data_5W97
# 
_entry.id   5W97 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5W97         
WWPDB D_1000228635 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5W97 
_pdbx_database_status.recvd_initial_deposition_date   2017-06-22 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Rousseau, D.L.' 1 ? 
'Yeh, S.-R.'     2 ? 
'Ishigami, I.'   3 ? 
'Zatsepin, N.A.' 4 ? 
'Grant, T.D.'    5 ? 
'Fromme, P.'     6 ? 
'Fromme, R.'     7 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Proc. Natl. Acad. Sci. U.S.A.' 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            114 
_citation.language                  ? 
_citation.page_first                8011 
_citation.page_last                 8016 
_citation.title                     
'Crystal structure of CO-bound cytochrome c oxidase determined by serial femtosecond X-ray crystallography at room temperature.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1705628114 
_citation.pdbx_database_id_PubMed   28698372 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ishigami, I.'   1  ? 
primary 'Zatsepin, N.A.' 2  ? 
primary 'Hikita, M.'     3  ? 
primary 'Conrad, C.E.'   4  ? 
primary 'Nelson, G.'     5  ? 
primary 'Coe, J.D.'      6  ? 
primary 'Basu, S.'       7  ? 
primary 'Grant, T.D.'    8  ? 
primary 'Seaberg, M.H.'  9  ? 
primary 'Sierra, R.G.'   10 ? 
primary 'Hunter, M.S.'   11 ? 
primary 'Fromme, P.'     12 ? 
primary 'Fromme, R.'     13 ? 
primary 'Yeh, S.R.'      14 ? 
primary 'Rousseau, D.L.' 15 ? 
# 
_cell.length_a           178.300 
_cell.length_b           189.000 
_cell.length_c           209.000 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           5W97 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         5W97 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'Cytochrome c oxidase subunit 1' 57093.852 2    1.9.3.1 ? ?                 ? 
2  polymer     nat 'Cytochrome c oxidase subunit 2' 26068.404 2    ?       ? ?                 ? 
3  polymer     nat 'Cytochrome c oxidase subunit 3' 29957.627 2    ?       ? ?                 ? 
4  polymer     nat 'Cytochrome c oxidase subunit 4 isoform 1, mitochondrial' 17179.646 2    ?       ? 'residues 23-169' ? 
5  polymer     nat 'Cytochrome c oxidase subunit 5A, mitochondrial' 12453.081 2    ?       ? 'residues 44-152' ? 
6  polymer     nat 'Cytochrome c oxidase subunit 5B, mitochondrial' 10684.038 2    ?       ? 'residues 32-129' ? 
7  polymer     nat 'Cytochrome c oxidase subunit 6A2, mitochondrial' 9629.782  2    ?       ? 'residues 13-97'  ? 
8  polymer     nat 'Cytochrome c oxidase subunit 6B1' 10039.244 2    ?       ? ?                 ? 
9  polymer     nat 'Cytochrome c oxidase subunit 6C' 8537.019  2    ?       ? ?                 ? 
10 polymer     nat 'Cytochrome c oxidase subunit 7A1, mitochondrial' 6682.726  2    ?       ? 'residues 22-80'  ? 
11 polymer     nat 'Cytochrome c oxidase subunit 7B, mitochondrial' 6365.217  2    ?       ? 'residues 25-80'  ? 
12 polymer     nat 'Cytochrome c oxidase subunit 7C, mitochondrial' 5449.396  2    ?       ? 'residues 17-63'  ? 
13 polymer     nat 'Cytochrome c oxidase subunit 8B, mitochondrial' 4967.756  2    ?       ? 'residues 25-70'  ? 
14 non-polymer syn HEME-A 852.837   4    ?       ? ?                 ? 
15 non-polymer syn 'COPPER (II) ION' 63.546    2    ?       ? ?                 ? 
16 non-polymer syn 'MAGNESIUM ION' 24.305    2    ?       ? ?                 ? 
17 non-polymer syn 'SODIUM ION' 22.990    2    ?       ? ?                 ? 
18 non-polymer syn 
'(1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE' 749.007   
8    ?       ? ?                 ? 
19 non-polymer syn TRISTEAROYLGLYCEROL 891.480   6    ?       ? ?                 ? 
20 non-polymer syn 'CARBON MONOXIDE' 28.010    2    ?       ? ?                 ? 
21 non-polymer syn 'DINUCLEAR COPPER ION' 127.092   2    ?       ? ?                 ? 
22 non-polymer syn 
'(7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE' 
759.068   2    ?       ? ?                 ? 
23 non-polymer syn 'CHOLIC ACID' 408.571   8    ?       ? ?                 ? 
24 non-polymer syn 
'(1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE' 
768.055   6    ?       ? ?                 ? 
25 non-polymer syn CARDIOLIPIN 1464.043  4    ?       ? ?                 ? 
26 non-polymer man DECYL-BETA-D-MALTOPYRANOSIDE 482.562   4    ?       ? ?                 ? 
27 non-polymer syn 'ZINC ION' 65.409    2    ?       ? ?                 ? 
28 water       nat water 18.015    1291 ?       ? ?                 ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'Cytochrome c oxidase polypeptide I' 
2  'Cytochrome c oxidase polypeptide II' 
3  'Cytochrome c oxidase polypeptide III' 
4  'Cytochrome c oxidase polypeptide IV,Cytochrome c oxidase subunit IV isoform 1,COX IV-1' 
5  'Cytochrome c oxidase polypeptide Va' 
6  'Cytochrome c oxidase polypeptide VIa,Cytochrome c oxidase polypeptide Vb' 
7  'Cytochrome c oxidase polypeptide VIa-heart,COXVIAH,Cytochrome c oxidase polypeptide VIb' 
8  'Cytochrome c oxidase polypeptide VII,Cytochrome c oxidase subunit AED,Cytochrome c oxidase subunit VIb isoform 1,COX VIb-1' 
9  'Cytochrome c oxidase polypeptide VIc,Cytochrome c oxidase subunit STA' 
10 
;Cytochrome c oxidase subunit VIIIc,VIIIC,Cytochrome c oxidase subunit VIIa-heart,Cytochrome c oxidase subunit VIIa-H,Cytochrome c oxidase subunit VIIa-muscle,Cytochrome c oxidase subunit VIIa-M
;
11 'Cytochrome c oxidase polypeptide VIIb,IHQ' 
12 'Cytochrome c oxidase polypeptide VIIIA,Cytochrome c oxidase polypeptide VIIc' 
13 'Cytochrome c oxidase polypeptide VIII-heart,Cytochrome c oxidase subunit 8-1,Cytochrome c oxidase subunit 8H,IX,VIIIb' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no yes 
;(FME)FINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIG
GFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVS
SILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFW
FFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPT
GVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHW
FPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAF
ASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
;
;MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGN
WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILG
AINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV
FSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLF
SGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKR
EVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
;
A,a ? 
2  'polypeptide(L)' no yes 
;(FME)AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILI
ALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSS
EDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
;
;MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPS
LRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVL
HSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
;
B,b ? 
3  'polypeptide(L)' no no  
;MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLR
YGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHML
QALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS
;
;MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLR
YGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHML
QALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS
;
C,c ? 
4  'polypeptide(L)' no no  
;AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKT
VVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK
;
;AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKT
VVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK
;
D,d ? 
5  'polypeptide(L)' no no  
;SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKE
IYPYVIQELRPTLNELGISTPEELGLDKV
;
;SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKE
IYPYVIQELRPTLNELGISTPEELGLDKV
;
E,e ? 
6  'polypeptide(L)' no no  
;ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQ
RCPSCGTHYKLVPHQLAH
;
;ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQ
RCPSCGTHYKLVPHQLAH
;
F,f ? 
7  'polypeptide(L)' no yes 
;ASAAKGDHGG(TPO)GARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVN
PLPTGYEKP
;
;ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPT
GYEKP
;
G,g ? 
8  'polypeptide(L)' no no  
;AEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGT
FPGKI
;
;AEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGT
FPGKI
;
H,h ? 
9  'polypeptide(L)' no yes '(SAC)TALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK' 
STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK I,i ? 
10 'polypeptide(L)' no no  FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHKK 
FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHKK J,j ? 
11 'polypeptide(L)' no no  IHQKRAPDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWREQ 
IHQKRAPDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWREQ K,k ? 
12 'polypeptide(L)' no no  SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK L,l ? 
13 'polypeptide(L)' no no  ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKSSAA ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKSSAA M,m ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   FME n 
1  2   PHE n 
1  3   ILE n 
1  4   ASN n 
1  5   ARG n 
1  6   TRP n 
1  7   LEU n 
1  8   PHE n 
1  9   SER n 
1  10  THR n 
1  11  ASN n 
1  12  HIS n 
1  13  LYS n 
1  14  ASP n 
1  15  ILE n 
1  16  GLY n 
1  17  THR n 
1  18  LEU n 
1  19  TYR n 
1  20  LEU n 
1  21  LEU n 
1  22  PHE n 
1  23  GLY n 
1  24  ALA n 
1  25  TRP n 
1  26  ALA n 
1  27  GLY n 
1  28  MET n 
1  29  VAL n 
1  30  GLY n 
1  31  THR n 
1  32  ALA n 
1  33  LEU n 
1  34  SER n 
1  35  LEU n 
1  36  LEU n 
1  37  ILE n 
1  38  ARG n 
1  39  ALA n 
1  40  GLU n 
1  41  LEU n 
1  42  GLY n 
1  43  GLN n 
1  44  PRO n 
1  45  GLY n 
1  46  THR n 
1  47  LEU n 
1  48  LEU n 
1  49  GLY n 
1  50  ASP n 
1  51  ASP n 
1  52  GLN n 
1  53  ILE n 
1  54  TYR n 
1  55  ASN n 
1  56  VAL n 
1  57  VAL n 
1  58  VAL n 
1  59  THR n 
1  60  ALA n 
1  61  HIS n 
1  62  ALA n 
1  63  PHE n 
1  64  VAL n 
1  65  MET n 
1  66  ILE n 
1  67  PHE n 
1  68  PHE n 
1  69  MET n 
1  70  VAL n 
1  71  MET n 
1  72  PRO n 
1  73  ILE n 
1  74  MET n 
1  75  ILE n 
1  76  GLY n 
1  77  GLY n 
1  78  PHE n 
1  79  GLY n 
1  80  ASN n 
1  81  TRP n 
1  82  LEU n 
1  83  VAL n 
1  84  PRO n 
1  85  LEU n 
1  86  MET n 
1  87  ILE n 
1  88  GLY n 
1  89  ALA n 
1  90  PRO n 
1  91  ASP n 
1  92  MET n 
1  93  ALA n 
1  94  PHE n 
1  95  PRO n 
1  96  ARG n 
1  97  MET n 
1  98  ASN n 
1  99  ASN n 
1  100 MET n 
1  101 SER n 
1  102 PHE n 
1  103 TRP n 
1  104 LEU n 
1  105 LEU n 
1  106 PRO n 
1  107 PRO n 
1  108 SER n 
1  109 PHE n 
1  110 LEU n 
1  111 LEU n 
1  112 LEU n 
1  113 LEU n 
1  114 ALA n 
1  115 SER n 
1  116 SER n 
1  117 MET n 
1  118 VAL n 
1  119 GLU n 
1  120 ALA n 
1  121 GLY n 
1  122 ALA n 
1  123 GLY n 
1  124 THR n 
1  125 GLY n 
1  126 TRP n 
1  127 THR n 
1  128 VAL n 
1  129 TYR n 
1  130 PRO n 
1  131 PRO n 
1  132 LEU n 
1  133 ALA n 
1  134 GLY n 
1  135 ASN n 
1  136 LEU n 
1  137 ALA n 
1  138 HIS n 
1  139 ALA n 
1  140 GLY n 
1  141 ALA n 
1  142 SER n 
1  143 VAL n 
1  144 ASP n 
1  145 LEU n 
1  146 THR n 
1  147 ILE n 
1  148 PHE n 
1  149 SER n 
1  150 LEU n 
1  151 HIS n 
1  152 LEU n 
1  153 ALA n 
1  154 GLY n 
1  155 VAL n 
1  156 SER n 
1  157 SER n 
1  158 ILE n 
1  159 LEU n 
1  160 GLY n 
1  161 ALA n 
1  162 ILE n 
1  163 ASN n 
1  164 PHE n 
1  165 ILE n 
1  166 THR n 
1  167 THR n 
1  168 ILE n 
1  169 ILE n 
1  170 ASN n 
1  171 MET n 
1  172 LYS n 
1  173 PRO n 
1  174 PRO n 
1  175 ALA n 
1  176 MET n 
1  177 SER n 
1  178 GLN n 
1  179 TYR n 
1  180 GLN n 
1  181 THR n 
1  182 PRO n 
1  183 LEU n 
1  184 PHE n 
1  185 VAL n 
1  186 TRP n 
1  187 SER n 
1  188 VAL n 
1  189 MET n 
1  190 ILE n 
1  191 THR n 
1  192 ALA n 
1  193 VAL n 
1  194 LEU n 
1  195 LEU n 
1  196 LEU n 
1  197 LEU n 
1  198 SER n 
1  199 LEU n 
1  200 PRO n 
1  201 VAL n 
1  202 LEU n 
1  203 ALA n 
1  204 ALA n 
1  205 GLY n 
1  206 ILE n 
1  207 THR n 
1  208 MET n 
1  209 LEU n 
1  210 LEU n 
1  211 THR n 
1  212 ASP n 
1  213 ARG n 
1  214 ASN n 
1  215 LEU n 
1  216 ASN n 
1  217 THR n 
1  218 THR n 
1  219 PHE n 
1  220 PHE n 
1  221 ASP n 
1  222 PRO n 
1  223 ALA n 
1  224 GLY n 
1  225 GLY n 
1  226 GLY n 
1  227 ASP n 
1  228 PRO n 
1  229 ILE n 
1  230 LEU n 
1  231 TYR n 
1  232 GLN n 
1  233 HIS n 
1  234 LEU n 
1  235 PHE n 
1  236 TRP n 
1  237 PHE n 
1  238 PHE n 
1  239 GLY n 
1  240 HIS n 
1  241 PRO n 
1  242 GLU n 
1  243 VAL n 
1  244 TYR n 
1  245 ILE n 
1  246 LEU n 
1  247 ILE n 
1  248 LEU n 
1  249 PRO n 
1  250 GLY n 
1  251 PHE n 
1  252 GLY n 
1  253 MET n 
1  254 ILE n 
1  255 SER n 
1  256 HIS n 
1  257 ILE n 
1  258 VAL n 
1  259 THR n 
1  260 TYR n 
1  261 TYR n 
1  262 SER n 
1  263 GLY n 
1  264 LYS n 
1  265 LYS n 
1  266 GLU n 
1  267 PRO n 
1  268 PHE n 
1  269 GLY n 
1  270 TYR n 
1  271 MET n 
1  272 GLY n 
1  273 MET n 
1  274 VAL n 
1  275 TRP n 
1  276 ALA n 
1  277 MET n 
1  278 MET n 
1  279 SER n 
1  280 ILE n 
1  281 GLY n 
1  282 PHE n 
1  283 LEU n 
1  284 GLY n 
1  285 PHE n 
1  286 ILE n 
1  287 VAL n 
1  288 TRP n 
1  289 ALA n 
1  290 HIS n 
1  291 HIS n 
1  292 MET n 
1  293 PHE n 
1  294 THR n 
1  295 VAL n 
1  296 GLY n 
1  297 MET n 
1  298 ASP n 
1  299 VAL n 
1  300 ASP n 
1  301 THR n 
1  302 ARG n 
1  303 ALA n 
1  304 TYR n 
1  305 PHE n 
1  306 THR n 
1  307 SER n 
1  308 ALA n 
1  309 THR n 
1  310 MET n 
1  311 ILE n 
1  312 ILE n 
1  313 ALA n 
1  314 ILE n 
1  315 PRO n 
1  316 THR n 
1  317 GLY n 
1  318 VAL n 
1  319 LYS n 
1  320 VAL n 
1  321 PHE n 
1  322 SER n 
1  323 TRP n 
1  324 LEU n 
1  325 ALA n 
1  326 THR n 
1  327 LEU n 
1  328 HIS n 
1  329 GLY n 
1  330 GLY n 
1  331 ASN n 
1  332 ILE n 
1  333 LYS n 
1  334 TRP n 
1  335 SER n 
1  336 PRO n 
1  337 ALA n 
1  338 MET n 
1  339 MET n 
1  340 TRP n 
1  341 ALA n 
1  342 LEU n 
1  343 GLY n 
1  344 PHE n 
1  345 ILE n 
1  346 PHE n 
1  347 LEU n 
1  348 PHE n 
1  349 THR n 
1  350 VAL n 
1  351 GLY n 
1  352 GLY n 
1  353 LEU n 
1  354 THR n 
1  355 GLY n 
1  356 ILE n 
1  357 VAL n 
1  358 LEU n 
1  359 ALA n 
1  360 ASN n 
1  361 SER n 
1  362 SER n 
1  363 LEU n 
1  364 ASP n 
1  365 ILE n 
1  366 VAL n 
1  367 LEU n 
1  368 HIS n 
1  369 ASP n 
1  370 THR n 
1  371 TYR n 
1  372 TYR n 
1  373 VAL n 
1  374 VAL n 
1  375 ALA n 
1  376 HIS n 
1  377 PHE n 
1  378 HIS n 
1  379 TYR n 
1  380 VAL n 
1  381 LEU n 
1  382 SER n 
1  383 MET n 
1  384 GLY n 
1  385 ALA n 
1  386 VAL n 
1  387 PHE n 
1  388 ALA n 
1  389 ILE n 
1  390 MET n 
1  391 GLY n 
1  392 GLY n 
1  393 PHE n 
1  394 VAL n 
1  395 HIS n 
1  396 TRP n 
1  397 PHE n 
1  398 PRO n 
1  399 LEU n 
1  400 PHE n 
1  401 SER n 
1  402 GLY n 
1  403 TYR n 
1  404 THR n 
1  405 LEU n 
1  406 ASN n 
1  407 ASP n 
1  408 THR n 
1  409 TRP n 
1  410 ALA n 
1  411 LYS n 
1  412 ILE n 
1  413 HIS n 
1  414 PHE n 
1  415 ALA n 
1  416 ILE n 
1  417 MET n 
1  418 PHE n 
1  419 VAL n 
1  420 GLY n 
1  421 VAL n 
1  422 ASN n 
1  423 MET n 
1  424 THR n 
1  425 PHE n 
1  426 PHE n 
1  427 PRO n 
1  428 GLN n 
1  429 HIS n 
1  430 PHE n 
1  431 LEU n 
1  432 GLY n 
1  433 LEU n 
1  434 SER n 
1  435 GLY n 
1  436 MET n 
1  437 PRO n 
1  438 ARG n 
1  439 ARG n 
1  440 TYR n 
1  441 SER n 
1  442 ASP n 
1  443 TYR n 
1  444 PRO n 
1  445 ASP n 
1  446 ALA n 
1  447 TYR n 
1  448 THR n 
1  449 MET n 
1  450 TRP n 
1  451 ASN n 
1  452 THR n 
1  453 ILE n 
1  454 SER n 
1  455 SER n 
1  456 MET n 
1  457 GLY n 
1  458 SER n 
1  459 PHE n 
1  460 ILE n 
1  461 SER n 
1  462 LEU n 
1  463 THR n 
1  464 ALA n 
1  465 VAL n 
1  466 MET n 
1  467 LEU n 
1  468 MET n 
1  469 VAL n 
1  470 PHE n 
1  471 ILE n 
1  472 ILE n 
1  473 TRP n 
1  474 GLU n 
1  475 ALA n 
1  476 PHE n 
1  477 ALA n 
1  478 SER n 
1  479 LYS n 
1  480 ARG n 
1  481 GLU n 
1  482 VAL n 
1  483 LEU n 
1  484 THR n 
1  485 VAL n 
1  486 ASP n 
1  487 LEU n 
1  488 THR n 
1  489 THR n 
1  490 THR n 
1  491 ASN n 
1  492 LEU n 
1  493 GLU n 
1  494 TRP n 
1  495 LEU n 
1  496 ASN n 
1  497 GLY n 
1  498 CYS n 
1  499 PRO n 
1  500 PRO n 
1  501 PRO n 
1  502 TYR n 
1  503 HIS n 
1  504 THR n 
1  505 PHE n 
1  506 GLU n 
1  507 GLU n 
1  508 PRO n 
1  509 THR n 
1  510 TYR n 
1  511 VAL n 
1  512 ASN n 
1  513 LEU n 
1  514 LYS n 
2  1   FME n 
2  2   ALA n 
2  3   TYR n 
2  4   PRO n 
2  5   MET n 
2  6   GLN n 
2  7   LEU n 
2  8   GLY n 
2  9   PHE n 
2  10  GLN n 
2  11  ASP n 
2  12  ALA n 
2  13  THR n 
2  14  SER n 
2  15  PRO n 
2  16  ILE n 
2  17  MET n 
2  18  GLU n 
2  19  GLU n 
2  20  LEU n 
2  21  LEU n 
2  22  HIS n 
2  23  PHE n 
2  24  HIS n 
2  25  ASP n 
2  26  HIS n 
2  27  THR n 
2  28  LEU n 
2  29  MET n 
2  30  ILE n 
2  31  VAL n 
2  32  PHE n 
2  33  LEU n 
2  34  ILE n 
2  35  SER n 
2  36  SER n 
2  37  LEU n 
2  38  VAL n 
2  39  LEU n 
2  40  TYR n 
2  41  ILE n 
2  42  ILE n 
2  43  SER n 
2  44  LEU n 
2  45  MET n 
2  46  LEU n 
2  47  THR n 
2  48  THR n 
2  49  LYS n 
2  50  LEU n 
2  51  THR n 
2  52  HIS n 
2  53  THR n 
2  54  SER n 
2  55  THR n 
2  56  MET n 
2  57  ASP n 
2  58  ALA n 
2  59  GLN n 
2  60  GLU n 
2  61  VAL n 
2  62  GLU n 
2  63  THR n 
2  64  ILE n 
2  65  TRP n 
2  66  THR n 
2  67  ILE n 
2  68  LEU n 
2  69  PRO n 
2  70  ALA n 
2  71  ILE n 
2  72  ILE n 
2  73  LEU n 
2  74  ILE n 
2  75  LEU n 
2  76  ILE n 
2  77  ALA n 
2  78  LEU n 
2  79  PRO n 
2  80  SER n 
2  81  LEU n 
2  82  ARG n 
2  83  ILE n 
2  84  LEU n 
2  85  TYR n 
2  86  MET n 
2  87  MET n 
2  88  ASP n 
2  89  GLU n 
2  90  ILE n 
2  91  ASN n 
2  92  ASN n 
2  93  PRO n 
2  94  SER n 
2  95  LEU n 
2  96  THR n 
2  97  VAL n 
2  98  LYS n 
2  99  THR n 
2  100 MET n 
2  101 GLY n 
2  102 HIS n 
2  103 GLN n 
2  104 TRP n 
2  105 TYR n 
2  106 TRP n 
2  107 SER n 
2  108 TYR n 
2  109 GLU n 
2  110 TYR n 
2  111 THR n 
2  112 ASP n 
2  113 TYR n 
2  114 GLU n 
2  115 ASP n 
2  116 LEU n 
2  117 SER n 
2  118 PHE n 
2  119 ASP n 
2  120 SER n 
2  121 TYR n 
2  122 MET n 
2  123 ILE n 
2  124 PRO n 
2  125 THR n 
2  126 SER n 
2  127 GLU n 
2  128 LEU n 
2  129 LYS n 
2  130 PRO n 
2  131 GLY n 
2  132 GLU n 
2  133 LEU n 
2  134 ARG n 
2  135 LEU n 
2  136 LEU n 
2  137 GLU n 
2  138 VAL n 
2  139 ASP n 
2  140 ASN n 
2  141 ARG n 
2  142 VAL n 
2  143 VAL n 
2  144 LEU n 
2  145 PRO n 
2  146 MET n 
2  147 GLU n 
2  148 MET n 
2  149 THR n 
2  150 ILE n 
2  151 ARG n 
2  152 MET n 
2  153 LEU n 
2  154 VAL n 
2  155 SER n 
2  156 SER n 
2  157 GLU n 
2  158 ASP n 
2  159 VAL n 
2  160 LEU n 
2  161 HIS n 
2  162 SER n 
2  163 TRP n 
2  164 ALA n 
2  165 VAL n 
2  166 PRO n 
2  167 SER n 
2  168 LEU n 
2  169 GLY n 
2  170 LEU n 
2  171 LYS n 
2  172 THR n 
2  173 ASP n 
2  174 ALA n 
2  175 ILE n 
2  176 PRO n 
2  177 GLY n 
2  178 ARG n 
2  179 LEU n 
2  180 ASN n 
2  181 GLN n 
2  182 THR n 
2  183 THR n 
2  184 LEU n 
2  185 MET n 
2  186 SER n 
2  187 SER n 
2  188 ARG n 
2  189 PRO n 
2  190 GLY n 
2  191 LEU n 
2  192 TYR n 
2  193 TYR n 
2  194 GLY n 
2  195 GLN n 
2  196 CYS n 
2  197 SER n 
2  198 GLU n 
2  199 ILE n 
2  200 CYS n 
2  201 GLY n 
2  202 SER n 
2  203 ASN n 
2  204 HIS n 
2  205 SER n 
2  206 PHE n 
2  207 MET n 
2  208 PRO n 
2  209 ILE n 
2  210 VAL n 
2  211 LEU n 
2  212 GLU n 
2  213 LEU n 
2  214 VAL n 
2  215 PRO n 
2  216 LEU n 
2  217 LYS n 
2  218 TYR n 
2  219 PHE n 
2  220 GLU n 
2  221 LYS n 
2  222 TRP n 
2  223 SER n 
2  224 ALA n 
2  225 SER n 
2  226 MET n 
2  227 LEU n 
3  1   MET n 
3  2   THR n 
3  3   HIS n 
3  4   GLN n 
3  5   THR n 
3  6   HIS n 
3  7   ALA n 
3  8   TYR n 
3  9   HIS n 
3  10  MET n 
3  11  VAL n 
3  12  ASN n 
3  13  PRO n 
3  14  SER n 
3  15  PRO n 
3  16  TRP n 
3  17  PRO n 
3  18  LEU n 
3  19  THR n 
3  20  GLY n 
3  21  ALA n 
3  22  LEU n 
3  23  SER n 
3  24  ALA n 
3  25  LEU n 
3  26  LEU n 
3  27  MET n 
3  28  THR n 
3  29  SER n 
3  30  GLY n 
3  31  LEU n 
3  32  THR n 
3  33  MET n 
3  34  TRP n 
3  35  PHE n 
3  36  HIS n 
3  37  PHE n 
3  38  ASN n 
3  39  SER n 
3  40  MET n 
3  41  THR n 
3  42  LEU n 
3  43  LEU n 
3  44  MET n 
3  45  ILE n 
3  46  GLY n 
3  47  LEU n 
3  48  THR n 
3  49  THR n 
3  50  ASN n 
3  51  MET n 
3  52  LEU n 
3  53  THR n 
3  54  MET n 
3  55  TYR n 
3  56  GLN n 
3  57  TRP n 
3  58  TRP n 
3  59  ARG n 
3  60  ASP n 
3  61  VAL n 
3  62  ILE n 
3  63  ARG n 
3  64  GLU n 
3  65  SER n 
3  66  THR n 
3  67  PHE n 
3  68  GLN n 
3  69  GLY n 
3  70  HIS n 
3  71  HIS n 
3  72  THR n 
3  73  PRO n 
3  74  ALA n 
3  75  VAL n 
3  76  GLN n 
3  77  LYS n 
3  78  GLY n 
3  79  LEU n 
3  80  ARG n 
3  81  TYR n 
3  82  GLY n 
3  83  MET n 
3  84  ILE n 
3  85  LEU n 
3  86  PHE n 
3  87  ILE n 
3  88  ILE n 
3  89  SER n 
3  90  GLU n 
3  91  VAL n 
3  92  LEU n 
3  93  PHE n 
3  94  PHE n 
3  95  THR n 
3  96  GLY n 
3  97  PHE n 
3  98  PHE n 
3  99  TRP n 
3  100 ALA n 
3  101 PHE n 
3  102 TYR n 
3  103 HIS n 
3  104 SER n 
3  105 SER n 
3  106 LEU n 
3  107 ALA n 
3  108 PRO n 
3  109 THR n 
3  110 PRO n 
3  111 GLU n 
3  112 LEU n 
3  113 GLY n 
3  114 GLY n 
3  115 CYS n 
3  116 TRP n 
3  117 PRO n 
3  118 PRO n 
3  119 THR n 
3  120 GLY n 
3  121 ILE n 
3  122 HIS n 
3  123 PRO n 
3  124 LEU n 
3  125 ASN n 
3  126 PRO n 
3  127 LEU n 
3  128 GLU n 
3  129 VAL n 
3  130 PRO n 
3  131 LEU n 
3  132 LEU n 
3  133 ASN n 
3  134 THR n 
3  135 SER n 
3  136 VAL n 
3  137 LEU n 
3  138 LEU n 
3  139 ALA n 
3  140 SER n 
3  141 GLY n 
3  142 VAL n 
3  143 SER n 
3  144 ILE n 
3  145 THR n 
3  146 TRP n 
3  147 ALA n 
3  148 HIS n 
3  149 HIS n 
3  150 SER n 
3  151 LEU n 
3  152 MET n 
3  153 GLU n 
3  154 GLY n 
3  155 ASP n 
3  156 ARG n 
3  157 LYS n 
3  158 HIS n 
3  159 MET n 
3  160 LEU n 
3  161 GLN n 
3  162 ALA n 
3  163 LEU n 
3  164 PHE n 
3  165 ILE n 
3  166 THR n 
3  167 ILE n 
3  168 THR n 
3  169 LEU n 
3  170 GLY n 
3  171 VAL n 
3  172 TYR n 
3  173 PHE n 
3  174 THR n 
3  175 LEU n 
3  176 LEU n 
3  177 GLN n 
3  178 ALA n 
3  179 SER n 
3  180 GLU n 
3  181 TYR n 
3  182 TYR n 
3  183 GLU n 
3  184 ALA n 
3  185 PRO n 
3  186 PHE n 
3  187 THR n 
3  188 ILE n 
3  189 SER n 
3  190 ASP n 
3  191 GLY n 
3  192 VAL n 
3  193 TYR n 
3  194 GLY n 
3  195 SER n 
3  196 THR n 
3  197 PHE n 
3  198 PHE n 
3  199 VAL n 
3  200 ALA n 
3  201 THR n 
3  202 GLY n 
3  203 PHE n 
3  204 HIS n 
3  205 GLY n 
3  206 LEU n 
3  207 HIS n 
3  208 VAL n 
3  209 ILE n 
3  210 ILE n 
3  211 GLY n 
3  212 SER n 
3  213 THR n 
3  214 PHE n 
3  215 LEU n 
3  216 ILE n 
3  217 VAL n 
3  218 CYS n 
3  219 PHE n 
3  220 PHE n 
3  221 ARG n 
3  222 GLN n 
3  223 LEU n 
3  224 LYS n 
3  225 PHE n 
3  226 HIS n 
3  227 PHE n 
3  228 THR n 
3  229 SER n 
3  230 ASN n 
3  231 HIS n 
3  232 HIS n 
3  233 PHE n 
3  234 GLY n 
3  235 PHE n 
3  236 GLU n 
3  237 ALA n 
3  238 ALA n 
3  239 ALA n 
3  240 TRP n 
3  241 TYR n 
3  242 TRP n 
3  243 HIS n 
3  244 PHE n 
3  245 VAL n 
3  246 ASP n 
3  247 VAL n 
3  248 VAL n 
3  249 TRP n 
3  250 LEU n 
3  251 PHE n 
3  252 LEU n 
3  253 TYR n 
3  254 VAL n 
3  255 SER n 
3  256 ILE n 
3  257 TYR n 
3  258 TRP n 
3  259 TRP n 
3  260 GLY n 
3  261 SER n 
4  1   ALA n 
4  2   HIS n 
4  3   GLY n 
4  4   SER n 
4  5   VAL n 
4  6   VAL n 
4  7   LYS n 
4  8   SER n 
4  9   GLU n 
4  10  ASP n 
4  11  TYR n 
4  12  ALA n 
4  13  LEU n 
4  14  PRO n 
4  15  SER n 
4  16  TYR n 
4  17  VAL n 
4  18  ASP n 
4  19  ARG n 
4  20  ARG n 
4  21  ASP n 
4  22  TYR n 
4  23  PRO n 
4  24  LEU n 
4  25  PRO n 
4  26  ASP n 
4  27  VAL n 
4  28  ALA n 
4  29  HIS n 
4  30  VAL n 
4  31  LYS n 
4  32  ASN n 
4  33  LEU n 
4  34  SER n 
4  35  ALA n 
4  36  SER n 
4  37  GLN n 
4  38  LYS n 
4  39  ALA n 
4  40  LEU n 
4  41  LYS n 
4  42  GLU n 
4  43  LYS n 
4  44  GLU n 
4  45  LYS n 
4  46  ALA n 
4  47  SER n 
4  48  TRP n 
4  49  SER n 
4  50  SER n 
4  51  LEU n 
4  52  SER n 
4  53  ILE n 
4  54  ASP n 
4  55  GLU n 
4  56  LYS n 
4  57  VAL n 
4  58  GLU n 
4  59  LEU n 
4  60  TYR n 
4  61  ARG n 
4  62  LEU n 
4  63  LYS n 
4  64  PHE n 
4  65  LYS n 
4  66  GLU n 
4  67  SER n 
4  68  PHE n 
4  69  ALA n 
4  70  GLU n 
4  71  MET n 
4  72  ASN n 
4  73  ARG n 
4  74  SER n 
4  75  THR n 
4  76  ASN n 
4  77  GLU n 
4  78  TRP n 
4  79  LYS n 
4  80  THR n 
4  81  VAL n 
4  82  VAL n 
4  83  GLY n 
4  84  ALA n 
4  85  ALA n 
4  86  MET n 
4  87  PHE n 
4  88  PHE n 
4  89  ILE n 
4  90  GLY n 
4  91  PHE n 
4  92  THR n 
4  93  ALA n 
4  94  LEU n 
4  95  LEU n 
4  96  LEU n 
4  97  ILE n 
4  98  TRP n 
4  99  GLU n 
4  100 LYS n 
4  101 HIS n 
4  102 TYR n 
4  103 VAL n 
4  104 TYR n 
4  105 GLY n 
4  106 PRO n 
4  107 ILE n 
4  108 PRO n 
4  109 HIS n 
4  110 THR n 
4  111 PHE n 
4  112 GLU n 
4  113 GLU n 
4  114 GLU n 
4  115 TRP n 
4  116 VAL n 
4  117 ALA n 
4  118 LYS n 
4  119 GLN n 
4  120 THR n 
4  121 LYS n 
4  122 ARG n 
4  123 MET n 
4  124 LEU n 
4  125 ASP n 
4  126 MET n 
4  127 LYS n 
4  128 VAL n 
4  129 ALA n 
4  130 PRO n 
4  131 ILE n 
4  132 GLN n 
4  133 GLY n 
4  134 PHE n 
4  135 SER n 
4  136 ALA n 
4  137 LYS n 
4  138 TRP n 
4  139 ASP n 
4  140 TYR n 
4  141 ASP n 
4  142 LYS n 
4  143 ASN n 
4  144 GLU n 
4  145 TRP n 
4  146 LYS n 
4  147 LYS n 
5  1   SER n 
5  2   HIS n 
5  3   GLY n 
5  4   SER n 
5  5   HIS n 
5  6   GLU n 
5  7   THR n 
5  8   ASP n 
5  9   GLU n 
5  10  GLU n 
5  11  PHE n 
5  12  ASP n 
5  13  ALA n 
5  14  ARG n 
5  15  TRP n 
5  16  VAL n 
5  17  THR n 
5  18  TYR n 
5  19  PHE n 
5  20  ASN n 
5  21  LYS n 
5  22  PRO n 
5  23  ASP n 
5  24  ILE n 
5  25  ASP n 
5  26  ALA n 
5  27  TRP n 
5  28  GLU n 
5  29  LEU n 
5  30  ARG n 
5  31  LYS n 
5  32  GLY n 
5  33  MET n 
5  34  ASN n 
5  35  THR n 
5  36  LEU n 
5  37  VAL n 
5  38  GLY n 
5  39  TYR n 
5  40  ASP n 
5  41  LEU n 
5  42  VAL n 
5  43  PRO n 
5  44  GLU n 
5  45  PRO n 
5  46  LYS n 
5  47  ILE n 
5  48  ILE n 
5  49  ASP n 
5  50  ALA n 
5  51  ALA n 
5  52  LEU n 
5  53  ARG n 
5  54  ALA n 
5  55  CYS n 
5  56  ARG n 
5  57  ARG n 
5  58  LEU n 
5  59  ASN n 
5  60  ASP n 
5  61  PHE n 
5  62  ALA n 
5  63  SER n 
5  64  ALA n 
5  65  VAL n 
5  66  ARG n 
5  67  ILE n 
5  68  LEU n 
5  69  GLU n 
5  70  VAL n 
5  71  VAL n 
5  72  LYS n 
5  73  ASP n 
5  74  LYS n 
5  75  ALA n 
5  76  GLY n 
5  77  PRO n 
5  78  HIS n 
5  79  LYS n 
5  80  GLU n 
5  81  ILE n 
5  82  TYR n 
5  83  PRO n 
5  84  TYR n 
5  85  VAL n 
5  86  ILE n 
5  87  GLN n 
5  88  GLU n 
5  89  LEU n 
5  90  ARG n 
5  91  PRO n 
5  92  THR n 
5  93  LEU n 
5  94  ASN n 
5  95  GLU n 
5  96  LEU n 
5  97  GLY n 
5  98  ILE n 
5  99  SER n 
5  100 THR n 
5  101 PRO n 
5  102 GLU n 
5  103 GLU n 
5  104 LEU n 
5  105 GLY n 
5  106 LEU n 
5  107 ASP n 
5  108 LYS n 
5  109 VAL n 
6  1   ALA n 
6  2   SER n 
6  3   GLY n 
6  4   GLY n 
6  5   GLY n 
6  6   VAL n 
6  7   PRO n 
6  8   THR n 
6  9   ASP n 
6  10  GLU n 
6  11  GLU n 
6  12  GLN n 
6  13  ALA n 
6  14  THR n 
6  15  GLY n 
6  16  LEU n 
6  17  GLU n 
6  18  ARG n 
6  19  GLU n 
6  20  VAL n 
6  21  MET n 
6  22  LEU n 
6  23  ALA n 
6  24  ALA n 
6  25  ARG n 
6  26  LYS n 
6  27  GLY n 
6  28  GLN n 
6  29  ASP n 
6  30  PRO n 
6  31  TYR n 
6  32  ASN n 
6  33  ILE n 
6  34  LEU n 
6  35  ALA n 
6  36  PRO n 
6  37  LYS n 
6  38  ALA n 
6  39  THR n 
6  40  SER n 
6  41  GLY n 
6  42  THR n 
6  43  LYS n 
6  44  GLU n 
6  45  ASP n 
6  46  PRO n 
6  47  ASN n 
6  48  LEU n 
6  49  VAL n 
6  50  PRO n 
6  51  SER n 
6  52  ILE n 
6  53  THR n 
6  54  ASN n 
6  55  LYS n 
6  56  ARG n 
6  57  ILE n 
6  58  VAL n 
6  59  GLY n 
6  60  CYS n 
6  61  ILE n 
6  62  CYS n 
6  63  GLU n 
6  64  GLU n 
6  65  ASP n 
6  66  ASN n 
6  67  SER n 
6  68  THR n 
6  69  VAL n 
6  70  ILE n 
6  71  TRP n 
6  72  PHE n 
6  73  TRP n 
6  74  LEU n 
6  75  HIS n 
6  76  LYS n 
6  77  GLY n 
6  78  GLU n 
6  79  ALA n 
6  80  GLN n 
6  81  ARG n 
6  82  CYS n 
6  83  PRO n 
6  84  SER n 
6  85  CYS n 
6  86  GLY n 
6  87  THR n 
6  88  HIS n 
6  89  TYR n 
6  90  LYS n 
6  91  LEU n 
6  92  VAL n 
6  93  PRO n 
6  94  HIS n 
6  95  GLN n 
6  96  LEU n 
6  97  ALA n 
6  98  HIS n 
7  1   ALA n 
7  2   SER n 
7  3   ALA n 
7  4   ALA n 
7  5   LYS n 
7  6   GLY n 
7  7   ASP n 
7  8   HIS n 
7  9   GLY n 
7  10  GLY n 
7  11  TPO n 
7  12  GLY n 
7  13  ALA n 
7  14  ARG n 
7  15  THR n 
7  16  TRP n 
7  17  ARG n 
7  18  PHE n 
7  19  LEU n 
7  20  THR n 
7  21  PHE n 
7  22  GLY n 
7  23  LEU n 
7  24  ALA n 
7  25  LEU n 
7  26  PRO n 
7  27  SER n 
7  28  VAL n 
7  29  ALA n 
7  30  LEU n 
7  31  CYS n 
7  32  THR n 
7  33  LEU n 
7  34  ASN n 
7  35  SER n 
7  36  TRP n 
7  37  LEU n 
7  38  HIS n 
7  39  SER n 
7  40  GLY n 
7  41  HIS n 
7  42  ARG n 
7  43  GLU n 
7  44  ARG n 
7  45  PRO n 
7  46  ALA n 
7  47  PHE n 
7  48  ILE n 
7  49  PRO n 
7  50  TYR n 
7  51  HIS n 
7  52  HIS n 
7  53  LEU n 
7  54  ARG n 
7  55  ILE n 
7  56  ARG n 
7  57  THR n 
7  58  LYS n 
7  59  PRO n 
7  60  PHE n 
7  61  SER n 
7  62  TRP n 
7  63  GLY n 
7  64  ASP n 
7  65  GLY n 
7  66  ASN n 
7  67  HIS n 
7  68  THR n 
7  69  PHE n 
7  70  PHE n 
7  71  HIS n 
7  72  ASN n 
7  73  PRO n 
7  74  ARG n 
7  75  VAL n 
7  76  ASN n 
7  77  PRO n 
7  78  LEU n 
7  79  PRO n 
7  80  THR n 
7  81  GLY n 
7  82  TYR n 
7  83  GLU n 
7  84  LYS n 
7  85  PRO n 
8  1   ALA n 
8  2   GLU n 
8  3   ASP n 
8  4   ILE n 
8  5   GLN n 
8  6   ALA n 
8  7   LYS n 
8  8   ILE n 
8  9   LYS n 
8  10  ASN n 
8  11  TYR n 
8  12  GLN n 
8  13  THR n 
8  14  ALA n 
8  15  PRO n 
8  16  PHE n 
8  17  ASP n 
8  18  SER n 
8  19  ARG n 
8  20  PHE n 
8  21  PRO n 
8  22  ASN n 
8  23  GLN n 
8  24  ASN n 
8  25  GLN n 
8  26  THR n 
8  27  ARG n 
8  28  ASN n 
8  29  CYS n 
8  30  TRP n 
8  31  GLN n 
8  32  ASN n 
8  33  TYR n 
8  34  LEU n 
8  35  ASP n 
8  36  PHE n 
8  37  HIS n 
8  38  ARG n 
8  39  CYS n 
8  40  GLU n 
8  41  LYS n 
8  42  ALA n 
8  43  MET n 
8  44  THR n 
8  45  ALA n 
8  46  LYS n 
8  47  GLY n 
8  48  GLY n 
8  49  ASP n 
8  50  VAL n 
8  51  SER n 
8  52  VAL n 
8  53  CYS n 
8  54  GLU n 
8  55  TRP n 
8  56  TYR n 
8  57  ARG n 
8  58  ARG n 
8  59  VAL n 
8  60  TYR n 
8  61  LYS n 
8  62  SER n 
8  63  LEU n 
8  64  CYS n 
8  65  PRO n 
8  66  ILE n 
8  67  SER n 
8  68  TRP n 
8  69  VAL n 
8  70  SER n 
8  71  THR n 
8  72  TRP n 
8  73  ASP n 
8  74  ASP n 
8  75  ARG n 
8  76  ARG n 
8  77  ALA n 
8  78  GLU n 
8  79  GLY n 
8  80  THR n 
8  81  PHE n 
8  82  PRO n 
8  83  GLY n 
8  84  LYS n 
8  85  ILE n 
9  1   SAC n 
9  2   THR n 
9  3   ALA n 
9  4   LEU n 
9  5   ALA n 
9  6   LYS n 
9  7   PRO n 
9  8   GLN n 
9  9   MET n 
9  10  ARG n 
9  11  GLY n 
9  12  LEU n 
9  13  LEU n 
9  14  ALA n 
9  15  ARG n 
9  16  ARG n 
9  17  LEU n 
9  18  ARG n 
9  19  PHE n 
9  20  HIS n 
9  21  ILE n 
9  22  VAL n 
9  23  GLY n 
9  24  ALA n 
9  25  PHE n 
9  26  MET n 
9  27  VAL n 
9  28  SER n 
9  29  LEU n 
9  30  GLY n 
9  31  PHE n 
9  32  ALA n 
9  33  THR n 
9  34  PHE n 
9  35  TYR n 
9  36  LYS n 
9  37  PHE n 
9  38  ALA n 
9  39  VAL n 
9  40  ALA n 
9  41  GLU n 
9  42  LYS n 
9  43  ARG n 
9  44  LYS n 
9  45  LYS n 
9  46  ALA n 
9  47  TYR n 
9  48  ALA n 
9  49  ASP n 
9  50  PHE n 
9  51  TYR n 
9  52  ARG n 
9  53  ASN n 
9  54  TYR n 
9  55  ASP n 
9  56  SER n 
9  57  MET n 
9  58  LYS n 
9  59  ASP n 
9  60  PHE n 
9  61  GLU n 
9  62  GLU n 
9  63  MET n 
9  64  ARG n 
9  65  LYS n 
9  66  ALA n 
9  67  GLY n 
9  68  ILE n 
9  69  PHE n 
9  70  GLN n 
9  71  SER n 
9  72  ALA n 
9  73  LYS n 
10 1   PHE n 
10 2   GLU n 
10 3   ASN n 
10 4   ARG n 
10 5   VAL n 
10 6   ALA n 
10 7   GLU n 
10 8   LYS n 
10 9   GLN n 
10 10  LYS n 
10 11  LEU n 
10 12  PHE n 
10 13  GLN n 
10 14  GLU n 
10 15  ASP n 
10 16  ASN n 
10 17  GLY n 
10 18  LEU n 
10 19  PRO n 
10 20  VAL n 
10 21  HIS n 
10 22  LEU n 
10 23  LYS n 
10 24  GLY n 
10 25  GLY n 
10 26  ALA n 
10 27  THR n 
10 28  ASP n 
10 29  ASN n 
10 30  ILE n 
10 31  LEU n 
10 32  TYR n 
10 33  ARG n 
10 34  VAL n 
10 35  THR n 
10 36  MET n 
10 37  THR n 
10 38  LEU n 
10 39  CYS n 
10 40  LEU n 
10 41  GLY n 
10 42  GLY n 
10 43  THR n 
10 44  LEU n 
10 45  TYR n 
10 46  SER n 
10 47  LEU n 
10 48  TYR n 
10 49  CYS n 
10 50  LEU n 
10 51  GLY n 
10 52  TRP n 
10 53  ALA n 
10 54  SER n 
10 55  PHE n 
10 56  PRO n 
10 57  HIS n 
10 58  LYS n 
10 59  LYS n 
11 1   ILE n 
11 2   HIS n 
11 3   GLN n 
11 4   LYS n 
11 5   ARG n 
11 6   ALA n 
11 7   PRO n 
11 8   ASP n 
11 9   PHE n 
11 10  HIS n 
11 11  ASP n 
11 12  LYS n 
11 13  TYR n 
11 14  GLY n 
11 15  ASN n 
11 16  ALA n 
11 17  VAL n 
11 18  LEU n 
11 19  ALA n 
11 20  SER n 
11 21  GLY n 
11 22  ALA n 
11 23  THR n 
11 24  PHE n 
11 25  CYS n 
11 26  VAL n 
11 27  ALA n 
11 28  VAL n 
11 29  TRP n 
11 30  VAL n 
11 31  TYR n 
11 32  MET n 
11 33  ALA n 
11 34  THR n 
11 35  GLN n 
11 36  ILE n 
11 37  GLY n 
11 38  ILE n 
11 39  GLU n 
11 40  TRP n 
11 41  ASN n 
11 42  PRO n 
11 43  SER n 
11 44  PRO n 
11 45  VAL n 
11 46  GLY n 
11 47  ARG n 
11 48  VAL n 
11 49  THR n 
11 50  PRO n 
11 51  LYS n 
11 52  GLU n 
11 53  TRP n 
11 54  ARG n 
11 55  GLU n 
11 56  GLN n 
12 1   SER n 
12 2   HIS n 
12 3   TYR n 
12 4   GLU n 
12 5   GLU n 
12 6   GLY n 
12 7   PRO n 
12 8   GLY n 
12 9   LYS n 
12 10  ASN n 
12 11  ILE n 
12 12  PRO n 
12 13  PHE n 
12 14  SER n 
12 15  VAL n 
12 16  GLU n 
12 17  ASN n 
12 18  LYS n 
12 19  TRP n 
12 20  ARG n 
12 21  LEU n 
12 22  LEU n 
12 23  ALA n 
12 24  MET n 
12 25  MET n 
12 26  THR n 
12 27  LEU n 
12 28  PHE n 
12 29  PHE n 
12 30  GLY n 
12 31  SER n 
12 32  GLY n 
12 33  PHE n 
12 34  ALA n 
12 35  ALA n 
12 36  PRO n 
12 37  PHE n 
12 38  PHE n 
12 39  ILE n 
12 40  VAL n 
12 41  ARG n 
12 42  HIS n 
12 43  GLN n 
12 44  LEU n 
12 45  LEU n 
12 46  LYS n 
12 47  LYS n 
13 1   ILE n 
13 2   THR n 
13 3   ALA n 
13 4   LYS n 
13 5   PRO n 
13 6   ALA n 
13 7   LYS n 
13 8   THR n 
13 9   PRO n 
13 10  THR n 
13 11  SER n 
13 12  PRO n 
13 13  LYS n 
13 14  GLU n 
13 15  GLN n 
13 16  ALA n 
13 17  ILE n 
13 18  GLY n 
13 19  LEU n 
13 20  SER n 
13 21  VAL n 
13 22  THR n 
13 23  PHE n 
13 24  LEU n 
13 25  SER n 
13 26  PHE n 
13 27  LEU n 
13 28  LEU n 
13 29  PRO n 
13 30  ALA n 
13 31  GLY n 
13 32  TRP n 
13 33  VAL n 
13 34  LEU n 
13 35  TYR n 
13 36  HIS n 
13 37  LEU n 
13 38  ASP n 
13 39  ASN n 
13 40  TYR n 
13 41  LYS n 
13 42  LYS n 
13 43  SER n 
13 44  SER n 
13 45  ALA n 
13 46  ALA n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 514 Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 1 227 Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 1 261 Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 1 147 Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1 109 Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1 98  Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1 85  Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1 85  Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 1 73  Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1 59  Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1 56  Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1 47  Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 1 46  Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP COX1_BOVIN  P00396 ? 1  
;MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGN
WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILG
AINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV
FSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLF
SGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKR
EVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
;
1  
2  UNP COX2_BOVIN  P68530 ? 2  
;MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPS
LRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVL
HSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
;
1  
3  UNP COX3_BOVIN  P00415 ? 3  
;MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLR
YGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHML
QALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS
;
1  
4  UNP COX41_BOVIN P00423 ? 4  
;AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKT
VVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK
;
23 
5  UNP COX5A_BOVIN P00426 ? 5  
;SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKE
IYPYVIQELRPTLNELGISTPEELGLDKV
;
44 
6  UNP COX5B_BOVIN P00428 ? 6  
;ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQ
RCPSCGTHYKLVPHQLAH
;
32 
7  UNP CX6A2_BOVIN P07471 ? 7  
;ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPT
GYEKP
;
13 
8  UNP CX6B1_BOVIN P00429 ? 8  
;AEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGT
FPGKI
;
2  
9  UNP COX6C_BOVIN P04038 ? 9  STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK 2  
10 UNP CX7A1_BOVIN P07470 ? 10 FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHKK 22 
11 UNP COX7B_BOVIN P13183 ? 11 IHQKRAPDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWREQ 25 
12 UNP COX7C_BOVIN P00430 ? 12 SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK 17 
13 UNP COX8B_BOVIN P10175 ? 13 ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKSSAA 25 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  5W97 A 1 ? 514 ? P00396 1  ? 514 ? 1 514 
2  2  5W97 B 1 ? 227 ? P68530 1  ? 227 ? 1 227 
3  3  5W97 C 1 ? 261 ? P00415 1  ? 261 ? 1 261 
4  4  5W97 D 1 ? 147 ? P00423 23 ? 169 ? 1 147 
5  5  5W97 E 1 ? 109 ? P00426 44 ? 152 ? 1 109 
6  6  5W97 F 1 ? 98  ? P00428 32 ? 129 ? 1 98  
7  7  5W97 G 1 ? 85  ? P07471 13 ? 97  ? 1 85  
8  8  5W97 H 1 ? 85  ? P00429 2  ? 86  ? 1 85  
9  9  5W97 I 1 ? 73  ? P04038 2  ? 74  ? 1 73  
10 10 5W97 J 1 ? 59  ? P07470 22 ? 80  ? 1 59  
11 11 5W97 K 1 ? 56  ? P13183 25 ? 80  ? 1 56  
12 12 5W97 L 1 ? 47  ? P00430 17 ? 63  ? 1 47  
13 13 5W97 M 1 ? 46  ? P10175 25 ? 70  ? 1 46  
14 1  5W97 a 1 ? 514 ? P00396 1  ? 514 ? 1 514 
15 2  5W97 b 1 ? 227 ? P68530 1  ? 227 ? 1 227 
16 3  5W97 c 1 ? 261 ? P00415 1  ? 261 ? 1 261 
17 4  5W97 d 1 ? 147 ? P00423 23 ? 169 ? 1 147 
18 5  5W97 e 1 ? 109 ? P00426 44 ? 152 ? 1 109 
19 6  5W97 f 1 ? 98  ? P00428 32 ? 129 ? 1 98  
20 7  5W97 g 1 ? 85  ? P07471 13 ? 97  ? 1 85  
21 8  5W97 h 1 ? 85  ? P00429 2  ? 86  ? 1 85  
22 9  5W97 i 1 ? 73  ? P04038 2  ? 74  ? 1 73  
23 10 5W97 j 1 ? 59  ? P07470 22 ? 80  ? 1 59  
24 11 5W97 k 1 ? 56  ? P13183 25 ? 80  ? 1 56  
25 12 5W97 l 1 ? 47  ? P00430 17 ? 63  ? 1 47  
26 13 5W97 m 1 ? 46  ? P10175 25 ? 70  ? 1 46  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                                                                                       
'C3 H7 N O2'         89.093   
ARG 'L-peptide linking' y ARGININE ?                                                                                       
'C6 H15 N4 O2 1'     175.209  
ASN 'L-peptide linking' y ASPARAGINE ?                                                                                       
'C4 H8 N2 O3'        132.118  
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                                                                                       
'C4 H7 N O4'         133.103  
CDL non-polymer         . CARDIOLIPIN 
;DIPHOSPHATIDYL GLYCEROL; BIS-(1,2-DIACYL-SN-GLYCERO-3-PHOSPHO)-1',3'-SN-GLYCEROL
;
'C81 H156 O17 P2 -2' 1464.043 
CHD non-polymer         . 'CHOLIC ACID' ?                                                                                       
'C24 H40 O5'         408.571  
CMO non-polymer         . 'CARBON MONOXIDE' ? 'C O'                28.010   
CU  non-polymer         . 'COPPER (II) ION' ? 'Cu 2'               63.546   
CUA non-polymer         . 'DINUCLEAR COPPER ION' ? Cu2                  127.092  
CYS 'L-peptide linking' y CYSTEINE ?                                                                                       
'C3 H7 N O2 S'       121.158  
DMU D-saccharide        . DECYL-BETA-D-MALTOPYRANOSIDE DECYLMALTOSIDE 'C22 H42 O11'        482.562  
FME 'L-peptide linking' n N-FORMYLMETHIONINE ? 'C6 H11 N O3 S'      177.221  
GLN 'L-peptide linking' y GLUTAMINE ?                                                                                       
'C5 H10 N2 O3'       146.144  
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                                                                                       
'C5 H9 N O4'         147.129  
GLY 'peptide linking'   y GLYCINE ?                                                                                       
'C2 H5 N O2'         75.067   
HEA non-polymer         . HEME-A ?                                                                                       
'C49 H56 Fe N4 O6'   852.837  
HIS 'L-peptide linking' y HISTIDINE ?                                                                                       
'C6 H10 N3 O2 1'     156.162  
HOH non-polymer         . WATER ?                                                                                       'H2 O' 
18.015   
ILE 'L-peptide linking' y ISOLEUCINE ?                                                                                       
'C6 H13 N O2'        131.173  
LEU 'L-peptide linking' y LEUCINE ?                                                                                       
'C6 H13 N O2'        131.173  
LYS 'L-peptide linking' y LYSINE ?                                                                                       
'C6 H15 N2 O2 1'     147.195  
MET 'L-peptide linking' y METHIONINE ?                                                                                       
'C5 H11 N O2 S'      149.211  
MG  non-polymer         . 'MAGNESIUM ION' ?                                                                                       
'Mg 2'               24.305   
NA  non-polymer         . 'SODIUM ION' ?                                                                                       
'Na 1'               22.990   
PEK non-polymer         . 
'(1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE' 
'PHOSPHATIDYLETHANOLAMINE, 2-ARACHIDONOYL-1-STEAROYL-SN-GLYCEROL-3-PHOSPHOETHANOLAMINE' 'C43 H78 N O8 P'     768.055  
PGV non-polymer         . 
'(1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE' 
'PHOSPHATIDYLGLYCEROL, 2-VACCENOYL-1-PALMITOYL-SN-GLYCEROL-3-PHOSPHOGLYCEROL'           'C40 H77 O10 P'      749.007  
PHE 'L-peptide linking' y PHENYLALANINE ?                                                                                       
'C9 H11 N O2'        165.189  
PRO 'L-peptide linking' y PROLINE ?                                                                                       
'C5 H9 N O2'         115.130  
PSC non-polymer         . 
'(7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE' 
'PHOSPHATIDYLCHOLINE, 2-LINOLEOYL-1-PALMITOYL-SN-GYCEROL-3-PHOSPHOCHOLINE'              'C42 H81 N O8 P 1'   759.068  
SAC 'L-peptide linking' n N-ACETYL-SERINE ?                                                                                       
'C5 H9 N O4'         147.129  
SER 'L-peptide linking' y SERINE ?                                                                                       
'C3 H7 N O3'         105.093  
TGL non-polymer         . TRISTEAROYLGLYCEROL TRIACYLGLYCEROL 'C57 H110 O6'        891.480  
THR 'L-peptide linking' y THREONINE ?                                                                                       
'C4 H9 N O3'         119.119  
TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE                                                                      
'C4 H10 N O6 P'      199.099  
TRP 'L-peptide linking' y TRYPTOPHAN ?                                                                                       
'C11 H12 N2 O2'      204.225  
TYR 'L-peptide linking' y TYROSINE ?                                                                                       
'C9 H11 N O3'        181.189  
VAL 'L-peptide linking' y VALINE ?                                                                                       
'C5 H11 N O2'        117.146  
ZN  non-polymer         . 'ZINC ION' ?                                                                                       
'Zn 2'               65.409   
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5W97 
_exptl.crystals_number            26264 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.36 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         71.76 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'BATCH MODE' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 4000, Potassium Phosphate, decylmaltoside' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'CS-PAD CXI-1' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-06-16 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.3 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'FREE ELECTRON LASER' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLAC LCLS BEAMLINE CXI' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.3 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   CXI 
_diffrn_source.pdbx_synchrotron_site       'SLAC LCLS' 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5W97 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.3 
_reflns.d_resolution_low                 30.00 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       311037 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  211 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            2.29 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.907 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.3 
_reflns_shell.d_res_low                   2.38 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.57 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           30856 
_reflns_shell.percent_possible_all        99.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             36 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.156 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.entry_id                                 5W97 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            2.3000 
_refine.ls_d_res_low                             29.8600 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.9400 
_refine.ls_number_reflns_obs                     308128 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2088 
_refine.ls_R_factor_R_work                       0.2084 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2516 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 1.0000 
_refine.ls_number_reflns_R_free                  2994 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               50.7840 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.0500 
_refine.aniso_B[2][2]                            0.0900 
_refine.aniso_B[3][3]                            -0.0400 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9490 
_refine.correlation_coeff_Fo_to_Fc_free          0.9200 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.2030 
_refine.pdbx_overall_ESU_R_Free                  0.1870 
_refine.overall_SU_ML                            0.2320 
_refine.overall_SU_B                             10.8260 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      3AG2 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                244.750 
_refine.B_iso_min                                8.810 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.3000 
_refine_hist.d_res_low                        29.8600 
_refine_hist.pdbx_number_atoms_ligand         2228 
_refine_hist.number_atoms_solvent             1291 
_refine_hist.number_atoms_total               32025 
_refine_hist.pdbx_number_residues_total       3558 
_refine_hist.pdbx_B_iso_mean_ligand           86.06 
_refine_hist.pdbx_B_iso_mean_solvent          48.44 
_refine_hist.pdbx_number_atoms_protein        28506 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' r_bond_refined_d       31710 0.013  0.019  ? ? 
'X-RAY DIFFRACTION' r_bond_other_d         30162 0.002  0.020  ? ? 
'X-RAY DIFFRACTION' r_angle_refined_deg    42766 1.837  2.010  ? ? 
'X-RAY DIFFRACTION' r_angle_other_deg      70140 1.015  3.000  ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 3532  6.960  5.000  ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 1230  35.877 22.976 ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 4686  16.312 15.000 ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 124   17.722 15.000 ? ? 
'X-RAY DIFFRACTION' r_chiral_restr         4532  0.118  0.200  ? ? 
'X-RAY DIFFRACTION' r_gen_planes_refined   33000 0.008  0.021  ? ? 
'X-RAY DIFFRACTION' r_gen_planes_other     6672  0.004  0.020  ? ? 
# 
_refine_ls_shell.d_res_high                       2.3000 
_refine_ls_shell.d_res_low                        2.3590 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.9800 
_refine_ls_shell.number_reflns_R_work             22468 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.4010 
_refine_ls_shell.R_factor_R_free                  0.4060 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             232 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.number_reflns_all                22700 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_obs                     ? 
# 
_struct.entry_id                     5W97 
_struct.title                        
'Crystal Structure of CO-bound Cytochrome c Oxidase determined by Serial Femtosecond X-Ray Crystallography at Room Temperature' 
_struct.pdbx_descriptor              
;Cytochrome c oxidase subunit 1 (E.C.1.9.3.1), Cytochrome c oxidase subunit 2, Cytochrome c oxidase subunit 3, Cytochrome c oxidase subunit 4 isoform 1, mitochondrial, Cytochrome c oxidase subunit 5A, mitochondrial, Cytochrome c oxidase subunit 5B, mitochondrial, Cytochrome c oxidase subunit 6A2, mitochondrial, Cytochrome c oxidase subunit 6B1, Cytochrome c oxidase subunit 6C, Cytochrome c oxidase subunit 7A1, mitochondrial, Cytochrome c oxidase subunit 7B, mitochondrial, Cytochrome c oxidase subunit 7C, mitochondrial, Cytochrome c oxidase subunit 8B, mitochondrial
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5W97 
_struct_keywords.text            'Bioenergetics, Proton translocation, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 1  ? 
O  N N 2  ? 
P  N N 3  ? 
Q  N N 4  ? 
R  N N 5  ? 
S  N N 6  ? 
T  N N 7  ? 
U  N N 8  ? 
V  N N 9  ? 
W  N N 10 ? 
X  N N 11 ? 
Y  N N 12 ? 
Z  N N 13 ? 
AA N N 14 ? 
BA N N 14 ? 
CA N N 15 ? 
DA N N 16 ? 
EA N N 17 ? 
FA N N 18 ? 
GA N N 18 ? 
HA N N 19 ? 
IA N N 20 ? 
JA N N 21 ? 
KA N N 22 ? 
LA N N 23 ? 
MA N N 23 ? 
NA N N 24 ? 
OA N N 18 ? 
PA N N 18 ? 
QA N N 25 ? 
RA N N 23 ? 
SA N N 26 ? 
TA N N 24 ? 
UA N N 24 ? 
VA N N 19 ? 
WA N N 27 ? 
XA N N 25 ? 
YA N N 24 ? 
ZA N N 18 ? 
AB N N 23 ? 
BB N N 19 ? 
CB N N 26 ? 
DB N N 14 ? 
EB N N 14 ? 
FB N N 15 ? 
GB N N 16 ? 
HB N N 17 ? 
IB N N 19 ? 
JB N N 18 ? 
KB N N 20 ? 
LB N N 23 ? 
MB N N 21 ? 
NB N N 18 ? 
OB N N 23 ? 
PB N N 24 ? 
QB N N 18 ? 
RB N N 25 ? 
SB N N 23 ? 
TB N N 26 ? 
UB N N 22 ? 
VB N N 27 ? 
WB N N 24 ? 
XB N N 25 ? 
YB N N 19 ? 
ZB N N 23 ? 
AC N N 19 ? 
BC N N 26 ? 
CC N N 28 ? 
DC N N 28 ? 
EC N N 28 ? 
FC N N 28 ? 
GC N N 28 ? 
HC N N 28 ? 
IC N N 28 ? 
JC N N 28 ? 
KC N N 28 ? 
LC N N 28 ? 
MC N N 28 ? 
NC N N 28 ? 
OC N N 28 ? 
PC N N 28 ? 
QC N N 28 ? 
RC N N 28 ? 
SC N N 28 ? 
TC N N 28 ? 
UC N N 28 ? 
VC N N 28 ? 
WC N N 28 ? 
XC N N 28 ? 
YC N N 28 ? 
ZC N N 28 ? 
AD N N 28 ? 
