881  ? ? 1.93 
380  1 O   J HOH 704  ? ? O   J HOH 1009 ? ? 1.93 
381  1 O   K THR 404  ? ? O   K HOH 605  ? ? 1.93 
382  1 NH2 N ARG 166  ? ? O   N HOH 605  ? ? 1.93 
383  1 O   C HOH 639  ? ? O   C HOH 670  ? ? 1.93 
384  1 OE1 C GLU 392  ? ? O   C HOH 605  ? ? 1.93 
385  1 O   B HOH 941  ? ? O   B HOH 969  ? ? 1.93 
386  1 O   I HOH 1132 ? ? O   I HOH 1199 ? ? 1.93 
387  1 O2  E SO4 502  ? ? O   E HOH 605  ? ? 1.93 
388  1 O   R HOH 1026 ? ? O   R HOH 1093 ? ? 1.93 
389  1 O   P ARG 166  ? ? O   P HOH 606  ? ? 1.93 
390  1 O   Q HOH 923  ? ? O   U HOH 611  ? ? 1.93 
391  1 O   J PHE 84   ? ? O   J HOH 603  ? ? 1.94 
392  1 OD1 M ASN 375  ? ? O   M HOH 608  ? ? 1.94 
393  1 O   R HOH 1196 ? ? O   R HOH 1197 ? ? 1.94 
394  1 O   L HOH 957  ? ? O   L HOH 975  ? ? 1.94 
395  1 O   L VAL 7    ? ? O   L HOH 603  ? ? 1.94 
396  1 O   H HOH 615  ? ? O   H HOH 1002 ? ? 1.94 
397  1 OG  N SER 364  ? ? O   N HOH 606  ? ? 1.94 
398  1 O   R HOH 947  ? ? O   R HOH 1152 ? ? 1.94 
399  1 O   A HOH 1009 ? ? O   A HOH 1041 ? ? 1.94 
400  1 O   D HOH 917  ? ? O   D HOH 1118 ? ? 1.94 
401  1 O   C HOH 898  ? ? O   H HOH 609  ? ? 1.94 
402  1 O   L HOH 983  ? ? O   L HOH 1069 ? ? 1.94 
403  1 O   D HOH 611  ? ? O   D HOH 881  ? ? 1.94 
404  1 O   E HOH 641  ? ? O   E HOH 798  ? ? 1.94 
405  1 O   A HOH 605  ? ? O   A HOH 685  ? ? 1.94 
406  1 NH1 G ARG 402  ? ? O   G HOH 603  ? ? 1.94 
407  1 O   A HOH 948  ? ? O   A HOH 1083 ? ? 1.94 
408  1 NZ  C LYS 247  ? ? O   C HOH 606  ? ? 1.94 
409  1 O   U HOH 968  ? ? O   U HOH 1031 ? ? 1.94 
410  1 O   A HOH 734  ? ? O   A HOH 1005 ? ? 1.94 
411  1 O   R HOH 661  ? ? O   R HOH 876  ? ? 1.94 
412  1 O   D HOH 1131 ? ? O   D HOH 1164 ? ? 1.94 
413  1 O   L HOH 634  ? ? O   L HOH 893  ? ? 1.94 
414  1 O   I HOH 881  ? ? O   I HOH 1149 ? ? 1.94 
415  1 O   P HOH 925  ? ? O   P HOH 1006 ? ? 1.94 
416  1 NH1 M ARG 252  ? ? O   M HOH 609  ? ? 1.94 
417  1 O   U HOH 945  ? ? O   U HOH 1025 ? ? 1.94 
418  1 O   M HOH 945  ? ? O   M HOH 1088 ? ? 1.94 
419  1 O   P HOH 1024 ? ? O   P HOH 1064 ? ? 1.94 
420  1 O   B GLU 29   ? ? O   B HOH 605  ? ? 1.94 
421  1 O   O HOH 1053 ? ? O   O HOH 1148 ? ? 1.94 
422  1 O   P HOH 650  ? ? O   P HOH 707  ? ? 1.94 
423  1 O   P HOH 855  ? ? O   P HOH 927  ? ? 1.94 
424  1 O   T HOH 1090 ? ? O   T HOH 1150 ? ? 1.94 
425  1 O   B HOH 1016 ? ? O   B HOH 1059 ? ? 1.95 
426  1 O   Q HOH 971  ? ? O   Q HOH 1045 ? ? 1.95 
427  1 O   O ASP 227  ? ? O   O HOH 605  ? ? 1.95 
428  1 O   Q HOH 1071 ? ? O   Q HOH 1133 ? ? 1.95 
429  1 O   B HOH 905  ? ? O   B HOH 952  ? ? 1.95 
430  1 OE2 C GLU 123  ? ? O   C HOH 607  ? ? 1.95 
431  1 O   E HOH 603  ? ? O   E HOH 874  ? ? 1.95 
432  1 O   T HOH 620  ? ? O   T HOH 719  ? ? 1.95 
433  1 NH1 N ARG 166  ? ? OD1 N ASP 192  ? ? 1.95 
434  1 O   D HOH 891  ? ? O   D HOH 999  ? ? 1.95 
435  1 OG1 G THR 412  ? ? O   G HOH 604  ? ? 1.95 
436  1 O   D HOH 1002 ? ? O   D HOH 1046 ? ? 1.95 
437  1 O   N HOH 848  ? ? O   N HOH 879  ? ? 1.95 
438  1 O   U GLN 106  ? ? O   U HOH 609  ? ? 1.95 
439  1 OH  J TYR 241  ? ? O   J HOH 604  ? ? 1.95 
440  1 O   O HOH 1095 ? ? O   O HOH 1146 ? ? 1.95 
441  1 O   J GLU 200  ? ? O   J HOH 605  ? ? 1.95 
442  1 O   A HOH 792  ? ? O   A HOH 1015 ? ? 1.95 
443  1 OD1 G ASP 397  ? ? O   G HOH 605  ? ? 1.95 
444  1 O   M HOH 893  ? ? O   M HOH 1001 ? ? 1.95 
445  1 O   O GLN 106  ? ? O   O HOH 606  ? ? 1.95 
446  1 O   P HOH 819  ? ? O   P HOH 1072 ? ? 1.95 
447  1 O   P HOH 635  ? ? O   P HOH 688  ? ? 1.95 
448  1 O   U HOH 1103 ? ? O   U HOH 1116 ? ? 1.95 
449  1 O   O HOH 900  ? ? O   O HOH 1115 ? ? 1.95 
450  1 O   A HOH 1007 ? ? O   P HOH 1091 ? ? 1.95 
451  1 O   R HOH 952  ? ? O   R HOH 1053 ? ? 1.95 
452  1 O   I HOH 1016 ? ? O   I HOH 1037 ? ? 1.95 
453  1 O   B HOH 711  ? ? O   B HOH 748  ? ? 1.95 
454  1 O   A HOH 1032 ? ? O   P HOH 944  ? ? 1.95 
455  1 O   G HOH 800  ? ? O   G HOH 891  ? ? 1.95 
456  1 O   R HOH 869  ? ? O   R HOH 1059 ? ? 1.95 
457  1 O   H HOH 715  ? ? O   H HOH 752  ? ? 1.95 
458  1 O   N SER 260  ? ? O   N HOH 607  ? ? 1.95 
459  1 O   P HOH 678  ? ? O   P HOH 811  ? ? 1.95 
460  1 O   H HOH 946  ? ? O   H HOH 1116 ? ? 1.95 
461  1 NH1 M ARG 223  ? ? O   M HOH 610  ? ? 1.95 
462  1 O   H PRO 97   ? ? O   H HOH 608  ? ? 1.95 
463  1 O   N HOH 905  ? ? O   N HOH 1038 ? ? 1.95 
464  1 O   F HOH 717  ? ? O   F HOH 868  ? ? 1.95 
465  1 O   O HOH 688  ? ? O   O HOH 995  ? ? 1.95 
466  1 O   Q HOH 928  ? ? O   Q HOH 944  ? ? 1.96 
467  1 NH1 U ARG 232  ? ? O   U HOH 610  ? ? 1.96 
468  1 OG  O SER 231  ? ? O   O HOH 607  ? ? 1.96 
469  1 O   D HOH 830  ? ? O   D HOH 878  ? ? 1.96 
470  1 O   N HOH 925  ? ? O   N HOH 1004 ? ? 1.96 
471  1 O   P HOH 809  ? ? O   P HOH 837  ? ? 1.96 
472  1 O   M HOH 872  ? ? O   M HOH 1022 ? ? 1.96 
473  1 O   H HOH 808  ? ? O   H HOH 1035 ? ? 1.96 
474  1 O   R HOH 761  ? ? O   R HOH 1000 ? ? 1.96 
475  1 O   D HOH 686  ? ? O   D HOH 1035 ? ? 1.96 
476  1 O   N HOH 945  ? ? O   N HOH 961  ? ? 1.96 
477  1 OH  Q TYR 353  ? ? O   Q HOH 604  ? ? 1.96 
478  1 O   B HOH 941  ? ? O   B HOH 982  ? ? 1.96 
479  1 O   N HOH 775  ? ? O   N HOH 1012 ? ? 1.96 
480  1 O   O HOH 1053 ? ? O   O HOH 1160 ? ? 1.96 
481  1 O   U HOH 688  ? ? O   U HOH 882  ? ? 1.96 
482  1 O   M HOH 872  ? ? O   M HOH 1037 ? ? 1.96 
483  1 O   B HOH 729  ? ? O   B HOH 889  ? ? 1.96 
484  1 O   B HOH 985  ? ? O   B HOH 1048 ? ? 1.96 
485  1 O   E HOH 1113 ? ? O   E HOH 1152 ? ? 1.96 
486  1 O   K HOH 802  ? ? O   K HOH 1089 ? ? 1.96 
487  1 O   R HOH 766  ? ? O   R HOH 870  ? ? 1.96 
488  1 O   N PRO 228  ? ? O   N HOH 608  ? ? 1.96 
489  1 O   O HOH 982  ? ? O   O HOH 1119 ? ? 1.96 
490  1 O   L HOH 715  ? ? O   L HOH 1045 ? ? 1.96 
491  1 O   A HOH 693  ? ? O   A HOH 952  ? ? 1.96 
492  1 O   L HOH 1016 ? ? O   L HOH 1053 ? ? 1.96 
493  1 O   D HOH 1058 ? ? O   D HOH 1121 ? ? 1.96 
494  1 O   O HOH 963  ? ? O   O HOH 1127 ? ? 1.96 
495  1 O   Q HOH 896  ? ? O   Q HOH 988  ? ? 1.96 
496  1 O   Q HOH 913  ? ? O   Q HOH 926  ? ? 1.96 
497  1 O   O HOH 638  ? ? O   O HOH 1004 ? ? 1.96 
498  1 OD2 O ASP 417  ? ? O   O HOH 608  ? ? 1.96 
499  1 O   O HOH 987  ? ? O   O HOH 1085 ? ? 1.96 
500  1 O   G HOH 942  ? ? O   G HOH 971  ? ? 1.96 
501  1 O   T HOH 1180 ? ? O   T HOH 1187 ? ? 1.96 
502  1 O   Q HOH 905  ? ? O   Q HOH 1028 ? ? 1.96 
503  1 O   M HOH 848  ? ? O   M HOH 1070 ? ? 1.96 
504  1 O   C HOH 667  ? ? O   C HOH 964  ? ? 1.96 
505  1 O   A LYS 70   ? ? O   A HOH 605  ? ? 1.96 
506  1 OG1 K THR 346  ? ? O   K HOH 606  ? ? 1.96 
507  1 O   T HOH 847  ? ? O   T HOH 1025 ? ? 1.96 
508  1 O   N HOH 749  ? ? O   N HOH 809  ? ? 1.96 
509  1 O   J ALA 98   ? ? O   J HOH 606  ? ? 1.96 
510  1 O   B HOH 950  ? ? O   B HOH 1060 ? ? 1.96 
511  1 O   R PRO 97   ? ? O   R HOH 606  ? ? 1.96 
512  1 O   P HOH 952  ? ? O   P HOH 960  ? ? 1.96 
513  1 O   G HOH 685  ? ? O   G HOH 711  ? ? 1.96 
514  1 OD2 C ASP 13   ? ? O   C HOH 608  ? ? 1.96 
515  1 O   F ARG 400  ? ? O   F HOH 603  ? ? 1.96 
516  1 O   D HOH 862  ? ? O   D HOH 947  ? ? 1.96 
517  1 O   C HOH 690  ? ? O   C HOH 729  ? ? 1.96 
518  1 O   A ARG 33   ? ? O   A HOH 606  ? ? 1.96 
519  1 O   U HOH 658  ? ? O   U HOH 964  ? ? 1.97 
520  1 O   A HOH 619  ? ? O   E HOH 835  ? ? 1.97 
521  1 O   G HOH 626  ? ? O   G HOH 907  ? ? 1.97 
522  1 O   J HOH 1117 ? ? O   J HOH 1150 ? ? 1.97 
523  1 O   G HOH 1024 ? ? O   G HOH 1046 ? ? 1.97 
524  1 O   U HOH 946  ? ? O   U HOH 987  ? ? 1.97 
525  1 O   L GLY 160  ? ? O   L HOH 604  ? ? 1.97 
526  1 O   E HOH 796  ? ? O   E HOH 835  ? ? 1.97 
527  1 O1  K SO4 502  ? ? O   K HOH 607  ? ? 1.97 
528  1 O   R HOH 674  ? ? O   R HOH 711  ? ? 1.97 
529  1 O   L HOH 721  ? ? O   L HOH 953  ? ? 1.97 
530  1 N   I VAL 7    ? ? O   I HOH 605  ? ? 1.97 
531  1 O   Q HOH 656  ? ? O   Q HOH 1029 ? ? 1.97 
532  1 O   E ILE 238  ? ? O   E HOH 606  ? ? 1.97 
533  1 NH1 H ARG 80   ? ? O   H HOH 609  ? ? 1.97 
534  1 O   I HOH 1033 ? ? O   I HOH 1182 ? ? 1.97 
535  1 OD2 N ASP 275  ? ? O   N HOH 609  ? ? 1.97 
536  1 NH2 B ARG 166  ? ? O   B HOH 606  ? ? 1.97 
537  1 O   N HOH 703  ? ? O   N HOH 745  ? ? 1.97 
538  1 O   H HOH 1079 ? ? O   H HOH 1103 ? ? 1.97 
539  1 O   B HOH 1044 ? ? O   B HOH 1051 ? ? 1.97 
540  1 O   G THR 105  ? ? O   G HOH 606  ? ? 1.97 
541  1 O   C GLY 198  ? ? O   C HOH 609  ? ? 1.97 
542  1 N   L ALA 226  ? ? O   L HOH 605  ? ? 1.97 
543  1 NE  B ARG 232  ? ? O   B HOH 607  ? ? 1.97 
544  1 O   Q HOH 1150 ? ? O   Q HOH 1155 ? ? 1.97 
545  1 O   L HOH 923  ? ? O   L HOH 988  ? ? 1.97 
546  1 N   T ALA 220  ? ? O   T HOH 604  ? ? 1.97 
547  1 O   U HOH 943  ? ? O   U HOH 1020 ? ? 1.97 
548  1 O   N HOH 835  ? ? O   N HOH 916  ? ? 1.97 
549  1 O   D HOH 900  ? ? O   D HOH 1093 ? ? 1.97 
550  1 O   D HOH 947  ? ? O   D HOH 1062 ? ? 1.97 
551  1 O   J HOH 952  ? ? O   J HOH 1063 ? ? 1.97 
552  1 O   A HOH 962  ? ? O   A HOH 984  ? ? 1.97 
553  1 O   N HOH 677  ? ? O   N HOH 739  ? ? 1.97 
554  1 O   K HOH 1110 ? ? O   K HOH 1122 ? ? 1.97 
555  1 O   P HOH 776  ? ? O   P HOH 1028 ? ? 1.97 
556  1 O   A HOH 941  ? ? O   A HOH 1003 ? ? 1.97 
557  1 O   M HOH 953  ? ? O   M HOH 1036 ? ? 1.97 
558  1 OG1 T THR 105  ? ? O   T HOH 605  ? ? 1.97 
559  1 O   B HOH 995  ? ? O   B HOH 1055 ? ? 1.97 
560  1 O   U HOH 731  ? ? O   U HOH 805  ? ? 1.97 
561  1 O   Q HOH 705  ? ? O   Q HOH 969  ? ? 1.97 
562  1 O   O ALA 112  ? ? O   O HOH 609  ? ? 1.97 
563  1 O   O HOH 895  ? ? O   O HOH 977  ? ? 1.97 
564  1 O   M HOH 939  ? ? O   M HOH 1076 ? ? 1.97 
565  1 O   C HOH 960  ? ? O   I HOH 1013 ? ? 1.97 
566  1 O   M HOH 638  ? ? O   M HOH 988  ? ? 1.97 
567  1 O   A HOH 924  ? ? O   A HOH 954  ? ? 1.97 
568  1 O   O HOH 1079 ? ? O   O HOH 1163 ? ? 1.97 
569  1 O   D HOH 917  ? ? O   D HOH 999  ? ? 1.97 
570  1 O   O HOH 986  ? ? O   O HOH 1100 ? ? 1.97 
571  1 O   R HOH 1151 ? ? O   R HOH 1180 ? ? 1.97 
572  1 NH2 A ARG 61   ? ? O   A HOH 607  ? ? 1.97 
573  1 O   P HOH 859  ? ? O   P HOH 1049 ? ? 1.97 
574  1 OH  E TYR 294  ? ? O   E HOH 607  ? ? 1.97 
575  1 OD2 I ASP 397  ? ? O   I HOH 606  ? ? 1.97 
576  1 O   M HOH 950  ? ? O   M HOH 1002 ? ? 1.97 
577  1 O   D HOH 638  ? ? O   D HOH 1000 ? ? 1.97 
578  1 OD2 N ASP 379  ? ? O   N HOH 610  ? ? 1.97 
579  1 O   I HOH 887  ? ? O   I HOH 1100 ? ? 1.97 
580  1 NH1 E ARG 320  ? ? O   E HOH 608  ? ? 1.97 
581  1 O   F HOH 951  ? ? O   F HOH 1060 ? ? 1.98 
582  1 O   L HOH 797  ? ? O   L HOH 1004 ? ? 1.98 
583  1 O   Q HOH 917  ? ? O   Q HOH 1009 ? ? 1.98 
584  1 O   J HOH 901  ? ? O   J HOH 1022 ? ? 1.98 
585  1 N   L GLU 179  ? ? O   L HOH 606  ? ? 1.98 
586  1 NH1 C ARG 222  ? ? O   C HOH 610  ? ? 1.98 
587  1 O   N HOH 1002 ? ? O   N HOH 1077 ? ? 1.98 
588  1 O   B HOH 934  ? ? O   K HOH 927  ? ? 1.98 
589  1 O   Q HOH 1098 ? ? O   Q HOH 1117 ? ? 1.98 
590  1 O   L ARG 222  ? ? O   L HOH 605  ? ? 1.98 
591  1 O   A HOH 670  ? ? O   A HOH 695  ? ? 1.98 
592  1 O   I HOH 936  ? ? O   I HOH 964  ? ? 1.98 
593  1 O   I HOH 931  ? ? O   I HOH 1149 ? ? 1.98 
594  1 O   K HOH 765  ? ? O   K HOH 966  ? ? 1.98 
595  1 OE1 F GLU 163  ? ? O   F HOH 604  ? ? 1.98 
596  1 O   B HOH 725  ? ? O   B HOH 956  ? ? 1.98 
597  1 O   L HOH 984  ? ? O   L HOH 1096 ? ? 1.98 
598  1 O   P HOH 705  ? ? O   P HOH 712  ? ? 1.98 
599  1 O   D HOH 850  ? ? O   D HOH 1049 ? ? 1.98 
600  1 O   U HOH 804  ? ? O   U HOH 1046 ? ? 1.98 
601  1 O   I HOH 619  ? ? O   I HOH 975  ? ? 1.98 
602  1 O   L HOH 951  ? ? O   L HOH 1051 ? ? 1.98 
603  1 O   C HOH 1142 ? ? O   C HOH 1198 ? ? 1.98 
604  1 O   P HOH 775  ? ? O   P HOH 1010 ? ? 1.98 
605  1 O   Q HOH 660  ? ? O   Q HOH 744  ? ? 1.98 
606  1 O   D HOH 793  ? ? O   D HOH 1079 ? ? 1.98 
607  1 OD2 M ASP 275  ? ? O   M HOH 611  ? ? 1.98 
608  1 O   C HOH 671  ? ? O   C HOH 991  ? ? 1.98 
609  1 O   E HOH 1003 ? ? O   E HOH 1133 ? ? 1.98 
610  1 O   J HOH 1120 ? ? O   J HOH 1147 ? ? 1.98 
611  1 NZ  E LYS 44   ? ? O   E HOH 609  ? ? 1.98 
612  1 O   U HOH 1022 ? ? O   U HOH 1082 ? ? 1.98 
613  1 O   U HOH 919  ? ? O   U HOH 940  ? ? 1.98 
614  1 O   H HOH 952  ? ? O   H HOH 960  ? ? 1.98 
615  1 NH1 E ARG 400  ? ? O   E HOH 610  ? ? 1.98 
616  1 O   B HOH 1096 ? ? O   B HOH 1103 ? ? 1.98 
617  1 OD1 K ASP 290  ? ? O   K HOH 608  ? ? 1.98 
618  1 O   J ALA 250  ? ? O   J HOH 607  ? ? 1.99 
619  1 O   B HOH 981  ? ? O   K HOH 1008 ? ? 1.99 
620  1 O   B LYS 180  ? ? O   B HOH 608  ? ? 1.99 
621  1 O   F HOH 749  ? ? O   F HOH 958  ? ? 1.99 
622  1 N   U ARG 80   ? ? O   U HOH 605  ? ? 1.99 
623  1 NH2 P ARG 403  ? ? O   P HOH 607  ? ? 1.99 
624  1 O   C HOH 1176 ? ? O   C HOH 1187 ? ? 1.99 
625  1 O   K HOH 683  ? ? O   M HOH 944  ? ? 1.99 
626  1 OE1 K GLU 179  ? ? O   K HOH 609  ? ? 1.99 
627  1 O   G HOH 853  ? ? O   G HOH 1012 ? ? 1.99 
628  1 O   B HOH 616  ? ? O   D HOH 610  ? ? 1.99 
629  1 O   U HOH 1032 ? ? O   U HOH 1126 ? ? 1.99 
630  1 O   L HOH 995  ? ? O   L HOH 1005 ? ? 1.99 
631  1 NH2 H ARG 349  ? ? O   H HOH 610  ? ? 1.99 
632  1 O   G HOH 1049 ? ? O   G HOH 1067 ? ? 1.99 
633  1 O   J HOH 861  ? ? O   J HOH 1073 ? ? 1.99 
634  1 O   B ARG 400  ? ? O   B HOH 609  ? ? 1.99 
635  1 OD1 A ASP 397  ? ? O   A HOH 608  ? ? 1.99 
636  1 O   M HOH 950  ? ? O   M HOH 1005 ? ? 1.99 
637  1 O   E HOH 657  ? ? O   E HOH 951  ? ? 1.99 
638  1 O   I HOH 673  ? ? O   I HOH 683  ? ? 1.99 
639  1 O   J HOH 645  ? ? O   J HOH 1067 ? ? 1.99 
640  1 O   D HOH 1004 ? ? O   D HOH 1110 ? ? 1.99 
641  1 O   B HOH 690  ? ? O   D HOH 962  ? ? 1.99 
642  1 O   F HOH 928  ? ? O   F HOH 1110 ? ? 1.99 
643  1 OG  T SER 73   ? ? O   T HOH 606  ? ? 1.99 
644  1 O   J HOH 980  ? ? O   J HOH 1033 ? ? 1.99 
645  1 O   K HOH 800  ? ? O   K HOH 813  ? ? 1.99 
646  1 O   N HOH 929  ? ? O   N HOH 1050 ? ? 1.99 
647  1 O   L HOH 726  ? ? O   L HOH 903  ? ? 1.99 
648  1 O   L HOH 852  ? ? O   L HOH 939  ? ? 1.99 
649  1 O   O HOH 1016 ? ? O   O HOH 1139 ? ? 1.99 
650  1 O   T HOH 641  ? ? O   T HOH 928  ? ? 1.99 
651  1 O   A HOH 821  ? ? O   A HOH 1040 ? ? 1.99 
652  1 O   K HOH 953  ? ? O   K HOH 970  ? ? 1.99 
653  1 O   F HOH 980  ? ? O   T HOH 886  ? ? 1.99 
654  1 O   O HOH 634  ? ? O   O HOH 730  ? ? 1.99 
655  1 O   T ASP 270  ? ? O   T HOH 607  ? ? 1.99 
656  1 O   U HOH 770  ? ? O   U HOH 995  ? ? 1.99 
657  1 O   O HOH 734  ? ? O   O HOH 793  ? ? 1.99 
658  1 NE2 U GLN 79   ? ? O   U HOH 611  ? ? 1.99 
659  1 O   M HOH 784  ? ? O   M HOH 881  ? ? 1.99 
660  1 OE1 B GLU 168  ? ? O   B HOH 610  ? ? 1.99 
661  1 O   P HOH 611  ? ? O   P HOH 646  ? ? 1.99 
662  1 O   F HOH 750  ? ? O   F HOH 804  ? ? 1.99 
663  1 OE1 F GLU 305  ? ? O   F HOH 605  ? ? 1.99 
664  1 N   R ILE 242  ? ? O   R HOH 601  ? ? 1.99 
665  1 O   I HOH 678  ? ? O   I HOH 783  ? ? 1.99 
666  1 O   M HOH 819  ? ? O   M HOH 1013 ? ? 1.99 
667  1 O   L HOH 780  ? ? O   L HOH 963  ? ? 1.99 
668  1 OG  F SER 153  ? ? O   F HOH 606  ? ? 1.99 
669  1 O   G HOH 608  ? ? O   G HOH 863  ? ? 1.99 
670  1 O   M HOH 1010 ? ? O   M HOH 1085 ? ? 1.99 
671  1 O   U HOH 812  ? ? O   U HOH 946  ? ? 1.99 
672  1 N   D PHE 401  ? ? O   D HOH 604  ? ? 1.99 
673  1 O   R VAL 243  ? ? O   R HOH 607  ? ? 1.99 
674  1 O   B HOH 795  ? ? O   B HOH 957  ? ? 1.99 
675  1 O   U GLY 208  ? ? O   U HOH 612  ? ? 2.00 
676  1 O   N HOH 733  ? ? O   N HOH 793  ? ? 2.00 
677  1 O   T HOH 747  ? ? O   T HOH 749  ? ? 2.00 
678  1 O   H HOH 817  ? ? O   H HOH 1096 ? ? 2.00 
679  1 O   O HOH 1150 ? ? O   O HOH 1176 ? ? 2.00 
680  1 O   B HOH 1062 ? ? O   M HOH 994  ? ? 2.00 
681  1 O   B HOH 1107 ? ? O   B HOH 1122 ? ? 2.00 
682  1 O   D HOH 1014 ? ? O   D HOH 1020 ? ? 2.00 
683  1 O   A GLY 407  ? ? O   A HOH 609  ? ? 2.00 
684  1 O   O HOH 1011 ? ? O   O HOH 1151 ? ? 2.00 
685  1 O   P HOH 854  ? ? O   P HOH 1032 ? ? 2.00 
686  1 O   K HOH 960  ? ? O   M HOH 762  ? ? 2.00 
687  1 O   T HOH 815  ? ? O   T HOH 1137 ? ? 2.00 
688  1 O   Q HOH 634  ? ? O   Q HOH 914  ? ? 2.00 
689  1 O   H HOH 702  ? ? O   H HOH 983  ? ? 2.00 
690  1 O   U LEU 419  ? ? O   U HOH 613  ? ? 2.00 
691  1 O   C HOH 1108 ? ? O   C HOH 1162 ? ? 2.00 
692  1 O   P HOH 785  ? ? O   P HOH 819  ? ? 2.00 
693  1 NZ  B LYS 247  ? ? O   B HOH 611  ? ? 2.00 
694  1 NH1 T ARG 355  ? ? O   T HOH 608  ? ? 2.00 
695  1 OG  G SER 374  ? ? O   G HOH 607  ? ? 2.00 
696  1 OE2 G GLU 200  ? ? O   G HOH 608  ? ? 2.00 
697  1 O   Q HOH 857  ? ? O   Q HOH 900  ? ? 2.00 
698  1 O   N HOH 848  ? ? O   N HOH 959  ? ? 2.00 
699  1 O   U ARG 101  ? ? O   U HOH 614  ? ? 2.00 
700  1 O   T HOH 745  ? ? O   T HOH 975  ? ? 2.00 
701  1 O   G HOH 781  ? ? O   G HOH 896  ? ? 2.00 
702  1 O   G HOH 906  ? ? O   G HOH 966  ? ? 2.00 
703  1 O   R HOH 606  ? ? O   R HOH 972  ? ? 2.00 
704  1 O   K HOH 833  ? ? O   K HOH 1064 ? ? 2.00 
705  1 O   P LEU 204  ? ? O   P HOH 608  ? ? 2.00 
706  1 O   C HOH 623  ? ? O   C HOH 966  ? ? 2.00 
707  1 O   T LEU 421  ? ? O   T HOH 609  ? ? 2.00 
708  1 O   D HOH 979  ? ? O   D HOH 1115 ? ? 2.00 
709  1 NZ  D LYS 215  ? ? O   D HOH 605  ? ? 2.00 
710  1 O   D HOH 903  ? ? O   D HOH 1016 ? ? 2.00 
711  1 O   J HOH 1007 ? ? O   J HOH 1197 ? ? 2.00 
712  1 O   O HOH 1007 ? ? O   O HOH 1083 ? ? 2.00 
713  1 O   C HOH 1077 ? ? O   I HOH 1080 ? ? 2.00 
714  1 O   G HOH 969  ? ? O   G HOH 1016 ? ? 2.00 
715  1 NH2 E ARG 76   ? ? O   E HOH 611  ? ? 2.00 
716  1 O   Q HOH 911  ? ? O   Q HOH 934  ? ? 2.00 
717  1 NZ  B LYS 180  ? ? O   B HOH 611  ? ? 2.00 
718  1 O   G HOH 854  ? ? O   G HOH 1044 ? ? 2.00 
719  1 O   U HOH 1029 ? ? O   U HOH 1041 ? ? 2.00 
720  1 O   P HOH 738  ? ? O   P HOH 960  ? ? 2.00 
721  1 O   E HOH 863  ? ? O   E HOH 1016 ? ? 2.00 
722  1 O   M HOH 683  ? ? O   M HOH 981  ? ? 2.00 
723  1 O   F HOH 1075 ? ? O   U HOH 918  ? ? 2.00 
724  1 O   Q HOH 978  ? ? O   Q HOH 1077 ? ? 2.00 
725  1 O   O HOH 832  ? ? O   O HOH 837  ? ? 2.00 
726  1 O   C HOH 809  ? ? O   C HOH 961  ? ? 2.00 
727  1 O   C HOH 765  ? ? O   C HOH 919  ? ? 2.00 
728  1 OD2 F ASP 397  ? ? O   F HOH 607  ? ? 2.00 
729  1 O   N HOH 648  ? ? O   N HOH 727  ? ? 2.00 
730  1 OG  U SER 406  ? ? O   U HOH 615  ? ? 2.00 
731  1 O   O HOH 842  ? ? O   O HOH 1158 ? ? 2.00 
732  1 NH1 A ARG 403  ? ? O   A HOH 610  ? ? 2.01 
733  1 O   J HOH 1047 ? ? O   J HOH 1059 ? ? 2.01 
734  1 O   P VAL 390  ? ? O   P HOH 609  ? ? 2.01 
735  1 O   J HOH 782  ? ? O   J HOH 1001 ? ? 2.01 
736  1 N   G LEU 396  ? ? O   G HOH 609  ? ? 2.01 
737  1 O   I HOH 1062 ? ? O   I HOH 1109 ? ? 2.01 
738  1 O   H HOH 1129 ? ? O   G HOH 1025 ? ? 2.01 
739  1 O   K HOH 949  ? ? O   M HOH 667  ? ? 2.01 
740  1 O   U HOH 1006 ? ? O   U HOH 1061 ? ? 2.01 
741  1 OD1 Q ASP 275  ? ? O   Q HOH 605  ? ? 2.01 
742  1 O   H ILE 416  ? ? O   H HOH 611  ? ? 2.01 
743  1 O   Q HOH 759  ? ? O   Q HOH 959  ? ? 2.01 
744  1 O   A HOH 686  ? ? O   A HOH 897  ? ? 2.01 
745  1 O   O HOH 820  ? ? O   O HOH 837  ? ? 2.01 
746  1 O   U HOH 1129 ? ? O   U HOH 1130 ? ? 2.01 
747  1 O   H HOH 995  ? ? O   H HOH 1091 ? ? 2.01 
748  1 O   O HOH 634  ? ? O   O HOH 758  ? ? 2.01 
749  1 NH2 E ARG 403  ? ? O   E HOH 612  ? ? 2.01 
750  1 N   O GLU 317  ? ? O   O HOH 610  ? ? 2.01 
751  1 O   J HOH 1176 ? ? O   J HOH 1208 ? ? 2.01 
752  1 O   M HOH 1089 ? ? O   M HOH 1116 ? ? 2.01 
753  1 O   H HOH 914  ? ? O   H HOH 971  ? ? 2.01 
754  1 O   R HOH 602  ? ? O   R HOH 943  ? ? 2.01 
755  1 O   D HOH 923  ? ? O   D HOH 1026 ? ? 2.01 
756  1 O   T HOH 990  ? ? O   T HOH 1067 ? ? 2.01 
757  1 OD2 T ASP 152  ? ? O   T HOH 610  ? ? 2.01 
758  1 O   G HOH 861  ? ? O   G HOH 869  ? ? 2.01 
759  1 O   T HOH 681  ? ? O   T HOH 784  ? ? 2.01 
760  1 O   U GLU 395  ? ? O   U HOH 616  ? ? 2.01 
761  1 O   C HOH 668  ? ? O   C HOH 1103 ? ? 2.01 
762  1 O   D HOH 634  ? ? O   D HOH 837  ? ? 2.01 
763  1 O   R HOH 929  ? ? O   R HOH 1112 ? ? 2.01 
764  1 O   B HOH 1101 ? ? O   B HOH 1119 ? ? 2.01 
765  1 O   B HOH 989  ? ? O   B HOH 1080 ? ? 2.01 
766  1 OE2 U GLU 357  ? ? O   U HOH 617  ? ? 2.01 
767  1 NH1 O ARG 223  ? ? O   O HOH 611  ? ? 2.01 
768  1 O   T HOH 636  ? ? O   T HOH 795  ? ? 2.01 
769  1 OG  K SER 414  ? ? O   K HOH 610  ? ? 2.01 
770  1 O   I HOH 967  ? ? O   I HOH 1173 ? ? 2.01 
771  1 O   G HOH 725  ? ? O   G HOH 939  ? ? 2.01 
772  1 O   K HOH 958  ? ? O   K HOH 1081 ? ? 2.01 
773  1 O   A HOH 700  ? ? O   A HOH 769  ? ? 2.01 
774  1 O   C HOH 952  ? ? O   C HOH 992  ? ? 2.01 
775  1 O   L HOH 969  ? ? O   L HOH 1098 ? ? 2.01 
776  1 O   D HOH 649  ? ? O   D HOH 711  ? ? 2.01 
777  1 O   O HOH 651  ? ? O   O HOH 1098 ? ? 2.01 
778  1 O   H HOH 1054 ? ? O   H HOH 1071 ? ? 2.01 
779  1 O   O HOH 1017 ? ? O   O HOH 1170 ? ? 2.01 
780  1 NH1 K ARG 400  ? ? O   K HOH 611  ? ? 2.01 
781  1 O   Q HOH 713  ? ? O   Q HOH 766  ? ? 2.01 
782  1 O   N HOH 772  ? ? O   N HOH 787  ? ? 2.01 
783  1 O   M HOH 768  ? ? O   M HOH 778  ? ? 2.01 
784  1 N   H HIS 245  ? ? O   H HOH 602  ? ? 2.01 
785  1 NH1 I ARG 341  ? ? O   I HOH 607  ? ? 2.01 
786  1 O   R HOH 960  ? ? O   R HOH 1054 ? ? 2.01 
787  1 N   F PHE 401  ? ? O   F HOH 608  ? ? 2.01 
788  1 O   M HOH 670  ? ? O   M HOH 833  ? ? 2.01 
789  1 OE1 H GLU 128  ? ? O   H HOH 612  ? ? 2.01 
790  1 O   Q HOH 850  ? ? O   Q HOH 954  ? ? 2.01 
791  1 O   B HOH 843  ? ? O   B HOH 1011 ? ? 2.01 
792  1 O   T HOH 663  ? ? O   T HOH 950  ? ? 2.01 
793  1 NH1 R ARG 355  ? ? O   R HOH 608  ? ? 2.01 
794  1 O   B HOH 622  ? ? O   B HOH 943  ? ? 2.02 
795  1 OE1 Q GLN 68   ? ? O   Q HOH 606  ? ? 2.02 
796  1 O   L HOH 777  ? ? O   L HOH 876  ? ? 2.02 
797  1 OE1 R GLU 109  ? ? O   R HOH 609  ? ? 2.02 
798  1 O   T HOH 1040 ? ? O   T HOH 1172 ? ? 2.02 
799  1 O   J HOH 1114 ? ? O   J HOH 1211 ? ? 2.02 
800  1 OH  T TYR 353  ? ? O   T HOH 611  ? ? 2.02 
801  1 O   H HOH 935  ? ? O   H HOH 956  ? ? 2.02 
802  1 O   M HOH 781  ? ? O   M HOH 862  ? ? 2.02 
803  1 O   K HOH 872  ? ? O   K HOH 1082 ? ? 2.02 
804  1 O   H HOH 993  ? ? O   H HOH 1059 ? ? 2.02 
805  1 O   E GLU 200  ? ? O   E HOH 613  ? ? 2.02 
806  1 O   U HOH 915  ? ? O   U HOH 942  ? ? 2.02 
807  1 O   I HOH 803  ? ? O   I HOH 823  ? ? 2.02 
808  1 O   N HOH 720  ? ? O   N HOH 800  ? ? 2.02 
809  1 O   N HOH 944  ? ? O   N HOH 1071 ? ? 2.02 
810  1 O   R HOH 774  ? ? O   R HOH 1021 ? ? 2.02 
811  1 O   F ASP 397  ? ? O   F HOH 608  ? ? 2.02 
812  1 O   F ALA 191  ? ? O   F HOH 609  ? ? 2.02 
813  1 O   H HOH 915  ? ? O   H HOH 1011 ? ? 2.02 
814  1 OE2 K GLU 188  ? ? O   K HOH 612  ? ? 2.02 
815  1 O   K HOH 949  ? ? O   M HOH 1008 ? ? 2.02 
816  1 O   L HOH 817  ? ? O   R HOH 798  ? ? 2.02 
817  1 O   M HOH 617  ? ? O   M HOH 904  ? ? 2.02 
818  1 O   E HOH 1063 ? ? O   E HOH 1097 ? ? 2.02 
819  1 O   F HOH 823  ? ? O   F HOH 979  ? ? 2.02 
820  1 O   I HOH 953  ? ? O   I HOH 1102 ? ? 2.02 
821  1 O   I HOH 1086 ? ? O   I HOH 1103 ? ? 2.02 
822  1 O   E HOH 760  ? ? O   E HOH 791  ? ? 2.02 
823  1 N   O VAL 151  ? ? O   O HOH 602  ? ? 2.02 
824  1 NH2 H ARG 349  ? ? O   H HOH 613  ? ? 2.02 
825  1 OD1 N ASP 113  ? ? CZ  N ARG 232  ? ? 2.02 
826  1 O   H HOH 759  ? ? O   H HOH 969  ? ? 2.02 
827  1 O   K HOH 881  ? ? O   K HOH 1084 ? ? 2.02 
828  1 O   N HOH 648  ? ? O   N HOH 846  ? ? 2.02 
829  1 O   C HOH 919  ? ? O   C HOH 934  ? ? 2.02 
830  1 O   D HOH 953  ? ? O   D HOH 1097 ? ? 2.02 
831  1 OE2 G GLU 265  ? ? O   G HOH 610  ? ? 2.02 
832  1 O   B HOH 686  ? ? O   B HOH 740  ? ? 2.02 
833  1 O   H HOH 736  ? ? O   H HOH 1020 ? ? 2.02 
834  1 O   H HOH 880  ? ? O   H HOH 1067 ? ? 2.02 
835  1 O   G HOH 644  ? ? O   G HOH 736  ? ? 2.02 
836  1 O   C HOH 1164 ? ? O   C HOH 1184 ? ? 2.02 
837  1 O   T HOH 985  ? ? O   T HOH 1062 ? ? 2.02 
838  1 O   E HOH 1004 ? ? O   E HOH 1144 ? ? 2.02 
839  1 O   U HOH 614  ? ? O   U HOH 642  ? ? 2.02 
840  1 O   E HOH 866  ? ? O   E HOH 1099 ? ? 2.02 
841  1 NZ  T LYS 296  ? ? O   T HOH 612  ? ? 2.02 
842  1 O   L HOH 955  ? ? O   R HOH 1084 ? ? 2.02 
843  1 N   A ARG 319  ? ? O   A HOH 611  ? ? 2.02 
844  1 O   I HOH 675  ? ? O   I HOH 1060 ? ? 2.02 
845  1 O   C LEU 419  ? ? O   C HOH 611  ? ? 2.02 
846  1 O   N HOH 757  ? ? O   N HOH 856  ? ? 2.02 
847  1 O   P HOH 1081 ? ? O   P HOH 1098 ? ? 2.02 
848  1 O   A GLU 123  ? ? O   A HOH 612  ? ? 2.02 
849  1 OD2 D ASP 192  ? ? O   D HOH 606  ? ? 2.02 
850  1 O   A LEU 96   ? ? O   A HOH 613  ? ? 2.02 
851  1 O   C HOH 746  ? ? O   C HOH 1075 ? ? 2.02 
852  1 NZ  I LYS 44   ? ? O   I HOH 608  ? ? 2.02 
853  1 NH2 H ARG 341  ? ? O   H HOH 614  ? ? 2.02 
854  1 OE1 T GLU 29   ? ? O   T HOH 613  ? ? 2.02 
855  1 O   K HOH 990  ? ? O   K HOH 1086 ? ? 2.02 
856  1 O   F HOH 641  ? ? O   F HOH 852  ? ? 2.02 
857  1 O   I HOH 946  ? ? O   I HOH 1032 ? ? 2.02 
858  1 O   T HOH 625  ? ? O   T HOH 918  ? ? 2.03 
859  1 O   B HOH 1129 ? ? O   B HOH 1130 ? ? 2.03 
860  1 O   C HOH 781  ? ? O   C HOH 901  ? ? 2.03 
861  1 O   L HOH 727  ? ? O   L HOH 815  ? ? 2.03 
862  1 O   D HOH 856  ? ? O   D HOH 978  ? ? 2.03 
863  1 OG  A SER 153  ? ? O   A HOH 614  ? ? 2.03 
864  1 O   A HOH 1026 ? ? O   A HOH 1078 ? ? 2.03 
865  1 O   H HOH 622  ? ? O   H HOH 783  ? ? 2.03 
866  1 NH1 L ARG 80   ? ? O   L HOH 607  ? ? 2.03 
867  1 O   J HOH 839  ? ? O   J HOH 1046 ? ? 2.03 
868  1 OE2 N GLU 405  ? ? O   N HOH 611  ? ? 2.03 
869  1 O   H HOH 933  ? ? O   H HOH 957  ? ? 2.03 
870  1 O   R HOH 914  ? ? O   R HOH 946  ? ? 2.03 
871  1 O   H GLU 168  ? ? O   H HOH 615  ? ? 2.03 
872  1 O   C HOH 1211 ? ? O   C HOH 1215 ? ? 2.03 
873  1 O   F HOH 771  ? ? O   F HOH 1023 ? ? 2.03 
874  1 O   I HOH 629  ? ? O   I HOH 844  ? ? 2.03 
875  1 O   G HOH 635  ? ? O   G HOH 968  ? ? 2.03 
876  1 O   P HOH 932  ? ? O   P HOH 992  ? ? 2.03 
877  1 O   U ASP 295  ? ? O   U HOH 618  ? ? 2.03 
878  1 O   P HOH 943  ? ? O   P HOH 1009 ? ? 2.03 
879  1 O   F HOH 927  ? ? O   F HOH 1035 ? ? 2.03 
880  1 O   C HOH 613  ? ? O   C HOH 695  ? ? 2.03 
881  1 O   T HOH 617  ? ? O   U HOH 743  ? ? 2.03 
882  1 O   D HOH 1013 ? ? O   D HOH 1143 ? ? 2.03 
883  1 O   N HOH 887  ? ? O   N HOH 965  ? ? 2.03 
884  1 OD2 U ASP 393  ? ? O   U HOH 619  ? ? 2.03 
885  1 O   F HOH 681  ? ? O   F HOH 782  ? ? 2.03 
886  1 O   H HOH 887  ? ? O   H HOH 1095 ? ? 2.03 