BD N N 28 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 FME A 1   ? LEU A 7   ? FME A 1   LEU A 7   1 ? 7  
HELX_P HELX_P2   AA2 ASN A 11  ? GLY A 42  ? ASN A 11  GLY A 42  1 ? 32 
HELX_P HELX_P3   AA3 ASP A 50  ? PHE A 68  ? ASP A 50  PHE A 68  1 ? 19 
HELX_P HELX_P4   AA4 MET A 69  ? ILE A 75  ? MET A 69  ILE A 75  1 ? 7  
HELX_P HELX_P5   AA5 GLY A 76  ? GLY A 88  ? GLY A 76  GLY A 88  1 ? 13 
HELX_P HELX_P6   AA6 PHE A 94  ? LEU A 104 ? PHE A 94  LEU A 104 1 ? 11 
HELX_P HELX_P7   AA7 LEU A 104 ? VAL A 118 ? LEU A 104 VAL A 118 1 ? 15 
HELX_P HELX_P8   AA8 ALA A 141 ? MET A 171 ? ALA A 141 MET A 171 1 ? 31 
HELX_P HELX_P9   AA9 SER A 177 ? THR A 181 ? SER A 177 THR A 181 5 ? 5  
HELX_P HELX_P10  AB1 PRO A 182 ? LEU A 215 ? PRO A 182 LEU A 215 1 ? 34 
HELX_P HELX_P11  AB2 ASP A 221 ? GLY A 225 ? ASP A 221 GLY A 225 5 ? 5  
HELX_P HELX_P12  AB3 ASP A 227 ? SER A 262 ? ASP A 227 SER A 262 1 ? 36 
HELX_P HELX_P13  AB4 GLY A 269 ? GLY A 284 ? GLY A 269 GLY A 284 1 ? 16 
HELX_P HELX_P14  AB5 PHE A 285 ? ILE A 286 ? PHE A 285 ILE A 286 5 ? 2  
HELX_P HELX_P15  AB6 VAL A 287 ? MET A 292 ? VAL A 287 MET A 292 5 ? 6  
HELX_P HELX_P16  AB7 ASP A 298 ? ILE A 312 ? ASP A 298 ILE A 312 1 ? 15 
HELX_P HELX_P17  AB8 ILE A 312 ? HIS A 328 ? ILE A 312 HIS A 328 1 ? 17 
HELX_P HELX_P18  AB9 SER A 335 ? ALA A 359 ? SER A 335 ALA A 359 1 ? 25 
HELX_P HELX_P19  AC1 ASN A 360 ? HIS A 368 ? ASN A 360 HIS A 368 1 ? 9  
HELX_P HELX_P20  AC2 THR A 370 ? MET A 383 ? THR A 370 MET A 383 1 ? 14 
HELX_P HELX_P21  AC3 GLY A 384 ? GLY A 402 ? GLY A 384 GLY A 402 1 ? 19 
HELX_P HELX_P22  AC4 ASN A 406 ? PHE A 426 ? ASN A 406 PHE A 426 1 ? 21 
HELX_P HELX_P23  AC5 PRO A 427 ? SER A 434 ? PRO A 427 SER A 434 1 ? 8  
HELX_P HELX_P24  AC6 PRO A 444 ? ALA A 446 ? PRO A 444 ALA A 446 5 ? 3  
HELX_P HELX_P25  AC7 TYR A 447 ? LYS A 479 ? TYR A 447 LYS A 479 1 ? 33 
HELX_P HELX_P26  AC8 LEU A 487 ? LEU A 495 ? LEU A 487 LEU A 495 5 ? 9  
HELX_P HELX_P27  AC9 SER B 14  ? LEU B 46  ? SER B 14  LEU B 46  1 ? 33 
HELX_P HELX_P28  AD1 GLU B 60  ? MET B 87  ? GLU B 60  MET B 87  1 ? 28 
HELX_P HELX_P29  AD2 PRO B 166 ? GLY B 169 ? PRO B 166 GLY B 169 5 ? 4  
HELX_P HELX_P30  AD3 ASN B 203 ? MET B 207 ? ASN B 203 MET B 207 5 ? 5  
HELX_P HELX_P31  AD4 PRO B 215 ? MET B 226 ? PRO B 215 MET B 226 1 ? 12 
HELX_P HELX_P32  AD5 PRO C 15  ? PHE C 37  ? PRO C 15  PHE C 37  1 ? 23 
HELX_P HELX_P33  AD6 MET C 40  ? THR C 66  ? MET C 40  THR C 66  1 ? 27 
HELX_P HELX_P34  AD7 THR C 72  ? LEU C 106 ? THR C 72  LEU C 106 1 ? 35 
HELX_P HELX_P35  AD8 THR C 109 ? GLY C 113 ? THR C 109 GLY C 113 5 ? 5  
HELX_P HELX_P36  AD9 GLU C 128 ? GLU C 153 ? GLU C 128 GLU C 153 1 ? 26 
HELX_P HELX_P37  AE1 ASP C 155 ? ALA C 184 ? ASP C 155 ALA C 184 1 ? 30 
HELX_P HELX_P38  AE2 ASP C 190 ? LYS C 224 ? ASP C 190 LYS C 224 1 ? 35 
HELX_P HELX_P39  AE3 HIS C 232 ? ILE C 256 ? HIS C 232 ILE C 256 1 ? 25 
HELX_P HELX_P40  AE4 LYS D 7   ? TYR D 11  ? LYS D 7   TYR D 11  5 ? 5  
HELX_P HELX_P41  AE5 SER D 34  ? GLU D 44  ? SER D 34  GLU D 44  1 ? 11 
HELX_P HELX_P42  AE6 SER D 47  ? LEU D 51  ? SER D 47  LEU D 51  5 ? 5  
HELX_P HELX_P43  AE7 SER D 52  ? PHE D 64  ? SER D 52  PHE D 64  1 ? 13 
HELX_P HELX_P44  AE8 SER D 67  ? ASN D 72  ? SER D 67  ASN D 72  1 ? 6  
HELX_P HELX_P45  AE9 ASN D 76  ? VAL D 103 ? ASN D 76  VAL D 103 1 ? 28 
HELX_P HELX_P46  AF1 PRO D 108 ? PHE D 111 ? PRO D 108 PHE D 111 5 ? 4  
HELX_P HELX_P47  AF2 GLU D 112 ? MET D 126 ? GLU D 112 MET D 126 1 ? 15 
HELX_P HELX_P48  AF3 PHE D 134 ? ALA D 136 ? PHE D 134 ALA D 136 5 ? 3  
HELX_P HELX_P49  AF4 THR E 7   ? LYS E 21  ? THR E 7   LYS E 21  1 ? 15 
HELX_P HELX_P50  AF5 ASP E 25  ? VAL E 37  ? ASP E 25  VAL E 37  1 ? 13 
HELX_P HELX_P51  AF6 GLU E 44  ? LEU E 58  ? GLU E 44  LEU E 58  1 ? 15 
HELX_P HELX_P52  AF7 ASP E 60  ? GLY E 76  ? ASP E 60  GLY E 76  1 ? 17 
HELX_P HELX_P53  AF8 GLU E 80  ? GLY E 97  ? GLU E 80  GLY E 97  1 ? 18 
HELX_P HELX_P54  AF9 THR F 8   ? ALA F 13  ? THR F 8   ALA F 13  1 ? 6  
HELX_P HELX_P55  AG1 THR F 14  ? LYS F 26  ? THR F 14  LYS F 26  1 ? 13 
HELX_P HELX_P56  AG2 GLY G 12  ? LEU G 23  ? GLY G 12  LEU G 23  1 ? 12 
HELX_P HELX_P57  AG3 LEU G 23  ? HIS G 38  ? LEU G 23  HIS G 38  1 ? 16 
HELX_P HELX_P58  AG4 GLN H 25  ? GLY H 47  ? GLN H 25  GLY H 47  1 ? 23 
HELX_P HELX_P59  AG5 ASP H 49  ? VAL H 52  ? ASP H 49  VAL H 52  5 ? 4  
HELX_P HELX_P60  AG6 CYS H 53  ? CYS H 64  ? CYS H 53  CYS H 64  1 ? 12 
HELX_P HELX_P61  AG7 PRO H 65  ? GLY H 79  ? PRO H 65  GLY H 79  1 ? 15 
HELX_P HELX_P62  AG8 GLY I 11  ? VAL I 39  ? GLY I 11  VAL I 39  1 ? 29 
HELX_P HELX_P63  AG9 VAL I 39  ? ASN I 53  ? VAL I 39  ASN I 53  1 ? 15 
HELX_P HELX_P64  AH1 ASP I 55  ? GLY I 67  ? ASP I 55  GLY I 67  1 ? 13 
HELX_P HELX_P65  AH2 ARG J 4   ? GLN J 13  ? ARG J 4   GLN J 13  1 ? 10 
HELX_P HELX_P66  AH3 GLY J 25  ? SER J 54  ? GLY J 25  SER J 54  1 ? 30 
HELX_P HELX_P67  AH4 ASP K 8   ? ILE K 36  ? ASP K 8   ILE K 36  1 ? 29 
HELX_P HELX_P68  AH5 SER K 43  ? ARG K 47  ? SER K 43  ARG K 47  5 ? 5  
HELX_P HELX_P69  AH6 ASN L 17  ? LYS L 47  ? ASN L 17  LYS L 47  1 ? 31 
HELX_P HELX_P70  AH7 SER M 11  ? HIS M 36  ? SER M 11  HIS M 36  1 ? 26 
HELX_P HELX_P71  AH8 HIS M 36  ? LYS M 41  ? HIS M 36  LYS M 41  1 ? 6  
HELX_P HELX_P72  AH9 PHE N 2   ? LEU N 7   ? PHE a 2   LEU a 7   1 ? 6  
HELX_P HELX_P73  AI1 ASN N 11  ? GLY N 42  ? ASN a 11  GLY a 42  1 ? 32 
HELX_P HELX_P74  AI2 ASP N 50  ? MET N 69  ? ASP a 50  MET a 69  1 ? 20 
HELX_P HELX_P75  AI3 MET N 69  ? ILE N 75  ? MET a 69  ILE a 75  1 ? 7  
HELX_P HELX_P76  AI4 GLY N 76  ? GLY N 88  ? GLY a 76  GLY a 88  1 ? 13 
HELX_P HELX_P77  AI5 PHE N 94  ? LEU N 104 ? PHE a 94  LEU a 104 1 ? 11 
HELX_P HELX_P78  AI6 LEU N 104 ? VAL N 118 ? LEU a 104 VAL a 118 1 ? 15 
HELX_P HELX_P79  AI7 GLY N 140 ? MET N 171 ? GLY a 140 MET a 171 1 ? 32 
HELX_P HELX_P80  AI8 SER N 177 ? THR N 181 ? SER a 177 THR a 181 5 ? 5  
HELX_P HELX_P81  AI9 PRO N 182 ? LEU N 215 ? PRO a 182 LEU a 215 1 ? 34 
HELX_P HELX_P82  AJ1 ASP N 221 ? GLY N 225 ? ASP a 221 GLY a 225 5 ? 5  
HELX_P HELX_P83  AJ2 ASP N 227 ? TYR N 261 ? ASP a 227 TYR a 261 1 ? 35 
HELX_P HELX_P84  AJ3 GLY N 269 ? GLY N 284 ? GLY a 269 GLY a 284 1 ? 16 
HELX_P HELX_P85  AJ4 PHE N 285 ? ILE N 286 ? PHE a 285 ILE a 286 5 ? 2  
HELX_P HELX_P86  AJ5 VAL N 287 ? MET N 292 ? VAL a 287 MET a 292 5 ? 6  
HELX_P HELX_P87  AJ6 ASP N 298 ? ILE N 312 ? ASP a 298 ILE a 312 1 ? 15 
HELX_P HELX_P88  AJ7 ILE N 312 ? HIS N 328 ? ILE a 312 HIS a 328 1 ? 17 
HELX_P HELX_P89  AJ8 SER N 335 ? ASN N 360 ? SER a 335 ASN a 360 1 ? 26 
HELX_P HELX_P90  AJ9 ASN N 360 ? HIS N 368 ? ASN a 360 HIS a 368 1 ? 9  
HELX_P HELX_P91  AK1 THR N 370 ? MET N 383 ? THR a 370 MET a 383 1 ? 14 
HELX_P HELX_P92  AK2 GLY N 384 ? GLY N 402 ? GLY a 384 GLY a 402 1 ? 19 
HELX_P HELX_P93  AK3 ASN N 406 ? PHE N 426 ? ASN a 406 PHE a 426 1 ? 21 
HELX_P HELX_P94  AK4 PRO N 427 ? GLY N 435 ? PRO a 427 GLY a 435 1 ? 9  
HELX_P HELX_P95  AK5 PRO N 444 ? ALA N 446 ? PRO a 444 ALA a 446 5 ? 3  
HELX_P HELX_P96  AK6 TYR N 447 ? LYS N 479 ? TYR a 447 LYS a 479 1 ? 33 
HELX_P HELX_P97  AK7 LEU N 487 ? LEU N 495 ? LEU a 487 LEU a 495 5 ? 9  
HELX_P HELX_P98  AK8 SER O 14  ? THR O 47  ? SER b 14  THR b 47  1 ? 34 
HELX_P HELX_P99  AK9 ALA O 58  ? GLU O 89  ? ALA b 58  GLU b 89  1 ? 32 
HELX_P HELX_P100 AL1 PRO O 166 ? GLY O 169 ? PRO b 166 GLY b 169 5 ? 4  
HELX_P HELX_P101 AL2 ASN O 203 ? PHE O 206 ? ASN b 203 PHE b 206 5 ? 4  
HELX_P HELX_P102 AL3 PRO O 215 ? MET O 226 ? PRO b 215 MET b 226 1 ? 12 
HELX_P HELX_P103 AL4 PRO P 15  ? PHE P 37  ? PRO c 15  PHE c 37  1 ? 23 
HELX_P HELX_P104 AL5 MET P 40  ? THR P 66  ? MET c 40  THR c 66  1 ? 27 
HELX_P HELX_P105 AL6 THR P 72  ? ALA P 107 ? THR c 72  ALA c 107 1 ? 36 
HELX_P HELX_P106 AL7 THR P 109 ? GLY P 113 ? THR c 109 GLY c 113 5 ? 5  
HELX_P HELX_P107 AL8 GLU P 128 ? GLU P 153 ? GLU c 128 GLU c 153 1 ? 26 
HELX_P HELX_P108 AL9 ASP P 155 ? ALA P 184 ? ASP c 155 ALA c 184 1 ? 30 
HELX_P HELX_P109 AM1 ASP P 190 ? LYS P 224 ? ASP c 190 LYS c 224 1 ? 35 
HELX_P HELX_P110 AM2 HIS P 232 ? ILE P 256 ? HIS c 232 ILE c 256 1 ? 25 
HELX_P HELX_P111 AM3 SER Q 34  ? GLU Q 44  ? SER d 34  GLU d 44  1 ? 11 
HELX_P HELX_P112 AM4 LYS Q 45  ? ALA Q 46  ? LYS d 45  ALA d 46  5 ? 2  
HELX_P HELX_P113 AM5 SER Q 47  ? LEU Q 51  ? SER d 47  LEU d 51  5 ? 5  
HELX_P HELX_P114 AM6 SER Q 52  ? PHE Q 64  ? SER d 52  PHE d 64  1 ? 13 
HELX_P HELX_P115 AM7 SER Q 67  ? ASN Q 72  ? SER d 67  ASN d 72  1 ? 6  
HELX_P HELX_P116 AM8 ASN Q 76  ? VAL Q 103 ? ASN d 76  VAL d 103 1 ? 28 
HELX_P HELX_P117 AM9 GLU Q 112 ? MET Q 126 ? GLU d 112 MET d 126 1 ? 15 
HELX_P HELX_P118 AN1 PHE Q 134 ? ALA Q 136 ? PHE d 134 ALA d 136 5 ? 3  
HELX_P HELX_P119 AN2 THR R 7   ? LYS R 21  ? THR e 7   LYS e 21  1 ? 15 
HELX_P HELX_P120 AN3 ASP R 25  ? VAL R 37  ? ASP e 25  VAL e 37  1 ? 13 
HELX_P HELX_P121 AN4 GLU R 44  ? LEU R 58  ? GLU e 44  LEU e 58  1 ? 15 
HELX_P HELX_P122 AN5 ASP R 60  ? GLY R 76  ? ASP e 60  GLY e 76  1 ? 17 
HELX_P HELX_P123 AN6 GLU R 80  ? GLY R 97  ? GLU e 80  GLY e 97  1 ? 18 
HELX_P HELX_P124 AN7 THR S 8   ? ALA S 13  ? THR f 8   ALA f 13  1 ? 6  
HELX_P HELX_P125 AN8 THR S 14  ? LYS S 26  ? THR f 14  LYS f 26  1 ? 13 
HELX_P HELX_P126 AN9 GLY T 12  ? LEU T 23  ? GLY g 12  LEU g 23  1 ? 12 
HELX_P HELX_P127 AO1 LEU T 23  ? LEU T 37  ? LEU g 23  LEU g 37  1 ? 15 
HELX_P HELX_P128 AO2 GLN U 25  ? GLY U 47  ? GLN h 25  GLY h 47  1 ? 23 
HELX_P HELX_P129 AO3 ASP U 49  ? VAL U 52  ? ASP h 49  VAL h 52  5 ? 4  
HELX_P HELX_P130 AO4 CYS U 53  ? CYS U 64  ? CYS h 53  CYS h 64  1 ? 12 
HELX_P HELX_P131 AO5 PRO U 65  ? GLY U 79  ? PRO h 65  GLY h 79  1 ? 15 
HELX_P HELX_P132 AO6 GLY V 11  ? VAL V 39  ? GLY i 11  VAL i 39  1 ? 29 
HELX_P HELX_P133 AO7 VAL V 39  ? TYR V 51  ? VAL i 39  TYR i 51  1 ? 13 
HELX_P HELX_P134 AO8 ASP V 55  ? ALA V 66  ? ASP i 55  ALA i 66  1 ? 12 
HELX_P HELX_P135 AO9 ARG W 4   ? GLN W 13  ? ARG j 4   GLN j 13  1 ? 10 
HELX_P HELX_P136 AP1 PRO W 19  ? LYS W 23  ? PRO j 19  LYS j 23  5 ? 5  
HELX_P HELX_P137 AP2 GLY W 25  ? PHE W 55  ? GLY j 25  PHE j 55  1 ? 31 
HELX_P HELX_P138 AP3 ASP X 8   ? GLN X 35  ? ASP k 8   GLN k 35  1 ? 28 
HELX_P HELX_P139 AP4 ASN Y 17  ? LYS Y 47  ? ASN l 17  LYS l 47  1 ? 31 
HELX_P HELX_P140 AP5 SER Z 11  ? HIS Z 36  ? SER m 11  HIS m 36  1 ? 26 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ?    ? H  CYS 29  SG  ? ? ? 1_555 H  CYS 64  SG  ? ? H CYS 29  H CYS 64  1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf2  disulf ?    ? H  CYS 39  SG  ? ? ? 1_555 H  CYS 53  SG  ? ? H CYS 39  H CYS 53  1_555 ? ? ? ? ? ? ? 1.994 ? 
disulf3  disulf ?    ? U  CYS 29  SG  ? ? ? 1_555 U  CYS 64  SG  ? ? h CYS 29  h CYS 64  1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf4  disulf ?    ? U  CYS 39  SG  ? ? ? 1_555 U  CYS 53  SG  ? ? h CYS 39  h CYS 53  1_555 ? ? ? ? ? ? ? 2.030 ? 
covale1  covale both ? A  FME 1   C   ? ? ? 1_555 A  PHE 2   N   ? ? A FME 1   A PHE 2   1_555 ? ? ? ? ? ? ? 1.330 ? 
metalc1  metalc ?    ? A  GLU 40  O   ? ? ? 1_555 EA NA  .   NA  ? ? A GLU 40  A NA  605 1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc2  metalc ?    ? A  GLU 40  OE1 ? ? ? 1_555 EA NA  .   NA  ? ? A GLU 40  A NA  605 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc3  metalc ?    ? A  GLY 45  O   ? ? ? 1_555 EA NA  .   NA  ? ? A GLY 45  A NA  605 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc4  metalc ?    ? A  HIS 61  NE2 ? ? ? 1_555 AA HEA .   FE  ? ? A HIS 61  A HEA 601 1_555 ? ? ? ? ? ? ? 1.949 ? 
metalc5  metalc ?    ? A  HIS 240 ND1 ? ? ? 1_555 CA CU  .   CU  ? ? A HIS 240 A CU  603 1_555 ? ? ? ? ? ? ? 2.047 ? 
covale2  covale none ? A  HIS 240 NE2 ? ? ? 1_555 A  TYR 244 CE2 ? ? A HIS 240 A TYR 244 1_555 ? ? ? ? ? ? ? 1.382 ? 
metalc6  metalc ?    ? A  HIS 290 NE2 ? ? ? 1_555 CA CU  .   CU  ? ? A HIS 290 A CU  603 1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc7  metalc ?    ? A  HIS 291 NE2 ? ? ? 1_555 CA CU  .   CU  ? ? A HIS 291 A CU  603 1_555 ? ? ? ? ? ? ? 2.013 ? 
metalc8  metalc ?    ? A  ASP 369 OD2 ? ? ? 1_555 DA MG  .   MG  ? ? A ASP 369 A MG  604 1_555 ? ? ? ? ? ? ? 2.157 ? 
metalc9  metalc ?    ? A  HIS 376 NE2 ? ? ? 1_555 BA HEA .   FE  ? ? A HIS 376 A HEA 602 1_555 ? ? ? ? ? ? ? 1.987 ? 
metalc10 metalc ?    ? A  HIS 378 NE2 ? ? ? 1_555 AA HEA .   FE  ? ? A HIS 378 A HEA 601 1_555 ? ? ? ? ? ? ? 1.931 ? 
metalc11 metalc ?    ? A  SER 441 O   ? ? ? 1_555 EA NA  .   NA  ? ? A SER 441 A NA  605 1_555 ? ? ? ? ? ? ? 2.276 ? 
covale3  covale both ? B  FME 1   C   ? ? ? 1_555 B  ALA 2   N   ? ? B FME 1   B ALA 2   1_555 ? ? ? ? ? ? ? 1.320 ? 
metalc12 metalc ?    ? B  HIS 161 ND1 ? ? ? 1_555 JA CUA .   CU1 ? ? B HIS 161 B CUA 301 1_555 ? ? ? ? ? ? ? 2.047 ? 
metalc13 metalc ?    ? B  CYS 196 SG  ? ? ? 1_555 JA CUA .   CU2 ? ? B CYS 196 B CUA 301 1_555 ? ? ? ? ? ? ? 2.299 ? 
metalc14 metalc ?    ? B  CYS 196 SG  ? ? ? 1_555 JA CUA .   CU1 ? ? B CYS 196 B CUA 301 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc15 metalc ?    ? B  GLU 198 O   ? ? ? 1_555 JA CUA .   CU2 ? ? B GLU 198 B CUA 301 1_555 ? ? ? ? ? ? ? 2.137 ? 
metalc16 metalc ?    ? B  GLU 198 OE1 ? ? ? 1_555 DA MG  .   MG  ? ? B GLU 198 A MG  604 1_555 ? ? ? ? ? ? ? 2.133 ? 
metalc17 metalc ?    ? B  CYS 200 SG  ? ? ? 1_555 JA CUA .   CU2 ? ? B CYS 200 B CUA 301 1_555 ? ? ? ? ? ? ? 2.280 ? 
metalc18 metalc ?    ? B  CYS 200 SG  ? ? ? 1_555 JA CUA .   CU1 ? ? B CYS 200 B CUA 301 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc19 metalc ?    ? B  HIS 204 ND1 ? ? ? 1_555 JA CUA .   CU2 ? ? B HIS 204 B CUA 301 1_555 ? ? ? ? ? ? ? 2.035 ? 
metalc20 metalc ?    ? B  MET 207 SD  ? ? ? 1_555 JA CUA .   CU1 ? ? B MET 207 B CUA 301 1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc21 metalc ?    ? F  CYS 60  SG  ? ? ? 1_555 WA ZN  .   ZN  ? ? F CYS 60  F ZN  101 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc22 metalc ?    ? F  CYS 62  SG  ? ? ? 1_555 WA ZN  .   ZN  ? ? F CYS 62  F ZN  101 1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc23 metalc ?    ? F  CYS 82  SG  ? ? ? 1_555 WA ZN  .   ZN  ? ? F CYS 82  F ZN  101 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc24 metalc ?    ? F  CYS 85  SG  ? ? ? 1_555 WA ZN  .   ZN  ? ? F CYS 85  F ZN  101 1_555 ? ? ? ? ? ? ? 2.360 ? 
covale4  covale both ? G  GLY 10  C   ? ? ? 1_555 G  TPO 11  N   ? ? G GLY 10  G TPO 11  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale5  covale both ? G  TPO 11  C   ? ? ? 1_555 G  GLY 12  N   ? ? G TPO 11  G GLY 12  1_555 ? ? ? ? ? ? ? 1.338 ? 
covale6  covale both ? I  SAC 1   C   ? ? ? 1_555 I  THR 2   N   ? ? I SAC 1   I THR 2   1_555 ? ? ? ? ? ? ? 1.327 ? 
covale7  covale both ? N  FME 1   C   ? ? ? 1_555 N  PHE 2   N   ? ? a FME 1   a PHE 2   1_555 ? ? ? ? ? ? ? 1.335 ? 
metalc25 metalc ?    ? N  GLU 40  O   ? ? ? 1_555 HB NA  .   NA  ? ? a GLU 40  a NA  605 1_555 ? ? ? ? ? ? ? 2.254 ? 
metalc26 metalc ?    ? N  GLU 40  OE1 ? ? ? 1_555 HB NA  .   NA  ? ? a GLU 40  a NA  605 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc27 metalc ?    ? N  GLY 45  O   ? ? ? 1_555 HB NA  .   NA  ? ? a GLY 45  a NA  605 1_555 ? ? ? ? ? ? ? 2.266 ? 
metalc28 metalc ?    ? N  HIS 61  NE2 ? ? ? 1_555 DB HEA .   FE  ? ? a HIS 61  a HEA 601 1_555 ? ? ? ? ? ? ? 1.922 ? 
metalc29 metalc ?    ? N  HIS 240 ND1 ? ? ? 1_555 FB CU  .   CU  ? ? a HIS 240 a CU  603 1_555 ? ? ? ? ? ? ? 2.027 ? 
covale8  covale none ? N  HIS 240 NE2 ? ? ? 1_555 N  TYR 244 CE2 ? ? a HIS 240 a TYR 244 1_555 ? ? ? ? ? ? ? 1.372 ? 
metalc30 metalc ?    ? N  HIS 290 NE2 ? ? ? 1_555 FB CU  .   CU  ? ? a HIS 290 a CU  603 1_555 ? ? ? ? ? ? ? 2.012 ? 
metalc31 metalc ?    ? N  HIS 291 NE2 ? ? ? 1_555 FB CU  .   CU  ? ? a HIS 291 a CU  603 1_555 ? ? ? ? ? ? ? 2.022 ? 
metalc32 metalc ?    ? N  ASP 369 OD2 ? ? ? 1_555 GB MG  .   MG  ? ? a ASP 369 a MG  604 1_555 ? ? ? ? ? ? ? 2.202 ? 
metalc33 metalc ?    ? N  HIS 376 NE2 ? ? ? 1_555 EB HEA .   FE  ? ? a HIS 376 a HEA 602 1_555 ? ? ? ? ? ? ? 1.948 ? 
metalc34 metalc ?    ? N  HIS 378 NE2 ? ? ? 1_555 DB HEA .   FE  ? ? a HIS 378 a HEA 601 1_555 ? ? ? ? ? ? ? 1.949 ? 
metalc35 metalc ?    ? N  SER 441 O   ? ? ? 1_555 HB NA  .   NA  ? ? a SER 441 a NA  605 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc36 metalc ?    ? N  ASP 442 OD1 ? ? ? 1_555 HB NA  .   NA  ? ? a ASP 442 a NA  605 1_555 ? ? ? ? ? ? ? 3.068 ? 
covale9  covale both ? O  FME 1   C   ? ? ? 1_555 O  ALA 2   N   ? ? b FME 1   b ALA 2   1_555 ? ? ? ? ? ? ? 1.329 ? 
metalc37 metalc ?    ? O  HIS 161 ND1 ? ? ? 1_555 MB CUA .   CU1 ? ? b HIS 161 b CUA 302 1_555 ? ? ? ? ? ? ? 2.026 ? 
metalc38 metalc ?    ? O  CYS 196 SG  ? ? ? 1_555 MB CUA .   CU1 ? ? b CYS 196 b CUA 302 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc39 metalc ?    ? O  CYS 196 SG  ? ? ? 1_555 MB CUA .   CU2 ? ? b CYS 196 b CUA 302 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc40 metalc ?    ? O  GLU 198 O   ? ? ? 1_555 MB CUA .   CU2 ? ? b GLU 198 b CUA 302 1_555 ? ? ? ? ? ? ? 2.074 ? 
metalc41 metalc ?    ? O  GLU 198 OE2 ? ? ? 1_555 GB MG  .   MG  ? ? b GLU 198 a MG  604 1_555 ? ? ? ? ? ? ? 2.166 ? 
metalc42 metalc ?    ? O  CYS 200 SG  ? ? ? 1_555 MB CUA .   CU1 ? ? b CYS 200 b CUA 302 1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc43 metalc ?    ? O  CYS 200 SG  ? ? ? 1_555 MB CUA .   CU2 ? ? b CYS 200 b CUA 302 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc44 metalc ?    ? O  HIS 204 ND1 ? ? ? 1_555 MB CUA .   CU2 ? ? b HIS 204 b CUA 302 1_555 ? ? ? ? ? ? ? 1.993 ? 
metalc45 metalc ?    ? O  MET 207 SD  ? ? ? 1_555 MB CUA .   CU1 ? ? b MET 207 b CUA 302 1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc46 metalc ?    ? S  CYS 60  SG  ? ? ? 1_555 VB ZN  .   ZN  ? ? f CYS 60  f ZN  101 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc47 metalc ?    ? S  CYS 62  SG  ? ? ? 1_555 VB ZN  .   ZN  ? ? f CYS 62  f ZN  101 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc48 metalc ?    ? S  CYS 82  SG  ? ? ? 1_555 VB ZN  .   ZN  ? ? f CYS 82  f ZN  101 1_555 ? ? ? ? ? ? ? 2.367 ? 
metalc49 metalc ?    ? S  CYS 85  SG  ? ? ? 1_555 VB ZN  .   ZN  ? ? f CYS 85  f ZN  101 1_555 ? ? ? ? ? ? ? 2.344 ? 
covale10 covale both ? T  GLY 10  C   ? ? ? 1_555 T  TPO 11  N   ? ? g GLY 10  g TPO 11  1_555 ? ? ? ? ? ? ? 1.343 ? 
covale11 covale both ? T  TPO 11  C   ? ? ? 1_555 T  GLY 12  N   ? ? g TPO 11  g GLY 12  1_555 ? ? ? ? ? ? ? 1.341 ? 
covale12 covale both ? V  SAC 1   C   ? ? ? 1_555 V  THR 2   N   ? ? i SAC 1   i THR 2   1_555 ? ? ? ? ? ? ? 1.336 ? 
metalc50 metalc ?    ? DA MG  .   MG  ? ? ? 1_555 DC HOH .   O   ? ? A MG  604 B HOH 419 1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc51 metalc ?    ? DA MG  .   MG  ? ? ? 1_555 DC HOH .   O   ? ? A MG  604 B HOH 421 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc52 metalc ?    ? DA MG  .   MG  ? ? ? 1_555 DC HOH .   O   ? ? A MG  604 B HOH 486 1_555 ? ? ? ? ? ? ? 2.234 ? 
metalc53 metalc ?    ? EA NA  .   NA  ? ? ? 1_555 CC HOH .   O   ? ? A NA  605 A HOH 826 1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc54 metalc ?    ? EB HEA .   FE  ? ? ? 1_555 KB CMO .   C   ? ? a HEA 602 a CMO 608 1_555 ? ? ? ? ? ? ? 2.784 ? 
metalc55 metalc ?    ? GB MG  .   MG  ? ? ? 1_555 QC HOH .   O   ? ? a MG  604 b HOH 429 1_555 ? ? ? ? ? ? ? 1.991 ? 
metalc56 metalc ?    ? GB MG  .   MG  ? ? ? 1_555 QC HOH .   O   ? ? a MG  604 b HOH 435 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc57 metalc ?    ? BA HEA .   FE  ? ? ? 1_555 IA CMO .   C   ? ? A HEA 602 A CMO 609 1_555 ? ? ? ? ? ? ? 1.888 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 130 A . ? PRO 130 A PRO 131 A ? PRO 131 A 1 3.79   
2 CYS 498 A . ? CYS 498 A PRO 499 A ? PRO 499 A 1 -7.52  
3 GLN 103 B . ? GLN 103 B TRP 104 B ? TRP 104 B 1 2.71   
4 TRP 116 C . ? TRP 116 C PRO 117 C ? PRO 117 C 1 4.19   
5 PRO 130 N . ? PRO 130 a PRO 131 N ? PRO 131 a 1 2.18   
6 CYS 498 N . ? CYS 498 a PRO 499 N ? PRO 499 a 1 -11.80 
7 GLN 103 O . ? GLN 103 b TRP 104 O ? TRP 104 b 1 -2.26  
8 TRP 116 P . ? TRP 116 c PRO 117 P ? PRO 117 c 1 -3.16  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 3 ? 
AA3 ? 5 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 3 ? 
AA8 ? 2 ? 
AA9 ? 3 ? 
AB1 ? 5 ? 
AB2 ? 3 ? 
AB3 ? 2 ? 
AB4 ? 2 ? 
AB5 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA3 4 5 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? parallel      
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? parallel      
AB1 4 5 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? parallel      
AB5 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 482 ? THR A 484 ? VAL A 482 THR A 484 
AA1 2 THR M 2   ? ALA M 3   ? THR M 2   ALA M 3   
AA2 1 TYR A 510 ? VAL A 511 ? TYR A 510 VAL A 511 
AA2 2 LYS F 55  ? CYS F 60  ? LYS F 55  CYS F 60  
AA2 3 ILE F 70  ? HIS F 75  ? ILE F 70  HIS F 75  
AA3 1 LEU B 116 ? SER B 120 ? LEU B 116 SER B 120 
AA3 2 TYR B 105 ? TYR B 110 ? TYR B 105 TYR B 110 
AA3 3 LEU B 95  ? HIS B 102 ? LEU B 95  HIS B 102 
AA3 4 THR B 149 ? SER B 156 ? THR B 149 SER B 156 
AA3 5 ASN B 180 ? MET B 185 ? ASN B 180 MET B 185 
AA4 1 VAL B 142 ? PRO B 145 ? VAL B 142 PRO B 145 
AA4 2 ILE B 209 ? VAL B 214 ? ILE B 209 VAL B 214 
AA4 3 GLY B 190 ? GLY B 194 ? GLY B 190 GLY B 194 
AA5 1 HIS B 161 ? VAL B 165 ? HIS B 161 VAL B 165 
AA5 2 LEU B 170 ? ALA B 174 ? LEU B 170 ALA B 174 
AA6 1 TRP D 138 ? ASP D 139 ? TRP D 138 ASP D 139 
AA6 2 GLU D 144 ? TRP D 145 ? GLU D 144 TRP D 145 
AA7 1 ASN F 47  ? PRO F 50  ? ASN F 47  PRO F 50  
AA7 2 HIS F 88  ? VAL F 92  ? HIS F 88  VAL F 92  
AA7 3 GLN F 80  ? ARG F 81  ? GLN F 80  ARG F 81  
AA8 1 VAL N 482 ? THR N 484 ? VAL a 482 THR a 484 
AA8 2 THR Z 2   ? ALA Z 3   ? THR m 2   ALA m 3   
AA9 1 TYR N 510 ? VAL N 511 ? TYR a 510 VAL a 511 
AA9 2 LYS S 55  ? CYS S 60  ? LYS f 55  CYS f 60  
AA9 3 ILE S 70  ? HIS S 75  ? ILE f 70  HIS f 75  
AB1 1 LEU O 116 ? SER O 120 ? LEU b 116 SER b 120 
AB1 2 TYR O 105 ? TYR O 110 ? TYR b 105 TYR b 110 
AB1 3 LEU O 95  ? HIS O 102 ? LEU b 95  HIS b 102 
AB1 4 ILE O 150 ? SER O 156 ? ILE b 150 SER b 156 
AB1 5 ASN O 180 ? LEU O 184 ? ASN b 180 LEU b 184 
AB2 1 VAL O 142 ? PRO O 145 ? VAL b 142 PRO b 145 
AB2 2 PRO O 208 ? VAL O 214 ? PRO b 208 VAL b 214 
AB2 3 GLY O 190 ? GLN O 195 ? GLY b 190 GLN b 195 
AB3 1 HIS O 161 ? VAL O 165 ? HIS b 161 VAL b 165 
AB3 2 LEU O 170 ? ALA O 174 ? LEU b 170 ALA b 174 
AB4 1 TRP Q 138 ? ASP Q 139 ? TRP d 138 ASP d 139 
AB4 2 GLU Q 144 ? TRP Q 145 ? GLU d 144 TRP d 145 
AB5 1 ASN S 47  ? PRO S 50  ? ASN f 47  PRO f 50  
AB5 2 HIS S 88  ? VAL S 92  ? HIS f 88  VAL f 92  
AB5 3 GLN S 80  ? ARG S 81  ? GLN f 80  ARG f 81  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 483 ? N LEU A 483 O THR M 2   ? O THR M 2   
AA2 1 2 N TYR A 510 ? N TYR A 510 O GLY F 59  ? O GLY F 59  
AA2 2 3 N VAL F 58  ? N VAL F 58  O PHE F 72  ? O PHE F 72  
AA3 1 2 O LEU B 116 ? O LEU B 116 N TYR B 110 ? N TYR B 110 
AA3 2 3 O GLU B 109 ? O GLU B 109 N LYS B 98  ? N LYS B 98  
AA3 3 4 N THR B 99  ? N THR B 99  O LEU B 153 ? O LEU B 153 
AA3 4 5 N VAL B 154 ? N VAL B 154 O ASN B 180 ? O ASN B 180 
AA4 1 2 N VAL B 142 ? N VAL B 142 O GLU B 212 ? O GLU B 212 
AA4 2 3 O LEU B 213 ? O LEU B 213 N GLY B 190 ? N GLY B 190 
AA5 1 2 N HIS B 161 ? N HIS B 161 O ALA B 174 ? O ALA B 174 
AA6 1 2 N ASP D 139 ? N ASP D 139 O GLU D 144 ? O GLU D 144 
AA7 1 2 N ASN F 47  ? N ASN F 47  O LYS F 90  ? O LYS F 90  
AA7 2 3 O TYR F 89  ? O TYR F 89  N GLN F 80  ? N GLN F 80  
AA8 1 2 N LEU N 483 ? N LEU a 483 O THR Z 2   ? O THR m 2   
AA9 1 2 N TYR N 510 ? N TYR a 510 O GLY S 59  ? O GLY f 59  
AA9 2 3 N VAL S 58  ? N VAL f 58  O PHE S 72  ? O PHE f 72  
AB1 1 2 O LEU O 116 ? O LEU b 116 N TYR O 110 ? N TYR b 110 
AB1 2 3 O GLU O 109 ? O GLU b 109 N LYS O 98  ? N LYS b 98  
AB1 3 4 N VAL O 97  ? N VAL b 97  O ARG O 151 ? O ARG b 151 
AB1 4 5 N VAL O 154 ? N VAL b 154 O ASN O 180 ? O ASN b 180 
AB2 1 2 N VAL O 142 ? N VAL b 142 O VAL O 210 ? O VAL b 210 
AB2 2 3 O LEU O 211 ? O LEU b 211 N TYR O 192 ? N TYR b 192 
AB3 1 2 N HIS O 161 ? N HIS b 161 O ALA O 174 ? O ALA b 174 
AB4 1 2 N ASP Q 139 ? N ASP d 139 O GLU Q 144 ? O GLU d 144 
AB5 1 2 N ASN S 47  ? N ASN f 47  O LYS S 90  ? O LYS f 90  
AB5 2 3 O TYR S 89  ? O TYR f 89  N GLN S 80  ? N GLN f 80  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A HEA 601 ? 27 'binding site for residue HEA A 601'                  
AC2 Software A HEA 602 ? 26 'binding site for residue HEA A 602'                  
AC3 Software A CU  603 ? 4  'binding site for residue CU A 603'                   
AC4 Software A MG  604 ? 6  'binding site for residue MG A 604'                   
AC5 Software A NA  605 ? 4  'binding site for residue NA A 605'                   
AC6 Software A PGV 606 ? 6  'binding site for residue PGV A 606'                  
AC7 Software A PGV 607 ? 14 'binding site for residue PGV A 607'                  
AC8 Software A TGL 608 ? 8  'binding site for residue TGL A 608'                  
AC9 Software A CMO 609 ? 5  'binding site for residue CMO A 609'                  
AD1 Software B CUA 301 ? 6  'binding site for residue CUA B 301'                  
AD2 Software B PSC 302 ? 7  'binding site for residue PSC B 302'                  
AD3 Software B CHD 303 ? 9  'binding site for residue CHD B 303'                  
AD4 Software C CHD 301 ? 8  'binding site for residue CHD C 301'                  
AD5 Software C PEK 302 ? 14 'binding site for residue PEK C 302'                  
AD6 Software C PGV 303 ? 15 'binding site for residue PGV C 303'                  
AD7 Software C PGV 304 ? 6  'binding site for residue PGV C 304'                  
AD8 Software C CDL 305 ? 12 'binding site for residue CDL C 305'                  
AD9 Software C CHD 306 ? 3  'binding site for residue CHD C 306'                  
AE1 Software C DMU 307 ? 5  'binding site for residue DMU C 307'                  
AE2 Software C PEK 308 ? 7  'binding site for residue PEK C 308'                  
AE3 Software C PEK 309 ? 10 'binding site for residue PEK C 309'                  
AE4 Software D TGL 201 ? 5  'binding site for residue TGL D 201'                  
AE5 Software F ZN  101 ? 4  'binding site for residue ZN F 101'                   
AE6 Software G CDL 101 ? 16 'binding site for residue CDL G 101'                  
AE7 Software G PEK 102 ? 5  'binding site for residue PEK G 102'                  
AE8 Software G PGV 103 ? 7  'binding site for residue PGV G 103'                  
AE9 Software J CHD 101 ? 3  'binding site for residue CHD J 101'                  
AF1 Software L TGL 101 ? 10 'binding site for residue TGL L 101'                  
AF2 Software M DMU 101 ? 7  'binding site for residue DMU M 101'                  
AF3 Software a HEA 601 ? 22 'binding site for residue HEA a 601'                  
AF4 Software a HEA 602 ? 27 'binding site for residue HEA a 602'                  
AF5 Software a CU  603 ? 4  'binding site for residue CU a 603'                   
AF6 Software a MG  604 ? 5  'binding site for residue MG a 604'                   
AF7 Software a NA  605 ? 4  'binding site for residue NA a 605'                   
AF8 Software a TGL 606 ? 5  'binding site for residue TGL a 606'                  
AF9 Software a PGV 607 ? 10 'binding site for residue PGV a 607'                  
AG1 Software a CMO 608 ? 4  'binding site for residue CMO a 608'                  
AG2 Software b CHD 301 ? 11 'binding site for residue CHD b 301'                  
AG3 Software b CUA 302 ? 6  'binding site for residue CUA b 302'                  
AG4 Software c PGV 301 ? 14 'binding site for residue PGV c 301'                  
AG5 Software c CHD 302 ? 8  'binding site for residue CHD c 302'                  
AG6 Software c PEK 303 ? 7  'binding site for residue PEK c 303'                  
AG7 Software c PGV 304 ? 17 'binding site for residue PGV c 304'                  
AG8 Software c CDL 305 ? 12 'binding site for residue CDL c 305'                  
AG9 Software c CHD 306 ? 3  'binding site for residue CHD c 306'                  
AH1 Software m DMU 401 ? 8  'binding site for residue DMU m 401'                  
AH2 Software e PSC 201 ? 5  'binding site for residue PSC e 201'                  
AH3 Software f ZN  101 ? 4  'binding site for residue ZN f 101'                   
AH4 Software c DMU 307 ? 3  'binding site for residue DMU c 307'                  
AH5 Software g PEK 102 ? 15 'binding site for residue PEK g 102'                  
AH6 Software g CDL 103 ? 18 'binding site for residue CDL g 103'                  
AH7 Software i TGL 101 ? 5  'binding site for residue TGL i 101'                  
AH8 Software j CHD 101 ? 4  'binding site for residue CHD j 101'                  
AH9 Software l TGL 101 ? 8  'binding site for residue TGL l 101'                  
AI1 Software a HIS 240 ? 18 'binding site for Di-peptide HIS a 240 and TYR a 244' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 27 THR A  31  ? THR A 31  . ? 1_555 ? 