887  1 NH2 T ARG 166  ? ? O   T HOH 614  ? ? 2.03 
888  1 O   E HOH 685  ? ? O   E HOH 1023 ? ? 2.03 
889  1 O   U HOH 968  ? ? O   U HOH 1012 ? ? 2.03 
890  1 O   F HOH 816  ? ? O   F HOH 1096 ? ? 2.03 
891  1 O   J HOH 1079 ? ? O   J HOH 1173 ? ? 2.03 
892  1 O   Q HOH 619  ? ? O   U HOH 786  ? ? 2.03 
893  1 OD1 F ASP 318  ? ? O   F HOH 610  ? ? 2.03 
894  1 O   F HOH 1014 ? ? O   F HOH 1134 ? ? 2.03 
895  1 NH2 G ARG 349  ? A O   G HOH 611  ? ? 2.03 
896  1 O   G HOH 730  ? ? O   G HOH 997  ? ? 2.03 
897  1 O   D HOH 645  ? ? O   D HOH 941  ? ? 2.03 
898  1 O   P HOH 662  ? ? O   P HOH 968  ? ? 2.03 
899  1 OD2 G ASP 275  ? ? O   G HOH 612  ? ? 2.03 
900  1 O   Q HOH 1110 ? ? O   T HOH 1091 ? ? 2.03 
901  1 NZ  G LYS 140  ? ? O   G HOH 613  ? ? 2.03 
902  1 O   C HOH 645  ? ? O   C HOH 1009 ? ? 2.03 
903  1 O   Q HOH 959  ? ? O   Q HOH 1120 ? ? 2.03 
904  1 O   M PRO 97   ? ? O   M HOH 612  ? ? 2.03 
905  1 O   A HOH 657  ? ? O   A HOH 971  ? ? 2.03 
906  1 O   G HOH 1004 ? ? O   G HOH 1079 ? ? 2.03 
907  1 O   P HOH 968  ? ? O   P HOH 1007 ? ? 2.03 
908  1 O   G GLY 235  ? ? O   G HOH 614  ? ? 2.03 
909  1 O   O HOH 1044 ? ? O   O HOH 1156 ? ? 2.03 
910  1 O   I HOH 995  ? ? O   I HOH 1039 ? ? 2.03 
911  1 O   Q HOH 951  ? ? O   Q HOH 974  ? ? 2.03 
912  1 O   U HOH 980  ? ? O   U HOH 1078 ? ? 2.03 
913  1 O   B HOH 702  ? ? O   B HOH 896  ? ? 2.03 
914  1 O   B HOH 934  ? ? O   B HOH 1053 ? ? 2.03 
915  1 O   N VAL 390  ? ? O   N HOH 612  ? ? 2.03 
916  1 O   C HOH 771  ? ? O   C HOH 1028 ? ? 2.03 
917  1 O   G HOH 914  ? ? O   G HOH 1043 ? ? 2.03 
918  1 OD1 M ASP 379  ? ? O   M HOH 613  ? ? 2.03 
919  1 O   Q HOH 1079 ? ? O   Q HOH 1095 ? ? 2.03 
920  1 O   I HOH 767  ? ? O   I HOH 977  ? ? 2.03 
921  1 O   A HOH 897  ? ? O   A HOH 945  ? ? 2.03 
922  1 OD1 A ASP 318  ? ? O   A HOH 615  ? ? 2.03 
923  1 O   H HOH 658  ? ? O   H HOH 945  ? ? 2.03 
924  1 O   Q HOH 787  ? ? O   Q HOH 873  ? ? 2.03 
925  1 OH  I TYR 294  ? ? O   I HOH 609  ? ? 2.04 
926  1 O   J HOH 747  ? ? O   J HOH 885  ? ? 2.04 
927  1 O   B VAL 7    ? ? O   B HOH 612  ? ? 2.04 
928  1 O   H ARG 355  ? ? O   H HOH 616  ? ? 2.04 
929  1 O   E ALA 114  ? ? O   E HOH 614  ? ? 2.04 
930  1 O   E MET 175  ? ? O   E HOH 615  ? ? 2.04 
931  1 O   A THR 105  ? ? O   A HOH 616  ? ? 2.04 
932  1 O   I HOH 999  ? ? O   I HOH 1075 ? ? 2.04 
933  1 O   I HOH 1154 ? ? O   I HOH 1194 ? ? 2.04 
934  1 O   A HOH 874  ? ? O   A HOH 952  ? ? 2.04 
935  1 O   C HOH 663  ? ? O   C HOH 945  ? ? 2.04 
936  1 O   T HOH 932  ? ? O   T HOH 962  ? ? 2.04 
937  1 O   F HOH 931  ? ? O   F HOH 1077 ? ? 2.04 
938  1 O   I HOH 967  ? ? O   I HOH 1171 ? ? 2.04 
939  1 O   A HOH 876  ? ? O   A HOH 929  ? ? 2.04 
940  1 O   U HOH 997  ? ? O   U HOH 1090 ? ? 2.04 
941  1 O   K HOH 1041 ? ? O   K HOH 1048 ? ? 2.04 
942  1 O   C HOH 952  ? ? O   C HOH 974  ? ? 2.04 
943  1 O   A HOH 1084 ? ? O   E HOH 1117 ? ? 2.04 
944  1 NZ  A LYS 418  ? ? O   A HOH 617  ? ? 2.04 
945  1 O   U HOH 975  ? ? O   U HOH 1067 ? ? 2.04 
946  1 O   I HOH 1061 ? ? O   I HOH 1074 ? ? 2.04 
947  1 OD2 E ASP 393  ? ? O   E HOH 616  ? ? 2.04 
948  1 NH1 J ARG 166  ? ? O   J HOH 608  ? ? 2.04 
949  1 O   E HOH 666  ? ? O   E HOH 1043 ? ? 2.04 
950  1 O   L ALA 169  ? ? O   L HOH 608  ? ? 2.04 
951  1 O   J HOH 1093 ? ? O   J HOH 1115 ? ? 2.04 
952  1 O   O HOH 1071 ? ? O   O HOH 1098 ? ? 2.04 
953  1 O   J HOH 961  ? ? O   J HOH 1021 ? ? 2.04 
954  1 O   I HOH 863  ? ? O   I HOH 878  ? ? 2.04 
955  1 O   C HOH 865  ? ? O   C HOH 1018 ? ? 2.04 
956  1 O   B HOH 665  ? ? O   B HOH 935  ? ? 2.04 
957  1 O   E ALA 134  ? ? O   E HOH 617  ? ? 2.04 
958  1 O   R PRO 193  ? ? O   R HOH 610  ? ? 2.04 
959  1 O   J HOH 906  ? ? O   J HOH 1209 ? ? 2.04 
960  1 NH2 R ARG 166  ? ? O   R HOH 610  ? ? 2.04 
961  1 O   B HOH 1053 ? ? O   K HOH 927  ? ? 2.04 
962  1 NZ  D LYS 44   ? ? O   D HOH 607  ? ? 2.04 
963  1 OH  G TYR 69   ? ? O   G HOH 615  ? ? 2.04 
964  1 O   D HOH 1137 ? ? O   D HOH 1152 ? ? 2.04 
965  1 OG  J SER 231  ? ? O   J HOH 609  ? ? 2.04 
966  1 O   C HOH 1217 ? ? O   C HOH 1218 ? ? 2.04 
967  1 O   E HOH 1131 ? ? O   E HOH 1156 ? ? 2.04 
968  1 OH  L TYR 116  ? ? O   L HOH 609  ? ? 2.04 
969  1 O   A HOH 900  ? ? O   A HOH 966  ? ? 2.04 
970  1 O   A GLN 100  ? ? O   A HOH 618  ? ? 2.04 
971  1 O   K HOH 915  ? ? O   K HOH 932  ? ? 2.04 
972  1 O   J HOH 928  ? ? O   J HOH 1070 ? ? 2.04 
973  1 O   O HOH 1086 ? ? O   O HOH 1132 ? ? 2.04 
974  1 O   C HOH 756  ? ? O   C HOH 958  ? ? 2.04 
975  1 O   L HOH 768  ? ? O   L HOH 1058 ? ? 2.04 
976  1 N   F TYR 69   ? ? O   F HOH 611  ? ? 2.04 
977  1 O   U HOH 1028 ? ? O   U HOH 1096 ? ? 2.04 
978  1 OD1 D ASP 261  ? ? O   D HOH 608  ? ? 2.04 
979  1 NH1 G ARG 33   ? ? O   G HOH 616  ? ? 2.04 
980  1 OD2 D ASP 270  ? ? O   D HOH 609  ? ? 2.04 
981  1 O   O HOH 687  ? ? O   O HOH 764  ? ? 2.04 
982  1 NH2 O ARG 34   ? ? O   O HOH 612  ? ? 2.04 
983  1 O   A HOH 1102 ? ? O   A HOH 1106 ? ? 2.04 
984  1 O   R HOH 950  ? ? O   R HOH 1069 ? ? 2.04 
985  1 O   N HOH 992  ? ? O   N HOH 1074 ? ? 2.04 
986  1 O   Q HOH 864  ? ? O   Q HOH 1004 ? ? 2.04 
987  1 NH1 C ARG 223  ? ? O   C HOH 612  ? ? 2.04 
988  1 NH1 B ARG 355  ? ? O   B HOH 613  ? ? 2.04 
989  1 O   Q HOH 933  ? ? O   Q HOH 1044 ? ? 2.04 
990  1 O   O HOH 1135 ? ? O   O HOH 1171 ? ? 2.04 
991  1 O   M HOH 720  ? ? O   M HOH 1058 ? ? 2.04 
992  1 O   B HOH 959  ? ? O   B HOH 970  ? ? 2.04 
993  1 O   G ARG 400  ? ? O   G HOH 617  ? ? 2.04 
994  1 O   K HOH 878  ? ? O   K HOH 1016 ? ? 2.04 
995  1 O   G ASP 286  ? ? O   G HOH 618  ? ? 2.04 
996  1 O   K HOH 983  ? ? O   M HOH 1124 ? ? 2.05 
997  1 O   Q HOH 728  ? ? O   Q HOH 1056 ? ? 2.05 
998  1 O   R HOH 1190 ? ? O   R HOH 1191 ? ? 2.05 
999  1 O   O HOH 1055 ? ? O   O HOH 1065 ? ? 2.05 
1000 1 O   O HOH 642  ? ? O   O HOH 814  ? ? 2.05 
1001 1 O   O ARG 12   ? ? O   O HOH 613  ? ? 2.05 
1002 1 O   H HOH 643  ? ? O   H HOH 891  ? ? 2.05 
1003 1 O   C HOH 1131 ? ? O   C HOH 1182 ? ? 2.05 
1004 1 O   C HOH 1028 ? ? O   C HOH 1037 ? ? 2.05 
1005 1 O   L ALA 98   ? ? O   L HOH 610  ? ? 2.05 
1006 1 O   T HOH 1163 ? ? O   T HOH 1188 ? ? 2.05 
1007 1 O   L HOH 791  ? ? O   L HOH 835  ? ? 2.05 
1008 1 O   E HOH 943  ? ? O   E HOH 967  ? ? 2.05 
1009 1 OG1 T THR 346  ? A O   T HOH 615  ? ? 2.05 
1010 1 O   Q HOH 817  ? ? O   Q HOH 854  ? ? 2.05 
1011 1 O   H HOH 909  ? ? O   H HOH 1117 ? ? 2.05 
1012 1 O   E VAL 287  ? ? O   E HOH 618  ? ? 2.05 
1013 1 O   J HOH 754  ? ? O   J HOH 1166 ? ? 2.05 
1014 1 O   I HOH 970  ? ? O   I HOH 1175 ? ? 2.05 
1015 1 NZ  I LYS 70   ? ? O   I HOH 610  ? ? 2.05 
1016 1 O   B HOH 937  ? ? O   K HOH 938  ? ? 2.05 
1017 1 O   J HOH 729  ? ? O   J HOH 1126 ? ? 2.05 
1018 1 OE1 F GLN 106  ? ? O   F HOH 612  ? ? 2.05 
1019 1 NH2 H ARG 403  ? ? O   H HOH 617  ? ? 2.05 
1020 1 O   Q HOH 871  ? ? O   U HOH 731  ? ? 2.05 
1021 1 O   Q HOH 868  ? ? O   Q HOH 880  ? ? 2.05 
1022 1 O   D HOH 891  ? ? O   D HOH 917  ? ? 2.05 
1023 1 O   R HOH 896  ? ? O   R HOH 1079 ? ? 2.05 
1024 1 O   R HOH 818  ? ? O   R HOH 943  ? ? 2.05 
1025 1 O   H HOH 739  ? ? O   H HOH 792  ? ? 2.05 
1026 1 O   D HOH 976  ? ? O   K HOH 920  ? ? 2.05 
1027 1 O   B HOH 694  ? ? O   B HOH 703  ? ? 2.05 
1028 1 O   B HOH 772  ? ? O   B HOH 1038 ? ? 2.05 
1029 1 O   H HOH 970  ? ? O   I HOH 1020 ? ? 2.05 
1030 1 N   K ASP 315  ? ? O   K HOH 613  ? ? 2.05 
1031 1 O   Q HOH 970  ? ? O   Q HOH 1034 ? ? 2.05 
1032 1 O   F HOH 1040 ? ? O   T HOH 857  ? ? 2.05 
1033 1 O   I GLY 246  ? ? O   I HOH 611  ? ? 2.05 
1034 1 O   F HOH 1024 ? ? O   U HOH 979  ? ? 2.05 
1035 1 NE2 Q GLN 68   ? ? O   Q HOH 607  ? ? 2.05 
1036 1 OG1 E THR 307  ? ? O   E HOH 619  ? ? 2.05 
1037 1 O   B ASP 295  ? ? O   B HOH 614  ? ? 2.05 
1038 1 O   I HOH 759  ? ? O   I HOH 960  ? ? 2.05 
1039 1 O   M ILE 293  ? ? O   M HOH 614  ? ? 2.05 
1040 1 O   R HOH 1177 ? ? O   R HOH 1186 ? ? 2.05 
1041 1 O   H HOH 642  ? ? O   H HOH 960  ? ? 2.05 
1042 1 O   D HOH 706  ? ? O   D HOH 932  ? ? 2.05 
1043 1 O   M HOH 752  ? ? O   M HOH 801  ? ? 2.05 
1044 1 O   P HOH 989  ? ? O   P HOH 1063 ? ? 2.05 
1045 1 O   K HOH 658  ? ? O   K HOH 927  ? ? 2.05 
1046 1 O   F HOH 1141 ? ? O   T HOH 1184 ? ? 2.05 
1047 1 OD1 C ASN 57   ? ? O   C HOH 613  ? ? 2.05 
1048 1 OD1 T ASN 199  ? ? O   T HOH 616  ? ? 2.05 
1049 1 O   G HOH 601  ? ? O   G HOH 649  ? ? 2.05 
1050 1 O   Q HOH 1062 ? ? O   Q HOH 1095 ? ? 2.05 
1051 1 O   M HOH 1041 ? ? O   M HOH 1123 ? ? 2.05 
1052 1 O   M HOH 1137 ? ? O   M HOH 1138 ? ? 2.05 
1053 1 O   E HOH 1133 ? ? O   E HOH 1148 ? ? 2.05 
1054 1 OH  D TYR 125  ? ? O   D HOH 610  ? ? 2.05 
1055 1 O   N HOH 674  ? ? O   N HOH 900  ? ? 2.05 
1056 1 O   E GLU 123  ? ? O   E HOH 620  ? ? 2.05 
1057 1 O   J HOH 659  ? ? O   J HOH 1057 ? ? 2.05 
1058 1 O   L HOH 801  ? ? O   L HOH 940  ? ? 2.05 
1059 1 OE2 M GLU 123  ? ? NZ  M LYS 215  ? ? 2.05 
1060 1 O   I HOH 801  ? ? O   I HOH 1154 ? ? 2.05 
1061 1 O   Q HOH 714  ? ? O   Q HOH 809  ? ? 2.05 
1062 1 O   P HOH 988  ? ? O   P HOH 1012 ? ? 2.05 
1063 1 O   G HOH 947  ? ? O   G HOH 1073 ? ? 2.05 
1064 1 O   F HOH 659  ? ? O   F HOH 943  ? ? 2.05 
1065 1 O   Q HOH 964  ? ? O   Q HOH 982  ? ? 2.05 
1066 1 O   T HOH 734  ? ? O   T HOH 1123 ? ? 2.05 
1067 1 O   A HOH 1062 ? ? O   A HOH 1101 ? ? 2.05 
1068 1 O   U HOH 767  ? ? O   U HOH 860  ? ? 2.06 
1069 1 O   C HOH 908  ? ? O   C HOH 910  ? ? 2.06 
1070 1 NH2 B ARG 76   ? ? O   B HOH 615  ? ? 2.06 
1071 1 O   T HOH 869  ? ? O   U HOH 865  ? ? 2.06 
1072 1 O   D HOH 940  ? ? O   D HOH 987  ? ? 2.06 
1073 1 O   E LYS 44   ? ? O   E HOH 621  ? ? 2.06 
1074 1 OD2 N ASP 233  ? ? O   N HOH 613  ? ? 2.06 
1075 1 O   P HOH 975  ? ? O   P HOH 1033 ? ? 2.06 
1076 1 O   U GLY 43   ? ? O   U HOH 620  ? ? 2.06 
1077 1 O   U HOH 941  ? ? O   U HOH 1010 ? ? 2.06 
1078 1 O   E HOH 964  ? ? O   E HOH 1043 ? ? 2.06 
1079 1 O   G HOH 828  ? ? O   G HOH 1012 ? ? 2.06 
1080 1 O   R HOH 841  ? ? O   R HOH 1148 ? ? 2.06 
1081 1 O   E HOH 627  ? ? O   E HOH 655  ? ? 2.06 
1082 1 O   M HOH 738  ? ? O   M HOH 1084 ? ? 2.06 
1083 1 NH1 U ARG 319  ? ? O   U HOH 621  ? ? 2.06 
1084 1 O   R HOH 787  ? ? O   R HOH 910  ? ? 2.06 
1085 1 O   D HOH 846  ? ? O   D HOH 975  ? ? 2.06 
1086 1 O   R HOH 827  ? ? O   R HOH 1018 ? ? 2.06 
1087 1 O   U HOH 1024 ? ? O   U HOH 1103 ? ? 2.06 
1088 1 O   H LEU 419  ? ? O   H HOH 618  ? ? 2.06 
1089 1 NH2 N ARG 76   ? ? O   N HOH 614  ? ? 2.06 
1090 1 NH2 B ARG 80   ? ? O   B HOH 616  ? ? 2.06 
1091 1 O   Q HOH 621  ? ? O   Q HOH 673  ? ? 2.06 
1092 1 O   H HOH 614  ? ? O   H HOH 775  ? ? 2.06 
1093 1 O   E HOH 656  ? ? O   E HOH 1007 ? ? 2.06 
1094 1 O   N HOH 897  ? ? O   N HOH 984  ? ? 2.06 
1095 1 OE2 U GLU 123  ? ? O   U HOH 622  ? ? 2.06 
1096 1 OG1 O THR 346  ? ? O   O HOH 614  ? ? 2.06 
1097 1 OD1 Q ASP 286  ? ? O   Q HOH 608  ? ? 2.06 
1098 1 O   T TYR 294  ? ? O   T HOH 617  ? ? 2.06 
1099 1 O   K HOH 619  ? ? O   K HOH 909  ? ? 2.06 
1100 1 O   Q HOH 629  ? ? O   Q HOH 718  ? ? 2.06 
1101 1 OD1 M ASN 118  ? ? O   M HOH 615  ? ? 2.06 
1102 1 O   E HOH 935  ? ? O   E HOH 1055 ? ? 2.06 
1103 1 O   Q HOH 1087 ? ? O   T HOH 1146 ? ? 2.06 
1104 1 OE1 E GLU 219  ? ? O   E HOH 622  ? ? 2.06 
1105 1 O   I HOH 1064 ? ? O   I HOH 1199 ? ? 2.06 
1106 1 O   R HOH 833  ? ? O   R HOH 982  ? ? 2.06 
1107 1 OE1 M GLN 149  ? ? O   M HOH 616  ? ? 2.06 
1108 1 O   R HOH 704  ? ? O   R HOH 1142 ? ? 2.06 
1109 1 O   I HOH 999  ? ? O   G HOH 935  ? ? 2.06 
1110 1 NZ  T LYS 36   ? ? O   T HOH 607  ? ? 2.06 
1111 1 O   M LEU 421  ? ? O   M HOH 617  ? ? 2.06 
1112 1 NE2 U GLN 372  ? ? O   U HOH 623  ? ? 2.06 
1113 1 O   H HOH 824  ? ? O   H HOH 855  ? ? 2.06 
1114 1 O   H HOH 608  ? ? O   H HOH 736  ? ? 2.06 
1115 1 O   Q HOH 1079 ? ? O   Q HOH 1094 ? ? 2.06 
1116 1 OG1 F THR 346  ? ? O   F HOH 613  ? ? 2.06 
1117 1 O   B HOH 647  ? ? O   B HOH 676  ? ? 2.06 
1118 1 O   Q GLN 68   ? ? O   Q HOH 609  ? ? 2.06 
1119 1 O   P HOH 891  ? ? O   P HOH 1074 ? ? 2.06 
1120 1 OE2 H GLU 109  ? ? O   H HOH 619  ? ? 2.06 
1121 1 O   J HOH 1024 ? ? O   J HOH 1032 ? ? 2.06 
1122 1 O   B HOH 1077 ? ? O   B HOH 1106 ? ? 2.06 
1123 1 O   C HOH 625  ? ? O   C HOH 969  ? ? 2.06 
1124 1 O   D HOH 928  ? ? O   D HOH 945  ? ? 2.06 
1125 1 O   R HOH 907  ? ? O   R HOH 1022 ? ? 2.06 
1126 1 O   J GLY 21   ? ? O   J HOH 610  ? ? 2.06 
1127 1 O   G HOH 921  ? ? O   G HOH 999  ? ? 2.06 
1128 1 O   C HOH 965  ? ? O   C HOH 997  ? ? 2.06 
1129 1 OD2 M ASP 315  ? ? O   M HOH 618  ? ? 2.06 
1130 1 NH1 D ARG 62   ? ? O   D HOH 611  ? ? 2.06 
1131 1 O   L HOH 838  ? ? O   L HOH 1063 ? ? 2.06 
1132 1 O   A HOH 870  ? ? O   A HOH 987  ? ? 2.06 
1133 1 O   O HOH 942  ? ? O   O HOH 1064 ? ? 2.06 
1134 1 O   F HOH 1037 ? ? O   F HOH 1047 ? ? 2.06 
1135 1 O   A HOH 1018 ? ? O   A HOH 1062 ? ? 2.06 
1136 1 O   M HOH 811  ? ? O   M HOH 925  ? ? 2.06 
1137 1 O   H HOH 995  ? ? O   H HOH 1049 ? ? 2.06 
1138 1 O   P HOH 909  ? ? O   P HOH 1030 ? ? 2.06 
1139 1 O   H HOH 852  ? ? O   H HOH 991  ? ? 2.06 