2   AC1 27 SER A  34  ? SER A 34  . ? 1_555 ? 
3   AC1 27 ILE A  37  ? ILE A 37  . ? 1_555 ? 
4   AC1 27 ARG A  38  ? ARG A 38  . ? 1_555 ? 
5   AC1 27 TYR A  54  ? TYR A 54  . ? 1_555 ? 
6   AC1 27 HIS A  61  ? HIS A 61  . ? 1_555 ? 
7   AC1 27 ALA A  62  ? ALA A 62  . ? 1_555 ? 
8   AC1 27 MET A  65  ? MET A 65  . ? 1_555 ? 
9   AC1 27 ILE A  66  ? ILE A 66  . ? 1_555 ? 
10  AC1 27 VAL A  70  ? VAL A 70  . ? 1_555 ? 
11  AC1 27 GLY A  125 ? GLY A 125 . ? 1_555 ? 
12  AC1 27 TRP A  126 ? TRP A 126 . ? 1_555 ? 
13  AC1 27 TYR A  371 ? TYR A 371 . ? 1_555 ? 
14  AC1 27 PHE A  377 ? PHE A 377 . ? 1_555 ? 
15  AC1 27 HIS A  378 ? HIS A 378 . ? 1_555 ? 
16  AC1 27 SER A  382 ? SER A 382 . ? 1_555 ? 
17  AC1 27 MET A  390 ? MET A 390 . ? 1_555 ? 
18  AC1 27 MET A  417 ? MET A 417 . ? 1_555 ? 
19  AC1 27 PHE A  425 ? PHE A 425 . ? 1_555 ? 
20  AC1 27 GLN A  428 ? GLN A 428 . ? 1_555 ? 
21  AC1 27 ARG A  438 ? ARG A 438 . ? 1_555 ? 
22  AC1 27 ARG A  439 ? ARG A 439 . ? 1_555 ? 
23  AC1 27 VAL A  465 ? VAL A 465 . ? 1_555 ? 
24  AC1 27 MET A  468 ? MET A 468 . ? 1_555 ? 
25  AC1 27 HOH CC .   ? HOH A 724 . ? 1_555 ? 
26  AC1 27 HOH CC .   ? HOH A 726 . ? 1_555 ? 
27  AC1 27 HOH CC .   ? HOH A 747 . ? 1_555 ? 
28  AC2 26 TRP A  126 ? TRP A 126 . ? 1_555 ? 
29  AC2 26 TRP A  236 ? TRP A 236 . ? 1_555 ? 
30  AC2 26 VAL A  243 ? VAL A 243 . ? 1_555 ? 
31  AC2 26 TYR A  244 ? TYR A 244 . ? 1_555 ? 
32  AC2 26 ILE A  247 ? ILE A 247 . ? 1_555 ? 
33  AC2 26 HIS A  290 ? HIS A 290 . ? 1_555 ? 
34  AC2 26 HIS A  291 ? HIS A 291 . ? 1_555 ? 
35  AC2 26 THR A  309 ? THR A 309 . ? 1_555 ? 
36  AC2 26 ILE A  312 ? ILE A 312 . ? 1_555 ? 
37  AC2 26 GLY A  317 ? GLY A 317 . ? 1_555 ? 
38  AC2 26 GLY A  352 ? GLY A 352 . ? 1_555 ? 
39  AC2 26 GLY A  355 ? GLY A 355 . ? 1_555 ? 
40  AC2 26 LEU A  358 ? LEU A 358 . ? 1_555 ? 
41  AC2 26 ALA A  359 ? ALA A 359 . ? 1_555 ? 
42  AC2 26 ASP A  364 ? ASP A 364 . ? 1_555 ? 
43  AC2 26 HIS A  368 ? HIS A 368 . ? 1_555 ? 
44  AC2 26 VAL A  373 ? VAL A 373 . ? 1_555 ? 
45  AC2 26 HIS A  376 ? HIS A 376 . ? 1_555 ? 
46  AC2 26 PHE A  377 ? PHE A 377 . ? 1_555 ? 
47  AC2 26 VAL A  380 ? VAL A 380 . ? 1_555 ? 
48  AC2 26 ARG A  438 ? ARG A 438 . ? 1_555 ? 
49  AC2 26 CMO IA .   ? CMO A 609 . ? 1_555 ? 
50  AC2 26 HOH CC .   ? HOH A 707 . ? 1_555 ? 
51  AC2 26 HOH CC .   ? HOH A 758 . ? 1_555 ? 
52  AC2 26 HOH CC .   ? HOH A 785 . ? 1_555 ? 
53  AC2 26 HOH CC .   ? HOH A 837 . ? 1_555 ? 
54  AC3 4  HIS A  240 ? HIS A 240 . ? 1_555 ? 
55  AC3 4  HIS A  290 ? HIS A 290 . ? 1_555 ? 
56  AC3 4  HIS A  291 ? HIS A 291 . ? 1_555 ? 
57  AC3 4  CMO IA .   ? CMO A 609 . ? 1_555 ? 
58  AC4 6  HIS A  368 ? HIS A 368 . ? 1_555 ? 
59  AC4 6  ASP A  369 ? ASP A 369 . ? 1_555 ? 
60  AC4 6  GLU B  198 ? GLU B 198 . ? 1_555 ? 
61  AC4 6  HOH DC .   ? HOH B 419 . ? 1_555 ? 
62  AC4 6  HOH DC .   ? HOH B 421 . ? 1_555 ? 
63  AC4 6  HOH DC .   ? HOH B 486 . ? 1_555 ? 
64  AC5 4  GLU A  40  ? GLU A 40  . ? 1_555 ? 
65  AC5 4  GLY A  45  ? GLY A 45  . ? 1_555 ? 
66  AC5 4  SER A  441 ? SER A 441 . ? 1_555 ? 
67  AC5 4  HOH CC .   ? HOH A 826 . ? 1_555 ? 
68  AC6 6  TRP A  409 ? TRP A 409 . ? 1_555 ? 
69  AC6 6  HOH CC .   ? HOH A 701 . ? 1_555 ? 
70  AC6 6  HOH CC .   ? HOH A 765 . ? 1_555 ? 
71  AC6 6  HOH CC .   ? HOH A 790 . ? 1_555 ? 
72  AC6 6  THR D  80  ? THR D 80  . ? 1_555 ? 
73  AC6 6  GLN M  15  ? GLN M 15  . ? 1_555 ? 
74  AC7 14 PHE A  94  ? PHE A 94  . ? 1_555 ? 
75  AC7 14 PRO A  95  ? PRO A 95  . ? 1_555 ? 
76  AC7 14 ARG A  96  ? ARG A 96  . ? 1_555 ? 
77  AC7 14 MET A  97  ? MET A 97  . ? 1_555 ? 
78  AC7 14 HOH CC .   ? HOH A 745 . ? 1_555 ? 
79  AC7 14 HIS C  9   ? HIS C 9   . ? 1_555 ? 
80  AC7 14 ASN C  50  ? ASN C 50  . ? 1_555 ? 
81  AC7 14 MET C  54  ? MET C 54  . ? 1_555 ? 
82  AC7 14 TRP C  57  ? TRP C 57  . ? 1_555 ? 
83  AC7 14 TRP C  58  ? TRP C 58  . ? 1_555 ? 
84  AC7 14 GLU C  64  ? GLU C 64  . ? 1_555 ? 
85  AC7 14 HIS C  71  ? HIS C 71  . ? 1_555 ? 
86  AC7 14 PHE C  86  ? PHE C 86  . ? 1_555 ? 
87  AC7 14 PEK NA .   ? PEK C 302 . ? 1_555 ? 
88  AC8 8  VAL A  350 ? VAL A 350 . ? 1_555 ? 
89  AC8 8  ASN A  422 ? ASN A 422 . ? 1_555 ? 
90  AC8 8  PHE A  426 ? PHE A 426 . ? 1_555 ? 
91  AC8 8  PHE A  430 ? PHE A 430 . ? 1_555 ? 
92  AC8 8  LEU A  433 ? LEU A 433 . ? 1_555 ? 
93  AC8 8  GLY B  8   ? GLY B 8   . ? 1_555 ? 
94  AC8 8  LEU B  28  ? LEU B 28  . ? 1_555 ? 
95  AC8 8  ARG I  43  ? ARG I 43  . ? 1_555 ? 
96  AC9 5  HIS A  240 ? HIS A 240 . ? 1_555 ? 
97  AC9 5  VAL A  243 ? VAL A 243 . ? 1_555 ? 
98  AC9 5  HIS A  291 ? HIS A 291 . ? 1_555 ? 
99  AC9 5  HEA BA .   ? HEA A 602 . ? 1_555 ? 
100 AC9 5  CU  CA .   ? CU  A 603 . ? 1_555 ? 
101 AD1 6  HIS B  161 ? HIS B 161 . ? 1_555 ? 
102 AD1 6  CYS B  196 ? CYS B 196 . ? 1_555 ? 
103 AD1 6  GLU B  198 ? GLU B 198 . ? 1_555 ? 
104 AD1 6  CYS B  200 ? CYS B 200 . ? 1_555 ? 
105 AD1 6  HIS B  204 ? HIS B 204 . ? 1_555 ? 
106 AD1 6  MET B  207 ? MET B 207 . ? 1_555 ? 
107 AD2 7  HIS B  52  ? HIS B 52  . ? 1_555 ? 
108 AD2 7  ASP B  57  ? ASP B 57  . ? 1_555 ? 
109 AD2 7  GLU B  60  ? GLU B 60  . ? 1_555 ? 
110 AD2 7  HOH DC .   ? HOH B 467 . ? 1_555 ? 
111 AD2 7  ASP E  8   ? ASP E 8   . ? 1_555 ? 
112 AD2 7  LEU E  41  ? LEU E 41  . ? 1_555 ? 
113 AD2 7  ARG I  18  ? ARG I 18  . ? 1_555 ? 
114 AD3 9  MET A  271 ? MET A 271 . ? 1_555 ? 
115 AD3 9  GLN B  59  ? GLN B 59  . ? 1_555 ? 
116 AD3 9  GLU B  62  ? GLU B 62  . ? 1_555 ? 
117 AD3 9  THR B  63  ? THR B 63  . ? 1_555 ? 
118 AD3 9  HOH DC .   ? HOH B 414 . ? 1_555 ? 
119 AD3 9  HOH DC .   ? HOH B 442 . ? 1_555 ? 
120 AD3 9  ARG T  14  ? ARG g 14  . ? 1_555 ? 
121 AD3 9  ARG T  17  ? ARG g 17  . ? 1_555 ? 
122 AD3 9  GLY T  22  ? GLY g 22  . ? 1_555 ? 
123 AD4 8  ASP A  300 ? ASP A 300 . ? 1_555 ? 
124 AD4 8  THR A  301 ? THR A 301 . ? 1_555 ? 
125 AD4 8  TYR A  304 ? TYR A 304 . ? 1_555 ? 
126 AD4 8  HOH CC .   ? HOH A 845 . ? 1_555 ? 
127 AD4 8  TRP C  99  ? TRP C 99  . ? 1_555 ? 
128 AD4 8  HIS C  103 ? HIS C 103 . ? 1_555 ? 
129 AD4 8  HOH EC .   ? HOH C 453 . ? 1_555 ? 
130 AD4 8  CDL XB .   ? CDL g 103 . ? 1_555 ? 
131 AD5 14 PGV GA .   ? PGV A 607 . ? 1_555 ? 
132 AD5 14 TYR C  181 ? TYR C 181 . ? 1_555 ? 
133 AD5 14 TYR C  182 ? TYR C 182 . ? 1_555 ? 
134 AD5 14 ALA C  184 ? ALA C 184 . ? 1_555 ? 
135 AD5 14 PHE C  186 ? PHE C 186 . ? 1_555 ? 
136 AD5 14 THR C  187 ? THR C 187 . ? 1_555 ? 
137 AD5 14 ILE C  188 ? ILE C 188 . ? 1_555 ? 
138 AD5 14 PHE C  198 ? PHE C 198 . ? 1_555 ? 
139 AD5 14 TRP G  62  ? TRP G 62  . ? 1_555 ? 
140 AD5 14 THR G  68  ? THR G 68  . ? 1_555 ? 
141 AD5 14 PHE G  69  ? PHE G 69  . ? 1_555 ? 
142 AD5 14 PHE G  70  ? PHE G 70  . ? 1_555 ? 
143 AD5 14 HIS G  71  ? HIS G 71  . ? 1_555 ? 
144 AD5 14 ASN G  76  ? ASN G 76  . ? 1_555 ? 
145 AD6 15 MET C  54  ? MET C 54  . ? 1_555 ? 
146 AD6 15 VAL C  61  ? VAL C 61  . ? 1_555 ? 
147 AD6 15 SER C  65  ? SER C 65  . ? 1_555 ? 
148 AD6 15 THR C  66  ? THR C 66  . ? 1_555 ? 
149 AD6 15 ILE C  210 ? ILE C 210 . ? 1_555 ? 
150 AD6 15 ARG C  221 ? ARG C 221 . ? 1_555 ? 
151 AD6 15 HIS C  226 ? HIS C 226 . ? 1_555 ? 
152 AD6 15 HIS C  231 ? HIS C 231 . ? 1_555 ? 
153 AD6 15 HIS C  232 ? HIS C 232 . ? 1_555 ? 
154 AD6 15 PHE C  233 ? PHE C 233 . ? 1_555 ? 
155 AD6 15 GLY C  234 ? GLY C 234 . ? 1_555 ? 
156 AD6 15 CDL QA .   ? CDL C 305 . ? 1_555 ? 
157 AD6 15 HOH EC .   ? HOH C 423 . ? 1_555 ? 
158 AD6 15 HOH EC .   ? HOH C 443 . ? 1_555 ? 
159 AD6 15 HOH HC .   ? HOH F 237 . ? 1_555 ? 
160 AD7 6  ASP A  298 ? ASP A 298 . ? 1_555 ? 
161 AD7 6  TYR C  102 ? TYR C 102 . ? 1_555 ? 
162 AD7 6  HIS C  103 ? HIS C 103 . ? 1_555 ? 
163 AD7 6  ALA C  107 ? ALA C 107 . ? 1_555 ? 
164 AD7 6  ASN H  22  ? ASN H 22  . ? 1_555 ? 
165 AD7 6  ALA T  1   ? ALA g 1   . ? 1_555 ? 
166 AD8 12 MET C  54  ? MET C 54  . ? 1_555 ? 
167 AD8 12 TYR C  55  ? TYR C 55  . ? 1_555 ? 
168 AD8 12 ARG C  63  ? ARG C 63  . ? 1_555 ? 
169 AD8 12 PHE C  67  ? PHE C 67  . ? 1_555 ? 
170 AD8 12 VAL C  217 ? VAL C 217 . ? 1_555 ? 
171 AD8 12 LYS C  224 ? LYS C 224 . ? 1_555 ? 
172 AD8 12 HIS C  226 ? HIS C 226 . ? 1_555 ? 
173 AD8 12 PGV OA .   ? PGV C 303 . ? 1_555 ? 
174 AD8 12 HOH EC .   ? HOH C 414 . ? 1_555 ? 
175 AD8 12 HOH EC .   ? HOH C 446 . ? 1_555 ? 
176 AD8 12 PHE J  12  ? PHE J 12  . ? 1_555 ? 
177 AD8 12 ASP J  28  ? ASP J 28  . ? 1_555 ? 
178 AD9 3  ARG C  156 ? ARG C 156 . ? 1_555 ? 
179 AD9 3  PHE C  164 ? PHE C 164 . ? 1_555 ? 
180 AD9 3  PHE J  1   ? PHE J 1   . ? 1_555 ? 
181 AE1 5  ASN C  38  ? ASN C 38  . ? 1_555 ? 
182 AE1 5  MET C  40  ? MET C 40  . ? 1_555 ? 
183 AE1 5  HOH EC .   ? HOH C 461 . ? 1_555 ? 
184 AE1 5  TRP G  62  ? TRP G 62  . ? 1_555 ? 
185 AE1 5  GLY G  63  ? GLY G 63  . ? 1_555 ? 
186 AE2 7  LYS C  157 ? LYS C 157 . ? 1_555 ? 
187 AE2 7  ARG G  17  ? ARG G 17  . ? 1_555 ? 
188 AE2 7  GLY G  22  ? GLY G 22  . ? 1_555 ? 
189 AE2 7  CDL XA .   ? CDL G 101 . ? 1_555 ? 
190 AE2 7  HOH IC .   ? HOH G 242 . ? 1_555 ? 
191 AE2 7  THR O  66  ? THR b 66  . ? 1_555 ? 
192 AE2 7  CHD LB .   ? CHD b 301 . ? 1_555 ? 
193 AE3 10 LYS C  77  ? LYS C 77  . ? 1_555 ? 
194 AE3 10 ARG C  80  ? ARG C 80  . ? 1_555 ? 
195 AE3 10 TYR C  81  ? TYR C 81  . ? 1_555 ? 
196 AE3 10 ILE C  84  ? ILE C 84  . ? 1_555 ? 
197 AE3 10 VAL C  91  ? VAL C 91  . ? 1_555 ? 
198 AE3 10 TRP C  240 ? TRP C 240 . ? 1_555 ? 
199 AE3 10 VAL C  247 ? VAL C 247 . ? 1_555 ? 
200 AE3 10 PHE C  251 ? PHE C 251 . ? 1_555 ? 
201 AE3 10 HIS T  8   ? HIS g 8   . ? 1_555 ? 
202 AE3 10 TPO T  11  ? TPO g 11  . ? 1_555 ? 
203 AE4 5  TRP A  334 ? TRP A 334 . ? 1_555 ? 
204 AE4 5  LYS A  411 ? LYS A 411 . ? 1_555 ? 
205 AE4 5  TRP D  78  ? TRP D 78  . ? 1_555 ? 
206 AE4 5  HOH FC .   ? HOH D 328 . ? 1_555 ? 
207 AE4 5  ARG I  16  ? ARG I 16  . ? 1_555 ? 
208 AE5 4  CYS F  60  ? CYS F 60  . ? 1_555 ? 
209 AE5 4  CYS F  62  ? CYS F 62  . ? 1_555 ? 
210 AE5 4  CYS F  82  ? CYS F 82  . ? 1_555 ? 
211 AE5 4  CYS F  85  ? CYS F 85  . ? 1_555 ? 
212 AE6 16 ASN C  125 ? ASN C 125 . ? 1_555 ? 
213 AE6 16 LEU C  127 ? LEU C 127 . ? 1_555 ? 
214 AE6 16 LEU C  131 ? LEU C 131 . ? 1_555 ? 
215 AE6 16 PEK TA .   ? PEK C 308 . ? 1_555 ? 
216 AE6 16 SER G  27  ? SER G 27  . ? 1_555 ? 
217 AE6 16 CYS G  31  ? CYS G 31  . ? 1_555 ? 
218 AE6 16 ASN G  34  ? ASN G 34  . ? 1_555 ? 
219 AE6 16 LEU G  37  ? LEU G 37  . ? 1_555 ? 
220 AE6 16 HIS G  38  ? HIS G 38  . ? 1_555 ? 
221 AE6 16 HOH IC .   ? HOH G 203 . ? 1_555 ? 
222 AE6 16 PHE N  282 ? PHE a 282 . ? 1_555 ? 
223 AE6 16 ASP N  300 ? ASP a 300 . ? 1_555 ? 
224 AE6 16 TYR N  304 ? TYR a 304 . ? 1_555 ? 
225 AE6 16 SER N  307 ? SER a 307 . ? 1_555 ? 
226 AE6 16 LEU O  78  ? LEU b 78  . ? 1_555 ? 
227 AE6 16 TYR O  85  ? TYR b 85  . ? 1_555 ? 
228 AE7 5  ALA G  3   ? ALA G 3   . ? 1_555 ? 
229 AE7 5  TPO G  11  ? TPO G 11  . ? 1_555 ? 
230 AE7 5  HOH IC .   ? HOH G 212 . ? 1_555 ? 
231 AE7 5  ARG P  80  ? ARG c 80  . ? 1_555 ? 
232 AE7 5  GLU P  236 ? GLU c 236 . ? 1_555 ? 
233 AE8 7  TRP C  258 ? TRP C 258 . ? 1_555 ? 
234 AE8 7  ALA G  1   ? ALA G 1   . ? 1_555 ? 
235 AE8 7  TRP P  99  ? TRP c 99  . ? 1_555 ? 
236 AE8 7  HIS P  103 ? HIS c 103 . ? 1_555 ? 
237 AE8 7  LEU P  106 ? LEU c 106 . ? 1_555 ? 
238 AE8 7  CHD OB .   ? CHD c 302 . ? 1_555 ? 
239 AE8 7  HOH RC .   ? HOH c 439 . ? 1_555 ? 
240 AE9 3  ARG J  33  ? ARG J 33  . ? 1_555 ? 
241 AE9 3  THR J  37  ? THR J 37  . ? 1_555 ? 
242 AE9 3  LEU J  40  ? LEU J 40  . ? 1_555 ? 
243 AF1 10 LEU A  21  ? LEU A 21  . ? 1_555 ? 
244 AF1 10 TRP A  25  ? TRP A 25  . ? 1_555 ? 
245 AF1 10 PHE A  400 ? PHE A 400 . ? 1_555 ? 
246 AF1 10 ILE A  472 ? ILE A 472 . ? 1_555 ? 
247 AF1 10 ILE L  11  ? ILE L 11  . ? 1_555 ? 
248 AF1 10 PRO L  12  ? PRO L 12  . ? 1_555 ? 
249 AF1 10 PHE L  13  ? PHE L 13  . ? 1_555 ? 
250 AF1 10 ARG L  20  ? ARG L 20  . ? 1_555 ? 
251 AF1 10 MET L  25  ? MET L 25  . ? 1_555 ? 
252 AF1 10 PHE L  29  ? PHE L 29  . ? 1_555 ? 
253 AF2 7  PHE A  459 ? PHE A 459 . ? 1_555 ? 
254 AF2 7  TRP D  98  ? TRP D 98  . ? 1_555 ? 
255 AF2 7  LEU M  28  ? LEU M 28  . ? 1_555 ? 
256 AF2 7  GLY M  31  ? GLY M 31  . ? 1_555 ? 
257 AF2 7  TRP M  32  ? TRP M 32  . ? 1_555 ? 
258 AF2 7  TYR M  35  ? TYR M 35  . ? 1_555 ? 
259 AF2 7  HIS M  36  ? HIS M 36  . ? 1_555 ? 
260 AF3 22 MET N  28  ? MET a 28  . ? 1_555 ? 
261 AF3 22 THR N  31  ? THR a 31  . ? 1_555 ? 
262 AF3 22 SER N  34  ? SER a 34  . ? 1_555 ? 
263 AF3 22 ARG N  38  ? ARG a 38  . ? 1_555 ? 
264 AF3 22 TYR N  54  ? TYR a 54  . ? 1_555 ? 
265 AF3 22 VAL N  58  ? VAL a 58  . ? 1_555 ? 
266 AF3 22 HIS N  61  ? HIS a 61  . ? 1_555 ? 
267 AF3 22 ALA N  62  ? ALA a 62  . ? 1_555 ? 
268 AF3 22 MET N  65  ? MET a 65  . ? 1_555 ? 
269 AF3 22 VAL N  70  ? VAL a 70  . ? 1_555 ? 
270 AF3 22 GLY N  125 ? GLY a 125 . ? 1_555 ? 
271 AF3 22 TRP N  126 ? TRP a 126 . ? 1_555 ? 
272 AF3 22 TYR N  371 ? TYR a 371 . ? 1_555 ? 
273 AF3 22 PHE N  377 ? PHE a 377 . ? 1_555 ? 
274 AF3 22 HIS N  378 ? HIS a 378 . ? 1_555 ? 
275 AF3 22 PHE N  425 ? PHE a 425 . ? 1_555 ? 
276 AF3 22 GLN N  428 ? GLN a 428 . ? 1_555 ? 
277 AF3 22 ARG N  438 ? ARG a 438 . ? 1_555 ? 
278 AF3 22 ARG N  439 ? ARG a 439 . ? 1_555 ? 
279 AF3 22 VAL N  465 ? VAL a 465 . ? 1_555 ? 
280 AF3 22 HOH PC .   ? HOH a 722 . ? 1_555 ? 
281 AF3 22 HOH PC .   ? HOH a 725 . ? 1_555 ? 
282 AF4 27 TRP N  126 ? TRP a 126 . ? 1_555 ? 
283 AF4 27 TRP N  236 ? TRP a 236 . ? 1_555 ? 
284 AF4 27 VAL N  243 ? VAL a 243 . ? 1_555 ? 
285 AF4 27 TYR N  244 ? TYR a 244 . ? 1_555 ? 
286 AF4 27 HIS N  290 ? HIS a 290 . ? 1_555 ? 
287 AF4 27 HIS N  291 ? HIS a 291 . ? 1_555 ? 
288 AF4 27 THR N  309 ? THR a 309 . ? 1_555 ? 
289 AF4 27 ILE N  312 ? ILE a 312 . ? 1_555 ? 
290 AF4 27 THR N  316 ? THR a 316 . ? 1_555 ? 
291 AF4 27 GLY N  317 ? GLY a 317 . ? 1_555 ? 
292 AF4 27 GLY N  352 ? GLY a 352 . ? 1_555 ? 
293 AF4 27 GLY N  355 ? GLY a 355 . ? 1_555 ? 
294 AF4 27 ILE N  356 ? ILE a 356 . ? 1_555 ? 
295 AF4 27 LEU N  358 ? LEU a 358 . ? 1_555 ? 
296 AF4 27 ALA N  359 ? ALA a 359 . ? 1_555 ? 
297 AF4 27 ASP N  364 ? ASP a 364 . ? 1_555 ? 
298 AF4 27 HIS N  368 ? HIS a 368 . ? 1_555 ? 
299 AF4 27 HIS N  376 ? HIS a 376 . ? 1_555 ? 
300 AF4 27 PHE N  377 ? PHE a 377 . ? 1_555 ? 
301 AF4 27 VAL N  380 ? VAL a 380 . ? 1_555 ? 
302 AF4 27 LEU N  381 ? LEU a 381 . ? 1_555 ? 
303 AF4 27 ARG N  438 ? ARG a 438 . ? 1_555 ? 
304 AF4 27 CMO KB .   ? CMO a 608 . ? 1_555 ? 
305 AF4 27 HOH PC .   ? HOH a 721 . ? 1_555 ? 
306 AF4 27 HOH PC .   ? HOH a 748 . ? 1_555 ? 
307 AF4 27 HOH PC .   ? HOH a 780 . ? 1_555 ? 
308 AF4 27 HOH PC .   ? HOH a 788 . ? 1_555 ? 
309 AF5 4  HIS N  240 ? HIS a 240 . ? 1_555 ? 
310 AF5 4  HIS N  290 ? HIS a 290 . ? 1_555 ? 
311 AF5 4  HIS N  291 ? HIS a 291 . ? 1_555 ? 
312 AF5 4  CMO KB .   ? CMO a 608 . ? 1_555 ? 
313 AF6 5  HIS N  368 ? HIS a 368 . ? 1_555 ? 
314 AF6 5  ASP N  369 ? ASP a 369 . ? 1_555 ? 
315 AF6 5  GLU O  198 ? GLU b 198 . ? 1_555 ? 
316 AF6 5  HOH QC .   ? HOH b 429 . ? 1_555 ? 
317 AF6 5  HOH QC .   ? HOH b 435 . ? 1_555 ? 
318 AF7 4  GLU N  40  ? GLU a 40  . ? 1_555 ? 
319 AF7 4  GLY N  45  ? GLY a 45  . ? 1_555 ? 
320 AF7 4  SER N  441 ? SER a 441 . ? 1_555 ? 
321 AF7 4  ASP N  442 ? ASP a 442 . ? 1_555 ? 
322 AF8 5  TRP N  334 ? TRP a 334 . ? 1_555 ? 
323 AF8 5  HOH QC .   ? HOH b 461 . ? 1_555 ? 
324 AF8 5  THR Q  75  ? THR d 75  . ? 1_555 ? 
325 AF8 5  TRP Q  78  ? TRP d 78  . ? 1_555 ? 
326 AF8 5  VAL Q  81  ? VAL d 81  . ? 1_555 ? 
327 AF9 10 ASN N  406 ? ASN a 406 . ? 1_555 ? 
328 AF9 10 THR N  408 ? THR a 408 . ? 1_555 ? 
329 AF9 10 TRP N  409 ? TRP a 409 . ? 1_555 ? 
330 AF9 10 HOH PC .   ? HOH a 705 . ? 1_555 ? 
331 AF9 10 ALA Q  84  ? ALA d 84  . ? 1_555 ? 
332 AF9 10 PHE X  9   ? PHE k 9   . ? 1_555 ? 
333 AF9 10 HIS X  10  ? HIS k 10  . ? 1_555 ? 
334 AF9 10 ALA Z  3   ? ALA m 3   . ? 1_555 ? 
335 AF9 10 LYS Z  4   ? LYS m 4   . ? 1_555 ? 
336 AF9 10 GLN Z  15  ? GLN m 15  . ? 1_555 ? 
337 AG1 4  HIS N  240 ? HIS a 240 . ? 1_555 ? 
338 AG1 4  VAL N  243 ? VAL a 243 . ? 1_555 ? 
339 AG1 4  HEA EB .   ? HEA a 602 . ? 1_555 ? 
340 AG1 4  CU  FB .   ? CU  a 603 . ? 1_555 ? 
341 AG2 11 PEK TA .   ? PEK C 308 . ? 1_555 ? 
342 AG2 11 ARG G  14  ? ARG G 14  . ? 1_555 ? 
343 AG2 11 ARG G  17  ? ARG G 17  . ? 1_555 ? 
344 AG2 11 PHE G  18  ? PHE G 18  . ? 1_555 ? 
345 AG2 11 GLY G  22  ? GLY G 22  . ? 1_555 ? 
346 AG2 11 MET N  271 ? MET a 271 . ? 1_555 ? 
347 AG2 11 GLN O  59  ? GLN b 59  . ? 1_555 ? 
348 AG2 11 GLU O  62  ? GLU b 62  . ? 1_555 ? 
349 AG2 11 THR O  63  ? THR b 63  . ? 1_555 ? 
350 AG2 11 HOH QC .   ? HOH b 431 . ? 1_555 ? 
351 AG2 11 HOH QC .   ? HOH b 440 . ? 1_555 ? 
352 AG3 6  HIS O  161 ? HIS b 161 . ? 1_555 ? 
353 AG3 6  CYS O  196 ? CYS b 196 . ? 1_555 ? 
354 AG3 6  GLU O  198 ? GLU b 198 . ? 1_555 ? 
355 AG3 6  CYS O  200 ? CYS b 200 . ? 1_555 ? 
356 AG3 6  HIS O  204 ? HIS b 204 . ? 1_555 ? 
357 AG3 6  MET O  207 ? MET b 207 . ? 1_555 ? 
358 AG4 14 PHE N  94  ? PHE a 94  . ? 1_555 ? 
359 AG4 14 PRO N  95  ? PRO a 95  . ? 1_555 ? 
360 AG4 14 ARG N  96  ? ARG a 96  . ? 1_555 ? 
361 AG4 14 MET N  97  ? MET a 97  . ? 1_555 ? 
362 AG4 14 HOH PC .   ? HOH a 709 . ? 1_555 ? 
363 AG4 14 HIS P  9   ? HIS c 9   . ? 1_555 ? 
364 AG4 14 ASN P  50  ? ASN c 50  . ? 1_555 ? 
365 AG4 14 MET P  54  ? MET c 54  . ? 1_555 ? 
366 AG4 14 TRP P  57  ? TRP c 57  . ? 1_555 ? 
367 AG4 14 TRP P  58  ? TRP c 58  . ? 1_555 ? 
368 AG4 14 GLU P  64  ? GLU c 64  . ? 1_555 ? 
369 AG4 14 HIS P  71  ? HIS c 71  . ? 1_555 ? 
370 AG4 14 PHE P  93  ? PHE c 93  . ? 1_555 ? 
371 AG4 14 PEK WB .   ? PEK g 102 . ? 1_555 ? 
372 AG5 8  PGV ZA .   ? PGV G 103 . ? 1_555 ? 
373 AG5 8  HIS N  233 ? HIS a 233 . ? 1_555 ? 
374 AG5 8  ASP N  300 ? ASP a 300 . ? 1_555 ? 
375 AG5 8  THR N  301 ? THR a 301 . ? 1_555 ? 
376 AG5 8  TYR N  304 ? TYR a 304 . ? 1_555 ? 
377 AG5 8  TRP P  99  ? TRP c 99  . ? 1_555 ? 
378 AG5 8  HIS P  103 ? HIS c 103 . ? 1_555 ? 
379 AG5 8  HOH RC .   ? HOH c 439 . ? 1_555 ? 
380 AG6 7  TRP A  275 ? TRP A 275 . ? 1_555 ? 
381 AG6 7  GLN B  59  ? GLN B 59  . ? 1_555 ? 
382 AG6 7  THR B  66  ? THR B 66  . ? 1_555 ? 
383 AG6 7  HIS P  158 ? HIS c 158 . ? 1_555 ? 
384 AG6 7  GLN P  161 ? GLN c 161 . ? 1_555 ? 
385 AG6 7  ARG T  17  ? ARG g 17  . ? 1_555 ? 
386 AG6 7  CDL XB .   ? CDL g 103 . ? 1_555 ? 
387 AG7 17 TRP P  58  ? TRP c 58  . ? 1_555 ? 
388 AG7 17 VAL P  61  ? VAL c 61  . ? 1_555 ? 
389 AG7 17 SER P  65  ? SER c 65  . ? 1_555 ? 
390 AG7 17 THR P  66  ? THR c 66  . ? 1_555 ? 
391 AG7 17 THR P  213 ? THR c 213 . ? 1_555 ? 
392 AG7 17 PHE P  214 ? PHE c 214 . ? 1_555 ? 
393 AG7 17 ARG P  221 ? ARG c 221 . ? 1_555 ? 
394 AG7 17 HIS P  226 ? HIS c 226 . ? 1_555 ? 
395 AG7 17 PHE P  227 ? PHE c 227 . ? 1_555 ? 
396 AG7 17 THR P  228 ? THR c 228 . ? 1_555 ? 
397 AG7 17 HIS P  231 ? HIS c 231 . ? 1_555 ? 
398 AG7 17 HIS P  232 ? HIS c 232 . ? 1_555 ? 
399 AG7 17 PHE P  233 ? PHE c 233 . ? 1_555 ? 
400 AG7 17 GLY P  234 ? GLY c 234 . ? 1_555 ? 
401 AG7 17 CDL RB .   ? CDL c 305 . ? 1_555 ? 
402 AG7 17 HOH RC .   ? HOH c 432 . ? 1_555 ? 
403 AG7 17 HOH UC .   ? HOH f 201 . ? 1_555 ? 
404 AG8 12 TYR P  55  ? TYR c 55  . ? 1_555 ? 
405 AG8 12 ARG P  59  ? ARG c 59  . ? 1_555 ? 
406 AG8 12 ILE P  62  ? ILE c 62  . ? 1_555 ? 
407 AG8 12 ARG P  63  ? ARG c 63  . ? 1_555 ? 
408 AG8 12 PHE P  67  ? PHE c 67  . ? 1_555 ? 
409 AG8 12 VAL P  217 ? VAL c 217 . ? 1_555 ? 
410 AG8 12 PHE P  220 ? PHE c 220 . ? 1_555 ? 
411 AG8 12 LYS P  224 ? LYS c 224 . ? 1_555 ? 
412 AG8 12 HIS P  226 ? HIS c 226 . ? 1_555 ? 
413 AG8 12 PGV QB .   ? PGV c 304 . ? 1_555 ? 
414 AG8 12 LYS W  8   ? LYS j 8   . ? 1_555 ? 
415 AG8 12 THR W  27  ? THR j 27  . ? 1_555 ? 
416 AG9 3  ARG P  156 ? ARG c 156 . ? 1_555 ? 
417 AG9 3  PHE P  164 ? PHE c 164 . ? 1_555 ? 
418 AG9 3  PHE W  1   ? PHE j 1   . ? 1_555 ? 
419 AH1 8  LEU N  35  ? LEU a 35  . ? 1_555 ? 
420 AH1 8  TRP Q  98  ? TRP d 98  . ? 1_555 ? 
421 AH1 8  TYR Q  102 ? TYR d 102 . ? 1_555 ? 
422 AH1 8  LEU Z  27  ? LEU m 27  . ? 1_555 ? 
423 AH1 8  LEU Z  28  ? LEU m 28  . ? 1_555 ? 
424 AH1 8  TRP Z  32  ? TRP m 32  . ? 1_555 ? 
425 AH1 8  TYR Z  35  ? TYR m 35  . ? 1_555 ? 
426 AH1 8  HIS Z  36  ? HIS m 36  . ? 1_555 ? 
427 AH2 5  HIS O  52  ? HIS b 52  . ? 1_555 ? 
428 AH2 5  VAL O  61  ? VAL b 61  . ? 1_555 ? 
429 AH2 5  HIS R  5   ? HIS e 5   . ? 1_555 ? 
430 AH2 5  GLU R  6   ? GLU e 6   . ? 1_555 ? 
431 AH2 5  ASP R  8   ? ASP e 8   . ? 1_555 ? 
432 AH3 4  CYS S  60  ? CYS f 60  . ? 1_555 ? 
433 AH3 4  CYS S  62  ? CYS f 62  . ? 1_555 ? 
434 AH3 4  CYS S  82  ? CYS f 82  . ? 1_555 ? 
435 AH3 4  CYS S  85  ? CYS f 85  . ? 1_555 ? 
436 AH4 3  MET P  40  ? MET c 40  . ? 1_555 ? 
437 AH4 3  GLY T  63  ? GLY g 63  . ? 1_555 ? 
438 AH4 3  HOH VC .   ? HOH g 202 . ? 1_555 ? 
439 AH5 15 THR N  207 ? THR a 207 . ? 1_555 ? 
440 AH5 15 TYR P  181 ? TYR c 181 . ? 1_555 ? 
441 AH5 15 TYR P  182 ? TYR c 182 . ? 1_555 ? 
442 AH5 15 ALA P  184 ? ALA c 184 . ? 1_555 ? 
443 AH5 15 PHE P  186 ? PHE c 186 . ? 1_555 ? 
444 AH5 15 THR P  187 ? THR c 187 . ? 1_555 ? 
445 AH5 15 ILE P  188 ? ILE c 188 . ? 1_555 ? 
446 AH5 15 PHE P  198 ? PHE c 198 . ? 1_555 ? 
447 AH5 15 LEU P  206 ? LEU c 206 . ? 1_555 ? 
448 AH5 15 PGV NB .   ? PGV c 301 . ? 1_555 ? 
449 AH5 15 THR T  68  ? THR g 68  . ? 1_555 ? 
450 AH5 15 PHE T  69  ? PHE g 69  . ? 1_555 ? 
451 AH5 15 PHE T  70  ? PHE g 70  . ? 1_555 ? 
452 AH5 15 HIS T  71  ? HIS g 71  . ? 1_555 ? 
453 AH5 15 ASN T  76  ? ASN g 76  . ? 1_555 ? 
454 AH6 18 ASP A  300 ? ASP A 300 . ? 1_555 ? 
455 AH6 18 SER A  307 ? SER A 307 . ? 1_555 ? 
456 AH6 18 ILE A  311 ? ILE A 311 . ? 1_555 ? 
457 AH6 18 LEU B  78  ? LEU B 78  . ? 1_555 ? 
458 AH6 18 LEU B  81  ? LEU B 81  . ? 1_555 ? 
459 AH6 18 CHD MA .   ? CHD C 301 . ? 1_555 ? 
460 AH6 18 LEU P  131 ? LEU c 131 . ? 1_555 ? 
461 AH6 18 PEK PB .   ? PEK c 303 . ? 1_555 ? 
462 AH6 18 ALA T  1   ? ALA g 1   . ? 1_555 ? 
463 AH6 18 SER T  27  ? SER g 27  . ? 1_555 ? 
464 AH6 18 CYS T  31  ? CYS g 31  . ? 1_555 ? 
465 AH6 18 ASN T  34  ? ASN g 34  . ? 1_555 ? 
466 AH6 18 HIS T  38  ? HIS g 38  . ? 1_555 ? 
467 AH6 18 HOH VC .   ? HOH g 201 . ? 1_555 ? 
468 AH6 18 HOH VC .   ? HOH g 208 . ? 1_555 ? 
469 AH6 18 HOH VC .   ? HOH g 210 . ? 1_555 ? 
470 AH6 18 HOH VC .   ? HOH g 214 . ? 1_555 ? 
471 AH6 18 HOH VC .   ? HOH g 215 . ? 1_555 ? 
472 AH7 5  ASN N  422 ? ASN a 422 . ? 1_555 ? 
473 AH7 5  LEU N  433 ? LEU a 433 . ? 1_555 ? 
474 AH7 5  LEU O  7   ? LEU b 7   . ? 1_555 ? 
475 AH7 5  LEU O  28  ? LEU b 28  . ? 1_555 ? 
476 AH7 5  ARG V  43  ? ARG i 43  . ? 1_555 ? 
477 AH8 4  TYR W  32  ? TYR j 32  . ? 1_555 ? 
478 AH8 4  ARG W  33  ? ARG j 33  . ? 1_555 ? 
479 AH8 4  MET W  36  ? MET j 36  . ? 1_555 ? 
480 AH8 4  THR W  37  ? THR j 37  . ? 1_555 ? 
481 AH9 8  PHE N  2   ? PHE a 2   . ? 1_555 ? 
482 AH9 8  LEU N  18  ? LEU a 18  . ? 1_555 ? 
483 AH9 8  PHE N  400 ? PHE a 400 . ? 1_555 ? 
484 AH9 8  ILE Y  11  ? ILE l 11  . ? 1_555 ? 
485 AH9 8  PHE Y  13  ? PHE l 13  . ? 1_555 ? 
486 AH9 8  MET Y  24  ? MET l 24  . ? 1_555 ? 
487 AH9 8  PHE Y  28  ? PHE l 28  . ? 1_555 ? 
488 AH9 8  PHE Y  29  ? PHE l 29  . ? 1_555 ? 
489 AI1 18 TRP N  236 ? TRP a 236 . ? 1_555 ? 
490 AI1 18 PHE N  238 ? PHE a 238 . ? 1_555 ? 
491 AI1 18 GLY N  239 ? GLY a 239 . ? 1_555 ? 
492 AI1 18 PRO N  241 ? PRO a 241 . ? 1_555 ? 
493 AI1 18 GLU N  242 ? GLU a 242 . ? 1_555 ? 
494 AI1 18 VAL N  243 ? VAL a 243 . ? 1_555 ? 
495 AI1 18 ILE N  245 ? ILE a 245 . ? 1_555 ? 
496 AI1 18 LEU N  246 ? LEU a 246 . ? 1_555 ? 
497 AI1 18 ILE N  247 ? ILE a 247 . ? 1_555 ? 
498 AI1 18 LEU N  248 ? LEU a 248 . ? 1_555 ? 
499 AI1 18 ILE N  280 ? ILE a 280 . ? 1_555 ? 
500 AI1 18 GLY N  284 ? GLY a 284 . ? 1_555 ? 
501 AI1 18 VAL N  287 ? VAL a 287 . ? 1_555 ? 
502 AI1 18 HIS N  290 ? HIS a 290 . ? 1_555 ? 
503 AI1 18 ILE N  312 ? ILE a 312 . ? 1_555 ? 
504 AI1 18 HEA EB .   ? HEA a 602 . ? 1_555 ? 
505 AI1 18 CU  FB .   ? CU  a 603 . ? 1_555 ? 
506 AI1 18 CMO KB .   ? CMO a 608 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5W97 
_atom_sites.fract_transf_matrix[1][1]   0.005609 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005291 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004785 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CU 
FE 
MG 
N  
NA 
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1     N  N   . FME A  1  1   ? -45.686 39.832  24.404  1.00 62.09  ? 1   FME A N   1 
HETATM 2     C  CN  . FME A  1  1   ? -44.685 39.019  24.771  1.00 59.18  ? 1   FME A CN  1 
HETATM 3     O  O1  . FME A  1  1   ? -44.236 39.018  25.883  1.00 53.48  ? 1   FME A O1  1 
HETATM 4     C  CA  . FME A  1  1   ? -46.035 39.702  23.007  1.00 62.65  ? 1   FME A CA  1 
HETATM 5     C  CB  . FME A  1  1   ? -47.221 40.589  22.622  1.00 69.68  ? 1   FME A CB  1 
HETATM 6     C  CG  . FME A  1  1   ? -48.532 39.797  22.548  1.00 82.42  ? 1   FME A CG  1 
HETATM 7     S  SD  . FME A  1  1   ? -48.584 38.447  23.707  1.00 98.10  ? 1   FME A SD  1 
HETATM 8     C  CE  . FME A  1  1   ? -50.213 38.650  24.374  1.00 100.21 ? 1   FME A CE  1 
HETATM 9     C  C   . FME A  1  1   ? -44.742 39.917  22.256  1.00 54.68  ? 1   FME A C   1 
HETATM 10    O  O   . FME A  1  1   ? -44.368 39.068  21.477  1.00 55.04  ? 1   FME A O   1 
ATOM   11    N  N   . PHE A  1  2   ? -44.003 40.978  22.567  1.00 48.19  ? 2   PHE A N   1 
ATOM   12    C  CA  . PHE A  1  2   ? -42.731 41.230  21.919  1.00 46.94  ? 2   PHE A CA  1 
ATOM   13    C  C   . PHE A  1  2   ? -41.748 40.071  22.142  1.00 46.33  ? 2   PHE A C   1 
ATOM   14    O  O   . PHE A  1  2   ? -41.183 39.572  21.208  1.00 47.45  ? 2   PHE A O   1 
ATOM   15    C  CB  . PHE A  1  2   ? -42.117 42.559  22.380  1.00 47.08  ? 2   PHE A CB  1 
ATOM   16    C  CG  . PHE A  1  2   ? -40.848 42.892  21.668  1.00 50.94  ? 2   PHE A CG  1 
ATOM   17    C  CD1 . PHE A  1  2   ? -39.628 42.393  22.127  1.00 50.92  ? 2   PHE A CD1 1 
ATOM   18    C  CD2 . PHE A  1  2   ? -40.866 43.656  20.498  1.00 51.22  ? 2   PHE A CD2 1 
ATOM   19    C  CE1 . PHE A  1  2   ? -38.452 42.651  21.433  1.00 52.27  ? 2   PHE A CE1 1 
ATOM   20    C  CE2 . PHE A  1  2   ? -39.685 43.923  19.813  1.00 50.42  ? 2   PHE A CE2 1 
ATOM   21    C  CZ  . PHE A  1  2   ? -38.481 43.415  20.284  1.00 47.24  ? 2   PHE A CZ  1 
ATOM   22    N  N   . ILE A  1  3   ? -41.564 39.639  23.377  1.00 45.92  ? 3   ILE A N   1 
ATOM   23    C  CA  . ILE A  1  3   ? -40.580 38.628  23.683  1.00 46.12  ? 3   ILE A CA  1 
ATOM   24    C  C   . ILE A  1  3   ? -40.997 37.281  23.082  1.00 45.60  ? 3   ILE A C   1 
ATOM   25    O  O   . ILE A  1  3   ? -40.206 36.660  22.372  1.00 43.77  ? 3   ILE A O   1 
ATOM   26    C  CB  . ILE A  1  3   ? -40.317 38.570  25.212  1.00 49.71  ? 3   ILE A CB  1 
ATOM   27    C  CG1 . ILE A  1  3   ? -39.433 39.756  25.598  1.00 53.01  ? 3   ILE A CG1 1 
ATOM   28    C  CG2 . ILE A  1  3   ? -39.616 37.287  25.640  1.00 50.39  ? 3   ILE A CG2 1 
ATOM   29    C  CD1 . ILE A  1  3   ? -39.286 39.963  27.094  1.00 56.50  ? 3   ILE A CD1 1 
ATOM   30    N  N   . ASN A  1  4   ? -42.216 36.830  23.380  1.00 42.98  ? 4   ASN A N   1 
ATOM   31    C  CA  . ASN A  1  4   ? -42.809 35.655  22.730  1.00 41.69  ? 4   ASN A CA  1 
ATOM   32    C  C   . ASN A  1  4   ? -42.604 35.662  21.229  1.00 37.85  ? 4   ASN A C   1 
ATOM   33    O  O   . ASN A  1  4   ? -42.266 34.629  20.640  1.00 35.87  ? 4   ASN A O   1 
ATOM   34    C  CB  . ASN A  1  4   ? -44.321 35.562  22.972  1.00 47.31  ? 4   ASN A CB  1 
ATOM   35    C  CG  . ASN A  1  4   ? -44.691 34.861  24.258  1.00 50.91  ? 4   ASN A CG  1 
ATOM   36    O  OD1 . ASN A  1  4   ? -43.849 34.471  25.056  1.00 52.30  ? 4   ASN A OD1 1 
ATOM   37    N  ND2 . ASN A  1  4   ? -45.991 34.697  24.462  1.00 59.98  ? 4   ASN A ND2 1 
ATOM   38    N  N   . ARG A  1  5   ? -42.836 36.810  20.606  1.00 32.17  ? 5   ARG A N   1 
ATOM   39    C  CA  . ARG A  1  5   ? -42.837 36.871  19.144  1.00 32.56  ? 5   ARG A CA  1 
ATOM   40    C  C   . ARG A  1  5   ? -41.434 36.834  18.517  1.00 32.10  ? 5   ARG A C   1 
ATOM   41    O  O   . ARG A  1  5   ? -41.222 36.123  17.529  1.00 31.54  ? 5   ARG A O   1 
ATOM   42    C  CB  . ARG A  1  5   ? -43.581 38.121  18.645  1.00 31.11  ? 5   ARG A CB  1 
ATOM   43    C  CG  . ARG A  1  5   ? -43.503 38.265  17.162  1.00 30.28  ? 5   ARG A CG  1 
ATOM   44    C  CD  . ARG A  1  5   ? -44.706 38.887  16.514  1.00 31.27  ? 5   ARG A CD  1 
ATOM   45    N  NE  . ARG A  1  5   ? -44.582 38.678  15.077  1.00 29.81  ? 5   ARG A NE  1 
ATOM   46    C  CZ  . ARG A  1  5   ? -45.383 39.173  14.166  1.00 29.22  ? 5   ARG A CZ  1 
ATOM   47    N  NH1 . ARG A  1  5   ? -46.389 39.945  14.515  1.00 32.86  ? 5   ARG A NH1 1 
ATOM   48    N  NH2 . ARG A  1  5   ? -45.156 38.911  12.890  1.00 28.37  ? 5   ARG A NH2 1 
ATOM   49    N  N   . TRP A  1  6   ? -40.527 37.614  19.108  1.00 29.65  ? 6   TRP A N   1 
ATOM   50    C  CA  . TRP A  1  6   ? -39.259 37.983  18.532  1.00 30.54  ? 6   TRP A CA  1 
ATOM   51    C  C   . TRP A  1  6   ? -38.041 37.315  19.159  1.00 31.64  ? 6   TRP A C   1 
ATOM   52    O  O   . TRP A  1  6   ? -37.015 37.171  18.487  1.00 31.25  ? 6   TRP A O   1 
ATOM   53    C  CB  . TRP A  1  6   ? -39.113 39.511  18.553  1.00 30.94  ? 6   TRP A CB  1 
ATOM   54    C  CG  . TRP A  1  6   ? -40.085 40.128  17.617  1.00 29.64  ? 6   TRP A CG  1 
ATOM   55    C  CD1 . TRP A  1  6   ? -41.152 40.889  17.935  1.00 29.08  ? 6   TRP A CD1 1 
ATOM   56    C  CD2 . TRP A  1  6   ? -40.098 39.975  16.202  1.00 28.69  ? 6   TRP A CD2 1 
ATOM   57    N  NE1 . TRP A  1  6   ? -41.840 41.228  16.805  1.00 29.67  ? 6   TRP A NE1 1 
ATOM   58    C  CE2 . TRP A  1  6   ? -41.204 40.701  15.720  1.00 27.82  ? 6   TRP A CE2 1 
ATOM   59    C  CE3 . TRP A  1  6   ? -39.254 39.324  15.290  1.00 29.55  ? 6   TRP A CE3 1 
ATOM   60    C  CZ2 . TRP A  1  6   ? -41.533 40.773  14.367  1.00 28.95  ? 6   TRP A CZ2 1 
ATOM   61    C  CZ3 . TRP A  1  6   ? -39.570 39.390  13.929  1.00 31.40  ? 6   TRP A CZ3 1 
ATOM   62    C  CH2 . TRP A  1  6   ? -40.730 40.115  13.482  1.00 30.16  ? 6   TRP A CH2 1 
ATOM   63    N  N   . LEU A  1  7   ? -38.138 36.901  20.412  1.00 30.43  ? 7   LEU A N   1 
ATOM   64    C  CA  . LEU A  1  7   ? -37.062 36.133  21.041  1.00 30.41  ? 7   LEU A CA  1 
ATOM   65    C  C   . LEU A  1  7   ? -37.366 34.642  21.078  1.00 29.45  ? 7   LEU A C   1 
ATOM   66    O  O   . LEU A  1  7   ? -36.442 33.845  21.159  1.00 28.88  ? 7   LEU A O   1 
ATOM   67    C  CB  . LEU A  1  7   ? -36.798 36.636  22.472  1.00 33.09  ? 7   LEU A CB  1 
ATOM   68    C  CG  . LEU A  1  7   ? -35.856 37.846  22.637  1.00 36.78  ? 7   LEU A CG  1 
ATOM   69    C  CD1 . LEU A  1  7   ? -35.950 38.860  21.531  1.00 35.11  ? 7   LEU A CD1 1 
ATOM   70    C  CD2 . LEU A  1  7   ? -36.118 38.535  23.955  1.00 38.86  ? 7   LEU A CD2 1 
ATOM   71    N  N   . PHE A  1  8   ? -38.647 34.257  21.104  1.00 28.91  ? 8   PHE A N   1 
ATOM   72    C  CA  . PHE A  1  8   ? -39.038 32.862  21.212  1.00 25.84  ? 8   PHE A CA  1 
ATOM   73    C  C   . PHE A  1  8   ? -39.736 32.382  19.950  1.00 25.42  ? 8   PHE A C   1 
ATOM   74    O  O   . PHE A  1  8   ? -40.567 31.489  20.022  1.00 29.85  ? 8   PHE A O   1 
ATOM   75    C  CB  . PHE A  1  8   ? -39.991 32.638  22.391  1.00 27.83  ? 8   PHE A CB  1 
ATOM   76    C  CG  . PHE A  1  8   ? -39.505 33.121  23.751  1.00 28.15  ? 8   PHE A CG  1 
ATOM   77    C  CD1 . PHE A  1  8   ? -38.191 33.506  24.018  1.00 27.54  ? 8   PHE A CD1 1 
ATOM   78    C  CD2 . PHE A  1  8   ? -40.408 33.093  24.822  1.00 29.18  ? 8   PHE A CD2 1 
ATOM   79    C  CE1 . PHE A  1  8   ? -37.798 33.921  25.296  1.00 27.36  ? 8   PHE A CE1 1 
ATOM   80    C  CE2 . PHE A  1  8   ? -40.018 33.500  26.097  1.00 30.76  ? 8   PHE A CE2 1 
ATOM   81    C  CZ  . PHE A  1  8   ? -38.700 33.929  26.325  1.00 28.61  ? 8   PHE A CZ  1 
ATOM   82    N  N   . SER A  1  9   ? -39.411 32.949  18.792  1.00 24.37  ? 9   SER A N   1 
ATOM   83    C  CA  . SER A  1  9   ? -40.123 32.641  17.546  1.00 22.77  ? 9   SER A CA  1 
ATOM   84    C  C   . SER A  1  9   ? -40.006 31.187  17.145  1.00 22.39  ? 9   SER A C   1 
ATOM   85    O  O   . SER A  1  9   ? -38.932 30.604  17.233  1.00 23.70  ? 9   SER A O   1 
ATOM   86    C  CB  . SER A  1  9   ? -39.551 33.447  16.389  1.00 22.24  ? 9   SER A CB  1 
ATOM   87    O  OG  . SER A  1  9   ? -40.332 33.262  15.221  1.00 24.01  ? 9   SER A OG  1 
ATOM   88    N  N   . THR A  1  10  ? -41.115 30.636  16.677  1.00 22.29  ? 10  THR A N   1 
ATOM   89    C  CA  . THR A  1  10  ? -41.187 29.383  15.922  1.00 24.10  ? 10  THR A CA  1 
ATOM   90    C  C   . THR A  1  10  ? -41.850 29.601  14.554  1.00 24.05  ? 10  THR A C   1 
ATOM   91    O  O   . THR A  1  10  ? -42.369 28.678  13.964  1.00 25.30  ? 10  THR A O   1 
ATOM   92    C  CB  . THR A  1  10  ? -41.968 28.311  16.687  1.00 24.81  ? 10  THR A CB  1 
ATOM   93    O  OG1 . THR A  1  10  ? -43.233 28.857  17.037  1.00 26.10  ? 10  THR A OG1 1 
ATOM   94    C  CG2 . THR A  1  10  ? -41.238 27.935  17.951  1.00 24.88  ? 10  THR A CG2 1 
ATOM   95    N  N   . ASN A  1  11  ? -41.736 30.814  14.021  1.00 24.81  ? 11  ASN A N   1 
ATOM   96    C  CA  . ASN A  1  11  ? -42.329 31.201  12.737  1.00 24.19  ? 11  ASN A CA  1 
ATOM   97    C  C   . ASN A  1  11  ? -41.257 31.523  11.727  1.00 24.01  ? 11  ASN A C   1 
ATOM   98    O  O   . ASN A  1  11  ? -40.395 32.361  11.994  1.00 21.99  ? 11  ASN A O   1 
ATOM   99    C  CB  . ASN A  1  11  ? -43.142 32.471  12.937  1.00 23.75  ? 11  ASN A CB  1 
ATOM   100   C  CG  . ASN A  1  11  ? -43.866 32.853  11.723  1.00 22.26  ? 11  ASN A CG  1 
ATOM   101   O  OD1 . ASN A  1  11  ? -43.436 33.706  10.981  1.00 23.05  ? 11  ASN A OD1 1 
ATOM   102   N  ND2 . ASN A  1  11  ? -44.961 32.182  11.483  1.00 25.06  ? 11  ASN A ND2 1 
ATOM   103   N  N   . HIS A  1  12  ? -41.368 30.905  10.559  1.00 24.09  ? 12  HIS A N   1 
ATOM   104   C  CA  . HIS A  1  12  ? -40.342 30.998  9.532   1.00 24.40  ? 12  HIS A CA  1 
ATOM   105   C  C   . HIS A  1  12  ? -40.102 32.385  8.952   1.00 25.46  ? 12  HIS A C   1 
ATOM   106   O  O   . HIS A  1  12  ? -38.995 32.712  8.548   1.00 27.13  ? 12  HIS A O   1 
ATOM   107   C  CB  . HIS A  1  12  ? -40.626 30.004  8.414   1.00 24.73  ? 12  HIS A CB  1 
ATOM   108   C  CG  . HIS A  1  12  ? -41.742 30.394  7.510   1.00 26.34  ? 12  HIS A CG  1 
ATOM   109   N  ND1 . HIS A  1  12  ? -41.527 31.022  6.300   1.00 27.90  ? 12  HIS A ND1 1 
ATOM   110   C  CD2 . HIS A  1  12  ? -43.075 30.204  7.604   1.00 26.99  ? 12  HIS A CD2 1 
ATOM   111   C  CE1 . HIS A  1  12  ? -42.683 31.231  5.702   1.00 27.66  ? 12  HIS A CE1 1 
ATOM   112   N  NE2 . HIS A  1  12  ? -43.639 30.755  6.477   1.00 28.44  ? 12  HIS A NE2 1 
ATOM   113   N  N   . LYS A  1  13  ? -41.148 33.188  8.923   1.00 26.84  ? 13  LYS A N   1 
ATOM   114   C  CA  . LYS A  1  13  ? -41.135 34.544  8.386   1.00 25.60  ? 13  LYS A CA  1 
ATOM   115   C  C   . LYS A  1  13  ? -40.484 35.511  9.381   1.00 23.85  ? 13  LYS A C   1 
ATOM   116   O  O   . LYS A  1  13  ? -39.675 36.335  9.001   1.00 22.95  ? 13  LYS A O   1 
ATOM   117   C  CB  . LYS A  1  13  ? -42.575 35.021  8.109   1.00 27.80  ? 13  LYS A CB  1 
ATOM   118   C  CG  . LYS A  1  13  ? -43.470 34.098  7.285   1.00 30.33  ? 13  LYS A CG  1 
ATOM   119   C  CD  . LYS A  1  13  ? -44.892 34.649  7.137   1.00 29.77  ? 13  LYS A CD  1 
ATOM   120   C  CE  . LYS A  1  13  ? -45.745 33.671  6.350   1.00 30.20  ? 13  LYS A CE  1 
ATOM   121   N  NZ  . LYS A  1  13  ? -46.277 32.524  7.152   1.00 30.16  ? 13  LYS A NZ  1 
ATOM   122   N  N   . ASP A  1  14  ? -40.858 35.425  10.645  1.00 24.44  ? 14  ASP A N   1 
ATOM   123   C  CA  . ASP A  1  14  ? -40.208 36.242  11.660  1.00 27.44  ? 14  ASP A CA  1 
ATOM   124   C  C   . ASP A  1  14  ? -38.742 35.904  11.829  1.00 26.48  ? 14  ASP A C   1 
ATOM   125   O  O   . ASP A  1  14  ? -37.926 36.794  12.005  1.00 27.04  ? 14  ASP A O   1 
ATOM   126   C  CB  . ASP A  1  14  ? -40.909 36.122  13.023  1.00 30.15  ? 14  ASP A CB  1 
ATOM   127   C  CG  . ASP A  1  14  ? -42.272 36.839  13.072  1.00 27.86  ? 14  ASP A CG  1 
ATOM   128   O  OD1 . ASP A  1  14  ? -42.673 37.451  12.050  1.00 24.61  ? 14  ASP A OD1 1 
ATOM   129   O  OD2 . ASP A  1  14  ? -42.921 36.738  14.144  1.00 25.12  ? 14  ASP A OD2 1 
ATOM   130   N  N   . ILE A  1  15  ? -38.388 34.629  11.761  1.00 26.64  ? 15  ILE A N   1 
ATOM   131   C  CA  . ILE A  1  15  ? -36.976 34.228  11.891  1.00 24.30  ? 15  ILE A CA  1 
ATOM   132   C  C   . ILE A  1  15  ? -36.231 34.746  10.680  1.00 25.18  ? 15  ILE A C   1 
ATOM   133   O  O   . ILE A  1  15  ? -35.129 35.321  10.816  1.00 25.27  ? 15  ILE A O   1 
ATOM   134   C  CB  . ILE A  1  15  ? -36.859 32.718  12.056  1.00 24.85  ? 15  ILE A CB  1 
ATOM   135   C  CG1 . ILE A  1  15  ? -37.388 32.340  13.447  1.00 24.41  ? 15  ILE A CG1 1 
ATOM   136   C  CG2 . ILE A  1  15  ? -35.418 32.232  11.885  1.00 26.93  ? 15  ILE A CG2 1 
ATOM   137   C  CD1 . ILE A  1  15  ? -37.780 30.890  13.619  1.00 24.65  ? 15  ILE A CD1 1 
ATOM   138   N  N   . GLY A  1  16  ? -36.855 34.596  9.507   1.00 23.72  ? 16  GLY A N   1 
ATOM   139   C  CA  . GLY A  1  16  ? -36.333 35.178  8.283   1.00 25.14  ? 16  GLY A CA  1 
ATOM   140   C  C   . GLY A  1  16  ? -36.069 36.671  8.400   1.00 26.53  ? 16  GLY A C   1 
ATOM   141   O  O   . GLY A  1  16  ? -35.032 37.170  7.984   1.00 26.91  ? 16  GLY A O   1 
ATOM   142   N  N   . THR A  1  17  ? -37.043 37.379  8.954   1.00 26.82  ? 17  THR A N   1 
ATOM   143   C  CA  . THR A  1  17  ? -36.947 38.814  9.168   1.00 25.42  ? 17  THR A CA  1 
ATOM   144   C  C   . THR A  1  17  ? -35.783 39.151  10.076  1.00 25.50  ? 17  THR A C   1 
ATOM   145   O  O   . THR A  1  17  ? -35.002 40.042  9.760   1.00 24.98  ? 17  THR A O   1 
ATOM   146   C  CB  . THR A  1  17  ? -38.268 39.362  9.714   1.00 25.14  ? 17  THR A CB  1 
ATOM   147   O  OG1 . THR A  1  17  ? -39.229 39.328  8.655   1.00 25.80  ? 17  THR A OG1 1 
ATOM   148   C  CG2 . THR A  1  17  ? -38.121 40.751  10.217  1.00 25.31  ? 17  THR A CG2 1 
ATOM   149   N  N   . LEU A  1  18  ? -35.633 38.416  11.167  1.00 25.92  ? 18  LEU A N   1 
ATOM   150   C  CA  . LEU A  1  18  ? -34.467 38.585  12.020  1.00 26.62  ? 18  LEU A CA  1 
ATOM   151   C  C   . LEU A  1  18  ? -33.137 38.421  11.261  1.00 25.28  ? 18  LEU A C   1 
ATOM   152   O  O   . LEU A  1  18  ? -32.250 39.254  11.346  1.00 25.03  ? 18  LEU A O   1 
ATOM   153   C  CB  . LEU A  1  18  ? -34.514 37.590  13.188  1.00 29.35  ? 18  LEU A CB  1 
ATOM   154   C  CG  . LEU A  1  18  ? -35.575 37.785  14.268  1.00 29.48  ? 18  LEU A CG  1 
ATOM   155   C  CD1 . LEU A  1  18  ? -35.606 36.567  15.176  1.00 30.87  ? 18  LEU A CD1 1 
ATOM   156   C  CD2 . LEU A  1  18  ? -35.282 39.041  15.069  1.00 30.85  ? 18  LEU A CD2 1 
ATOM   157   N  N   . TYR A  1  19  ? -33.017 37.354  10.497  1.00 25.25  ? 19  TYR A N   1 
ATOM   158   C  CA  . TYR A  1  19  ? -31.818 37.158  9.693   1.00 24.83  ? 19  TYR A CA  1 
ATOM   159   C  C   . TYR A  1  19  ? -31.563 38.359  8.809   1.00 24.30  ? 19  TYR A C   1 
ATOM   160   O  O   . TYR A  1  19  ? -30.433 38.822  8.749   1.00 26.77  ? 19  TYR A O   1 
ATOM   161   C  CB  . TYR A  1  19  ? -31.916 35.922  8.828   1.00 24.22  ? 19  TYR A CB  1 
ATOM   162   C  CG  . TYR A  1  19  ? -31.471 34.621  9.474   1.00 24.73  ? 19  TYR A CG  1 
ATOM   163   C  CD1 . TYR A  1  19  ? -30.117 34.313  9.599   1.00 25.15  ? 19  TYR A CD1 1 
ATOM   164   C  CD2 . TYR A  1  19  ? -32.394 33.656  9.863   1.00 23.60  ? 19  TYR A CD2 1 
ATOM   165   C  CE1 . TYR A  1  19  ? -29.704 33.106  10.120  1.00 24.33  ? 19  TYR A CE1 1 
ATOM   166   C  CE2 . TYR A  1  19  ? -31.982 32.446  10.388  1.00 23.32  ? 19  TYR A CE2 1 
ATOM   167   C  CZ  . TYR A  1  19  ? -30.646 32.167  10.519  1.00 23.72  ? 19  TYR A CZ  1 
ATOM   168   O  OH  . TYR A  1  19  ? -30.233 30.940  11.063  1.00 25.09  ? 19  TYR A OH  1 
ATOM   169   N  N   . LEU A  1  20  ? -32.586 38.890  8.147   1.00 23.02  ? 20  LEU A N   1 
ATOM   170   C  CA  . LEU A  1  20  ? -32.364 40.041  7.279   1.00 24.23  ? 20  LEU A CA  1 
ATOM   171   C  C   . LEU A  1  20  ? -31.850 41.252  8.036   1.00 25.64  ? 20  LEU A C   1 
ATOM   172   O  O   . LEU A  1  20  ? -30.983 41.940  7.515   1.00 27.20  ? 20  LEU A O   1 
ATOM   173   C  CB  . LEU A  1  20  ? -33.589 40.417  6.511   1.00 24.28  ? 20  LEU A CB  1 
ATOM   174   C  CG  . LEU A  1  20  ? -33.957 39.355  5.500   1.00 26.96  ? 20  LEU A CG  1 
ATOM   175   C  CD1 . LEU A  1  20  ? -35.320 39.722  4.911   1.00 27.84  ? 20  LEU A CD1 1 
ATOM   176   C  CD2 . LEU A  1  20  ? -32.899 39.195  4.415   1.00 26.94  ? 20  LEU A CD2 1 
ATOM   177   N  N   . LEU A  1  21  ? -32.380 41.526  9.234   1.00 25.92  ? 21  LEU A N   1 
ATOM   178   C  CA  . LEU A  1  21  ? -31.896 42.640  10.018  1.00 28.26  ? 21  LEU A CA  1 
ATOM   179   C  C   . LEU A  1  21  ? -30.410 42.454  10.452  1.00 31.44  ? 21  LEU A C   1 
ATOM   180   O  O   . LEU A  1  21  ? -29.592 43.412  10.432  1.00 30.09  ? 21  LEU A O   1 
ATOM   181   C  CB  . LEU A  1  21  ? -32.743 42.837  11.254  1.00 30.51  ? 21  LEU A CB  1 
ATOM   182   C  CG  . LEU A  1  21  ? -34.131 43.423  11.002  1.00 35.86  ? 21  LEU A CG  1 
ATOM   183   C  CD1 . LEU A  1  21  ? -35.028 43.308  12.226  1.00 36.96  ? 21  LEU A CD1 1 
ATOM   184   C  CD2 . LEU A  1  21  ? -34.035 44.877  10.597  1.00 39.29  ? 21  LEU A CD2 1 
ATOM   185   N  N   . PHE A  1  22  ? -30.081 41.227  10.855  1.00 28.04  ? 22  PHE A N   1 
ATOM   186   C  CA  . PHE A  1  22  ? -28.783 40.937  11.342  1.00 26.00  ? 22  PHE A CA  1 
ATOM   187   C  C   . PHE A  1  22  ? -27.796 41.115  10.215  1.00 25.96  ? 22  PHE A C   1 
ATOM   188   O  O   . PHE A  1  22  ? -26.800 41.799  10.350  1.00 26.00  ? 22  PHE A O   1 
ATOM   189   C  CB  . PHE A  1  22  ? -28.750 39.517  11.857  1.00 27.59  ? 22  PHE A CB  1 
ATOM   190   C  CG  . PHE A  1  22  ? -27.401 39.083  12.304  1.00 28.87  ? 22  PHE A CG  1 
ATOM   191   C  CD1 . PHE A  1  22  ? -26.965 39.373  13.561  1.00 30.28  ? 22  PHE A CD1 1 
ATOM   192   C  CD2 . PHE A  1  22  ? -26.550 38.415  11.428  1.00 29.88  ? 22  PHE A CD2 1 
ATOM   193   C  CE1 . PHE A  1  22  ? -25.701 38.966  13.962  1.00 34.10  ? 22  PHE A CE1 1 
ATOM   194   C  CE2 . PHE A  1  22  ? -25.282 38.014  11.811  1.00 29.44  ? 22  PHE A CE2 1 
ATOM   195   C  CZ  . PHE A  1  22  ? -24.860 38.277  13.084  1.00 31.18  ? 22  PHE A CZ  1 
ATOM   196   N  N   . GLY A  1  23  ? -28.083 40.513  9.086   1.00 26.11  ? 23  GLY A N   1 
ATOM   197   C  CA  . GLY A  1  23  ? -27.198 40.622  7.933   1.00 26.40  ? 23  GLY A CA  1 
ATOM   198   C  C   . GLY A  1  23  ? -26.958 42.048  7.430   1.00 25.24  ? 23  GLY A C   1 
ATOM   199   O  O   . GLY A  1  23  ? -25.861 42.371  7.012   1.00 26.62  ? 23  GLY A O   1 
ATOM   200   N  N   . ALA A  1  24  ? -27.991 42.872  7.435   1.00 23.25  ? 24  ALA A N   1 
ATOM   201   C  CA  . ALA A  1  24  ? -27.877 44.262  7.044   1.00 24.36  ? 24  ALA A CA  1 
ATOM   202   C  C   . ALA A  1  24  ? -26.969 45.037  8.007   1.00 25.38  ? 24  ALA A C   1 
ATOM   203   O  O   . ALA A  1  24  ? -26.182 45.901  7.590   1.00 25.34  ? 24  ALA A O   1 
ATOM   204   C  CB  . ALA A  1  24  ? -29.245 44.894  7.022   1.00 26.06  ? 24  ALA A CB  1 
ATOM   205   N  N   . TRP A  1  25  ? -27.082 44.731  9.295   1.00 25.95  ? 25  TRP A N   1 
ATOM   206   C  CA  . TRP A  1  25  ? -26.218 45.336  10.290  1.00 26.79  ? 25  TRP A CA  1 
ATOM   207   C  C   . TRP A  1  25  ? -24.730 44.881  10.077  1.00 29.75  ? 25  TRP A C   1 
ATOM   208   O  O   . TRP A  1  25  ? -23.805 45.723  9.938   1.00 29.02  ? 25  TRP A O   1 
ATOM   209   C  CB  . TRP A  1  25  ? -26.733 45.020  11.680  1.00 25.83  ? 25  TRP A CB  1 
ATOM   210   C  CG  . TRP A  1  25  ? -26.150 45.881  12.674  1.00 26.87  ? 25  TRP A CG  1 
ATOM   211   C  CD1 . TRP A  1  25  ? -26.544 47.129  12.981  1.00 28.52  ? 25  TRP A CD1 1 
ATOM   212   C  CD2 . TRP A  1  25  ? -25.012 45.602  13.475  1.00 28.50  ? 25  TRP A CD2 1 
ATOM   213   N  NE1 . TRP A  1  25  ? -25.728 47.656  13.950  1.00 28.40  ? 25  TRP A NE1 1 
ATOM   214   C  CE2 . TRP A  1  25  ? -24.775 46.733  14.267  1.00 28.40  ? 25  TRP A CE2 1 
ATOM   215   C  CE3 . TRP A  1  25  ? -24.172 44.489  13.616  1.00 29.82  ? 25  TRP A CE3 1 
ATOM   216   C  CZ2 . TRP A  1  25  ? -23.763 46.780  15.205  1.00 28.92  ? 25  TRP A CZ2 1 
ATOM   217   C  CZ3 . TRP A  1  25  ? -23.132 44.545  14.530  1.00 29.24  ? 25  TRP A CZ3 1 
ATOM   218   C  CH2 . TRP A  1  25  ? -22.933 45.681  15.312  1.00 30.36  ? 25  TRP A CH2 1 
ATOM   219   N  N   . ALA A  1  26  ? -24.519 43.564  9.979   1.00 28.01  ? 26  ALA A N   1 
ATOM   220   C  CA  . ALA A  1  26  ? -23.197 42.996  9.670   1.00 27.45  ? 26  ALA A CA  1 
ATOM   221   C  C   . ALA A  1  26  ? -22.614 43.625  8.430   1.00 27.57  ? 26  ALA A C   1 
ATOM   222   O  O   . ALA A  1  26  ? -21.421 43.932  8.384   1.00 26.45  ? 26  ALA A O   1 
ATOM   223   C  CB  . ALA A  1  26  ? -23.300 41.507  9.473   1.00 28.34  ? 26  ALA A CB  1 
ATOM   224   N  N   . GLY A  1  27  ? -23.464 43.854  7.434   1.00 25.19  ? 27  GLY A N   1 
ATOM   225   C  CA  . GLY A  1  27  ? -22.998 44.449  6.208   1.00 26.99  ? 27  GLY A CA  1 
ATOM   226   C  C   . GLY A  1  27  ? -22.447 45.859  6.384   1.00 28.94  ? 27  GLY A C   1 
ATOM   227   O  O   . GLY A  1  27  ? -21.558 46.286  5.632   1.00 29.08  ? 27  GLY A O   1 
ATOM   228   N  N   . MET A  1  28  ? -23.007 46.599  7.337   1.00 28.69  ? 28  MET A N   1 
ATOM   229   C  CA  . MET A  1  28  ? -22.529 47.928  7.621   1.00 29.18  ? 28  MET A CA  1 
ATOM   230   C  C   . MET A  1  28  ? -21.119 47.823  8.129   1.00 28.89  ? 28  MET A C   1 
ATOM   231   O  O   . MET A  1  28  ? -20.252 48.513  7.625   1.00 24.10  ? 28  MET A O   1 
ATOM   232   C  CB  . MET A  1  28  ? -23.420 48.625  8.627   1.00 29.84  ? 28  MET A CB  1 
ATOM   233   C  CG  . MET A  1  28  ? -24.776 49.007  8.074   1.00 30.02  ? 28  MET A CG  1 
ATOM   234   S  SD  . MET A  1  28  ? -24.695 49.843  6.488   1.00 31.70  ? 28  MET A SD  1 
ATOM   235   C  CE  . MET A  1  28  ? -25.851 48.906  5.513   1.00 36.06  ? 28  MET A CE  1 
ATOM   236   N  N   . VAL A  1  29  ? -20.918 46.885  9.059   1.00 30.21  ? 29  VAL A N   1 
ATOM   237   C  CA  . VAL A  1  29  ? -19.620 46.625  9.673   1.00 31.74  ? 29  VAL A CA  1 
ATOM   238   C  C   . VAL A  1  29  ? -18.569 46.222  8.629   1.00 32.25  ? 29  VAL A C   1 
ATOM   239   O  O   . VAL A  1  29  ? -17.440 46.731  8.649   1.00 34.86  ? 29  VAL A O   1 
ATOM   240   C  CB  . VAL A  1  29  ? -19.659 45.490  10.730  1.00 31.87  ? 29  VAL A CB  1 
ATOM   241   C  CG1 . VAL A  1  29  ? -18.258 45.248  11.291  1.00 32.56  ? 29  VAL A CG1 1 
ATOM   242   C  CG2 . VAL A  1  29  ? -20.616 45.783  11.872  1.00 30.44  ? 29  VAL A CG2 1 
ATOM   243   N  N   . GLY A  1  30  ? -18.930 45.303  7.747   1.00 28.30  ? 30  GLY A N   1 
ATOM   244   C  CA  . GLY A  1  30  ? -18.006 44.816  6.739   1.00 28.08  ? 30  GLY A CA  1 
ATOM   245   C  C   . GLY A  1  30  ? -17.649 45.834  5.676   1.00 28.30  ? 30  GLY A C   1 
ATOM   246   O  O   . GLY A  1  30  ? -16.591 45.760  5.076   1.00 32.69  ? 30  GLY A O   1 
ATOM   247   N  N   . THR A  1  31  ? -18.564 46.745  5.405   1.00 27.96  ? 31  THR A N   1 
ATOM   248   C  CA  . THR A  1  31  ? -18.372 47.817  4.457   1.00 27.54  ? 31  THR A CA  1 
ATOM   249   C  C   . THR A  1  31  ? -17.363 48.807  5.016   1.00 27.72  ? 31  THR A C   1 
ATOM   250   O  O   . THR A  1  31  ? -16.479 49.311  4.283   1.00 25.50  ? 31  THR A O   1 
ATOM   251   C  CB  . THR A  1  31  ? -19.729 48.522  4.213   1.00 28.55  ? 31  THR A CB  1 
ATOM   252   O  OG1 . THR A  1  31  ? -20.599 47.618  3.537   1.00 29.73  ? 31  THR A OG1 1 
ATOM   253   C  CG2 . THR A  1  31  ? -19.580 49.750  3.364   1.00 29.03  ? 31  THR A CG2 1 
ATOM   254   N  N   . ALA A  1  32  ? -17.509 49.089  6.315   1.00 26.87  ? 32  ALA A N   1 
ATOM   255   C  CA  . ALA A  1  32  ? -16.671 50.073  6.962   1.00 27.85  ? 32  ALA A CA  1 
ATOM   256   C  C   . ALA A  1  32  ? -15.254 49.510  7.080   1.00 26.70  ? 32  ALA A C   1 
ATOM   257   O  O   . ALA A  1  32  ? -14.298 50.224  6.886   1.00 25.04  ? 32  ALA A O   1 
ATOM   258   C  CB  . ALA A  1  32  ? -17.221 50.445  8.320   1.00 29.66  ? 32  ALA A CB  1 
ATOM   259   N  N   . LEU A  1  33  ? -15.128 48.226  7.381   1.00 25.39  ? 33  LEU A N   1 
ATOM   260   C  CA  . LEU A  1  33  ? -13.832 47.566  7.298   1.00 25.84  ? 33  LEU A CA  1 
ATOM   261   C  C   . LEU A  1  33  ? -13.258 47.659  5.881   1.00 27.36  ? 33  LEU A C   1 
ATOM   262   O  O   . LEU A  1  33  ? -12.087 47.991  5.704   1.00 27.72  ? 33  LEU A O   1 
ATOM   263   C  CB  . LEU A  1  33  ? -13.949 46.108  7.695   1.00 25.26  ? 33  LEU A CB  1 
ATOM   264   C  CG  . LEU A  1  33  ? -14.240 45.898  9.182   1.00 23.78  ? 33  LEU A CG  1 
ATOM   265   C  CD1 . LEU A  1  33  ? -14.779 44.505  9.399   1.00 23.87  ? 33  LEU A CD1 1 
ATOM   266   C  CD2 . LEU A  1  33  ? -12.980 46.085  9.993   1.00 24.97  ? 33  LEU A CD2 1 
ATOM   267   N  N   . SER A  1  34  ? -14.095 47.398  4.877   1.00 26.03  ? 34  SER A N   1 
ATOM   268   C  CA  . SER A  1  34  ? -13.677 47.556  3.508   1.00 25.40  ? 34  SER A CA  1 
ATOM   269   C  C   . SER A  1  34  ? -13.124 48.943  3.215   1.00 25.84  ? 34  SER A C   1 
ATOM   270   O  O   . SER A  1  34  ? -12.205 49.075  2.435   1.00 22.94  ? 34  SER A O   1 
ATOM   271   C  CB  . SER A  1  34  ? -14.799 47.191  2.520   1.00 24.99  ? 34  SER A CB  1 
ATOM   272   O  OG  . SER A  1  34  ? -15.710 48.237  2.239   1.00 23.86  ? 34  SER A OG  1 
ATOM   273   N  N   . LEU A  1  35  ? -13.712 49.975  3.801   1.00 27.76  ? 35  LEU A N   1 
ATOM   274   C  CA  . LEU A  1  35  ? -13.250 51.334  3.528   1.00 29.75  ? 35  LEU A CA  1 
ATOM   275   C  C   . LEU A  1  35  ? -11.922 51.678  4.221   1.00 29.48  ? 35  LEU A C   1 
ATOM   276   O  O   . LEU A  1  35  ? -11.106 52.388  3.666   1.00 30.55  ? 35  LEU A O   1 
ATOM   277   C  CB  . LEU A  1  35  ? -14.343 52.356  3.877   1.00 32.54  ? 35  LEU A CB  1 
ATOM   278   C  CG  . LEU A  1  35  ? -15.498 52.306  2.866   1.00 35.20  ? 35  LEU A CG  1 
ATOM   279   C  CD1 . LEU A  1  35  ? -16.769 52.822  3.484   1.00 38.34  ? 35  LEU A CD1 1 
ATOM   280   C  CD2 . LEU A  1  35  ? -15.200 53.110  1.605   1.00 37.43  ? 35  LEU A CD2 1 
ATOM   281   N  N   . LEU A  1  36  ? -11.720 51.178  5.429   1.00 29.26  ? 36  LEU A N   1 
ATOM   282   C  CA  . LEU A  1  36  ? -10.418 51.219  6.083   1.00 29.79  ? 36  LEU A CA  1 
ATOM   283   C  C   . LEU A  1  36  ? -9.313  50.581  5.238   1.00 29.13  ? 36  LEU A C   1 
ATOM   284   O  O   . LEU A  1  36  ? -8.233  51.155  5.054   1.00 30.20  ? 36  LEU A O   1 
ATOM   285   C  CB  . LEU A  1  36  ? -10.475 50.553  7.452   1.00 29.02  ? 36  LEU A CB  1 
ATOM   286   C  CG  . LEU A  1  36  ? -11.224 51.427  8.465   1.00 31.09  ? 36  LEU A CG  1 
ATOM   287   C  CD1 . LEU A  1  36  ? -11.595 50.611  9.699   1.00 32.49  ? 36  LEU A CD1 1 
ATOM   288   C  CD2 . LEU A  1  36  ? -10.401 52.644  8.859   1.00 32.04  ? 36  LEU A CD2 1 
ATOM   289   N  N   . ILE A  1  37  ? -9.600  49.419  4.684   1.00 28.36  ? 37  ILE A N   1 
ATOM   290   C  CA  . ILE A  1  37  ? -8.653  48.747  3.816   1.00 27.34  ? 37  ILE A CA  1 
ATOM   291   C  C   . ILE A  1  37  ? -8.204  49.677  2.711   1.00 29.20  ? 37  ILE A C   1 
ATOM   292   O  O   . ILE A  1  37  ? -7.003  49.786  2.425   1.00 32.51  ? 37  ILE A O   1 
ATOM   293   C  CB  . ILE A  1  37  ? -9.252  47.507  3.178   1.00 26.83  ? 37  ILE A CB  1 
ATOM   294   C  CG1 . ILE A  1  37  ? -9.477  46.423  4.247   1.00 28.96  ? 37  ILE A CG1 1 
ATOM   295   C  CG2 . ILE A  1  37  ? -8.364  47.006  2.026   1.00 27.52  ? 37  ILE A CG2 1 
ATOM   296   C  CD1 . ILE A  1  37  ? -10.232 45.194  3.741   1.00 30.92  ? 37  ILE A CD1 1 
ATOM   297   N  N   . ARG A  1  38  ? -9.177  50.332  2.091   1.00 28.68  ? 38  ARG A N   1 
ATOM   298   C  CA  . ARG A  1  38  ? -8.915  51.173  0.931   1.00 28.34  ? 38  ARG A CA  1 
ATOM   299   C  C   . ARG A  1  38  ? -8.415  52.574  1.294   1.00 28.11  ? 38  ARG A C   1 
ATOM   300   O  O   . ARG A  1  38  ? -7.765  53.221  0.473   1.00 27.49  ? 38  ARG A O   1 
ATOM   301   C  CB  . ARG A  1  38  ? -10.143 51.187  0.022   1.00 26.56  ? 38  ARG A CB  1 
ATOM   302   C  CG  . ARG A  1  38  ? -10.331 49.827  -0.651  1.00 27.02  ? 38  ARG A CG  1 
ATOM   303   C  CD  . ARG A  1  38  ? -9.962  49.859  -2.101  1.00 28.00  ? 38  ARG A CD  1 
ATOM   304   N  NE  . ARG A  1  38  ? -8.605  50.323  -2.423  1.00 28.48  ? 38  ARG A NE  1 
ATOM   305   C  CZ  . ARG A  1  38  ? -7.582  49.593  -2.870  1.00 27.10  ? 38  ARG A CZ  1 
ATOM   306   N  NH1 . ARG A  1  38  ? -7.635  48.283  -3.015  1.00 29.58  ? 38  ARG A NH1 1 
ATOM   307   N  NH2 . ARG A  1  38  ? -6.463  50.201  -3.194  1.00 29.67  ? 38  ARG A NH2 1 
ATOM   308   N  N   . ALA A  1  39  ? -8.715  53.035  2.508   1.00 28.56  ? 39  ALA A N   1 
ATOM   309   C  CA  . ALA A  1  39  ? -8.141  54.277  3.040   1.00 29.62  ? 39  ALA A CA  1 
ATOM   310   C  C   . ALA A  1  39  ? -6.632  54.104  3.120   1.00 30.20  ? 39  ALA A C   1 
ATOM   311   O  O   . ALA A  1  39  ? -5.885  54.906  2.547   1.00 32.12  ? 39  ALA A O   1 
ATOM   312   C  CB  . ALA A  1  39  ? -8.717  54.593  4.415   1.00 29.75  ? 39  ALA A CB  1 
ATOM   313   N  N   . GLU A  1  40  ? -6.208  53.013  3.767   1.00 28.57  ? 40  GLU A N   1 
ATOM   314   C  CA  . GLU A  1  40  ? -4.789  52.681  3.948   1.00 28.24  ? 40  GLU A CA  1 
ATOM   315   C  C   . GLU A  1  40  ? -4.000  52.661  2.647   1.00 26.63  ? 40  GLU A C   1 
ATOM   316   O  O   . GLU A  1  40  ? -2.857  53.069  2.611   1.00 30.50  ? 40  GLU A O   1 
ATOM   317   C  CB  . GLU A  1  40  ? -4.689  51.326  4.652   1.00 30.04  ? 40  GLU A CB  1 
ATOM   318   C  CG  . GLU A  1  40  ? -3.292  50.745  4.875   1.00 31.92  ? 40  GLU A CG  1 
ATOM   319   C  CD  . GLU A  1  40  ? -2.351  51.690  5.609   1.00 34.33  ? 40  GLU A CD  1 
ATOM   320   O  OE1 . GLU A  1  40  ? -1.399  52.204  4.956   1.00 30.89  ? 40  GLU A OE1 1 
ATOM   321   O  OE2 . GLU A  1  40  ? -2.573  51.887  6.842   1.00 31.14  ? 40  GLU A OE2 1 
ATOM   322   N  N   . LEU A  1  41  ? -4.622  52.146  1.610   1.00 25.72  ? 41  LEU A N   1 
ATOM   323   C  CA  . LEU A  1  41  ? -4.010  51.943  0.319   1.00 26.93  ? 41  LEU A CA  1 
ATOM   324   C  C   . LEU A  1  41  ? -4.282  53.056  -0.687  1.00 26.60  ? 41  LEU A C   1 
ATOM   325   O  O   . LEU A  1  41  ? -3.747  53.020  -1.793  1.00 23.56  ? 41  LEU A O   1 
ATOM   326   C  CB  . LEU A  1  41  ? -4.516  50.612  -0.268  1.00 26.46  ? 41  LEU A CB  1 
ATOM   327   C  CG  . LEU A  1  41  ? -4.159  49.360  0.546   1.00 28.03  ? 41  LEU A CG  1 
ATOM   328   C  CD1 . LEU A  1  41  ? -4.960  48.171  0.024   1.00 27.95  ? 41  LEU A CD1 1 
ATOM   329   C  CD2 . LEU A  1  41  ? -2.645  49.055  0.524   1.00 27.18  ? 41  LEU A CD2 1 
ATOM   330   N  N   . GLY A  1  42  ? -5.099  54.035  -0.316  1.00 27.83  ? 42  GLY A N   1 
ATOM   331   C  CA  . GLY A  1  42  ? -5.465  55.110  -1.241  1.00 32.31  ? 42  GLY A CA  1 
ATOM   332   C  C   . GLY A  1  42  ? -4.381  56.102  -1.625  1.00 33.84  ? 42  GLY A C   1 
ATOM   333   O  O   . GLY A  1  42  ? -4.523  56.828  -2.615  1.00 37.96  ? 42  GLY A O   1 
ATOM   334   N  N   . GLN A  1  43  ? -3.317  56.166  -0.828  1.00 36.75  ? 43  GLN A N   1 
ATOM   335   C  CA  . GLN A  1  43  ? -2.050  56.798  -1.254  1.00 36.04  ? 43  GLN A CA  1 
ATOM   336   C  C   . GLN A  1  43  ? -0.851  56.029  -0.702  1.00 34.54  ? 43  GLN A C   1 
ATOM   337   O  O   . GLN A  1  43  ? -0.975  55.224  0.268   1.00 33.56  ? 43  GLN A O   1 
ATOM   338   C  CB  . GLN A  1  43  ? -1.977  58.288  -0.854  1.00 34.60  ? 43  GLN A CB  1 
ATOM   339   C  CG  . GLN A  1  43  ? -2.104  58.567  0.633   1.00 38.81  ? 43  GLN A CG  1 
ATOM   340   C  CD  . GLN A  1  43  ? -1.542  59.945  1.042   1.00 44.71  ? 43  GLN A CD  1 
ATOM   341   O  OE1 . GLN A  1  43  ? -1.673  60.955  0.301   1.00 45.13  ? 43  GLN A OE1 1 
ATOM   342   N  NE2 . GLN A  1  43  ? -0.937  59.998  2.237   1.00 41.30  ? 43  GLN A NE2 1 
ATOM   343   N  N   . PRO A  1  44  ? 0.321   56.276  -1.294  1.00 33.29  ? 44  PRO A N   1 
ATOM   344   C  CA  . PRO A  1  44  ? 1.525   55.638  -0.776  1.00 33.39  ? 44  PRO A CA  1 
ATOM   345   C  C   . PRO A  1  44  ? 1.843   56.061  0.618   1.00 31.27  ? 44  PRO A C   1 
ATOM   346   O  O   . PRO A  1  44  ? 1.546   57.197  1.064   1.00 30.89  ? 44  PRO A O   1 
ATOM   347   C  CB  . PRO A  1  44  ? 2.624   56.078  -1.738  1.00 34.35  ? 44  PRO A CB  1 
ATOM   348   C  CG  . PRO A  1  44  ? 2.022   57.222  -2.498  1.00 35.56  ? 44  PRO A CG  1 
ATOM   349   C  CD  . PRO A  1  44  ? 0.576   56.890  -2.595  1.00 34.86  ? 44  PRO A CD  1 
ATOM   350   N  N   . GLY A  1  45  ? 2.442   55.111  1.299   1.00 30.33  ? 45  GLY A N   1 
ATOM   351   C  CA  . GLY A  1  45  ? 2.749   55.259  2.686   1.00 32.46  ? 45  GLY A CA  1 
ATOM   352   C  C   . GLY A  1  45  ? 1.870   54.464  3.594   1.00 33.22  ? 45  GLY A C   1 
ATOM   353   O  O   . GLY A  1  45  ? 1.160   53.531  3.155   1.00 34.99  ? 45  GLY A O   1 
ATOM   354   N  N   . THR A  1  46  ? 1.954   54.827  4.870   1.00 34.58  ? 46  THR A N   1 
ATOM   355   C  CA  . THR A  1  46  ? 1.168   54.216  5.902   1.00 40.34  ? 46  THR A CA  1 
ATOM   356   C  C   . THR A  1  46  ? 0.226   55.214  6.563   1.00 43.40  ? 46  THR A C   1 
ATOM   357   O  O   . THR A  1  46  ? 0.574   56.376  6.778   1.00 52.17  ? 46  THR A O   1 
ATOM   358   C  CB  . THR A  1  46  ? 2.036   53.494  6.939   1.00 43.41  ? 46  THR A CB  1 
ATOM   359   O  OG1 . THR A  1  46  ? 1.183   52.651  7.727   1.00 50.31  ? 46  THR A OG1 1 
ATOM   360   C  CG2 . THR A  1  46  ? 2.748   54.459  7.837   1.00 43.73  ? 46  THR A CG2 1 
ATOM   361   N  N   . LEU A  1  47  ? -0.975  54.738  6.886   1.00 44.79  ? 47  LEU A N   1 
ATOM   362   C  CA  . LEU A  1  47  ? -2.063  55.559  7.422   1.00 38.86  ? 47  LEU A CA  1 
ATOM   363   C  C   . LEU A  1  47  ? -2.366  55.086  8.858   1.00 38.87  ? 47  LEU A C   1 
ATOM   364   O  O   . LEU A  1  47  ? -2.360  55.862  9.794   1.00 37.72  ? 47  LEU A O   1 
ATOM   365   C  CB  . LEU A  1  47  ? -3.281  55.458  6.487   1.00 37.28  ? 47  LEU A CB  1 
ATOM   366   C  CG  . LEU A  1  47  ? -4.623  56.043  6.933   1.00 38.80  ? 47  LEU A CG  1 
ATOM   367   C  CD1 . LEU A  1  47  ? -4.595  57.545  6.985   1.00 39.37  ? 47  LEU A CD1 1 
ATOM   368   C  CD2 . LEU A  1  47  ? -5.732  55.606  5.993   1.00 43.09  ? 47  LEU A CD2 1 
ATOM   369   N  N   . LEU A  1  48  ? -2.624  53.805  9.037   1.00 42.92  ? 48  LEU A N   1 
ATOM   370   C  CA  . LEU A  1  48  ? -2.855  53.257  10.364  1.00 46.35  ? 48  LEU A CA  1 
ATOM   371   C  C   . LEU A  1  48  ? -1.525  53.265  11.181  1.00 51.85  ? 48  LEU A C   1 
ATOM   372   O  O   . LEU A  1  48  ? -1.551  53.381  12.424  1.00 58.38  ? 48  LEU A O   1 
ATOM   373   C  CB  . LEU A  1  48  ? -3.508  51.861  10.246  1.00 44.34  ? 48  LEU A CB  1 
ATOM   374   C  CG  . LEU A  1  48  ? -4.836  51.859  9.450   1.00 45.61  ? 48  LEU A CG  1 
ATOM   375   C  CD1 . LEU A  1  48  ? -5.336  50.459  9.114   1.00 45.23  ? 48  LEU A CD1 1 
ATOM   376   C  CD2 . LEU A  1  48  ? -5.929  52.635  10.168  1.00 44.80  ? 48  LEU A CD2 1 
ATOM   377   N  N   . GLY A  1  49  ? -0.376  53.184  10.487  1.00 49.33  ? 49  GLY A N   1 
ATOM   378   C  CA  . GLY A  1  49  ? 0.930   53.199  11.123  1.00 48.97  ? 49  GLY A CA  1 
ATOM   379   C  C   . GLY A  1  49  ? 1.110   52.004  12.023  1.00 52.09  ? 49  GLY A C   1 
ATOM   380   O  O   . GLY A  1  49  ? 1.880   52.038  12.974  1.00 68.22  ? 49  GLY A O   1 
ATOM   381   N  N   . ASP A  1  50  ? 0.365   50.950  11.733  1.00 56.15  ? 50  ASP A N   1 
ATOM   382   C  CA  . ASP A  1  50  ? 0.395   49.706  12.503  1.00 51.88  ? 50  ASP A CA  1 
ATOM   383   C  C   . ASP A  1  50  ? -0.210  48.648  11.598  1.00 47.54  ? 50  ASP A C   1 
ATOM   384   O  O   . ASP A  1  50  ? -1.396  48.615  11.380  1.00 40.41  ? 50  ASP A O   1 
ATOM   385   C  CB  . ASP A  1  50  ? -0.361  49.780  13.823  1.00 50.19  ? 50  ASP A CB  1 
ATOM   386   C  CG  . ASP A  1  50  ? -0.028  48.607  14.741  1.00 55.60  ? 50  ASP A CG  1 
ATOM   387   O  OD1 . ASP A  1  50  ? 0.325   47.508  14.242  1.00 55.03  ? 50  ASP A OD1 1 
ATOM   388   O  OD2 . ASP A  1  50  ? -0.082  48.790  15.975  1.00 62.45  ? 50  ASP A OD2 1 
ATOM   389   N  N   . ASP A  1  51  ? 0.657   47.799  11.072  1.00 48.01  ? 51  ASP A N   1 
ATOM   390   C  CA  . ASP A  1  51  ? 0.317   46.883  10.006  1.00 47.97  ? 51  ASP A CA  1 
ATOM   391   C  C   . ASP A  1  51  ? -0.398  45.659  10.536  1.00 45.53  ? 51  ASP A C   1 
ATOM   392   O  O   . ASP A  1  51  ? -1.141  45.015  9.774   1.00 44.96  ? 51  ASP A O   1 
ATOM   393   C  CB  . ASP A  1  51  ? 1.585   46.426  9.297   1.00 50.58  ? 51  ASP A CB  1 
ATOM   394   C  CG  . ASP A  1  51  ? 1.955   47.305  8.146   1.00 52.67  ? 51  ASP A CG  1 
ATOM   395   O  OD1 . ASP A  1  51  ? 2.096   48.533  8.305   1.00 47.66  ? 51  ASP A OD1 1 
ATOM   396   O  OD2 . ASP A  1  51  ? 2.117   46.730  7.053   1.00 66.53  ? 51  ASP A OD2 1 
ATOM   397   N  N   . GLN A  1  52  ? -0.126  45.303  11.801  1.00 35.98  ? 52  GLN A N   1 
ATOM   398   C  CA  . GLN A  1  52  ? -0.900  44.287  12.448  1.00 33.44  ? 52  GLN A CA  1 
ATOM   399   C  C   . GLN A  1  52  ? -2.369  44.737  12.460  1.00 33.35  ? 52  GLN A C   1 
ATOM   400   O  O   . GLN A  1  52  ? -3.242  43.893  12.330  1.00 35.34  ? 52  GLN A O   1 
ATOM   401   C  CB  . GLN A  1  52  ? -0.380  44.010  13.859  1.00 30.59  ? 52  GLN A CB  1 
ATOM   402   C  CG  . GLN A  1  52  ? -1.277  43.145  14.768  1.00 29.67  ? 52  GLN A CG  1 
ATOM   403   C  CD  . GLN A  1  52  ? -1.363  41.647  14.421  1.00 28.31  ? 52  GLN A CD  1 
ATOM   404   O  OE1 . GLN A  1  52  ? -0.602  41.104  13.580  1.00 27.15  ? 52  GLN A OE1 1 
ATOM   405   N  NE2 . GLN A  1  52  ? -2.301  40.968  15.093  1.00 22.80  ? 52  GLN A NE2 1 
ATOM   406   N  N   . ILE A  1  53  ? -2.639  46.038  12.630  1.00 30.51  ? 53  ILE A N   1 
ATOM   407   C  CA  . ILE A  1  53  ? -4.001  46.521  12.591  1.00 32.77  ? 53  ILE A CA  1 
ATOM   408   C  C   . ILE A  1  53  ? -4.568  46.403  11.164  1.00 30.44  ? 53  ILE A C   1 
ATOM   409   O  O   . ILE A  1  53  ? -5.709  45.972  11.009  1.00 28.77  ? 53  ILE A O   1 
ATOM   410   C  CB  . ILE A  1  53  ? -4.170  47.957  13.112  1.00 34.75  ? 53  ILE A CB  1 
ATOM   411   C  CG1 . ILE A  1  53  ? -3.809  48.047  14.573  1.00 36.69  ? 53  ILE A CG1 1 
ATOM   412   C  CG2 . ILE A  1  53  ? -5.618  48.418  12.975  1.00 35.17  ? 53  ILE A CG2 1 
ATOM   413   C  CD1 . ILE A  1  53  ? -3.762  49.498  15.047  1.00 40.63  ? 53  ILE A CD1 1 
ATOM   414   N  N   . TYR A  1  54  ? -3.786  46.748  10.143  1.00 26.34  ? 54  TYR A N   1 
ATOM   415   C  CA  . TYR A  1  54  ? -4.229  46.504  8.777   1.00 26.45  ? 54  TYR A CA  1 
ATOM   416   C  C   . TYR A  1  54  ? -4.694  45.031  8.598   1.00 28.03  ? 54  TYR A C   1 
ATOM   417   O  O   . TYR A  1  54  ? -5.783  44.769  8.096   1.00 27.65  ? 54  TYR A O   1 
ATOM   418   C  CB  . TYR A  1  54  ? -3.144  46.857  7.759   1.00 24.78  ? 54  TYR A CB  1 
ATOM   419   C  CG  . TYR A  1  54  ? -3.633  46.713  6.355   1.00 22.98  ? 54  TYR A CG  1 
ATOM   420   C  CD1 . TYR A  1  54  ? -4.518  47.614  5.826   1.00 23.77  ? 54  TYR A CD1 1 
ATOM   421   C  CD2 . TYR A  1  54  ? -3.267  45.655  5.588   1.00 23.54  ? 54  TYR A CD2 1 
ATOM   422   C  CE1 . TYR A  1  54  ? -5.015  47.465  4.550   1.00 24.93  ? 54  TYR A CE1 1 
ATOM   423   C  CE2 . TYR A  1  54  ? -3.743  45.500  4.301   1.00 24.89  ? 54  TYR A CE2 1 
ATOM   424   C  CZ  . TYR A  1  54  ? -4.636  46.403  3.800   1.00 25.18  ? 54  TYR A CZ  1 
ATOM   425   O  OH  . TYR A  1  54  ? -5.128  46.255  2.535   1.00 28.09  ? 54  TYR A OH  1 
ATOM   426   N  N   . ASN A  1  55  ? -3.857  44.098  9.040   1.00 27.65  ? 55  ASN A N   1 
ATOM   427   C  CA  . ASN A  1  55  ? -4.108  42.693  8.899   1.00 27.85  ? 55  ASN A CA  1 
ATOM   428   C  C   . ASN A  1  55  ? -5.351  42.220  9.645   1.00 27.04  ? 55  ASN A C   1 
ATOM   429   O  O   . ASN A  1  55  ? -6.030  41.287  9.217   1.00 26.21  ? 55  ASN A O   1 
ATOM   430   C  CB  . ASN A  1  55  ? -2.911  41.908  9.408   1.00 29.42  ? 55  ASN A CB  1 
ATOM   431   C  CG  . ASN A  1  55  ? -1.696  42.056  8.519   1.00 30.63  ? 55  ASN A CG  1 
ATOM   432   O  OD1 . ASN A  1  55  ? -1.795  42.643  7.447   1.00 30.13  ? 55  ASN A OD1 1 
ATOM   433   N  ND2 . ASN A  1  55  ? -0.532  41.489  8.962   1.00 27.17  ? 55  ASN A ND2 1 
ATOM   434   N  N   . VAL A  1  56  ? -5.593  42.828  10.784  1.00 26.63  ? 56  VAL A N   1 
ATOM   435   C  CA  . VAL A  1  56  ? -6.795  42.581  11.538  1.00 28.44  ? 56  VAL A CA  1 
ATOM   436   C  C   . VAL A  1  56  ? -8.045  43.041  10.786  1.00 28.72  ? 56  VAL A C   1 
ATOM   437   O  O   . VAL A  1  56  ? -9.060  42.332  10.751  1.00 29.33  ? 56  VAL A O   1 
ATOM   438   C  CB  . VAL A  1  56  ? -6.714  43.268  12.910  1.00 30.02  ? 56  VAL A CB  1 
ATOM   439   C  CG1 . VAL A  1  56  ? -8.083  43.324  13.589  1.00 30.79  ? 56  VAL A CG1 1 
ATOM   440   C  CG2 . VAL A  1  56  ? -5.724  42.505  13.773  1.00 31.74  ? 56  VAL A CG2 1 
ATOM   441   N  N   . VAL A  1  57  ? -7.962  44.244  10.218  1.00 28.98  ? 57  VAL A N   1 
ATOM   442   C  CA  . VAL A  1  57  ? -9.058  44.857  9.509   1.00 27.32  ? 57  VAL A CA  1 
ATOM   443   C  C   . VAL A  1  57  ? -9.425  43.998  8.316   1.00 28.29  ? 57  VAL A C   1 
ATOM   444   O  O   . VAL A  1  57  ? -10.593 43.784  8.044   1.00 30.88  ? 57  VAL A O   1 
ATOM   445   C  CB  . VAL A  1  57  ? -8.701  46.292  9.109   1.00 27.69  ? 57  VAL A CB  1 
ATOM   446   C  CG1 . VAL A  1  57  ? -9.638  46.828  8.033   1.00 30.41  ? 57  VAL A CG1 1 
ATOM   447   C  CG2 . VAL A  1  57  ? -8.815  47.186  10.337  1.00 27.43  ? 57  VAL A CG2 1 
ATOM   448   N  N   . VAL A  1  58  ? -8.419  43.505  7.617   1.00 28.39  ? 58  VAL A N   1 
ATOM   449   C  CA  . VAL A  1  58  ? -8.606  42.698  6.400   1.00 27.49  ? 58  VAL A CA  1 
ATOM   450   C  C   . VAL A  1  58  ? -9.286  41.379  6.728   1.00 28.26  ? 58  VAL A C   1 
ATOM   451   O  O   . VAL A  1  58  ? -10.167 40.943  6.025   1.00 30.20  ? 58  VAL A O   1 
ATOM   452   C  CB  . VAL A  1  58  ? -7.238  42.452  5.727   1.00 26.82  ? 58  VAL A CB  1 
ATOM   453   C  CG1 . VAL A  1  58  ? -7.301  41.423  4.613   1.00 28.43  ? 58  VAL A CG1 1 
ATOM   454   C  CG2 . VAL A  1  58  ? -6.728  43.752  5.152   1.00 28.32  ? 58  VAL A CG2 1 
ATOM   455   N  N   . THR A  1  59  ? -8.846  40.754  7.808   1.00 27.60  ? 59  THR A N   1 
ATOM   456   C  CA  . THR A  1  59  ? -9.345  39.468  8.236   1.00 26.15  ? 59  THR A CA  1 
ATOM   457   C  C   . THR A  1  59  ? -10.787 39.559  8.714   1.00 25.01  ? 59  THR A C   1 
ATOM   458   O  O   . THR A  1  59  ? -11.608 38.714  8.411   1.00 24.14  ? 59  THR A O   1 
ATOM   459   C  CB  . THR A  1  59  ? -8.425  38.940  9.375   1.00 26.20  ? 59  THR A CB  1 
ATOM   460   O  OG1 . THR A  1  59  ? -7.092  38.782  8.845   1.00 27.00  ? 59  THR A OG1 1 
ATOM   461   C  CG2 . THR A  1  59  ? -8.917  37.620  9.943   1.00 24.60  ? 59  THR A CG2 1 
ATOM   462   N  N   . ALA A  1  60  ? -11.077 40.568  9.517   1.00 24.93  ? 60  ALA A N   1 
ATOM   463   C  CA  . ALA A  1  60  ? -12.423 40.784  10.007  1.00 24.76  ? 60  ALA A CA  1 
ATOM   464   C  C   . ALA A  1  60  ? -13.345 41.107  8.855   1.00 24.46  ? 60  ALA A C   1 
ATOM   465   O  O   . ALA A  1  60  ? -14.462 40.655  8.869   1.00 23.32  ? 60  ALA A O   1 
ATOM   466   C  CB  . ALA A  1  60  ? -12.456 41.901  11.050  1.00 25.28  ? 60  ALA A CB  1 
ATOM   467   N  N   . HIS A  1  61  ? -12.856 41.873  7.863   1.00 24.38  ? 61  HIS A N   1 
ATOM   468   C  CA  . HIS A  1  61  ? -13.626 42.216  6.655   1.00 25.15  ? 61  HIS A CA  1 
ATOM   469   C  C   . HIS A  1  61  ? -14.194 40.956  6.046   1.00 25.58  ? 61  HIS A C   1 
ATOM   470   O  O   . HIS A  1  61  ? -15.405 40.829  5.935   1.00 26.28  ? 61  HIS A O   1 
ATOM   471   C  CB  . HIS A  1  61  ? -12.768 42.986  5.626   1.00 23.92  ? 61  HIS A CB  1 
ATOM   472   C  CG  . HIS A  1  61  ? -13.346 43.090  4.234   1.00 21.78  ? 61  HIS A CG  1 
ATOM   473   N  ND1 . HIS A  1  61  ? -14.503 43.778  3.944   1.00 21.27  ? 61  HIS A ND1 1 
ATOM   474   C  CD2 . HIS A  1  61  ? -12.868 42.637  3.039   1.00 21.56  ? 61  HIS A CD2 1 
ATOM   475   C  CE1 . HIS A  1  61  ? -14.717 43.737  2.631   1.00 22.10  ? 61  HIS A CE1 1 
ATOM   476   N  NE2 . HIS A  1  61  ? -13.739 43.049  2.052   1.00 21.02  ? 61  HIS A NE2 1 
ATOM   477   N  N   . ALA A  1  62  ? -13.314 40.050  5.657   1.00 24.92  ? 62  ALA A N   1 
ATOM   478   C  CA  . ALA A  1  62  ? -13.716 38.787  5.050   1.00 27.62  ? 62  ALA A CA  1 
ATOM   479   C  C   . ALA A  1  62  ? -14.724 37.955  5.857   1.00 27.60  ? 62  ALA A C   1 
ATOM   480   O  O   . ALA A  1  62  ? -15.723 37.431  5.311   1.00 27.15  ? 62  ALA A O   1 
ATOM   481   C  CB  . ALA A  1  62  ? -12.486 37.945  4.760   1.00 28.76  ? 62  ALA A CB  1 
ATOM   482   N  N   . PHE A  1  63  ? -14.461 37.833  7.149   1.00 25.85  ? 63  PHE A N   1 
ATOM   483   C  CA  . PHE A  1  63  ? -15.300 37.003  7.979   1.00 26.64  ? 63  PHE A CA  1 
ATOM   484   C  C   . PHE A  1  63  ? -16.670 37.594  8.124   1.00 25.97  ? 63  PHE A C   1 
ATOM   485   O  O   . PHE A  1  63  ? -17.651 36.880  8.134   1.00 27.05  ? 63  PHE A O   1 
ATOM   486   C  CB  . PHE A  1  63  ? -14.676 36.778  9.353   1.00 27.98  ? 63  PHE A CB  1 
ATOM   487   C  CG  . PHE A  1  63  ? -13.586 35.735  9.372   1.00 29.54  ? 63  PHE A CG  1 
ATOM   488   C  CD1 . PHE A  1  63  ? -13.797 34.473  8.857   1.00 29.75  ? 63  PHE A CD1 1 
ATOM   489   C  CD2 . PHE A  1  63  ? -12.374 35.998  9.997   1.00 32.74  ? 63  PHE A CD2 1 
ATOM   490   C  CE1 . PHE A  1  63  ? -12.816 33.494  8.916   1.00 31.27  ? 63  PHE A CE1 1 
ATOM   491   C  CE2 . PHE A  1  63  ? -11.389 35.011  10.084  1.00 34.32  ? 63  PHE A CE2 1 
ATOM   492   C  CZ  . PHE A  1  63  ? -11.613 33.758  9.523   1.00 32.98  ? 63  PHE A CZ  1 
ATOM   493   N  N   . VAL A  1  64  ? -16.725 38.905  8.271   1.00 25.91  ? 64  VAL A N   1 
ATOM   494   C  CA  . VAL A  1  64  ? -17.983 39.618  8.426   1.00 25.19  ? 64  VAL A CA  1 
ATOM   495   C  C   . VAL A  1  64  ? -18.771 39.468  7.132   1.00 25.24  ? 64  VAL A C   1 
ATOM   496   O  O   . VAL A  1  64  ? -19.909 38.997  7.146   1.00 24.79  ? 64  VAL A O   1 
ATOM   497   C  CB  . VAL A  1  64  ? -17.753 41.084  8.792   1.00 25.88  ? 64  VAL A CB  1 
ATOM   498   C  CG1 . VAL A  1  64  ? -19.033 41.884  8.724   1.00 26.68  ? 64  VAL A CG1 1 
ATOM   499   C  CG2 . VAL A  1  64  ? -17.173 41.168  10.202  1.00 28.34  ? 64  VAL A CG2 1 
ATOM   500   N  N   . MET A  1  65  ? -18.150 39.781  6.008   1.00 23.59  ? 65  MET A N   1 
ATOM   501   C  CA  . MET A  1  65  ? -18.880 39.691  4.773   1.00 24.33  ? 65  MET A CA  1 
ATOM   502   C  C   . MET A  1  65  ? -19.405 38.281  4.446   1.00 25.00  ? 65  MET A C   1 
ATOM   503   O  O   . MET A  1  65  ? -20.510 38.158  3.951   1.00 26.66  ? 65  MET A O   1 
ATOM   504   C  CB  . MET A  1  65  ? -18.068 40.246  3.634   1.00 23.55  ? 65  MET A CB  1 
ATOM   505   C  CG  . MET A  1  65  ? -17.824 41.739  3.742   1.00 25.35  ? 65  MET A CG  1 
ATOM   506   S  SD  . MET A  1  65  ? -19.367 42.651  3.795   1.00 24.64  ? 65  MET A SD  1 
ATOM   507   C  CE  . MET A  1  65  ? -18.942 44.063  2.793   1.00 25.93  ? 65  MET A CE  1 
ATOM   508   N  N   . ILE A  1  66  ? -18.627 37.248  4.734   1.00 25.96  ? 66  ILE A N   1 
ATOM   509   C  CA  . ILE A  1  66  ? -18.973 35.885  4.360   1.00 27.10  ? 66  ILE A CA  1 
ATOM   510   C  C   . ILE A  1  66  ? -19.931 35.331  5.383   1.00 27.55  ? 66  ILE A C   1 
ATOM   511   O  O   . ILE A  1  66  ? -21.031 34.962  5.051   1.00 29.51  ? 66  ILE A O   1 
ATOM   512   C  CB  . ILE A  1  66  ? -17.718 34.969  4.231   1.00 27.92  ? 66  ILE A CB  1 
ATOM   513   C  CG1 . ILE A  1  66  ? -16.933 35.303  2.948   1.00 29.44  ? 66  ILE A CG1 1 
ATOM   514   C  CG2 . ILE A  1  66  ? -18.097 33.487  4.246   1.00 27.52  ? 66  ILE A CG2 1 
ATOM   515   C  CD1 . ILE A  1  66  ? -15.500 34.838  3.001   1.00 32.06  ? 66  ILE A CD1 1 
ATOM   516   N  N   . PHE A  1  67  ? -19.497 35.246  6.626   1.00 28.90  ? 67  PHE A N   1 
ATOM   517   C  CA  . PHE A  1  67  ? -20.236 34.490  7.603   1.00 28.39  ? 67  PHE A CA  1 
ATOM   518   C  C   . PHE A  1  67  ? -21.407 35.271  8.167   1.00 27.23  ? 67  PHE A C   1 
ATOM   519   O  O   . PHE A  1  67  ? -22.408 34.666  8.548   1.00 27.05  ? 67  PHE A O   1 
ATOM   520   C  CB  . PHE A  1  67  ? -19.317 33.962  8.708   1.00 28.31  ? 67  PHE A CB  1 
ATOM   521   C  CG  . PHE A  1  67  ? -18.394 32.889  8.246   1.00 29.90  ? 67  PHE A CG  1 
ATOM   522   C  CD1 . PHE A  1  67  ? -18.818 31.561  8.185   1.00 30.84  ? 67  PHE A CD1 1 
ATOM   523   C  CD2 . PHE A  1  67  ? -17.085 33.182  7.869   1.00 31.01  ? 67  PHE A CD2 1 
ATOM   524   C  CE1 . PHE A  1  67  ? -17.958 30.555  7.756   1.00 29.00  ? 67  PHE A CE1 1 
ATOM   525   C  CE2 . PHE A  1  67  ? -16.227 32.175  7.430   1.00 28.46  ? 67  PHE A CE2 1 
ATOM   526   C  CZ  . PHE A  1  67  ? -16.658 30.867  7.381   1.00 28.62  ? 67  PHE A CZ  1 
ATOM   527   N  N   . PHE A  1  68  ? -21.294 36.600  8.217   1.00 26.14  ? 68  PHE A N   1 
ATOM   528   C  CA  . PHE A  1  68  ? -22.317 37.421  8.881   1.00 25.13  ? 68  PHE A CA  1 
ATOM   529   C  C   . PHE A  1  68  ? -23.208 38.301  7.977   1.00 23.99  ? 68  PHE A C   1 
ATOM   530   O  O   . PHE A  1  68  ? -24.209 38.792  8.425   1.00 23.14  ? 68  PHE A O   1 
ATOM   531   C  CB  . PHE A  1  68  ? -21.644 38.180  10.031  1.00 26.23  ? 68  PHE A CB  1 
ATOM   532   C  CG  . PHE A  1  68  ? -20.987 37.242  11.023  1.00 28.59  ? 68  PHE A CG  1 
ATOM   533   C  CD1 . PHE A  1  68  ? -21.742 36.366  11.761  1.00 29.48  ? 68  PHE A CD1 1 
ATOM   534   C  CD2 . PHE A  1  68  ? -19.606 37.201  11.176  1.00 31.46  ? 68  PHE A CD2 1 
ATOM   535   C  CE1 . PHE A  1  68  ? -21.148 35.476  12.637  1.00 32.94  ? 68  PHE A CE1 1 
ATOM   536   C  CE2 . PHE A  1  68  ? -18.993 36.316  12.039  1.00 30.71  ? 68  PHE A CE2 1 
ATOM   537   C  CZ  . PHE A  1  68  ? -19.764 35.446  12.768  1.00 34.16  ? 68  PHE A CZ  1 
ATOM   538   N  N   . MET A  1  69  ? -22.859 38.476  6.709   1.00 25.06  ? 69  MET A N   1 
ATOM   539   C  CA  . MET A  1  69  ? -23.672 39.246  5.794   1.00 28.15  ? 69  MET A CA  1 
ATOM   540   C  C   . MET A  1  69  ? -24.265 38.326  4.725   1.00 29.07  ? 69  MET A C   1 
ATOM   541   O  O   . MET A  1  69  ? -25.496 38.147  4.669   1.00 31.76  ? 69  MET A O   1 
ATOM   542   C  CB  . MET A  1  69  ? -22.887 40.398  5.168   1.00 29.58  ? 69  MET A CB  1 
ATOM   543   C  CG  . MET A  1  69  ? -23.763 41.393  4.398   1.00 30.18  ? 69  MET A CG  1 
ATOM   544   S  SD  . MET A  1  69  ? -23.789 40.929  2.675   1.00 38.95  ? 69  MET A SD  1 
ATOM   545   C  CE  . MET A  1  69  ? -22.355 41.828  2.100   1.00 33.77  ? 69  MET A CE  1 
ATOM   546   N  N   . VAL A  1  70  ? -23.424 37.713  3.907   1.00 25.64  ? 70  VAL A N   1 
ATOM   547   C  CA  . VAL A  1  70  ? -23.956 36.915  2.808   1.00 25.77  ? 70  VAL A CA  1 
ATOM   548   C  C   . VAL A  1  70  ? -24.769 35.701  3.261   1.00 25.97  ? 70  VAL A C   1 
ATOM   549   O  O   . VAL A  1  70  ? -25.932 35.587  2.865   1.00 26.17  ? 70  VAL A O   1 
ATOM   550   C  CB  . VAL A  1  70  ? -22.876 36.488  1.821   1.00 24.35  ? 70  VAL A CB  1 
ATOM   551   C  CG1 . VAL A  1  70  ? -23.447 35.559  0.761   1.00 22.59  ? 70  VAL A CG1 1 
ATOM   552   C  CG2 . VAL A  1  70  ? -22.259 37.750  1.205   1.00 24.61  ? 70  VAL A CG2 1 
ATOM   553   N  N   . MET A  1  71  ? -24.191 34.819  4.072   1.00 24.66  ? 71  MET A N   1 
ATOM   554   C  CA  . MET A  1  71  ? -24.868 33.562  4.404   1.00 24.62  ? 71  MET A CA  1 
ATOM   555   C  C   . MET A  1  71  ? -26.198 33.773  5.162   1.00 25.91  ? 71  MET A C   1 
ATOM   556   O  O   . MET A  1  71  ? -27.204 33.192  4.785   1.00 25.71  ? 71  MET A O   1 
ATOM   557   C  CB  . MET A  1  71  ? -23.948 32.595  5.146   1.00 24.99  ? 71  MET A CB  1 
ATOM   558   C  CG  . MET A  1  71  ? -22.813 32.021  4.302   1.00 26.53  ? 71  MET A CG  1 
ATOM   559   S  SD  . MET A  1  71  ? -21.621 31.107  5.312   1.00 27.09  ? 71  MET A SD  1 
ATOM   560   C  CE  . MET A  1  71  ? -22.621 29.681  5.649   1.00 28.10  ? 71  MET A CE  1 
ATOM   561   N  N   . PRO A  1  72  ? -26.226 34.639  6.201   1.00 25.38  ? 72  PRO A N   1 
ATOM   562   C  CA  . PRO A  1  72  ? -27.480 34.977  6.879   1.00 24.76  ? 72  PRO A CA  1 
ATOM   563   C  C   . PRO A  1  72  ? -28.587 35.541  5.974   1.00 24.66  ? 72  PRO A C   1 
ATOM   564   O  O   . PRO A  1  72  ? -29.729 35.122  6.054   1.00 21.75  ? 72  PRO A O   1 
ATOM   565   C  CB  . PRO A  1  72  ? -27.032 36.059  7.852   1.00 24.80  ? 72  PRO A CB  1 
ATOM   566   C  CG  . PRO A  1  72  ? -25.661 35.623  8.218   1.00 25.49  ? 72  PRO A CG  1 
ATOM   567   C  CD  . PRO A  1  72  ? -25.085 35.252  6.889   1.00 24.86  ? 72  PRO A CD  1 
ATOM   568   N  N   . ILE A  1  73  ? -28.217 36.494  5.119   1.00 24.99  ? 73  ILE A N   1 
ATOM   569   C  CA  . ILE A  1  73  ? -29.163 37.120  4.218   1.00 24.94  ? 73  ILE A CA  1 
ATOM   570   C  C   . ILE A  1  73  ? -29.750 36.092  3.241   1.00 25.94  ? 73  ILE A C   1 
ATOM   571   O  O   . ILE A  1  73  ? -30.964 35.953  3.171   1.00 23.82  ? 73  ILE A O   1 
ATOM   572   C  CB  . ILE A  1  73  ? -28.561 38.329  3.506   1.00 23.07  ? 73  ILE A CB  1 
ATOM   573   C  CG1 . ILE A  1  73  ? -28.322 39.416  4.532   1.00 24.05  ? 73  ILE A CG1 1 
ATOM   574   C  CG2 . ILE A  1  73  ? -29.533 38.857  2.486   1.00 23.37  ? 73  ILE A CG2 1 
ATOM   575   C  CD1 . ILE A  1  73  ? -27.677 40.663  3.982   1.00 25.31  ? 73  ILE A CD1 1 
ATOM   576   N  N   . MET A  1  74  ? -28.892 35.363  2.542   1.00 26.31  ? 74  MET A N   1 
ATOM   577   C  CA  . MET A  1  74  ? -29.327 34.487  1.475   1.00 29.07  ? 74  MET A CA  1 
ATOM   578   C  C   . MET A  1  74  ? -30.035 33.210  1.940   1.00 30.04  ? 74  MET A C   1 
ATOM   579   O  O   . MET A  1  74  ? -31.091 32.827  1.414   1.00 28.94  ? 74  MET A O   1 
ATOM   580   C  CB  . MET A  1  74  ? -28.138 34.087  0.609   1.00 33.13  ? 74  MET A CB  1 
ATOM   581   C  CG  . MET A  1  74  ? -27.907 35.010  -0.582  1.00 36.20  ? 74  MET A CG  1 
ATOM   582   S  SD  . MET A  1  74  ? -26.483 34.365  -1.451  1.00 45.73  ? 74  MET A SD  1 
ATOM   583   C  CE  . MET A  1  74  ? -26.373 35.562  -2.772  1.00 44.83  ? 74  MET A CE  1 
ATOM   584   N  N   . ILE A  1  75  ? -29.433 32.535  2.901   1.00 28.27  ? 75  ILE A N   1 
ATOM   585   C  CA  . ILE A  1  75  ? -29.929 31.262  3.335   1.00 28.59  ? 75  ILE A CA  1 
ATOM   586   C  C   . ILE A  1  75  ? -30.920 31.514  4.455   1.00 27.69  ? 75  ILE A C   1 
ATOM   587   O  O   . ILE A  1  75  ? -32.080 31.092  4.395   1.00 28.85  ? 75  ILE A O   1 
ATOM   588   C  CB  . ILE A  1  75  ? -28.748 30.340  3.754   1.00 31.14  ? 75  ILE A CB  1 
ATOM   589   C  CG1 . ILE A  1  75  ? -27.906 29.997  2.510   1.00 31.85  ? 75  ILE A CG1 1 
ATOM   590   C  CG2 . ILE A  1  75  ? -29.245 29.066  4.426   1.00 31.20  ? 75  ILE A CG2 1 
ATOM   591   C  CD1 . ILE A  1  75  ? -26.405 29.894  2.773   1.00 33.55  ? 75  ILE A CD1 1 
ATOM   592   N  N   . GLY A  1  76  ? -30.456 32.185  5.490   1.00 25.12  ? 76  GLY A N   1 
ATOM   593   C  CA  . GLY A  1  76  ? -31.273 32.431  6.653   1.00 24.64  ? 76  GLY A CA  1 
ATOM   594   C  C   . GLY A  1  76  ? -32.452 33.350  6.400   1.00 24.75  ? 76  GLY A C   1 
ATOM   595   O  O   . GLY A  1  76  ? -33.533 33.147  6.988   1.00 25.60  ? 76  GLY A O   1 
ATOM   596   N  N   . GLY A  1  77  ? -32.246 34.365  5.560   1.00 23.58  ? 77  GLY A N   1 
ATOM   597   C  CA  . GLY A  1  77  ? -33.237 35.412  5.370   1.00 24.54  ? 77  GLY A CA  1 
ATOM   598   C  C   . GLY A  1  77  ? -34.218 35.063  4.286   1.00 24.00  ? 77  GLY A C   1 
ATOM   599   O  O   . GLY A  1  77  ? -35.380 34.800  4.538   1.00 26.20  ? 77  GLY A O   1 
ATOM   600   N  N   . PHE A  1  78  ? -33.734 35.067  3.065   1.00 24.55  ? 78  PHE A N   1 
ATOM   601   C  CA  . PHE A  1  78  ? -34.535 34.673  1.933   1.00 26.06  ? 78  PHE A CA  1 
ATOM   602   C  C   . PHE A  1  78  ? -34.957 33.221  2.029   1.00 27.51  ? 78  PHE A C   1 
ATOM   603   O  O   . PHE A  1  78  ? -36.075 32.895  1.610   1.00 29.18  ? 78  PHE A O   1 
ATOM   604   C  CB  . PHE A  1  78  ? -33.790 34.927  0.620   1.00 26.38  ? 78  PHE A CB  1 
ATOM   605   C  CG  . PHE A  1  78  ? -33.673 36.363  0.294   1.00 29.13  ? 78  PHE A CG  1 
ATOM   606   C  CD1 . PHE A  1  78  ? -34.767 37.059  -0.163  1.00 31.51  ? 78  PHE A CD1 1 
ATOM   607   C  CD2 . PHE A  1  78  ? -32.485 37.049  0.510   1.00 31.80  ? 78  PHE A CD2 1 
ATOM   608   C  CE1 . PHE A  1  78  ? -34.676 38.410  -0.446  1.00 34.22  ? 78  PHE A CE1 1 
ATOM   609   C  CE2 . PHE A  1  78  ? -32.387 38.404  0.247   1.00 33.40  ? 78  PHE A CE2 1 
ATOM   610   C  CZ  . PHE A  1  78  ? -33.481 39.087  -0.241  1.00 34.17  ? 78  PHE A CZ  1 
ATOM   611   N  N   . GLY A  1  79  ? -34.071 32.357  2.541   1.00 25.52  ? 79  GLY A N   1 
ATOM   612   C  CA  . GLY A  1  79  ? -34.392 30.958  2.688   1.00 25.20  ? 79  GLY A CA  1 
ATOM   613   C  C   . GLY A  1  79  ? -35.548 30.668  3.625   1.00 25.53  ? 79  GLY A C   1 
ATOM   614   O  O   . GLY A  1  79  ? -36.507 29.985  3.238   1.00 28.18  ? 79  GLY A O   1 
ATOM   615   N  N   . ASN A  1  80  ? -35.503 31.171  4.846   1.00 24.98  ? 80  ASN A N   1 
ATOM   616   C  CA  . ASN A  1  80  ? -36.642 30.987  5.740   1.00 25.73  ? 80  ASN A CA  1 
ATOM   617   C  C   . ASN A  1  80  ? -37.913 31.675  5.275   1.00 25.67  ? 80  ASN A C   1 
ATOM   618   O  O   . ASN A  1  80  ? -38.988 31.103  5.420   1.00 24.39  ? 80  ASN A O   1 
ATOM   619   C  CB  . ASN A  1  80  ? -36.340 31.455  7.144   1.00 26.28  ? 80  ASN A CB  1 
ATOM   620   C  CG  . ASN A  1  80  ? -35.507 30.475  7.872   1.00 27.47  ? 80  ASN A CG  1 
ATOM   621   O  OD1 . ASN A  1  80  ? -35.946 29.334  8.085   1.00 25.57  ? 80  ASN A OD1 1 
ATOM   622   N  ND2 . ASN A  1  80  ? -34.267 30.879  8.230   1.00 27.93  ? 80  ASN A ND2 1 
ATOM   623   N  N   . TRP A  1  81  ? -37.798 32.882  4.734   1.00 24.21  ? 81  TRP A N   1 
ATOM   624   C  CA  . TRP A  1  81  ? -38.984 33.548  4.206   1.00 25.11  ? 81  TRP A CA  1 
ATOM   625   C  C   . TRP A  1  81  ? -39.669 32.797  3.096   1.00 25.24  ? 81  TRP A C   1 
ATOM   626   O  O   . TRP A  1  81  ? -40.876 32.645  3.120   1.00 24.05  ? 81  TRP A O   1 
ATOM   627   C  CB  . TRP A  1  81  ? -38.680 34.935  3.679   1.00 25.02  ? 81  TRP A CB  1 
ATOM   628   C  CG  . TRP A  1  81  ? -39.122 35.999  4.580   1.00 25.35  ? 81  TRP A CG  1 
ATOM   629   C  CD1 . TRP A  1  81  ? -38.364 36.713  5.430   1.00 25.19  ? 81  TRP A CD1 1 
ATOM   630   C  CD2 . TRP A  1  81  ? -40.440 36.494  4.698   1.00 26.83  ? 81  TRP A CD2 1 
ATOM   631   N  NE1 . TRP A  1  81  ? -39.118 37.620  6.100   1.00 26.04  ? 81  TRP A NE1 1 
ATOM   632   C  CE2 . TRP A  1  81  ? -40.408 37.527  5.656   1.00 27.23  ? 81  TRP A CE2 1 
ATOM   633   C  CE3 . TRP A  1  81  ? -41.655 36.173  4.083   1.00 26.02  ? 81  TRP A CE3 1 
ATOM   634   C  CZ2 . TRP A  1  81  ? -41.547 38.266  6.005   1.00 25.51  ? 81  TRP A CZ2 1 
ATOM   635   C  CZ3 . TRP A  1  81  ? -42.761 36.900  4.423   1.00 25.78  ? 81  TRP A CZ3 1 
ATOM   636   C  CH2 . TRP A  1  81  ? -42.702 37.929  5.381   1.00 25.02  ? 81  TRP A CH2 1 
ATOM   637   N  N   . LEU A  1  82  ? -38.893 32.374  2.112   1.00 26.42  ? 82  LEU A N   1 
ATOM   638   C  CA  . LEU A  1  82  ? -39.442 31.978  0.830   1.00 27.47  ? 82  LEU A CA  1 
ATOM   639   C  C   . LEU A  1  82  ? -39.659 30.490  0.644   1.00 26.59  ? 82  LEU A C   1 
ATOM   640   O  O   . LEU A  1  82  ? -40.625 30.118  -0.014  1.00 29.93  ? 82  LEU A O   1 
ATOM   641   C  CB  . LEU A  1  82  ? -38.575 32.528  -0.298  1.00 29.68  ? 82  LEU A CB  1 
ATOM   642   C  CG  . LEU A  1  82  ? -38.536 34.064  -0.313  1.00 31.62  ? 82  LEU A CG  1 
ATOM   643   C  CD1 . LEU A  1  82  ? -37.472 34.582  -1.268  1.00 34.27  ? 82  LEU A CD1 1 
ATOM   644   C  CD2 . LEU A  1  82  ? -39.896 34.634  -0.686  1.00 33.94  ? 82  LEU A CD2 1 
ATOM   645   N  N   . VAL A  1  83  ? -38.814 29.646  1.221   1.00 24.87  ? 83  VAL A N   1 
ATOM   646   C  CA  . VAL A  1  83  ? -38.864 28.226  0.927   1.00 24.58  ? 83  VAL A CA  1 
ATOM   647   C  C   . VAL A  1  83  ? -40.224 27.635  1.254   1.00 24.83  ? 83  VAL A C   1 
ATOM   648   O  O   . VAL A  1  83  ? -40.837 26.989  0.389   1.00 23.86  ? 83  VAL A O   1 
ATOM   649   C  CB  . VAL A  1  83  ? -37.722 27.418  1.564   1.00 24.02  ? 83  VAL A CB  1 
ATOM   650   C  CG1 . VAL A  1  83  ? -38.018 25.935  1.517   1.00 24.74  ? 83  VAL A CG1 1 
ATOM   651   C  CG2 . VAL A  1  83  ? -36.454 27.686  0.789   1.00 25.28  ? 83  VAL A CG2 1 
ATOM   652   N  N   . PRO A  1  84  ? -40.699 27.865  2.465   1.00 23.85  ? 84  PRO A N   1 
ATOM   653   C  CA  . PRO A  1  84  ? -42.032 27.375  2.825   1.00 24.85  ? 84  PRO A CA  1 
ATOM   654   C  C   . PRO A  1  84  ? -43.151 27.973  1.985   1.00 24.90  ? 84  PRO A C   1 
ATOM   655   O  O   . PRO A  1  84  ? -44.100 27.289  1.658   1.00 27.63  ? 84  PRO A O   1 
ATOM   656   C  CB  . PRO A  1  84  ? -42.183 27.794  4.287   1.00 24.58  ? 84  PRO A CB  1 
ATOM   657   C  CG  . PRO A  1  84  ? -40.772 27.988  4.761   1.00 25.09  ? 84  PRO A CG  1 
ATOM   658   C  CD  . PRO A  1  84  ? -40.077 28.592  3.572   1.00 24.70  ? 84  PRO A CD  1 
ATOM   659   N  N   . LEU A  1  85  ? -43.037 29.236  1.620   1.00 25.98  ? 85  LEU A N   1 
ATOM   660   C  CA  . LEU A  1  85  ? -44.052 29.880  0.793   1.00 25.61  ? 85  LEU A CA  1 
ATOM   661   C  C   . LEU A  1  85  ? -44.069 29.294  -0.614  1.00 26.22  ? 85  LEU A C   1 
ATOM   662   O  O   . LEU A  1  85  ? -45.115 29.179  -1.248  1.00 28.23  ? 85  LEU A O   1 
ATOM   663   C  CB  . LEU A  1  85  ? -43.791 31.392  0.766   1.00 26.51  ? 85  LEU A CB  1 
ATOM   664   C  CG  . LEU A  1  85  ? -44.061 32.155  2.066   1.00 26.37  ? 85  LEU A CG  1 
ATOM   665   C  CD1 . LEU A  1  85  ? -43.991 33.665  1.878   1.00 25.72  ? 85  LEU A CD1 1 
ATOM   666   C  CD2 . LEU A  1  85  ? -45.440 31.753  2.599   1.00 29.16  ? 85  LEU A CD2 1 
ATOM   667   N  N   . MET A  1  86  ? -42.896 28.907  -1.091  1.00 25.38  ? 86  MET A N   1 
ATOM   668   C  CA  . MET A  1  86  ? -42.791 28.318  -2.396  1.00 25.08  ? 86  MET A CA  1 
ATOM   669   C  C   . MET A  1  86  ? -43.233 26.871  -2.480  1.00 24.51  ? 86  MET A C   1 
ATOM   670   O  O   . MET A  1  86  ? -43.459 26.413  -3.576  1.00 26.93  ? 86  MET A O   1 
ATOM   671   C  CB  . MET A  1  86  ? -41.379 28.472  -2.929  1.00 25.00  ? 86  MET A CB  1 
ATOM   672   C  CG  . MET A  1  86  ? -41.042 29.910  -3.312  1.00 26.39  ? 86  MET A CG  1 
ATOM   673   S  SD  . MET A  1  86  ? -39.359 30.012  -3.920  1.00 26.90  ? 86  MET A SD  1 
ATOM   674   C  CE  . MET A  1  86  ? -39.298 31.758  -4.220  1.00 27.80  ? 86  MET A CE  1 
ATOM   675   N  N   . ILE A  1  87  ? -43.315 26.137  -1.372  1.00 23.94  ? 87  ILE A N   1 
ATOM   676   C  CA  . ILE A  1  87  ? -43.717 24.735  -1.438  1.00 24.97  ? 87  ILE A CA  1 
ATOM   677   C  C   . ILE A  1  87  ? -44.992 24.448  -0.672  1.00 26.40  ? 87  ILE A C   1 
ATOM   678   O  O   . ILE A  1  87  ? -45.374 23.275  -0.497  1.00 29.17  ? 87  ILE A O   1 
ATOM   679   C  CB  . ILE A  1  87  ? -42.604 23.782  -0.986  1.00 23.92  ? 87  ILE A CB  1 
ATOM   680   C  CG1 . ILE A  1  87  ? -42.351 23.870  0.529   1.00 23.30  ? 87  ILE A CG1 1 
ATOM   681   C  CG2 . ILE A  1  87  ? -41.354 24.038  -1.812  1.00 24.32  ? 87  ILE A CG2 1 
ATOM   682   C  CD1 . ILE A  1  87  ? -41.231 22.950  0.958   1.00 23.38  ? 87  ILE A CD1 1 
ATOM   683   N  N   . GLY A  1  88  ? -45.659 25.509  -0.244  1.00 25.80  ? 88  GLY A N   1 
ATOM   684   C  CA  . GLY A  1  88  ? -46.954 25.388  0.396   1.00 26.79  ? 88  GLY A CA  1 
ATOM   685   C  C   . GLY A  1  88  ? -46.915 24.803  1.772   1.00 26.37  ? 88  GLY A C   1 
ATOM   686   O  O   . GLY A  1  88  ? -47.918 24.221  2.202   1.00 27.84  ? 88  GLY A O   1 
ATOM   687   N  N   . ALA A  1  89  ? -45.781 24.977  2.461   1.00 24.90  ? 89  ALA A N   1 
ATOM   688   C  CA  . ALA A  1  89  ? -45.564 24.366  3.775   1.00 25.81  ? 89  ALA A CA  1 
ATOM   689   C  C   . ALA A  1  89  ? -45.976 25.345  4.840   1.00 27.12  ? 89  ALA A C   1 
ATOM   690   O  O   . ALA A  1  89  ? -45.820 26.557  4.649   1.00 29.02  ? 89  ALA A O   1 
ATOM   691   C  CB  . ALA A  1  89  ? -44.103 23.983  3.959   1.00 25.91  ? 89  ALA A CB  1 
ATOM   692   N  N   . PRO A  1  90  ? -46.535 24.848  5.957   1.00 27.72  ? 90  PRO A N   1 
ATOM   693   C  CA  . PRO A  1  90  ? -47.025 25.759  6.970   1.00 28.73  ? 90  PRO A CA  1 
ATOM   694   C  C   . PRO A  1  90  ? -45.880 26.394  7.783   1.00 28.50  ? 90  PRO A C   1 
ATOM   695   O  O   . PRO A  1  90  ? -46.071 27.440  8.421   1.00 27.84  ? 90  PRO A O   1 
ATOM   696   C  CB  . PRO A  1  90  ? -47.915 24.861  7.831   1.00 28.12  ? 90  PRO A CB  1 
ATOM   697   C  CG  . PRO A  1  90  ? -47.282 23.525  7.727   1.00 26.92  ? 90  PRO A CG  1 
ATOM   698   C  CD  . PRO A  1  90  ? -46.721 23.445  6.360   1.00 28.25  ? 90  PRO A CD  1 
ATOM   699   N  N   . ASP A  1  91  ? -44.733 25.724  7.798   1.00 26.65  ? 91  ASP A N   1 
ATOM   700   C  CA  . ASP A  1  91  ? -43.518 26.270  8.361   1.00 27.59  ? 91  ASP A CA  1 
ATOM   701   C  C   . ASP A  1  91  ? -42.362 25.323  7.972   1.00 28.12  ? 91  ASP A C   1 
ATOM   702   O  O   . ASP A  1  91  ? -42.521 24.493  7.052   1.00 27.31  ? 91  ASP A O   1 
ATOM   703   C  CB  . ASP A  1  91  ? -43.639 26.455  9.885   1.00 27.54  ? 91  ASP A CB  1 
ATOM   704   C  CG  . ASP A  1  91  ? -42.740 27.580  10.419  1.00 27.73  ? 91  ASP A CG  1 
ATOM   705   O  OD1 . ASP A  1  91  ? -41.538 27.313  10.636  1.00 28.06  ? 91  ASP A OD1 1 
ATOM   706   O  OD2 . ASP A  1  91  ? -43.216 28.709  10.636  1.00 27.33  ? 91  ASP A OD2 1 
ATOM   707   N  N   . MET A  1  92  ? -41.215 25.475  8.637   1.00 26.48  ? 92  MET A N   1 
ATOM   708   C  CA  . MET A  1  92  ? -40.083 24.568  8.487   1.00 27.41  ? 92  MET A CA  1 
ATOM   709   C  C   . MET A  1  92  ? -40.345 23.342  9.363   1.00 28.27  ? 92  MET A C   1 
ATOM   710   O  O   . MET A  1  92  ? -41.206 23.367  10.246  1.00 28.97  ? 92  MET A O   1 
ATOM   711   C  CB  . MET A  1  92  ? -38.789 25.238  8.955   1.00 26.70  ? 92  MET A CB  1 
ATOM   712   C  CG  . MET A  1  92  ? -38.430 26.538  8.241   1.00 27.77  ? 92  MET A CG  1 
ATOM   713   S  SD  . MET A  1  92  ? -37.948 26.287  6.541   1.00 29.77  ? 92  MET A SD  1 
ATOM   714   C  CE  . MET A  1  92  ? -36.383 25.445  6.726   1.00 32.02  ? 92  MET A CE  1 
ATOM   715   N  N   . ALA A  1  93  ? -39.595 22.280  9.107   1.00 27.23  ? 93  ALA A N   1 
ATOM   716   C  CA  . ALA A  1  93  ? -39.751 21.028  9.817   1.00 27.10  ? 93  ALA A CA  1 
ATOM   717   C  C   . ALA A  1  93  ? -39.458 21.165  11.281  1.00 26.13  ? 93  ALA A C   1 
ATOM   718   O  O   . ALA A  1  93  ? -40.148 20.537  12.085  1.00 27.34  ? 93  ALA A O   1 
ATOM   719   C  CB  . ALA A  1  93  ? -38.858 19.934  9.213   1.00 27.81  ? 93  ALA A CB  1 
ATOM   720   N  N   . PHE A  1  94  ? -38.452 21.966  11.628  1.00 24.54  ? 94  PHE A N   1 
ATOM   721   C  CA  . PHE A  1  94  ? -37.995 22.070  13.007  1.00 23.99  ? 94  PHE A CA  1 
ATOM   722   C  C   . PHE A  1  94  ? -38.011 23.544  13.378  1.00 25.47  ? 94  PHE A C   1 
ATOM   723   O  O   . PHE A  1  94  ? -36.954 24.199  13.433  1.00 28.72  ? 94  PHE A O   1 
ATOM   724   C  CB  . PHE A  1  94  ? -36.597 21.415  13.174  1.00 24.82  ? 94  PHE A CB  1 
ATOM   725   C  CG  . PHE A  1  94  ? -36.508 20.010  12.606  1.00 24.45  ? 94  PHE A CG  1 
ATOM   726   C  CD1 . PHE A  1  94  ? -37.396 19.024  13.017  1.00 23.95  ? 94  PHE A CD1 1 
ATOM   727   C  CD2 . PHE A  1  94  ? -35.572 19.693  11.637  1.00 24.31  ? 94  PHE A CD2 1 
ATOM   728   C  CE1 . PHE A  1  94  ? -37.351 17.757  12.475  1.00 24.17  ? 94  PHE A CE1 1 
ATOM   729   C  CE2 . PHE A  1  94  ? -35.508 18.419  11.093  1.00 25.55  ? 94  PHE A CE2 1 
ATOM   730   C  CZ  . PHE A  1  94  ? -36.396 17.444  11.520  1.00 25.69  ? 94  PHE A CZ  1 
ATOM   731   N  N   . PRO A  1  95  ? -39.209 24.095  13.630  1.00 26.82  ? 95  PRO A N   1 
ATOM   732   C  CA  . PRO A  1  95  ? -39.345 25.543  13.797  1.00 28.21  ? 95  PRO A CA  1 
ATOM   733   C  C   . PRO A  1  95  ? -38.589 26.170  14.947  1.00 28.24  ? 95  PRO A C   1 
ATOM   734   O  O   . PRO A  1  95  ? -38.232 27.360  14.887  1.00 29.62  ? 95  PRO A O   1 
ATOM   735   C  CB  . PRO A  1  95  ? -40.841 25.716  14.069  1.00 29.75  ? 95  PRO A CB  1 
ATOM   736   C  CG  . PRO A  1  95  ? -41.474 24.545  13.428  1.00 29.51  ? 95  PRO A CG  1 
ATOM   737   C  CD  . PRO A  1  95  ? -40.519 23.435  13.721  1.00 27.78  ? 95  PRO A CD  1 
ATOM   738   N  N   . ARG A  1  96  ? -38.388 25.381  15.992  1.00 26.41  ? 96  ARG A N   1 
ATOM   739   C  CA  . ARG A  1  96  ? -37.780 25.830  17.223  1.00 26.92  ? 96  ARG A CA  1 
ATOM   740   C  C   . ARG A  1  96  ? -36.267 25.687  17.063  1.00 26.68  ? 96  ARG A C   1 
ATOM   741   O  O   . ARG A  1  96  ? -35.496 26.583  17.416  1.00 27.50  ? 96  ARG A O   1 
ATOM   742   C  CB  . ARG A  1  96  ? -38.379 25.016  18.404  1.00 27.79  ? 96  ARG A CB  1 
ATOM   743   C  CG  . ARG A  1  96  ? -37.634 25.066  19.710  1.00 28.44  ? 96  ARG A CG  1 
ATOM   744   C  CD  . ARG A  1  96  ? -38.404 24.344  20.794  1.00 28.89  ? 96  ARG A CD  1 
ATOM   745   N  NE  . ARG A  1  96  ? -38.804 23.027  20.335  1.00 30.49  ? 96  ARG A NE  1 
ATOM   746   C  CZ  . ARG A  1  96  ? -39.791 22.289  20.842  1.00 28.71  ? 96  ARG A CZ  1 
ATOM   747   N  NH1 . ARG A  1  96  ? -40.549 22.693  21.876  1.00 27.93  ? 96  ARG A NH1 1 
ATOM   748   N  NH2 . ARG A  1  96  ? -40.022 21.123  20.276  1.00 28.17  ? 96  ARG A NH2 1 
ATOM   749   N  N   . MET A  1  97  ? -35.819 24.597  16.470  1.00 26.50  ? 97  MET A N   1 
ATOM   750   C  CA  . MET A  1  97  ? -34.379 24.481  16.191  1.00 27.08  ? 97  MET A CA  1 
ATOM   751   C  C   . MET A  1  97  ? -33.932 25.604  15.282  1.00 26.04  ? 97  MET A C   1 
ATOM   752   O  O   . MET A  1  97  ? -32.789 26.072  15.377  1.00 26.31  ? 97  MET A O   1 
ATOM   753   C  CB  . MET A  1  97  ? -34.045 23.125  15.571  1.00 27.58  ? 97  MET A CB  1 
ATOM   754   C  CG  . MET A  1  97  ? -32.554 22.857  15.452  1.00 28.79  ? 97  MET A CG  1 
ATOM   755   S  SD  . MET A  1  97  ? -32.130 21.178  14.927  1.00 32.18  ? 97  MET A SD  1 
ATOM   756   C  CE  . MET A  1  97  ? -32.587 21.180  13.179  1.00 30.43  ? 97  MET A CE  1 
ATOM   757   N  N   . ASN A  1  98  ? -34.832 25.983  14.376  1.00 25.33  ? 98  ASN A N   1 
ATOM   758   C  CA  . ASN A  1  98  ? -34.599 27.045  13.439  1.00 27.15  ? 98  ASN A CA  1 
ATOM   759   C  C   . ASN A  1  98  ? -34.329 28.355  14.161  1.00 28.78  ? 98  ASN A C   1 
ATOM   760   O  O   . ASN A  1  98  ? -33.491 29.117  13.715  1.00 27.59  ? 98  ASN A O   1 
ATOM   761   C  CB  . ASN A  1  98  ? -35.800 27.222  12.507  1.00 28.99  ? 98  ASN A CB  1 
ATOM   762   C  CG  . ASN A  1  98  ? -35.446 27.940  11.208  1.00 31.99  ? 98  ASN A CG  1 
ATOM   763   O  OD1 . ASN A  1  98  ? -34.333 27.762  10.639  1.00 36.86  ? 98  ASN A OD1 1 
ATOM   764   N  ND2 . ASN A  1  98  ? -36.411 28.732  10.699  1.00 29.83  ? 98  ASN A ND2 1 
ATOM   765   N  N   . ASN A  1  99  ? -35.039 28.618  15.263  1.00 27.58  ? 99  ASN A N   1 
ATOM   766   C  CA  . ASN A  1  99  ? -34.791 29.818  16.034  1.00 26.90  ? 99  ASN A CA  1 
ATOM   767   C  C   . ASN A  1  99  ? -33.382 29.756  16.598  1.00 27.82  ? 99  ASN A C   1 
ATOM   768   O  O   . ASN A  1  99  ? -32.701 30.796  16.683  1.00 25.78  ? 99  ASN A O   1 
ATOM   769   C  CB  . ASN A  1  99  ? -35.814 29.990  17.179  1.00 28.54  ? 99  ASN A CB  1 
ATOM   770   C  CG  . ASN A  1  99  ? -35.964 31.450  17.641  1.00 27.38  ? 99  ASN A CG  1 
ATOM   771   O  OD1 . ASN A  1  99  ? -35.890 32.342  16.822  1.00 26.31  ? 99  ASN A OD1 1 
ATOM   772   N  ND2 . ASN A  1  99  ? -36.182 31.685  18.951  1.00 22.87  ? 99  ASN A ND2 1 
ATOM   773   N  N   . MET A  1  100 ? -32.921 28.560  16.978  1.00 28.44  ? 100 MET A N   1 
ATOM   774   C  CA  . MET A  1  100 ? -31.564 28.448  17.517  1.00 28.85  ? 100 MET A CA  1 
ATOM   775   C  C   . MET A  1  100 ? -30.477 28.775  16.486  1.00 28.46  ? 100 MET A C   1 
ATOM   776   O  O   . MET A  1  100 ? -29.484 29.442  16.812  1.00 28.74  ? 100 MET A O   1 
ATOM   777   C  CB  . MET A  1  100 ? -31.291 27.109  18.206  1.00 30.27  ? 100 MET A CB  1 
ATOM   778   C  CG  . MET A  1  100 ? -29.896 27.110  18.816  1.00 31.36  ? 100 MET A CG  1 