1140 1 O   E HOH 848  ? ? O   E HOH 1144 ? ? 2.06 
1141 1 O   D HOH 784  ? ? O   D HOH 1001 ? ? 2.06 
1142 1 O   K GLU 395  ? ? O   K HOH 614  ? ? 2.06 
1143 1 O   P HOH 895  ? ? O   P HOH 912  ? ? 2.06 
1144 1 O   L HOH 1030 ? ? O   R HOH 1021 ? ? 2.07 
1145 1 O   P HOH 855  ? ? O   P HOH 1022 ? ? 2.07 
1146 1 O   E GLY 110  ? ? O   E HOH 623  ? ? 2.07 
1147 1 N   P SER 230  ? ? O   P HOH 610  ? ? 2.07 
1148 1 O   F HOH 822  ? ? O   F HOH 1010 ? ? 2.07 
1149 1 O   N HOH 979  ? ? O   N HOH 982  ? ? 2.07 
1150 1 O   O HOH 765  ? ? O   O HOH 952  ? ? 2.07 
1151 1 O   D HOH 1028 ? ? O   D HOH 1039 ? ? 2.07 
1152 1 O   D HOH 718  ? ? O   D HOH 948  ? ? 2.07 
1153 1 O   D HOH 708  ? ? O   D HOH 953  ? ? 2.07 
1154 1 OE1 A GLN 79   ? ? O   A HOH 619  ? ? 2.07 
1155 1 O   U HOH 1012 ? ? O   U HOH 1031 ? ? 2.07 
1156 1 NZ  A LYS 215  ? ? O   A HOH 620  ? ? 2.07 
1157 1 O   R HOH 725  ? ? O   R HOH 1072 ? ? 2.07 
1158 1 O   L HOH 714  ? ? O   P HOH 947  ? ? 2.07 
1159 1 O   Q PHE 50   ? ? O   Q HOH 610  ? ? 2.07 
1160 1 O   T HOH 908  ? ? O   T HOH 1151 ? ? 2.07 
1161 1 NH1 K ARG 369  ? ? O   K HOH 615  ? ? 2.07 
1162 1 O   P HIS 176  ? ? O   P HOH 611  ? ? 2.07 
1163 1 O   H HOH 745  ? ? O   H HOH 889  ? ? 2.07 
1164 1 OD2 T ASP 316  ? ? O   T HOH 618  ? ? 2.07 
1165 1 O   U HOH 736  ? ? O   U HOH 1102 ? ? 2.07 
1166 1 O   J HOH 1103 ? ? O   J HOH 1122 ? ? 2.07 
1167 1 O   J HOH 955  ? ? O   J HOH 1076 ? ? 2.07 
1168 1 O   T HOH 728  ? ? O   T HOH 1017 ? ? 2.07 
1169 1 NZ  Q LYS 180  ? ? O   Q HOH 611  ? ? 2.07 
1170 1 O   F HOH 876  ? ? O   F HOH 1083 ? ? 2.07 
1171 1 O   B HOH 669  ? ? O   B HOH 961  ? ? 2.07 
1172 1 NH1 B ARG 80   ? ? O   B HOH 617  ? ? 2.07 
1173 1 O   M HOH 949  ? ? O   M HOH 1012 ? ? 2.07 
1174 1 O   D HOH 716  ? ? O   D HOH 876  ? ? 2.07 
1175 1 O   C HOH 641  ? ? O   C HOH 704  ? ? 2.07 
1176 1 O   P THR 111  ? ? O   P HOH 612  ? ? 2.07 
1177 1 NH1 L ARG 269  ? ? O   L HOH 611  ? ? 2.07 
1178 1 O   J HOH 1060 ? ? O   J HOH 1214 ? ? 2.07 
1179 1 O   J HOH 1251 ? ? O   J HOH 1253 ? ? 2.07 
1180 1 O   D HOH 793  ? ? O   D HOH 824  ? ? 2.07 
1181 1 O   P HOH 880  ? ? O   P HOH 940  ? ? 2.07 
1182 1 OE2 M GLU 317  ? ? O   M HOH 619  ? ? 2.07 
1183 1 O   A HOH 638  ? ? O   A HOH 776  ? ? 2.07 
1184 1 O   U ALA 155  ? ? O   U HOH 624  ? ? 2.07 
1185 1 O   N HOH 921  ? ? O   N HOH 1049 ? ? 2.07 
1186 1 O   F HOH 928  ? ? O   F HOH 933  ? ? 2.07 
1187 1 O   G HOH 782  ? ? O   G HOH 956  ? ? 2.07 
1188 1 OE1 B GLU 123  ? ? O   B HOH 618  ? ? 2.07 
1189 1 OE1 L GLN 106  ? ? O   L HOH 612  ? ? 2.07 
1190 1 O   G HOH 801  ? ? O   G HOH 921  ? ? 2.07 
1191 1 OE2 F GLU 109  ? ? O   F HOH 614  ? ? 2.07 
1192 1 NH2 M ARG 26   ? ? O   M HOH 620  ? ? 2.07 
1193 1 O   F ALA 250  ? ? O   F HOH 615  ? ? 2.07 
1194 1 O   P HOH 763  ? ? O   P HOH 921  ? ? 2.07 
1195 1 O   C HOH 994  ? ? O   C HOH 995  ? ? 2.07 
1196 1 O   L HOH 731  ? ? O   L HOH 931  ? ? 2.07 
1197 1 O   K HOH 607  ? ? O   K HOH 932  ? ? 2.07 
1198 1 O   Q HOH 669  ? ? O   Q HOH 829  ? ? 2.07 
1199 1 O   E HOH 623  ? ? O   E HOH 890  ? ? 2.07 
1200 1 O   A HOH 926  ? ? O   A HOH 933  ? ? 2.07 
1201 1 O   U HOH 1040 ? ? O   U HOH 1087 ? ? 2.07 
1202 1 O   R HOH 746  ? ? O   R HOH 752  ? ? 2.07 
1203 1 O   E HOH 796  ? ? O   E HOH 957  ? ? 2.07 
1204 1 O   I HOH 746  ? ? O   I HOH 1035 ? ? 2.07 
1205 1 OE2 N GLU 386  ? ? O   N HOH 615  ? ? 2.07 
1206 1 O   R HOH 863  ? ? O   R HOH 988  ? ? 2.07 
1207 1 O   I HOH 969  ? ? O   I HOH 995  ? ? 2.07 
1208 1 O   E HOH 862  ? ? O   E HOH 1005 ? ? 2.07 
1209 1 O   R HOH 1056 ? ? O   R HOH 1116 ? ? 2.07 
1210 1 O   P HOH 710  ? ? O   P HOH 942  ? ? 2.07 
1211 1 O   A HOH 754  ? ? O   A HOH 921  ? ? 2.07 
1212 1 O   E HOH 740  ? ? O   E HOH 1014 ? ? 2.07 
1213 1 N   U ALA 280  ? ? O   U HOH 625  ? ? 2.07 
1214 1 O   J HOH 799  ? ? O   J HOH 888  ? ? 2.07 
1215 1 O   M HOH 1005 ? ? O   M HOH 1095 ? ? 2.08 
1216 1 OE2 A GLU 200  ? ? O   A HOH 621  ? ? 2.08 
1217 1 OD1 L ASP 286  ? ? O   L HOH 613  ? ? 2.08 
1218 1 O   U GLY 198  ? ? O   U HOH 626  ? ? 2.08 
1219 1 O   A HOH 869  ? ? O   A HOH 1051 ? ? 2.08 
1220 1 O   I HOH 906  ? ? O   I HOH 1183 ? ? 2.08 
1221 1 O   R HOH 909  ? ? O   R HOH 1002 ? ? 2.08 
1222 1 O   Q TYR 129  ? ? O   Q HOH 612  ? ? 2.08 
1223 1 O   K HOH 1138 ? ? O   K HOH 1144 ? ? 2.08 
1224 1 NH2 B ARG 222  ? ? O   B HOH 619  ? ? 2.08 
1225 1 O   J THR 170  ? ? O   J HOH 611  ? ? 2.08 
1226 1 NZ  U LYS 247  ? ? O   U HOH 627  ? ? 2.08 
1227 1 O   N GLU 168  ? ? O   N HOH 616  ? ? 2.08 
1228 1 NH1 R ARG 222  ? ? O   R HOH 611  ? ? 2.08 
1229 1 O   R HOH 972  ? ? O   R HOH 1164 ? ? 2.08 
1230 1 O   M TYR 129  ? ? O   M HOH 621  ? ? 2.08 
1231 1 O   G HOH 922  ? ? O   G HOH 1052 ? ? 2.08 
1232 1 O   H HOH 1060 ? ? O   H HOH 1101 ? ? 2.08 
1233 1 OE1 K GLN 68   ? ? O   K HOH 616  ? ? 2.08 
1234 1 O   B HOH 799  ? ? O   B HOH 835  ? ? 2.08 
1235 1 O   R VAL 7    ? ? O   R HOH 612  ? ? 2.08 
1236 1 O   C ASP 318  ? ? O   C HOH 614  ? ? 2.08 
1237 1 O   C HOH 761  ? ? O   G HOH 835  ? ? 2.08 
1238 1 O   E HOH 772  ? ? O   E HOH 1063 ? ? 2.08 
1239 1 O   P HOH 628  ? ? O   P HOH 723  ? ? 2.08 
1240 1 O   H HOH 845  ? ? O   H HOH 905  ? ? 2.08 
1241 1 O   R HOH 638  ? ? O   R HOH 929  ? ? 2.08 
1242 1 O   A HOH 1010 ? ? O   A HOH 1015 ? ? 2.08 
1243 1 O   T HOH 1152 ? ? O   T HOH 1168 ? ? 2.08 
1244 1 OE2 B GLU 392  ? ? O   B HOH 620  ? ? 2.08 
1245 1 OG1 C THR 307  ? ? O   C HOH 615  ? ? 2.08 
1246 1 O   D HOH 972  ? ? O   D HOH 1083 ? ? 2.08 
1247 1 O   E HOH 854  ? ? O   E HOH 890  ? ? 2.08 
1248 1 OE1 H GLU 219  ? ? O   H HOH 620  ? ? 2.08 
1249 1 O   J HOH 1234 ? ? O   J HOH 1244 ? ? 2.08 
1250 1 O   J HOH 893  ? ? O   J HOH 1166 ? ? 2.08 
1251 1 NE2 A GLN 117  ? ? O   A HOH 622  ? ? 2.08 
1252 1 O   H HOH 863  ? ? O   H HOH 1072 ? ? 2.08 
1253 1 OD2 G ASP 233  ? ? O   G HOH 619  ? ? 2.08 
1254 1 OD2 F ASP 233  ? ? O   F HOH 616  ? ? 2.08 
1255 1 O   R HOH 829  ? ? O   R HOH 999  ? ? 2.08 
1256 1 O   D HOH 1025 ? ? O   D HOH 1137 ? ? 2.08 
1257 1 O   P HOH 840  ? ? O   P HOH 849  ? ? 2.08 
1258 1 O   R HOH 694  ? ? O   R HOH 951  ? ? 2.08 
1259 1 OE1 C GLU 200  ? ? O   C HOH 616  ? ? 2.08 
1260 1 O   C HOH 1052 ? ? O   C HOH 1067 ? ? 2.08 
1261 1 O   A HOH 878  ? ? O   A HOH 977  ? ? 2.08 
1262 1 O   A HOH 679  ? ? O   A HOH 950  ? ? 2.08 
1263 1 O   U ASP 316  ? ? O   U HOH 628  ? ? 2.08 
1264 1 O   B HOH 945  ? ? O   B HOH 1054 ? ? 2.08 
1265 1 O   A HOH 1085 ? ? O   P HOH 1054 ? ? 2.08 
1266 1 O   Q ASP 316  ? ? O   Q HOH 613  ? ? 2.08 
1267 1 O   M HOH 605  ? ? O   M HOH 662  ? ? 2.08 
1268 1 N   D VAL 7    ? ? O   D HOH 612  ? ? 2.08 
1269 1 O   R HOH 893  ? ? O   R HOH 1100 ? ? 2.08 
1270 1 O   L HOH 639  ? ? O   L HOH 935  ? ? 2.08 
1271 1 O   A HOH 1039 ? ? O   A HOH 1067 ? ? 2.08 
1272 1 O   N HOH 724  ? ? O   N HOH 926  ? ? 2.08 
1273 1 NH1 C ARG 62   ? ? O   C HOH 617  ? ? 2.08 
1274 1 O   U ALA 276  ? ? O   U HOH 625  ? ? 2.08 
1275 1 O   U LYS 44   ? ? O   U HOH 629  ? ? 2.08 
1276 1 O   H GLY 407  ? ? O   H HOH 621  ? ? 2.08 
1277 1 O   Q GLU 395  ? ? O   Q HOH 614  ? ? 2.08 
1278 1 O   J HOH 631  ? ? O   J HOH 642  ? ? 2.08 
1279 1 O   N HOH 672  ? ? O   N HOH 789  ? ? 2.08 
1280 1 O   G HOH 835  ? ? O   G HOH 926  ? ? 2.08 
1281 1 O   G ASP 142  ? ? O   G HOH 620  ? ? 2.08 
1282 1 O   P HOH 641  ? ? O   P HOH 964  ? ? 2.08 
1283 1 O   Q HOH 835  ? ? O   Q HOH 1041 ? ? 2.08 
1284 1 O   D HOH 693  ? ? O   D HOH 957  ? ? 2.08 
1285 1 O   M HOH 741  ? ? O   M HOH 766  ? ? 2.08 
1286 1 O   K HOH 690  ? ? O   K HOH 799  ? ? 2.08 
1287 1 O   N HOH 677  ? ? O   N HOH 843  ? ? 2.08 
1288 1 O   R HOH 631  ? ? O   R HOH 885  ? ? 2.08 
1289 1 O   K HOH 765  ? ? O   K HOH 987  ? ? 2.08 
1290 1 O   R HOH 883  ? ? O   R HOH 1112 ? ? 2.08 
1291 1 O   K HOH 861  ? ? O   K HOH 1040 ? ? 2.08 
1292 1 OE2 L GLU 200  ? B O   L HOH 614  ? ? 2.08 
1293 1 O   D HOH 650  ? ? O   D HOH 1008 ? ? 2.08 
1294 1 O   Q HOH 609  ? ? O   Q HOH 735  ? ? 2.08 
1295 1 O   J HOH 1163 ? ? O   J HOH 1245 ? ? 2.09 
1296 1 NH1 T ARG 80   ? ? O   T HOH 619  ? ? 2.09 
1297 1 O   E HOH 641  ? ? O   E HOH 909  ? ? 2.09 
1298 1 O   O HOH 975  ? ? O   O HOH 1180 ? ? 2.09 
1299 1 O   R HOH 912  ? ? O   R HOH 1129 ? ? 2.09 
1300 1 NZ  Q LYS 44   ? ? O   Q HOH 615  ? ? 2.09 
1301 1 O   J HOH 768  ? ? O   J HOH 1098 ? ? 2.09 
1302 1 O   M HIS 251  ? ? O   M HOH 622  ? ? 2.09 
1303 1 O   F HOH 853  ? ? O   F HOH 1104 ? ? 2.09 
1304 1 O   K GLU 168  ? ? O   K HOH 617  ? ? 2.09 
1305 1 O   B HOH 636  ? ? O   B HOH 897  ? ? 2.09 
1306 1 O   P HOH 964  ? ? O   P HOH 988  ? ? 2.09 
1307 1 O   E HOH 749  ? ? O   E HOH 1011 ? ? 2.09 
1308 1 OE2 B GLU 392  ? ? O   B HOH 621  ? ? 2.09 
1309 1 O   A HOH 871  ? ? O   A HOH 994  ? ? 2.09 
1310 1 OD1 N ASP 275  ? ? O   N HOH 617  ? ? 2.09 
1311 1 O   K HOH 883  ? ? O   K HOH 891  ? ? 2.09 
1312 1 O   L HOH 841  ? ? O   L HOH 952  ? ? 2.09 
1313 1 O   Q HOH 812  ? ? O   Q HOH 917  ? ? 2.09 
1314 1 O   F HOH 985  ? ? O   F HOH 1094 ? ? 2.09 
1315 1 NH2 A ARG 23   ? ? O   A HOH 623  ? ? 2.09 
1316 1 O   R ALA 225  ? ? O   R HOH 613  ? ? 2.09 
1317 1 O   F HOH 854  ? ? O   F HOH 994  ? ? 2.09 
1318 1 O   C HOH 820  ? ? O   C HOH 1029 ? ? 2.09 
1319 1 OE1 L GLU 219  ? ? O   L HOH 615  ? ? 2.09 
1320 1 O   N HOH 1028 ? ? O   N HOH 1033 ? ? 2.09 
1321 1 O   M HOH 881  ? ? O   M HOH 982  ? ? 2.09 
1322 1 O   Q HOH 720  ? ? O   U HOH 763  ? ? 2.09 
1323 1 O   G HOH 637  ? ? O   G HOH 884  ? ? 2.09 
1324 1 N   G ALA 134  ? ? O   G HOH 621  ? ? 2.09 
1325 1 OE1 N GLU 386  ? ? O   N HOH 618  ? ? 2.09 
1326 1 O   B HOH 1050 ? ? O   K HOH 998  ? ? 2.09 
1327 1 O   D ARG 400  ? ? O   D HOH 613  ? ? 2.09 
1328 1 O   R HOH 832  ? ? O   R HOH 980  ? ? 2.09 
1329 1 O   K GLY 160  ? ? O   K HOH 618  ? ? 2.09 
1330 1 OD2 I ASP 331  ? ? O   I HOH 612  ? ? 2.09 
1331 1 OE2 J GLU 109  ? ? O   J HOH 612  ? ? 2.09 
1332 1 OD2 B ASP 113  ? ? O   B HOH 622  ? ? 2.09 
1333 1 O   G HOH 837  ? ? O   G HOH 950  ? ? 2.09 
1334 1 O   E HOH 815  ? ? O   E HOH 992  ? ? 2.09 
1335 1 O   A ILE 196  ? ? O   A HOH 624  ? ? 2.09 
1336 1 O   H GLN 79   ? ? O   H HOH 622  ? ? 2.09 
1337 1 O   A HOH 928  ? ? O   A HOH 1054 ? ? 2.09 
1338 1 O   Q HOH 1072 ? ? O   Q HOH 1106 ? ? 2.09 
1339 1 NZ  B LYS 44   ? ? O   B HOH 623  ? ? 2.09 
1340 1 O   B HOH 994  ? ? O   M HOH 803  ? ? 2.09 
1341 1 O   M HOH 863  ? ? O   M HOH 925  ? ? 2.09 
1342 1 O   G HOH 978  ? ? O   G HOH 1036 ? ? 2.09 
1343 1 OG  C SER 153  ? ? O   C HOH 618  ? ? 2.09 
1344 1 OG  L SER 322  ? ? O   L HOH 616  ? ? 2.09 
1345 1 O   G HOH 654  ? ? O   G HOH 672  ? ? 2.09 
1346 1 OG  U SER 297  ? ? O   U HOH 630  ? ? 2.09 
1347 1 O   J HOH 721  ? ? O   J HOH 979  ? ? 2.09 
1348 1 O   N HOH 988  ? ? O   N HOH 1026 ? ? 2.09 
1349 1 O   T HOH 1091 ? ? O   T HOH 1094 ? ? 2.09 
1350 1 O   D HOH 633  ? ? O   D HOH 1057 ? ? 2.09 
1351 1 O   Q HOH 1063 ? ? O   Q HOH 1125 ? ? 2.09 
1352 1 O   O HOH 1106 ? ? O   O HOH 1130 ? ? 2.09 
1353 1 O   H HOH 725  ? ? O   H HOH 990  ? ? 2.09 
1354 1 NH2 Q ARG 23   ? ? O   Q HOH 616  ? ? 2.09 
1355 1 O   U HOH 1054 ? ? O   U HOH 1099 ? ? 2.09 
1356 1 O   O HOH 655  ? ? O   O HOH 1052 ? ? 2.09 
1357 1 O   O HOH 811  ? ? O   O HOH 929  ? ? 2.09 
1358 1 NH2 T ARG 232  ? ? O   T HOH 620  ? ? 2.09 
1359 1 O   Q HOH 1051 ? ? O   T HOH 906  ? ? 2.09 
1360 1 O   K HOH 783  ? ? O   K HOH 993  ? ? 2.09 
1361 1 O   E HOH 892  ? ? O   E HOH 942  ? ? 2.09 
1362 1 O   L HOH 1065 ? ? O   L HOH 1084 ? ? 2.09 
1363 1 O   R PRO 394  ? ? O   R HOH 614  ? ? 2.10 
1364 1 O   T HOH 712  ? ? O   T HOH 1043 ? ? 2.10 
1365 1 O   K HOH 975  ? ? O   K HOH 1022 ? ? 2.10 
1366 1 O   K HOH 829  ? ? O   M HOH 944  ? ? 2.10 
1367 1 O   F HOH 926  ? ? O   F HOH 1052 ? ? 2.10 
1368 1 NH2 U ARG 349  ? ? O   U HOH 631  ? ? 2.10 
1369 1 O   C HOH 1017 ? ? O   C HOH 1053 ? ? 2.10 
1370 1 O   N HOH 956  ? ? O   N HOH 1030 ? ? 2.10 
1371 1 OG  Q SER 25   ? ? O   Q HOH 617  ? ? 2.10 
1372 1 O   N HOH 890  ? ? O   N HOH 1030 ? ? 2.10 
1373 1 O   M HOH 886  ? ? O   M HOH 1018 ? ? 2.10 
1374 1 O   Q HOH 1049 ? ? O   F HOH 966  ? ? 2.10 
1375 1 O   B HOH 713  ? ? O   B HOH 930  ? ? 2.10 
1376 1 O   J HOH 806  ? ? O   J HOH 1080 ? ? 2.10 
1377 1 O   F HOH 784  ? ? O   F HOH 827  ? ? 2.10 
1378 1 O   I HOH 983  ? ? O   I HOH 1091 ? ? 2.10 
1379 1 OE1 I GLU 109  ? ? O   I HOH 613  ? ? 2.10 
1380 1 O   M HOH 828  ? ? O   M HOH 964  ? ? 2.10 
1381 1 O   E HOH 946  ? ? O   E HOH 1025 ? ? 2.10 
1382 1 NZ  N LYS 296  ? ? O   N HOH 619  ? ? 2.10 
1383 1 O   K HOH 1059 ? ? O   Q HOH 996  ? ? 2.10 
1384 1 O   I HOH 1061 ? ? O   I HOH 1155 ? ? 2.10 
1385 1 O   T HOH 984  ? ? O   T HOH 1035 ? ? 2.10 
1386 1 NH2 D ARG 80   ? ? O   D HOH 614  ? ? 2.10 
1387 1 O   I HOH 941  ? ? O   I HOH 1152 ? ? 2.10 
1388 1 O   J HOH 758  ? ? O   J HOH 933  ? ? 2.10 
1389 1 O   J HOH 822  ? ? O   J HOH 1107 ? ? 2.10 
1390 1 O   B HOH 976  ? ? O   B HOH 979  ? ? 2.10 
1391 1 NE2 A GLN 68   ? ? O   A HOH 625  ? ? 2.10 
1392 1 OH  Q TYR 241  ? ? O   Q HOH 618  ? ? 2.10 
1393 1 OE2 T GLU 200  ? ? O   T HOH 621  ? ? 2.10 