ATOM   779   S  SD  . MET A  1  100 ? -29.630 25.837  20.013  1.00 32.10  ? 100 MET A SD  1 
ATOM   780   C  CE  . MET A  1  100 ? -29.341 24.481  18.887  1.00 30.23  ? 100 MET A CE  1 
ATOM   781   N  N   . SER A  1  101 ? -30.669 28.339  15.252  1.00 26.84  ? 101 SER A N   1 
ATOM   782   C  CA  . SER A  1  101 ? -29.740 28.700  14.213  1.00 27.29  ? 101 SER A CA  1 
ATOM   783   C  C   . SER A  1  101 ? -29.536 30.217  14.130  1.00 27.23  ? 101 SER A C   1 
ATOM   784   O  O   . SER A  1  101 ? -28.441 30.693  13.806  1.00 25.67  ? 101 SER A O   1 
ATOM   785   C  CB  . SER A  1  101 ? -30.228 28.188  12.861  1.00 28.78  ? 101 SER A CB  1 
ATOM   786   O  OG  . SER A  1  101 ? -30.052 26.791  12.816  1.00 34.72  ? 101 SER A OG  1 
ATOM   787   N  N   . PHE A  1  102 ? -30.613 30.965  14.347  1.00 25.85  ? 102 PHE A N   1 
ATOM   788   C  CA  . PHE A  1  102 ? -30.547 32.398  14.279  1.00 24.22  ? 102 PHE A CA  1 
ATOM   789   C  C   . PHE A  1  102 ? -29.789 32.922  15.479  1.00 23.50  ? 102 PHE A C   1 
ATOM   790   O  O   . PHE A  1  102 ? -28.899 33.753  15.342  1.00 24.89  ? 102 PHE A O   1 
ATOM   791   C  CB  . PHE A  1  102 ? -31.920 33.109  14.193  1.00 23.37  ? 102 PHE A CB  1 
ATOM   792   C  CG  . PHE A  1  102 ? -31.763 34.574  14.324  1.00 22.85  ? 102 PHE A CG  1 
ATOM   793   C  CD1 . PHE A  1  102 ? -31.167 35.276  13.313  1.00 23.73  ? 102 PHE A CD1 1 
ATOM   794   C  CD2 . PHE A  1  102 ? -31.977 35.193  15.502  1.00 23.68  ? 102 PHE A CD2 1 
ATOM   795   C  CE1 . PHE A  1  102 ? -30.842 36.592  13.452  1.00 24.06  ? 102 PHE A CE1 1 
ATOM   796   C  CE2 . PHE A  1  102 ? -31.657 36.529  15.662  1.00 25.84  ? 102 PHE A CE2 1 
ATOM   797   C  CZ  . PHE A  1  102 ? -31.089 37.232  14.634  1.00 24.71  ? 102 PHE A CZ  1 
ATOM   798   N  N   . TRP A  1  103 ? -30.171 32.479  16.656  1.00 23.14  ? 103 TRP A N   1 
ATOM   799   C  CA  . TRP A  1  103 ? -29.682 33.112  17.873  1.00 24.27  ? 103 TRP A CA  1 
ATOM   800   C  C   . TRP A  1  103 ? -28.238 32.771  18.193  1.00 23.78  ? 103 TRP A C   1 
ATOM   801   O  O   . TRP A  1  103 ? -27.628 33.450  19.001  1.00 21.23  ? 103 TRP A O   1 
ATOM   802   C  CB  . TRP A  1  103 ? -30.626 32.837  19.070  1.00 26.09  ? 103 TRP A CB  1 
ATOM   803   C  CG  . TRP A  1  103 ? -31.787 33.769  19.039  1.00 27.27  ? 103 TRP A CG  1 
ATOM   804   C  CD1 . TRP A  1  103 ? -33.098 33.477  18.748  1.00 25.97  ? 103 TRP A CD1 1 
ATOM   805   C  CD2 . TRP A  1  103 ? -31.713 35.173  19.228  1.00 27.07  ? 103 TRP A CD2 1 
ATOM   806   N  NE1 . TRP A  1  103 ? -33.845 34.635  18.760  1.00 26.67  ? 103 TRP A NE1 1 
ATOM   807   C  CE2 . TRP A  1  103 ? -33.030 35.687  19.063  1.00 27.50  ? 103 TRP A CE2 1 
ATOM   808   C  CE3 . TRP A  1  103 ? -30.662 36.046  19.527  1.00 26.81  ? 103 TRP A CE3 1 
ATOM   809   C  CZ2 . TRP A  1  103 ? -33.327 37.046  19.182  1.00 30.57  ? 103 TRP A CZ2 1 
ATOM   810   C  CZ3 . TRP A  1  103 ? -30.938 37.401  19.664  1.00 29.73  ? 103 TRP A CZ3 1 
ATOM   811   C  CH2 . TRP A  1  103 ? -32.264 37.902  19.474  1.00 31.05  ? 103 TRP A CH2 1 
ATOM   812   N  N   . LEU A  1  104 ? -27.707 31.731  17.556  1.00 22.75  ? 104 LEU A N   1 
ATOM   813   C  CA  . LEU A  1  104 ? -26.267 31.498  17.587  1.00 25.07  ? 104 LEU A CA  1 
ATOM   814   C  C   . LEU A  1  104 ? -25.393 32.579  16.907  1.00 24.49  ? 104 LEU A C   1 
ATOM   815   O  O   . LEU A  1  104 ? -24.228 32.699  17.223  1.00 27.98  ? 104 LEU A O   1 
ATOM   816   C  CB  . LEU A  1  104 ? -25.939 30.132  16.995  1.00 24.44  ? 104 LEU A CB  1 
ATOM   817   C  CG  . LEU A  1  104 ? -26.222 28.950  17.905  1.00 25.32  ? 104 LEU A CG  1 
ATOM   818   C  CD1 . LEU A  1  104 ? -26.270 27.638  17.123  1.00 26.83  ? 104 LEU A CD1 1 
ATOM   819   C  CD2 . LEU A  1  104 ? -25.131 28.875  18.939  1.00 27.07  ? 104 LEU A CD2 1 
ATOM   820   N  N   . LEU A  1  105 ? -25.932 33.330  15.968  1.00 23.94  ? 105 LEU A N   1 
ATOM   821   C  CA  . LEU A  1  105 ? -25.126 34.274  15.207  1.00 24.30  ? 105 LEU A CA  1 
ATOM   822   C  C   . LEU A  1  105 ? -24.758 35.542  15.959  1.00 25.41  ? 105 LEU A C   1 
ATOM   823   O  O   . LEU A  1  105 ? -23.625 36.016  15.831  1.00 25.53  ? 105 LEU A O   1 
ATOM   824   C  CB  . LEU A  1  105 ? -25.816 34.609  13.904  1.00 25.02  ? 105 LEU A CB  1 
ATOM   825   C  CG  . LEU A  1  105 ? -25.860 33.467  12.891  1.00 24.77  ? 105 LEU A CG  1 
ATOM   826   C  CD1 . LEU A  1  105 ? -26.567 33.956  11.646  1.00 26.57  ? 105 LEU A CD1 1 
ATOM   827   C  CD2 . LEU A  1  105 ? -24.470 33.049  12.506  1.00 27.47  ? 105 LEU A CD2 1 
ATOM   828   N  N   . PRO A  1  106 ? -25.703 36.127  16.732  1.00 27.34  ? 106 PRO A N   1 
ATOM   829   C  CA  . PRO A  1  106 ? -25.208 37.297  17.472  1.00 27.13  ? 106 PRO A CA  1 
ATOM   830   C  C   . PRO A  1  106 ? -24.053 36.937  18.413  1.00 26.83  ? 106 PRO A C   1 
ATOM   831   O  O   . PRO A  1  106 ? -23.034 37.613  18.394  1.00 27.00  ? 106 PRO A O   1 
ATOM   832   C  CB  . PRO A  1  106 ? -26.488 37.838  18.170  1.00 25.94  ? 106 PRO A CB  1 
ATOM   833   C  CG  . PRO A  1  106 ? -27.549 37.520  17.180  1.00 24.83  ? 106 PRO A CG  1 
ATOM   834   C  CD  . PRO A  1  106 ? -27.187 36.125  16.698  1.00 26.09  ? 106 PRO A CD  1 
ATOM   835   N  N   . PRO A  1  107 ? -24.184 35.859  19.197  1.00 27.66  ? 107 PRO A N   1 
ATOM   836   C  CA  . PRO A  1  107 ? -22.982 35.482  19.921  1.00 27.35  ? 107 PRO A CA  1 
ATOM   837   C  C   . PRO A  1  107 ? -21.764 35.124  19.030  1.00 26.84  ? 107 PRO A C   1 
ATOM   838   O  O   . PRO A  1  107 ? -20.648 35.530  19.372  1.00 26.48  ? 107 PRO A O   1 
ATOM   839   C  CB  . PRO A  1  107 ? -23.450 34.319  20.785  1.00 28.51  ? 107 PRO A CB  1 
ATOM   840   C  CG  . PRO A  1  107 ? -24.853 34.019  20.385  1.00 27.28  ? 107 PRO A CG  1 
ATOM   841   C  CD  . PRO A  1  107 ? -25.372 35.306  19.851  1.00 27.80  ? 107 PRO A CD  1 
ATOM   842   N  N   . SER A  1  108 ? -21.951 34.438  17.900  1.00 24.92  ? 108 SER A N   1 
ATOM   843   C  CA  . SER A  1  108 ? -20.818 34.207  17.009  1.00 25.74  ? 108 SER A CA  1 
ATOM   844   C  C   . SER A  1  108 ? -20.138 35.508  16.647  1.00 27.62  ? 108 SER A C   1 
ATOM   845   O  O   . SER A  1  108 ? -18.893 35.564  16.600  1.00 28.28  ? 108 SER A O   1 
ATOM   846   C  CB  . SER A  1  108 ? -21.195 33.516  15.705  1.00 25.22  ? 108 SER A CB  1 
ATOM   847   O  OG  . SER A  1  108 ? -20.001 33.217  14.955  1.00 22.63  ? 108 SER A OG  1 
ATOM   848   N  N   . PHE A  1  109 ? -20.953 36.533  16.389  1.00 28.92  ? 109 PHE A N   1 
ATOM   849   C  CA  . PHE A  1  109 ? -20.462 37.829  15.932  1.00 30.68  ? 109 PHE A CA  1 
ATOM   850   C  C   . PHE A  1  109 ? -19.772 38.552  17.103  1.00 27.81  ? 109 PHE A C   1 
ATOM   851   O  O   . PHE A  1  109 ? -18.743 39.219  16.928  1.00 27.19  ? 109 PHE A O   1 
ATOM   852   C  CB  . PHE A  1  109 ? -21.607 38.680  15.334  1.00 31.63  ? 109 PHE A CB  1 
ATOM   853   C  CG  . PHE A  1  109 ? -21.173 39.784  14.383  1.00 35.35  ? 109 PHE A CG  1 
ATOM   854   C  CD1 . PHE A  1  109 ? -19.857 40.071  14.092  1.00 41.88  ? 109 PHE A CD1 1 
ATOM   855   C  CD2 . PHE A  1  109 ? -22.127 40.582  13.802  1.00 40.42  ? 109 PHE A CD2 1 
ATOM   856   C  CE1 . PHE A  1  109 ? -19.509 41.098  13.228  1.00 41.95  ? 109 PHE A CE1 1 
ATOM   857   C  CE2 . PHE A  1  109 ? -21.783 41.606  12.935  1.00 41.51  ? 109 PHE A CE2 1 
ATOM   858   C  CZ  . PHE A  1  109 ? -20.465 41.864  12.648  1.00 40.41  ? 109 PHE A CZ  1 
ATOM   859   N  N   . LEU A  1  110 ? -20.312 38.411  18.292  1.00 26.83  ? 110 LEU A N   1 
ATOM   860   C  CA  . LEU A  1  110 ? -19.696 39.071  19.438  1.00 31.05  ? 110 LEU A CA  1 
ATOM   861   C  C   . LEU A  1  110 ? -18.256 38.551  19.640  1.00 31.08  ? 110 LEU A C   1 
ATOM   862   O  O   . LEU A  1  110 ? -17.347 39.333  19.863  1.00 31.91  ? 110 LEU A O   1 
ATOM   863   C  CB  . LEU A  1  110 ? -20.552 38.897  20.690  1.00 32.12  ? 110 LEU A CB  1 
ATOM   864   C  CG  . LEU A  1  110 ? -20.044 39.472  22.015  1.00 34.08  ? 110 LEU A CG  1 
ATOM   865   C  CD1 . LEU A  1  110 ? -20.068 40.980  21.972  1.00 34.87  ? 110 LEU A CD1 1 
ATOM   866   C  CD2 . LEU A  1  110 ? -20.906 38.970  23.168  1.00 34.63  ? 110 LEU A CD2 1 
ATOM   867   N  N   . LEU A  1  111 ? -18.050 37.250  19.491  1.00 30.38  ? 111 LEU A N   1 
ATOM   868   C  CA  . LEU A  1  111 ? -16.746 36.668  19.665  1.00 31.29  ? 111 LEU A CA  1 
ATOM   869   C  C   . LEU A  1  111 ? -15.738 37.176  18.639  1.00 30.83  ? 111 LEU A C   1 
ATOM   870   O  O   . LEU A  1  111 ? -14.582 37.425  18.976  1.00 29.08  ? 111 LEU A O   1 
ATOM   871   C  CB  . LEU A  1  111 ? -16.822 35.137  19.599  1.00 32.89  ? 111 LEU A CB  1 
ATOM   872   C  CG  . LEU A  1  111 ? -17.531 34.460  20.771  1.00 35.51  ? 111 LEU A CG  1 
ATOM   873   C  CD1 . LEU A  1  111 ? -17.810 32.983  20.464  1.00 38.31  ? 111 LEU A CD1 1 
ATOM   874   C  CD2 . LEU A  1  111 ? -16.717 34.598  22.048  1.00 36.85  ? 111 LEU A CD2 1 
ATOM   875   N  N   . LEU A  1  112 ? -16.155 37.302  17.386  1.00 30.50  ? 112 LEU A N   1 
ATOM   876   C  CA  . LEU A  1  112 ? -15.267 37.849  16.355  1.00 30.33  ? 112 LEU A CA  1 
ATOM   877   C  C   . LEU A  1  112 ? -14.866 39.288  16.708  1.00 31.07  ? 112 LEU A C   1 
ATOM   878   O  O   . LEU A  1  112 ? -13.685 39.614  16.692  1.00 34.05  ? 112 LEU A O   1 
ATOM   879   C  CB  . LEU A  1  112 ? -15.953 37.836  15.005  1.00 30.46  ? 112 LEU A CB  1 
ATOM   880   C  CG  . LEU A  1  112 ? -15.043 38.171  13.844  1.00 30.73  ? 112 LEU A CG  1 
ATOM   881   C  CD1 . LEU A  1  112 ? -14.296 36.916  13.442  1.00 34.88  ? 112 LEU A CD1 1 
ATOM   882   C  CD2 . LEU A  1  112 ? -15.840 38.648  12.672  1.00 29.50  ? 112 LEU A CD2 1 
ATOM   883   N  N   . LEU A  1  113 ? -15.845 40.118  17.072  1.00 30.09  ? 113 LEU A N   1 
ATOM   884   C  CA  . LEU A  1  113 ? -15.582 41.507  17.445  1.00 32.42  ? 113 LEU A CA  1 
ATOM   885   C  C   . LEU A  1  113 ? -14.710 41.560  18.677  1.00 30.29  ? 113 LEU A C   1 
ATOM   886   O  O   . LEU A  1  113 ? -13.770 42.308  18.737  1.00 27.70  ? 113 LEU A O   1 
ATOM   887   C  CB  . LEU A  1  113 ? -16.888 42.315  17.667  1.00 34.99  ? 113 LEU A CB  1 
ATOM   888   C  CG  . LEU A  1  113 ? -17.680 42.651  16.375  1.00 38.66  ? 113 LEU A CG  1 
ATOM   889   C  CD1 . LEU A  1  113 ? -19.038 43.271  16.693  1.00 42.43  ? 113 LEU A CD1 1 
ATOM   890   C  CD2 . LEU A  1  113 ? -16.919 43.529  15.394  1.00 36.58  ? 113 LEU A CD2 1 
ATOM   891   N  N   . ALA A  1  114 ? -15.011 40.723  19.644  1.00 30.56  ? 114 ALA A N   1 
ATOM   892   C  CA  . ALA A  1  114 ? -14.145 40.551  20.812  1.00 30.77  ? 114 ALA A CA  1 
ATOM   893   C  C   . ALA A  1  114 ? -12.701 40.240  20.442  1.00 30.66  ? 114 ALA A C   1 
ATOM   894   O  O   . ALA A  1  114 ? -11.802 40.763  21.057  1.00 35.18  ? 114 ALA A O   1 
ATOM   895   C  CB  . ALA A  1  114 ? -14.689 39.450  21.711  1.00 28.84  ? 114 ALA A CB  1 
ATOM   896   N  N   . SER A  1  115 ? -12.494 39.425  19.424  1.00 28.75  ? 115 SER A N   1 
ATOM   897   C  CA  . SER A  1  115 ? -11.166 39.032  19.029  1.00 30.73  ? 115 SER A CA  1 
ATOM   898   C  C   . SER A  1  115 ? -10.300 40.198  18.526  1.00 32.24  ? 115 SER A C   1 
ATOM   899   O  O   . SER A  1  115 ? -9.077  40.087  18.539  1.00 28.74  ? 115 SER A O   1 
ATOM   900   C  CB  . SER A  1  115 ? -11.214 37.945  17.946  1.00 29.98  ? 115 SER A CB  1 
ATOM   901   O  OG  . SER A  1  115 ? -11.299 38.486  16.635  1.00 28.01  ? 115 SER A OG  1 
ATOM   902   N  N   . SER A  1  116 ? -10.949 41.237  18.009  1.00 31.25  ? 116 SER A N   1 
ATOM   903   C  CA  . SER A  1  116 ? -10.290 42.418  17.477  1.00 33.40  ? 116 SER A CA  1 
ATOM   904   C  C   . SER A  1  116 ? -10.049 43.457  18.573  1.00 33.93  ? 116 SER A C   1 
ATOM   905   O  O   . SER A  1  116 ? -9.322  44.433  18.347  1.00 35.58  ? 116 SER A O   1 
ATOM   906   C  CB  . SER A  1  116 ? -11.165 43.037  16.366  1.00 34.87  ? 116 SER A CB  1 
ATOM   907   O  OG  . SER A  1  116 ? -12.348 43.686  16.902  1.00 32.69  ? 116 SER A OG  1 
ATOM   908   N  N   . MET A  1  117 ? -10.668 43.249  19.736  1.00 34.09  ? 117 MET A N   1 
ATOM   909   C  CA  . MET A  1  117 ? -10.560 44.120  20.900  1.00 36.87  ? 117 MET A CA  1 
ATOM   910   C  C   . MET A  1  117 ? -9.428  43.721  21.843  1.00 36.94  ? 117 MET A C   1 
ATOM   911   O  O   . MET A  1  117 ? -8.894  44.565  22.530  1.00 38.84  ? 117 MET A O   1 
ATOM   912   C  CB  . MET A  1  117 ? -11.856 44.074  21.734  1.00 41.17  ? 117 MET A CB  1 
ATOM   913   C  CG  . MET A  1  117 ? -13.117 44.694  21.120  1.00 47.13  ? 117 MET A CG  1 
ATOM   914   S  SD  . MET A  1  117 ? -12.990 46.476  20.909  1.00 57.90  ? 117 MET A SD  1 
ATOM   915   C  CE  . MET A  1  117 ? -13.485 47.084  22.529  1.00 58.46  ? 117 MET A CE  1 
ATOM   916   N  N   . VAL A  1  118 ? -9.136  42.430  21.935  1.00 35.77  ? 118 VAL A N   1 
ATOM   917   C  CA  . VAL A  1  118 ? -8.221  41.906  22.917  1.00 31.98  ? 118 VAL A CA  1 
ATOM   918   C  C   . VAL A  1  118 ? -6.929  41.692  22.202  1.00 31.68  ? 118 VAL A C   1 
ATOM   919   O  O   . VAL A  1  118 ? -6.902  41.422  20.988  1.00 28.01  ? 118 VAL A O   1 
ATOM   920   C  CB  . VAL A  1  118 ? -8.677  40.576  23.567  1.00 32.71  ? 118 VAL A CB  1 
ATOM   921   C  CG1 . VAL A  1  118 ? -10.168 40.563  23.851  1.00 33.64  ? 118 VAL A CG1 1 
ATOM   922   C  CG2 . VAL A  1  118 ? -8.298  39.355  22.748  1.00 33.81  ? 118 VAL A CG2 1 
ATOM   923   N  N   . GLU A  1  119 ? -5.855  41.823  22.968  1.00 33.77  ? 119 GLU A N   1 
ATOM   924   C  CA  . GLU A  1  119 ? -4.498  41.763  22.446  1.00 34.14  ? 119 GLU A CA  1 
ATOM   925   C  C   . GLU A  1  119 ? -4.339  42.700  21.244  1.00 31.33  ? 119 GLU A C   1 
ATOM   926   O  O   . GLU A  1  119 ? -4.870  43.828  21.253  1.00 31.24  ? 119 GLU A O   1 
ATOM   927   C  CB  . GLU A  1  119 ? -4.170  40.302  22.134  1.00 38.10  ? 119 GLU A CB  1 
ATOM   928   C  CG  . GLU A  1  119 ? -4.283  39.406  23.363  1.00 45.58  ? 119 GLU A CG  1 
ATOM   929   C  CD  . GLU A  1  119 ? -3.264  39.735  24.461  1.00 49.37  ? 119 GLU A CD  1 
ATOM   930   O  OE1 . GLU A  1  119 ? -3.499  39.306  25.617  1.00 59.03  ? 119 GLU A OE1 1 
ATOM   931   O  OE2 . GLU A  1  119 ? -2.231  40.397  24.179  1.00 47.46  ? 119 GLU A OE2 1 
ATOM   932   N  N   . ALA A  1  120 ? -3.653  42.240  20.205  1.00 29.76  ? 120 ALA A N   1 
ATOM   933   C  CA  . ALA A  1  120 ? -3.535  43.001  18.986  1.00 32.39  ? 120 ALA A CA  1 
ATOM   934   C  C   . ALA A  1  120 ? -4.382  42.390  17.844  1.00 30.53  ? 120 ALA A C   1 
ATOM   935   O  O   . ALA A  1  120 ? -4.081  42.582  16.673  1.00 30.15  ? 120 ALA A O   1 
ATOM   936   C  CB  . ALA A  1  120 ? -2.047  43.088  18.602  1.00 34.16  ? 120 ALA A CB  1 
ATOM   937   N  N   . GLY A  1  121 ? -5.425  41.634  18.181  1.00 30.71  ? 121 GLY A N   1 
ATOM   938   C  CA  . GLY A  1  121 ? -6.278  41.063  17.171  1.00 29.79  ? 121 GLY A CA  1 
ATOM   939   C  C   . GLY A  1  121 ? -5.704  39.877  16.420  1.00 30.31  ? 121 GLY A C   1 
ATOM   940   O  O   . GLY A  1  121 ? -4.531  39.495  16.603  1.00 31.92  ? 121 GLY A O   1 
ATOM   941   N  N   . ALA A  1  122 ? -6.560  39.270  15.586  1.00 31.03  ? 122 ALA A N   1 
ATOM   942   C  CA  . ALA A  1  122 ? -6.163  38.162  14.712  1.00 29.31  ? 122 ALA A CA  1 
ATOM   943   C  C   . ALA A  1  122 ? -5.864  38.726  13.340  1.00 28.28  ? 122 ALA A C   1 
ATOM   944   O  O   . ALA A  1  122 ? -6.781  38.962  12.583  1.00 29.22  ? 122 ALA A O   1 
ATOM   945   C  CB  . ALA A  1  122 ? -7.266  37.123  14.646  1.00 27.96  ? 122 ALA A CB  1 
ATOM   946   N  N   . GLY A  1  123 ? -4.594  39.041  13.084  1.00 25.58  ? 123 GLY A N   1 
ATOM   947   C  CA  . GLY A  1  123 ? -4.097  39.460  11.784  1.00 25.95  ? 123 GLY A CA  1 
ATOM   948   C  C   . GLY A  1  123 ? -3.522  38.276  11.048  1.00 27.30  ? 123 GLY A C   1 
ATOM   949   O  O   . GLY A  1  123 ? -2.329  38.199  10.757  1.00 28.46  ? 123 GLY A O   1 
ATOM   950   N  N   . THR A  1  124 ? -4.391  37.353  10.710  1.00 27.87  ? 124 THR A N   1 
ATOM   951   C  CA  . THR A  1  124 ? -3.996  36.088  10.119  1.00 27.62  ? 124 THR A CA  1 
ATOM   952   C  C   . THR A  1  124 ? -4.338  35.950  8.657   1.00 26.83  ? 124 THR A C   1 
ATOM   953   O  O   . THR A  1  124 ? -3.878  35.014  8.007   1.00 27.12  ? 124 THR A O   1 
ATOM   954   C  CB  . THR A  1  124 ? -4.806  35.021  10.818  1.00 30.84  ? 124 THR A CB  1 
ATOM   955   O  OG1 . THR A  1  124 ? -6.203  35.286  10.619  1.00 30.24  ? 124 THR A OG1 1 
ATOM   956   C  CG2 . THR A  1  124 ? -4.525  35.059  12.322  1.00 34.00  ? 124 THR A CG2 1 
ATOM   957   N  N   . GLY A  1  125 ? -5.185  36.844  8.136   1.00 26.15  ? 125 GLY A N   1 
ATOM   958   C  CA  . GLY A  1  125 ? -5.962  36.528  6.942   1.00 26.52  ? 125 GLY A CA  1 
ATOM   959   C  C   . GLY A  1  125 ? -7.096  35.572  7.294   1.00 26.43  ? 125 GLY A C   1 
ATOM   960   O  O   . GLY A  1  125 ? -7.106  34.967  8.374   1.00 26.78  ? 125 GLY A O   1 
ATOM   961   N  N   . TRP A  1  126 ? -8.080  35.442  6.420   1.00 25.53  ? 126 TRP A N   1 
ATOM   962   C  CA  . TRP A  1  126 ? -9.292  34.663  6.793   1.00 25.56  ? 126 TRP A CA  1 
ATOM   963   C  C   . TRP A  1  126 ? -9.052  33.148  6.735   1.00 24.23  ? 126 TRP A C   1 
ATOM   964   O  O   . TRP A  1  126 ? -9.879  32.384  7.187   1.00 22.30  ? 126 TRP A O   1 
ATOM   965   C  CB  . TRP A  1  126 ? -10.521 35.077  5.958   1.00 23.56  ? 126 TRP A CB  1 
ATOM   966   C  CG  . TRP A  1  126 ? -10.651 34.430  4.620   1.00 22.23  ? 126 TRP A CG  1 
ATOM   967   C  CD1 . TRP A  1  126 ? -9.938  34.701  3.556   1.00 23.44  ? 126 TRP A CD1 1 
ATOM   968   C  CD2 . TRP A  1  126 ? -11.590 33.428  4.236   1.00 22.62  ? 126 TRP A CD2 1 
ATOM   969   N  NE1 . TRP A  1  126 ? -10.346 33.943  2.485   1.00 24.13  ? 126 TRP A NE1 1 
ATOM   970   C  CE2 . TRP A  1  126 ? -11.365 33.145  2.890   1.00 23.97  ? 126 TRP A CE2 1 
ATOM   971   C  CE3 . TRP A  1  126 ? -12.625 32.766  4.900   1.00 24.17  ? 126 TRP A CE3 1 
ATOM   972   C  CZ2 . TRP A  1  126 ? -12.104 32.193  2.179   1.00 26.88  ? 126 TRP A CZ2 1 
ATOM   973   C  CZ3 . TRP A  1  126 ? -13.348 31.816  4.225   1.00 25.39  ? 126 TRP A CZ3 1 
ATOM   974   C  CH2 . TRP A  1  126 ? -13.089 31.529  2.865   1.00 27.45  ? 126 TRP A CH2 1 
ATOM   975   N  N   . THR A  1  127 ? -7.928  32.750  6.141   1.00 25.10  ? 127 THR A N   1 
ATOM   976   C  CA  . THR A  1  127 ? -7.509  31.354  6.058   1.00 23.95  ? 127 THR A CA  1 
ATOM   977   C  C   . THR A  1  127 ? -6.998  30.865  7.366   1.00 23.53  ? 127 THR A C   1 
ATOM   978   O  O   . THR A  1  127 ? -7.043  29.677  7.595   1.00 22.57  ? 127 THR A O   1 
ATOM   979   C  CB  . THR A  1  127 ? -6.387  31.150  5.031   1.00 25.67  ? 127 THR A CB  1 
ATOM   980   O  OG1 . THR A  1  127 ? -5.475  32.267  5.032   1.00 26.92  ? 127 THR A OG1 1 
ATOM   981   C  CG2 . THR A  1  127 ? -6.971  31.030  3.663   1.00 27.83  ? 127 THR A CG2 1 
ATOM   982   N  N   . VAL A  1  128 ? -6.495  31.780  8.212   1.00 23.33  ? 128 VAL A N   1 
ATOM   983   C  CA  . VAL A  1  128 ? -6.031  31.455  9.544   1.00 24.04  ? 128 VAL A CA  1 
ATOM   984   C  C   . VAL A  1  128 ? -4.963  30.321  9.514   1.00 25.26  ? 128 VAL A C   1 
ATOM   985   O  O   . VAL A  1  128 ? -4.982  29.423  10.315  1.00 25.12  ? 128 VAL A O   1 
ATOM   986   C  CB  . VAL A  1  128 ? -7.207  31.095  10.499  1.00 25.55  ? 128 VAL A CB  1 
ATOM   987   C  CG1 . VAL A  1  128 ? -6.820  31.425  11.928  1.00 25.38  ? 128 VAL A CG1 1 
ATOM   988   C  CG2 . VAL A  1  128 ? -8.501  31.854  10.164  1.00 25.97  ? 128 VAL A CG2 1 
ATOM   989   N  N   . TYR A  1  129 ? -4.045  30.365  8.560   1.00 26.08  ? 129 TYR A N   1 
ATOM   990   C  CA  . TYR A  1  129 ? -2.945  29.389  8.477   1.00 25.13  ? 129 TYR A CA  1 
ATOM   991   C  C   . TYR A  1  129 ? -1.969  29.411  9.691   1.00 26.97  ? 129 TYR A C   1 
ATOM   992   O  O   . TYR A  1  129 ? -1.439  30.467  10.095  1.00 24.91  ? 129 TYR A O   1 
ATOM   993   C  CB  . TYR A  1  129 ? -2.134  29.677  7.244   1.00 23.81  ? 129 TYR A CB  1 
ATOM   994   C  CG  . TYR A  1  129 ? -2.757  29.357  5.890   1.00 24.80  ? 129 TYR A CG  1 
ATOM   995   C  CD1 . TYR A  1  129 ? -3.987  28.688  5.740   1.00 25.81  ? 129 TYR A CD1 1 
ATOM   996   C  CD2 . TYR A  1  129 ? -2.027  29.584  4.746   1.00 24.84  ? 129 TYR A CD2 1 
ATOM   997   C  CE1 . TYR A  1  129 ? -4.475  28.350  4.483   1.00 23.61  ? 129 TYR A CE1 1 
ATOM   998   C  CE2 . TYR A  1  129 ? -2.507  29.227  3.497   1.00 25.68  ? 129 TYR A CE2 1 
ATOM   999   C  CZ  . TYR A  1  129 ? -3.740  28.643  3.382   1.00 23.89  ? 129 TYR A CZ  1 
ATOM   1000  O  OH  . TYR A  1  129 ? -4.143  28.339  2.117   1.00 25.71  ? 129 TYR A OH  1 
ATOM   1001  N  N   . PRO A  1  130 ? -1.703  28.230  10.269  1.00 28.83  ? 130 PRO A N   1 
ATOM   1002  C  CA  . PRO A  1  130 ? -0.539  28.108  11.163  1.00 27.76  ? 130 PRO A CA  1 
ATOM   1003  C  C   . PRO A  1  130 ? 0.699   28.013  10.296  1.00 26.23  ? 130 PRO A C   1 
ATOM   1004  O  O   . PRO A  1  130 ? 0.546   27.639  9.130   1.00 28.38  ? 130 PRO A O   1 
ATOM   1005  C  CB  . PRO A  1  130 ? -0.794  26.814  11.885  1.00 28.16  ? 130 PRO A CB  1 
ATOM   1006  C  CG  . PRO A  1  130 ? -1.619  26.017  10.955  1.00 29.67  ? 130 PRO A CG  1 
ATOM   1007  C  CD  . PRO A  1  130 ? -2.345  26.934  10.024  1.00 28.32  ? 130 PRO A CD  1 
ATOM   1008  N  N   . PRO A  1  131 ? 1.890   28.386  10.784  1.00 24.64  ? 131 PRO A N   1 
ATOM   1009  C  CA  . PRO A  1  131 ? 2.151   28.826  12.150  1.00 24.42  ? 131 PRO A CA  1 
ATOM   1010  C  C   . PRO A  1  131 ? 1.800   30.266  12.510  1.00 24.28  ? 131 PRO A C   1 
ATOM   1011  O  O   . PRO A  1  131 ? 1.767   30.606  13.733  1.00 24.78  ? 131 PRO A O   1 
ATOM   1012  C  CB  . PRO A  1  131 ? 3.661   28.644  12.305  1.00 24.05  ? 131 PRO A CB  1 
ATOM   1013  C  CG  . PRO A  1  131 ? 4.074   27.787  11.204  1.00 23.79  ? 131 PRO A CG  1 
ATOM   1014  C  CD  . PRO A  1  131 ? 3.150   28.127  10.080  1.00 24.32  ? 131 PRO A CD  1 
ATOM   1015  N  N   . LEU A  1  132 ? 1.493   31.106  11.531  1.00 22.87  ? 132 LEU A N   1 
ATOM   1016  C  CA  . LEU A  1  132 ? 1.117   32.490  11.886  1.00 23.17  ? 132 LEU A CA  1 
ATOM   1017  C  C   . LEU A  1  132 ? -0.038  32.544  12.896  1.00 23.87  ? 132 LEU A C   1 
ATOM   1018  O  O   . LEU A  1  132 ? 0.027   33.337  13.830  1.00 24.10  ? 132 LEU A O   1 
ATOM   1019  C  CB  . LEU A  1  132 ? 0.795   33.296  10.649  1.00 22.30  ? 132 LEU A CB  1 
ATOM   1020  C  CG  . LEU A  1  132 ? 0.510   34.755  10.953  1.00 24.98  ? 132 LEU A CG  1 
ATOM   1021  C  CD1 . LEU A  1  132 ? 1.714   35.473  11.596  1.00 26.30  ? 132 LEU A CD1 1 
ATOM   1022  C  CD2 . LEU A  1  132 ? 0.092   35.450  9.662   1.00 25.20  ? 132 LEU A CD2 1 
ATOM   1023  N  N   . ALA A  1  133 ? -1.061  31.679  12.728  1.00 24.88  ? 133 ALA A N   1 
ATOM   1024  C  CA  . ALA A  1  133 ? -2.224  31.553  13.688  1.00 23.19  ? 133 ALA A CA  1 
ATOM   1025  C  C   . ALA A  1  133 ? -1.905  30.788  14.923  1.00 22.98  ? 133 ALA A C   1 
ATOM   1026  O  O   . ALA A  1  133 ? -2.795  30.621  15.740  1.00 22.93  ? 133 ALA A O   1 
ATOM   1027  C  CB  . ALA A  1  133 ? -3.414  30.860  13.035  1.00 22.20  ? 133 ALA A CB  1 
ATOM   1028  N  N   . GLY A  1  134 ? -0.675  30.277  15.055  1.00 23.59  ? 134 GLY A N   1 
ATOM   1029  C  CA  . GLY A  1  134 ? -0.258  29.529  16.240  1.00 24.30  ? 134 GLY A CA  1 
ATOM   1030  C  C   . GLY A  1  134 ? 0.040   30.351  17.482  1.00 26.13  ? 134 GLY A C   1 
ATOM   1031  O  O   . GLY A  1  134 ? 0.044   31.576  17.456  1.00 25.75  ? 134 GLY A O   1 
ATOM   1032  N  N   . ASN A  1  135 ? 0.307   29.669  18.586  1.00 29.00  ? 135 ASN A N   1 
ATOM   1033  C  CA  . ASN A  1  135 ? 0.407   30.350  19.893  1.00 29.83  ? 135 ASN A CA  1 
ATOM   1034  C  C   . ASN A  1  135 ? 1.747   31.080  20.114  1.00 31.84  ? 135 ASN A C   1 
ATOM   1035  O  O   . ASN A  1  135 ? 1.965   31.665  21.168  1.00 33.15  ? 135 ASN A O   1 
ATOM   1036  C  CB  . ASN A  1  135 ? 0.132   29.344  21.021  1.00 30.66  ? 135 ASN A CB  1 
ATOM   1037  C  CG  . ASN A  1  135 ? 1.146   28.202  21.042  1.00 30.18  ? 135 ASN A CG  1 
ATOM   1038  O  OD1 . ASN A  1  135 ? 2.178   28.270  20.368  1.00 26.77  ? 135 ASN A OD1 1 
ATOM   1039  N  ND2 . ASN A  1  135 ? 0.841   27.146  21.798  1.00 30.72  ? 135 ASN A ND2 1 
ATOM   1040  N  N   . LEU A  1  136 ? 2.624   31.060  19.112  1.00 36.18  ? 136 LEU A N   1 
ATOM   1041  C  CA  . LEU A  1  136 ? 3.883   31.820  19.121  1.00 37.54  ? 136 LEU A CA  1 
ATOM   1042  C  C   . LEU A  1  136 ? 3.830   33.136  18.349  1.00 34.20  ? 136 LEU A C   1 
ATOM   1043  O  O   . LEU A  1  136 ? 4.078   34.190  18.903  1.00 34.24  ? 136 LEU A O   1 
ATOM   1044  C  CB  . LEU A  1  136 ? 4.976   30.936  18.553  1.00 43.20  ? 136 LEU A CB  1 
ATOM   1045  C  CG  . LEU A  1  136 ? 6.386   31.060  19.059  1.00 49.22  ? 136 LEU A CG  1 
ATOM   1046  C  CD1 . LEU A  1  136 ? 6.381   31.255  20.580  1.00 54.49  ? 136 LEU A CD1 1 
ATOM   1047  C  CD2 . LEU A  1  136 ? 7.113   29.776  18.630  1.00 50.92  ? 136 LEU A CD2 1 
ATOM   1048  N  N   . ALA A  1  137 ? 3.476   33.074  17.074  1.00 32.55  ? 137 ALA A N   1 
ATOM   1049  C  CA  . ALA A  1  137 ? 3.233   34.270  16.278  1.00 29.93  ? 137 ALA A CA  1 
ATOM   1050  C  C   . ALA A  1  137 ? 1.906   34.996  16.604  1.00 28.89  ? 137 ALA A C   1 
ATOM   1051  O  O   . ALA A  1  137 ? 1.718   36.152  16.220  1.00 29.95  ? 137 ALA A O   1 
ATOM   1052  C  CB  . ALA A  1  137 ? 3.320   33.922  14.787  1.00 29.99  ? 137 ALA A CB  1 
ATOM   1053  N  N   . HIS A  1  138 ? 0.976   34.318  17.262  1.00 27.19  ? 138 HIS A N   1 
ATOM   1054  C  CA  . HIS A  1  138 ? -0.293  34.936  17.649  1.00 27.23  ? 138 HIS A CA  1 
ATOM   1055  C  C   . HIS A  1  138 ? -0.664  34.451  19.014  1.00 28.84  ? 138 HIS A C   1 
ATOM   1056  O  O   . HIS A  1  138 ? -1.649  33.762  19.219  1.00 33.77  ? 138 HIS A O   1 
ATOM   1057  C  CB  . HIS A  1  138 ? -1.393  34.650  16.623  1.00 26.46  ? 138 HIS A CB  1 
ATOM   1058  C  CG  . HIS A  1  138 ? -1.535  35.712  15.602  1.00 24.02  ? 138 HIS A CG  1 
ATOM   1059  N  ND1 . HIS A  1  138 ? -2.372  36.778  15.786  1.00 26.21  ? 138 HIS A ND1 1 
ATOM   1060  C  CD2 . HIS A  1  138 ? -0.926  35.911  14.420  1.00 25.04  ? 138 HIS A CD2 1 
ATOM   1061  C  CE1 . HIS A  1  138 ? -2.270  37.598  14.760  1.00 26.53  ? 138 HIS A CE1 1 
ATOM   1062  N  NE2 . HIS A  1  138 ? -1.410  37.084  13.906  1.00 26.32  ? 138 HIS A NE2 1 
ATOM   1063  N  N   . ALA A  1  139 ? 0.160   34.829  19.966  1.00 30.41  ? 139 ALA A N   1 
ATOM   1064  C  CA  . ALA A  1  139 ? -0.038  34.413  21.334  1.00 31.78  ? 139 ALA A CA  1 
ATOM   1065  C  C   . ALA A  1  139 ? -1.219  35.197  21.901  1.00 28.50  ? 139 ALA A C   1 
ATOM   1066  O  O   . ALA A  1  139 ? -1.460  36.315  21.488  1.00 29.47  ? 139 ALA A O   1 
ATOM   1067  C  CB  . ALA A  1  139 ? 1.244   34.661  22.136  1.00 30.05  ? 139 ALA A CB  1 
ATOM   1068  N  N   . GLY A  1  140 ? -1.951  34.596  22.825  1.00 27.93  ? 140 GLY A N   1 
ATOM   1069  C  CA  . GLY A  1  140 ? -3.106  35.249  23.459  1.00 28.32  ? 140 GLY A CA  1 
ATOM   1070  C  C   . GLY A  1  140 ? -4.407  34.875  22.793  1.00 29.68  ? 140 GLY A C   1 
ATOM   1071  O  O   . GLY A  1  140 ? -4.434  34.091  21.839  1.00 30.33  ? 140 GLY A O   1 
ATOM   1072  N  N   . ALA A  1  141 ? -5.481  35.499  23.235  1.00 27.62  ? 141 ALA A N   1 
ATOM   1073  C  CA  . ALA A  1  141 ? -6.802  34.956  22.984  1.00 27.40  ? 141 ALA A CA  1 
ATOM   1074  C  C   . ALA A  1  141 ? -7.437  35.252  21.621  1.00 27.81  ? 141 ALA A C   1 
ATOM   1075  O  O   . ALA A  1  141 ? -8.407  34.593  21.264  1.00 27.51  ? 141 ALA A O   1 
ATOM   1076  C  CB  . ALA A  1  141 ? -7.742  35.395  24.095  1.00 27.71  ? 141 ALA A CB  1 
ATOM   1077  N  N   . SER A  1  142 ? -6.915  36.212  20.859  1.00 27.29  ? 142 SER A N   1 
ATOM   1078  C  CA  . SER A  1  142 ? -7.601  36.665  19.639  1.00 28.13  ? 142 SER A CA  1 
ATOM   1079  C  C   . SER A  1  142 ? -7.976  35.537  18.699  1.00 27.59  ? 142 SER A C   1 
ATOM   1080  O  O   . SER A  1  142 ? -9.130  35.454  18.302  1.00 28.14  ? 142 SER A O   1 
ATOM   1081  C  CB  . SER A  1  142 ? -6.803  37.714  18.852  1.00 28.64  ? 142 SER A CB  1 
ATOM   1082  O  OG  . SER A  1  142 ? -6.682  38.914  19.573  1.00 31.86  ? 142 SER A OG  1 
ATOM   1083  N  N   . VAL A  1  143 ? -7.010  34.692  18.347  1.00 27.10  ? 143 VAL A N   1 
ATOM   1084  C  CA  . VAL A  1  143 ? -7.229  33.680  17.338  1.00 26.60  ? 143 VAL A CA  1 
ATOM   1085  C  C   . VAL A  1  143 ? -8.219  32.674  17.854  1.00 26.88  ? 143 VAL A C   1 
ATOM   1086  O  O   . VAL A  1  143 ? -9.001  32.111  17.086  1.00 27.90  ? 143 VAL A O   1 
ATOM   1087  C  CB  . VAL A  1  143 ? -5.904  33.013  16.923  1.00 28.91  ? 143 VAL A CB  1 
ATOM   1088  C  CG1 . VAL A  1  143 ? -6.112  31.668  16.225  1.00 29.09  ? 143 VAL A CG1 1 
ATOM   1089  C  CG2 . VAL A  1  143 ? -5.134  33.935  15.988  1.00 31.71  ? 143 VAL A CG2 1 
ATOM   1090  N  N   . ASP A  1  144 ? -8.174  32.431  19.155  1.00 26.80  ? 144 ASP A N   1 
ATOM   1091  C  CA  . ASP A  1  144 ? -9.050  31.453  19.762  1.00 27.93  ? 144 ASP A CA  1 
ATOM   1092  C  C   . ASP A  1  144 ? -10.486 31.945  19.773  1.00 26.14  ? 144 ASP A C   1 
ATOM   1093  O  O   . ASP A  1  144 ? -11.390 31.165  19.574  1.00 25.69  ? 144 ASP A O   1 
ATOM   1094  C  CB  . ASP A  1  144 ? -8.594  31.088  21.198  1.00 29.68  ? 144 ASP A CB  1 
ATOM   1095  C  CG  . ASP A  1  144 ? -7.315  30.233  21.212  1.00 31.13  ? 144 ASP A CG  1 
ATOM   1096  O  OD1 . ASP A  1  144 ? -7.138  29.356  20.352  1.00 30.46  ? 144 ASP A OD1 1 
ATOM   1097  O  OD2 . ASP A  1  144 ? -6.448  30.466  22.064  1.00 33.62  ? 144 ASP A OD2 1 
ATOM   1098  N  N   . LEU A  1  145 ? -10.681 33.225  20.032  1.00 24.89  ? 145 LEU A N   1 
ATOM   1099  C  CA  . LEU A  1  145 ? -11.991 33.820  19.965  1.00 26.61  ? 145 LEU A CA  1 
ATOM   1100  C  C   . LEU A  1  145 ? -12.565 33.717  18.545  1.00 29.05  ? 145 LEU A C   1 
ATOM   1101  O  O   . LEU A  1  145 ? -13.805 33.567  18.375  1.00 30.04  ? 145 LEU A O   1 
ATOM   1102  C  CB  . LEU A  1  145 ? -11.940 35.273  20.445  1.00 25.18  ? 145 LEU A CB  1 
ATOM   1103  C  CG  . LEU A  1  145 ? -11.747 35.410  21.960  1.00 25.32  ? 145 LEU A CG  1 
ATOM   1104  C  CD1 . LEU A  1  145 ? -11.404 36.826  22.400  1.00 27.13  ? 145 LEU A CD1 1 
ATOM   1105  C  CD2 . LEU A  1  145 ? -12.988 34.977  22.714  1.00 26.72  ? 145 LEU A CD2 1 
ATOM   1106  N  N   . THR A  1  146 ? -11.669 33.795  17.550  1.00 27.94  ? 146 THR A N   1 
ATOM   1107  C  CA  . THR A  1  146 ? -12.040 33.647  16.130  1.00 28.77  ? 146 THR A CA  1 
ATOM   1108  C  C   . THR A  1  146 ? -12.494 32.222  15.803  1.00 27.87  ? 146 THR A C   1 
ATOM   1109  O  O   . THR A  1  146 ? -13.459 32.035  15.058  1.00 28.49  ? 146 THR A O   1 
ATOM   1110  C  CB  . THR A  1  146 ? -10.866 33.985  15.181  1.00 25.71  ? 146 THR A CB  1 
ATOM   1111  O  OG1 . THR A  1  146 ? -10.403 35.282  15.478  1.00 27.69  ? 146 THR A OG1 1 
ATOM   1112  C  CG2 . THR A  1  146 ? -11.294 33.955  13.763  1.00 25.01  ? 146 THR A CG2 1 
ATOM   1113  N  N   . ILE A  1  147 ? -11.739 31.251  16.313  1.00 26.83  ? 147 ILE A N   1 
ATOM   1114  C  CA  . ILE A  1  147 ? -12.052 29.846  16.176  1.00 25.29  ? 147 ILE A CA  1 
ATOM   1115  C  C   . ILE A  1  147 ? -13.414 29.573  16.751  1.00 26.55  ? 147 ILE A C   1 
ATOM   1116  O  O   . ILE A  1  147 ? -14.195 28.887  16.127  1.00 30.37  ? 147 ILE A O   1 
ATOM   1117  C  CB  . ILE A  1  147 ? -11.025 28.954  16.873  1.00 23.27  ? 147 ILE A CB  1 
ATOM   1118  C  CG1 . ILE A  1  147 ? -9.719  28.971  16.061  1.00 23.91  ? 147 ILE A CG1 1 
ATOM   1119  C  CG2 . ILE A  1  147 ? -11.556 27.537  16.979  1.00 23.31  ? 147 ILE A CG2 1 
ATOM   1120  C  CD1 . ILE A  1  147 ? -8.530  28.243  16.679  1.00 24.03  ? 147 ILE A CD1 1 
ATOM   1121  N  N   . PHE A  1  148 ? -13.681 30.064  17.949  1.00 26.86  ? 148 PHE A N   1 
ATOM   1122  C  CA  . PHE A  1  148 ? -14.971 29.853  18.590  1.00 27.33  ? 148 PHE A CA  1 
ATOM   1123  C  C   . PHE A  1  148 ? -16.118 30.574  17.870  1.00 27.45  ? 148 PHE A C   1 
ATOM   1124  O  O   . PHE A  1  148 ? -17.231 30.044  17.792  1.00 26.16  ? 148 PHE A O   1 
ATOM   1125  C  CB  . PHE A  1  148 ? -14.927 30.261  20.060  1.00 28.21  ? 148 PHE A CB  1 
ATOM   1126  C  CG  . PHE A  1  148 ? -14.118 29.337  20.924  1.00 31.36  ? 148 PHE A CG  1 
ATOM   1127  C  CD1 . PHE A  1  148 ? -14.268 27.936  20.832  1.00 36.27  ? 148 PHE A CD1 1 
ATOM   1128  C  CD2 . PHE A  1  148 ? -13.234 29.847  21.853  1.00 32.29  ? 148 PHE A CD2 1 
ATOM   1129  C  CE1 . PHE A  1  148 ? -13.526 27.088  21.631  1.00 38.79  ? 148 PHE A CE1 1 
ATOM   1130  C  CE2 . PHE A  1  148 ? -12.498 29.011  22.664  1.00 35.31  ? 148 PHE A CE2 1 
ATOM   1131  C  CZ  . PHE A  1  148 ? -12.635 27.632  22.556  1.00 38.86  ? 148 PHE A CZ  1 
ATOM   1132  N  N   . SER A  1  149 ? -15.858 31.773  17.359  1.00 25.84  ? 149 SER A N   1 
ATOM   1133  C  CA  . SER A  1  149 ? -16.805 32.421  16.431  1.00 26.15  ? 149 SER A CA  1 
ATOM   1134  C  C   . SER A  1  149 ? -17.197 31.464  15.302  1.00 23.90  ? 149 SER A C   1 
ATOM   1135  O  O   . SER A  1  149 ? -18.371 31.326  14.972  1.00 22.45  ? 149 SER A O   1 
ATOM   1136  C  CB  . SER A  1  149 ? -16.219 33.712  15.834  1.00 26.29  ? 149 SER A CB  1 
ATOM   1137  O  OG  . SER A  1  149 ? -17.159 34.359  14.993  1.00 25.50  ? 149 SER A OG  1 
ATOM   1138  N  N   . LEU A  1  150 ? -16.203 30.806  14.734  1.00 24.16  ? 150 LEU A N   1 
ATOM   1139  C  CA  . LEU A  1  150 ? -16.433 29.908  13.609  1.00 26.58  ? 150 LEU A CA  1 
ATOM   1140  C  C   . LEU A  1  150 ? -17.185 28.650  14.034  1.00 27.28  ? 150 LEU A C   1 
ATOM   1141  O  O   . LEU A  1  150 ? -18.010 28.153  13.283  1.00 31.77  ? 150 LEU A O   1 
ATOM   1142  C  CB  . LEU A  1  150 ? -15.140 29.574  12.846  1.00 26.73  ? 150 LEU A CB  1 
ATOM   1143  C  CG  . LEU A  1  150 ? -14.581 30.732  11.998  1.00 29.90  ? 150 LEU A CG  1 
ATOM   1144  C  CD1 . LEU A  1  150 ? -13.224 30.346  11.429  1.00 31.88  ? 150 LEU A CD1 1 
ATOM   1145  C  CD2 . LEU A  1  150 ? -15.511 31.168  10.860  1.00 30.82  ? 150 LEU A CD2 1 
ATOM   1146  N  N   . HIS A  1  151 ? -16.917 28.135  15.219  1.00 25.55  ? 151 HIS A N   1 
ATOM   1147  C  CA  . HIS A  1  151 ? -17.657 26.988  15.705  1.00 25.87  ? 151 HIS A CA  1 
ATOM   1148  C  C   . HIS A  1  151 ? -19.149 27.294  15.845  1.00 25.23  ? 151 HIS A C   1 
ATOM   1149  O  O   . HIS A  1  151 ? -19.960 26.477  15.436  1.00 25.69  ? 151 HIS A O   1 
ATOM   1150  C  CB  . HIS A  1  151 ? -17.126 26.489  17.047  1.00 25.31  ? 151 HIS A CB  1 
ATOM   1151  C  CG  . HIS A  1  151 ? -15.938 25.603  16.925  1.00 26.50  ? 151 HIS A CG  1 
ATOM   1152  N  ND1 . HIS A  1  151 ? -14.849 25.700  17.765  1.00 24.96  ? 151 HIS A ND1 1 
ATOM   1153  C  CD2 . HIS A  1  151 ? -15.685 24.563  16.096  1.00 29.10  ? 151 HIS A CD2 1 
ATOM   1154  C  CE1 . HIS A  1  151 ? -13.975 24.762  17.459  1.00 26.67  ? 151 HIS A CE1 1 
ATOM   1155  N  NE2 . HIS A  1  151 ? -14.448 24.068  16.434  1.00 29.65  ? 151 HIS A NE2 1 
ATOM   1156  N  N   . LEU A  1  152 ? -19.492 28.453  16.404  1.00 24.42  ? 152 LEU A N   1 
ATOM   1157  C  CA  . LEU A  1  152 ? -20.873 28.793  16.612  1.00 24.66  ? 152 LEU A CA  1 
ATOM   1158  C  C   . LEU A  1  152 ? -21.537 29.101  15.271  1.00 25.07  ? 152 LEU A C   1 
ATOM   1159  O  O   . LEU A  1  152 ? -22.656 28.638  15.024  1.00 25.84  ? 152 LEU A O   1 
ATOM   1160  C  CB  . LEU A  1  152 ? -21.031 29.951  17.592  1.00 25.97  ? 152 LEU A CB  1 
ATOM   1161  C  CG  . LEU A  1  152 ? -20.500 29.807  19.031  1.00 25.48  ? 152 LEU A CG  1 
ATOM   1162  C  CD1 . LEU A  1  152 ? -21.257 30.731  19.963  1.00 26.79  ? 152 LEU A CD1 1 
ATOM   1163  C  CD2 . LEU A  1  152 ? -20.665 28.425  19.522  1.00 26.73  ? 152 LEU A CD2 1 
ATOM   1164  N  N   . ALA A  1  153 ? -20.867 29.826  14.381  1.00 24.12  ? 153 ALA A N   1 
ATOM   1165  C  CA  . ALA A  1  153 ? -21.399 29.956  13.007  1.00 23.77  ? 153 ALA A CA  1 
ATOM   1166  C  C   . ALA A  1  153 ? -21.619 28.612  12.271  1.00 23.46  ? 153 ALA A C   1 
ATOM   1167  O  O   . ALA A  1  153 ? -22.569 28.454  11.526  1.00 23.88  ? 153 ALA A O   1 
ATOM   1168  C  CB  . ALA A  1  153 ? -20.494 30.843  12.177  1.00 24.10  ? 153 ALA A CB  1 
ATOM   1169  N  N   . GLY A  1  154 ? -20.735 27.647  12.465  1.00 23.15  ? 154 GLY A N   1 
ATOM   1170  C  CA  . GLY A  1  154 ? -20.848 26.410  11.749  1.00 24.45  ? 154 GLY A CA  1 
ATOM   1171  C  C   . GLY A  1  154 ? -21.986 25.548  12.272  1.00 25.40  ? 154 GLY A C   1 
ATOM   1172  O  O   . GLY A  1  154 ? -22.712 24.962  11.512  1.00 27.60  ? 154 GLY A O   1 
ATOM   1173  N  N   . VAL A  1  155 ? -22.124 25.456  13.579  1.00 26.70  ? 155 VAL A N   1 
ATOM   1174  C  CA  . VAL A  1  155 ? -23.247 24.773  14.183  1.00 26.68  ? 155 VAL A CA  1 
ATOM   1175  C  C   . VAL A  1  155 ? -24.546 25.380  13.683  1.00 26.53  ? 155 VAL A C   1 
ATOM   1176  O  O   . VAL A  1  155 ? -25.441 24.657  13.269  1.00 26.14  ? 155 VAL A O   1 
ATOM   1177  C  CB  . VAL A  1  155 ? -23.218 24.872  15.714  1.00 27.80  ? 155 VAL A CB  1 
ATOM   1178  C  CG1 . VAL A  1  155 ? -24.495 24.297  16.299  1.00 31.63  ? 155 VAL A CG1 1 
ATOM   1179  C  CG2 . VAL A  1  155 ? -22.064 24.078  16.263  1.00 28.69  ? 155 VAL A CG2 1 
ATOM   1180  N  N   . SER A  1  156 ? -24.652 26.703  13.724  1.00 26.21  ? 156 SER A N   1 
ATOM   1181  C  CA  . SER A  1  156 ? -25.854 27.377  13.227  1.00 26.58  ? 156 SER A CA  1 
ATOM   1182  C  C   . SER A  1  156 ? -26.193 26.935  11.811  1.00 26.57  ? 156 SER A C   1 
ATOM   1183  O  O   . SER A  1  156 ? -27.337 26.598  11.538  1.00 28.00  ? 156 SER A O   1 
ATOM   1184  C  CB  . SER A  1  156 ? -25.713 28.904  13.271  1.00 27.21  ? 156 SER A CB  1 
ATOM   1185  O  OG  . SER A  1  156 ? -26.728 29.567  12.535  1.00 25.31  ? 156 SER A OG  1 
ATOM   1186  N  N   . SER A  1  157 ? -25.210 26.942  10.926  1.00 25.13  ? 157 SER A N   1 
ATOM   1187  C  CA  . SER A  1  157 ? -25.456 26.549  9.541   1.00 25.04  ? 157 SER A CA  1 
ATOM   1188  C  C   . SER A  1  157 ? -25.681 25.050  9.317   1.00 24.73  ? 157 SER A C   1 
ATOM   1189  O  O   . SER A  1  157 ? -26.379 24.677  8.406   1.00 26.88  ? 157 SER A O   1 
ATOM   1190  C  CB  . SER A  1  157 ? -24.321 27.033  8.681   1.00 24.79  ? 157 SER A CB  1 
ATOM   1191  O  OG  . SER A  1  157 ? -24.441 28.420  8.561   1.00 25.63  ? 157 SER A OG  1 
ATOM   1192  N  N   . ILE A  1  158 ? -25.100 24.200  10.144  1.00 25.93  ? 158 ILE A N   1 
ATOM   1193  C  CA  . ILE A  1  158 ? -25.344 22.763  10.098  1.00 27.49  ? 158 ILE A CA  1 
ATOM   1194  C  C   . ILE A  1  158 ? -26.796 22.438  10.518  1.00 27.36  ? 158 ILE A C   1 
ATOM   1195  O  O   . ILE A  1  158 ? -27.513 21.733  9.833   1.00 28.65  ? 158 ILE A O   1 
ATOM   1196  C  CB  . ILE A  1  158 ? -24.316 22.016  10.985  1.00 27.98  ? 158 ILE A CB  1 
ATOM   1197  C  CG1 . ILE A  1  158 ? -22.945 22.049  10.314  1.00 30.12  ? 158 ILE A CG1 1 
ATOM   1198  C  CG2 . ILE A  1  158 ? -24.694 20.554  11.169  1.00 28.43  ? 158 ILE A CG2 1 
ATOM   1199  C  CD1 . ILE A  1  158 ? -21.805 21.604  11.217  1.00 30.38  ? 158 ILE A CD1 1 
ATOM   1200  N  N   . LEU A  1  159 ? -27.231 22.975  11.637  1.00 27.08  ? 159 LEU A N   1 
ATOM   1201  C  CA  . LEU A  1  159 ? -28.616 22.829  12.037  1.00 27.50  ? 159 LEU A CA  1 
ATOM   1202  C  C   . LEU A  1  159 ? -29.560 23.414  10.996  1.00 25.68  ? 159 LEU A C   1 
ATOM   1203  O  O   . LEU A  1  159 ? -30.568 22.817  10.701  1.00 27.53  ? 159 LEU A O   1 
ATOM   1204  C  CB  . LEU A  1  159 ? -28.862 23.474  13.392  1.00 28.52  ? 159 LEU A CB  1 
ATOM   1205  C  CG  . LEU A  1  159 ? -28.022 22.825  14.488  1.00 29.54  ? 159 LEU A CG  1 
ATOM   1206  C  CD1 . LEU A  1  159 ? -28.340 23.540  15.769  1.00 30.62  ? 159 LEU A CD1 1 
ATOM   1207  C  CD2 . LEU A  1  159 ? -28.246 21.321  14.583  1.00 30.80  ? 159 LEU A CD2 1 
ATOM   1208  N  N   . GLY A  1  160 ? -29.211 24.550  10.413  1.00 23.58  ? 160 GLY A N   1 
ATOM   1209  C  CA  . GLY A  1  160 ? -30.018 25.172  9.377   1.00 23.19  ? 160 GLY A CA  1 
ATOM   1210  C  C   . GLY A  1  160 ? -30.146 24.284  8.175   1.00 22.83  ? 160 GLY A C   1 
ATOM   1211  O  O   . GLY A  1  160 ? -31.217 24.153  7.598   1.00 24.83  ? 160 GLY A O   1 
ATOM   1212  N  N   . ALA A  1  161 ? -29.043 23.670  7.795   1.00 22.76  ? 161 ALA A N   1 
ATOM   1213  C  CA  . ALA A  1  161 ? -29.026 22.774  6.659   1.00 22.80  ? 161 ALA A CA  1 
ATOM   1214  C  C   . ALA A  1  161 ? -29.916 21.542  6.834   1.00 23.25  ? 161 ALA A C   1 
ATOM   1215  O  O   . ALA A  1  161 ? -30.585 21.119  5.903   1.00 23.90  ? 161 ALA A O   1 
ATOM   1216  C  CB  . ALA A  1  161 ? -27.593 22.366  6.356   1.00 22.40  ? 161 ALA A CB  1 
ATOM   1217  N  N   . ILE A  1  162 ? -29.909 20.963  8.020   1.00 24.55  ? 162 ILE A N   1 
ATOM   1218  C  CA  . ILE A  1  162 ? -30.716 19.785  8.317   1.00 24.41  ? 162 ILE A CA  1 
ATOM   1219  C  C   . ILE A  1  162 ? -32.193 20.161  8.235   1.00 24.54  ? 162 ILE A C   1 
ATOM   1220  O  O   . ILE A  1  162 ? -33.022 19.370  7.822   1.00 25.10  ? 162 ILE A O   1 
ATOM   1221  C  CB  . ILE A  1  162 ? -30.372 19.229  9.720   1.00 25.89  ? 162 ILE A CB  1 
ATOM   1222  C  CG1 . ILE A  1  162 ? -28.951 18.666  9.703   1.00 26.10  ? 162 ILE A CG1 1 
ATOM   1223  C  CG2 . ILE A  1  162 ? -31.354 18.094  10.120  1.00 28.41  ? 162 ILE A CG2 1 
ATOM   1224  C  CD1 . ILE A  1  162 ? -28.368 18.348  11.050  1.00 27.26  ? 162 ILE A CD1 1 
ATOM   1225  N  N   . ASN A  1  163 ? -32.501 21.388  8.628   1.00 24.81  ? 163 ASN A N   1 
ATOM   1226  C  CA  . ASN A  1  163 ? -33.850 21.900  8.601   1.00 24.93  ? 163 ASN A CA  1 
ATOM   1227  C  C   . ASN A  1  163 ? -34.356 22.106  7.186   1.00 25.20  ? 163 ASN A C   1 
ATOM   1228  O  O   . ASN A  1  163 ? -35.437 21.634  6.807   1.00 25.17  ? 163 ASN A O   1 
ATOM   1229  C  CB  . ASN A  1  163 ? -33.907 23.199  9.374   1.00 24.45  ? 163 ASN A CB  1 
ATOM   1230  C  CG  . ASN A  1  163 ? -35.214 23.382  10.097  1.00 26.33  ? 163 ASN A CG  1 
ATOM   1231  O  OD1 . ASN A  1  163 ? -36.256 22.816  9.745   1.00 25.66  ? 163 ASN A OD1 1 
ATOM   1232  N  ND2 . ASN A  1  163 ? -35.150 24.132  11.163  1.00 29.44  ? 163 ASN A ND2 1 
ATOM   1233  N  N   . PHE A  1  164 ? -33.569 22.854  6.427   1.00 25.10  ? 164 PHE A N   1 
ATOM   1234  C  CA  . PHE A  1  164 ? -33.858 23.115  5.028   1.00 24.74  ? 164 PHE A CA  1 
ATOM   1235  C  C   . PHE A  1  164 ? -33.994 21.821  4.217   1.00 23.70  ? 164 PHE A C   1 
ATOM   1236  O  O   . PHE A  1  164 ? -34.943 21.679  3.448   1.00 24.64  ? 164 PHE A O   1 
ATOM   1237  C  CB  . PHE A  1  164 ? -32.819 24.072  4.403   1.00 25.04  ? 164 PHE A CB  1 
ATOM   1238  C  CG  . PHE A  1  164 ? -33.049 25.530  4.733   1.00 26.96  ? 164 PHE A CG  1 
ATOM   1239  C  CD1 . PHE A  1  164 ? -34.189 26.168  4.318   1.00 26.76  ? 164 PHE A CD1 1 
ATOM   1240  C  CD2 . PHE A  1  164 ? -32.113 26.264  5.428   1.00 27.63  ? 164 PHE A CD2 1 
ATOM   1241  C  CE1 . PHE A  1  164 ? -34.416 27.493  4.613   1.00 27.40  ? 164 PHE A CE1 1 
ATOM   1242  C  CE2 . PHE A  1  164 ? -32.339 27.595  5.718   1.00 28.81  ? 164 PHE A CE2 1 
ATOM   1243  C  CZ  . PHE A  1  164 ? -33.490 28.209  5.310   1.00 27.52  ? 164 PHE A CZ  1 
ATOM   1244  N  N   . ILE A  1  165 ? -33.082 20.879  4.391   1.00 22.53  ? 165 ILE A N   1 
ATOM   1245  C  CA  . ILE A  1  165 ? -33.149 19.660  3.612   1.00 22.89  ? 165 ILE A CA  1 
ATOM   1246  C  C   . ILE A  1  165 ? -34.418 18.899  4.001   1.00 23.51  ? 165 ILE A C   1 
ATOM   1247  O  O   . ILE A  1  165 ? -35.223 18.533  3.157   1.00 20.74  ? 165 ILE A O   1 
ATOM   1248  C  CB  . ILE A  1  165 ? -31.926 18.756  3.797   1.00 23.40  ? 165 ILE A CB  1 
ATOM   1249  C  CG1 . ILE A  1  165 ? -30.643 19.447  3.271   1.00 24.38  ? 165 ILE A CG1 1 
ATOM   1250  C  CG2 . ILE A  1  165 ? -32.119 17.440  3.037   1.00 23.93  ? 165 ILE A CG2 1 
ATOM   1251  C  CD1 . ILE A  1  165 ? -29.366 18.817  3.829   1.00 25.08  ? 165 ILE A CD1 1 
ATOM   1252  N  N   . THR A  1  166 ? -34.584 18.666  5.290   1.00 25.20  ? 166 THR A N   1 
ATOM   1253  C  CA  . THR A  1  166 ? -35.761 17.956  5.773   1.00 24.48  ? 166 THR A CA  1 
ATOM   1254  C  C   . THR A  1  166 ? -37.043 18.616  5.298   1.00 25.03  ? 166 THR A C   1 
ATOM   1255  O  O   . THR A  1  166 ? -37.969 17.912  4.896   1.00 24.26  ? 166 THR A O   1 
ATOM   1256  C  CB  . THR A  1  166 ? -35.767 17.833  7.282   1.00 23.21  ? 166 THR A CB  1 
ATOM   1257  O  OG1 . THR A  1  166 ? -34.588 17.130  7.702   1.00 21.71  ? 166 THR A OG1 1 
ATOM   1258  C  CG2 . THR A  1  166 ? -36.966 17.032  7.709   1.00 23.99  ? 166 THR A CG2 1 
ATOM   1259  N  N   . THR A  1  167 ? -37.083 19.948  5.308   1.00 23.89  ? 167 THR A N   1 
ATOM   1260  C  CA  . THR A  1  167 ? -38.288 20.673  4.920   1.00 23.85  ? 167 THR A CA  1 
ATOM   1261  C  C   . THR A  1  167 ? -38.638 20.433  3.463   1.00 26.40  ? 167 THR A C   1 
ATOM   1262  O  O   . THR A  1  167 ? -39.783 20.151  3.104   1.00 27.84  ? 167 THR A O   1 
ATOM   1263  C  CB  . THR A  1  167 ? -38.134 22.184  5.165   1.00 23.75  ? 167 THR A CB  1 
ATOM   1264  O  OG1 . THR A  1  167 ? -38.035 22.444  6.576   1.00 23.02  ? 167 THR A OG1 1 
ATOM   1265  C  CG2 . THR A  1  167 ? -39.328 22.948  4.639   1.00 24.31  ? 167 THR A CG2 1 
ATOM   1266  N  N   . ILE A  1  168 ? -37.637 20.552  2.620   1.00 26.95  ? 168 ILE A N   1 
ATOM   1267  C  CA  . ILE A  1  168 ? -37.830 20.547  1.189   1.00 27.74  ? 168 ILE A CA  1 
ATOM   1268  C  C   . ILE A  1  168 ? -38.203 19.128  0.690   1.00 30.87  ? 168 ILE A C   1 
ATOM   1269  O  O   . ILE A  1  168 ? -39.033 18.957  -0.208  1.00 34.67  ? 168 ILE A O   1 
ATOM   1270  C  CB  . ILE A  1  168 ? -36.571 21.169  0.518   1.00 26.93  ? 168 ILE A CB  1 
ATOM   1271  C  CG1 . ILE A  1  168 ? -36.500 22.671  0.874   1.00 25.83  ? 168 ILE A CG1 1 
ATOM   1272  C  CG2 . ILE A  1  168 ? -36.574 20.984  -0.983  1.00 26.27  ? 168 ILE A CG2 1 
ATOM   1273  C  CD1 . ILE A  1  168 ? -35.129 23.270  0.715   1.00 26.93  ? 168 ILE A CD1 1 
ATOM   1274  N  N   . ILE A  1  169 ? -37.599 18.119  1.285   1.00 30.51  ? 169 ILE A N   1 
ATOM   1275  C  CA  . ILE A  1  169 ? -37.858 16.741  0.928   1.00 30.82  ? 169 ILE A CA  1 
ATOM   1276  C  C   . ILE A  1  169 ? -39.233 16.272  1.450   1.00 30.55  ? 169 ILE A C   1 
ATOM   1277  O  O   . ILE A  1  169 ? -39.985 15.640  0.714   1.00 27.71  ? 169 ILE A O   1 
ATOM   1278  C  CB  . ILE A  1  169 ? -36.740 15.856  1.502   1.00 33.82  ? 169 ILE A CB  1 
ATOM   1279  C  CG1 . ILE A  1  169 ? -35.405 16.163  0.809   1.00 37.48  ? 169 ILE A CG1 1 
ATOM   1280  C  CG2 . ILE A  1  169 ? -37.079 14.390  1.403   1.00 36.49  ? 169 ILE A CG2 1 
ATOM   1281  C  CD1 . ILE A  1  169 ? -35.312 15.772  -0.657  1.00 40.05  ? 169 ILE A CD1 1 
ATOM   1282  N  N   . ASN A  1  170 ? -39.548 16.595  2.708   1.00 29.86  ? 170 ASN A N   1 
ATOM   1283  C  CA  . ASN A  1  170 ? -40.663 15.984  3.439   1.00 30.05  ? 170 ASN A CA  1 
ATOM   1284  C  C   . ASN A  1  170 ? -41.993 16.739  3.397   1.00 30.93  ? 170 ASN A C   1 
ATOM   1285  O  O   . ASN A  1  170 ? -43.030 16.095  3.543   1.00 32.28  ? 170 ASN A O   1 
ATOM   1286  C  CB  . ASN A  1  170 ? -40.281 15.780  4.915   1.00 30.88  ? 170 ASN A CB  1 
ATOM   1287  C  CG  . ASN A  1  170 ? -41.269 14.909  5.654   1.00 32.15  ? 170 ASN A CG  1 
ATOM   1288  O  OD1 . ASN A  1  170 ? -41.618 13.823  5.172   1.00 36.03  ? 170 ASN A OD1 1 
ATOM   1289  N  ND2 . ASN A  1  170 ? -41.739 15.375  6.818   1.00 30.62  ? 170 ASN A ND2 1 
ATOM   1290  N  N   . MET A  1  171 ? -41.968 18.064  3.199   1.00 27.83  ? 171 MET A N   1 
ATOM   1291  C  CA  . MET A  1  171 ? -43.140 18.919  3.439   1.00 27.95  ? 171 MET A CA  1 
ATOM   1292  C  C   . MET A  1  171 ? -43.678 19.607  2.209   1.00 27.41  ? 171 MET A C   1 
ATOM   1293  O  O   . MET A  1  171 ? -44.252 20.653  2.297   1.00 29.92  ? 171 MET A O   1 
ATOM   1294  C  CB  . MET A  1  171 ? -42.837 19.974  4.515   1.00 28.28  ? 171 MET A CB  1 
ATOM   1295  C  CG  . MET A  1  171 ? -42.274 19.351  5.769   1.00 28.58  ? 171 MET A CG  1 
ATOM   1296  S  SD  . MET A  1  171 ? -41.903 20.519  7.056   1.00 27.49  ? 171 MET A SD  1 
ATOM   1297  C  CE  . MET A  1  171 ? -43.439 21.420  7.239   1.00 32.03  ? 171 MET A CE  1 
ATOM   1298  N  N   . LYS A  1  172 ? -43.524 19.002  1.058   1.00 29.44  ? 172 LYS A N   1 
ATOM   1299  C  CA  . LYS A  1  172 ? -44.186 19.467  -0.139  1.00 31.53  ? 172 LYS A CA  1 
ATOM   1300  C  C   . LYS A  1  172 ? -45.575 18.822  -0.182  1.00 30.77  ? 172 LYS A C   1 
ATOM   1301  O  O   . LYS A  1  172 ? -45.804 17.799  0.510   1.00 31.10  ? 172 LYS A O   1 
ATOM   1302  C  CB  . LYS A  1  172 ? -43.423 18.946  -1.349  1.00 35.38  ? 172 LYS A CB  1 
ATOM   1303  C  CG  . LYS A  1  172 ? -41.989 19.375  -1.421  1.00 37.42  ? 172 LYS A CG  1 
ATOM   1304  C  CD  . LYS A  1  172 ? -41.342 18.912  -2.720  1.00 38.29  ? 172 LYS A CD  1 
ATOM   1305  C  CE  . LYS A  1  172 ? -41.291 17.412  -2.879  1.00 38.34  ? 172 LYS A CE  1 
ATOM   1306  N  NZ  . LYS A  1  172 ? -40.462 16.734  -1.858  1.00 40.94  ? 172 LYS A NZ  1 
ATOM   1307  N  N   . PRO A  1  173 ? -46.478 19.354  -1.042  1.00 30.47  ? 173 PRO A N   1 
ATOM   1308  C  CA  . PRO A  1  173 ? -47.741 18.665  -1.279  1.00 29.29  ? 173 PRO A CA  1 
ATOM   1309  C  C   . PRO A  1  173 ? -47.445 17.266  -1.761  1.00 29.22  ? 173 PRO A C   1 
ATOM   1310  O  O   . PRO A  1  173 ? -46.553 17.127  -2.605  1.00 28.59  ? 173 PRO A O   1 
ATOM   1311  C  CB  . PRO A  1  173 ? -48.395 19.478  -2.412  1.00 29.60  ? 173 PRO A CB  1 
ATOM   1312  C  CG  . PRO A  1  173 ? -47.762 20.840  -2.327  1.00 29.87  ? 173 PRO A CG  1 
ATOM   1313  C  CD  . PRO A  1  173 ? -46.338 20.512  -1.960  1.00 31.82  ? 173 PRO A CD  1 
ATOM   1314  N  N   . PRO A  1  174 ? -48.169 16.231  -1.241  1.00 28.20  ? 174 PRO A N   1 
ATOM   1315  C  CA  . PRO A  1  174 ? -47.884 14.859  -1.612  1.00 27.93  ? 174 PRO A CA  1 
ATOM   1316  C  C   . PRO A  1  174 ? -47.796 14.582  -3.103  1.00 29.17  ? 174 PRO A C   1 
ATOM   1317  O  O   . PRO A  1  174 ? -47.028 13.727  -3.489  1.00 31.78  ? 174 PRO A O   1 
ATOM   1318  C  CB  . PRO A  1  174 ? -49.034 14.072  -0.999  1.00 28.31  ? 174 PRO A CB  1 
ATOM   1319  C  CG  . PRO A  1  174 ? -49.984 15.065  -0.502  1.00 27.86  ? 174 PRO A CG  1 
ATOM   1320  C  CD  . PRO A  1  174 ? -49.222 16.286  -0.222  1.00 27.18  ? 174 PRO A CD  1 
ATOM   1321  N  N   . ALA A  1  175 ? -48.576 15.254  -3.940  1.00 30.85  ? 175 ALA A N   1 
ATOM   1322  C  CA  . ALA A  1  175 ? -48.466 15.041  -5.397  1.00 31.44  ? 175 ALA A CA  1 
ATOM   1323  C  C   . ALA A  1  175 ? -47.282 15.744  -6.074  1.00 32.77  ? 175 ALA A C   1 
ATOM   1324  O  O   . ALA A  1  175 ? -46.954 15.407  -7.209  1.00 38.32  ? 175 ALA A O   1 
ATOM   1325  C  CB  . ALA A  1  175 ? -49.751 15.447  -6.076  1.00 32.44  ? 175 ALA A CB  1 
ATOM   1326  N  N   . MET A  1  176 ? -46.671 16.736  -5.431  1.00 32.78  ? 176 MET A N   1 
ATOM   1327  C  CA  . MET A  1  176 ? -45.512 17.449  -6.008  1.00 33.70  ? 176 MET A CA  1 
ATOM   1328  C  C   . MET A  1  176 ? -44.232 16.622  -5.874  1.00 31.96  ? 176 MET A C   1 
ATOM   1329  O  O   . MET A  1  176 ? -43.885 16.172  -4.801  1.00 33.74  ? 176 MET A O   1 
ATOM   1330  C  CB  . MET A  1  176 ? -45.314 18.770  -5.295  1.00 36.61  ? 176 MET A CB  1 
ATOM   1331  C  CG  . MET A  1  176 ? -44.253 19.696  -5.870  1.00 40.34  ? 176 MET A CG  1 
ATOM   1332  S  SD  . MET A  1  176 ? -44.187 21.290  -5.007  1.00 43.05  ? 176 MET A SD  1 
ATOM   1333  C  CE  . MET A  1  176 ? -45.761 21.998  -5.415  1.00 41.58  ? 176 MET A CE  1 
ATOM   1334  N  N   . SER A  1  177 ? -43.557 16.404  -6.981  1.00 30.39  ? 177 SER A N   1 
ATOM   1335  C  CA  . SER A  1  177 ? -42.261 15.789  -6.973  1.00 33.45  ? 177 SER A CA  1 
ATOM   1336  C  C   . SER A  1  177 ? -41.184 16.874  -6.843  1.00 33.44  ? 177 SER A C   1 
ATOM   1337  O  O   . SER A  1  177 ? -41.442 18.060  -7.032  1.00 31.42  ? 177 SER A O   1 
ATOM   1338  C  CB  . SER A  1  177 ? -42.041 14.917  -8.235  1.00 33.01  ? 177 SER A CB  1 
ATOM   1339  O  OG  . SER A  1  177 ? -41.532 15.627  -9.324  1.00 34.68  ? 177 SER A OG  1 
ATOM   1340  N  N   . GLN A  1  178 ? -39.971 16.441  -6.536  1.00 31.96  ? 178 GLN A N   1 
ATOM   1341  C  CA  . GLN A  1  178 ? -38.848 17.354  -6.473  1.00 34.14  ? 178 GLN A CA  1 
ATOM   1342  C  C   . GLN A  1  178 ? -38.699 18.173  -7.759  1.00 31.27  ? 178 GLN A C   1 
ATOM   1343  O  O   . GLN A  1  178 ? -38.229 19.322  -7.709  1.00 30.28  ? 178 GLN A O   1 
ATOM   1344  C  CB  . GLN A  1  178 ? -37.521 16.610  -6.149  1.00 36.22  ? 178 GLN A CB  1 
ATOM   1345  C  CG  . GLN A  1  178 ? -36.694 17.348  -5.093  1.00 38.65  ? 178 GLN A CG  1 
ATOM   1346  C  CD  . GLN A  1  178 ? -37.414 17.429  -3.756  1.00 38.28  ? 178 GLN A CD  1 
ATOM   1347  O  OE1 . GLN A  1  178 ? -37.856 16.402  -3.227  1.00 45.83  ? 178 GLN A OE1 1 
ATOM   1348  N  NE2 . GLN A  1  178 ? -37.568 18.647  -3.216  1.00 38.06  ? 178 GLN A NE2 1 
ATOM   1349  N  N   . TYR A  1  179 ? -39.139 17.586  -8.881  1.00 29.96  ? 179 TYR A N   1 
ATOM   1350  C  CA  . TYR A  1  179 ? -38.966 18.164  -10.195 1.00 29.81  ? 179 TYR A CA  1 
ATOM   1351  C  C   . TYR A  1  179 ? -40.067 19.165  -10.522 1.00 28.48  ? 179 TYR A C   1 
ATOM   1352  O  O   . TYR A  1  179 ? -40.168 19.600  -11.660 1.00 29.12  ? 179 TYR A O   1 
ATOM   1353  C  CB  . TYR A  1  179 ? -38.855 17.048  -11.245 1.00 31.35  ? 179 TYR A CB  1 
ATOM   1354  C  CG  . TYR A  1  179 ? -37.755 16.060  -10.878 1.00 36.85  ? 179 TYR A CG  1 
ATOM   1355  C  CD1 . TYR A  1  179 ? -36.405 16.466  -10.788 1.00 40.00  ? 179 TYR A CD1 1 
ATOM   1356  C  CD2 . TYR A  1  179 ? -38.043 14.742  -10.575 1.00 38.69  ? 179 TYR A CD2 1 
ATOM   1357  C  CE1 . TYR A  1  179 ? -35.394 15.581  -10.406 1.00 36.46  ? 179 TYR A CE1 1 
ATOM   1358  C  CE2 . TYR A  1  179 ? -37.033 13.865  -10.200 1.00 38.47  ? 179 TYR A CE2 1 
ATOM   1359  C  CZ  . TYR A  1  179 ? -35.723 14.295  -10.120 1.00 36.72  ? 179 TYR A CZ  1 
ATOM   1360  O  OH  . TYR A  1  179 ? -34.758 13.406  -9.746  1.00 38.53  ? 179 TYR A OH  1 
ATOM   1361  N  N   . GLN A  1  180 ? -40.845 19.543  -9.521  1.00 26.27  ? 180 GLN A N   1 
ATOM   1362  C  CA  . GLN A  1  180 ? -41.869 20.553  -9.620  1.00 30.11  ? 180 GLN A CA  1 
ATOM   1363  C  C   . GLN A  1  180 ? -41.746 21.635  -8.563  1.00 30.58  ? 180 GLN A C   1 
ATOM   1364  O  O   . GLN A  1  180 ? -42.700 22.357  -8.310  1.00 33.41  ? 180 GLN A O   1 
ATOM   1365  C  CB  . GLN A  1  180 ? -43.227 19.847  -9.471  1.00 32.57  ? 180 GLN A CB  1 
ATOM   1366  C  CG  . GLN A  1  180 ? -43.583 19.143  -10.760 1.00 36.63  ? 180 GLN A CG  1 
ATOM   1367  C  CD  . GLN A  1  180 ? -44.317 17.847  -10.651 1.00 36.15  ? 180 GLN A CD  1 
ATOM   1368  O  OE1 . GLN A  1  180 ? -44.566 17.351  -9.587  1.00 36.03  ? 180 GLN A OE1 1 
ATOM   1369  N  NE2 . GLN A  1  180 ? -44.653 17.283  -11.806 1.00 41.46  ? 180 GLN A NE2 1 
ATOM   1370  N  N   . THR A  1  181 ? -40.591 21.728  -7.919  1.00 30.88  ? 181 THR A N   1 
ATOM   1371  C  CA  . THR A  1  181 ? -40.316 22.799  -6.979  1.00 30.33  ? 181 THR A CA  1 
ATOM   1372  C  C   . THR A  1  181 ? -39.612 23.914  -7.754  1.00 26.76  ? 181 THR A C   1 
ATOM   1373  O  O   . THR A  1  181 ? -38.845 23.650  -8.684  1.00 26.83  ? 181 THR A O   1 
ATOM   1374  C  CB  . THR A  1  181 ? -39.424 22.309  -5.834  1.00 32.99  ? 181 THR A CB  1 
ATOM   1375  O  OG1 . THR A  1  181 ? -38.157 21.931  -6.351  1.00 34.86  ? 181 THR A OG1 1 
ATOM   1376  C  CG2 . THR A  1  181 ? -40.009 21.100  -5.159  1.00 33.71  ? 181 THR A CG2 1 
ATOM   1377  N  N   . PRO A  1  182 ? -39.843 25.160  -7.384  1.00 25.59  ? 182 PRO A N   1 
ATOM   1378  C  CA  . PRO A  1  182 ? -39.090 26.240  -8.049  1.00 26.93  ? 182 PRO A CA  1 
ATOM   1379  C  C   . PRO A  1  182 ? -37.559 26.182  -7.859  1.00 26.74  ? 182 PRO A C   1 
ATOM   1380  O  O   . PRO A  1  182 ? -37.071 25.508  -6.941  1.00 24.69  ? 182 PRO A O   1 
ATOM   1381  C  CB  . PRO A  1  182 ? -39.646 27.500  -7.404  1.00 26.87  ? 182 PRO A CB  1 
ATOM   1382  C  CG  . PRO A  1  182 ? -40.970 27.086  -6.838  1.00 27.44  ? 182 PRO A CG  1 
ATOM   1383  C  CD  . PRO A  1  182 ? -40.719 25.696  -6.341  1.00 26.85  ? 182 PRO A CD  1 
ATOM   1384  N  N   . LEU A  1  183 ? -36.821 26.853  -8.750  1.00 26.01  ? 183 LEU A N   1 
ATOM   1385  C  CA  . LEU A  1  183 ? -35.334 26.748  -8.770  1.00 25.32  ? 183 LEU A CA  1 
ATOM   1386  C  C   . LEU A  1  183 ? -34.672 27.281  -7.493  1.00 24.91  ? 183 LEU A C   1 
ATOM   1387  O  O   . LEU A  1  183 ? -33.647 26.746  -7.059  1.00 23.26  ? 183 LEU A O   1 
ATOM   1388  C  CB  . LEU A  1  183 ? -34.740 27.406  -9.996  1.00 23.35  ? 183 LEU A CB  1 
ATOM   1389  C  CG  . LEU A  1  183 ? -35.057 26.672  -11.269 1.00 25.50  ? 183 LEU A CG  1 
ATOM   1390  C  CD1 . LEU A  1  183 ? -34.393 27.390  -12.401 1.00 26.90  ? 183 LEU A CD1 1 
ATOM   1391  C  CD2 . LEU A  1  183 ? -34.574 25.233  -11.248 1.00 26.89  ? 183 LEU A CD2 1 
ATOM   1392  N  N   . PHE A  1  184 ? -35.293 28.280  -6.867  1.00 23.21  ? 184 PHE A N   1 
ATOM   1393  C  CA  . PHE A  1  184 ? -34.739 28.829  -5.647  1.00 24.44  ? 184 PHE A CA  1 
ATOM   1394  C  C   . PHE A  1  184 ? -34.652 27.739  -4.579  1.00 25.66  ? 184 PHE A C   1 
ATOM   1395  O  O   . PHE A  1  184 ? -33.683 27.660  -3.836  1.00 28.83  ? 184 PHE A O   1 
ATOM   1396  C  CB  . PHE A  1  184 ? -35.560 30.017  -5.115  1.00 23.43  ? 184 PHE A CB  1 
ATOM   1397  C  CG  . PHE A  1  184 ? -34.994 30.603  -3.867  1.00 23.51  ? 184 PHE A CG  1 
ATOM   1398  C  CD1 . PHE A  1  184 ? -33.716 31.164  -3.874  1.00 25.93  ? 184 PHE A CD1 1 
ATOM   1399  C  CD2 . PHE A  1  184 ? -35.665 30.527  -2.684  1.00 24.13  ? 184 PHE A CD2 1 
ATOM   1400  C  CE1 . PHE A  1  184 ? -33.133 31.679  -2.706  1.00 25.00  ? 184 PHE A CE1 1 
ATOM   1401  C  CE2 . PHE A  1  184 ? -35.110 31.041  -1.520  1.00 25.95  ? 184 PHE A CE2 1 
ATOM   1402  C  CZ  . PHE A  1  184 ? -33.841 31.615  -1.531  1.00 25.54  ? 184 PHE A CZ  1 
ATOM   1403  N  N   . VAL A  1  185 ? -35.700 26.937  -4.490  1.00 24.47  ? 185 VAL A N   1 
ATOM   1404  C  CA  . VAL A  1  185 ? -35.801 25.875  -3.502  1.00 24.84  ? 185 VAL A CA  1 
ATOM   1405  C  C   . VAL A  1  185 ? -34.707 24.833  -3.747  1.00 23.86  ? 185 VAL A C   1 
ATOM   1406  O  O   . VAL A  1  185 ? -34.049 24.403  -2.811  1.00 25.40  ? 185 VAL A O   1 
ATOM   1407  C  CB  . VAL A  1  185 ? -37.231 25.257  -3.526  1.00 25.68  ? 185 VAL A CB  1 
ATOM   1408  C  CG1 . VAL A  1  185 ? -37.299 23.967  -2.721  1.00 27.59  ? 185 VAL A CG1 1 
ATOM   1409  C  CG2 . VAL A  1  185 ? -38.231 26.287  -3.034  1.00 24.84  ? 185 VAL A CG2 1 
ATOM   1410  N  N   . TRP A  1  186 ? -34.547 24.418  -4.995  1.00 22.95  ? 186 TRP A N   1 
ATOM   1411  C  CA  . TRP A  1  186 ? -33.467 23.538  -5.381  1.00 24.57  ? 186 TRP A CA  1 
ATOM   1412  C  C   . TRP A  1  186 ? -32.102 24.109  -4.943  1.00 24.93  ? 186 TRP A C   1 
ATOM   1413  O  O   . TRP A  1  186 ? -31.311 23.411  -4.360  1.00 25.17  ? 186 TRP A O   1 
ATOM   1414  C  CB  . TRP A  1  186 ? -33.456 23.346  -6.908  1.00 26.76  ? 186 TRP A CB  1 
ATOM   1415  C  CG  . TRP A  1  186 ? -34.232 22.195  -7.381  1.00 26.26  ? 186 TRP A CG  1 
ATOM   1416  C  CD1 . TRP A  1  186 ? -35.411 22.218  -8.046  1.00 27.04  ? 186 TRP A CD1 1 
ATOM   1417  C  CD2 . TRP A  1  186 ? -33.878 20.842  -7.218  1.00 27.37  ? 186 TRP A CD2 1 
ATOM   1418  N  NE1 . TRP A  1  186 ? -35.838 20.936  -8.303  1.00 28.65  ? 186 TRP A NE1 1 
ATOM   1419  C  CE2 . TRP A  1  186 ? -34.913 20.065  -7.799  1.00 29.33  ? 186 TRP A CE2 1 
ATOM   1420  C  CE3 . TRP A  1  186 ? -32.778 20.194  -6.643  1.00 26.78  ? 186 TRP A CE3 1 
ATOM   1421  C  CZ2 . TRP A  1  186 ? -34.874 18.666  -7.835  1.00 29.65  ? 186 TRP A CZ2 1 
ATOM   1422  C  CZ3 . TRP A  1  186 ? -32.742 18.809  -6.653  1.00 28.87  ? 186 TRP A CZ3 1 
ATOM   1423  C  CH2 . TRP A  1  186 ? -33.782 18.051  -7.247  1.00 29.66  ? 186 TRP A CH2 1 
ATOM   1424  N  N   . SER A  1  187 ? -31.873 25.393  -5.197  1.00 24.08  ? 187 SER A N   1 
ATOM   1425  C  CA  . SER A  1  187 ? -30.602 26.032  -4.900  1.00 22.83  ? 187 SER A CA  1 
ATOM   1426  C  C   . SER A  1  187 ? -30.276 26.037  -3.436  1.00 23.30  ? 187 SER A C   1 
ATOM   1427  O  O   . SER A  1  187 ? -29.131 25.862  -3.062  1.00 23.33  ? 187 SER A O   1 
ATOM   1428  C  CB  . SER A  1  187 ? -30.578 27.459  -5.449  1.00 23.07  ? 187 SER A CB  1 
ATOM   1429  O  OG  . SER A  1  187 ? -31.274 28.396  -4.658  1.00 23.19  ? 187 SER A OG  1 
ATOM   1430  N  N   . VAL A  1  188 ? -31.301 26.206  -2.603  1.00 25.74  ? 188 VAL A N   1 
ATOM   1431  C  CA  . VAL A  1  188 ? -31.161 26.139  -1.159  1.00 23.97  ? 188 VAL A CA  1 
ATOM   1432  C  C   . VAL A  1  188 ? -30.919 24.708  -0.715  1.00 24.40  ? 188 VAL A C   1 
ATOM   1433  O  O   . VAL A  1  188 ? -30.096 24.468  0.189   1.00 24.43  ? 188 VAL A O   1 
ATOM   1434  C  CB  . VAL A  1  188 ? -32.346 26.797  -0.441  1.00 23.59  ? 188 VAL A CB  1 
ATOM   1435  C  CG1 . VAL A  1  188 ? -32.243 26.648  1.068   1.00 23.85  ? 188 VAL A CG1 1 
ATOM   1436  C  CG2 . VAL A  1  188 ? -32.388 28.264  -0.790  1.00 24.28  ? 188 VAL A CG2 1 
ATOM   1437  N  N   . MET A  1  189 ? -31.595 23.747  -1.344  1.00 25.54  ? 189 MET A N   1 
ATOM   1438  C  CA  . MET A  1  189 ? -31.407 22.371  -0.922  1.00 25.60  ? 189 MET A CA  1 
ATOM   1439  C  C   . MET A  1  189 ? -29.990 21.884  -1.194  1.00 24.10  ? 189 MET A C   1 
ATOM   1440  O  O   . MET A  1  189 ? -29.397 21.229  -0.356  1.00 23.25  ? 189 MET A O   1 
ATOM   1441  C  CB  . MET A  1  189 ? -32.392 21.431  -1.548  1.00 27.27  ? 189 MET A CB  1 
ATOM   1442  C  CG  . MET A  1  189 ? -32.350 20.115  -0.819  1.00 31.62  ? 189 MET A CG  1 
ATOM   1443  S  SD  . MET A  1  189 ? -33.322 18.877  -1.628  1.00 44.46  ? 189 MET A SD  1 
ATOM   1444  C  CE  . MET A  1  189 ? -32.434 18.816  -3.182  1.00 42.96  ? 189 MET A CE  1 
ATOM   1445  N  N   . ILE A  1  190 ? -29.449 22.215  -2.355  1.00 23.79  ? 190 ILE A N   1 
ATOM   1446  C  CA  . ILE A  1  190 ? -28.077 21.845  -2.716  1.00 24.21  ? 190 ILE A CA  1 
ATOM   1447  C  C   . ILE A  1  190 ? -27.031 22.599  -1.871  1.00 24.20  ? 190 ILE A C   1 
ATOM   1448  O  O   . ILE A  1  190 ? -26.006 22.017  -1.488  1.00 25.80  ? 190 ILE A O   1 
ATOM   1449  C  CB  . ILE A  1  190 ? -27.812 22.049  -4.210  1.00 24.67  ? 190 ILE A CB  1 
ATOM   1450  C  CG1 . ILE A  1  190 ? -28.741 21.140  -5.021  1.00 26.02  ? 190 ILE A CG1 1 
ATOM   1451  C  CG2 . ILE A  1  190 ? -26.361 21.742  -4.538  1.00 24.82  ? 190 ILE A CG2 1 
ATOM   1452  C  CD1 . ILE A  1  190 ? -28.812 21.544  -6.473  1.00 28.54  ? 190 ILE A CD1 1 
ATOM   1453  N  N   . THR A  1  191 ? -27.302 23.862  -1.568  1.00 22.34  ? 191 THR A N   1 
ATOM   1454  C  CA  . THR A  1  191 ? -26.467 24.620  -0.657  1.00 21.43  ? 191 THR A CA  1 
ATOM   1455  C  C   . THR A  1  191 ? -26.419 23.996  0.712   1.00 22.54  ? 191 THR A C   1 
ATOM   1456  O  O   . THR A  1  191 ? -25.349 23.933  1.337   1.00 24.39  ? 191 THR A O   1 
ATOM   1457  C  CB  . THR A  1  191 ? -26.953 26.057  -0.510  1.00 20.97  ? 191 THR A CB  1 
ATOM   1458  O  OG1 . THR A  1  191 ? -26.824 26.732  -1.757  1.00 19.91  ? 191 THR A OG1 1 
ATOM   1459  C  CG2 . THR A  1  191 ? -26.136 26.808  0.499   1.00 22.60  ? 191 THR A CG2 1 
ATOM   1460  N  N   . ALA A  1  192 ? -27.576 23.564  1.189   1.00 22.08  ? 192 ALA A N   1 
ATOM   1461  C  CA  . ALA A  1  192 ? -27.680 22.914  2.469   1.00 21.46  ? 192 ALA A CA  1 
ATOM   1462  C  C   . ALA A  1  192 ? -26.916 21.600  2.506   1.00 20.88  ? 192 ALA A C   1 
ATOM   1463  O  O   . ALA A  1  192 ? -26.359 21.231  3.521   1.00 20.21  ? 192 ALA A O   1 
ATOM   1464  C  CB  . ALA A  1  192 ? -29.141 22.663  2.779   1.00 23.39  ? 192 ALA A CB  1 
ATOM   1465  N  N   . VAL A  1  193 ? -26.896 20.872  1.404   1.00 22.02  ? 193 VAL A N   1 
ATOM   1466  C  CA  . VAL A  1  193 ? -26.142 19.641  1.367   1.00 23.02  ? 193 VAL A CA  1 
ATOM   1467  C  C   . VAL A  1  193 ? -24.664 19.972  1.428   1.00 23.45  ? 193 VAL A C   1 
ATOM   1468  O  O   . VAL A  1  193 ? -23.951 19.287  2.106   1.00 24.97  ? 193 VAL A O   1 
ATOM   1469  C  CB  . VAL A  1  193 ? -26.457 18.784  0.138   1.00 24.05  ? 193 VAL A CB  1 
ATOM   1470  C  CG1 . VAL A  1  193 ? -25.463 17.622  -0.021  1.00 24.06  ? 193 VAL A CG1 1 
ATOM   1471  C  CG2 . VAL A  1  193 ? -27.864 18.242  0.263   1.00 24.86  ? 193 VAL A CG2 1 
ATOM   1472  N  N   . LEU A  1  194 ? -24.205 21.007  0.731   1.00 23.97  ? 194 LEU A N   1 
ATOM   1473  C  CA  . LEU A  1  194 ? -22.802 21.368  0.796   1.00 24.04  ? 194 LEU A CA  1 
ATOM   1474  C  C   . LEU A  1  194 ? -22.380 21.856  2.189   1.00 24.69  ? 194 LEU A C   1 
ATOM   1475  O  O   . LEU A  1  194 ? -21.310 21.483  2.677   1.00 27.04  ? 194 LEU A O   1 
ATOM   1476  C  CB  . LEU A  1  194 ? -22.439 22.421  -0.238  1.00 24.58  ? 194 LEU A CB  1 
ATOM   1477  C  CG  . LEU A  1  194 ? -22.705 22.240  -1.735  1.00 25.42  ? 194 LEU A CG  1 
ATOM   1478  C  CD1 . LEU A  1  194 ? -21.811 23.205  -2.478  1.00 28.96  ? 194 LEU A CD1 1 
ATOM   1479  C  CD2 . LEU A  1  194 ? -22.538 20.875  -2.328  1.00 25.18  ? 194 LEU A CD2 1 
ATOM   1480  N  N   . LEU A  1  195 ? -23.213 22.668  2.831   1.00 23.80  ? 195 LEU A N   1 
ATOM   1481  C  CA  . LEU A  1  195 ? -22.961 23.067  4.205   1.00 23.58  ? 195 LEU A CA  1 
ATOM   1482  C  C   . LEU A  1  195 ? -22.802 21.859  5.098   1.00 24.02  ? 195 LEU A C   1 
ATOM   1483  O  O   . LEU A  1  195 ? -21.893 21.801  5.913   1.00 26.14  ? 195 LEU A O   1 
ATOM   1484  C  CB  . LEU A  1  195 ? -24.091 23.934  4.742   1.00 24.41  ? 195 LEU A CB  1 
ATOM   1485  C  CG  . LEU A  1  195 ? -24.220 25.387  4.250   1.00 24.79  ? 195 LEU A CG  1 
ATOM   1486  C  CD1 . LEU A  1  195 ? -25.579 25.973  4.591   1.00 25.66  ? 195 LEU A CD1 1 
ATOM   1487  C  CD2 . LEU A  1  195 ? -23.165 26.233  4.900   1.00 25.17  ? 195 LEU A CD2 1 
ATOM   1488  N  N   . LEU A  1  196 ? -23.682 20.883  4.938   1.00 24.36  ? 196 LEU A N   1 
ATOM   1489  C  CA  . LEU A  1  196 ? -23.737 19.720  5.836   1.00 24.35  ? 196 LEU A CA  1 
ATOM   1490  C  C   . LEU A  1  196 ? -22.443 18.903  5.833   1.00 24.23  ? 196 LEU A C   1 
ATOM   1491  O  O   . LEU A  1  196 ? -22.016 18.444  6.874   1.00 22.31  ? 196 LEU A O   1 
ATOM   1492  C  CB  . LEU A  1  196 ? -24.925 18.836  5.450   1.00 24.75  ? 196 LEU A CB  1 
ATOM   1493  C  CG  . LEU A  1  196 ? -25.243 17.679  6.365   1.00 25.35  ? 196 LEU A CG  1 
ATOM   1494  C  CD1 . LEU A  1  196 ? -26.087 18.081  7.565   1.00 25.27  ? 196 LEU A CD1 1 
ATOM   1495  C  CD2 . LEU A  1  196 ? -25.930 16.654  5.507   1.00 26.53  ? 196 LEU A CD2 1 
ATOM   1496  N  N   . LEU A  1  197 ? -21.823 18.773  4.665   1.00 24.76  ? 197 LEU A N   1 
ATOM   1497  C  CA  . LEU A  1  197 ? -20.621 17.983  4.477   1.00 25.89  ? 197 LEU A CA  1 
ATOM   1498  C  C   . LEU A  1  197 ? -19.316 18.784  4.571   1.00 26.48  ? 197 LEU A C   1 
ATOM   1499  O  O   . LEU A  1  197 ? -18.254 18.205  4.839   1.00 28.97  ? 197 LEU A O   1 
ATOM   1500  C  CB  . LEU A  1  197 ? -20.659 17.368  3.103   1.00 27.40  ? 197 LEU A CB  1 
ATOM   1501  C  CG  . LEU A  1  197 ? -21.920 16.578  2.771   1.00 29.89  ? 197 LEU A CG  1 
ATOM   1502  C  CD1 . LEU A  1  197 ? -21.963 16.358  1.262   1.00 31.12  ? 197 LEU A CD1 1 
ATOM   1503  C  CD2 . LEU A  1  197 ? -21.952 15.272  3.545   1.00 29.56  ? 197 LEU A CD2 1 
ATOM   1504  N  N   . SER A  1  198 ? -19.363 20.088  4.319   1.00 24.97  ? 198 SER A N   1 
ATOM   1505  C  CA  . SER A  1  198 ? -18.138 20.871  4.284   1.00 25.10  ? 198 SER A CA  1 
ATOM   1506  C  C   . SER A  1  198 ? -17.807 21.383  5.669   1.00 25.84  ? 198 SER A C   1 
ATOM   1507  O  O   . SER A  1  198 ? -16.689 21.202  6.117   1.00 27.47  ? 198 SER A O   1 
ATOM   1508  C  CB  . SER A  1  198 ? -18.215 22.007  3.262   1.00 24.83  ? 198 SER A CB  1 
ATOM   1509  O  OG  . SER A  1  198 ? -19.212 22.941  3.568   1.00 23.84  ? 198 SER A OG  1 
ATOM   1510  N  N   . LEU A  1  199 ? -18.777 21.952  6.381   1.00 24.71  ? 199 LEU A N   1 
ATOM   1511  C  CA  . LEU A  1  199 ? -18.493 22.559  7.689   1.00 25.57  ? 199 LEU A CA  1 
ATOM   1512  C  C   . LEU A  1  199 ? -17.938 21.649  8.799   1.00 24.68  ? 199 LEU A C   1 
ATOM   1513  O  O   . LEU A  1  199 ? -17.205 22.113  9.672   1.00 23.62  ? 199 LEU A O   1 
ATOM   1514  C  CB  . LEU A  1  199 ? -19.727 23.289  8.218   1.00 26.40  ? 199 LEU A CB  1 
ATOM   1515  C  CG  . LEU A  1  199 ? -19.997 24.611  7.530   1.00 27.44  ? 199 LEU A CG  1 
ATOM   1516  C  CD1 . LEU A  1  199 ? -21.457 24.931  7.645   1.00 28.82  ? 199 LEU A CD1 1 
ATOM   1517  C  CD2 . LEU A  1  199 ? -19.179 25.718  8.178   1.00 29.59  ? 199 LEU A CD2 1 
ATOM   1518  N  N   . PRO A  1  200 ? -18.327 20.374  8.809   1.00 24.25  ? 200 PRO A N   1 
ATOM   1519  C  CA  . PRO A  1  200 ? -17.713 19.506  9.819   1.00 24.16  ? 200 PRO A CA  1 
ATOM   1520  C  C   . PRO A  1  200 ? -16.227 19.320  9.624   1.00 23.42  ? 200 PRO A C   1 
ATOM   1521  O  O   . PRO A  1  200 ? -15.520 19.187  10.599  1.00 22.82  ? 200 PRO A O   1 
ATOM   1522  C  CB  . PRO A  1  200 ? -18.435 18.187  9.636   1.00 24.88  ? 200 PRO A CB  1 
ATOM   1523  C  CG  . PRO A  1  200 ? -19.738 18.547  8.988   1.00 24.47  ? 200 PRO A CG  1 
ATOM   1524  C  CD  . PRO A  1  200 ? -19.445 19.711  8.112   1.00 23.69  ? 200 PRO A CD  1 
ATOM   1525  N  N   . VAL A  1  201 ? -15.748 19.375  8.389   1.00 24.03  ? 201 VAL A N   1 
ATOM   1526  C  CA  . VAL A  1  201 ? -14.294 19.283  8.130   1.00 27.31  ? 201 VAL A CA  1 
ATOM   1527  C  C   . VAL A  1  201 ? -13.604 20.583  8.623   1.00 29.06  ? 201 VAL A C   1 
ATOM   1528  O  O   . VAL A  1  201 ? -12.559 20.517  9.257   1.00 32.27  ? 201 VAL A O   1 
ATOM   1529  C  CB  . VAL A  1  201 ? -13.954 19.013  6.647   1.00 25.85  ? 201 VAL A CB  1 
ATOM   1530  C  CG1 . VAL A  1  201 ? -12.453 18.822  6.463   1.00 26.32  ? 201 VAL A CG1 1 
ATOM   1531  C  CG2 . VAL A  1  201 ? -14.723 17.796  6.129   1.00 26.41  ? 201 VAL A CG2 1 
ATOM   1532  N  N   . LEU A  1  202 ? -14.208 21.742  8.375   1.00 25.66  ? 202 LEU A N   1 
ATOM   1533  C  CA  . LEU A  1  202 ? -13.688 22.970  8.937   1.00 28.11  ? 202 LEU A CA  1 
ATOM   1534  C  C   . LEU A  1  202 ? -13.641 22.850  10.463  1.00 29.48  ? 202 LEU A C   1 
ATOM   1535  O  O   . LEU A  1  202 ? -12.599 23.091  11.078  1.00 29.81  ? 202 LEU A O   1 
ATOM   1536  C  CB  . LEU A  1  202 ? -14.552 24.167  8.534   1.00 27.62  ? 202 LEU A CB  1 
ATOM   1537  C  CG  . LEU A  1  202 ? -14.097 25.538  9.040   1.00 27.93  ? 202 LEU A CG  1 
ATOM   1538  C  CD1 . LEU A  1  202 ? -12.678 25.852  8.596   1.00 28.82  ? 202 LEU A CD1 1 
ATOM   1539  C  CD2 . LEU A  1  202 ? -15.084 26.638  8.601   1.00 28.92  ? 202 LEU A CD2 1 
ATOM   1540  N  N   . ALA A  1  203 ? -14.758 22.440  11.065  1.00 28.41  ? 203 ALA A N   1 
ATOM   1541  C  CA  . ALA A  1  203 ? -14.820 22.307  12.520  1.00 28.43  ? 203 ALA A CA  1 
ATOM   1542  C  C   . ALA A  1  203 ? -13.709 21.377  13.031  1.00 27.45  ? 203 ALA A C   1 
ATOM   1543  O  O   . ALA A  1  203 ? -13.143 21.636  14.072  1.00 27.86  ? 203 ALA A O   1 
ATOM   1544  C  CB  . ALA A  1  203 ? -16.203 21.814  12.981  1.00 28.40  ? 203 ALA A CB  1 
ATOM   1545  N  N   . ALA A  1  204 ? -13.403 20.317  12.282  1.00 26.06  ? 204 ALA A N   1 
ATOM   1546  C  CA  . ALA A  1  204 ? -12.276 19.440  12.610  1.00 26.29  ? 204 ALA A CA  1 
ATOM   1547  C  C   . ALA A  1  204 ? -10.920 20.174  12.546  1.00 25.56  ? 204 ALA A C   1 
ATOM   1548  O  O   . ALA A  1  204 ? -10.089 20.101  13.481  1.00 22.90  ? 204 ALA A O   1 
ATOM   1549  C  CB  . ALA A  1  204 ? -12.249 18.238  11.660  1.00 26.53  ? 204 ALA A CB  1 
ATOM   1550  N  N   . GLY A  1  205 ? -10.696 20.840  11.422  1.00 23.55  ? 205 GLY A N   1 
ATOM   1551  C  CA  . GLY A  1  205 ? -9.447  21.513  11.202  1.00 26.22  ? 205 GLY A CA  1 
ATOM   1552  C  C   . GLY A  1  205 ? -9.136  22.598  12.231  1.00 26.25  ? 205 GLY A C   1 
ATOM   1553  O  O   . GLY A  1  205 ? -8.011  22.651  12.725  1.00 28.88  ? 205 GLY A O   1 
ATOM   1554  N  N   . ILE A  1  206 ? -10.112 23.448  12.550  1.00 24.67  ? 206 ILE A N   1 
ATOM   1555  C  CA  . ILE A  1  206 ? -9.899  24.539  13.506  1.00 26.32  ? 206 ILE A CA  1 
ATOM   1556  C  C   . ILE A  1  206 ? -9.902  24.114  14.962  1.00 26.60  ? 206 ILE A C   1 
ATOM   1557  O  O   . ILE A  1  206 ? -9.448  24.848  15.811  1.00 30.99  ? 206 ILE A O   1 
ATOM   1558  C  CB  . ILE A  1  206 ? -10.879 25.718  13.320  1.00 26.80  ? 206 ILE A CB  1 
ATOM   1559  C  CG1 . ILE A  1  206 ? -12.323 25.332  13.664  1.00 28.61  ? 206 ILE A CG1 1 
ATOM   1560  C  CG2 . ILE A  1  206 ? -10.840 26.226  11.890  1.00 28.38  ? 206 ILE A CG2 1 
ATOM   1561  C  CD1 . ILE A  1  206 ? -13.331 26.395  13.244  1.00 29.08  ? 206 ILE A CD1 1 
ATOM   1562  N  N   . THR A  1  207 ? -10.460 22.955  15.253  1.00 27.95  ? 207 THR A N   1 
ATOM   1563  C  CA  . THR A  1  207 ? -10.375 22.337  16.570  1.00 26.84  ? 207 THR A CA  1 
ATOM   1564  C  C   . THR A  1  207 ? -8.933  21.858  16.813  1.00 28.84  ? 207 THR A C   1 
ATOM   1565  O  O   . THR A  1  207 ? -8.380  22.031  17.902  1.00 29.85  ? 207 THR A O   1 
ATOM   1566  C  CB  . THR A  1  207 ? -11.369 21.155  16.649  1.00 27.16  ? 207 THR A CB  1 
ATOM   1567  O  OG1 . THR A  1  207 ? -12.698 21.664  16.701  1.00 26.23  ? 207 THR A OG1 1 
ATOM   1568  C  CG2 . THR A  1  207 ? -11.159 20.313  17.895  1.00 27.58  ? 207 THR A CG2 1 
ATOM   1569  N  N   . MET A  1  208 ? -8.359  21.211  15.798  1.00 28.66  ? 208 MET A N   1 
ATOM   1570  C  CA  . MET A  1  208 ? -6.965  20.795  15.803  1.00 29.45  ? 208 MET A CA  1 
ATOM   1571  C  C   . MET A  1  208 ? -6.072  22.022  15.920  1.00 29.14  ? 208 MET A C   1 
ATOM   1572  O  O   . MET A  1  208 ? -5.055  21.989  16.622  1.00 26.90  ? 208 MET A O   1 
ATOM   1573  C  CB  . MET A  1  208 ? -6.611  19.989  14.533  1.00 30.83  ? 208 MET A CB  1 
ATOM   1574  C  CG  . MET A  1  208 ? -7.181  18.564  14.444  1.00 31.62  ? 208 MET A CG  1 
ATOM   1575  S  SD  . MET A  1  208 ? -6.783  17.917  12.826  1.00 34.18  ? 208 MET A SD  1 
ATOM   1576  C  CE  . MET A  1  208 ? -8.277  17.287  12.110  1.00 37.96  ? 208 MET A CE  1 
ATOM   1577  N  N   . LEU A  1  209 ? -6.461  23.121  15.269  1.00 29.70  ? 209 LEU A N   1 
ATOM   1578  C  CA  . LEU A  1  209 ? -5.707  24.360  15.420  1.00 28.35  ? 209 LEU A CA  1 
ATOM   1579  C  C   . LEU A  1  209 ? -5.822  24.847  16.858  1.00 28.19  ? 209 LEU A C   1 
ATOM   1580  O  O   . LEU A  1  209 ? -4.850  25.292  17.444  1.00 27.89  ? 209 LEU A O   1 
ATOM   1581  C  CB  . LEU A  1  209 ? -6.191  25.430  14.444  1.00 29.10  ? 209 LEU A CB  1 
ATOM   1582  C  CG  . LEU A  1  209 ? -5.462  26.778  14.608  1.00 30.24  ? 209 LEU A CG  1 
ATOM   1583  C  CD1 . LEU A  1  209 ? -3.936  26.642  14.469  1.00 29.70  ? 209 LEU A CD1 1 
ATOM   1584  C  CD2 . LEU A  1  209 ? -6.045  27.772  13.619  1.00 30.22  ? 209 LEU A CD2 1 
ATOM   1585  N  N   . LEU A  1  210 ? -7.011  24.720  17.437  1.00 28.33  ? 210 LEU A N   1 
ATOM   1586  C  CA  . LEU A  1  210 ? -7.222  25.095  18.833  1.00 28.24  ? 210 LEU A CA  1 
ATOM   1587  C  C   . LEU A  1  210 ? -6.401  24.285  19.810  1.00 27.30  ? 210 LEU A C   1 
ATOM   1588  O  O   . LEU A  1  210 ? -5.942  24.819  20.798  1.00 26.00  ? 210 LEU A O   1 
ATOM   1589  C  CB  . LEU A  1  210 ? -8.699  24.969  19.189  1.00 29.31  ? 210 LEU A CB  1 
ATOM   1590  C  CG  . LEU A  1  210 ? -9.190  25.360  20.582  1.00 29.74  ? 210 LEU A CG  1 
ATOM   1591  C  CD1 . LEU A  1  210 ? -9.206  26.871  20.683  1.00 31.04  ? 210 LEU A CD1 1 
ATOM   1592  C  CD2 . LEU A  1  210 ? -10.570 24.781  20.825  1.00 28.11  ? 210 LEU A CD2 1 
ATOM   1593  N  N   . THR A  1  211 ? -6.242  22.990  19.539  1.00 29.27  ? 211 THR A N   1 
ATOM   1594  C  CA  . THR A  1  211 ? -5.459  22.108  20.419  1.00 28.34  ? 211 THR A CA  1 
ATOM   1595  C  C   . THR A  1  211 ? -3.950  22.299  20.224  1.00 29.08  ? 211 THR A C   1 
ATOM   1596  O  O   . THR A  1  211 ? -3.201  22.180  21.176  1.00 29.66  ? 211 THR A O   1 
ATOM   1597  C  CB  . THR A  1  211 ? -5.837  20.596  20.278  1.00 27.02  ? 211 THR A CB  1 
ATOM   1598  O  OG1 . THR A  1  211 ? -5.605  20.141  18.947  1.00 25.84  ? 211 THR A OG1 1 
ATOM   1599  C  CG2 . THR A  1  211 ? -7.306  20.340  20.649  1.00 25.44  ? 211 THR A CG2 1 
ATOM   1600  N  N   . ASP A  1  212 ? -3.492  22.578  19.006  1.00 28.62  ? 212 ASP A N   1 
ATOM   1601  C  CA  . ASP A  1  212 ? -2.096  22.992  18.812  1.00 27.61  ? 212 ASP A CA  1 
ATOM   1602  C  C   . ASP A  1  212 ? -1.787  24.303  19.641  1.00 30.26  ? 212 ASP A C   1 
ATOM   1603  O  O   . ASP A  1  212 ? -0.711  24.435  20.260  1.00 32.60  ? 212 ASP A O   1 
ATOM   1604  C  CB  . ASP A  1  212 ? -1.790  23.186  17.306  1.00 25.04  ? 212 ASP A CB  1 
ATOM   1605  C  CG  . ASP A  1  212 ? -1.414  21.910  16.608  1.00 26.43  ? 212 ASP A CG  1 
ATOM   1606  O  OD1 . ASP A  1  212 ? -1.829  20.807  17.045  1.00 29.09  ? 212 ASP A OD1 1 
ATOM   1607  O  OD2 . ASP A  1  212 ? -0.669  21.964  15.604  1.00 26.32  ? 212 ASP A OD2 1 
ATOM   1608  N  N   . ARG A  1  213 ? -2.728  25.253  19.664  1.00 28.90  ? 213 ARG A N   1 
ATOM   1609  C  CA  . ARG A  1  213 ? -2.540  26.467  20.447  1.00 27.99  ? 213 ARG A CA  1 
ATOM   1610  C  C   . ARG A  1  213 ? -2.715  26.275  21.970  1.00 27.46  ? 213 ARG A C   1 
ATOM   1611  O  O   . ARG A  1  213 ? -2.232  27.082  22.735  1.00 28.75  ? 213 ARG A O   1 
ATOM   1612  C  CB  . ARG A  1  213 ? -3.504  27.568  19.981  1.00 27.81  ? 213 ARG A CB  1 
ATOM   1613  C  CG  . ARG A  1  213 ? -3.331  28.056  18.562  1.00 26.80  ? 213 ARG A CG  1 
ATOM   1614  C  CD  . ARG A  1  213 ? -4.504  28.937  18.137  1.00 27.56  ? 213 ARG A CD  1 
ATOM   1615  N  NE  . ARG A  1  213 ? -4.750  29.974  19.131  1.00 28.48  ? 213 ARG A NE  1 
ATOM   1616  C  CZ  . ARG A  1  213 ? -3.992  31.057  19.315  1.00 28.21  ? 213 ARG A CZ  1 
ATOM   1617  N  NH1 . ARG A  1  213 ? -2.947  31.321  18.535  1.00 27.80  ? 213 ARG A NH1 1 
ATOM   1618  N  NH2 . ARG A  1  213 ? -4.296  31.903  20.281  1.00 28.64  ? 213 ARG A NH2 1 
ATOM   1619  N  N   . ASN A  1  214 ? -3.457  25.274  22.429  1.00 26.35  ? 214 ASN A N   1 
ATOM   1620  C  CA  . ASN A  1  214 ? -3.780  25.190  23.860  1.00 26.14  ? 214 ASN A CA  1 
ATOM   1621  C  C   . ASN A  1  214 ? -3.549  23.866  24.554  1.00 25.58  ? 214 ASN A C   1 
ATOM   1622  O  O   . ASN A  1  214 ? -3.494  23.848  25.754  1.00 26.82  ? 214 ASN A O   1 
ATOM   1623  C  CB  . ASN A  1  214 ? -5.245  25.640  24.092  1.00 27.29  ? 214 ASN A CB  1 
ATOM   1624  C  CG  . ASN A  1  214 ? -5.464  27.066  23.660  1.00 28.82  ? 214 ASN A CG  1 
ATOM   1625  O  OD1 . ASN A  1  214 ? -5.038  27.986  24.358  1.00 30.39  ? 214 ASN A OD1 1 
ATOM   1626  N  ND2 . ASN A  1  214 ? -6.064  27.270  22.476  1.00 28.01  ? 214 ASN A ND2 1 
ATOM   1627  N  N   . LEU A  1  215 ? -3.427  22.756  23.843  1.00 26.97  ? 215 LEU A N   1 
ATOM   1628  C  CA  . LEU A  1  215 ? -3.305  21.444  24.486  1.00 28.49  ? 215 LEU A CA  1 
ATOM   1629  C  C   . LEU A  1  215 ? -2.029  20.700  24.115  1.00 28.02  ? 215 LEU A C   1 
ATOM   1630  O  O   . LEU A  1  215 ? -1.905  19.491  24.358  1.00 25.52  ? 215 LEU A O   1 
ATOM   1631  C  CB  . LEU A  1  215 ? -4.520  20.589  24.138  1.00 31.01  ? 215 LEU A CB  1 
ATOM   1632  C  CG  . LEU A  1  215 ? -5.832  21.054  24.730  1.00 34.38  ? 215 LEU A CG  1 
ATOM   1633  C  CD1 . LEU A  1  215 ? -6.893  20.060  24.282  1.00 36.04  ? 215 LEU A CD1 1 
ATOM   1634  C  CD2 . LEU A  1  215 ? -5.745  21.144  26.247  1.00 34.80  ? 215 LEU A CD2 1 
ATOM   1635  N  N   . ASN A  1  216 ? -1.082  21.422  23.528  1.00 28.49  ? 216 ASN A N   1 
ATOM   1636  C  CA  . ASN A  1  216 ? 0.247   20.878  23.195  1.00 28.82  ? 216 ASN A CA  1 
ATOM   1637  C  C   . ASN A  1  216 ? 0.247   19.715  22.190  1.00 28.82  ? 216 ASN A C   1 
ATOM   1638  O  O   . ASN A  1  216 ? 1.214   18.911  22.134  1.00 27.73  ? 216 ASN A O   1 
ATOM   1639  C  CB  . ASN A  1  216 ? 1.036   20.572  24.476  1.00 26.94  ? 216 ASN A CB  1 
ATOM   1640  C  CG  . ASN A  1  216 ? 1.453   21.837  25.206  1.00 26.76  ? 216 ASN A CG  1 
ATOM   1641  O  OD1 . ASN A  1  216 ? 2.060   22.740  24.605  1.00 25.09  ? 216 ASN A OD1 1 
ATOM   1642  N  ND2 . ASN A  1  216 ? 1.148   21.903  26.518  1.00 26.04  ? 216 ASN A ND2 1 
ATOM   1643  N  N   . THR A  1  217 ? -0.799  19.692  21.345  1.00 27.41  ? 217 THR A N   1 
ATOM   1644  C  CA  . THR A  1  217 ? -0.805  18.871  20.143  1.00 27.47  ? 217 THR A CA  1 
ATOM   1645  C  C   . THR A  1  217 ? 0.067   19.565  19.113  1.00 28.79  ? 217 THR A C   1 
ATOM   1646  O  O   . THR A  1  217 ? 0.440   20.739  19.285  1.00 30.12  ? 217 THR A O   1 
ATOM   1647  C  CB  . THR A  1  217 ? -2.213  18.629  19.552  1.00 27.64  ? 217 THR A CB  1 
ATOM   1648  O  OG1 . THR A  1  217 ? -2.827  19.867  19.194  1.00 23.47  ? 217 THR A OG1 1 
ATOM   1649  C  CG2 . THR A  1  217 ? -3.085  17.879  20.564  1.00 27.97  ? 217 THR A CG2 1 
ATOM   1650  N  N   . THR A  1  218 ? 0.414   18.817  18.067  1.00 28.43  ? 218 THR A N   1 
ATOM   1651  C  CA  . THR A  1  218 ? 1.310   19.282  17.017  1.00 27.99  ? 218 THR A CA  1 
ATOM   1652  C  C   . THR A  1  218 ? 0.818   18.696  15.701  1.00 29.61  ? 218 THR A C   1 
ATOM   1653  O  O   . THR A  1  218 ? 1.608   18.115  14.925  1.00 32.85  ? 218 THR A O   1 
ATOM   1654  C  CB  . THR A  1  218 ? 2.751   18.792  17.273  1.00 27.90  ? 218 THR A CB  1 
ATOM   1655  O  OG1 . THR A  1  218 ? 2.727   17.369  17.493  1.00 28.14  ? 218 THR A OG1 1 
ATOM   1656  C  CG2 . THR A  1  218 ? 3.350   19.491  18.480  1.00 26.88  ? 218 THR A CG2 1 
ATOM   1657  N  N   . PHE A  1  219 ? -0.489  18.836  15.451  1.00 26.05  ? 219 PHE A N   1 
ATOM   1658  C  CA  . PHE A  1  219 ? -1.044  18.499  14.169  1.00 25.38  ? 219 PHE A CA  1 
ATOM   1659  C  C   . PHE A  1  219 ? -0.357  19.284  13.082  1.00 24.70  ? 219 PHE A C   1 
ATOM   1660  O  O   . PHE A  1  219 ? -0.095  18.732  12.035  1.00 26.64  ? 219 PHE A O   1 
ATOM   1661  C  CB  . PHE A  1  219 ? -2.545  18.820  14.119  1.00 26.87  ? 219 PHE A CB  1 
ATOM   1662  C  CG  . PHE A  1  219 ? -3.377  17.898  14.931  1.00 25.19  ? 219 PHE A CG  1 
ATOM   1663  C  CD1 . PHE A  1  219 ? -3.566  16.605  14.518  1.00 26.26  ? 219 PHE A CD1 1 
ATOM   1664  C  CD2 . PHE A  1  219 ? -3.943  18.320  16.109  1.00 24.63  ? 219 PHE A CD2 1 
ATOM   1665  C  CE1 . PHE A  1  219 ? -4.318  15.735  15.269  1.00 27.61  ? 219 PHE A CE1 1 
ATOM   1666  C  CE2 . PHE A  1  219 ? -4.685  17.466  16.862  1.00 25.42  ? 219 PHE A CE2 1 
ATOM   1667  C  CZ  . PHE A  1  219 ? -4.886  16.173  16.450  1.00 26.48  ? 219 PHE A CZ  1 
ATOM   1668  N  N   . PHE A  1  220 ? -0.082  20.562  13.328  1.00 25.29  ? 220 PHE A N   1 
ATOM   1669  C  CA  . PHE A  1  220 ? 0.436   21.476  12.274  1.00 28.45  ? 220 PHE A CA  1 
ATOM   1670  C  C   . PHE A  1  220 ? 1.862   22.024  12.512  1.00 31.19  ? 220 PHE A C   1 
ATOM   1671  O  O   . PHE A  1  220 ? 2.325   22.872  11.737  1.00 34.25  ? 220 PHE A O   1 
ATOM   1672  C  CB  . PHE A  1  220 ? -0.570  22.628  12.044  1.00 25.81  ? 220 PHE A CB  1 
ATOM   1673  C  CG  . PHE A  1  220 ? -1.971  22.147  11.896  1.00 24.52  ? 220 PHE A CG  1 
ATOM   1674  C  CD1 . PHE A  1  220 ? -2.270  21.128  10.991  1.00 24.47  ? 220 PHE A CD1 1 
ATOM   1675  C  CD2 . PHE A  1  220 ? -2.976  22.657  12.661  1.00 23.96  ? 220 PHE A CD2 1 
ATOM   1676  C  CE1 . PHE A  1  220 ? -3.550  20.640  10.871  1.00 23.53  ? 220 PHE A CE1 1 
ATOM   1677  C  CE2 . PHE A  1  220 ? -4.267  22.178  12.528  1.00 23.51  ? 220 PHE A CE2 1 
ATOM   1678  C  CZ  . PHE A  1  220 ? -4.547  21.167  11.638  1.00 22.62  ? 220 PHE A CZ  1 
ATOM   1679  N  N   . ASP A  1  221 ? 2.531   21.495  13.545  1.00 32.01  ? 221 ASP A N   1 
ATOM   1680  C  CA  . ASP A  1  221 ? 3.823   21.946  14.036  1.00 31.92  ? 221 ASP A CA  1 
ATOM   1681  C  C   . ASP A  1  221 ? 4.869   20.877  13.673  1.00 34.45  ? 221 ASP A C   1 
ATOM   1682  O  O   . ASP A  1  221 ? 4.887   19.777  14.244  1.00 31.51  ? 221 ASP A O   1 
ATOM   1683  C  CB  . ASP A  1  221 ? 3.750   22.122  15.545  1.00 31.98  ? 221 ASP A CB  1 
ATOM   1684  C  CG  . ASP A  1  221 ? 4.996   22.742  16.135  1.00 34.03  ? 221 ASP A CG  1 
ATOM   1685  O  OD1 . ASP A  1  221 ? 6.081   22.574  15.531  1.00 32.91  ? 221 ASP A OD1 1 
ATOM   1686  O  OD2 . ASP A  1  221 ? 4.888   23.402  17.211  1.00 32.04  ? 221 ASP A OD2 1 
ATOM   1687  N  N   . PRO A  1  222 ? 5.778   21.202  12.739  1.00 36.77  ? 222 PRO A N   1 
ATOM   1688  C  CA  . PRO A  1  222 ? 6.726   20.152  12.347  1.00 37.81  ? 222 PRO A CA  1 
ATOM   1689  C  C   . PRO A  1  222 ? 7.647   19.670  13.467  1.00 33.51  ? 222 PRO A C   1 
ATOM   1690  O  O   . PRO A  1  222 ? 8.212   18.615  13.331  1.00 30.13  ? 222 PRO A O   1 
ATOM   1691  C  CB  . PRO A  1  222 ? 7.556   20.797  11.207  1.00 39.16  ? 222 PRO A CB  1 
ATOM   1692  C  CG  . PRO A  1  222 ? 7.084   22.208  11.082  1.00 38.76  ? 222 PRO A CG  1 
ATOM   1693  C  CD  . PRO A  1  222 ? 6.178   22.526  12.239  1.00 36.44  ? 222 PRO A CD  1 
ATOM   1694  N  N   . ALA A  1  223 ? 7.813   20.446  14.527  1.00 31.97  ? 223 ALA A N   1 
ATOM   1695  C  CA  . ALA A  1  223 ? 8.583   20.008  15.677  1.00 34.88  ? 223 ALA A CA  1 
ATOM   1696  C  C   . ALA A  1  223 ? 8.075   18.683  16.257  1.00 36.92  ? 223 ALA A C   1 
ATOM   1697  O  O   . ALA A  1  223 ? 8.879   17.830  16.633  1.00 40.55  ? 223 ALA A O   1 
ATOM   1698  C  CB  . ALA A  1  223 ? 8.613   21.083  16.751  1.00 35.87  ? 223 ALA A CB  1 
ATOM   1699  N  N   . GLY A  1  224 ? 6.761   18.486  16.261  1.00 35.46  ? 224 GLY A N   1 
ATOM   1700  C  CA  . GLY A  1  224 ? 6.158   17.241  16.727  1.00 32.37  ? 224 GLY A CA  1 
ATOM   1701  C  C   . GLY A  1  224 ? 5.856   16.266  15.623  1.00 31.73  ? 224 GLY A C   1 
ATOM   1702  O  O   . GLY A  1  224 ? 5.174   15.269  15.853  1.00 35.65  ? 224 GLY A O   1 
ATOM   1703  N  N   . GLY A  1  225 ? 6.381   16.506  14.431  1.00 30.75  ? 225 GLY A N   1 
ATOM   1704  C  CA  . GLY A  1  225 ? 5.998   15.720  13.242  1.00 30.89  ? 225 GLY A CA  1 
ATOM   1705  C  C   . GLY A  1  225 ? 4.788   16.201  12.462  1.00 30.79  ? 225 GLY A C   1 
ATOM   1706  O  O   . GLY A  1  225 ? 4.362   15.547  11.516  1.00 30.58  ? 225 GLY A O   1 
ATOM   1707  N  N   . GLY A  1  226 ? 4.248   17.355  12.862  1.00 31.43  ? 226 GLY A N   1 
ATOM   1708  C  CA  . GLY A  1  226 ? 3.146   18.006  12.183  1.00 30.97  ? 226 GLY A CA  1 
ATOM   1709  C  C   . GLY A  1  226 ? 3.500   18.583  10.819  1.00 30.09  ? 226 GLY A C   1 
ATOM   1710  O  O   . GLY A  1  226 ? 4.629   18.497  10.346  1.00 29.54  ? 226 GLY A O   1 
ATOM   1711  N  N   . ASP A  1  227 ? 2.491   19.174  10.195  1.00 29.16  ? 227 ASP A N   1 
ATOM   1712  C  CA  . ASP A  1  227 ? 2.586   19.697  8.863   1.00 27.61  ? 227 ASP A CA  1 
ATOM   1713  C  C   . ASP A  1  227 ? 1.576   20.848  8.677   1.00 29.84  ? 227 ASP A C   1 
ATOM   1714  O  O   . ASP A  1  227 ? 0.366   20.624  8.609   1.00 26.62  ? 227 ASP A O   1 
ATOM   1715  C  CB  . ASP A  1  227 ? 2.325   18.569  7.889   1.00 27.46  ? 227 ASP A CB  1 
ATOM   1716  C  CG  . ASP A  1  227 ? 2.553   18.967  6.469   1.00 27.85  ? 227 ASP A CG  1 
ATOM   1717  O  OD1 . ASP A  1  227 ? 2.979   20.131  6.280   1.00 29.67  ? 227 ASP A OD1 1 
ATOM   1718  O  OD2 . ASP A  1  227 ? 2.300   18.125  5.560   1.00 24.43  ? 227 ASP A OD2 1 
ATOM   1719  N  N   . PRO A  1  228 ? 2.085   22.095  8.566   1.00 30.99  ? 228 PRO A N   1 
ATOM   1720  C  CA  . PRO A  1  228 ? 1.200   23.209  8.208   1.00 29.80  ? 228 PRO A CA  1 
ATOM   1721  C  C   . PRO A  1  228 ? 0.315   22.951  6.992   1.00 26.80  ? 228 PRO A C   1 
ATOM   1722  O  O   . PRO A  1  228 ? -0.776  23.474  6.927   1.00 28.46  ? 228 PRO A O   1 
ATOM   1723  C  CB  . PRO A  1  228 ? 2.184   24.359  7.931   1.00 29.86  ? 228 PRO A CB  1 
ATOM   1724  C  CG  . PRO A  1  228 ? 3.409   24.010  8.716   1.00 29.44  ? 228 PRO A CG  1 
ATOM   1725  C  CD  . PRO A  1  228 ? 3.500   22.520  8.620   1.00 29.54  ? 228 PRO A CD  1 
ATOM   1726  N  N   . ILE A  1  229 ? 0.784   22.163  6.048   1.00 26.03  ? 229 ILE A N   1 
ATOM   1727  C  CA  . ILE A  1  229 ? 0.015   21.850  4.860   1.00 29.67  ? 229 ILE A CA  1 
ATOM   1728  C  C   . ILE A  1  229 ? -1.263  21.019  5.170   1.00 30.98  ? 229 ILE A C   1 
ATOM   1729  O  O   . ILE A  1  229 ? -2.250  21.120  4.433   1.00 32.37  ? 229 ILE A O   1 
ATOM   1730  C  CB  . ILE A  1  229 ? 0.894   21.099  3.811   1.00 32.94  ? 229 ILE A CB  1 
ATOM   1731  C  CG1 . ILE A  1  229 ? 2.118   21.927  3.386   1.00 36.76  ? 229 ILE A CG1 1 
ATOM   1732  C  CG2 . ILE A  1  229 ? 0.107   20.712  2.570   1.00 34.94  ? 229 ILE A CG2 1 
ATOM   1733  C  CD1 . ILE A  1  229 ? 1.803   23.364  3.062   1.00 40.15  ? 229 ILE A CD1 1 
ATOM   1734  N  N   . LEU A  1  230 ? -1.264  20.208  6.233   1.00 27.57  ? 230 LEU A N   1 
ATOM   1735  C  CA  . LEU A  1  230 ? -2.455  19.474  6.568   1.00 26.45  ? 230 LEU A CA  1 
ATOM   1736  C  C   . LEU A  1  230 ? -3.621  20.476  6.800   1.00 26.62  ? 230 LEU A C   1 
ATOM   1737  O  O   . LEU A  1  230 ? -4.722  20.274  6.266   1.00 23.47  ? 230 LEU A O   1 
ATOM   1738  C  CB  . LEU A  1  230 ? -2.235  18.515  7.748   1.00 26.89  ? 230 LEU A CB  1 
ATOM   1739  C  CG  . LEU A  1  230 ? -3.506  17.817  8.261   1.00 28.29  ? 230 LEU A CG  1 
ATOM   1740  C  CD1 . LEU A  1  230 ? -4.051  16.798  7.284   1.00 31.39  ? 230 LEU A CD1 1 
ATOM   1741  C  CD2 . LEU A  1  230 ? -3.298  17.137  9.577   1.00 29.65  ? 230 LEU A CD2 1 
ATOM   1742  N  N   . TYR A  1  231 ? -3.361  21.563  7.545   1.00 26.59  ? 231 TYR A N   1 
ATOM   1743  C  CA  . TYR A  1  231 ? -4.376  22.594  7.827   1.00 25.97  ? 231 TYR A CA  1 
ATOM   1744  C  C   . TYR A  1  231 ? -4.990  23.133  6.534   1.00 26.14  ? 231 TYR A C   1 
ATOM   1745  O  O   . TYR A  1  231 ? -6.202  23.258  6.420   1.00 24.99  ? 231 TYR A O   1 
ATOM   1746  C  CB  . TYR A  1  231 ? -3.816  23.766  8.641   1.00 26.87  ? 231 TYR A CB  1 
ATOM   1747  C  CG  . TYR A  1  231 ? -4.874  24.829  8.867   1.00 26.62  ? 231 TYR A CG  1 
ATOM   1748  C  CD1 . TYR A  1  231 ? -5.728  24.762  9.943   1.00 27.03  ? 231 TYR A CD1 1 
ATOM   1749  C  CD2 . TYR A  1  231 ? -5.059  25.848  7.957   1.00 26.94  ? 231 TYR A CD2 1 
ATOM   1750  C  CE1 . TYR A  1  231 ? -6.723  25.701  10.115  1.00 27.89  ? 231 TYR A CE1 1 
ATOM   1751  C  CE2 . TYR A  1  231 ? -6.063  26.777  8.115   1.00 26.48  ? 231 TYR A CE2 1 
ATOM   1752  C  CZ  . TYR A  1  231 ? -6.883  26.693  9.189   1.00 26.64  ? 231 TYR A CZ  1 
ATOM   1753  O  OH  . TYR A  1  231 ? -7.854  27.616  9.362   1.00 28.69  ? 231 TYR A OH  1 
ATOM   1754  N  N   . GLN A  1  232 ? -4.135  23.424  5.562   1.00 25.26  ? 232 GLN A N   1 
ATOM   1755  C  CA  . GLN A  1  232 ? -4.573  23.993  4.312   1.00 24.39  ? 232 GLN A CA  1 
ATOM   1756  C  C   . GLN A  1  232 ? -5.497  23.060  3.575   1.00 25.63  ? 232 GLN A C   1 
ATOM   1757  O  O   . GLN A  1  232 ? -6.528  23.504  3.096   1.00 27.16  ? 232 GLN A O   1 
ATOM   1758  C  CB  . GLN A  1  232 ? -3.383  24.350  3.443   1.00 25.46  ? 232 GLN A CB  1 
ATOM   1759  C  CG  . GLN A  1  232 ? -2.529  25.413  4.102   1.00 26.01  ? 232 GLN A CG  1 
ATOM   1760  C  CD  . GLN A  1  232 ? -1.406  25.947  3.254   1.00 26.43  ? 232 GLN A CD  1 
ATOM   1761  O  OE1 . GLN A  1  232 ? -0.431  26.442  3.810   1.00 30.20  ? 232 GLN A OE1 1 
ATOM   1762  N  NE2 . GLN A  1  232 ? -1.544  25.906  1.943   1.00 23.18  ? 232 GLN A NE2 1 
ATOM   1763  N  N   . HIS A  1  233 ? -5.180  21.760  3.526   1.00 26.78  ? 233 HIS A N   1 
ATOM   1764  C  CA  . HIS A  1  233 ? -6.129  20.780  2.950   1.00 26.10  ? 233 HIS A CA  1 
ATOM   1765  C  C   . HIS A  1  233 ? -7.515  20.760  3.628   1.00 24.39  ? 233 HIS A C   1 
ATOM   1766  O  O   . HIS A  1  233 ? -8.502  20.724  2.948   1.00 23.50  ? 233 HIS A O   1 
ATOM   1767  C  CB  . HIS A  1  233 ? -5.545  19.377  2.946   1.00 26.61  ? 233 HIS A CB  1 
ATOM   1768  C  CG  . HIS A  1  233 ? -4.487  19.186  1.926   1.00 27.64  ? 233 HIS A CG  1 
ATOM   1769  N  ND1 . HIS A  1  233 ? -4.732  19.331  0.579   1.00 29.06  ? 233 HIS A ND1 1 
ATOM   1770  C  CD2 . HIS A  1  233 ? -3.180  18.857  2.044   1.00 27.85  ? 233 HIS A CD2 1 
ATOM   1771  C  CE1 . HIS A  1  233 ? -3.614  19.109  -0.093  1.00 30.13  ? 233 HIS A CE1 1 
ATOM   1772  N  NE2 . HIS A  1  233 ? -2.658  18.818  0.772   1.00 29.18  ? 233 HIS A NE2 1 
ATOM   1773  N  N   . LEU A  1  234 ? -7.553  20.775  4.956   1.00 24.52  ? 234 LEU A N   1 
ATOM   1774  C  CA  . LEU A  1  234 ? -8.789  20.723  5.692   1.00 25.80  ? 234 LEU A CA  1 
ATOM   1775  C  C   . LEU A  1  234 ? -9.551  21.999  5.517   1.00 24.50  ? 234 LEU A C   1 
ATOM   1776  O  O   . LEU A  1  234 ? -10.752 21.967  5.277   1.00 23.13  ? 234 LEU A O   1 
ATOM   1777  C  CB  . LEU A  1  234 ? -8.567  20.461  7.169   1.00 28.63  ? 234 LEU A CB  1 
ATOM   1778  C  CG  . LEU A  1  234 ? -7.855  19.160  7.517   1.00 32.52  ? 234 LEU A CG  1 
ATOM   1779  C  CD1 . LEU A  1  234 ? -7.611  19.119  9.016   1.00 34.64  ? 234 LEU A CD1 1 
ATOM   1780  C  CD2 . LEU A  1  234 ? -8.646  17.949  7.074   1.00 33.84  ? 234 LEU A CD2 1 
ATOM   1781  N  N   . PHE A  1  235 ? -8.854  23.124  5.593   1.00 24.14  ? 235 PHE A N   1 
ATOM   1782  C  CA  . PHE A  1  235 ? -9.510  24.398  5.419   1.00 23.80  ? 235 PHE A CA  1 
ATOM   1783  C  C   . PHE A  1  235 ? -10.204 24.479  4.065   1.00 25.74  ? 235 PHE A C   1 
ATOM   1784  O  O   . PHE A  1  235 ? -11.394 24.793  3.976   1.00 28.16  ? 235 PHE A O   1 
ATOM   1785  C  CB  . PHE A  1  235 ? -8.529  25.548  5.533   1.00 22.70  ? 235 PHE A CB  1 
ATOM   1786  C  CG  . PHE A  1  235 ? -9.202  26.892  5.459   1.00 22.15  ? 235 PHE A CG  1 
ATOM   1787  C  CD1 . PHE A  1  235 ? -9.788  27.440  6.579   1.00 22.04  ? 235 PHE A CD1 1 
ATOM   1788  C  CD2 . PHE A  1  235 ? -9.316  27.555  4.263   1.00 21.95  ? 235 PHE A CD2 1 
ATOM   1789  C  CE1 . PHE A  1  235 ? -10.452 28.654  6.518   1.00 22.11  ? 235 PHE A CE1 1 
ATOM   1790  C  CE2 . PHE A  1  235 ? -9.957  28.785  4.200   1.00 22.38  ? 235 PHE A CE2 1 
ATOM   1791  C  CZ  . PHE A  1  235 ? -10.525 29.334  5.316   1.00 21.34  ? 235 PHE A CZ  1 
ATOM   1792  N  N   . TRP A  1  236 ? -9.435  24.210  3.018   1.00 25.95  ? 236 TRP A N   1 
ATOM   1793  C  CA  . TRP A  1  236 ? -9.905  24.371  1.664   1.00 25.13  ? 236 TRP A CA  1 
ATOM   1794  C  C   . TRP A  1  236 ? -10.840 23.283  1.192   1.00 24.15  ? 236 TRP A C   1 
ATOM   1795  O  O   . TRP A  1  236 ? -11.551 23.523  0.263   1.00 22.13  ? 236 TRP A O   1 
ATOM   1796  C  CB  . TRP A  1  236 ? -8.716  24.527  0.690   1.00 26.52  ? 236 TRP A CB  1 
ATOM   1797  C  CG  . TRP A  1  236 ? -8.089  25.861  0.811   1.00 27.32  ? 236 TRP A CG  1 
ATOM   1798  C  CD1 . TRP A  1  236 ? -6.807  26.167  1.216   1.00 26.62  ? 236 TRP A CD1 1 
ATOM   1799  C  CD2 . TRP A  1  236 ? -8.744  27.100  0.577   1.00 27.64  ? 236 TRP A CD2 1 
ATOM   1800  N  NE1 . TRP A  1  236 ? -6.644  27.531  1.236   1.00 26.62  ? 236 TRP A NE1 1 
ATOM   1801  C  CE2 . TRP A  1  236 ? -7.803  28.124  0.830   1.00 25.50  ? 236 TRP A CE2 1 
ATOM   1802  C  CE3 . TRP A  1  236 ? -10.041 27.445  0.147   1.00 26.96  ? 236 TRP A CE3 1 
ATOM   1803  C  CZ2 . TRP A  1  236 ? -8.106  29.456  0.681   1.00 28.78  ? 236 TRP A CZ2 1 
ATOM   1804  C  CZ3 . TRP A  1  236 ? -10.350 28.776  0.004   1.00 28.94  ? 236 TRP A CZ3 1 
ATOM   1805  C  CH2 . TRP A  1  236 ? -9.386  29.780  0.272   1.00 28.99  ? 236 TRP A CH2 1 
ATOM   1806  N  N   . PHE A  1  237 ? -10.823 22.103  1.816   1.00 23.63  ? 237 PHE A N   1 
ATOM   1807  C  CA  . PHE A  1  237 ? -11.773 21.071  1.522   1.00 23.07  ? 237 PHE A CA  1 
ATOM   1808  C  C   . PHE A  1  237 ? -13.146 21.629  1.855   1.00 24.41  ? 237 PHE A C   1 
ATOM   1809  O  O   . PHE A  1  237 ? -14.074 21.361  1.113   1.00 24.18  ? 237 PHE A O   1 
ATOM   1810  C  CB  . PHE A  1  237 ? -11.502 19.787  2.293   1.00 24.29  ? 237 PHE A CB  1 
ATOM   1811  C  CG  . PHE A  1  237 ? -12.394 18.642  1.887   1.00 24.77  ? 237 PHE A CG  1 
ATOM   1812  C  CD1 . PHE A  1  237 ? -13.629 18.459  2.495   1.00 26.21  ? 237 PHE A CD1 1 
ATOM   1813  C  CD2 . PHE A  1  237 ? -12.012 17.775  0.887   1.00 25.11  ? 237 PHE A CD2 1 
ATOM   1814  C  CE1 . PHE A  1  237 ? -14.472 17.424  2.112   1.00 27.12  ? 237 PHE A CE1 1 