1394 1 O   I HOH 1172 ? ? O   I HOH 1194 ? ? 2.10 
1395 1 O   I HOH 650  ? ? O   I HOH 806  ? ? 2.10 
1396 1 O   N HOH 917  ? ? O   N HOH 978  ? ? 2.10 
1397 1 O   L HOH 787  ? ? O   L HOH 983  ? ? 2.10 
1398 1 O   K HOH 612  ? ? O   K HOH 996  ? ? 2.10 
1399 1 O   I HOH 914  ? ? O   I HOH 1064 ? ? 2.10 
1400 1 OE1 F GLU 263  ? ? O   F HOH 617  ? ? 2.10 
1401 1 O   E HOH 768  ? ? O   E HOH 896  ? ? 2.10 
1402 1 O   N HOH 808  ? ? O   N HOH 930  ? ? 2.10 
1403 1 O   A HOH 743  ? ? O   A HOH 1049 ? ? 2.10 
1404 1 O   C HOH 717  ? ? O   C HOH 1046 ? ? 2.10 
1405 1 O   K HOH 953  ? ? O   K HOH 1004 ? ? 2.10 
1406 1 O   F HOH 678  ? ? O   F HOH 792  ? ? 2.10 
1407 1 O   J GLU 163  ? ? O   J HOH 613  ? ? 2.10 
1408 1 O   K HOH 1108 ? ? O   K HOH 1117 ? ? 2.10 
1409 1 OD2 F ASP 261  ? ? O   F HOH 618  ? ? 2.10 
1410 1 O   F HOH 631  ? ? O   F HOH 681  ? ? 2.10 
1411 1 OD2 E ASP 233  ? ? O   E HOH 624  ? ? 2.10 
1412 1 O   L ALA 38   ? ? O   L HOH 617  ? ? 2.10 
1413 1 O   C HOH 982  ? ? O   C HOH 988  ? ? 2.10 
1414 1 O   K HOH 774  ? ? O   K HOH 1028 ? ? 2.10 
1415 1 O   K HOH 900  ? ? O   K HOH 1054 ? ? 2.10 
1416 1 O   O HOH 825  ? ? O   O HOH 900  ? ? 2.10 
1417 1 O   D HOH 713  ? ? O   K HOH 1044 ? ? 2.10 
1418 1 O   I HOH 1038 ? ? O   I HOH 1195 ? ? 2.10 
1419 1 O   F HOH 628  ? ? O   F HOH 815  ? ? 2.10 
1420 1 O   T GLN 106  ? ? O   T HOH 622  ? ? 2.10 
1421 1 O2  B SO4 501  ? ? O   B HOH 624  ? ? 2.10 
1422 1 O   C HOH 834  ? ? O   H HOH 657  ? ? 2.10 
1423 1 O   O HOH 1087 ? ? O   O HOH 1126 ? ? 2.10 
1424 1 OH  C TYR 294  ? ? O   C HOH 619  ? ? 2.10 
1425 1 O   F HOH 865  ? ? O   F HOH 946  ? ? 2.10 
1426 1 O   R HOH 1143 ? ? O   R HOH 1178 ? ? 2.10 
1427 1 NH1 C ARG 76   ? ? O   C HOH 620  ? ? 2.10 
1428 1 O   J HOH 858  ? ? O   J HOH 1181 ? ? 2.10 
1429 1 O   D HOH 1156 ? ? O   D HOH 1159 ? ? 2.10 
1430 1 OE2 M GLU 29   ? ? O   M HOH 623  ? ? 2.10 
1431 1 O   P HOH 615  ? ? O   P HOH 785  ? ? 2.10 
1432 1 O   Q HOH 1055 ? ? O   Q HOH 1085 ? ? 2.10 
1433 1 O   E HOH 719  ? ? O   E HOH 966  ? ? 2.10 
1434 1 O   C HOH 961  ? ? O   H HOH 622  ? ? 2.10 
1435 1 O   D HOH 897  ? ? O   D HOH 933  ? ? 2.10 
1436 1 O   C HOH 1004 ? ? O   C HOH 1109 ? ? 2.11 
1437 1 O   C HOH 711  ? ? O   C HOH 829  ? ? 2.11 
1438 1 O   B HOH 963  ? ? O   B HOH 983  ? ? 2.11 
1439 1 O   I HOH 1010 ? ? O   I HOH 1037 ? ? 2.11 
1440 1 O   Q HOH 860  ? ? O   Q HOH 862  ? ? 2.11 
1441 1 OD1 K ASP 32   ? ? O   K HOH 619  ? ? 2.11 
1442 1 OE1 C GLN 8    ? ? O   C HOH 621  ? ? 2.11 
1443 1 O   P HOH 940  ? ? O   P HOH 989  ? ? 2.11 
1444 1 NH2 J ARG 403  ? ? O   J HOH 614  ? ? 2.11 
1445 1 ND2 F ASN 281  ? ? O   F HOH 619  ? ? 2.11 
1446 1 OG  N SER 103  ? ? O   N HOH 620  ? ? 2.11 
1447 1 N   D PHE 216  ? ? O   D HOH 615  ? ? 2.11 
1448 1 O   O HOH 1060 ? ? O   O HOH 1088 ? ? 2.11 
1449 1 O   C HOH 1163 ? ? O   F HOH 993  ? ? 2.11 
1450 1 O   E HOH 710  ? ? O   E HOH 948  ? ? 2.11 
1451 1 NH1 Q ARG 86   ? ? O   Q HOH 619  ? ? 2.11 
1452 1 O   B HOH 1106 ? ? O   D HOH 1106 ? ? 2.11 
1453 1 O   T HOH 1005 ? ? O   T HOH 1028 ? ? 2.11 
1454 1 O   A HOH 866  ? ? O   A HOH 967  ? ? 2.11 
1455 1 OD1 K ASP 417  ? ? O   K HOH 620  ? ? 2.11 
1456 1 O   K HOH 631  ? ? O   K HOH 890  ? ? 2.11 
1457 1 O   A HOH 711  ? ? O   A HOH 994  ? ? 2.11 
1458 1 O   J HOH 892  ? ? O   J HOH 1028 ? ? 2.11 
1459 1 O   P HOH 877  ? ? O   P HOH 914  ? ? 2.11 
1460 1 O   H HOH 961  ? ? O   H HOH 1118 ? ? 2.11 
1461 1 O   D PRO 165  ? ? O   D HOH 616  ? ? 2.11 
1462 1 O   F HOH 756  ? ? O   F HOH 798  ? ? 2.11 
1463 1 O   J HOH 661  ? ? O   J HOH 1154 ? ? 2.11 
1464 1 O   U HOH 798  ? ? O   U HOH 965  ? ? 2.11 
1465 1 O   N HOH 660  ? ? O   N HOH 995  ? ? 2.11 
1466 1 O   R HOH 707  ? ? O   R HOH 775  ? ? 2.11 
1467 1 OE1 N GLN 149  ? ? O   N HOH 621  ? ? 2.11 
1468 1 O   L HOH 778  ? ? O   L HOH 907  ? ? 2.11 
1469 1 O   M HOH 687  ? ? O   M HOH 1090 ? ? 2.11 
1470 1 O   L HOH 797  ? ? O   L HOH 864  ? ? 2.11 
1471 1 O   C HOH 802  ? ? O   C HOH 1094 ? ? 2.11 
1472 1 O   O HOH 940  ? ? O   O HOH 1031 ? ? 2.11 
1473 1 O   C HOH 1185 ? ? O   C HOH 1194 ? ? 2.11 
1474 1 NH1 O ARG 34   ? ? O1  O SO4 502  ? ? 2.11 
1475 1 OE2 I GLU 244  ? ? O   I HOH 614  ? ? 2.11 
1476 1 O   Q HOH 785  ? ? O   Q HOH 987  ? ? 2.11 
1477 1 O   M PRO 197  ? ? O   M HOH 624  ? ? 2.11 
1478 1 O   B HOH 620  ? ? O   B HOH 621  ? ? 2.11 
1479 1 O   U HOH 1089 ? ? O   U HOH 1109 ? ? 2.11 
1480 1 O   I HOH 1130 ? ? O   I HOH 1208 ? ? 2.11 
1481 1 O   E HOH 971  ? ? O   E HOH 1119 ? ? 2.11 
1482 1 OE1 N GLU 163  ? ? O   N HOH 622  ? ? 2.11 
1483 1 O   B HOH 802  ? ? O   K HOH 850  ? ? 2.11 
1484 1 O   R HOH 641  ? ? O   R HOH 1124 ? ? 2.11 
1485 1 O   Q HOH 662  ? ? O   Q HOH 927  ? ? 2.11 
1486 1 O   O HOH 740  ? ? O   O HOH 1062 ? ? 2.11 
1487 1 OD2 L ASP 290  ? ? O   L HOH 618  ? ? 2.11 
1488 1 O   Q HOH 1064 ? ? O   Q HOH 1092 ? ? 2.11 
1489 1 O   H HOH 694  ? ? O   H HOH 938  ? ? 2.11 
1490 1 O   J HOH 896  ? ? O   J HOH 1207 ? ? 2.11 
1491 1 O   T TYR 125  ? ? O   T HOH 623  ? ? 2.11 
1492 1 O   H HOH 698  ? ? O   H HOH 1018 ? ? 2.11 
1493 1 O   G HOH 693  ? ? O   G HOH 739  ? ? 2.11 
1494 1 O   L HOH 696  ? ? O   L HOH 1030 ? ? 2.11 
1495 1 O   B HOH 635  ? ? O   B HOH 1040 ? ? 2.11 
1496 1 O   L HOH 640  ? ? O   L HOH 714  ? ? 2.11 
1497 1 O   M HOH 1032 ? ? O   M HOH 1101 ? ? 2.11 
1498 1 O   K HOH 887  ? ? O   K HOH 935  ? ? 2.11 
1499 1 O   A HOH 630  ? ? O   E HOH 888  ? ? 2.11 
1500 1 O   G ASP 185  ? ? O   G HOH 622  ? ? 2.11 
1501 1 O   H HOH 1100 ? ? O   I HOH 927  ? ? 2.11 
1502 1 OD1 B ASP 237  ? ? O   B HOH 625  ? ? 2.11 
1503 1 NE2 C GLN 68   ? ? O   C HOH 622  ? ? 2.11 
1504 1 O   U HOH 940  ? ? O   U HOH 982  ? ? 2.11 
1505 1 O   A HOH 742  ? ? O   A HOH 757  ? ? 2.11 
1506 1 O   G SER 352  ? ? O   G HOH 623  ? ? 2.11 
1507 1 O   I HOH 603  ? ? O   I HOH 855  ? ? 2.11 
1508 1 O   D HOH 637  ? ? O   D HOH 1007 ? ? 2.11 
1509 1 O   D HOH 928  ? ? O   D HOH 1081 ? ? 2.11 
1510 1 NH1 F ARG 403  ? ? O   F HOH 620  ? ? 2.11 
1511 1 O   A HOH 684  ? ? O   A HOH 1000 ? ? 2.11 
1512 1 O   C HOH 936  ? ? O   H HOH 1020 ? ? 2.11 
1513 1 O   T HOH 810  ? ? O   T HOH 1153 ? ? 2.11 
1514 1 O   P HOH 1003 ? ? O   P HOH 1039 ? ? 2.11 
1515 1 O   C PRO 124  ? ? O   C HOH 623  ? ? 2.11 
1516 1 O   R HOH 1031 ? ? O   R HOH 1105 ? ? 2.11 
1517 1 O   G ASP 318  ? ? O   G HOH 624  ? ? 2.11 
1518 1 O   C HOH 889  ? ? O   C HOH 1084 ? ? 2.11 
1519 1 O   D HOH 982  ? ? O   D HOH 1015 ? ? 2.11 
1520 1 O   L HOH 684  ? ? O   L HOH 971  ? ? 2.12 
1521 1 O   G HOH 647  ? ? O   G HOH 791  ? ? 2.12 
1522 1 O   R HOH 622  ? ? O   R HOH 779  ? ? 2.12 
1523 1 O   R HOH 1006 ? ? O   R HOH 1086 ? ? 2.12 
1524 1 OE1 N GLU 200  ? ? O   N HOH 623  ? ? 2.12 
1525 1 O   F HOH 741  ? ? O   F HOH 1080 ? ? 2.12 
1526 1 O   H ASP 316  ? ? O   H HOH 623  ? ? 2.12 
1527 1 O   C HOH 973  ? ? O   C HOH 1169 ? ? 2.12 
1528 1 O   P ALA 250  ? ? O   P HOH 613  ? ? 2.12 
1529 1 O   E HOH 943  ? ? O   E HOH 1151 ? ? 2.12 
1530 1 O   R HOH 690  ? ? O   R HOH 1112 ? ? 2.12 
1531 1 OE1 F GLU 200  ? ? O   F HOH 621  ? ? 2.12 
1532 1 O   C ASP 237  ? ? O   C HOH 624  ? ? 2.12 
1533 1 O   B HOH 614  ? ? O   B HOH 890  ? ? 2.12 
1534 1 NH1 A ARG 76   ? ? O   A HOH 626  ? ? 2.12 
1535 1 O   Q HOH 854  ? ? O   Q HOH 1013 ? ? 2.12 
1536 1 NE2 D GLN 106  ? ? O   D HOH 617  ? ? 2.12 
1537 1 O   H HOH 621  ? ? O   H HOH 632  ? ? 2.12 
1538 1 O   H HOH 830  ? ? O   H HOH 1082 ? ? 2.12 
1539 1 O   O HOH 782  ? ? O   O HOH 1039 ? ? 2.12 
1540 1 NZ  O LYS 44   ? ? O   O HOH 615  ? ? 2.12 
1541 1 O   E HOH 895  ? ? O   E HOH 1029 ? ? 2.12 
1542 1 O   I HOH 870  ? ? O   I HOH 1021 ? ? 2.12 
1543 1 OD2 R ASP 192  ? ? O   R HOH 615  ? ? 2.12 
1544 1 OE2 B GLU 179  ? ? O   B HOH 626  ? ? 2.12 
1545 1 O   B HOH 658  ? ? O   D HOH 614  ? ? 2.12 
1546 1 O   F HOH 940  ? ? O   F HOH 1037 ? ? 2.12 
1547 1 O   L ASP 286  ? ? O   L HOH 619  ? ? 2.12 
1548 1 O   P HOH 679  ? ? O   P HOH 1056 ? ? 2.12 
1549 1 NE  P ARG 349  ? ? O   P HOH 614  ? ? 2.12 
1550 1 O   M HOH 874  ? ? O   M HOH 927  ? ? 2.12 
1551 1 OE2 M GLU 163  ? ? O   M HOH 625  ? ? 2.12 
1552 1 O   O GLN 106  ? ? O   O HOH 616  ? ? 2.12 
1553 1 O   E HOH 962  ? ? O   E HOH 1101 ? ? 2.12 
1554 1 O   E HOH 985  ? ? O   E HOH 999  ? ? 2.12 
1555 1 O   U HOH 822  ? ? O   U HOH 879  ? ? 2.12 
1556 1 O   H HOH 677  ? ? O   H HOH 947  ? ? 2.12 
1557 1 O   K VAL 243  ? ? O   K HOH 621  ? ? 2.12 
1558 1 O2  T SO4 501  ? ? O   T HOH 624  ? ? 2.12 
1559 1 O   N HOH 625  ? ? O   N HOH 891  ? ? 2.12 
1560 1 O   P HOH 1021 ? ? O   P HOH 1050 ? ? 2.12 
1561 1 OE2 K GLU 188  ? ? O   K HOH 622  ? ? 2.12 
1562 1 OD2 N ASP 261  ? ? O   N HOH 624  ? ? 2.12 
1563 1 O   C VAL 390  ? ? O   C HOH 625  ? ? 2.12 
1564 1 O   A HOH 722  ? ? O   A HOH 804  ? ? 2.12 
1565 1 O   Q HOH 945  ? ? O   Q HOH 1097 ? ? 2.12 
1566 1 O   U ILE 384  ? ? O   U HOH 632  ? ? 2.12 
1567 1 O   G HOH 870  ? ? O   G HOH 1055 ? ? 2.12 
1568 1 O   G HOH 915  ? ? O   G HOH 1001 ? ? 2.12 
1569 1 O   N HOH 808  ? ? O   N HOH 871  ? ? 2.12 
1570 1 O   B HOH 926  ? ? O   B HOH 1011 ? ? 2.12 
1571 1 O   F HOH 693  ? ? O   U HOH 979  ? ? 2.12 
1572 1 O   J HOH 936  ? ? O   J HOH 937  ? ? 2.12 
1573 1 NZ  F LYS 366  ? ? O   F HOH 622  ? ? 2.12 
1574 1 O   R HOH 765  ? ? O   R HOH 770  ? ? 2.12 
1575 1 O   K HOH 920  ? ? O   M HOH 962  ? ? 2.12 
1576 1 O   H HOH 1004 ? ? O   H HOH 1030 ? ? 2.12 
1577 1 O   T HOH 844  ? ? O   T HOH 1073 ? ? 2.12 
1578 1 NH2 J ARG 23   ? ? O   J HOH 615  ? ? 2.12 
1579 1 O   R HOH 756  ? ? O   R HOH 1077 ? ? 2.12 
1580 1 O   E VAL 243  ? ? O   E HOH 625  ? ? 2.12 
1581 1 O   C HOH 710  ? ? O   C HOH 1018 ? ? 2.12 
1582 1 O   B ILE 196  ? ? O   B HOH 627  ? ? 2.12 
1583 1 O   A HOH 795  ? ? O   A HOH 931  ? ? 2.12 
1584 1 O   F HOH 1001 ? ? O   F HOH 1012 ? ? 2.12 
1585 1 N   H ALA 134  ? ? O   H HOH 624  ? ? 2.12 
1586 1 O   R HOH 1152 ? ? O   R HOH 1173 ? ? 2.12 
1587 1 O   C HOH 755  ? ? O   C HOH 875  ? ? 2.12 
1588 1 O   Q HOH 940  ? ? O   T HOH 1064 ? ? 2.12 
1589 1 O   O HOH 1037 ? ? O   O HOH 1058 ? ? 2.12 
1590 1 NE2 A GLN 372  ? ? O   A HOH 627  ? ? 2.12 
1591 1 O   Q HOH 841  ? ? O   Q HOH 1054 ? ? 2.12 
1592 1 O   B HOH 1111 ? ? O   B HOH 1126 ? ? 2.12 
1593 1 O   H HOH 973  ? ? O   H HOH 1010 ? ? 2.12 
1594 1 O   N HOH 924  ? ? O   N HOH 1066 ? ? 2.12 
1595 1 O   L HOH 905  ? ? O   L HOH 1080 ? ? 2.12 
1596 1 O   R HOH 1055 ? ? O   R HOH 1070 ? ? 2.12 
1597 1 O   B HOH 834  ? ? O   B HOH 989  ? ? 2.12 
1598 1 O   M HOH 1025 ? ? O   M HOH 1099 ? ? 2.12 
1599 1 O   J PRO 97   ? ? O   J HOH 616  ? ? 2.12 
1600 1 O   C HOH 990  ? ? O   C HOH 1042 ? ? 2.12 
1601 1 O   C HOH 1020 ? ? O   C HOH 1101 ? ? 2.12 
1602 1 NZ  H LYS 366  ? ? O   H HOH 625  ? ? 2.12 
1603 1 O   K HOH 1041 ? ? O   K HOH 1102 ? ? 2.12 
1604 1 O   Q HOH 865  ? ? O   Q HOH 1061 ? ? 2.12 
1605 1 O   G HOH 1051 ? ? O   G HOH 1067 ? ? 2.12 
1606 1 OD1 N ASP 94   ? ? O   N HOH 625  ? ? 2.13 
1607 1 O   H HOH 619  ? ? O   H HOH 958  ? ? 2.13 
1608 1 O   Q HOH 849  ? ? O   T HOH 1118 ? ? 2.13 
1609 1 O   B HOH 727  ? ? O   B HOH 1032 ? ? 2.13 
1610 1 O   H HOH 756  ? ? O   H HOH 1017 ? ? 2.13 
1611 1 OG1 R THR 170  ? ? O   R HOH 616  ? ? 2.13 
1612 1 O   T HOH 628  ? ? O   T HOH 703  ? ? 2.13 
1613 1 OD2 Q ASP 270  ? ? O   Q HOH 620  ? ? 2.13 
1614 1 O   B HOH 972  ? ? O   D HOH 1050 ? ? 2.13 
1615 1 O   A HOH 961  ? ? O   B HOH 863  ? ? 2.13 
1616 1 O   O HOH 871  ? ? O   O HOH 946  ? ? 2.13 
1617 1 O   Q HOH 1016 ? ? O   U HOH 835  ? ? 2.13 
1618 1 O   E HOH 703  ? ? O   E HOH 1085 ? ? 2.13 
1619 1 O   F HOH 811  ? ? O   F HOH 944  ? ? 2.13 
1620 1 OD2 D ASP 316  ? ? O   D HOH 618  ? ? 2.13 
1621 1 OD1 C ASP 32   ? ? O   C HOH 626  ? ? 2.13 
1622 1 O   B HOH 781  ? ? O   B HOH 848  ? ? 2.13 
1623 1 O   Q HOH 1010 ? ? O   Q HOH 1128 ? ? 2.13 
1624 1 O   G HOH 1047 ? ? O   G HOH 1069 ? ? 2.13 
1625 1 OD2 L ASP 420  ? ? O   L HOH 620  ? ? 2.13 
1626 1 O   J HOH 895  ? ? O   J HOH 938  ? ? 2.13 
1627 1 O   N GLY 171  ? ? O   N HOH 626  ? ? 2.13 
1628 1 O   P PHE 262  ? ? O   P HOH 615  ? ? 2.13 
1629 1 NH1 B ARG 76   ? ? O   B HOH 628  ? ? 2.13 
1630 1 O   J HOH 927  ? ? O   J HOH 976  ? ? 2.13 
1631 1 O   J HOH 1048 ? ? O   J HOH 1197 ? ? 2.13 
1632 1 O   H HOH 1079 ? ? O   H HOH 1126 ? ? 2.13 
1633 1 O   P ARG 402  ? ? O   P HOH 616  ? ? 2.13 
1634 1 O   C HOH 730  ? ? O   C HOH 775  ? ? 2.13 
1635 1 O   B HOH 992  ? ? O   M HOH 822  ? ? 2.13 
1636 1 OE1 M GLN 372  ? ? O   M HOH 626  ? ? 2.13 
1637 1 O   Q LEU 421  ? ? O   Q HOH 621  ? ? 2.13 
1638 1 OE1 P GLN 413  ? ? O   P HOH 617  ? ? 2.13 
1639 1 OD1 A ASN 57   ? ? O   A HOH 628  ? ? 2.13 
1640 1 O   I HOH 1203 ? ? O   I HOH 1221 ? ? 2.13 
1641 1 O   D HOH 1127 ? ? O   K HOH 1109 ? ? 2.13 
1642 1 O   A HOH 895  ? ? O   A HOH 1016 ? ? 2.13 
1643 1 OH  L TYR 353  ? ? O   L HOH 621  ? ? 2.13 
1644 1 O   T HOH 640  ? ? O   T HOH 944  ? ? 2.13 
1645 1 O   K HOH 939  ? ? O   K HOH 963  ? ? 2.13 
1646 1 O   K ILE 183  ? ? O   K HOH 621  ? ? 2.13 
1647 1 O   B HOH 849  ? ? O   K HOH 921  ? ? 2.13 
1648 1 O   U HOH 922  ? ? O   U HOH 950  ? ? 2.13 
1649 1 O   F HOH 997  ? ? O   F HOH 1093 ? ? 2.13 
1650 1 O   N VAL 7    ? ? O   N HOH 627  ? ? 2.13 
1651 1 O   A HOH 824  ? ? O   A HOH 987  ? ? 2.13 
1652 1 O   T HOH 700  ? ? O   T HOH 788  ? ? 2.13 
1653 1 NH1 K ARG 349  ? ? O   K HOH 623  ? ? 2.13 
1654 1 O   Q HOH 659  ? ? O   Q HOH 835  ? ? 2.13 
1655 1 O   J HOH 1107 ? ? O   J HOH 1207 ? ? 2.13 
1656 1 O   E HOH 726  ? ? O   E HOH 1102 ? ? 2.13 
1657 1 OE1 B GLU 29   ? ? O   B HOH 629  ? ? 2.13 
1658 1 O   H HOH 881  ? ? O   H HOH 966  ? ? 2.13 
1659 1 OH  T TYR 129  ? ? O   T HOH 625  ? ? 2.13 
1660 1 O   M HOH 603  ? ? O   M HOH 909  ? ? 2.13 
1661 1 O   G HOH 723  ? ? O   G HOH 824  ? ? 2.13 
1662 1 O   D HOH 1165 ? ? O   M HOH 1015 ? ? 2.13 
1663 1 O   E HOH 843  ? ? O   E HOH 954  ? ? 2.13 
1664 1 O   O HOH 1169 ? ? O   O HOH 1172 ? ? 2.13 
1665 1 O   A VAL 7    ? ? O   A HOH 629  ? ? 2.13 
1666 1 O   T HOH 789  ? ? O   T HOH 875  ? ? 2.13 
1667 1 OD2 O ASP 32   ? ? O   O HOH 617  ? ? 2.13 
1668 1 OG1 R THR 111  ? ? OD1 R ASP 233  ? ? 2.13 
1669 1 O   O HOH 904  ? ? O   O HOH 1026 ? ? 2.13 
1670 1 O   R HOH 752  ? ? O   R HOH 913  ? ? 2.13 
1671 1 O   R HOH 612  ? ? O   R HOH 1023 ? ? 2.13 
1672 1 O   C HOH 1143 ? ? O   C HOH 1160 ? ? 2.13 
1673 1 O   A HOH 1085 ? ? O   P HOH 1053 ? ? 2.13 
1674 1 O   O HOH 904  ? ? O   O HOH 1069 ? ? 2.13 
1675 1 O   K HOH 873  ? ? O   K HOH 911  ? ? 2.13 
1676 1 O   K HOH 1001 ? ? O   K HOH 1003 ? ? 2.13 
1677 1 O   F HOH 860  ? ? O   F HOH 988  ? ? 2.13 
1678 1 O   H HOH 905  ? ? O   H HOH 1053 ? ? 2.13 
1679 1 O   C HOH 886  ? ? O   C HOH 925  ? ? 2.13 
1680 1 O   F HOH 618  ? ? O   F HOH 869  ? ? 2.13 
1681 1 O   I HOH 730  ? ? O   I HOH 969  ? ? 2.13 
1682 1 O   J HOH 1198 ? ? O   J HOH 1202 ? ? 2.13 
1683 1 OD1 O ASP 275  ? ? O   O HOH 618  ? ? 2.13 
1684 1 O   G HOH 803  ? ? O   G HOH 875  ? ? 2.13 
1685 1 O   H HOH 855  ? ? O   H HOH 924  ? ? 2.13 
1686 1 O   L HOH 712  ? ? O   L HOH 930  ? ? 2.13 
1687 1 O   O HOH 681  ? ? O   O HOH 851  ? ? 2.13 
1688 1 O   K HOH 822  ? ? O   M HOH 965  ? ? 2.13 
1689 1 O   B HOH 743  ? ? O   B HOH 1026 ? ? 2.13 
1690 1 O   H HOH 945  ? ? O   G HOH 948  ? ? 2.13 
1691 1 OE1 A GLN 79   ? ? O   A HOH 630  ? ? 2.13 
1692 1 O   Q HOH 780  ? ? O   Q HOH 1038 ? ? 2.13 
1693 1 O   B HOH 971  ? ? O   M HOH 757  ? ? 2.13 
1694 1 O   M HOH 986  ? ? O   M HOH 1074 ? ? 2.13 
1695 1 OD1 C ASP 156  ? ? O   C HOH 627  ? ? 2.13 
1696 1 NE2 C GLN 8    ? ? O   C HOH 628  ? ? 2.13 
1697 1 O   D HOH 1090 ? ? O   D HOH 1105 ? ? 2.13 
1698 1 N   E LYS 215  ? ? O   E HOH 626  ? ? 2.13 
1699 1 O   I HIS 150  ? ? O   I HOH 615  ? ? 2.13 
1700 1 O   E HOH 946  ? ? O   E HOH 1119 ? ? 2.13 
1701 1 O   J HOH 906  ? ? O   J HOH 1137 ? ? 2.13 
1702 1 OD1 M ASP 315  ? ? O   M HOH 627  ? ? 2.13 
1703 1 O   D ASP 397  ? ? O   D HOH 604  ? ? 2.14 
1704 1 O   U HOH 667  ? ? O   U HOH 916  ? ? 2.14 
1705 1 O   E HOH 931  ? ? O   E HOH 1103 ? ? 2.14 
1706 1 O   A HOH 645  ? ? O   A HOH 794  ? ? 2.14 
1707 1 O   R HOH 857  ? ? O   R HOH 1045 ? ? 2.14 
1708 1 O   D HOH 863  ? ? O   D HOH 985  ? ? 2.14 
1709 1 O   B HOH 888  ? ? O   B HOH 928  ? ? 2.14 
1710 1 O   I HOH 1088 ? ? O   I HOH 1174 ? ? 2.14 
1711 1 NE2 P HIS 251  ? ? OG  P SER 256  ? ? 2.14 
1712 1 O   C HOH 1177 ? ? O   C HOH 1209 ? ? 2.14 
1713 1 O   J HOH 996  ? ? O   J HOH 1057 ? ? 2.14 
1714 1 OE1 P GLU 182  ? ? O   P HOH 618  ? ? 2.14 
1715 1 O   H HOH 742  ? ? O   H HOH 904  ? ? 2.14 
1716 1 O   P HOH 1000 ? ? O   P HOH 1016 ? ? 2.14 
1717 1 O   U HOH 1052 ? ? O   U HOH 1054 ? ? 2.14 
1718 1 O   I HOH 826  ? ? O   I HOH 887  ? ? 2.14 
1719 1 O   T HOH 703  ? ? O   T HOH 947  ? ? 2.14 
1720 1 O   Q HOH 606  ? ? O   Q HOH 1050 ? ? 2.14 
1721 1 OD2 B ASP 227  ? ? O   B HOH 630  ? ? 2.14 
1722 1 NZ  U LYS 140  ? ? O   U HOH 633  ? ? 2.14 
1723 1 O   C HOH 641  ? ? O   C HOH 806  ? ? 2.14 
1724 1 O   Q HOH 1032 ? ? O   Q HOH 1105 ? ? 2.14 
1725 1 O   O HOH 924  ? ? O   O HOH 1102 ? ? 2.14 
1726 1 O   H HOH 905  ? ? O   H HOH 913  ? ? 2.14 
1727 1 O   C HOH 1071 ? ? O   C HOH 1142 ? ? 2.14 
1728 1 O   K LYS 44   ? ? O   K HOH 624  ? ? 2.14 
1729 1 O   I HOH 724  ? ? O   I HOH 1035 ? ? 2.14 
1730 1 O   B HOH 687  ? ? O   B HOH 925  ? ? 2.14 
1731 1 O   I HOH 622  ? ? O   I HOH 728  ? ? 2.14 
1732 1 O   T HOH 896  ? ? O   T HOH 1109 ? ? 2.14 
1733 1 O   M HOH 974  ? ? O   M HOH 1101 ? ? 2.14 
1734 1 O   C HOH 725  ? ? O   C HOH 1129 ? ? 2.14 
1735 1 O   C HOH 1050 ? ? O   C HOH 1191 ? ? 2.14 
1736 1 O   N HOH 966  ? ? O   N HOH 992  ? ? 2.14 
1737 1 O   G HOH 610  ? ? O   G HOH 929  ? ? 2.14 
1738 1 OG  F SER 231  ? ? O   F HOH 623  ? ? 2.14 
1739 1 N   D VAL 211  ? ? O   D HOH 602  ? ? 2.14 
1740 1 OE1 M GLU 109  ? ? O   M HOH 628  ? ? 2.14 
1741 1 OH  H TYR 353  ? ? O   H HOH 626  ? ? 2.14 
1742 1 O   M HOH 644  ? ? O   M HOH 888  ? ? 2.14 
1743 1 O   Q ARG 320  ? ? O   Q HOH 622  ? ? 2.14 
1744 1 O   B PRO 228  ? ? O   B HOH 631  ? ? 2.14 
1745 1 O   M HOH 966  ? ? O   M HOH 993  ? ? 2.14 
1746 1 O   C HOH 970  ? ? O   H HOH 1046 ? ? 2.14 
1747 1 ND2 F ASN 178  ? ? O   F GLU 182  ? ? 2.14 
1748 1 O   H HOH 610  ? ? O   H HOH 613  ? ? 2.14 
1749 1 O   U HOH 707  ? ? O   U HOH 992  ? ? 2.14 
1750 1 O   K HOH 840  ? ? O   K HOH 939  ? ? 2.14 
1751 1 O   I HOH 940  ? ? O   I HOH 1130 ? ? 2.14 
1752 1 O   E HOH 1021 ? ? O   E HOH 1103 ? ? 2.14 
1753 1 O   L HOH 921  ? ? O   L HOH 1076 ? ? 2.14 
1754 1 O   J HOH 847  ? ? O   J HOH 1030 ? ? 2.14 
1755 1 O   Q HOH 962  ? ? O   T HOH 820  ? ? 2.14 
1756 1 O   I HOH 1009 ? ? O   I HOH 1067 ? ? 2.14 
1757 1 O   J HOH 1115 ? ? O   J HOH 1226 ? ? 2.14 
1758 1 OD1 J ASP 275  ? ? O   J HOH 617  ? ? 2.14 
1759 1 O   A HOH 1080 ? ? O   A HOH 1103 ? ? 2.14 
1760 1 N   D ASP 136  ? ? O   D HOH 619  ? ? 2.14 
1761 1 O   Q HOH 725  ? ? O   Q HOH 897  ? ? 2.14 
1762 1 ND1 C HIS 370  ? ? O   C HOH 629  ? ? 2.14 
1763 1 O   M HOH 880  ? ? O   M HOH 898  ? ? 2.14 
1764 1 NH2 C ARG 223  ? ? O   C HOH 630  ? ? 2.14 
1765 1 OH  H TYR 40   ? ? O   H HOH 627  ? ? 2.14 
1766 1 O   E HOH 867  ? ? O   E HOH 964  ? ? 2.14 
1767 1 OD2 K ASP 227  ? ? O   K HOH 625  ? ? 2.14 
1768 1 O   H HOH 1009 ? ? O   H HOH 1047 ? ? 2.14 
1769 1 O   T ARG 101  ? ? O   T HOH 626  ? ? 2.14 
1770 1 O   H HOH 1067 ? ? O   H HOH 1097 ? ? 2.14 
1771 1 OE1 E GLN 106  ? ? O   E HOH 627  ? ? 2.14 
1772 1 O   O HOH 941  ? ? O   O HOH 1143 ? ? 2.14 
1773 1 O   B HOH 901  ? ? O   D HOH 1050 ? ? 2.14 
1774 1 O   T HOH 1151 ? ? O   T HOH 1181 ? ? 2.14 
1775 1 O3  T SO4 503  ? ? O   T HOH 627  ? ? 2.14 
1776 1 O   A HOH 665  ? ? O   A HOH 923  ? ? 2.14 
1777 1 O   B HOH 939  ? ? O   B HOH 1047 ? ? 2.14 
1778 1 O   T PRO 240  ? ? O   T HOH 628  ? ? 2.14 
1779 1 O   O HOH 1089 ? ? O   O HOH 1127 ? ? 2.14 
1780 1 O   B HOH 871  ? ? O   B HOH 1055 ? ? 2.14 
1781 1 O   L HOH 861  ? ? O   L HOH 1006 ? ? 2.14 
1782 1 O   H HOH 739  ? ? O   H HOH 859  ? ? 2.14 
1783 1 O   J HOH 872  ? ? O   J HOH 1092 ? ? 2.14 
1784 1 O   J HOH 735  ? ? O   J HOH 1016 ? ? 2.14 
1785 1 NH1 N ARG 23   ? ? O   N HOH 628  ? ? 2.14 
1786 1 O   L HOH 993  ? ? O   L HOH 1080 ? ? 2.14 
1787 1 O   M HOH 706  ? ? O   M HOH 967  ? ? 2.14 
1788 1 OE1 K GLN 148  ? ? O   K HOH 626  ? ? 2.14 
1789 1 O   K HOH 648  ? ? O   K HOH 714  ? ? 2.14 
1790 1 O   M HOH 730  ? ? O   M HOH 996  ? ? 2.14 
1791 1 O   D HOH 998  ? ? O   D HOH 1117 ? ? 2.14 
1792 1 O   C HOH 705  ? ? O   C HOH 937  ? ? 2.14 
1793 1 O   E HOH 672  ? ? O   E HOH 956  ? ? 2.14 
1794 1 OD2 H ASP 142  ? ? O   H HOH 628  ? ? 2.14 
1795 1 O   H HOH 752  ? ? O   H HOH 1015 ? ? 2.14 
1796 1 O   L HOH 850  ? ? O   L HOH 870  ? ? 2.14 
1797 1 O   A HOH 710  ? ? O   A HOH 1035 ? ? 2.14 
1798 1 OD1 C ASP 417  ? ? O   C HOH 631  ? ? 2.14 
1799 1 O   T HOH 805  ? ? O   T HOH 1093 ? ? 2.14 
1800 1 O   B HOH 849  ? ? O   K HOH 901  ? ? 2.14 
1801 1 O   G HOH 1006 ? ? O   G HOH 1066 ? ? 2.15 
1802 1 O   Q HOH 631  ? ? O   Q HOH 978  ? ? 2.15 
1803 1 O   C HOH 880  ? ? O   C HOH 1043 ? ? 2.15 
1804 1 O   L HOH 1035 ? ? O   R HOH 982  ? ? 2.15 
1805 1 O   D PHE 401  ? ? O   D HOH 604  ? ? 2.15 
1806 1 O   Q HIS 264  ? ? O   Q HOH 623  ? ? 2.15 
1807 1 O   K HOH 606  ? ? O   K HOH 913  ? ? 2.15 
1808 1 O   I HOH 1116 ? ? O   I HOH 1134 ? ? 2.15 
1809 1 O   Q HOH 888  ? ? O   Q HOH 1067 ? ? 2.15 
1810 1 O   D VAL 211  ? ? O   D HOH 620  ? ? 2.15 
1811 1 O   F HOH 694  ? ? O   F HOH 858  ? ? 2.15 
1812 1 O   D HOH 656  ? ? O   D HOH 1038 ? ? 2.15 
1813 1 O   R HOH 678  ? ? O   R HOH 699  ? ? 2.15 
1814 1 OE1 O GLN 79   ? ? O   O HOH 619  ? ? 2.15 
1815 1 O   O HOH 811  ? ? O   O HOH 1164 ? ? 2.15 
1816 1 O   B HOH 728  ? ? O   B HOH 1052 ? ? 2.15 
1817 1 OE2 L GLU 163  ? ? O   L HOH 622  ? ? 2.15 
1818 1 O   Q HOH 602  ? ? O   Q HOH 783  ? ? 2.15 
1819 1 O   P HOH 844  ? ? O   P HOH 900  ? ? 2.15 
1820 1 O   E HOH 880  ? ? O   E HOH 1130 ? ? 2.15 
1821 1 O   U HOH 980  ? ? O   U HOH 1037 ? ? 2.15 
1822 1 O   M HOH 868  ? ? O   M HOH 932  ? ? 2.15 
1823 1 O   I HOH 671  ? ? O   I HOH 982  ? ? 2.15 
1824 1 O   P LYS 70   ? ? O   P HOH 619  ? ? 2.15 
1825 1 O   L HOH 895  ? ? O   L HOH 1057 ? ? 2.15 
1826 1 O   U HOH 845  ? ? O   U HOH 1070 ? ? 2.15 
1827 1 O   H HOH 693  ? ? O   H HOH 1026 ? ? 2.15 
1828 1 O   A HOH 836  ? ? O   A HOH 851  ? ? 2.15 
1829 1 O   B HOH 798  ? ? O   B HOH 862  ? ? 2.15 
1830 1 O   H HOH 634  ? ? O   H HOH 1011 ? ? 2.15 
1831 1 OD2 F ASP 237  ? ? O   F HOH 623  ? ? 2.15 
1832 1 O   N HOH 626  ? ? O   N HOH 865  ? ? 2.15 
1833 1 O   C HOH 807  ? ? O   C HOH 1011 ? ? 2.15 
1834 1 O   U HOH 973  ? ? O   U HOH 1074 ? ? 2.15 
1835 1 O   L TYR 241  ? ? O   L HOH 623  ? ? 2.15 
1836 1 NH1 K ARG 403  ? ? O   K HOH 627  ? ? 2.15 
1837 1 O   Q HOH 761  ? ? O   F HOH 813  ? ? 2.15 
1838 1 O   C HOH 761  ? ? O   C HOH 782  ? ? 2.15 
1839 1 O   R HOH 632  ? ? O   R HOH 1098 ? ? 2.15 
1840 1 O   N HOH 724  ? ? O   N HOH 767  ? ? 2.15 
1841 1 OE2 T GLU 200  ? ? O   T HOH 629  ? ? 2.15 
1842 1 O   C HOH 879  ? ? O   C HOH 910  ? ? 2.15 
1843 1 O   E HOH 1041 ? ? O   E HOH 1045 ? ? 2.15 
1844 1 OD2 D ASP 227  ? ? O   D HOH 621  ? ? 2.15 
1845 1 O   Q HOH 859  ? ? O   T HOH 787  ? ? 2.15 
1846 1 O   Q HOH 820  ? ? O   Q HOH 1041 ? ? 2.15 
1847 1 O   E HOH 837  ? ? O   E HOH 1008 ? ? 2.15 
1848 1 O   K HOH 919  ? ? O   K HOH 927  ? ? 2.15 
1849 1 ND2 U ASN 178  ? ? O   U HOH 634  ? ? 2.15 
1850 1 O   T HOH 1088 ? ? O   T HOH 1108 ? ? 2.15 
1851 1 O   A HOH 833  ? ? O   A HOH 864  ? ? 2.15 
1852 1 NH2 B ARG 89   ? ? O   B HOH 632  ? ? 2.15 
1853 1 OE1 R GLN 413  ? ? O   R HOH 617  ? ? 2.15 
1854 1 O   B HOH 843  ? ? O   B HOH 926  ? ? 2.15 
1855 1 O   H HOH 648  ? ? O   H HOH 1079 ? ? 2.15 
1856 1 NZ  J LYS 70   ? ? O   J HOH 618  ? ? 2.15 
1857 1 OD2 M ASP 113  ? ? O   M HOH 629  ? ? 2.15 
1858 1 O   J HOH 913  ? ? O   J HOH 1071 ? ? 2.15 
1859 1 O   B HOH 836  ? ? O   D HOH 842  ? ? 2.15 
1860 1 O   P HOH 1035 ? ? O   P HOH 1040 ? ? 2.15 
1861 1 O   J SER 206  ? ? O   J HOH 619  ? ? 2.15 
1862 1 O   E HOH 1172 ? ? O   E HOH 1180 ? ? 2.15 
1863 1 O   D HOH 687  ? ? O   D HOH 762  ? ? 2.15 
1864 1 O   Q HOH 1052 ? ? O   Q HOH 1133 ? ? 2.15 
1865 1 N   D ASP 318  ? ? O   D HOH 603  ? ? 2.15 
1866 1 O   P HOH 985  ? ? O   P HOH 1092 ? ? 2.15 
1867 1 O   D HOH 668  ? ? O   D HOH 749  ? ? 2.15 
1868 1 OE1 A GLN 106  ? ? O   A HOH 631  ? ? 2.15 
1869 1 O   Q HOH 949  ? ? O   Q HOH 1126 ? ? 2.15 
1870 1 O   T HOH 995  ? ? O   T HOH 1113 ? ? 2.15 
1871 1 O   Q HOH 616  ? ? O   Q HOH 683  ? ? 2.15 
1872 1 O   U HOH 644  ? ? O   U HOH 959  ? ? 2.15 
1873 1 O   B HOH 1044 ? ? O   B HOH 1088 ? ? 2.15 
1874 1 O   H HOH 703  ? ? O   H HOH 788  ? ? 2.15 
1875 1 O   R ASP 420  ? ? O   R HOH 618  ? ? 2.15 
1876 1 O   B HOH 790  ? ? O   B HOH 1081 ? ? 2.15 
1877 1 O   N HOH 854  ? ? O   N HOH 993  ? ? 2.15 
1878 1 O   Q HOH 959  ? ? O   Q HOH 1064 ? ? 2.15 
1879 1 O   F HOH 770  ? ? O   U HOH 963  ? ? 2.15 
1880 1 O   G HOH 674  ? ? O   G HOH 869  ? ? 2.15 
1881 1 O   K HOH 632  ? ? O   K HOH 986  ? ? 2.15 
1882 1 O   F HOH 958  ? ? O   F HOH 992  ? ? 2.15 
1883 1 O   I HOH 758  ? ? O   J HOH 1005 ? ? 2.15 
1884 1 O   Q HOH 797  ? ? O   Q HOH 1098 ? ? 2.15 
1885 1 O   N HOH 949  ? ? O   N HOH 1047 ? ? 2.15 
1886 1 O   M HOH 668  ? ? O   M HOH 947  ? ? 2.15 
1887 1 O   U HOH 991  ? ? O   U HOH 1049 ? ? 2.15 
1888 1 O   Q HOH 938  ? ? O   Q HOH 1079 ? ? 2.15 
1889 1 O   D HOH 822  ? ? O   K HOH 889  ? ? 2.15 
1890 1 O   B HOH 890  ? ? O   B HOH 936  ? ? 2.15 
1891 1 O   N HOH 766  ? ? O   N HOH 943  ? ? 2.15 
1892 1 O   K HOH 756  ? ? O   M HOH 615  ? ? 2.15 
1893 1 OD1 N ASN 199  ? ? O   N HOH 622  ? ? 2.15 
1894 1 O   A HOH 1104 ? ? O   E HOH 1111 ? ? 2.15 
1895 1 N   K GLY 173  ? ? O   K HOH 622  ? ? 2.15 
1896 1 O   A HOH 853  ? ? O   A HOH 959  ? ? 2.15 
1897 1 O   C HOH 1111 ? ? O   C HOH 1128 ? ? 2.15 
1898 1 O   D HOH 970  ? ? O   D HOH 971  ? ? 2.15 
1899 1 OD1 J ASP 275  ? ? O   J HOH 620  ? ? 2.15 
1900 1 O   P HOH 755  ? ? O   P HOH 1083 ? ? 2.15 