ATOM   1815  C  CE2 . PHE A  1  237 ? -12.837 16.727  0.505   1.00 27.73  ? 237 PHE A CE2 1 
ATOM   1816  C  CZ  . PHE A  1  237 ? -14.071 16.540  1.123   1.00 26.41  ? 237 PHE A CZ  1 
ATOM   1817  N  N   . PHE A  1  238 ? -13.252 22.399  2.944   1.00 23.13  ? 238 PHE A N   1 
ATOM   1818  C  CA  . PHE A  1  238 ? -14.440 23.202  3.240   1.00 24.82  ? 238 PHE A CA  1 
ATOM   1819  C  C   . PHE A  1  238 ? -14.571 24.457  2.373   1.00 26.12  ? 238 PHE A C   1 
ATOM   1820  O  O   . PHE A  1  238 ? -15.671 24.809  1.921   1.00 26.63  ? 238 PHE A O   1 
ATOM   1821  C  CB  . PHE A  1  238 ? -14.452 23.651  4.711   1.00 25.74  ? 238 PHE A CB  1 
ATOM   1822  C  CG  . PHE A  1  238 ? -15.057 25.027  4.937   1.00 26.50  ? 238 PHE A CG  1 
ATOM   1823  C  CD1 . PHE A  1  238 ? -16.437 25.191  5.031   1.00 27.76  ? 238 PHE A CD1 1 
ATOM   1824  C  CD2 . PHE A  1  238 ? -14.241 26.154  5.068   1.00 27.30  ? 238 PHE A CD2 1 
ATOM   1825  C  CE1 . PHE A  1  238 ? -16.989 26.452  5.247   1.00 27.92  ? 238 PHE A CE1 1 
ATOM   1826  C  CE2 . PHE A  1  238 ? -14.788 27.423  5.283   1.00 26.84  ? 238 PHE A CE2 1 
ATOM   1827  C  CZ  . PHE A  1  238 ? -16.157 27.571  5.379   1.00 27.63  ? 238 PHE A CZ  1 
ATOM   1828  N  N   . GLY A  1  239 ? -13.441 25.142  2.206   1.00 25.94  ? 239 GLY A N   1 
ATOM   1829  C  CA  . GLY A  1  239 ? -13.392 26.473  1.652   1.00 23.93  ? 239 GLY A CA  1 
ATOM   1830  C  C   . GLY A  1  239 ? -13.833 26.534  0.238   1.00 23.12  ? 239 GLY A C   1 
ATOM   1831  O  O   . GLY A  1  239 ? -14.396 27.544  -0.171  1.00 22.36  ? 239 GLY A O   1 
ATOM   1832  N  N   . HIS A  1  240 ? -13.579 25.493  -0.547  1.00 21.43  ? 240 HIS A N   1 
ATOM   1833  C  CA  . HIS A  1  240 ? -14.095 25.574  -1.860  1.00 21.57  ? 240 HIS A CA  1 
ATOM   1834  C  C   . HIS A  1  240 ? -15.619 25.447  -1.921  1.00 24.46  ? 240 HIS A C   1 
ATOM   1835  O  O   . HIS A  1  240 ? -16.297 26.297  -2.538  1.00 25.27  ? 240 HIS A O   1 
ATOM   1836  C  CB  . HIS A  1  240 ? -13.460 24.717  -2.900  1.00 21.60  ? 240 HIS A CB  1 
ATOM   1837  C  CG  . HIS A  1  240 ? -14.032 25.063  -4.218  1.00 23.53  ? 240 HIS A CG  1 
ATOM   1838  N  ND1 . HIS A  1  240 ? -13.605 26.167  -4.901  1.00 27.59  ? 240 HIS A ND1 1 
ATOM   1839  C  CD2 . HIS A  1  240 ? -15.167 24.667  -4.820  1.00 25.62  ? 240 HIS A CD2 1 
ATOM   1840  C  CE1 . HIS A  1  240 ? -14.373 26.360  -5.951  1.00 27.32  ? 240 HIS A CE1 1 
ATOM   1841  N  NE2 . HIS A  1  240 ? -15.385 25.508  -5.888  1.00 28.86  ? 240 HIS A NE2 1 
ATOM   1842  N  N   . PRO A  1  241 ? -16.172 24.391  -1.313  1.00 23.96  ? 241 PRO A N   1 
ATOM   1843  C  CA  . PRO A  1  241 ? -17.609 24.315  -1.196  1.00 23.56  ? 241 PRO A CA  1 
ATOM   1844  C  C   . PRO A  1  241 ? -18.231 25.581  -0.659  1.00 22.96  ? 241 PRO A C   1 
ATOM   1845  O  O   . PRO A  1  241 ? -19.279 25.957  -1.125  1.00 23.67  ? 241 PRO A O   1 
ATOM   1846  C  CB  . PRO A  1  241 ? -17.807 23.177  -0.203  1.00 24.99  ? 241 PRO A CB  1 
ATOM   1847  C  CG  . PRO A  1  241 ? -16.697 22.241  -0.489  1.00 25.16  ? 241 PRO A CG  1 
ATOM   1848  C  CD  . PRO A  1  241 ? -15.534 23.127  -0.906  1.00 25.95  ? 241 PRO A CD  1 
ATOM   1849  N  N   . GLU A  1  242 ? -17.576 26.222  0.301   1.00 22.51  ? 242 GLU A N   1 
ATOM   1850  C  CA  . GLU A  1  242 ? -18.027 27.517  0.816   1.00 23.76  ? 242 GLU A CA  1 
ATOM   1851  C  C   . GLU A  1  242 ? -18.234 28.581  -0.263  1.00 25.69  ? 242 GLU A C   1 
ATOM   1852  O  O   . GLU A  1  242 ? -19.165 29.358  -0.172  1.00 27.56  ? 242 GLU A O   1 
ATOM   1853  C  CB  . GLU A  1  242 ? -17.116 28.025  1.947   1.00 22.49  ? 242 GLU A CB  1 
ATOM   1854  C  CG  . GLU A  1  242 ? -17.427 29.399  2.499   1.00 22.09  ? 242 GLU A CG  1 
ATOM   1855  C  CD  . GLU A  1  242 ? -18.796 29.475  3.147   1.00 23.32  ? 242 GLU A CD  1 
ATOM   1856  O  OE1 . GLU A  1  242 ? -19.254 30.624  3.383   1.00 24.13  ? 242 GLU A OE1 1 
ATOM   1857  O  OE2 . GLU A  1  242 ? -19.403 28.420  3.435   1.00 20.20  ? 242 GLU A OE2 1 
ATOM   1858  N  N   . VAL A  1  243 ? -17.418 28.622  -1.304  1.00 27.55  ? 243 VAL A N   1 
ATOM   1859  C  CA  . VAL A  1  243 ? -17.643 29.651  -2.325  1.00 27.05  ? 243 VAL A CA  1 
ATOM   1860  C  C   . VAL A  1  243 ? -18.903 29.348  -3.155  1.00 26.07  ? 243 VAL A C   1 
ATOM   1861  O  O   . VAL A  1  243 ? -19.627 30.280  -3.598  1.00 27.13  ? 243 VAL A O   1 
ATOM   1862  C  CB  . VAL A  1  243 ? -16.394 29.947  -3.209  1.00 27.53  ? 243 VAL A CB  1 
ATOM   1863  C  CG1 . VAL A  1  243 ? -15.214 30.285  -2.342  1.00 28.18  ? 243 VAL A CG1 1 
ATOM   1864  C  CG2 . VAL A  1  243 ? -16.054 28.830  -4.175  1.00 28.63  ? 243 VAL A CG2 1 
ATOM   1865  N  N   . TYR A  1  244 ? -19.177 28.061  -3.349  1.00 25.31  ? 244 TYR A N   1 
ATOM   1866  C  CA  . TYR A  1  244 ? -20.367 27.629  -4.108  1.00 25.40  ? 244 TYR A CA  1 
ATOM   1867  C  C   . TYR A  1  244 ? -21.622 27.816  -3.270  1.00 24.97  ? 244 TYR A C   1 
ATOM   1868  O  O   . TYR A  1  244 ? -22.617 28.251  -3.774  1.00 26.44  ? 244 TYR A O   1 
ATOM   1869  C  CB  . TYR A  1  244 ? -20.168 26.237  -4.700  1.00 24.85  ? 244 TYR A CB  1 
ATOM   1870  C  CG  . TYR A  1  244 ? -19.009 26.320  -5.670  1.00 25.36  ? 244 TYR A CG  1 
ATOM   1871  C  CD1 . TYR A  1  244 ? -19.166 26.996  -6.888  1.00 25.58  ? 244 TYR A CD1 1 
ATOM   1872  C  CD2 . TYR A  1  244 ? -17.745 25.860  -5.313  1.00 25.21  ? 244 TYR A CD2 1 
ATOM   1873  C  CE1 . TYR A  1  244 ? -18.124 27.153  -7.763  1.00 25.97  ? 244 TYR A CE1 1 
ATOM   1874  C  CE2 . TYR A  1  244 ? -16.644 26.004  -6.170  1.00 28.53  ? 244 TYR A CE2 1 
ATOM   1875  C  CZ  . TYR A  1  244 ? -16.874 26.674  -7.421  1.00 27.40  ? 244 TYR A CZ  1 
ATOM   1876  O  OH  . TYR A  1  244 ? -15.876 26.857  -8.344  1.00 27.74  ? 244 TYR A OH  1 
ATOM   1877  N  N   . ILE A  1  245 ? -21.497 27.605  -1.973  1.00 24.37  ? 245 ILE A N   1 
ATOM   1878  C  CA  . ILE A  1  245 ? -22.527 27.902  -1.015  1.00 25.08  ? 245 ILE A CA  1 
ATOM   1879  C  C   . ILE A  1  245 ? -22.893 29.386  -1.046  1.00 24.93  ? 245 ILE A C   1 
ATOM   1880  O  O   . ILE A  1  245 ? -24.044 29.738  -0.878  1.00 26.49  ? 245 ILE A O   1 
ATOM   1881  C  CB  . ILE A  1  245 ? -22.019 27.481  0.400   1.00 26.81  ? 245 ILE A CB  1 
ATOM   1882  C  CG1 . ILE A  1  245 ? -21.983 25.945  0.535   1.00 27.02  ? 245 ILE A CG1 1 
ATOM   1883  C  CG2 . ILE A  1  245 ? -22.783 28.136  1.569   1.00 25.91  ? 245 ILE A CG2 1 
ATOM   1884  C  CD1 . ILE A  1  245 ? -21.169 25.492  1.743   1.00 26.50  ? 245 ILE A CD1 1 
ATOM   1885  N  N   . LEU A  1  246 ? -21.908 30.254  -1.216  1.00 24.90  ? 246 LEU A N   1 
ATOM   1886  C  CA  . LEU A  1  246 ? -22.155 31.676  -1.277  1.00 25.21  ? 246 LEU A CA  1 
ATOM   1887  C  C   . LEU A  1  246 ? -22.867 32.094  -2.544  1.00 25.75  ? 246 LEU A C   1 
ATOM   1888  O  O   . LEU A  1  246 ? -23.582 33.074  -2.544  1.00 28.11  ? 246 LEU A O   1 
ATOM   1889  C  CB  . LEU A  1  246 ? -20.862 32.464  -1.181  1.00 25.43  ? 246 LEU A CB  1 
ATOM   1890  C  CG  . LEU A  1  246 ? -20.130 32.368  0.127   1.00 26.39  ? 246 LEU A CG  1 
ATOM   1891  C  CD1 . LEU A  1  246 ? -18.767 33.031  -0.030  1.00 27.06  ? 246 LEU A CD1 1 
ATOM   1892  C  CD2 . LEU A  1  246 ? -20.914 33.000  1.261   1.00 26.62  ? 246 LEU A CD2 1 
ATOM   1893  N  N   . ILE A  1  247 ? -22.656 31.389  -3.639  1.00 25.31  ? 247 ILE A N   1 
ATOM   1894  C  CA  . ILE A  1  247 ? -23.282 31.825  -4.871  1.00 24.10  ? 247 ILE A CA  1 
ATOM   1895  C  C   . ILE A  1  247 ? -24.577 31.096  -5.279  1.00 24.53  ? 247 ILE A C   1 
ATOM   1896  O  O   . ILE A  1  247 ? -25.344 31.667  -6.005  1.00 24.76  ? 247 ILE A O   1 
ATOM   1897  C  CB  . ILE A  1  247 ? -22.251 31.786  -5.982  1.00 23.01  ? 247 ILE A CB  1 
ATOM   1898  C  CG1 . ILE A  1  247 ? -22.620 32.743  -7.106  1.00 24.51  ? 247 ILE A CG1 1 
ATOM   1899  C  CG2 . ILE A  1  247 ? -21.995 30.380  -6.474  1.00 23.97  ? 247 ILE A CG2 1 
ATOM   1900  C  CD1 . ILE A  1  247 ? -22.646 34.210  -6.703  1.00 24.98  ? 247 ILE A CD1 1 
ATOM   1901  N  N   . LEU A  1  248 ? -24.806 29.860  -4.833  1.00 24.89  ? 248 LEU A N   1 
ATOM   1902  C  CA  . LEU A  1  248 ? -25.902 29.041  -5.350  1.00 26.88  ? 248 LEU A CA  1 
ATOM   1903  C  C   . LEU A  1  248 ? -27.296 29.644  -5.040  1.00 24.50  ? 248 LEU A C   1 
ATOM   1904  O  O   . LEU A  1  248 ? -28.146 29.678  -5.891  1.00 22.54  ? 248 LEU A O   1 
ATOM   1905  C  CB  . LEU A  1  248 ? -25.835 27.596  -4.846  1.00 28.33  ? 248 LEU A CB  1 
ATOM   1906  C  CG  . LEU A  1  248 ? -24.860 26.640  -5.538  1.00 33.39  ? 248 LEU A CG  1 
ATOM   1907  C  CD1 . LEU A  1  248 ? -24.803 25.309  -4.792  1.00 34.89  ? 248 LEU A CD1 1 
ATOM   1908  C  CD2 . LEU A  1  248 ? -25.212 26.400  -6.986  1.00 33.85  ? 248 LEU A CD2 1 
ATOM   1909  N  N   . PRO A  1  249 ? -27.521 30.131  -3.833  1.00 24.19  ? 249 PRO A N   1 
ATOM   1910  C  CA  . PRO A  1  249 ? -28.822 30.775  -3.657  1.00 25.56  ? 249 PRO A CA  1 
ATOM   1911  C  C   . PRO A  1  249 ? -29.013 31.997  -4.521  1.00 25.43  ? 249 PRO A C   1 
ATOM   1912  O  O   . PRO A  1  249 ? -30.148 32.369  -4.808  1.00 30.58  ? 249 PRO A O   1 
ATOM   1913  C  CB  . PRO A  1  249 ? -28.814 31.160  -2.169  1.00 25.26  ? 249 PRO A CB  1 
ATOM   1914  C  CG  . PRO A  1  249 ? -27.848 30.170  -1.553  1.00 25.31  ? 249 PRO A CG  1 
ATOM   1915  C  CD  . PRO A  1  249 ? -26.766 30.078  -2.572  1.00 25.07  ? 249 PRO A CD  1 
ATOM   1916  N  N   . GLY A  1  250 ? -27.915 32.643  -4.889  1.00 24.58  ? 250 GLY A N   1 
ATOM   1917  C  CA  . GLY A  1  250 ? -27.953 33.767  -5.773  1.00 23.55  ? 250 GLY A CA  1 
ATOM   1918  C  C   . GLY A  1  250 ? -28.335 33.343  -7.160  1.00 23.35  ? 250 GLY A C   1 
ATOM   1919  O  O   . GLY A  1  250 ? -29.064 34.039  -7.821  1.00 26.20  ? 250 GLY A O   1 
ATOM   1920  N  N   . PHE A  1  251 ? -27.831 32.211  -7.617  1.00 23.33  ? 251 PHE A N   1 
ATOM   1921  C  CA  . PHE A  1  251 ? -28.242 31.634  -8.897  1.00 24.60  ? 251 PHE A CA  1 
ATOM   1922  C  C   . PHE A  1  251 ? -29.762 31.385  -8.884  1.00 25.80  ? 251 PHE A C   1 
ATOM   1923  O  O   . PHE A  1  251 ? -30.450 31.686  -9.831  1.00 28.59  ? 251 PHE A O   1 
ATOM   1924  C  CB  . PHE A  1  251 ? -27.561 30.279  -9.133  1.00 25.60  ? 251 PHE A CB  1 
ATOM   1925  C  CG  . PHE A  1  251 ? -26.082 30.310  -9.508  1.00 26.55  ? 251 PHE A CG  1 
ATOM   1926  C  CD1 . PHE A  1  251 ? -25.401 31.486  -9.928  1.00 27.50  ? 251 PHE A CD1 1 
ATOM   1927  C  CD2 . PHE A  1  251 ? -25.373 29.092  -9.504  1.00 27.18  ? 251 PHE A CD2 1 
ATOM   1928  C  CE1 . PHE A  1  251 ? -24.076 31.440  -10.328 1.00 27.90  ? 251 PHE A CE1 1 
ATOM   1929  C  CE2 . PHE A  1  251 ? -24.026 29.043  -9.879  1.00 28.08  ? 251 PHE A CE2 1 
ATOM   1930  C  CZ  . PHE A  1  251 ? -23.381 30.215  -10.290 1.00 29.73  ? 251 PHE A CZ  1 
ATOM   1931  N  N   . GLY A  1  252 ? -30.262 30.836  -7.782  1.00 27.09  ? 252 GLY A N   1 
ATOM   1932  C  CA  . GLY A  1  252 ? -31.680 30.628  -7.540  1.00 27.42  ? 252 GLY A CA  1 
ATOM   1933  C  C   . GLY A  1  252 ? -32.515 31.884  -7.684  1.00 27.20  ? 252 GLY A C   1 
ATOM   1934  O  O   . GLY A  1  252 ? -33.505 31.882  -8.417  1.00 27.81  ? 252 GLY A O   1 
ATOM   1935  N  N   . MET A  1  253 ? -32.109 32.939  -6.991  1.00 26.09  ? 253 MET A N   1 
ATOM   1936  C  CA  . MET A  1  253 ? -32.850 34.185  -7.005  1.00 26.96  ? 253 MET A CA  1 
ATOM   1937  C  C   . MET A  1  253 ? -32.838 34.823  -8.383  1.00 26.26  ? 253 MET A C   1 
ATOM   1938  O  O   . MET A  1  253 ? -33.849 35.351  -8.842  1.00 23.19  ? 253 MET A O   1 
ATOM   1939  C  CB  . MET A  1  253 ? -32.288 35.147  -5.970  1.00 29.21  ? 253 MET A CB  1 
ATOM   1940  C  CG  . MET A  1  253 ? -32.628 34.729  -4.551  1.00 32.33  ? 253 MET A CG  1 
ATOM   1941  S  SD  . MET A  1  253 ? -32.221 36.010  -3.378  1.00 37.83  ? 253 MET A SD  1 
ATOM   1942  C  CE  . MET A  1  253 ? -30.546 35.547  -3.070  1.00 38.89  ? 253 MET A CE  1 
ATOM   1943  N  N   . ILE A  1  254 ? -31.682 34.754  -9.035  1.00 25.94  ? 254 ILE A N   1 
ATOM   1944  C  CA  . ILE A  1  254 ? -31.500 35.325  -10.363 1.00 24.74  ? 254 ILE A CA  1 
ATOM   1945  C  C   . ILE A  1  254 ? -32.442 34.609  -11.320 1.00 25.17  ? 254 ILE A C   1 
ATOM   1946  O  O   . ILE A  1  254 ? -33.103 35.244  -12.122 1.00 26.58  ? 254 ILE A O   1 
ATOM   1947  C  CB  . ILE A  1  254 ? -30.007 35.247  -10.816 1.00 23.59  ? 254 ILE A CB  1 
ATOM   1948  C  CG1 . ILE A  1  254 ? -29.131 36.176  -9.968  1.00 23.75  ? 254 ILE A CG1 1 
ATOM   1949  C  CG2 . ILE A  1  254 ? -29.837 35.633  -12.266 1.00 24.22  ? 254 ILE A CG2 1 
ATOM   1950  C  CD1 . ILE A  1  254 ? -29.492 37.651  -10.006 1.00 23.06  ? 254 ILE A CD1 1 
ATOM   1951  N  N   . SER A  1  255 ? -32.541 33.285  -11.221 1.00 26.33  ? 255 SER A N   1 
ATOM   1952  C  CA  . SER A  1  255 ? -33.496 32.545  -12.050 1.00 24.77  ? 255 SER A CA  1 
ATOM   1953  C  C   . SER A  1  255 ? -34.908 33.052  -11.873 1.00 24.40  ? 255 SER A C   1 
ATOM   1954  O  O   . SER A  1  255 ? -35.641 33.230  -12.844 1.00 26.46  ? 255 SER A O   1 
ATOM   1955  C  CB  . SER A  1  255 ? -33.419 31.057  -11.779 1.00 24.46  ? 255 SER A CB  1 
ATOM   1956  O  OG  . SER A  1  255 ? -32.172 30.596  -12.249 1.00 24.30  ? 255 SER A OG  1 
ATOM   1957  N  N   . HIS A  1  256 ? -35.296 33.319  -10.644 1.00 23.65  ? 256 HIS A N   1 
ATOM   1958  C  CA  . HIS A  1  256 ? -36.654 33.765  -10.403 1.00 23.55  ? 256 HIS A CA  1 
ATOM   1959  C  C   . HIS A  1  256 ? -36.861 35.183  -10.933 1.00 24.28  ? 256 HIS A C   1 
ATOM   1960  O  O   . HIS A  1  256 ? -37.852 35.469  -11.569 1.00 23.43  ? 256 HIS A O   1 
ATOM   1961  C  CB  . HIS A  1  256 ? -36.979 33.692  -8.918  1.00 23.48  ? 256 HIS A CB  1 
ATOM   1962  C  CG  . HIS A  1  256 ? -37.342 32.322  -8.433  1.00 23.76  ? 256 HIS A CG  1 
ATOM   1963  N  ND1 . HIS A  1  256 ? -38.611 32.009  -7.999  1.00 21.95  ? 256 HIS A ND1 1 
ATOM   1964  C  CD2 . HIS A  1  256 ? -36.607 31.184  -8.308  1.00 23.45  ? 256 HIS A CD2 1 
ATOM   1965  C  CE1 . HIS A  1  256 ? -38.628 30.752  -7.595  1.00 23.23  ? 256 HIS A CE1 1 
ATOM   1966  N  NE2 . HIS A  1  256 ? -37.432 30.223  -7.786  1.00 22.05  ? 256 HIS A NE2 1 
ATOM   1967  N  N   . ILE A  1  257 ? -35.921 36.073  -10.658 1.00 26.38  ? 257 ILE A N   1 
ATOM   1968  C  CA  . ILE A  1  257 ? -36.030 37.478  -11.077 1.00 26.76  ? 257 ILE A CA  1 
ATOM   1969  C  C   . ILE A  1  257 ? -36.063 37.574  -12.602 1.00 25.17  ? 257 ILE A C   1 
ATOM   1970  O  O   . ILE A  1  257 ? -36.944 38.170  -13.174 1.00 25.73  ? 257 ILE A O   1 
ATOM   1971  C  CB  . ILE A  1  257 ? -34.887 38.294  -10.478 1.00 28.19  ? 257 ILE A CB  1 
ATOM   1972  C  CG1 . ILE A  1  257 ? -35.104 38.393  -8.982  1.00 29.59  ? 257 ILE A CG1 1 
ATOM   1973  C  CG2 . ILE A  1  257 ? -34.816 39.708  -11.040 1.00 29.41  ? 257 ILE A CG2 1 
ATOM   1974  C  CD1 . ILE A  1  257 ? -33.832 38.808  -8.282  1.00 33.33  ? 257 ILE A CD1 1 
ATOM   1975  N  N   . VAL A  1  258 ? -35.149 36.914  -13.259 1.00 24.85  ? 258 VAL A N   1 
ATOM   1976  C  CA  . VAL A  1  258 ? -35.099 36.963  -14.700 1.00 26.00  ? 258 VAL A CA  1 
ATOM   1977  C  C   . VAL A  1  258 ? -36.382 36.405  -15.346 1.00 26.23  ? 258 VAL A C   1 
ATOM   1978  O  O   . VAL A  1  258 ? -36.884 36.957  -16.312 1.00 27.99  ? 258 VAL A O   1 
ATOM   1979  C  CB  . VAL A  1  258 ? -33.830 36.267  -15.178 1.00 27.87  ? 258 VAL A CB  1 
ATOM   1980  C  CG1 . VAL A  1  258 ? -33.879 36.012  -16.657 1.00 32.19  ? 258 VAL A CG1 1 
ATOM   1981  C  CG2 . VAL A  1  258 ? -32.634 37.148  -14.865 1.00 29.95  ? 258 VAL A CG2 1 
ATOM   1982  N  N   . THR A  1  259 ? -36.910 35.313  -14.817 1.00 25.13  ? 259 THR A N   1 
ATOM   1983  C  CA  . THR A  1  259 ? -38.187 34.776  -15.270 1.00 25.46  ? 259 THR A CA  1 
ATOM   1984  C  C   . THR A  1  259 ? -39.345 35.758  -15.079 1.00 25.76  ? 259 THR A C   1 
ATOM   1985  O  O   . THR A  1  259 ? -40.076 36.107  -16.021 1.00 29.14  ? 259 THR A O   1 
ATOM   1986  C  CB  . THR A  1  259 ? -38.506 33.463  -14.538 1.00 24.21  ? 259 THR A CB  1 
ATOM   1987  O  OG1 . THR A  1  259 ? -37.436 32.541  -14.757 1.00 24.26  ? 259 THR A OG1 1 
ATOM   1988  C  CG2 . THR A  1  259 ? -39.754 32.864  -15.080 1.00 23.94  ? 259 THR A CG2 1 
ATOM   1989  N  N   . TYR A  1  260 ? -39.464 36.250  -13.869 1.00 24.83  ? 260 TYR A N   1 
ATOM   1990  C  CA  . TYR A  1  260 ? -40.524 37.161  -13.535 1.00 25.99  ? 260 TYR A CA  1 
ATOM   1991  C  C   . TYR A  1  260 ? -40.597 38.390  -14.421 1.00 26.32  ? 260 TYR A C   1 
ATOM   1992  O  O   . TYR A  1  260 ? -41.668 38.750  -14.902 1.00 30.55  ? 260 TYR A O   1 
ATOM   1993  C  CB  . TYR A  1  260 ? -40.412 37.583  -12.060 1.00 26.61  ? 260 TYR A CB  1 
ATOM   1994  C  CG  . TYR A  1  260 ? -41.634 38.299  -11.558 1.00 25.50  ? 260 TYR A CG  1 
ATOM   1995  C  CD1 . TYR A  1  260 ? -42.699 37.588  -11.019 1.00 26.32  ? 260 TYR A CD1 1 
ATOM   1996  C  CD2 . TYR A  1  260 ? -41.722 39.672  -11.627 1.00 25.37  ? 260 TYR A CD2 1 
ATOM   1997  C  CE1 . TYR A  1  260 ? -43.817 38.228  -10.548 1.00 26.56  ? 260 TYR A CE1 1 
ATOM   1998  C  CE2 . TYR A  1  260 ? -42.843 40.326  -11.176 1.00 26.31  ? 260 TYR A CE2 1 
ATOM   1999  C  CZ  . TYR A  1  260 ? -43.885 39.594  -10.647 1.00 28.14  ? 260 TYR A CZ  1 
ATOM   2000  O  OH  . TYR A  1  260 ? -44.997 40.248  -10.211 1.00 33.44  ? 260 TYR A OH  1 
ATOM   2001  N  N   . TYR A  1  261 ? -39.474 39.051  -14.616 1.00 26.06  ? 261 TYR A N   1 
ATOM   2002  C  CA  . TYR A  1  261 ? -39.480 40.376  -15.243 1.00 26.60  ? 261 TYR A CA  1 
ATOM   2003  C  C   . TYR A  1  261 ? -39.359 40.256  -16.760 1.00 27.02  ? 261 TYR A C   1 
ATOM   2004  O  O   . TYR A  1  261 ? -39.360 41.237  -17.468 1.00 26.53  ? 261 TYR A O   1 
ATOM   2005  C  CB  . TYR A  1  261 ? -38.388 41.270  -14.621 1.00 25.15  ? 261 TYR A CB  1 
ATOM   2006  C  CG  . TYR A  1  261 ? -38.730 41.665  -13.176 1.00 25.34  ? 261 TYR A CG  1 
ATOM   2007  C  CD1 . TYR A  1  261 ? -39.722 42.626  -12.896 1.00 24.24  ? 261 TYR A CD1 1 
ATOM   2008  C  CD2 . TYR A  1  261 ? -38.100 41.070  -12.092 1.00 24.42  ? 261 TYR A CD2 1 
ATOM   2009  C  CE1 . TYR A  1  261 ? -40.052 42.979  -11.607 1.00 21.28  ? 261 TYR A CE1 1 
ATOM   2010  C  CE2 . TYR A  1  261 ? -38.436 41.434  -10.793 1.00 23.80  ? 261 TYR A CE2 1 
ATOM   2011  C  CZ  . TYR A  1  261 ? -39.403 42.394  -10.587 1.00 22.68  ? 261 TYR A CZ  1 
ATOM   2012  O  OH  . TYR A  1  261 ? -39.731 42.732  -9.345  1.00 23.20  ? 261 TYR A OH  1 
ATOM   2013  N  N   . SER A  1  262 ? -39.203 39.028  -17.230 1.00 30.04  ? 262 SER A N   1 
ATOM   2014  C  CA  . SER A  1  262 ? -39.408 38.683  -18.627 1.00 30.58  ? 262 SER A CA  1 
ATOM   2015  C  C   . SER A  1  262 ? -40.866 38.279  -18.902 1.00 29.67  ? 262 SER A C   1 
ATOM   2016  O  O   . SER A  1  262 ? -41.209 38.048  -20.058 1.00 27.45  ? 262 SER A O   1 
ATOM   2017  C  CB  . SER A  1  262 ? -38.505 37.514  -18.984 1.00 29.90  ? 262 SER A CB  1 
ATOM   2018  O  OG  . SER A  1  262 ? -37.180 37.916  -18.797 1.00 33.37  ? 262 SER A OG  1 
ATOM   2019  N  N   . GLY A  1  263 ? -41.693 38.185  -17.856 1.00 28.87  ? 263 GLY A N   1 
ATOM   2020  C  CA  . GLY A  1  263 ? -43.073 37.710  -17.970 1.00 30.45  ? 263 GLY A CA  1 
ATOM   2021  C  C   . GLY A  1  263 ? -43.180 36.329  -18.575 1.00 32.17  ? 263 GLY A C   1 
ATOM   2022  O  O   . GLY A  1  263 ? -44.016 36.079  -19.443 1.00 36.94  ? 263 GLY A O   1 
ATOM   2023  N  N   . LYS A  1  264 ? -42.282 35.448  -18.160 1.00 32.81  ? 264 LYS A N   1 
ATOM   2024  C  CA  . LYS A  1  264 ? -42.342 34.046  -18.514 1.00 31.53  ? 264 LYS A CA  1 
ATOM   2025  C  C   . LYS A  1  264 ? -42.945 33.296  -17.356 1.00 31.07  ? 264 LYS A C   1 
ATOM   2026  O  O   . LYS A  1  264 ? -42.815 33.703  -16.213 1.00 30.19  ? 264 LYS A O   1 
ATOM   2027  C  CB  . LYS A  1  264 ? -40.944 33.512  -18.773 1.00 32.26  ? 264 LYS A CB  1 
ATOM   2028  C  CG  . LYS A  1  264 ? -40.141 34.302  -19.787 1.00 32.52  ? 264 LYS A CG  1 
ATOM   2029  C  CD  . LYS A  1  264 ? -40.704 34.171  -21.185 1.00 31.60  ? 264 LYS A CD  1 
ATOM   2030  C  CE  . LYS A  1  264 ? -39.726 34.632  -22.260 1.00 30.29  ? 264 LYS A CE  1 
ATOM   2031  N  NZ  . LYS A  1  264 ? -38.776 33.552  -22.639 1.00 29.33  ? 264 LYS A NZ  1 
ATOM   2032  N  N   . LYS A  1  265 ? -43.601 32.190  -17.657 1.00 37.32  ? 265 LYS A N   1 
ATOM   2033  C  CA  . LYS A  1  265 ? -44.163 31.297  -16.644 1.00 39.98  ? 265 LYS A CA  1 
ATOM   2034  C  C   . LYS A  1  265 ? -43.093 30.449  -15.997 1.00 38.52  ? 265 LYS A C   1 
ATOM   2035  O  O   . LYS A  1  265 ? -43.282 29.938  -14.895 1.00 37.63  ? 265 LYS A O   1 
ATOM   2036  C  CB  . LYS A  1  265 ? -45.173 30.350  -17.286 1.00 49.33  ? 265 LYS A CB  1 
ATOM   2037  C  CG  . LYS A  1  265 ? -46.453 31.022  -17.732 1.00 58.54  ? 265 LYS A CG  1 
ATOM   2038  C  CD  . LYS A  1  265 ? -47.283 30.061  -18.588 1.00 73.97  ? 265 LYS A CD  1 
ATOM   2039  C  CE  . LYS A  1  265 ? -48.762 30.433  -18.574 1.00 82.50  ? 265 LYS A CE  1 
ATOM   2040  N  NZ  . LYS A  1  265 ? -48.969 31.913  -18.697 1.00 87.97  ? 265 LYS A NZ  1 
ATOM   2041  N  N   . GLU A  1  266 ? -41.987 30.247  -16.698 1.00 38.84  ? 266 GLU A N   1 
ATOM   2042  C  CA  . GLU A  1  266 ? -40.929 29.424  -16.170 1.00 39.57  ? 266 GLU A CA  1 
ATOM   2043  C  C   . GLU A  1  266 ? -39.610 29.718  -16.822 1.00 36.07  ? 266 GLU A C   1 
ATOM   2044  O  O   . GLU A  1  266 ? -39.574 30.220  -17.936 1.00 31.47  ? 266 GLU A O   1 
ATOM   2045  C  CB  . GLU A  1  266 ? -41.274 27.951  -16.353 1.00 44.27  ? 266 GLU A CB  1 
ATOM   2046  C  CG  . GLU A  1  266 ? -41.249 27.404  -17.763 1.00 50.76  ? 266 GLU A CG  1 
ATOM   2047  C  CD  . GLU A  1  266 ? -41.816 25.986  -17.822 1.00 57.70  ? 266 GLU A CD  1 
ATOM   2048  O  OE1 . GLU A  1  266 ? -41.356 25.072  -17.059 1.00 56.54  ? 266 GLU A OE1 1 
ATOM   2049  O  OE2 . GLU A  1  266 ? -42.743 25.808  -18.629 1.00 61.78  ? 266 GLU A OE2 1 
ATOM   2050  N  N   . PRO A  1  267 ? -38.510 29.383  -16.128 1.00 32.95  ? 267 PRO A N   1 
ATOM   2051  C  CA  . PRO A  1  267 ? -37.218 29.595  -16.728 1.00 30.57  ? 267 PRO A CA  1 
ATOM   2052  C  C   . PRO A  1  267 ? -36.982 28.615  -17.837 1.00 28.87  ? 267 PRO A C   1 
ATOM   2053  O  O   . PRO A  1  267 ? -37.564 27.547  -17.867 1.00 33.51  ? 267 PRO A O   1 
ATOM   2054  C  CB  . PRO A  1  267 ? -36.242 29.359  -15.572 1.00 29.53  ? 267 PRO A CB  1 
ATOM   2055  C  CG  . PRO A  1  267 ? -36.939 28.448  -14.681 1.00 31.58  ? 267 PRO A CG  1 
ATOM   2056  C  CD  . PRO A  1  267 ? -38.389 28.838  -14.764 1.00 33.65  ? 267 PRO A CD  1 
ATOM   2057  N  N   . PHE A  1  268 ? -36.159 29.002  -18.774 1.00 27.11  ? 268 PHE A N   1 
ATOM   2058  C  CA  . PHE A  1  268 ? -35.725 28.092  -19.789 1.00 28.06  ? 268 PHE A CA  1 
ATOM   2059  C  C   . PHE A  1  268 ? -34.884 26.927  -19.211 1.00 30.86  ? 268 PHE A C   1 
ATOM   2060  O  O   . PHE A  1  268 ? -33.950 27.137  -18.405 1.00 33.56  ? 268 PHE A O   1 
ATOM   2061  C  CB  . PHE A  1  268 ? -34.885 28.859  -20.791 1.00 28.48  ? 268 PHE A CB  1 
ATOM   2062  C  CG  . PHE A  1  268 ? -34.341 28.006  -21.866 1.00 29.20  ? 268 PHE A CG  1 
ATOM   2063  C  CD1 . PHE A  1  268 ? -33.185 27.287  -21.662 1.00 29.31  ? 268 PHE A CD1 1 
ATOM   2064  C  CD2 . PHE A  1  268 ? -35.024 27.883  -23.062 1.00 29.76  ? 268 PHE A CD2 1 
ATOM   2065  C  CE1 . PHE A  1  268 ? -32.695 26.475  -22.657 1.00 31.50  ? 268 PHE A CE1 1 
ATOM   2066  C  CE2 . PHE A  1  268 ? -34.548 27.081  -24.048 1.00 30.86  ? 268 PHE A CE2 1 
ATOM   2067  C  CZ  . PHE A  1  268 ? -33.383 26.369  -23.848 1.00 31.68  ? 268 PHE A CZ  1 
ATOM   2068  N  N   . GLY A  1  269 ? -35.181 25.709  -19.667 1.00 29.86  ? 269 GLY A N   1 
ATOM   2069  C  CA  . GLY A  1  269 ? -34.352 24.562  -19.366 1.00 29.47  ? 269 GLY A CA  1 
ATOM   2070  C  C   . GLY A  1  269 ? -34.300 24.225  -17.881 1.00 29.48  ? 269 GLY A C   1 
ATOM   2071  O  O   . GLY A  1  269 ? -33.222 23.986  -17.330 1.00 31.29  ? 269 GLY A O   1 
ATOM   2072  N  N   . TYR A  1  270 ? -35.471 24.203  -17.249 1.00 25.97  ? 270 TYR A N   1 
ATOM   2073  C  CA  . TYR A  1  270 ? -35.594 23.895  -15.833 1.00 24.77  ? 270 TYR A CA  1 
ATOM   2074  C  C   . TYR A  1  270 ? -34.697 22.719  -15.445 1.00 25.47  ? 270 TYR A C   1 
ATOM   2075  O  O   . TYR A  1  270 ? -33.904 22.848  -14.541 1.00 26.83  ? 270 TYR A O   1 
ATOM   2076  C  CB  . TYR A  1  270 ? -37.042 23.587  -15.490 1.00 23.71  ? 270 TYR A CB  1 
ATOM   2077  C  CG  . TYR A  1  270 ? -37.289 23.091  -14.095 1.00 22.67  ? 270 TYR A CG  1 
ATOM   2078  C  CD1 . TYR A  1  270 ? -37.448 23.963  -13.044 1.00 22.74  ? 270 TYR A CD1 1 
ATOM   2079  C  CD2 . TYR A  1  270 ? -37.364 21.764  -13.839 1.00 23.76  ? 270 TYR A CD2 1 
ATOM   2080  C  CE1 . TYR A  1  270 ? -37.678 23.510  -11.761 1.00 24.24  ? 270 TYR A CE1 1 
ATOM   2081  C  CE2 . TYR A  1  270 ? -37.586 21.299  -12.555 1.00 25.46  ? 270 TYR A CE2 1 
ATOM   2082  C  CZ  . TYR A  1  270 ? -37.759 22.173  -11.514 1.00 23.95  ? 270 TYR A CZ  1 
ATOM   2083  O  OH  . TYR A  1  270 ? -37.984 21.659  -10.222 1.00 25.67  ? 270 TYR A OH  1 
ATOM   2084  N  N   . MET A  1  271 ? -34.805 21.581  -16.114 1.00 25.69  ? 271 MET A N   1 
ATOM   2085  C  CA  . MET A  1  271 ? -34.054 20.419  -15.666 1.00 27.16  ? 271 MET A CA  1 
ATOM   2086  C  C   . MET A  1  271 ? -32.529 20.595  -15.865 1.00 26.62  ? 271 MET A C   1 
ATOM   2087  O  O   . MET A  1  271 ? -31.759 20.121  -15.064 1.00 27.47  ? 271 MET A O   1 
ATOM   2088  C  CB  . MET A  1  271 ? -34.594 19.155  -16.341 1.00 30.44  ? 271 MET A CB  1 
ATOM   2089  C  CG  . MET A  1  271 ? -35.991 18.734  -15.894 1.00 30.99  ? 271 MET A CG  1 
ATOM   2090  S  SD  . MET A  1  271 ? -36.043 18.250  -14.149 1.00 35.34  ? 271 MET A SD  1 
ATOM   2091  C  CE  . MET A  1  271 ? -35.152 16.723  -14.241 1.00 39.41  ? 271 MET A CE  1 
ATOM   2092  N  N   . GLY A  1  272 ? -32.116 21.323  -16.894 1.00 25.90  ? 272 GLY A N   1 
ATOM   2093  C  CA  . GLY A  1  272 ? -30.731 21.708  -17.093 1.00 26.44  ? 272 GLY A CA  1 
ATOM   2094  C  C   . GLY A  1  272 ? -30.193 22.592  -15.993 1.00 27.87  ? 272 GLY A C   1 
ATOM   2095  O  O   . GLY A  1  272 ? -29.053 22.423  -15.555 1.00 29.90  ? 272 GLY A O   1 
ATOM   2096  N  N   . MET A  1  273 ? -31.037 23.484  -15.493 1.00 27.70  ? 273 MET A N   1 
ATOM   2097  C  CA  . MET A  1  273 ? -30.707 24.288  -14.320 1.00 27.23  ? 273 MET A CA  1 
ATOM   2098  C  C   . MET A  1  273 ? -30.497 23.441  -13.072 1.00 26.23  ? 273 MET A C   1 
ATOM   2099  O  O   . MET A  1  273 ? -29.553 23.658  -12.329 1.00 26.81  ? 273 MET A O   1 
ATOM   2100  C  CB  . MET A  1  273 ? -31.793 25.335  -14.047 1.00 27.68  ? 273 MET A CB  1 
ATOM   2101  C  CG  . MET A  1  273 ? -32.075 26.332  -15.164 1.00 29.47  ? 273 MET A CG  1 
ATOM   2102  S  SD  . MET A  1  273 ? -30.763 27.564  -15.360 1.00 34.69  ? 273 MET A SD  1 
ATOM   2103  C  CE  . MET A  1  273 ? -29.664 26.492  -16.237 1.00 38.71  ? 273 MET A CE  1 
ATOM   2104  N  N   . VAL A  1  274 ? -31.387 22.485  -12.849 1.00 25.40  ? 274 VAL A N   1 
ATOM   2105  C  CA  . VAL A  1  274 ? -31.253 21.536  -11.759 1.00 26.55  ? 274 VAL A CA  1 
ATOM   2106  C  C   . VAL A  1  274 ? -29.960 20.693  -11.926 1.00 26.53  ? 274 VAL A C   1 
ATOM   2107  O  O   . VAL A  1  274 ? -29.199 20.541  -10.997 1.00 23.78  ? 274 VAL A O   1 
ATOM   2108  C  CB  . VAL A  1  274 ? -32.492 20.612  -11.655 1.00 27.06  ? 274 VAL A CB  1 
ATOM   2109  C  CG1 . VAL A  1  274 ? -32.268 19.512  -10.629 1.00 28.83  ? 274 VAL A CG1 1 
ATOM   2110  C  CG2 . VAL A  1  274 ? -33.711 21.404  -11.244 1.00 28.43  ? 274 VAL A CG2 1 
ATOM   2111  N  N   . TRP A  1  275 ? -29.744 20.151  -13.116 1.00 27.43  ? 275 TRP A N   1 
ATOM   2112  C  CA  . TRP A  1  275 ? -28.543 19.374  -13.415 1.00 27.09  ? 275 TRP A CA  1 
ATOM   2113  C  C   . TRP A  1  275 ? -27.285 20.230  -13.188 1.00 27.25  ? 275 TRP A C   1 
ATOM   2114  O  O   . TRP A  1  275 ? -26.292 19.738  -12.628 1.00 26.11  ? 275 TRP A O   1 
ATOM   2115  C  CB  . TRP A  1  275 ? -28.574 18.812  -14.872 1.00 26.71  ? 275 TRP A CB  1 
ATOM   2116  C  CG  . TRP A  1  275 ? -27.251 18.237  -15.310 1.00 25.41  ? 275 TRP A CG  1 
ATOM   2117  C  CD1 . TRP A  1  275 ? -26.786 16.995  -15.063 1.00 24.29  ? 275 TRP A CD1 1 
ATOM   2118  C  CD2 . TRP A  1  275 ? -26.208 18.927  -15.999 1.00 24.36  ? 275 TRP A CD2 1 
ATOM   2119  N  NE1 . TRP A  1  275 ? -25.533 16.842  -15.586 1.00 22.40  ? 275 TRP A NE1 1 
ATOM   2120  C  CE2 . TRP A  1  275 ? -25.152 18.028  -16.159 1.00 25.05  ? 275 TRP A CE2 1 
ATOM   2121  C  CE3 . TRP A  1  275 ? -26.082 20.211  -16.526 1.00 26.02  ? 275 TRP A CE3 1 
ATOM   2122  C  CZ2 . TRP A  1  275 ? -23.952 18.380  -16.826 1.00 26.70  ? 275 TRP A CZ2 1 
ATOM   2123  C  CZ3 . TRP A  1  275 ? -24.887 20.578  -17.181 1.00 25.47  ? 275 TRP A CZ3 1 
ATOM   2124  C  CH2 . TRP A  1  275 ? -23.836 19.659  -17.319 1.00 26.66  ? 275 TRP A CH2 1 
ATOM   2125  N  N   . ALA A  1  276 ? -27.327 21.487  -13.630 1.00 25.49  ? 276 ALA A N   1 
ATOM   2126  C  CA  . ALA A  1  276 ? -26.175 22.394  -13.450 1.00 25.37  ? 276 ALA A CA  1 
ATOM   2127  C  C   . ALA A  1  276 ? -25.796 22.626  -11.983 1.00 24.49  ? 276 ALA A C   1 
ATOM   2128  O  O   . ALA A  1  276 ? -24.622 22.503  -11.607 1.00 24.46  ? 276 ALA A O   1 
ATOM   2129  C  CB  . ALA A  1  276 ? -26.415 23.717  -14.140 1.00 25.44  ? 276 ALA A CB  1 
ATOM   2130  N  N   . MET A  1  277 ? -26.798 22.875  -11.150 1.00 25.24  ? 277 MET A N   1 
ATOM   2131  C  CA  . MET A  1  277 ? -26.560 23.094  -9.731  1.00 25.58  ? 277 MET A CA  1 
ATOM   2132  C  C   . MET A  1  277 ? -26.044 21.867  -9.045  1.00 26.67  ? 277 MET A C   1 
ATOM   2133  O  O   . MET A  1  277 ? -25.100 21.977  -8.262  1.00 30.09  ? 277 MET A O   1 
ATOM   2134  C  CB  . MET A  1  277 ? -27.796 23.647  -9.048  1.00 24.89  ? 277 MET A CB  1 
ATOM   2135  C  CG  . MET A  1  277 ? -28.048 25.080  -9.508  1.00 26.91  ? 277 MET A CG  1 
ATOM   2136  S  SD  . MET A  1  277 ? -29.256 26.007  -8.559  1.00 25.99  ? 277 MET A SD  1 
ATOM   2137  C  CE  . MET A  1  277 ? -30.711 25.092  -9.037  1.00 26.66  ? 277 MET A CE  1 
ATOM   2138  N  N   . MET A  1  278 ? -26.613 20.708  -9.360  1.00 28.70  ? 278 MET A N   1 
ATOM   2139  C  CA  . MET A  1  278 ? -26.128 19.432  -8.807  1.00 32.56  ? 278 MET A CA  1 
ATOM   2140  C  C   . MET A  1  278 ? -24.701 19.151  -9.186  1.00 30.12  ? 278 MET A C   1 
ATOM   2141  O  O   . MET A  1  278 ? -23.932 18.817  -8.325  1.00 28.53  ? 278 MET A O   1 
ATOM   2142  C  CB  . MET A  1  278 ? -26.940 18.241  -9.261  1.00 37.01  ? 278 MET A CB  1 
ATOM   2143  C  CG  . MET A  1  278 ? -28.271 18.151  -8.578  1.00 46.69  ? 278 MET A CG  1 
ATOM   2144  S  SD  . MET A  1  278 ? -28.948 16.501  -8.776  1.00 62.92  ? 278 MET A SD  1 
ATOM   2145  C  CE  . MET A  1  278 ? -30.666 16.830  -8.393  1.00 67.57  ? 278 MET A CE  1 
ATOM   2146  N  N   . SER A  1  279 ? -24.377 19.286  -10.471 1.00 28.45  ? 279 SER A N   1 
ATOM   2147  C  CA  . SER A  1  279 ? -23.044 19.067  -10.966 1.00 28.74  ? 279 SER A CA  1 
ATOM   2148  C  C   . SER A  1  279 ? -22.049 20.011  -10.293 1.00 28.36  ? 279 SER A C   1 
ATOM   2149  O  O   . SER A  1  279 ? -21.028 19.569  -9.782  1.00 32.95  ? 279 SER A O   1 
ATOM   2150  C  CB  . SER A  1  279 ? -22.991 19.302  -12.483 1.00 29.21  ? 279 SER A CB  1 
ATOM   2151  O  OG  . SER A  1  279 ? -23.977 18.564  -13.165 1.00 28.28  ? 279 SER A OG  1 
ATOM   2152  N  N   . ILE A  1  280 ? -22.348 21.305  -10.292 1.00 27.72  ? 280 ILE A N   1 
ATOM   2153  C  CA  . ILE A  1  280 ? -21.493 22.297  -9.616  1.00 26.98  ? 280 ILE A CA  1 
ATOM   2154  C  C   . ILE A  1  280 ? -21.243 21.914  -8.150  1.00 28.75  ? 280 ILE A C   1 
ATOM   2155  O  O   . ILE A  1  280 ? -20.136 22.116  -7.639  1.00 28.71  ? 280 ILE A O   1 
ATOM   2156  C  CB  . ILE A  1  280 ? -22.113 23.713  -9.651  1.00 25.62  ? 280 ILE A CB  1 
ATOM   2157  C  CG1 . ILE A  1  280 ? -22.005 24.294  -11.043 1.00 23.82  ? 280 ILE A CG1 1 
ATOM   2158  C  CG2 . ILE A  1  280 ? -21.420 24.653  -8.657  1.00 26.50  ? 280 ILE A CG2 1 
ATOM   2159  C  CD1 . ILE A  1  280 ? -22.888 25.468  -11.270 1.00 23.20  ? 280 ILE A CD1 1 
ATOM   2160  N  N   . GLY A  1  281 ? -22.292 21.422  -7.482  1.00 28.13  ? 281 GLY A N   1 
ATOM   2161  C  CA  . GLY A  1  281 ? -22.208 20.981  -6.098  1.00 28.03  ? 281 GLY A CA  1 
ATOM   2162  C  C   . GLY A  1  281 ? -21.295 19.786  -5.962  1.00 30.00  ? 281 GLY A C   1 
ATOM   2163  O  O   . GLY A  1  281 ? -20.492 19.732  -5.028  1.00 33.49  ? 281 GLY A O   1 
ATOM   2164  N  N   . PHE A  1  282 ? -21.381 18.851  -6.901  1.00 28.12  ? 282 PHE A N   1 
ATOM   2165  C  CA  . PHE A  1  282 ? -20.534 17.670  -6.883  1.00 32.19  ? 282 PHE A CA  1 
ATOM   2166  C  C   . PHE A  1  282 ? -19.059 18.003  -7.198  1.00 29.58  ? 282 PHE A C   1 
ATOM   2167  O  O   . PHE A  1  282 ? -18.170 17.568  -6.513  1.00 27.16  ? 282 PHE A O   1 
ATOM   2168  C  CB  . PHE A  1  282 ? -21.057 16.598  -7.856  1.00 37.27  ? 282 PHE A CB  1 
ATOM   2169  C  CG  . PHE A  1  282 ? -20.194 15.389  -7.897  1.00 48.19  ? 282 PHE A CG  1 
ATOM   2170  C  CD1 . PHE A  1  282 ? -20.277 14.424  -6.882  1.00 58.56  ? 282 PHE A CD1 1 
ATOM   2171  C  CD2 . PHE A  1  282 ? -19.219 15.225  -8.907  1.00 57.49  ? 282 PHE A CD2 1 
ATOM   2172  C  CE1 . PHE A  1  282 ? -19.424 13.294  -6.894  1.00 61.70  ? 282 PHE A CE1 1 
ATOM   2173  C  CE2 . PHE A  1  282 ? -18.359 14.109  -8.917  1.00 59.37  ? 282 PHE A CE2 1 
ATOM   2174  C  CZ  . PHE A  1  282 ? -18.463 13.145  -7.907  1.00 61.69  ? 282 PHE A CZ  1 
ATOM   2175  N  N   . LEU A  1  283 ? -18.823 18.748  -8.257  1.00 27.29  ? 283 LEU A N   1 
ATOM   2176  C  CA  . LEU A  1  283 ? -17.471 19.099  -8.652  1.00 29.75  ? 283 LEU A CA  1 
ATOM   2177  C  C   . LEU A  1  283 ? -16.770 19.985  -7.623  1.00 30.37  ? 283 LEU A C   1 
ATOM   2178  O  O   . LEU A  1  283 ? -15.519 19.967  -7.484  1.00 31.40  ? 283 LEU A O   1 
ATOM   2179  C  CB  . LEU A  1  283 ? -17.489 19.810  -10.010 1.00 29.32  ? 283 LEU A CB  1 
ATOM   2180  C  CG  . LEU A  1  283 ? -17.869 18.900  -11.174 1.00 30.01  ? 283 LEU A CG  1 
ATOM   2181  C  CD1 . LEU A  1  283 ? -18.245 19.717  -12.370 1.00 30.30  ? 283 LEU A CD1 1 
ATOM   2182  C  CD2 . LEU A  1  283 ? -16.714 17.983  -11.542 1.00 31.28  ? 283 LEU A CD2 1 
ATOM   2183  N  N   . GLY A  1  284 ? -17.573 20.736  -6.883  1.00 28.08  ? 284 GLY A N   1 
ATOM   2184  C  CA  . GLY A  1  284 ? -17.042 21.691  -5.937  1.00 28.46  ? 284 GLY A CA  1 
ATOM   2185  C  C   . GLY A  1  284 ? -16.373 21.050  -4.748  1.00 26.04  ? 284 GLY A C   1 
ATOM   2186  O  O   . GLY A  1  284 ? -15.721 21.765  -3.983  1.00 22.00  ? 284 GLY A O   1 
ATOM   2187  N  N   . PHE A  1  285 ? -16.543 19.717  -4.613  1.00 25.35  ? 285 PHE A N   1 
ATOM   2188  C  CA  . PHE A  1  285 ? -15.864 18.891  -3.584  1.00 25.44  ? 285 PHE A CA  1 
ATOM   2189  C  C   . PHE A  1  285 ? -14.543 18.295  -3.973  1.00 25.80  ? 285 PHE A C   1 
ATOM   2190  O  O   . PHE A  1  285 ? -13.879 17.751  -3.113  1.00 26.76  ? 285 PHE A O   1 
ATOM   2191  C  CB  . PHE A  1  285 ? -16.761 17.734  -3.076  1.00 24.62  ? 285 PHE A CB  1 
ATOM   2192  C  CG  . PHE A  1  285 ? -17.650 18.160  -1.989  1.00 23.94  ? 285 PHE A CG  1 
ATOM   2193  C  CD1 . PHE A  1  285 ? -17.140 18.352  -0.730  1.00 24.00  ? 285 PHE A CD1 1 
ATOM   2194  C  CD2 . PHE A  1  285 ? -18.969 18.502  -2.241  1.00 23.52  ? 285 PHE A CD2 1 
ATOM   2195  C  CE1 . PHE A  1  285 ? -17.940 18.838  0.285   1.00 24.34  ? 285 PHE A CE1 1 
ATOM   2196  C  CE2 . PHE A  1  285 ? -19.782 18.969  -1.224  1.00 23.61  ? 285 PHE A CE2 1 
ATOM   2197  C  CZ  . PHE A  1  285 ? -19.266 19.138  0.047   1.00 24.00  ? 285 PHE A CZ  1 
ATOM   2198  N  N   . ILE A  1  286 ? -14.170 18.364  -5.242  1.00 26.83  ? 286 ILE A N   1 
ATOM   2199  C  CA  . ILE A  1  286 ? -12.980 17.649  -5.688  1.00 27.61  ? 286 ILE A CA  1 
ATOM   2200  C  C   . ILE A  1  286 ? -11.894 18.559  -6.318  1.00 29.27  ? 286 ILE A C   1 
ATOM   2201  O  O   . ILE A  1  286 ? -11.021 18.037  -7.045  1.00 29.88  ? 286 ILE A O   1 
ATOM   2202  C  CB  . ILE A  1  286 ? -13.365 16.510  -6.636  1.00 26.29  ? 286 ILE A CB  1 
ATOM   2203  C  CG1 . ILE A  1  286 ? -13.968 17.017  -7.945  1.00 27.55  ? 286 ILE A CG1 1 
ATOM   2204  C  CG2 . ILE A  1  286 ? -14.362 15.599  -5.975  1.00 27.41  ? 286 ILE A CG2 1 
ATOM   2205  C  CD1 . ILE A  1  286 ? -14.106 15.906  -8.986  1.00 28.05  ? 286 ILE A CD1 1 
ATOM   2206  N  N   . VAL A  1  287 ? -11.958 19.870  -6.018  1.00 24.43  ? 287 VAL A N   1 
ATOM   2207  C  CA  . VAL A  1  287 ? -11.140 20.886  -6.668  1.00 24.50  ? 287 VAL A CA  1 
ATOM   2208  C  C   . VAL A  1  287 ? -10.241 21.759  -5.712  1.00 23.71  ? 287 VAL A C   1 
ATOM   2209  O  O   . VAL A  1  287 ? -9.518  22.664  -6.168  1.00 22.88  ? 287 VAL A O   1 
ATOM   2210  C  CB  . VAL A  1  287 ? -12.018 21.820  -7.576  1.00 23.08  ? 287 VAL A CB  1 
ATOM   2211  C  CG1 . VAL A  1  287 ? -12.658 21.033  -8.692  1.00 22.83  ? 287 VAL A CG1 1 
ATOM   2212  C  CG2 . VAL A  1  287 ? -13.065 22.598  -6.807  1.00 23.57  ? 287 VAL A CG2 1 
ATOM   2213  N  N   . TRP A  1  288 ? -10.291 21.464  -4.417  1.00 20.81  ? 288 TRP A N   1 
ATOM   2214  C  CA  . TRP A  1  288 ? -9.846  22.342  -3.377  1.00 21.37  ? 288 TRP A CA  1 
ATOM   2215  C  C   . TRP A  1  288 ? -8.389  22.761  -3.465  1.00 23.52  ? 288 TRP A C   1 
ATOM   2216  O  O   . TRP A  1  288 ? -8.060  23.821  -2.981  1.00 25.70  ? 288 TRP A O   1 
ATOM   2217  C  CB  . TRP A  1  288 ? -10.115 21.738  -1.986  1.00 21.55  ? 288 TRP A CB  1 
ATOM   2218  C  CG  . TRP A  1  288 ? -9.188  20.673  -1.599  1.00 22.39  ? 288 TRP A CG  1 
ATOM   2219  C  CD1 . TRP A  1  288 ? -8.036  20.826  -0.925  1.00 23.42  ? 288 TRP A CD1 1 
ATOM   2220  C  CD2 . TRP A  1  288 ? -9.323  19.267  -1.848  1.00 23.35  ? 288 TRP A CD2 1 
ATOM   2221  N  NE1 . TRP A  1  288 ? -7.430  19.618  -0.754  1.00 22.66  ? 288 TRP A NE1 1 
ATOM   2222  C  CE2 . TRP A  1  288 ? -8.193  18.648  -1.326  1.00 23.34  ? 288 TRP A CE2 1 
ATOM   2223  C  CE3 . TRP A  1  288 ? -10.311 18.468  -2.440  1.00 24.57  ? 288 TRP A CE3 1 
ATOM   2224  C  CZ2 . TRP A  1  288 ? -8.012  17.266  -1.366  1.00 25.62  ? 288 TRP A CZ2 1 
ATOM   2225  C  CZ3 . TRP A  1  288 ? -10.107 17.085  -2.518  1.00 24.97  ? 288 TRP A CZ3 1 
ATOM   2226  C  CH2 . TRP A  1  288 ? -8.982  16.502  -1.973  1.00 25.32  ? 288 TRP A CH2 1 
ATOM   2227  N  N   . ALA A  1  289 ? -7.524  21.955  -4.083  1.00 24.47  ? 289 ALA A N   1 
ATOM   2228  C  CA  . ALA A  1  289 ? -6.105  22.180  -4.033  1.00 23.38  ? 289 ALA A CA  1 
ATOM   2229  C  C   . ALA A  1  289 ? -5.654  23.255  -5.002  1.00 25.16  ? 289 ALA A C   1 
ATOM   2230  O  O   . ALA A  1  289 ? -4.473  23.663  -4.949  1.00 25.71  ? 289 ALA A O   1 
ATOM   2231  C  CB  . ALA A  1  289 ? -5.350  20.888  -4.257  1.00 24.42  ? 289 ALA A CB  1 
ATOM   2232  N  N   . HIS A  1  290 ? -6.572  23.792  -5.821  1.00 25.55  ? 290 HIS A N   1 
ATOM   2233  C  CA  . HIS A  1  290 ? -6.258  25.028  -6.626  1.00 25.28  ? 290 HIS A CA  1 
ATOM   2234  C  C   . HIS A  1  290 ? -5.961  26.277  -5.780  1.00 24.63  ? 290 HIS A C   1 
ATOM   2235  O  O   . HIS A  1  290 ? -5.472  27.279  -6.319  1.00 24.08  ? 290 HIS A O   1 
ATOM   2236  C  CB  . HIS A  1  290 ? -7.290  25.354  -7.762  1.00 24.20  ? 290 HIS A CB  1 
ATOM   2237  C  CG  . HIS A  1  290 ? -8.701  25.620  -7.299  1.00 24.12  ? 290 HIS A CG  1 
ATOM   2238  N  ND1 . HIS A  1  290 ? -9.795  25.074  -7.938  1.00 23.39  ? 290 HIS A ND1 1 
ATOM   2239  C  CD2 . HIS A  1  290 ? -9.201  26.383  -6.289  1.00 24.48  ? 290 HIS A CD2 1 
ATOM   2240  C  CE1 . HIS A  1  290 ? -10.906 25.492  -7.338  1.00 25.38  ? 290 HIS A CE1 1 
ATOM   2241  N  NE2 . HIS A  1  290 ? -10.582 26.282  -6.329  1.00 24.05  ? 290 HIS A NE2 1 
ATOM   2242  N  N   . HIS A  1  291 ? -6.262  26.205  -4.479  1.00 25.14  ? 291 HIS A N   1 
ATOM   2243  C  CA  . HIS A  1  291 ? -5.846  27.199  -3.479  1.00 25.38  ? 291 HIS A CA  1 
ATOM   2244  C  C   . HIS A  1  291 ? -4.434  26.940  -2.893  1.00 25.44  ? 291 HIS A C   1 
ATOM   2245  O  O   . HIS A  1  291 ? -4.003  27.684  -1.977  1.00 21.68  ? 291 HIS A O   1 
ATOM   2246  C  CB  . HIS A  1  291 ? -6.869  27.245  -2.346  1.00 25.00  ? 291 HIS A CB  1 
ATOM   2247  C  CG  . HIS A  1  291 ? -8.231  27.628  -2.815  1.00 26.91  ? 291 HIS A CG  1 
ATOM   2248  N  ND1 . HIS A  1  291 ? -8.603  28.936  -3.007  1.00 27.54  ? 291 HIS A ND1 1 
ATOM   2249  C  CD2 . HIS A  1  291 ? -9.310  26.880  -3.145  1.00 28.60  ? 291 HIS A CD2 1 
ATOM   2250  C  CE1 . HIS A  1  291 ? -9.840  28.981  -3.464  1.00 28.35  ? 291 HIS A CE1 1 
ATOM   2251  N  NE2 . HIS A  1  291 ? -10.302 27.748  -3.535  1.00 29.45  ? 291 HIS A NE2 1 
ATOM   2252  N  N   . MET A  1  292 ? -3.754  25.900  -3.413  1.00 24.78  ? 292 MET A N   1 
ATOM   2253  C  CA  . MET A  1  292 ? -2.496  25.390  -2.873  1.00 26.08  ? 292 MET A CA  1 
ATOM   2254  C  C   . MET A  1  292 ? -1.477  25.076  -3.984  1.00 28.07  ? 292 MET A C   1 
ATOM   2255  O  O   . MET A  1  292 ? -0.592  24.220  -3.805  1.00 30.86  ? 292 MET A O   1 
ATOM   2256  C  CB  . MET A  1  292 ? -2.761  24.127  -2.062  1.00 25.82  ? 292 MET A CB  1 
ATOM   2257  C  CG  . MET A  1  292 ? -3.686  24.374  -0.899  1.00 27.46  ? 292 MET A CG  1 
ATOM   2258  S  SD  . MET A  1  292 ? -4.237  22.938  -0.011  1.00 27.04  ? 292 MET A SD  1 
ATOM   2259  C  CE  . MET A  1  292 ? -2.693  22.158  0.465   1.00 27.62  ? 292 MET A CE  1 
ATOM   2260  N  N   . PHE A  1  293 ? -1.569  25.780  -5.112  1.00 25.97  ? 293 PHE A N   1 
ATOM   2261  C  CA  . PHE A  1  293 ? -0.687  25.524  -6.247  1.00 26.29  ? 293 PHE A CA  1 
ATOM   2262  C  C   . PHE A  1  293 ? 0.804   25.941  -6.048  1.00 26.68  ? 293 PHE A C   1 
ATOM   2263  O  O   . PHE A  1  293 ? 1.641   25.606  -6.890  1.00 27.11  ? 293 PHE A O   1 
ATOM   2264  C  CB  . PHE A  1  293 ? -1.230  26.199  -7.516  1.00 25.37  ? 293 PHE A CB  1 
ATOM   2265  C  CG  . PHE A  1  293 ? -2.389  25.494  -8.176  1.00 25.45  ? 293 PHE A CG  1 
ATOM   2266  C  CD1 . PHE A  1  293 ? -2.531  24.108  -8.154  1.00 25.39  ? 293 PHE A CD1 1 
ATOM   2267  C  CD2 . PHE A  1  293 ? -3.314  26.238  -8.907  1.00 25.38  ? 293 PHE A CD2 1 
ATOM   2268  C  CE1 . PHE A  1  293 ? -3.582  23.496  -8.827  1.00 25.54  ? 293 PHE A CE1 1 
ATOM   2269  C  CE2 . PHE A  1  293 ? -4.360  25.622  -9.576  1.00 25.17  ? 293 PHE A CE2 1 
ATOM   2270  C  CZ  . PHE A  1  293 ? -4.479  24.247  -9.549  1.00 24.94  ? 293 PHE A CZ  1 
ATOM   2271  N  N   . THR A  1  294 ? 1.116   26.676  -4.981  1.00 25.46  ? 294 THR A N   1 
ATOM   2272  C  CA  . THR A  1  294 ? 2.484   27.091  -4.694  1.00 27.01  ? 294 THR A CA  1 
ATOM   2273  C  C   . THR A  1  294 ? 3.098   26.467  -3.417  1.00 28.78  ? 294 THR A C   1 
ATOM   2274  O  O   . THR A  1  294 ? 4.110   26.950  -2.961  1.00 35.14  ? 294 THR A O   1 
ATOM   2275  C  CB  . THR A  1  294 ? 2.554   28.644  -4.521  1.00 26.07  ? 294 THR A CB  1 
ATOM   2276  O  OG1 . THR A  1  294 ? 1.833   29.045  -3.352  1.00 25.25  ? 294 THR A OG1 1 
ATOM   2277  C  CG2 . THR A  1  294 ? 2.006   29.371  -5.735  1.00 24.21  ? 294 THR A CG2 1 
ATOM   2278  N  N   . VAL A  1  295 ? 2.493   25.435  -2.830  1.00 27.88  ? 295 VAL A N   1 
ATOM   2279  C  CA  . VAL A  1  295 ? 2.929   24.895  -1.531  1.00 26.57  ? 295 VAL A CA  1 
ATOM   2280  C  C   . VAL A  1  295 ? 3.904   23.746  -1.739  1.00 27.28  ? 295 VAL A C   1 
ATOM   2281  O  O   . VAL A  1  295 ? 4.481   23.245  -0.752  1.00 24.74  ? 295 VAL A O   1 
ATOM   2282  C  CB  . VAL A  1  295 ? 1.731   24.439  -0.636  1.00 26.90  ? 295 VAL A CB  1 
ATOM   2283  C  CG1 . VAL A  1  295 ? 0.627   25.483  -0.690  1.00 28.06  ? 295 VAL A CG1 1 
ATOM   2284  C  CG2 . VAL A  1  295 ? 1.145   23.074  -1.033  1.00 25.36  ? 295 VAL A CG2 1 
ATOM   2285  N  N   . GLY A  1  296 ? 4.057   23.315  -2.999  1.00 26.25  ? 296 GLY A N   1 
ATOM   2286  C  CA  . GLY A  1  296 ? 4.987   22.245  -3.351  1.00 28.01  ? 296 GLY A CA  1 
ATOM   2287  C  C   . GLY A  1  296 ? 4.430   20.838  -3.446  1.00 28.22  ? 296 GLY A C   1 
ATOM   2288  O  O   . GLY A  1  296 ? 5.096   19.873  -3.127  1.00 31.00  ? 296 GLY A O   1 
ATOM   2289  N  N   . MET A  1  297 ? 3.226   20.714  -3.942  1.00 29.56  ? 297 MET A N   1 
ATOM   2290  C  CA  . MET A  1  297 ? 2.650   19.425  -4.226  1.00 31.55  ? 297 MET A CA  1 
ATOM   2291  C  C   . MET A  1  297 ? 3.217   18.950  -5.534  1.00 30.77  ? 297 MET A C   1 
ATOM   2292  O  O   . MET A  1  297 ? 3.779   19.746  -6.299  1.00 32.57  ? 297 MET A O   1 
ATOM   2293  C  CB  . MET A  1  297 ? 1.132   19.569  -4.376  1.00 33.81  ? 297 MET A CB  1 
ATOM   2294  C  CG  . MET A  1  297 ? 0.443   20.040  -3.113  1.00 37.02  ? 297 MET A CG  1 
ATOM   2295  S  SD  . MET A  1  297 ? -1.336  19.884  -3.258  1.00 39.17  ? 297 MET A SD  1 
ATOM   2296  C  CE  . MET A  1  297 ? -1.753  21.228  -4.367  1.00 38.31  ? 297 MET A CE  1 
ATOM   2297  N  N   . ASP A  1  298 ? 2.991   17.674  -5.809  1.00 33.21  ? 298 ASP A N   1 
ATOM   2298  C  CA  . ASP A  1  298 ? 3.448   16.977  -7.014  1.00 36.10  ? 298 ASP A CA  1 
ATOM   2299  C  C   . ASP A  1  298 ? 2.798   17.546  -8.270  1.00 34.62  ? 298 ASP A C   1 
ATOM   2300  O  O   . ASP A  1  298 ? 1.633   17.988  -8.280  1.00 32.70  ? 298 ASP A O   1 
ATOM   2301  C  CB  . ASP A  1  298 ? 3.127   15.464  -6.925  1.00 46.07  ? 298 ASP A CB  1 
ATOM   2302  C  CG  . ASP A  1  298 ? 3.812   14.783  -5.710  1.00 59.92  ? 298 ASP A CG  1 
ATOM   2303  O  OD1 . ASP A  1  298 ? 4.816   15.332  -5.181  1.00 67.72  ? 298 ASP A OD1 1 
ATOM   2304  O  OD2 . ASP A  1  298 ? 3.340   13.712  -5.256  1.00 70.64  ? 298 ASP A OD2 1 
ATOM   2305  N  N   . VAL A  1  299 ? 3.562   17.501  -9.345  1.00 33.32  ? 299 VAL A N   1 
ATOM   2306  C  CA  . VAL A  1  299 ? 3.121   17.993  -10.636 1.00 34.34  ? 299 VAL A CA  1 
ATOM   2307  C  C   . VAL A  1  299 ? 1.849   17.255  -11.079 1.00 34.13  ? 299 VAL A C   1 
ATOM   2308  O  O   . VAL A  1  299 ? 0.907   17.880  -11.570 1.00 34.65  ? 299 VAL A O   1 
ATOM   2309  C  CB  . VAL A  1  299 ? 4.290   17.997  -11.688 1.00 30.76  ? 299 VAL A CB  1 
ATOM   2310  C  CG1 . VAL A  1  299 ? 4.720   16.625  -12.087 1.00 31.55  ? 299 VAL A CG1 1 
ATOM   2311  C  CG2 . VAL A  1  299 ? 3.929   18.773  -12.924 1.00 31.71  ? 299 VAL A CG2 1 
ATOM   2312  N  N   . ASP A  1  300 ? 1.804   15.944  -10.868 1.00 35.29  ? 300 ASP A N   1 
ATOM   2313  C  CA  . ASP A  1  300 ? 0.670   15.168  -11.322 1.00 33.48  ? 300 ASP A CA  1 
ATOM   2314  C  C   . ASP A  1  300 ? -0.582  15.571  -10.573 1.00 29.34  ? 300 ASP A C   1 
ATOM   2315  O  O   . ASP A  1  300 ? -1.617  15.749  -11.183 1.00 26.05  ? 300 ASP A O   1 
ATOM   2316  C  CB  . ASP A  1  300 ? 0.927   13.685  -11.148 1.00 37.64  ? 300 ASP A CB  1 
ATOM   2317  C  CG  . ASP A  1  300 ? 1.937   13.137  -12.144 1.00 43.26  ? 300 ASP A CG  1 
ATOM   2318  O  OD1 . ASP A  1  300 ? 1.946   13.582  -13.319 1.00 46.49  ? 300 ASP A OD1 1 
ATOM   2319  O  OD2 . ASP A  1  300 ? 2.692   12.220  -11.751 1.00 48.77  ? 300 ASP A OD2 1 
ATOM   2320  N  N   . THR A  1  301 ? -0.472  15.730  -9.255  1.00 28.44  ? 301 THR A N   1 
ATOM   2321  C  CA  . THR A  1  301 ? -1.569  16.246  -8.462  1.00 27.17  ? 301 THR A CA  1 
ATOM   2322  C  C   . THR A  1  301 ? -2.036  17.595  -9.009  1.00 28.84  ? 301 THR A C   1 
ATOM   2323  O  O   . THR A  1  301 ? -3.187  17.750  -9.345  1.00 28.60  ? 301 THR A O   1 
ATOM   2324  C  CB  . THR A  1  301 ? -1.181  16.414  -7.017  1.00 25.84  ? 301 THR A CB  1 
ATOM   2325  O  OG1 . THR A  1  301 ? -1.054  15.145  -6.422  1.00 23.95  ? 301 THR A OG1 1 
ATOM   2326  C  CG2 . THR A  1  301 ? -2.248  17.162  -6.262  1.00 27.40  ? 301 THR A CG2 1 
ATOM   2327  N  N   . ARG A  1  302 ? -1.115  18.546  -9.138  1.00 31.32  ? 302 ARG A N   1 
ATOM   2328  C  CA  . ARG A  1  302 ? -1.417  19.848  -9.727  1.00 30.96  ? 302 ARG A CA  1 
ATOM   2329  C  C   . ARG A  1  302 ? -2.094  19.787  -11.074 1.00 30.18  ? 302 ARG A C   1 
ATOM   2330  O  O   . ARG A  1  302 ? -2.891  20.657  -11.404 1.00 35.07  ? 302 ARG A O   1 
ATOM   2331  C  CB  . ARG A  1  302 ? -0.154  20.726  -9.780  1.00 32.45  ? 302 ARG A CB  1 
ATOM   2332  C  CG  . ARG A  1  302 ? 0.143   21.299  -8.401  1.00 33.96  ? 302 ARG A CG  1 