1901 1 O   R HOH 1135 ? ? O   R HOH 1139 ? ? 2.15 
1902 1 O   M HOH 941  ? ? O   M HOH 1114 ? ? 2.15 
1903 1 O   M HOH 1102 ? ? O   M HOH 1123 ? ? 2.15 
1904 1 O   G HOH 633  ? ? O   G HOH 936  ? ? 2.15 
1905 1 O   B HOH 755  ? ? O   B HOH 765  ? ? 2.15 
1906 1 O   O HOH 1048 ? ? O   O HOH 1129 ? ? 2.15 
1907 1 O   F HOH 940  ? ? O   F HOH 1086 ? ? 2.15 
1908 1 O   B HOH 637  ? ? O   D HOH 833  ? ? 2.15 
1909 1 O   U HOH 1049 ? ? O   U HOH 1071 ? ? 2.15 
1910 1 O   Q HOH 707  ? ? O   Q HOH 977  ? ? 2.15 
1911 1 O   Q HOH 631  ? ? O   Q HOH 818  ? ? 2.16 
1912 1 O   G HOH 780  ? ? O   G HOH 878  ? ? 2.16 
1913 1 O   A HOH 766  ? ? O   E HOH 888  ? ? 2.16 
1914 1 O   R HOH 1121 ? ? O   R HOH 1135 ? ? 2.16 
1915 1 O   E HOH 1068 ? ? O   E HOH 1104 ? ? 2.16 
1916 1 O   T HOH 755  ? ? O   T HOH 827  ? ? 2.16 
1917 1 O   G HOH 888  ? ? O   G HOH 929  ? ? 2.16 
1918 1 O   J HOH 1035 ? ? O   J HOH 1038 ? ? 2.16 
1919 1 O   T HOH 770  ? ? O   T HOH 984  ? ? 2.16 
1920 1 OG  N SER 73   ? ? O   N HOH 629  ? ? 2.16 
1921 1 O   O HOH 1158 ? ? O   O HOH 1183 ? ? 2.16 
1922 1 O   O HOH 717  ? ? O   O HOH 938  ? ? 2.16 
1923 1 OH  B TYR 145  ? ? O   B HOH 633  ? ? 2.16 
1924 1 O   D HOH 870  ? ? O   D HOH 871  ? ? 2.16 
1925 1 O   D HOH 796  ? ? O   D HOH 999  ? ? 2.16 
1926 1 O   J HOH 670  ? ? O   J HOH 828  ? ? 2.16 
1927 1 O   C HOH 697  ? ? O   C HOH 976  ? ? 2.16 
1928 1 O   U HOH 638  ? ? O   U HOH 1030 ? ? 2.16 
1929 1 O   N HOH 907  ? ? O   N HOH 1001 ? ? 2.16 
1930 1 O   M HOH 986  ? ? O   M HOH 1133 ? ? 2.16 
1931 1 O   B HOH 939  ? ? O   B HOH 1086 ? ? 2.16 
1932 1 O   G HOH 841  ? ? O   G HOH 985  ? ? 2.16 
1933 1 O   K HOH 654  ? ? O   K HOH 991  ? ? 2.16 
1934 1 O   I HOH 1090 ? ? O   I HOH 1123 ? ? 2.16 
1935 1 OG1 I THR 346  ? A O   I HOH 616  ? ? 2.16 
1936 1 NE2 H GLN 148  ? ? O   H HOH 629  ? ? 2.16 
1937 1 O   F HOH 612  ? ? O   F HOH 984  ? ? 2.16 
1938 1 NH2 M ARG 223  ? ? O   M HOH 630  ? ? 2.16 
1939 1 OE2 P GLU 29   ? ? O   P HOH 620  ? ? 2.16 
1940 1 O   E HOH 730  ? ? O   E HOH 851  ? ? 2.16 
1941 1 O   R HOH 1001 ? ? O   R HOH 1013 ? ? 2.16 
1942 1 NZ  D LYS 140  ? ? O   D HOH 622  ? ? 2.16 
1943 1 O   O GLU 200  ? ? O   O HOH 620  ? ? 2.16 
1944 1 O   I HOH 943  ? ? O   I HOH 1092 ? ? 2.16 
1945 1 OG1 L THR 307  ? ? O   L HOH 624  ? ? 2.16 
1946 1 NH2 E ARG 80   ? ? O   E HOH 628  ? ? 2.16 
1947 1 O   I HOH 773  ? ? O   I HOH 921  ? ? 2.16 
1948 1 N   G MET 415  ? ? O   G HOH 604  ? ? 2.16 
1949 1 O   K HOH 634  ? ? O   K HOH 900  ? ? 2.16 
1950 1 O   T HOH 1019 ? ? O   T HOH 1144 ? ? 2.16 
1951 1 OE2 H GLU 265  ? ? O   H HOH 630  ? ? 2.16 
1952 1 NH1 E ARG 400  ? ? O   E HOH 629  ? ? 2.16 
1953 1 O   E HOH 925  ? ? O   E HOH 996  ? ? 2.16 
1954 1 O   I HOH 1145 ? ? O   I HOH 1162 ? ? 2.16 
1955 1 NH1 C ARG 222  ? ? O   C HOH 632  ? ? 2.16 
1956 1 O   T HOH 1174 ? ? O   T HOH 1189 ? ? 2.16 
1957 1 NH1 L ARG 341  ? ? O   L HOH 613  ? ? 2.16 
1958 1 NH2 F ARG 23   ? ? O   F HOH 624  ? ? 2.16 
1959 1 O   L HOH 1003 ? ? O   L HOH 1029 ? ? 2.16 
1960 1 O   N HOH 726  ? ? O   N HOH 893  ? ? 2.16 
1961 1 O   C HOH 953  ? ? O   G HOH 917  ? ? 2.16 
1962 1 OE2 G GLU 305  ? ? O   G HOH 625  ? ? 2.16 
1963 1 N   G GLY 201  ? ? O   G HOH 626  ? ? 2.16 
1964 1 OE1 D GLU 265  ? ? O   D HOH 623  ? ? 2.16 
1965 1 O   I ASP 181  ? ? O   I HOH 617  ? ? 2.16 
1966 1 O   R HOH 779  ? ? O   R HOH 899  ? ? 2.16 
1967 1 O   G HOH 681  ? ? O   G HOH 806  ? ? 2.16 
1968 1 O   J HOH 683  ? ? O   J HOH 1196 ? ? 2.16 
1969 1 O   L PRO 228  ? ? O   L HOH 625  ? ? 2.16 
1970 1 O   K HOH 832  ? ? O   M HOH 764  ? ? 2.16 
1971 1 O3  E SO4 503  ? ? O   E HOH 630  ? ? 2.16 
1972 1 NH2 N ARG 23   ? ? O   N HOH 630  ? ? 2.16 
1973 1 OE2 C GLU 91   ? ? O   C HOH 633  ? ? 2.16 
1974 1 O   O HOH 1191 ? ? O   O HOH 1202 ? ? 2.16 
1975 1 OD1 O ASN 57   ? ? O   O HOH 621  ? ? 2.16 
1976 1 O   F HOH 1085 ? ? O   T HOH 1018 ? ? 2.16 
1977 1 O   Q HOH 1143 ? ? O   Q HOH 1145 ? ? 2.16 
1978 1 O   L HOH 911  ? ? O   L HOH 969  ? ? 2.16 
1979 1 OE1 D GLU 91   ? ? O   D HOH 624  ? ? 2.16 
1980 1 OH  O TYR 125  ? ? O   O HOH 622  ? ? 2.16 
1981 1 O   M HOH 612  ? ? O   M HOH 1003 ? ? 2.16 
1982 1 O   L HOH 949  ? ? O   L HOH 1068 ? ? 2.16 
1983 1 O   R HOH 1005 ? ? O   R HOH 1075 ? ? 2.16 
1984 1 O   D HOH 997  ? ? O   M HOH 1118 ? ? 2.16 
1985 1 O   N HOH 725  ? ? O   N HOH 839  ? ? 2.16 
1986 1 OD1 G ASP 393  ? ? O   G HOH 609  ? ? 2.16 
1987 1 O   C HIS 245  ? ? O   C HOH 634  ? ? 2.16 
1988 1 O   T HOH 756  ? ? O   T HOH 891  ? ? 2.16 
1989 1 N   R ALA 398  ? ? O   R HOH 614  ? ? 2.16 
1990 1 O   J HOH 623  ? ? O   J HOH 1113 ? ? 2.16 
1991 1 O   R HOH 1054 ? ? O   R HOH 1170 ? ? 2.16 
1992 1 O   D HOH 1003 ? ? O   D HOH 1160 ? ? 2.16 
1993 1 O   A HOH 757  ? ? O   A HOH 998  ? ? 2.16 
1994 1 O   R HOH 644  ? ? O   R HOH 1014 ? ? 2.16 
1995 1 OE2 J GLU 392  ? ? O   J HOH 621  ? ? 2.16 
1996 1 O   N HOH 842  ? ? O   N HOH 1053 ? ? 2.16 
1997 1 O   Q HOH 932  ? ? O   T HOH 1064 ? ? 2.16 
1998 1 O   E HOH 1013 ? ? O   P HOH 1094 ? ? 2.16 
1999 1 O   P HOH 767  ? ? O   P HOH 895  ? ? 2.16 
2000 1 OG1 H THR 346  ? ? O   H HOH 631  ? ? 2.16 
2001 1 O   L HOH 816  ? ? O   L HOH 967  ? ? 2.16 
2002 1 NE1 F TRP 268  ? ? O   F HOH 625  ? ? 2.16 
2003 1 O   D HOH 683  ? ? O   D HOH 1076 ? ? 2.16 
2004 1 O   C HOH 1065 ? ? O   I HOH 1017 ? ? 2.16 
2005 1 O   Q HOH 1135 ? ? O   Q HOH 1144 ? ? 2.16 
2006 1 O   C HOH 1006 ? ? O   G HOH 1059 ? ? 2.16 
2007 1 O   Q HOH 828  ? ? O   Q HOH 1050 ? ? 2.16 
2008 1 O   N HOH 962  ? ? O   N HOH 1007 ? ? 2.16 
2009 1 O2  L SO4 502  ? ? O   L HOH 626  ? ? 2.16 
2010 1 OE2 P GLU 128  ? ? O   P HOH 621  ? ? 2.16 
2011 1 O   M HOH 1061 ? ? O   M HOH 1083 ? ? 2.16 
2012 1 O   F HOH 802  ? ? O   F HOH 901  ? ? 2.17 
2013 1 OD2 T ASP 420  ? ? O   T HOH 630  ? ? 2.17 
2014 1 O   G HOH 728  ? ? O   G HOH 967  ? ? 2.17 
2015 1 O   A HOH 958  ? ? O   P HOH 868  ? ? 2.17 
2016 1 O   T HOH 1131 ? ? O   U HOH 1080 ? ? 2.17 
2017 1 OG1 N THR 158  ? ? O   N HOH 631  ? ? 2.17 
2018 1 OE1 O GLU 244  ? ? O   O HOH 623  ? ? 2.17 
2019 1 O   M HOH 844  ? ? O   M HOH 882  ? ? 2.17 
2020 1 O   Q HOH 739  ? ? O   Q HOH 942  ? ? 2.17 
2021 1 NH2 C ARG 101  ? ? OE1 H GLN 79   ? ? 2.17 
2022 1 OG1 P THR 346  ? A O   P HOH 622  ? ? 2.17 
2023 1 O   E HOH 623  ? ? O   E HOH 681  ? ? 2.17 
2024 1 O   D HOH 889  ? ? O   D HOH 1131 ? ? 2.17 
2025 1 O   A HOH 1074 ? ? O   A HOH 1102 ? ? 2.17 
2026 1 N   F GLU 392  ? ? O   F HOH 607  ? ? 2.17 
2027 1 O   U HOH 895  ? ? O   U HOH 983  ? ? 2.17 
2028 1 O   I HOH 714  ? ? O   I HOH 827  ? ? 2.17 
2029 1 O   L HOH 892  ? ? O   R HOH 1136 ? ? 2.17 
2030 1 O   B HOH 727  ? ? O   B HOH 863  ? ? 2.17 
2031 1 O   C TYR 210  ? ? O   C HOH 635  ? ? 2.17 
2032 1 OE1 B GLN 79   ? ? O   B HOH 634  ? ? 2.17 
2033 1 O   T HOH 861  ? ? O   T HOH 1116 ? ? 2.17 
2034 1 O   R HOH 1141 ? ? O   R HOH 1182 ? ? 2.17 
2035 1 O   G LYS 70   ? ? O   G HOH 627  ? ? 2.17 
2036 1 NH2 G ARG 166  ? ? O   G HOH 628  ? ? 2.17 
2037 1 O   T HOH 909  ? ? O   T HOH 1010 ? ? 2.17 
2038 1 ND1 C HIS 72   ? ? O   C HOH 636  ? ? 2.17 
2039 1 O   C HOH 771  ? ? O   C HOH 1037 ? ? 2.17 
2040 1 O   D HOH 645  ? ? O   K HOH 985  ? ? 2.17 
2041 1 NZ  C LYS 236  ? ? O   C HOH 637  ? ? 2.17 
2042 1 O   E HOH 1000 ? ? O   E HOH 1121 ? ? 2.17 
2043 1 O   E HOH 1003 ? ? O   E HOH 1148 ? ? 2.17 
2044 1 O   E HOH 802  ? ? O   E HOH 1067 ? ? 2.17 
2045 1 O   B HOH 972  ? ? O   D HOH 710  ? ? 2.17 
2046 1 O   D HOH 956  ? ? O   K HOH 1017 ? ? 2.17 
2047 1 O   N HOH 829  ? ? O   N HOH 951  ? ? 2.17 
2048 1 O   E HOH 1018 ? ? O   E HOH 1024 ? ? 2.17 
2049 1 O   F MET 218  ? ? O   F HOH 626  ? ? 2.17 
2050 1 OD2 Q ASP 397  ? ? O   Q HOH 624  ? ? 2.17 
2051 1 O   C HOH 703  ? ? O   C HOH 1015 ? ? 2.17 
2052 1 O   D HOH 640  ? ? O   D HOH 982  ? ? 2.17 
2053 1 O   I HOH 641  ? ? O   I HOH 1067 ? ? 2.17 
2054 1 O   E HOH 621  ? ? O   E HOH 1021 ? ? 2.17 
2055 1 O   F HOH 815  ? ? O   F HOH 825  ? ? 2.17 
2056 1 O   T HOH 624  ? ? O   T HOH 835  ? ? 2.17 
2057 1 O   D HOH 964  ? ? O   D HOH 1150 ? ? 2.17 
2058 1 O   A HOH 666  ? ? O   A HOH 895  ? ? 2.17 
2059 1 O   D HOH 632  ? ? O   D HOH 949  ? ? 2.17 
2060 1 O   F HOH 999  ? ? O   F HOH 1103 ? ? 2.17 
2061 1 O2  E SO4 503  ? ? O   E HOH 631  ? ? 2.17 
2062 1 O   K HOH 762  ? ? O   K HOH 1092 ? ? 2.17 
2063 1 O   A ASP 417  ? ? O   A HOH 632  ? ? 2.17 
2064 1 O   B HOH 848  ? ? O   B HOH 1014 ? ? 2.17 
2065 1 O   O HOH 625  ? ? O   O HOH 919  ? ? 2.17 
2066 1 O   T HOH 1029 ? ? O   U HOH 954  ? ? 2.17 
2067 1 O   A MET 167  ? ? O   A HOH 633  ? ? 2.17 
2068 1 O   L HOH 1031 ? ? O   L HOH 1079 ? ? 2.17 
2069 1 O   J HOH 794  ? ? O   J HOH 1194 ? ? 2.17 
2070 1 O   R HOH 1112 ? ? O   R HOH 1135 ? ? 2.17 
2071 1 O   L HOH 1006 ? ? O   L HOH 1088 ? ? 2.17 
2072 1 N   Q ALA 398  ? ? O   Q HOH 625  ? ? 2.17 
2073 1 O   T HOH 660  ? ? O   T HOH 894  ? ? 2.17 
2074 1 O   A HOH 649  ? ? O   A HOH 807  ? ? 2.17 
2075 1 OE2 T GLU 91   ? ? O   T HOH 631  ? ? 2.17 
2076 1 O   B HOH 974  ? ? O   D HOH 986  ? ? 2.17 
2077 1 O   O HOH 736  ? ? O   O HOH 878  ? ? 2.17 
2078 1 O   P HOH 730  ? ? O   P HOH 840  ? ? 2.17 
2079 1 O   J HOH 1072 ? ? O   J HOH 1136 ? ? 2.17 
2080 1 O   L HOH 860  ? ? O   L HOH 1024 ? ? 2.17 
2081 1 O   C HOH 687  ? ? O   C HOH 858  ? ? 2.17 
2082 1 OD1 M ASP 286  ? ? O   M HOH 631  ? ? 2.17 
2083 1 O   B HOH 858  ? ? O   M HOH 876  ? ? 2.17 
2084 1 O   F HOH 915  ? ? O   F HOH 1047 ? ? 2.17 
2085 1 NZ  K LYS 44   ? ? O   K HOH 628  ? ? 2.17 
2086 1 O   R HOH 746  ? ? O   R HOH 913  ? ? 2.17 
2087 1 O   T HOH 777  ? ? O   T HOH 1150 ? ? 2.17 
2088 1 O   H HOH 628  ? ? O   I HOH 972  ? ? 2.17 
2089 1 O   O HOH 953  ? ? O   O HOH 1038 ? ? 2.17 
2090 1 O   P HOH 821  ? ? O   P HOH 911  ? ? 2.17 
2091 1 O   I HOH 914  ? ? O   I HOH 1060 ? ? 2.17 
2092 1 O   A HOH 964  ? ? O   A HOH 1014 ? ? 2.17 
2093 1 O   Q HOH 957  ? ? O   Q HOH 1110 ? ? 2.17 
2094 1 O   T HOH 976  ? ? O   T HOH 1133 ? ? 2.17 
2095 1 O   F GLY 195  ? ? O   F HOH 627  ? ? 2.17 
2096 1 O   F HOH 986  ? ? O   F HOH 987  ? ? 2.17 
2097 1 O   T ALA 134  ? ? O   T HOH 632  ? ? 2.17 
2098 1 O   J HOH 637  ? ? O   J HOH 1116 ? ? 2.17 
2099 1 NH2 Q ARG 223  ? ? O   Q HOH 626  ? ? 2.17 
2100 1 O   B HOH 872  ? ? O   B HOH 1063 ? ? 2.17 
2101 1 ND1 O HIS 176  ? ? O   O HOH 624  ? ? 2.17 
2102 1 O   D HOH 869  ? ? O   D HOH 1119 ? ? 2.17 
2103 1 OG  L SER 406  ? ? O   L HOH 627  ? ? 2.17 
2104 1 O   F HOH 771  ? ? O   F HOH 887  ? ? 2.17 
2105 1 O   P HOH 707  ? ? O   P HOH 1034 ? ? 2.18 
2106 1 O   H SER 374  ? ? O   H HOH 632  ? ? 2.18 
2107 1 O   A ARG 320  ? ? O   A HOH 634  ? ? 2.18 
2108 1 O   K HOH 996  ? ? O   K HOH 1039 ? ? 2.18 
2109 1 O   L HOH 780  ? ? O   L HOH 1020 ? ? 2.18 
2110 1 O   G HOH 699  ? ? O   G HOH 934  ? ? 2.18 
2111 1 O   T HOH 838  ? ? O   T HOH 928  ? ? 2.18 
2112 1 O   K HOH 1118 ? ? O   K HOH 1123 ? ? 2.18 
2113 1 O   T HOH 993  ? ? O   T HOH 1160 ? ? 2.18 
2114 1 O   R PRO 309  ? ? O   R HOH 619  ? ? 2.18 
2115 1 O   U HOH 805  ? ? O   U HOH 904  ? ? 2.18 
2116 1 OD2 E ASP 255  ? ? O   E HOH 632  ? ? 2.18 
2117 1 O   O HOH 628  ? ? O   O HOH 1000 ? ? 2.18 
2118 1 O   K HOH 644  ? ? O   K HOH 805  ? ? 2.18 
2119 1 O   R HOH 938  ? ? O   R HOH 1099 ? ? 2.18 
2120 1 O   O HOH 961  ? ? O   O HOH 1136 ? ? 2.18 
2121 1 O   T HOH 822  ? ? O   T HOH 1009 ? ? 2.18 
2122 1 O   A HOH 991  ? ? O   A HOH 1059 ? ? 2.18 
2123 1 OG1 O THR 105  ? ? O   O HOH 625  ? ? 2.18 
2124 1 O   E HOH 847  ? ? O   E HOH 969  ? ? 2.18 
2125 1 O   P HOH 761  ? ? O   P HOH 1043 ? ? 2.18 
2126 1 O   C HOH 1063 ? ? O   G HOH 852  ? ? 2.18 
2127 1 NH1 G ARG 222  ? ? O   G HOH 629  ? ? 2.18 
2128 1 O   J HOH 1086 ? ? O   J HOH 1121 ? ? 2.18 
2129 1 O   M VAL 243  ? ? O   M HOH 632  ? ? 2.18 
2130 1 O   K HOH 851  ? ? O   K HOH 931  ? ? 2.18 
2131 1 O   I SER 231  ? ? O   I HOH 618  ? ? 2.18 
2132 1 ND2 E ASN 118  ? ? O   E HOH 614  ? ? 2.18 
2133 1 O   E HOH 1083 ? ? O   E HOH 1127 ? ? 2.18 
2134 1 OD1 K ASP 224  ? ? O   K HOH 629  ? ? 2.18 
2135 1 O   I HOH 727  ? ? O   I HOH 1019 ? ? 2.18 
2136 1 O   K HOH 764  ? ? O   K HOH 908  ? ? 2.18 
2137 1 O   M HOH 616  ? ? O   M HOH 1046 ? ? 2.18 
2138 1 O   F HOH 1040 ? ? O   T HOH 821  ? ? 2.18 
2139 1 O   F HOH 644  ? ? O   F HOH 688  ? ? 2.18 
2140 1 O   F HOH 868  ? ? O   F HOH 1069 ? ? 2.18 
2141 1 OD1 I ASP 156  ? ? O   I HOH 619  ? ? 2.18 
2142 1 O   P HOH 824  ? ? O   P HOH 901  ? ? 2.18 
2143 1 O   C HOH 739  ? ? O   C HOH 932  ? ? 2.18 
2144 1 O   G HOH 739  ? ? O   G HOH 1028 ? ? 2.18 
2145 1 O   L HOH 847  ? ? O   L HOH 958  ? ? 2.18 
2146 1 O   C HOH 724  ? ? O   G HOH 835  ? ? 2.18 
2147 1 O   R HOH 739  ? ? O   R HOH 1054 ? ? 2.18 
2148 1 O   K HOH 737  ? ? O   M HOH 801  ? ? 2.18 
2149 1 O   H HOH 908  ? ? O   H HOH 1121 ? ? 2.18 
2150 1 O   O HOH 995  ? ? O   O HOH 1037 ? ? 2.18 
2151 1 OD1 K ASP 318  ? ? O   K HOH 630  ? ? 2.18 
2152 1 O   Q HOH 1091 ? ? O   T HOH 1096 ? ? 2.18 
2153 1 O   Q HOH 957  ? ? O   T HOH 1091 ? ? 2.18 
2154 1 O   J HOH 1140 ? ? O   J HOH 1189 ? ? 2.18 
2155 1 O   D HOH 708  ? ? O   D HOH 1097 ? ? 2.18 
2156 1 O   U HOH 964  ? ? O   U HOH 1108 ? ? 2.18 
2157 1 O   A HOH 1064 ? ? O   E HOH 1153 ? ? 2.18 
2158 1 O   A HOH 927  ? ? O   A HOH 934  ? ? 2.18 
2159 1 O   O LYS 70   ? ? O   O HOH 626  ? ? 2.18 
2160 1 O   I HOH 742  ? ? O   I HOH 752  ? ? 2.18 
2161 1 O   M GLY 198  ? ? O   M HOH 633  ? ? 2.18 
2162 1 O   C HOH 1024 ? ? O   C HOH 1135 ? ? 2.18 
2163 1 O   H HOH 1086 ? ? O   G HOH 1065 ? ? 2.18 
2164 1 OD2 M ASP 417  ? ? O   M HOH 634  ? ? 2.18 
2165 1 OD2 L ASP 318  ? ? O   L HOH 628  ? ? 2.18 
2166 1 O   L ILE 378  ? ? O   L HOH 629  ? ? 2.18 
2167 1 O   I HOH 894  ? ? O   I HOH 1054 ? ? 2.18 
2168 1 O   P ASP 192  ? ? O   P HOH 623  ? ? 2.18 
2169 1 O   C HOH 906  ? ? O   C HOH 1166 ? ? 2.18 
2170 1 O   N HOH 665  ? ? O   N HOH 720  ? ? 2.18 
2171 1 O   D HOH 961  ? ? O   D HOH 973  ? ? 2.18 
2172 1 O   A HOH 712  ? ? O   A HOH 916  ? ? 2.18 
2173 1 NH1 B ARG 33   ? ? O   B HOH 635  ? ? 2.18 
2174 1 O   L HOH 665  ? ? O   L HOH 679  ? ? 2.18 
2175 1 O   G HOH 857  ? ? O   G HOH 900  ? ? 2.18 
2176 1 NE2 N GLN 413  ? ? O   N HOH 632  ? ? 2.18 
2177 1 O   N HOH 1095 ? ? O   N HOH 1102 ? ? 2.18 
2178 1 NE2 K GLN 68   ? ? O   K HOH 631  ? ? 2.18 
2179 1 OE1 H GLN 8    ? ? O   H HOH 633  ? ? 2.18 
2180 1 O   F HOH 748  ? ? O   F HOH 1006 ? ? 2.18 
2181 1 OD2 K ASP 192  ? ? O   K HOH 632  ? ? 2.18 
2182 1 O   D HOH 722  ? ? O   D HOH 1042 ? ? 2.18 
2183 1 O   T HOH 796  ? ? O   T HOH 1074 ? ? 2.18 
2184 1 O   C HOH 874  ? ? O   C HOH 964  ? ? 2.18 
2185 1 O   T HOH 619  ? ? O   T HOH 1069 ? ? 2.18 
2186 1 O   R HOH 703  ? ? O   R HOH 789  ? ? 2.18 
2187 1 O   N HOH 885  ? ? O   N HOH 1064 ? ? 2.18 
2188 1 OD2 E ASP 255  ? ? O   E HOH 633  ? ? 2.18 
2189 1 O   D HOH 959  ? ? O   M HOH 962  ? ? 2.18 
2190 1 OE1 D GLN 148  ? ? O   D HOH 625  ? ? 2.18 
2191 1 O   R ALA 226  ? ? O   R HOH 620  ? ? 2.18 
2192 1 O   I HOH 1010 ? ? O   I HOH 1016 ? ? 2.18 
2193 1 O   P HOH 851  ? ? O   P HOH 994  ? ? 2.18 
2194 1 O   J VAL 382  ? ? O   J HOH 622  ? ? 2.18 
2195 1 O   P ASP 181  ? ? O   P HOH 613  ? ? 2.18 
2196 1 O   T HOH 786  ? ? O   T HOH 1126 ? ? 2.18 
2197 1 O   E HOH 703  ? ? O   E HOH 982  ? ? 2.18 
2198 1 OG  P SER 206  ? ? O   P HOH 624  ? ? 2.18 
2199 1 OE1 T GLU 263  ? ? O   T HOH 633  ? ? 2.18 
2200 1 OE1 E GLN 148  ? ? O   E HOH 634  ? ? 2.18 
2201 1 O   H HOH 931  ? ? O   H HOH 975  ? ? 2.18 
2202 1 O   M HOH 735  ? ? O   M HOH 803  ? ? 2.18 
2203 1 OD1 T ASP 420  ? ? O   T HOH 634  ? ? 2.18 
2204 1 O   F HOH 876  ? ? O   F HOH 1057 ? ? 2.18 
2205 1 O   P HOH 673  ? ? O   P HOH 687  ? ? 2.18 
2206 1 O   O ASP 286  ? ? O   O HOH 627  ? ? 2.18 
2207 1 O   I HOH 750  ? ? O   I HOH 849  ? ? 2.18 
2208 1 O   F HOH 926  ? ? O   F HOH 1043 ? ? 2.18 
2209 1 OE2 L GLU 91   ? ? O   L HOH 630  ? ? 2.18 
2210 1 O   R HOH 1013 ? ? O   R HOH 1049 ? ? 2.18 
2211 1 O   L HOH 785  ? ? O   L HOH 910  ? ? 2.18 
2212 1 O   P HOH 820  ? ? O   P HOH 917  ? ? 2.18 
2213 1 OG  K SER 206  ? ? O   K HOH 633  ? ? 2.18 
2214 1 O   K HOH 905  ? ? O   K HOH 961  ? ? 2.18 
2215 1 N   P ASP 152  ? ? O   P HOH 625  ? ? 2.18 
2216 1 O   R HOH 745  ? ? O   R HOH 883  ? ? 2.18 
2217 1 O   C HOH 680  ? ? O   C HOH 856  ? ? 2.18 
2218 1 OD2 J ASP 393  ? ? O   J HOH 623  ? ? 2.18 
2219 1 O   Q HOH 706  ? ? O   Q HOH 1106 ? ? 2.18 
2220 1 OD2 R ASP 181  ? ? O   R HOH 621  ? ? 2.19 
2221 1 NH2 F ARG 252  ? ? O   F HOH 628  ? ? 2.19 
2222 1 O   U HOH 744  ? ? O   U HOH 846  ? ? 2.19 
2223 1 O   P HOH 735  ? ? O   P HOH 863  ? ? 2.19 
2224 1 O   L HOH 638  ? ? O   L HOH 772  ? ? 2.19 
2225 1 O   E HOH 874  ? ? O   E HOH 879  ? ? 2.19 
2226 1 O   H TRP 107  ? ? O   H HOH 634  ? ? 2.19 
2227 1 NZ  F LYS 180  ? ? O   F HOH 629  ? ? 2.19 
2228 1 O   H HOH 781  ? ? O   H HOH 963  ? ? 2.19 
2229 1 O   C HOH 954  ? ? O   C HOH 1080 ? ? 2.19 
2230 1 NZ  E LYS 366  ? ? O   E HOH 635  ? ? 2.19 
2231 1 O   E VAL 7    ? ? O   E HOH 636  ? ? 2.19 
2232 1 O   I HOH 1024 ? ? O   I HOH 1141 ? ? 2.19 
2233 1 OD2 M ASP 316  ? ? O   M HOH 635  ? ? 2.19 
2234 1 O   B HOH 729  ? ? O   B HOH 1069 ? ? 2.19 
2235 1 O   I HOH 826  ? ? O   I HOH 849  ? ? 2.19 
2236 1 O   Q HOH 828  ? ? O   Q HOH 1074 ? ? 2.19 
2237 1 O   R ASP 227  ? ? O   R HOH 622  ? ? 2.19 
2238 1 O   O HOH 992  ? ? O   O HOH 1096 ? ? 2.19 
2239 1 OD2 K ASP 397  ? ? O   K HOH 627  ? ? 2.19 
2240 1 O   L HOH 826  ? ? O   L HOH 1055 ? ? 2.19 
2241 1 O   M HOH 747  ? ? O   M HOH 1060 ? ? 2.19 
2242 1 SD  A MET 15   ? ? O   A HOH 986  ? ? 2.19 
2243 1 O   F PHE 401  ? ? O   F HOH 608  ? ? 2.19 
2244 1 OG1 G THR 307  ? ? O   G HOH 630  ? ? 2.19 
2245 1 OD1 P ASP 13   ? ? O   P HOH 626  ? ? 2.19 
2246 1 O   B HOH 638  ? ? O   B HOH 973  ? ? 2.19 
2247 1 NH1 K ARG 341  ? ? O   K HOH 634  ? ? 2.19 
2248 1 O   R HOH 794  ? ? O   R HOH 1008 ? ? 2.19 
2249 1 O   L GLU 405  ? ? O   L HOH 631  ? ? 2.19 
2250 1 OE1 R GLN 148  ? ? O   R HOH 623  ? ? 2.19 
2251 1 O   H HOH 762  ? ? O   H HOH 1012 ? ? 2.19 
2252 1 O   C THR 105  ? ? O   C HOH 638  ? ? 2.19 
2253 1 O   H HOH 944  ? ? O   H HOH 1014 ? ? 2.19 
2254 1 O   D HOH 992  ? ? O   D HOH 1061 ? ? 2.19 
2255 1 O   O PHE 186  ? ? O   O HOH 628  ? ? 2.19 
2256 1 O   L HOH 616  ? ? O   L HOH 658  ? ? 2.19 
2257 1 O   O HOH 822  ? ? O   O HOH 991  ? ? 2.19 
2258 1 OD2 H ASP 316  ? ? O   H HOH 635  ? ? 2.19 
2259 1 O   H HOH 668  ? ? O   H HOH 1044 ? ? 2.19 
2260 1 O   N HOH 776  ? ? O   N HOH 836  ? ? 2.19 
2261 1 O   B HOH 815  ? ? O   B HOH 1064 ? ? 2.19 
2262 1 O   A HOH 678  ? ? O   A HOH 1030 ? ? 2.19 
2263 1 O   T HOH 701  ? ? O   T HOH 1141 ? ? 2.19 
2264 1 O   E HOH 795  ? ? O   E HOH 844  ? ? 2.19 
2265 1 O   P HOH 747  ? ? O   P HOH 1058 ? ? 2.19 
2266 1 NH2 M ARG 259  ? ? O   M HOH 636  ? ? 2.19 
2267 1 O   T HOH 707  ? ? O   T HOH 1115 ? ? 2.19 
2268 1 O   B HOH 1109 ? ? O   B HOH 1127 ? ? 2.19 
2269 1 O   Q HOH 653  ? ? O   Q HOH 986  ? ? 2.19 
2270 1 O   M HOH 632  ? ? O   M HOH 1047 ? ? 2.19 
2271 1 O   U VAL 383  ? ? O   U HOH 635  ? ? 2.19 
2272 1 O   B HOH 694  ? ? O   B HOH 985  ? ? 2.19 
2273 1 O   D HOH 955  ? ? O   D HOH 996  ? ? 2.19 
2274 1 O   M HOH 648  ? ? O   M HOH 1087 ? ? 2.19 
2275 1 O   M CYS 332  ? ? O   M HOH 637  ? ? 2.19 
2276 1 O   E HOH 862  ? ? O   E HOH 1007 ? ? 2.19 
2277 1 O   N HOH 984  ? ? O   N HOH 1024 ? ? 2.19 
2278 1 NH1 A ARG 222  ? ? O   A HOH 635  ? ? 2.19 
2279 1 O   L HOH 1014 ? ? O   L HOH 1036 ? ? 2.19 
2280 1 O   P MET 175  ? ? O   P HOH 627  ? ? 2.19 
2281 1 NZ  C LYS 44   ? ? O   C HOH 639  ? ? 2.19 
2282 1 O   N THR 229  ? ? O   N HOH 633  ? ? 2.19 
2283 1 O   B HOH 895  ? ? O   B HOH 1015 ? ? 2.19 
2284 1 O   C HOH 939  ? ? O   C HOH 1177 ? ? 2.19 
2285 1 O   K HOH 866  ? ? O   K HOH 952  ? ? 2.19 
2286 1 O   D HOH 914  ? ? O   D HOH 951  ? ? 2.19 
2287 1 O   R HOH 631  ? ? O   R HOH 688  ? ? 2.19 
2288 1 N   F VAL 7    ? ? O   F HOH 630  ? ? 2.19 
2289 1 O   E HOH 811  ? ? O   E HOH 815  ? ? 2.19 
2290 1 O   L HOH 861  ? ? O   L HOH 1088 ? ? 2.19 
2291 1 O   J HOH 761  ? ? O   J HOH 1088 ? ? 2.19 
2292 1 O   K HOH 853  ? ? O   K HOH 930  ? ? 2.19 
2293 1 NE  U ARG 252  ? ? O   U HOH 636  ? ? 2.19 
2294 1 O   R HOH 776  ? ? O   R HOH 1161 ? ? 2.19 
2295 1 OG  C SER 414  ? ? O   C HOH 640  ? ? 2.19 
2296 1 OG  A SER 25   ? ? O   A HOH 636  ? ? 2.19 
2297 1 O   C HOH 690  ? ? O   C HOH 984  ? ? 2.19 
2298 1 OD2 O ASP 316  ? ? O   O HOH 629  ? ? 2.19 
2299 1 O   H HOH 724  ? ? O   H HOH 997  ? ? 2.19 
2300 1 O   D HOH 801  ? ? O   D HOH 838  ? ? 2.19 
2301 1 O   H HOH 1063 ? ? O   I HOH 763  ? ? 2.19 
2302 1 OE2 M GLU 357  ? ? O   M HOH 638  ? ? 2.19 
2303 1 O   U HOH 936  ? ? O   U HOH 1079 ? ? 2.19 
2304 1 O   L LYS 215  ? ? O   L HOH 632  ? ? 2.19 
2305 1 O   N HOH 652  ? ? O   N HOH 693  ? ? 2.19 
2306 1 O   B HOH 781  ? ? O   M HOH 985  ? ? 2.19 
2307 1 NH2 C ARG 403  ? ? O   C HOH 641  ? ? 2.19 
2308 1 O   H ARG 320  ? ? O   H HOH 636  ? ? 2.19 
2309 1 O   U HOH 986  ? ? O   U HOH 1075 ? ? 2.19 
2310 1 OD2 G ASP 13   ? ? O   G HOH 631  ? ? 2.19 
2311 1 O   P HOH 990  ? ? O   P HOH 991  ? ? 2.19 
2312 1 NH1 H ARG 232  ? ? O   H HOH 637  ? ? 2.19 
2313 1 OD1 K ASP 185  ? ? O   K HOH 635  ? ? 2.19 
2314 1 OD1 R ASP 32   ? ? O   R HOH 624  ? ? 2.19 
2315 1 O   Q HOH 906  ? ? O   U HOH 647  ? ? 2.19 
2316 1 O   J HOH 890  ? ? O   J HOH 1187 ? ? 2.19 
2317 1 O   O HOH 855  ? ? O   O HOH 879  ? ? 2.19 
2318 1 OD2 C ASP 181  ? ? O   C HOH 642  ? ? 2.19 
2319 1 O   U HOH 1134 ? ? O   U HOH 1135 ? ? 2.19 
2320 1 NE  L ARG 223  ? ? O   L HOH 633  ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1  1 O M HOH 1066 ? ? 1_555 O U HOH 1036 ? ? 1_565 1.68 
2  1 O J HOH 1187 ? ? 1_555 O L HOH 1071 ? ? 1_546 1.69 
3  1 O J HOH 831  ? ? 1_555 O N HOH 787  ? ? 1_655 1.71 
4  1 O I HOH 648  ? ? 1_555 O J HOH 742  ? ? 1_455 1.74 
5  1 O J HOH 1031 ? ? 1_555 O N HOH 1056 ? ? 1_655 1.79 
6  1 O J HOH 1171 ? ? 1_555 O L HOH 859  ? ? 1_546 1.81 
7  1 O N HOH 823  ? ? 1_555 O R HOH 1024 ? ? 1_446 1.82 
8  1 O N HOH 841  ? ? 1_555 O R HOH 1133 ? ? 1_446 1.82 
9  1 O N HOH 831  ? ? 1_555 O R HOH 993  ? ? 1_446 1.84 
10 1 O J HOH 1242 ? ? 1_555 O R HOH 1160 ? ? 1_546 1.87 
11 1 O M HOH 1055 ? ? 1_555 O U HOH 1047 ? ? 1_465 1.87 
12 1 O H HOH 733  ? ? 1_555 O T HOH 972  ? ? 1_465 1.88 
13 1 O H HOH 806  ? ? 1_555 O T HOH 915  ? ? 1_565 1.88 
14 1 O E HOH 1016 ? ? 1_555 O O HOH 1028 ? ? 1_654 1.88 
15 1 O M HOH 1149 ? ? 1_555 O U HOH 1093 ? ? 1_565 1.88 
16 1 O O HOH 1187 ? ? 1_555 O P HOH 1074 ? ? 1_456 1.89 
17 1 O L HOH 928  ? ? 1_555 O N HOH 1065 ? ? 1_664 1.91 
18 1 O O HOH 906  ? ? 1_555 O P HOH 751  ? ? 1_456 1.92 
19 1 O D HOH 1096 ? ? 1_555 O E HOH 1026 ? ? 1_565 1.92 
20 1 O N HOH 1025 ? ? 1_555 O R HOH 1174 ? ? 1_446 1.92 
21 1 O H HOH 1069 ? ? 1_555 O T HOH 1073 ? ? 1_465 1.92 
22 1 O J HOH 1126 ? ? 1_555 O L HOH 985  ? ? 1_546 1.93 
23 1 O O HOH 622  ? ? 1_555 O P HOH 648  ? ? 1_456 1.93 
24 1 O A HOH 946  ? ? 1_555 O O HOH 1081 ? ? 1_654 1.94 
25 1 O N HOH 990  ? ? 1_555 O R HOH 1035 ? ? 1_446 1.95 
26 1 O L HOH 1016 ? ? 1_555 O N HOH 1061 ? ? 1_664 1.95 
27 1 O J HOH 831  ? ? 1_555 O N HOH 758  ? ? 1_655 1.95 
28 1 O J HOH 1026 ? ? 1_555 O L HOH 906  ? ? 1_546 1.98 
29 1 O N HOH 1044 ? ? 1_555 O G HOH 1013 ? ? 1_445 1.98 
30 1 O H HOH 1038 ? ? 1_555 O T HOH 1074 ? ? 1_465 1.99 
31 1 O M HOH 1110 ? ? 1_555 O U HOH 1048 ? ? 1_565 2.00 
32 1 O O HOH 965  ? ? 1_555 O P HOH 685  ? ? 1_456 2.01 
33 1 O N HOH 759  ? ? 1_555 O R HOH 730  ? ? 1_446 2.02 
34 1 O O HOH 818  ? ? 1_555 O P HOH 901  ? ? 1_456 2.02 
35 1 O C HOH 900  ? ? 1_555 O F HOH 879  ? ? 1_455 2.03 
36 1 O E HOH 1054 ? ? 1_555 O O HOH 690  ? ? 1_654 2.03 
37 1 O A HOH 624  ? ? 1_555 O B HOH 621  ? ? 1_655 2.03 
38 1 O L HOH 945  ? ? 1_555 O N HOH 918  ? ? 1_664 2.04 
39 1 O O HOH 901  ? ? 1_555 O P HOH 751  ? ? 1_456 2.06 
40 1 O O HOH 970  ? ? 1_555 O R HOH 1157 ? ? 1_546 2.07 
41 1 O J HOH 698  ? ? 1_555 O R HOH 657  ? ? 1_546 2.07 
42 1 O D HOH 916  ? ? 1_555 O E HOH 616  ? ? 1_465 2.07 
43 1 O J HOH 843  ? ? 1_555 O N HOH 782  ? ? 1_655 2.07 
44 1 O E HOH 618  ? ? 1_555 O O HOH 1002 ? ? 1_654 2.07 
45 1 O D HOH 993  ? ? 1_555 O E HOH 834  ? ? 1_465 2.07 
46 1 O A HOH 803  ? ? 1_555 O O HOH 912  ? ? 1_654 2.08 
47 1 O N HOH 906  ? ? 1_555 O R HOH 733  ? ? 1_446 2.08 
48 1 O L HOH 707  ? ? 1_555 O N HOH 964  ? ? 1_664 2.09 
49 1 O N HOH 964  ? ? 1_555 O R HOH 785  ? ? 1_446 2.09 
50 1 O H HOH 904  ? ? 1_555 O T HOH 1089 ? ? 1_565 2.09 
51 1 O J HOH 853  ? ? 1_555 O L HOH 723  ? ? 1_546 2.10 
52 1 O E HOH 1080 ? ? 1_555 O O HOH 1189 ? ? 1_654 2.10 
53 1 O J HOH 1127 ? ? 1_555 O R HOH 1018 ? ? 1_546 2.10 
54 1 O A HOH 898  ? ? 1_555 O O HOH 959  ? ? 1_654 2.10 
55 1 O N HOH 878  ? ? 1_555 O R HOH 680  ? ? 1_446 2.10 
56 1 O L HOH 666  ? ? 1_555 O N HOH 902  ? ? 1_664 2.11 
57 1 O E HOH 950  ? ? 1_555 O O HOH 922  ? ? 1_654 2.11 
58 1 O O HOH 713  ? ? 1_555 O P HOH 948  ? ? 1_456 2.11 
59 1 O J HOH 1124 ? ? 1_555 O L HOH 974  ? ? 1_546 2.12 
60 1 O O HOH 1031 ? ? 1_555 O P HOH 987  ? ? 1_456 2.12 
61 1 O J HOH 838  ? ? 1_555 O N HOH 893  ? ? 1_655 2.12 
62 1 O H HOH 791  ? ? 1_555 O T HOH 700  ? ? 1_465 2.13 
63 1 O J HOH 869  ? ? 1_555 O N HOH 958  ? ? 1_655 2.13 
64 1 O O HOH 1024 ? ? 1_555 O P HOH 750  ? ? 1_456 2.13 
65 1 O J HOH 779  ? ? 1_555 O R HOH 1063 ? ? 1_546 2.14 
66 1 O A HOH 892  ? ? 1_555 O B HOH 1019 ? ? 1_655 2.14 
67 1 O L HOH 994  ? ? 1_555 O N HOH 827  ? ? 1_664 2.14 
68 1 O H HOH 742  ? ? 1_555 O T HOH 1078 ? ? 1_565 2.14 
69 1 O N HOH 900  ? ? 1_555 O R HOH 1004 ? ? 1_446 2.15 
70 1 O M HOH 660  ? ? 1_555 O U HOH 623  ? ? 1_565 2.15 
71 1 O N HOH 1077 ? ? 1_555 O R HOH 1168 ? ? 1_446 2.15 
72 1 O J HOH 1126 ? ? 1_555 O L HOH 1028 ? ? 1_546 2.15 
73 1 O K GLU 200  ? ? 1_555 O Q HOH 602  ? ? 1_455 2.17 
74 1 O H HOH 1038 ? ? 1_555 O T HOH 844  ? ? 1_465 2.17 
75 1 O J HOH 793  ? ? 1_555 O L HOH 974  ? ? 1_546 2.17 
76 1 O L HOH 1046 ? ? 1_555 O N HOH 996  ? ? 1_664 2.18 
77 1 O J HOH 756  ? ? 1_555 O R HOH 826  ? ? 1_546 2.18 
78 1 O C HOH 1206 ?