ATOM   2333  C  CD  . ARG A  1  302 ? 1.335   22.215  -8.344  1.00 36.15  ? 302 ARG A CD  1 
ATOM   2334  N  NE  . ARG A  1  302 ? 2.514   21.384  -8.358  1.00 39.73  ? 302 ARG A NE  1 
ATOM   2335  C  CZ  . ARG A  1  302 ? 3.562   21.529  -9.144  1.00 39.56  ? 302 ARG A CZ  1 
ATOM   2336  N  NH1 . ARG A  1  302 ? 3.673   22.571  -9.957  1.00 45.37  ? 302 ARG A NH1 1 
ATOM   2337  N  NH2 . ARG A  1  302 ? 4.532   20.627  -9.071  1.00 39.82  ? 302 ARG A NH2 1 
ATOM   2338  N  N   . ALA A  1  303 ? -1.789  18.765  -11.847 1.00 29.97  ? 303 ALA A N   1 
ATOM   2339  C  CA  . ALA A  1  303 ? -2.369  18.608  -13.176 1.00 30.18  ? 303 ALA A CA  1 
ATOM   2340  C  C   . ALA A  1  303 ? -3.827  18.128  -13.074 1.00 30.04  ? 303 ALA A C   1 
ATOM   2341  O  O   . ALA A  1  303 ? -4.720  18.601  -13.808 1.00 29.99  ? 303 ALA A O   1 
ATOM   2342  C  CB  . ALA A  1  303 ? -1.519  17.663  -14.011 1.00 29.24  ? 303 ALA A CB  1 
ATOM   2343  N  N   . TYR A  1  304 ? -4.071  17.227  -12.139 1.00 29.92  ? 304 TYR A N   1 
ATOM   2344  C  CA  . TYR A  1  304 ? -5.443  16.791  -11.857 1.00 31.42  ? 304 TYR A CA  1 
ATOM   2345  C  C   . TYR A  1  304 ? -6.329  17.995  -11.480 1.00 31.06  ? 304 TYR A C   1 
ATOM   2346  O  O   . TYR A  1  304 ? -7.353  18.247  -12.088 1.00 31.78  ? 304 TYR A O   1 
ATOM   2347  C  CB  . TYR A  1  304 ? -5.486  15.714  -10.747 1.00 31.59  ? 304 TYR A CB  1 
ATOM   2348  C  CG  . TYR A  1  304 ? -6.850  15.647  -10.170 1.00 32.85  ? 304 TYR A CG  1 
ATOM   2349  C  CD1 . TYR A  1  304 ? -7.891  15.109  -10.904 1.00 33.30  ? 304 TYR A CD1 1 
ATOM   2350  C  CD2 . TYR A  1  304 ? -7.126  16.189  -8.933  1.00 34.12  ? 304 TYR A CD2 1 
ATOM   2351  C  CE1 . TYR A  1  304 ? -9.194  15.115  -10.416 1.00 34.80  ? 304 TYR A CE1 1 
ATOM   2352  C  CE2 . TYR A  1  304 ? -8.419  16.198  -8.434  1.00 37.22  ? 304 TYR A CE2 1 
ATOM   2353  C  CZ  . TYR A  1  304 ? -9.452  15.656  -9.180  1.00 36.15  ? 304 TYR A CZ  1 
ATOM   2354  O  OH  . TYR A  1  304 ? -10.734 15.657  -8.684  1.00 37.78  ? 304 TYR A OH  1 
ATOM   2355  N  N   . PHE A  1  305 ? -5.868  18.753  -10.506 1.00 30.47  ? 305 PHE A N   1 
ATOM   2356  C  CA  . PHE A  1  305 ? -6.645  19.798  -9.898  1.00 29.27  ? 305 PHE A CA  1 
ATOM   2357  C  C   . PHE A  1  305 ? -6.918  20.974  -10.820 1.00 29.77  ? 305 PHE A C   1 
ATOM   2358  O  O   . PHE A  1  305 ? -7.964  21.622  -10.734 1.00 30.17  ? 305 PHE A O   1 
ATOM   2359  C  CB  . PHE A  1  305 ? -5.961  20.259  -8.617  1.00 29.44  ? 305 PHE A CB  1 
ATOM   2360  C  CG  . PHE A  1  305 ? -6.335  19.431  -7.410  1.00 30.44  ? 305 PHE A CG  1 
ATOM   2361  C  CD1 . PHE A  1  305 ? -7.622  19.466  -6.908  1.00 31.07  ? 305 PHE A CD1 1 
ATOM   2362  C  CD2 . PHE A  1  305 ? -5.415  18.625  -6.795  1.00 30.87  ? 305 PHE A CD2 1 
ATOM   2363  C  CE1 . PHE A  1  305 ? -7.967  18.733  -5.806  1.00 31.37  ? 305 PHE A CE1 1 
ATOM   2364  C  CE2 . PHE A  1  305 ? -5.753  17.888  -5.687  1.00 32.13  ? 305 PHE A CE2 1 
ATOM   2365  C  CZ  . PHE A  1  305 ? -7.028  17.941  -5.187  1.00 32.97  ? 305 PHE A CZ  1 
ATOM   2366  N  N   . THR A  1  306 ? -5.988  21.243  -11.713 1.00 28.80  ? 306 THR A N   1 
ATOM   2367  C  CA  . THR A  1  306 ? -6.249  22.166  -12.783 1.00 26.93  ? 306 THR A CA  1 
ATOM   2368  C  C   . THR A  1  306 ? -7.339  21.594  -13.686 1.00 25.64  ? 306 THR A C   1 
ATOM   2369  O  O   . THR A  1  306 ? -8.240  22.281  -14.111 1.00 23.36  ? 306 THR A O   1 
ATOM   2370  C  CB  . THR A  1  306 ? -4.953  22.448  -13.546 1.00 26.81  ? 306 THR A CB  1 
ATOM   2371  O  OG1 . THR A  1  306 ? -4.150  23.292  -12.733 1.00 26.01  ? 306 THR A OG1 1 
ATOM   2372  C  CG2 . THR A  1  306 ? -5.212  23.143  -14.869 1.00 27.60  ? 306 THR A CG2 1 
ATOM   2373  N  N   . SER A  1  307 ? -7.255  20.325  -13.981 1.00 27.25  ? 307 SER A N   1 
ATOM   2374  C  CA  . SER A  1  307 ? -8.173  19.744  -14.944 1.00 28.73  ? 307 SER A CA  1 
ATOM   2375  C  C   . SER A  1  307 ? -9.595  19.676  -14.411 1.00 26.70  ? 307 SER A C   1 
ATOM   2376  O  O   . SER A  1  307 ? -10.533 19.979  -15.122 1.00 26.29  ? 307 SER A O   1 
ATOM   2377  C  CB  . SER A  1  307 ? -7.683  18.347  -15.367 1.00 29.59  ? 307 SER A CB  1 
ATOM   2378  O  OG  . SER A  1  307 ? -6.546  18.527  -16.160 1.00 31.08  ? 307 SER A OG  1 
ATOM   2379  N  N   . ALA A  1  308 ? -9.722  19.237  -13.172 1.00 26.22  ? 308 ALA A N   1 
ATOM   2380  C  CA  . ALA A  1  308 ? -10.997 19.098  -12.527 1.00 27.19  ? 308 ALA A CA  1 
ATOM   2381  C  C   . ALA A  1  308 ? -11.683 20.451  -12.314 1.00 27.53  ? 308 ALA A C   1 
ATOM   2382  O  O   . ALA A  1  308 ? -12.879 20.570  -12.514 1.00 26.28  ? 308 ALA A O   1 
ATOM   2383  C  CB  . ALA A  1  308 ? -10.826 18.375  -11.208 1.00 27.00  ? 308 ALA A CB  1 
ATOM   2384  N  N   . THR A  1  309 ? -10.913 21.458  -11.920 1.00 29.50  ? 309 THR A N   1 
ATOM   2385  C  CA  . THR A  1  309 ? -11.412 22.825  -11.720 1.00 29.69  ? 309 THR A CA  1 
ATOM   2386  C  C   . THR A  1  309 ? -12.028 23.381  -13.000 1.00 31.12  ? 309 THR A C   1 
ATOM   2387  O  O   . THR A  1  309 ? -13.051 24.101  -12.959 1.00 29.55  ? 309 THR A O   1 
ATOM   2388  C  CB  . THR A  1  309 ? -10.293 23.769  -11.212 1.00 27.68  ? 309 THR A CB  1 
ATOM   2389  O  OG1 . THR A  1  309 ? -9.777  23.284  -9.967  1.00 27.40  ? 309 THR A OG1 1 
ATOM   2390  C  CG2 . THR A  1  309 ? -10.794 25.179  -11.014 1.00 27.65  ? 309 THR A CG2 1 
ATOM   2391  N  N   . MET A  1  310 ? -11.442 23.030  -14.134 1.00 29.82  ? 310 MET A N   1 
ATOM   2392  C  CA  . MET A  1  310 ? -11.977 23.556  -15.402 1.00 34.26  ? 310 MET A CA  1 
ATOM   2393  C  C   . MET A  1  310 ? -13.324 22.999  -15.858 1.00 33.09  ? 310 MET A C   1 
ATOM   2394  O  O   . MET A  1  310 ? -14.094 23.710  -16.504 1.00 35.64  ? 310 MET A O   1 
ATOM   2395  C  CB  . MET A  1  310 ? -10.923 23.466  -16.501 1.00 36.24  ? 310 MET A CB  1 
ATOM   2396  C  CG  . MET A  1  310 ? -9.871  24.515  -16.235 1.00 40.44  ? 310 MET A CG  1 
ATOM   2397  S  SD  . MET A  1  310 ? -8.899  24.974  -17.626 1.00 51.59  ? 310 MET A SD  1 
ATOM   2398  C  CE  . MET A  1  310 ? -8.600  23.361  -18.304 1.00 48.19  ? 310 MET A CE  1 
ATOM   2399  N  N   . ILE A  1  311 ? -13.610 21.756  -15.498 1.00 31.19  ? 311 ILE A N   1 
ATOM   2400  C  CA  . ILE A  1  311 ? -14.896 21.162  -15.759 1.00 32.36  ? 311 ILE A CA  1 
ATOM   2401  C  C   . ILE A  1  311 ? -16.049 22.013  -15.184 1.00 30.78  ? 311 ILE A C   1 
ATOM   2402  O  O   . ILE A  1  311 ? -17.118 22.051  -15.776 1.00 28.68  ? 311 ILE A O   1 
ATOM   2403  C  CB  . ILE A  1  311 ? -15.006 19.754  -15.147 1.00 36.01  ? 311 ILE A CB  1 
ATOM   2404  C  CG1 . ILE A  1  311 ? -13.864 18.830  -15.555 1.00 40.79  ? 311 ILE A CG1 1 
ATOM   2405  C  CG2 . ILE A  1  311 ? -16.311 19.110  -15.546 1.00 40.07  ? 311 ILE A CG2 1 
ATOM   2406  C  CD1 . ILE A  1  311 ? -13.557 18.869  -17.029 1.00 45.59  ? 311 ILE A CD1 1 
ATOM   2407  N  N   . ILE A  1  312 ? -15.837 22.693  -14.054 1.00 29.58  ? 312 ILE A N   1 
ATOM   2408  C  CA  . ILE A  1  312 ? -16.891 23.509  -13.426 1.00 32.28  ? 312 ILE A CA  1 
ATOM   2409  C  C   . ILE A  1  312 ? -17.546 24.523  -14.417 1.00 30.81  ? 312 ILE A C   1 
ATOM   2410  O  O   . ILE A  1  312 ? -18.722 24.893  -14.306 1.00 31.23  ? 312 ILE A O   1 
ATOM   2411  C  CB  . ILE A  1  312 ? -16.371 24.274  -12.196 1.00 36.10  ? 312 ILE A CB  1 
ATOM   2412  C  CG1 . ILE A  1  312 ? -15.862 23.332  -11.109 1.00 42.14  ? 312 ILE A CG1 1 
ATOM   2413  C  CG2 . ILE A  1  312 ? -17.442 25.203  -11.632 1.00 42.05  ? 312 ILE A CG2 1 
ATOM   2414  C  CD1 . ILE A  1  312 ? -16.770 23.131  -9.909  1.00 48.85  ? 312 ILE A CD1 1 
ATOM   2415  N  N   . ALA A  1  313 ? -16.778 24.980  -15.374 1.00 27.53  ? 313 ALA A N   1 
ATOM   2416  C  CA  . ALA A  1  313 ? -17.237 25.924  -16.342 1.00 27.22  ? 313 ALA A CA  1 
ATOM   2417  C  C   . ALA A  1  313 ? -18.402 25.431  -17.194 1.00 26.67  ? 313 ALA A C   1 
ATOM   2418  O  O   . ALA A  1  313 ? -19.185 26.230  -17.709 1.00 25.53  ? 313 ALA A O   1 
ATOM   2419  C  CB  . ALA A  1  313 ? -16.067 26.283  -17.247 1.00 28.37  ? 313 ALA A CB  1 
ATOM   2420  N  N   . ILE A  1  314 ? -18.475 24.128  -17.416 1.00 26.21  ? 314 ILE A N   1 
ATOM   2421  C  CA  . ILE A  1  314 ? -19.483 23.598  -18.281 1.00 27.30  ? 314 ILE A CA  1 
ATOM   2422  C  C   . ILE A  1  314 ? -20.876 23.721  -17.651 1.00 26.65  ? 314 ILE A C   1 
ATOM   2423  O  O   . ILE A  1  314 ? -21.737 24.337  -18.231 1.00 27.83  ? 314 ILE A O   1 
ATOM   2424  C  CB  . ILE A  1  314 ? -19.146 22.171  -18.700 1.00 30.96  ? 314 ILE A CB  1 
ATOM   2425  C  CG1 . ILE A  1  314 ? -17.867 22.185  -19.559 1.00 31.05  ? 314 ILE A CG1 1 
ATOM   2426  C  CG2 . ILE A  1  314 ? -20.318 21.575  -19.466 1.00 32.06  ? 314 ILE A CG2 1 
ATOM   2427  C  CD1 . ILE A  1  314 ? -17.376 20.781  -19.915 1.00 31.75  ? 314 ILE A CD1 1 
ATOM   2428  N  N   . PRO A  1  315 ? -21.105 23.143  -16.464 1.00 26.80  ? 315 PRO A N   1 
ATOM   2429  C  CA  . PRO A  1  315 ? -22.409 23.360  -15.886 1.00 25.99  ? 315 PRO A CA  1 
ATOM   2430  C  C   . PRO A  1  315 ? -22.710 24.813  -15.609 1.00 23.93  ? 315 PRO A C   1 
ATOM   2431  O  O   . PRO A  1  315 ? -23.845 25.221  -15.733 1.00 22.87  ? 315 PRO A O   1 
ATOM   2432  C  CB  . PRO A  1  315 ? -22.360 22.547  -14.597 1.00 27.87  ? 315 PRO A CB  1 
ATOM   2433  C  CG  . PRO A  1  315 ? -20.897 22.408  -14.270 1.00 29.39  ? 315 PRO A CG  1 
ATOM   2434  C  CD  . PRO A  1  315 ? -20.308 22.221  -15.631 1.00 29.20  ? 315 PRO A CD  1 
ATOM   2435  N  N   . THR A  1  316 ? -21.715 25.600  -15.264 1.00 24.49  ? 316 THR A N   1 
ATOM   2436  C  CA  . THR A  1  316 ? -21.971 27.022  -14.984 1.00 26.94  ? 316 THR A CA  1 
ATOM   2437  C  C   . THR A  1  316 ? -22.416 27.711  -16.279 1.00 27.21  ? 316 THR A C   1 
ATOM   2438  O  O   . THR A  1  316 ? -23.344 28.515  -16.260 1.00 28.19  ? 316 THR A O   1 
ATOM   2439  C  CB  . THR A  1  316 ? -20.763 27.788  -14.379 1.00 26.09  ? 316 THR A CB  1 
ATOM   2440  O  OG1 . THR A  1  316 ? -20.156 27.026  -13.352 1.00 26.10  ? 316 THR A OG1 1 
ATOM   2441  C  CG2 . THR A  1  316 ? -21.227 29.075  -13.753 1.00 27.89  ? 316 THR A CG2 1 
ATOM   2442  N  N   . GLY A  1  317 ? -21.761 27.374  -17.386 1.00 26.33  ? 317 GLY A N   1 
ATOM   2443  C  CA  . GLY A  1  317 ? -22.115 27.914  -18.674 1.00 25.73  ? 317 GLY A CA  1 
ATOM   2444  C  C   . GLY A  1  317 ? -23.567 27.679  -18.975 1.00 25.26  ? 317 GLY A C   1 
ATOM   2445  O  O   . GLY A  1  317 ? -24.245 28.572  -19.387 1.00 27.05  ? 317 GLY A O   1 
ATOM   2446  N  N   . VAL A  1  318 ? -24.045 26.477  -18.715 1.00 26.36  ? 318 VAL A N   1 
ATOM   2447  C  CA  . VAL A  1  318 ? -25.422 26.095  -18.978 1.00 26.60  ? 318 VAL A CA  1 
ATOM   2448  C  C   . VAL A  1  318 ? -26.422 27.092  -18.288 1.00 27.98  ? 318 VAL A C   1 
ATOM   2449  O  O   . VAL A  1  318 ? -27.365 27.580  -18.926 1.00 27.26  ? 318 VAL A O   1 
ATOM   2450  C  CB  . VAL A  1  318 ? -25.615 24.599  -18.566 1.00 27.50  ? 318 VAL A CB  1 
ATOM   2451  C  CG1 . VAL A  1  318 ? -27.104 24.197  -18.460 1.00 29.01  ? 318 VAL A CG1 1 
ATOM   2452  C  CG2 . VAL A  1  318 ? -24.858 23.679  -19.533 1.00 27.18  ? 318 VAL A CG2 1 
ATOM   2453  N  N   . LYS A  1  319 ? -26.166 27.429  -17.019 1.00 28.02  ? 319 LYS A N   1 
ATOM   2454  C  CA  . LYS A  1  319 ? -26.946 28.434  -16.283 1.00 28.24  ? 319 LYS A CA  1 
ATOM   2455  C  C   . LYS A  1  319 ? -26.912 29.773  -16.960 1.00 28.83  ? 319 LYS A C   1 
ATOM   2456  O  O   . LYS A  1  319 ? -27.965 30.372  -17.176 1.00 27.73  ? 319 LYS A O   1 
ATOM   2457  C  CB  . LYS A  1  319 ? -26.518 28.593  -14.815 1.00 29.29  ? 319 LYS A CB  1 
ATOM   2458  C  CG  . LYS A  1  319 ? -26.589 27.298  -14.024 1.00 30.46  ? 319 LYS A CG  1 
ATOM   2459  C  CD  . LYS A  1  319 ? -26.663 27.536  -12.523 1.00 31.77  ? 319 LYS A CD  1 
ATOM   2460  C  CE  . LYS A  1  319 ? -28.024 27.988  -12.055 1.00 33.16  ? 319 LYS A CE  1 
ATOM   2461  N  NZ  . LYS A  1  319 ? -29.113 27.089  -12.485 1.00 34.83  ? 319 LYS A NZ  1 
ATOM   2462  N  N   . VAL A  1  320 ? -25.720 30.231  -17.328 1.00 28.82  ? 320 VAL A N   1 
ATOM   2463  C  CA  . VAL A  1  320 ? -25.593 31.580  -17.895 1.00 29.75  ? 320 VAL A CA  1 
ATOM   2464  C  C   . VAL A  1  320 ? -26.399 31.653  -19.178 1.00 28.13  ? 320 VAL A C   1 
ATOM   2465  O  O   . VAL A  1  320 ? -27.165 32.569  -19.357 1.00 26.76  ? 320 VAL A O   1 
ATOM   2466  C  CB  . VAL A  1  320 ? -24.122 32.030  -18.107 1.00 29.14  ? 320 VAL A CB  1 
ATOM   2467  C  CG1 . VAL A  1  320 ? -24.051 33.402  -18.762 1.00 28.41  ? 320 VAL A CG1 1 
ATOM   2468  C  CG2 . VAL A  1  320 ? -23.439 32.100  -16.766 1.00 31.47  ? 320 VAL A CG2 1 
ATOM   2469  N  N   . PHE A  1  321 ? -26.253 30.653  -20.029 1.00 29.68  ? 321 PHE A N   1 
ATOM   2470  C  CA  . PHE A  1  321 ? -26.994 30.618  -21.283 1.00 33.41  ? 321 PHE A CA  1 
ATOM   2471  C  C   . PHE A  1  321 ? -28.493 30.418  -21.093 1.00 28.79  ? 321 PHE A C   1 
ATOM   2472  O  O   . PHE A  1  321 ? -29.269 30.913  -21.878 1.00 28.46  ? 321 PHE A O   1 
ATOM   2473  C  CB  . PHE A  1  321 ? -26.370 29.623  -22.277 1.00 37.47  ? 321 PHE A CB  1 
ATOM   2474  C  CG  . PHE A  1  321 ? -24.989 30.039  -22.689 1.00 44.40  ? 321 PHE A CG  1 
ATOM   2475  C  CD1 . PHE A  1  321 ? -24.782 31.295  -23.269 1.00 45.31  ? 321 PHE A CD1 1 
ATOM   2476  C  CD2 . PHE A  1  321 ? -23.877 29.232  -22.419 1.00 49.90  ? 321 PHE A CD2 1 
ATOM   2477  C  CE1 . PHE A  1  321 ? -23.508 31.738  -23.598 1.00 46.72  ? 321 PHE A CE1 1 
ATOM   2478  C  CE2 . PHE A  1  321 ? -22.597 29.678  -22.748 1.00 50.09  ? 321 PHE A CE2 1 
ATOM   2479  C  CZ  . PHE A  1  321 ? -22.421 30.936  -23.335 1.00 49.77  ? 321 PHE A CZ  1 
ATOM   2480  N  N   . SER A  1  322 ? -28.883 29.738  -20.033 1.00 26.85  ? 322 SER A N   1 
ATOM   2481  C  CA  . SER A  1  322 ? -30.277 29.538  -19.758 1.00 26.96  ? 322 SER A CA  1 
ATOM   2482  C  C   . SER A  1  322 ? -30.974 30.832  -19.272 1.00 27.72  ? 322 SER A C   1 
ATOM   2483  O  O   . SER A  1  322 ? -32.157 31.041  -19.531 1.00 30.20  ? 322 SER A O   1 
ATOM   2484  C  CB  . SER A  1  322 ? -30.423 28.405  -18.762 1.00 26.56  ? 322 SER A CB  1 
ATOM   2485  O  OG  . SER A  1  322 ? -30.081 27.186  -19.370 1.00 24.60  ? 322 SER A OG  1 
ATOM   2486  N  N   . TRP A  1  323 ? -30.261 31.690  -18.568 1.00 27.85  ? 323 TRP A N   1 
ATOM   2487  C  CA  . TRP A  1  323 ? -30.791 33.013  -18.198 1.00 28.71  ? 323 TRP A CA  1 
ATOM   2488  C  C   . TRP A  1  323 ? -30.995 33.883  -19.416 1.00 30.22  ? 323 TRP A C   1 
ATOM   2489  O  O   . TRP A  1  323 ? -31.979 34.629  -19.485 1.00 35.00  ? 323 TRP A O   1 
ATOM   2490  C  CB  . TRP A  1  323 ? -29.846 33.736  -17.227 1.00 26.60  ? 323 TRP A CB  1 
ATOM   2491  C  CG  . TRP A  1  323 ? -29.820 33.084  -15.892 1.00 26.81  ? 323 TRP A CG  1 
ATOM   2492  C  CD1 . TRP A  1  323 ? -30.875 32.556  -15.223 1.00 25.76  ? 323 TRP A CD1 1 
ATOM   2493  C  CD2 . TRP A  1  323 ? -28.684 32.929  -15.046 1.00 27.46  ? 323 TRP A CD2 1 
ATOM   2494  N  NE1 . TRP A  1  323 ? -30.475 32.087  -14.016 1.00 28.67  ? 323 TRP A NE1 1 
ATOM   2495  C  CE2 . TRP A  1  323 ? -29.124 32.303  -13.877 1.00 28.73  ? 323 TRP A CE2 1 
ATOM   2496  C  CE3 . TRP A  1  323 ? -27.330 33.270  -15.164 1.00 27.52  ? 323 TRP A CE3 1 
ATOM   2497  C  CZ2 . TRP A  1  323 ? -28.236 31.952  -12.826 1.00 29.11  ? 323 TRP A CZ2 1 
ATOM   2498  C  CZ3 . TRP A  1  323 ? -26.456 32.953  -14.120 1.00 27.60  ? 323 TRP A CZ3 1 
ATOM   2499  C  CH2 . TRP A  1  323 ? -26.912 32.301  -12.971 1.00 28.26  ? 323 TRP A CH2 1 
ATOM   2500  N  N   . LEU A  1  324 ? -30.068 33.789  -20.363 1.00 28.26  ? 324 LEU A N   1 
ATOM   2501  C  CA  . LEU A  1  324 ? -30.174 34.534  -21.587 1.00 30.18  ? 324 LEU A CA  1 
ATOM   2502  C  C   . LEU A  1  324 ? -31.356 33.995  -22.406 1.00 32.10  ? 324 LEU A C   1 
ATOM   2503  O  O   . LEU A  1  324 ? -32.139 34.773  -22.985 1.00 31.40  ? 324 LEU A O   1 
ATOM   2504  C  CB  . LEU A  1  324 ? -28.861 34.473  -22.380 1.00 30.24  ? 324 LEU A CB  1 
ATOM   2505  C  CG  . LEU A  1  324 ? -27.633 35.019  -21.619 1.00 32.03  ? 324 LEU A CG  1 
ATOM   2506  C  CD1 . LEU A  1  324 ? -26.364 34.822  -22.445 1.00 32.89  ? 324 LEU A CD1 1 
ATOM   2507  C  CD2 . LEU A  1  324 ? -27.816 36.471  -21.188 1.00 32.38  ? 324 LEU A CD2 1 
ATOM   2508  N  N   . ALA A  1  325 ? -31.489 32.666  -22.428 1.00 30.26  ? 325 ALA A N   1 
ATOM   2509  C  CA  . ALA A  1  325 ? -32.581 32.003  -23.126 1.00 29.26  ? 325 ALA A CA  1 
ATOM   2510  C  C   . ALA A  1  325 ? -33.954 32.377  -22.501 1.00 29.52  ? 325 ALA A C   1 
ATOM   2511  O  O   . ALA A  1  325 ? -34.972 32.375  -23.167 1.00 31.54  ? 325 ALA A O   1 
ATOM   2512  C  CB  . ALA A  1  325 ? -32.353 30.489  -23.149 1.00 27.92  ? 325 ALA A CB  1 
ATOM   2513  N  N   . THR A  1  326 ? -33.959 32.703  -21.221 1.00 28.60  ? 326 THR A N   1 
ATOM   2514  C  CA  . THR A  1  326 ? -35.148 33.069  -20.528 1.00 27.20  ? 326 THR A CA  1 
ATOM   2515  C  C   . THR A  1  326 ? -35.533 34.483  -20.886 1.00 27.64  ? 326 THR A C   1 
ATOM   2516  O  O   . THR A  1  326 ? -36.721 34.770  -21.051 1.00 27.64  ? 326 THR A O   1 
ATOM   2517  C  CB  . THR A  1  326 ? -34.931 32.940  -19.010 1.00 27.14  ? 326 THR A CB  1 
ATOM   2518  O  OG1 . THR A  1  326 ? -34.609 31.576  -18.706 1.00 26.89  ? 326 THR A OG1 1 
ATOM   2519  C  CG2 . THR A  1  326 ? -36.193 33.321  -18.244 1.00 27.98  ? 326 THR A CG2 1 
ATOM   2520  N  N   . LEU A  1  327 ? -34.546 35.373  -20.959 1.00 27.40  ? 327 LEU A N   1 
ATOM   2521  C  CA  . LEU A  1  327 ? -34.765 36.747  -21.443 1.00 28.99  ? 327 LEU A CA  1 
ATOM   2522  C  C   . LEU A  1  327 ? -35.378 36.768  -22.856 1.00 30.25  ? 327 LEU A C   1 
ATOM   2523  O  O   . LEU A  1  327 ? -36.204 37.616  -23.157 1.00 32.06  ? 327 LEU A O   1 
ATOM   2524  C  CB  . LEU A  1  327 ? -33.436 37.495  -21.490 1.00 29.42  ? 327 LEU A CB  1 
ATOM   2525  C  CG  . LEU A  1  327 ? -32.870 37.850  -20.140 1.00 32.37  ? 327 LEU A CG  1 
ATOM   2526  C  CD1 . LEU A  1  327 ? -31.465 38.333  -20.341 1.00 34.97  ? 327 LEU A CD1 1 
ATOM   2527  C  CD2 . LEU A  1  327 ? -33.713 38.922  -19.457 1.00 33.54  ? 327 LEU A CD2 1 
ATOM   2528  N  N   . HIS A  1  328 ? -34.944 35.826  -23.699 1.00 30.49  ? 328 HIS A N   1 
ATOM   2529  C  CA  . HIS A  1  328 ? -35.321 35.726  -25.104 1.00 30.07  ? 328 HIS A CA  1 
ATOM   2530  C  C   . HIS A  1  328 ? -36.808 35.741  -25.306 1.00 30.23  ? 328 HIS A C   1 
ATOM   2531  O  O   . HIS A  1  328 ? -37.494 34.833  -24.896 1.00 30.60  ? 328 HIS A O   1 
ATOM   2532  C  CB  . HIS A  1  328 ? -34.804 34.421  -25.669 1.00 27.82  ? 328 HIS A CB  1 
ATOM   2533  C  CG  . HIS A  1  328 ? -35.020 34.258  -27.137 1.00 28.54  ? 328 HIS A CG  1 
ATOM   2534  N  ND1 . HIS A  1  328 ? -34.658 35.225  -28.053 1.00 28.62  ? 328 HIS A ND1 1 
ATOM   2535  C  CD2 . HIS A  1  328 ? -35.498 33.205  -27.853 1.00 27.34  ? 328 HIS A CD2 1 
ATOM   2536  C  CE1 . HIS A  1  328 ? -34.930 34.779  -29.271 1.00 30.28  ? 328 HIS A CE1 1 
ATOM   2537  N  NE2 . HIS A  1  328 ? -35.445 33.557  -29.173 1.00 27.33  ? 328 HIS A NE2 1 
ATOM   2538  N  N   . GLY A  1  329 ? -37.288 36.782  -25.954 1.00 31.30  ? 329 GLY A N   1 
ATOM   2539  C  CA  . GLY A  1  329 ? -38.708 36.901  -26.276 1.00 32.71  ? 329 GLY A CA  1 
ATOM   2540  C  C   . GLY A  1  329 ? -39.566 37.426  -25.155 1.00 31.32  ? 329 GLY A C   1 
ATOM   2541  O  O   . GLY A  1  329 ? -40.779 37.392  -25.244 1.00 34.06  ? 329 GLY A O   1 
ATOM   2542  N  N   . GLY A  1  330 ? -38.937 37.912  -24.095 1.00 31.58  ? 330 GLY A N   1 
ATOM   2543  C  CA  . GLY A  1  330 ? -39.642 38.344  -22.913 1.00 29.92  ? 330 GLY A CA  1 
ATOM   2544  C  C   . GLY A  1  330 ? -40.289 39.690  -23.163 1.00 29.75  ? 330 GLY A C   1 
ATOM   2545  O  O   . GLY A  1  330 ? -39.892 40.480  -24.034 1.00 26.95  ? 330 GLY A O   1 
ATOM   2546  N  N   . ASN A  1  331 ? -41.324 39.928  -22.389 1.00 29.85  ? 331 ASN A N   1 
ATOM   2547  C  CA  . ASN A  1  331 ? -41.915 41.223  -22.310 1.00 30.57  ? 331 ASN A CA  1 
ATOM   2548  C  C   . ASN A  1  331 ? -41.155 41.850  -21.149 1.00 30.58  ? 331 ASN A C   1 
ATOM   2549  O  O   . ASN A  1  331 ? -41.562 41.735  -19.975 1.00 29.57  ? 331 ASN A O   1 
ATOM   2550  C  CB  . ASN A  1  331 ? -43.420 41.116  -22.058 1.00 29.01  ? 331 ASN A CB  1 
ATOM   2551  C  CG  . ASN A  1  331 ? -44.029 42.449  -21.739 1.00 29.20  ? 331 ASN A CG  1 
ATOM   2552  O  OD1 . ASN A  1  331 ? -43.475 43.492  -22.102 1.00 29.16  ? 331 ASN A OD1 1 
ATOM   2553  N  ND2 . ASN A  1  331 ? -45.154 42.433  -21.035 1.00 28.59  ? 331 ASN A ND2 1 
ATOM   2554  N  N   . ILE A  1  332 ? -40.039 42.489  -21.485 1.00 29.93  ? 332 ILE A N   1 
ATOM   2555  C  CA  . ILE A  1  332 ? -39.054 42.876  -20.468 1.00 32.25  ? 332 ILE A CA  1 
ATOM   2556  C  C   . ILE A  1  332 ? -39.557 44.078  -19.672 1.00 33.30  ? 332 ILE A C   1 
ATOM   2557  O  O   . ILE A  1  332 ? -39.806 45.129  -20.250 1.00 32.47  ? 332 ILE A O   1 
ATOM   2558  C  CB  . ILE A  1  332 ? -37.663 43.203  -21.071 1.00 33.16  ? 332 ILE A CB  1 
ATOM   2559  C  CG1 . ILE A  1  332 ? -37.139 42.072  -21.957 1.00 36.16  ? 332 ILE A CG1 1 
ATOM   2560  C  CG2 . ILE A  1  332 ? -36.634 43.498  -19.984 1.00 34.63  ? 332 ILE A CG2 1 
ATOM   2561  C  CD1 . ILE A  1  332 ? -37.070 40.712  -21.315 1.00 37.04  ? 332 ILE A CD1 1 
ATOM   2562  N  N   . LYS A  1  333 ? -39.713 43.918  -18.354 1.00 33.66  ? 333 LYS A N   1 
ATOM   2563  C  CA  . LYS A  1  333 ? -39.933 45.057  -17.487 1.00 36.98  ? 333 LYS A CA  1 
ATOM   2564  C  C   . LYS A  1  333 ? -38.589 45.496  -16.884 1.00 36.38  ? 333 LYS A C   1 
ATOM   2565  O  O   . LYS A  1  333 ? -37.892 44.708  -16.272 1.00 41.20  ? 333 LYS A O   1 
ATOM   2566  C  CB  . LYS A  1  333 ? -40.936 44.715  -16.395 1.00 43.10  ? 333 LYS A CB  1 
ATOM   2567  C  CG  . LYS A  1  333 ? -41.585 45.962  -15.822 1.00 53.53  ? 333 LYS A CG  1 
ATOM   2568  C  CD  . LYS A  1  333 ? -42.693 45.682  -14.802 1.00 65.57  ? 333 LYS A CD  1 
ATOM   2569  C  CE  . LYS A  1  333 ? -43.021 46.927  -13.958 1.00 74.76  ? 333 LYS A CE  1 
ATOM   2570  N  NZ  . LYS A  1  333 ? -41.843 47.417  -13.158 1.00 80.99  ? 333 LYS A NZ  1 
ATOM   2571  N  N   . TRP A  1  334 ? -38.235 46.761  -17.047 1.00 34.11  ? 334 TRP A N   1 
ATOM   2572  C  CA  . TRP A  1  334 ? -36.996 47.310  -16.549 1.00 31.03  ? 334 TRP A CA  1 
ATOM   2573  C  C   . TRP A  1  334 ? -37.148 47.793  -15.115 1.00 30.14  ? 334 TRP A C   1 
ATOM   2574  O  O   . TRP A  1  334 ? -36.954 48.973  -14.758 1.00 31.45  ? 334 TRP A O   1 
ATOM   2575  C  CB  . TRP A  1  334 ? -36.550 48.438  -17.453 1.00 33.30  ? 334 TRP A CB  1 
ATOM   2576  C  CG  . TRP A  1  334 ? -36.084 47.977  -18.768 1.00 38.19  ? 334 TRP A CG  1 
ATOM   2577  C  CD1 . TRP A  1  334 ? -36.805 47.860  -19.903 1.00 42.44  ? 334 TRP A CD1 1 
ATOM   2578  C  CD2 . TRP A  1  334 ? -34.766 47.586  -19.089 1.00 42.46  ? 334 TRP A CD2 1 
ATOM   2579  N  NE1 . TRP A  1  334 ? -36.012 47.401  -20.931 1.00 43.74  ? 334 TRP A NE1 1 
ATOM   2580  C  CE2 . TRP A  1  334 ? -34.749 47.242  -20.452 1.00 43.13  ? 334 TRP A CE2 1 
ATOM   2581  C  CE3 . TRP A  1  334 ? -33.586 47.482  -18.344 1.00 51.20  ? 334 TRP A CE3 1 
ATOM   2582  C  CZ2 . TRP A  1  334 ? -33.617 46.790  -21.088 1.00 53.69  ? 334 TRP A CZ2 1 
ATOM   2583  C  CZ3 . TRP A  1  334 ? -32.435 47.042  -18.979 1.00 54.23  ? 334 TRP A CZ3 1 
ATOM   2584  C  CH2 . TRP A  1  334 ? -32.461 46.694  -20.337 1.00 58.03  ? 334 TRP A CH2 1 
ATOM   2585  N  N   . SER A  1  335 ? -37.480 46.856  -14.258 1.00 30.89  ? 335 SER A N   1 
ATOM   2586  C  CA  . SER A  1  335 ? -37.562 47.139  -12.845 1.00 30.57  ? 335 SER A CA  1 
ATOM   2587  C  C   . SER A  1  335 ? -36.124 47.224  -12.277 1.00 28.25  ? 335 SER A C   1 
ATOM   2588  O  O   . SER A  1  335 ? -35.169 46.697  -12.880 1.00 26.69  ? 335 SER A O   1 
ATOM   2589  C  CB  . SER A  1  335 ? -38.301 46.007  -12.161 1.00 33.54  ? 335 SER A CB  1 
ATOM   2590  O  OG  . SER A  1  335 ? -37.488 44.812  -12.174 1.00 39.10  ? 335 SER A OG  1 
ATOM   2591  N  N   . PRO A  1  336 ? -35.979 47.853  -11.104 1.00 25.86  ? 336 PRO A N   1 
ATOM   2592  C  CA  . PRO A  1  336 ? -34.723 47.826  -10.397 1.00 25.45  ? 336 PRO A CA  1 
ATOM   2593  C  C   . PRO A  1  336 ? -34.162 46.396  -10.246 1.00 25.80  ? 336 PRO A C   1 
ATOM   2594  O  O   . PRO A  1  336 ? -32.984 46.187  -10.513 1.00 25.68  ? 336 PRO A O   1 
ATOM   2595  C  CB  . PRO A  1  336 ? -35.083 48.383  -9.028  1.00 25.13  ? 336 PRO A CB  1 
ATOM   2596  C  CG  . PRO A  1  336 ? -36.311 49.180  -9.232  1.00 25.94  ? 336 PRO A CG  1 
ATOM   2597  C  CD  . PRO A  1  336 ? -37.040 48.565  -10.355 1.00 25.87  ? 336 PRO A CD  1 
ATOM   2598  N  N   . ALA A  1  337 ? -34.999 45.429  -9.855  1.00 27.39  ? 337 ALA A N   1 
ATOM   2599  C  CA  . ALA A  1  337 ? -34.542 44.034  -9.655  1.00 27.94  ? 337 ALA A CA  1 
ATOM   2600  C  C   . ALA A  1  337 ? -33.951 43.450  -10.919 1.00 27.79  ? 337 ALA A C   1 
ATOM   2601  O  O   . ALA A  1  337 ? -32.917 42.794  -10.887 1.00 28.01  ? 337 ALA A O   1 
ATOM   2602  C  CB  . ALA A  1  337 ? -35.665 43.165  -9.183  1.00 28.62  ? 337 ALA A CB  1 
ATOM   2603  N  N   . MET A  1  338 ? -34.593 43.740  -12.044 1.00 27.57  ? 338 MET A N   1 
ATOM   2604  C  CA  . MET A  1  338 ? -34.112 43.272  -13.310 1.00 26.94  ? 338 MET A CA  1 
ATOM   2605  C  C   . MET A  1  338 ? -32.732 43.852  -13.584 1.00 27.65  ? 338 MET A C   1 
ATOM   2606  O  O   . MET A  1  338 ? -31.933 43.220  -14.260 1.00 29.93  ? 338 MET A O   1 
ATOM   2607  C  CB  . MET A  1  338 ? -35.088 43.646  -14.451 1.00 26.07  ? 338 MET A CB  1 
ATOM   2608  C  CG  . MET A  1  338 ? -34.719 43.062  -15.820 1.00 26.37  ? 338 MET A CG  1 
ATOM   2609  S  SD  . MET A  1  338 ? -34.651 41.260  -15.728 1.00 28.20  ? 338 MET A SD  1 
ATOM   2610  C  CE  . MET A  1  338 ? -35.408 40.768  -17.270 1.00 28.82  ? 338 MET A CE  1 
ATOM   2611  N  N   . MET A  1  339 ? -32.478 45.070  -13.129 1.00 27.80  ? 339 MET A N   1 
ATOM   2612  C  CA  . MET A  1  339 ? -31.218 45.719  -13.427 1.00 29.75  ? 339 MET A CA  1 
ATOM   2613  C  C   . MET A  1  339 ? -30.088 45.036  -12.665 1.00 26.60  ? 339 MET A C   1 
ATOM   2614  O  O   . MET A  1  339 ? -29.050 44.714  -13.244 1.00 21.61  ? 339 MET A O   1 
ATOM   2615  C  CB  . MET A  1  339 ? -31.286 47.206  -13.097 1.00 34.13  ? 339 MET A CB  1 
ATOM   2616  C  CG  . MET A  1  339 ? -32.129 47.983  -14.107 1.00 38.83  ? 339 MET A CG  1 
ATOM   2617  S  SD  . MET A  1  339 ? -32.240 49.724  -13.664 1.00 40.59  ? 339 MET A SD  1 
ATOM   2618  C  CE  . MET A  1  339 ? -33.782 50.042  -14.486 1.00 45.93  ? 339 MET A CE  1 
ATOM   2619  N  N   . TRP A  1  340 ? -30.326 44.825  -11.374 1.00 25.30  ? 340 TRP A N   1 
ATOM   2620  C  CA  . TRP A  1  340 ? -29.452 44.002  -10.526 1.00 24.90  ? 340 TRP A CA  1 
ATOM   2621  C  C   . TRP A  1  340 ? -29.145 42.670  -11.193 1.00 26.12  ? 340 TRP A C   1 
ATOM   2622  O  O   . TRP A  1  340 ? -27.983 42.273  -11.305 1.00 26.32  ? 340 TRP A O   1 
ATOM   2623  C  CB  . TRP A  1  340 ? -30.086 43.794  -9.153  1.00 23.36  ? 340 TRP A CB  1 
ATOM   2624  C  CG  . TRP A  1  340 ? -30.073 45.058  -8.317  1.00 22.55  ? 340 TRP A CG  1 
ATOM   2625  C  CD1 . TRP A  1  340 ? -31.148 45.833  -7.930  1.00 22.63  ? 340 TRP A CD1 1 
ATOM   2626  C  CD2 . TRP A  1  340 ? -28.919 45.710  -7.832  1.00 22.68  ? 340 TRP A CD2 1 
ATOM   2627  N  NE1 . TRP A  1  340 ? -30.715 46.927  -7.209  1.00 22.49  ? 340 TRP A NE1 1 
ATOM   2628  C  CE2 . TRP A  1  340 ? -29.343 46.865  -7.140  1.00 23.47  ? 340 TRP A CE2 1 
ATOM   2629  C  CE3 . TRP A  1  340 ? -27.545 45.444  -7.935  1.00 24.84  ? 340 TRP A CE3 1 
ATOM   2630  C  CZ2 . TRP A  1  340 ? -28.447 47.731  -6.551  1.00 23.68  ? 340 TRP A CZ2 1 
ATOM   2631  C  CZ3 . TRP A  1  340 ? -26.656 46.290  -7.311  1.00 24.61  ? 340 TRP A CZ3 1 
ATOM   2632  C  CH2 . TRP A  1  340 ? -27.112 47.420  -6.632  1.00 24.69  ? 340 TRP A CH2 1 
ATOM   2633  N  N   . ALA A  1  341 ? -30.186 42.020  -11.701 1.00 25.97  ? 341 ALA A N   1 
ATOM   2634  C  CA  . ALA A  1  341 ? -30.050 40.717  -12.261 1.00 25.41  ? 341 ALA A CA  1 
ATOM   2635  C  C   . ALA A  1  341 ? -29.225 40.686  -13.534 1.00 25.33  ? 341 ALA A C   1 
ATOM   2636  O  O   . ALA A  1  341 ? -28.438 39.761  -13.759 1.00 25.86  ? 341 ALA A O   1 
ATOM   2637  C  CB  . ALA A  1  341 ? -31.426 40.112  -12.480 1.00 25.91  ? 341 ALA A CB  1 
ATOM   2638  N  N   . LEU A  1  342 ? -29.419 41.659  -14.398 1.00 27.08  ? 342 LEU A N   1 
ATOM   2639  C  CA  . LEU A  1  342 ? -28.634 41.729  -15.649 1.00 28.68  ? 342 LEU A CA  1 
ATOM   2640  C  C   . LEU A  1  342 ? -27.151 42.038  -15.373 1.00 29.01  ? 342 LEU A C   1 
ATOM   2641  O  O   . LEU A  1  342 ? -26.243 41.439  -15.952 1.00 27.51  ? 342 LEU A O   1 
ATOM   2642  C  CB  . LEU A  1  342 ? -29.194 42.829  -16.529 1.00 30.83  ? 342 LEU A CB  1 
ATOM   2643  C  CG  . LEU A  1  342 ? -30.586 42.555  -17.101 1.00 31.68  ? 342 LEU A CG  1 
ATOM   2644  C  CD1 . LEU A  1  342 ? -31.117 43.893  -17.614 1.00 32.86  ? 342 LEU A CD1 1 
ATOM   2645  C  CD2 . LEU A  1  342 ? -30.578 41.494  -18.198 1.00 30.91  ? 342 LEU A CD2 1 
ATOM   2646  N  N   . GLY A  1  343 ? -26.931 42.991  -14.475 1.00 28.88  ? 343 GLY A N   1 
ATOM   2647  C  CA  . GLY A  1  343 ? -25.631 43.263  -13.920 1.00 28.42  ? 343 GLY A CA  1 
ATOM   2648  C  C   . GLY A  1  343 ? -24.932 42.016  -13.430 1.00 26.61  ? 343 GLY A C   1 
ATOM   2649  O  O   . GLY A  1  343 ? -23.754 41.819  -13.717 1.00 24.93  ? 343 GLY A O   1 
ATOM   2650  N  N   . PHE A  1  344 ? -25.662 41.193  -12.685 1.00 26.42  ? 344 PHE A N   1 
ATOM   2651  C  CA  . PHE A  1  344 ? -25.155 39.910  -12.146 1.00 23.94  ? 344 PHE A CA  1 
ATOM   2652  C  C   . PHE A  1  344 ? -24.698 39.052  -13.300 1.00 26.39  ? 344 PHE A C   1 
ATOM   2653  O  O   . PHE A  1  344 ? -23.586 38.517  -13.295 1.00 26.28  ? 344 PHE A O   1 
ATOM   2654  C  CB  . PHE A  1  344 ? -26.244 39.147  -11.361 1.00 22.33  ? 344 PHE A CB  1 
ATOM   2655  C  CG  . PHE A  1  344 ? -25.826 37.760  -10.932 1.00 20.39  ? 344 PHE A CG  1 
ATOM   2656  C  CD1 . PHE A  1  344 ? -25.846 36.691  -11.815 1.00 19.89  ? 344 PHE A CD1 1 
ATOM   2657  C  CD2 . PHE A  1  344 ? -25.425 37.526  -9.638  1.00 19.93  ? 344 PHE A CD2 1 
ATOM   2658  C  CE1 . PHE A  1  344 ? -25.432 35.427  -11.407 1.00 19.74  ? 344 PHE A CE1 1 
ATOM   2659  C  CE2 . PHE A  1  344 ? -25.010 36.265  -9.224  1.00 20.25  ? 344 PHE A CE2 1 
ATOM   2660  C  CZ  . PHE A  1  344 ? -24.993 35.214  -10.117 1.00 19.10  ? 344 PHE A CZ  1 
ATOM   2661  N  N   . ILE A  1  345 ? -25.566 38.880  -14.290 1.00 27.00  ? 345 ILE A N   1 
ATOM   2662  C  CA  . ILE A  1  345 ? -25.249 37.916  -15.344 1.00 28.13  ? 345 ILE A CA  1 
ATOM   2663  C  C   . ILE A  1  345 ? -23.886 38.244  -15.980 1.00 26.19  ? 345 ILE A C   1 
ATOM   2664  O  O   . ILE A  1  345 ? -23.060 37.377  -16.273 1.00 26.58  ? 345 ILE A O   1 
ATOM   2665  C  CB  . ILE A  1  345 ? -26.389 37.805  -16.383 1.00 28.95  ? 345 ILE A CB  1 
ATOM   2666  C  CG1 . ILE A  1  345 ? -27.633 37.143  -15.761 1.00 31.33  ? 345 ILE A CG1 1 
ATOM   2667  C  CG2 . ILE A  1  345 ? -25.954 36.949  -17.563 1.00 30.58  ? 345 ILE A CG2 1 
ATOM   2668  C  CD1 . ILE A  1  345 ? -28.935 37.322  -16.535 1.00 29.56  ? 345 ILE A CD1 1 
ATOM   2669  N  N   . PHE A  1  346 ? -23.639 39.509  -16.185 1.00 27.41  ? 346 PHE A N   1 
ATOM   2670  C  CA  . PHE A  1  346 ? -22.456 39.889  -16.903 1.00 29.05  ? 346 PHE A CA  1 
ATOM   2671  C  C   . PHE A  1  346 ? -21.207 39.906  -16.017 1.00 26.73  ? 346 PHE A C   1 
ATOM   2672  O  O   . PHE A  1  346 ? -20.164 39.394  -16.403 1.00 24.32  ? 346 PHE A O   1 
ATOM   2673  C  CB  . PHE A  1  346 ? -22.658 41.228  -17.619 1.00 31.01  ? 346 PHE A CB  1 
ATOM   2674  C  CG  . PHE A  1  346 ? -21.417 41.704  -18.286 1.00 32.62  ? 346 PHE A CG  1 
ATOM   2675  C  CD1 . PHE A  1  346 ? -20.883 40.975  -19.349 1.00 33.46  ? 346 PHE A CD1 1 
ATOM   2676  C  CD2 . PHE A  1  346 ? -20.744 42.806  -17.809 1.00 32.97  ? 346 PHE A CD2 1 
ATOM   2677  C  CE1 . PHE A  1  346 ? -19.721 41.376  -19.959 1.00 34.59  ? 346 PHE A CE1 1 
ATOM   2678  C  CE2 . PHE A  1  346 ? -19.569 43.208  -18.412 1.00 35.48  ? 346 PHE A CE2 1 
ATOM   2679  C  CZ  . PHE A  1  346 ? -19.054 42.488  -19.482 1.00 34.63  ? 346 PHE A CZ  1 
ATOM   2680  N  N   . LEU A  1  347 ? -21.346 40.472  -14.830 1.00 25.11  ? 347 LEU A N   1 
ATOM   2681  C  CA  . LEU A  1  347 ? -20.233 40.661  -13.933 1.00 25.32  ? 347 LEU A CA  1 
ATOM   2682  C  C   . LEU A  1  347 ? -19.767 39.375  -13.300 1.00 25.13  ? 347 LEU A C   1 
ATOM   2683  O  O   . LEU A  1  347 ? -18.554 39.171  -13.105 1.00 27.53  ? 347 LEU A O   1 
ATOM   2684  C  CB  . LEU A  1  347 ? -20.584 41.694  -12.884 1.00 25.21  ? 347 LEU A CB  1 
ATOM   2685  C  CG  . LEU A  1  347 ? -20.891 43.043  -13.570 1.00 28.57  ? 347 LEU A CG  1 
ATOM   2686  C  CD1 . LEU A  1  347 ? -21.370 44.085  -12.545 1.00 30.05  ? 347 LEU A CD1 1 
ATOM   2687  C  CD2 . LEU A  1  347 ? -19.731 43.585  -14.400 1.00 30.16  ? 347 LEU A CD2 1 
ATOM   2688  N  N   . PHE A  1  348 ? -20.704 38.499  -12.982 1.00 24.85  ? 348 PHE A N   1 
ATOM   2689  C  CA  . PHE A  1  348 ? -20.377 37.133  -12.567 1.00 25.23  ? 348 PHE A CA  1 
ATOM   2690  C  C   . PHE A  1  348 ? -19.573 36.420  -13.631 1.00 24.50  ? 348 PHE A C   1 
ATOM   2691  O  O   . PHE A  1  348 ? -18.608 35.713  -13.335 1.00 25.08  ? 348 PHE A O   1 
ATOM   2692  C  CB  . PHE A  1  348 ? -21.643 36.302  -12.284 1.00 27.26  ? 348 PHE A CB  1 
ATOM   2693  C  CG  . PHE A  1  348 ? -21.343 34.856  -11.986 1.00 28.31  ? 348 PHE A CG  1 
ATOM   2694  C  CD1 . PHE A  1  348 ? -20.887 34.480  -10.738 1.00 30.92  ? 348 PHE A CD1 1 
ATOM   2695  C  CD2 . PHE A  1  348 ? -21.422 33.902  -12.968 1.00 27.98  ? 348 PHE A CD2 1 
ATOM   2696  C  CE1 . PHE A  1  348 ? -20.543 33.168  -10.478 1.00 29.43  ? 348 PHE A CE1 1 
ATOM   2697  C  CE2 . PHE A  1  348 ? -21.083 32.598  -12.716 1.00 28.30  ? 348 PHE A CE2 1 
ATOM   2698  C  CZ  . PHE A  1  348 ? -20.633 32.240  -11.472 1.00 29.51  ? 348 PHE A CZ  1 
ATOM   2699  N  N   . THR A  1  349 ? -19.999 36.569  -14.874 1.00 24.80  ? 349 THR A N   1 
ATOM   2700  C  CA  . THR A  1  349 ? -19.307 35.919  -15.989 1.00 25.65  ? 349 THR A CA  1 
ATOM   2701  C  C   . THR A  1  349 ? -17.842 36.365  -16.081 1.00 25.92  ? 349 THR A C   1 
ATOM   2702  O  O   . THR A  1  349 ? -16.970 35.526  -16.247 1.00 24.80  ? 349 THR A O   1 
ATOM   2703  C  CB  . THR A  1  349 ? -20.065 36.105  -17.312 1.00 25.55  ? 349 THR A CB  1 
ATOM   2704  O  OG1 . THR A  1  349 ? -21.320 35.451  -17.181 1.00 26.56  ? 349 THR A OG1 1 
ATOM   2705  C  CG2 . THR A  1  349 ? -19.316 35.475  -18.511 1.00 25.97  ? 349 THR A CG2 1 
ATOM   2706  N  N   . VAL A  1  350 ? -17.590 37.664  -15.896 1.00 26.32  ? 350 VAL A N   1 
ATOM   2707  C  CA  . VAL A  1  350 ? -16.250 38.206  -15.924 1.00 26.59  ? 350 VAL A CA  1 
ATOM   2708  C  C   . VAL A  1  350 ? -15.411 37.615  -14.808 1.00 26.55  ? 350 VAL A C   1 
ATOM   2709  O  O   . VAL A  1  350 ? -14.321 37.107  -15.064 1.00 27.26  ? 350 VAL A O   1 
ATOM   2710  C  CB  . VAL A  1  350 ? -16.253 39.743  -15.845 1.00 27.76  ? 350 VAL A CB  1 
ATOM   2711  C  CG1 . VAL A  1  350 ? -14.834 40.270  -15.642 1.00 29.08  ? 350 VAL A CG1 1 
ATOM   2712  C  CG2 . VAL A  1  350 ? -16.822 40.296  -17.141 1.00 29.46  ? 350 VAL A CG2 1 
ATOM   2713  N  N   . GLY A  1  351 ? -15.923 37.676  -13.581 1.00 27.03  ? 351 GLY A N   1 
ATOM   2714  C  CA  . GLY A  1  351 ? -15.269 37.028  -12.431 1.00 26.23  ? 351 GLY A CA  1 
ATOM   2715  C  C   . GLY A  1  351 ? -15.037 35.531  -12.571 1.00 25.15  ? 351 GLY A C   1 
ATOM   2716  O  O   . GLY A  1  351 ? -14.033 35.001  -12.098 1.00 29.00  ? 351 GLY A O   1 
ATOM   2717  N  N   . GLY A  1  352 ? -15.969 34.850  -13.211 1.00 25.34  ? 352 GLY A N   1 
ATOM   2718  C  CA  . GLY A  1  352 ? -15.841 33.436  -13.466 1.00 25.81  ? 352 GLY A CA  1 
ATOM   2719  C  C   . GLY A  1  352 ? -14.768 33.120  -14.464 1.00 24.54  ? 352 GLY A C   1 
ATOM   2720  O  O   . GLY A  1  352 ? -14.079 32.104  -14.357 1.00 23.72  ? 352 GLY A O   1 
ATOM   2721  N  N   . LEU A  1  353 ? -14.660 33.970  -15.464 1.00 25.36  ? 353 LEU A N   1 
ATOM   2722  C  CA  . LEU A  1  353 ? -13.614 33.821  -16.450 1.00 26.90  ? 353 LEU A CA  1 
ATOM   2723  C  C   . LEU A  1  353 ? -12.233 34.073  -15.878 1.00 27.84  ? 353 LEU A C   1 
ATOM   2724  O  O   . LEU A  1  353 ? -11.279 33.442  -16.316 1.00 29.14  ? 353 LEU A O   1 
ATOM   2725  C  CB  . LEU A  1  353 ? -13.825 34.714  -17.647 1.00 27.02  ? 353 LEU A CB  1 
ATOM   2726  C  CG  . LEU A  1  353 ? -15.019 34.313  -18.515 1.00 28.41  ? 353 LEU A CG  1 
ATOM   2727  C  CD1 . LEU A  1  353 ? -15.270 35.417  -19.529 1.00 30.59  ? 353 LEU A CD1 1 
ATOM   2728  C  CD2 . LEU A  1  353 ? -14.819 32.996  -19.220 1.00 28.74  ? 353 LEU A CD2 1 
ATOM   2729  N  N   . THR A  1  354 ? -12.089 34.989  -14.927 1.00 27.98  ? 354 THR A N   1 
ATOM   2730  C  CA  . THR A  1  354 ? -10.770 35.177  -14.323 1.00 27.77  ? 354 THR A CA  1 
ATOM   2731  C  C   . THR A  1  354 ? -10.433 33.993  -13.373 1.00 28.39  ? 354 THR A C   1 
ATOM   2732  O  O   . THR A  1  354 ? -9.281  33.741  -13.067 1.00 27.26  ? 354 THR A O   1 
ATOM   2733  C  CB  . THR A  1  354 ? -10.614 36.549  -13.643 1.00 27.32  ? 354 THR A CB  1 
ATOM   2734  O  OG1 . THR A  1  354 ? -11.599 36.718  -12.606 1.00 26.04  ? 354 THR A OG1 1 
ATOM   2735  C  CG2 . THR A  1  354 ? -10.724 37.662  -14.680 1.00 26.86  ? 354 THR A CG2 1 
ATOM   2736  N  N   . GLY A  1  355 ? -11.441 33.267  -12.921 1.00 27.86  ? 355 GLY A N   1 
ATOM   2737  C  CA  . GLY A  1  355 ? -11.209 32.051  -12.163 1.00 28.02  ? 355 GLY A CA  1 
ATOM   2738  C  C   . GLY A  1  355 ? -10.649 30.939  -12.991 1.00 27.38  ? 355 GLY A C   1 
ATOM   2739  O  O   . GLY A  1  355 ? -9.856  30.141  -12.512 1.00 26.75  ? 355 GLY A O   1 
ATOM   2740  N  N   . ILE A  1  356 ? -11.102 30.873  -14.233 1.00 29.01  ? 356 ILE A N   1 
ATOM   2741  C  CA  . ILE A  1  356 ? -10.562 29.927  -15.208 1.00 29.83  ? 356 ILE A CA  1 
ATOM   2742  C  C   . ILE A  1  356 ? -9.112  30.211  -15.495 1.00 28.75  ? 356 ILE A C   1 
ATOM   2743  O  O   . ILE A  1  356 ? -8.316  29.269  -15.639 1.00 32.81  ? 356 ILE A O   1 
ATOM   2744  C  CB  . ILE A  1  356 ? -11.405 29.936  -16.503 1.00 32.66  ? 356 ILE A CB  1 
ATOM   2745  C  CG1 . ILE A  1  356 ? -12.739 29.215  -16.244 1.00 37.47  ? 356 ILE A CG1 1 
ATOM   2746  C  CG2 . ILE A  1  356 ? -10.700 29.285  -17.674 1.00 32.49  ? 356 ILE A CG2 1 
ATOM   2747  C  CD1 . ILE A  1  356 ? -12.622 27.770  -15.761 1.00 35.67  ? 356 ILE A CD1 1 
ATOM   2748  N  N   . VAL A  1  357 ? -8.757  31.489  -15.567 1.00 26.73  ? 357 VAL A N   1 
ATOM   2749  C  CA  . VAL A  1  357 ? -7.356  31.859  -15.758 1.00 26.67  ? 357 VAL A CA  1 
ATOM   2750  C  C   . VAL A  1  357 ? -6.513  31.282  -14.615 1.00 26.28  ? 357 VAL A C   1 
ATOM   2751  O  O   . VAL A  1  357 ? -5.477  30.622  -14.854 1.00 23.88  ? 357 VAL A O   1 
ATOM   2752  C  CB  . VAL A  1  357 ? -7.195  33.378  -15.874 1.00 28.64  ? 357 VAL A CB  1 
ATOM   2753  C  CG1 . VAL A  1  357 ? -5.724  33.753  -15.908 1.00 30.40  ? 357 VAL A CG1 1 
ATOM   2754  C  CG2 . VAL A  1  357 ? -7.885  33.909  -17.144 1.00 29.22  ? 357 VAL A CG2 1 
ATOM   2755  N  N   . LEU A  1  358 ? -7.004  31.494  -13.387 1.00 26.16  ? 358 LEU A N   1 
ATOM   2756  C  CA  . LEU A  1  358 ? -6.351  31.044  -12.145 1.00 26.41  ? 358 LEU A CA  1 
ATOM   2757  C  C   . LEU A  1  358 ? -6.256  29.537  -11.974 1.00 26.86  ? 358 LEU A C   1 
ATOM   2758  O  O   . LEU A  1  358 ? -5.395  29.045  -11.216 1.00 26.42  ? 358 LEU A O   1 
ATOM   2759  C  CB  . LEU A  1  358 ? -7.084  31.582  -10.917 1.00 25.82  ? 358 LEU A CB  1 
ATOM   2760  C  CG  . LEU A  1  358 ? -6.926  33.070  -10.724 1.00 27.31  ? 358 LEU A CG  1 
ATOM   2761  C  CD1 . LEU A  1  358 ? -7.971  33.607  -9.766  1.00 26.88  ? 358 LEU A CD1 1 
ATOM   2762  C  CD2 . LEU A  1  358 ? -5.528  33.367  -10.205 1.00 29.41  ? 358 LEU A CD2 1 
ATOM   2763  N  N   . ALA A  1  359 ? -7.170  28.821  -12.619 1.00 26.18  ? 359 ALA A N   1 
ATOM   2764  C  CA  . ALA A  1  359 ? -7.268  27.385  -12.476 1.00 25.81  ? 359 ALA A CA  1 
ATOM   2765  C  C   . ALA A  1  359 ? -6.052  26.679  -13.027 1.00 26.16  ? 359 ALA A C   1 
ATOM   2766  O  O   . ALA A  1  359 ? -5.778  25.532  -12.690 1.00 26.05  ? 359 ALA A O   1 
ATOM   2767  C  CB  . ALA A  1  359 ? -8.500  26.916  -13.197 1.00 28.44  ? 359 ALA A CB  1 
ATOM   2768  N  N   . ASN A  1  360 ? -5.332  27.380  -13.904 1.00 27.78  ? 360 ASN A N   1 
ATOM   2769  C  CA  . ASN A  1  360 ? -4.076  26.919  -14.476 1.00 25.20  ? 360 ASN A CA  1 
ATOM   2770  C  C   . ASN A  1  360 ? -2.921  27.028  -13.467 1.00 25.50  ? 360 ASN A C   1 
ATOM   2771  O  O   . ASN A  1  360 ? -2.478  28.132  -13.147 1.00 26.42  ? 360 ASN A O   1 
ATOM   2772  C  CB  . ASN A  1  360 ? -3.780  27.774  -15.679 1.00 25.89  ? 360 ASN A CB  1 
ATOM   2773  C  CG  . ASN A  1  360 ? -4.839  27.651  -16.768 1.00 26.50  ? 360 ASN A CG  1 
ATOM   2774  O  OD1 . ASN A  1  360 ? -4.888  26.655  -17.472 1.00 25.35  ? 360 ASN A OD1 1 
ATOM   2775  N  ND2 . ASN A  1  360 ? -5.677  28.693  -16.926 1.00 29.14  ? 360 ASN A ND2 1 
ATOM   2776  N  N   . SER A  1  361 ? -2.429  25.886  -12.979 1.00 25.22  ? 361 SER A N   1 
ATOM   2777  C  CA  . SER A  1  361 ? -1.330  25.856  -11.997 1.00 26.48  ? 361 SER A CA  1 
ATOM   2778  C  C   . SER A  1  361 ? -0.087  26.567  -12.514 1.00 27.87  ? 361 SER A C   1 
ATOM   2779  O  O   . SER A  1  361 ? 0.601   27.248  -11.752 1.00 31.79  ? 361 SER A O   1 
ATOM   2780  C  CB  . SER A  1  361 ? -0.985  24.414  -11.578 1.00 27.06  ? 361 SER A CB  1 
ATOM   2781  O  OG  . SER A  1  361 ? -1.361  23.456  -12.584 1.00 26.18  ? 361 SER A OG  1 
ATOM   2782  N  N   . SER A  1  362 ? 0.186   26.387  -13.802 1.00 28.06  ? 362 SER A N   1 
ATOM   2783  C  CA  . SER A  1  362 ? 1.119   27.178  -14.580 1.00 29.00  ? 362 SER A CA  1 
ATOM   2784  C  C   . SER A  1  362 ? 1.098   28.644  -14.213 1.00 29.33  ? 362 SER A C   1 
ATOM   2785  O  O   . SER A  1  362 ? 2.046   29.148  -13.641 1.00 28.75  ? 362 SER A O   1 
ATOM   2786  C  CB  . SER A  1  362 ? 0.680   27.117  -16.036 1.00 30.16  ? 362 SER A CB  1 
ATOM   2787  O  OG  . SER A  1  362 ? 1.007   25.888  -16.520 1.00 38.54  ? 362 SER A OG  1 
ATOM   2788  N  N   . LEU A  1  363 ? 0.003   29.319  -14.582 1.00 29.48  ? 363 LEU A N   1 
ATOM   2789  C  CA  . LEU A  1  363 ? -0.089  30.754  -14.445 1.00 30.55  ? 363 LEU A CA  1 
ATOM   2790  C  C   . LEU A  1  363 ? -0.260  31.076  -13.026 1.00 29.36  ? 363 LEU A C   1 
ATOM   2791  O  O   . LEU A  1  363 ? 0.175   32.163  -12.597 1.00 33.51  ? 363 LEU A O   1 
ATOM   2792  C  CB  . LEU A  1  363 ? -1.285  31.366  -15.154 1.00 31.14  ? 363 LEU A CB  1 
ATOM   2793  C  CG  . LEU A  1  363 ? -1.075  31.890  -16.545 1.00 34.56  ? 363 LEU A CG  1 
ATOM   2794  C  CD1 . LEU A  1  363 ? -2.414  32.456  -17.003 1.00 37.15  ? 363 LEU A CD1 1 
ATOM   2795  C  CD2 . LEU A  1  363 ? 0.043   32.960  -16.616 1.00 33.38  ? 363 LEU A CD2 1 
ATOM   2796  N  N   . ASP A  1  364 ? -0.917  30.185  -12.283 1.00 26.00  ? 364 ASP A N   1 
ATOM   2797  C  CA  . ASP A  1  364 ? -1.243  30.563  -10.942 1.00 25.34  ? 364 ASP A CA  1 
ATOM   2798  C  C   . ASP A  1  364 ? 0.015   30.800  -10.102 1.00 25.41  ? 364 ASP A C   1 
ATOM   2799  O  O   . ASP A  1  364 ? -0.013  31.623  -9.178  1.00 24.25  ? 364 ASP A O   1 
ATOM   2800  C  CB  . ASP A  1  364 ? -2.157  29.580  -10.290 1.00 24.27  ? 364 ASP A CB  1 
ATOM   2801  C  CG  . ASP A  1  364 ? -2.609  30.062  -8.935  1.00 25.05  ? 364 ASP A CG  1 
ATOM   2802  O  OD1 . ASP A  1  364 ? -3.238  31.163  -8.868  1.00 22.17  ? 364 ASP A OD1 1 
ATOM   2803  O  OD2 . ASP A  1  364 ? -2.269  29.365  -7.943  1.00 23.88  ? 364 ASP A OD2 1 
ATOM   2804  N  N   . ILE A  1  365 ? 1.117   30.121  -10.444 1.00 26.12  ? 365 ILE A N   1 
ATOM   2805  C  CA  . ILE A  1  365 ? 2.396   30.410  -9.825  1.00 27.55  ? 365 ILE A CA  1 
ATOM   2806  C  C   . ILE A  1  365 ? 2.600   31.904  -9.742  1.00 26.25  ? 365 ILE A C   1 
ATOM   2807  O  O   . ILE A  1  365 ? 2.989   32.429  -8.702  1.00 24.47  ? 365 ILE A O   1 
ATOM   2808  C  CB  . ILE A  1  365 ? 3.561   29.836  -10.641 1.00 31.26  ? 365 ILE A CB  1 
ATOM   2809  C  CG1 . ILE A  1  365 ? 3.573   28.327  -10.586 1.00 33.91  ? 365 ILE A CG1 1 
ATOM   2810  C  CG2 . ILE A  1  365 ? 4.906   30.327  -10.137 1.00 31.86  ? 365 ILE A CG2 1 
ATOM   2811  C  CD1 . ILE A  1  365 ? 3.447   27.747  -9.202  1.00 38.21  ? 365 ILE A CD1 1 
ATOM   2812  N  N   . VAL A  1  366 ? 2.299   32.571  -10.842 1.00 25.68  ? 366 VAL A N   1 
ATOM   2813  C  CA  . VAL A  1  366 ? 2.619   33.975  -11.010 1.00 30.37  ? 366 VAL A CA  1 
ATOM   2814  C  C   . VAL A  1  366 ? 1.527   34.941  -10.535 1.00 29.78  ? 366 VAL A C   1 
ATOM   2815  O  O   . VAL A  1  366 ? 1.802   36.100  -10.186 1.00 28.50  ? 366 VAL A O   1 
ATOM   2816  C  CB  . VAL A  1  366 ? 3.090   34.190  -12.468 1.00 33.19  ? 366 VAL A CB  1 
ATOM   2817  C  CG1 . VAL A  1  366 ? 2.324   35.245  -13.163 1.00 37.61  ? 366 VAL A CG1 1 
ATOM   2818  C  CG2 . VAL A  1  366 ? 4.581   34.468  -12.498 1.00 34.30  ? 366 VAL A CG2 1 
ATOM   2819  N  N   . LEU A  1  367 ? 0.304   34.437  -10.498 1.00 29.25  ? 367 LEU A N   1 
ATOM   2820  C  CA  . LEU A  1  367 ? -0.846  35.204  -10.015 1.00 28.94  ? 367 LEU A CA  1 
ATOM   2821  C  C   . LEU A  1  367 ? -1.221  34.919  -8.571  1.00 25.40  ? 367 LEU A C   1 
ATOM   2822  O  O   . LEU A  1  367 ? -1.951  35.683  -8.003  1.00 22.97  ? 367 LEU A O   1 
ATOM   2823  C  CB  . LEU A  1  367 ? -2.058  34.928  -10.914 1.00 28.98  ? 367 LEU A CB  1 
ATOM   2824  C  CG  . LEU A  1  367 ? -1.858  35.338  -12.362 1.00 29.24  ? 367 LEU A CG  1 
ATOM   2825  C  CD1 . LEU A  1  367 ? -3.051  34.932  -13.195 1.00 30.15  ? 367 LEU A CD1 1 
ATOM   2826  C  CD2 . LEU A  1  367 ? -1.637  36.838  -12.464 1.00 30.55  ? 367 LEU A CD2 1 
ATOM   2827  N  N   . HIS A  1  368 ? -0.740  33.826  -7.987  1.00 25.24  ? 368 HIS A N   1 
ATOM   2828  C  CA  . HIS A  1  368 ? -1.140  33.471  -6.644  1.00 25.21  ? 368 HIS A CA  1 
ATOM   2829  C  C   . HIS A  1  368 ? -0.710  34.558  -5.653  1.00 24.48  ? 368 HIS A C   1 
ATOM   2830  O  O   . HIS A  1  368 ? 0.328   35.178  -5.811  1.00 26.24  ? 368 HIS A O   1 
ATOM   2831  C  CB  . HIS A  1  368 ? -0.588  32.092  -6.206  1.00 25.23  ? 368 HIS A CB  1 
ATOM   2832  C  CG  . HIS A  1  368 ? -0.913  31.766  -4.781  1.00 25.13  ? 368 HIS A CG  1 
ATOM   2833  N  ND1 . HIS A  1  368 ? -2.196  31.494  -4.357  1.00 25.79  ? 368 HIS A ND1 1 
ATOM   2834  C  CD2 . HIS A  1  368 ? -0.136  31.727  -3.674  1.00 27.16  ? 368 HIS A CD2 1 
ATOM   2835  C  CE1 . HIS A  1  368 ? -2.195  31.296  -3.047  1.00 27.13  ? 368 HIS A CE1 1 
ATOM   2836  N  NE2 . HIS A  1  368 ? -0.958  31.441  -2.603  1.00 27.66  ? 368 HIS A NE2 1 
ATOM   2837  N  N   . ASP A  1  369 ? -1.518  34.801  -4.634  1.00 24.01  ? 369 ASP A N   1 
ATOM   2838  C  CA  . ASP A  1  369 ? -1.209  35.832  -3.649  1.00 23.98  ? 369 ASP A CA  1 
ATOM   2839  C  C   . ASP A  1  369 ? -0.868  37.205  -4.323  1.00 25.39  ? 369 ASP A C   1 
ATOM   2840  O  O   . ASP A  1  369 ? 0.008   37.946  -3.837  1.00 26.13  ? 369 ASP A O   1 
ATOM   2841  C  CB  . ASP A  1  369 ? -0.103  35.348  -2.684  1.00 22.33  ? 369 ASP A CB  1 
ATOM   2842  C  CG  . ASP A  1  369 ? -0.618  35.071  -1.272  1.00 22.83  ? 369 ASP A CG  1 
ATOM   2843  O  OD1 . ASP A  1  369 ? -0.920  35.982  -0.484  1.00 22.53  ? 369 ASP A OD1 1 
ATOM   2844  O  OD2 . ASP A  1  369 ? -0.681  33.905  -0.886  1.00 24.99  ? 369 ASP A OD2 1 
ATOM   2845  N  N   . THR A  1  370 ? -1.571  37.527  -5.420  1.00 24.45  ? 370 THR A N   1 
ATOM   2846  C  CA  . THR A  1  370 ? -1.589  38.876  -5.970  1.00 23.34  ? 370 THR A CA  1 
ATOM   2847  C  C   . THR A  1  370 ? -3.001  39.433  -5.998  1.00 24.35  ? 370 THR A C   1 
ATOM   2848  O  O   . THR A  1  370 ? -3.991  38.740  -5.756  1.00 23.82  ? 370 THR A O   1 
ATOM   2849  C  CB  . THR A  1  370 ? -1.070  38.918  -7.407  1.00 24.56  ? 370 THR A CB  1 
ATOM   2850  O  OG1 . THR A  1  370 ? -2.030  38.369  -8.316  1.00 24.33  ? 370 THR A OG1 1 
ATOM   2851  C  CG2 . THR A  1  370 ? 0.240   38.160  -7.507  1.00 27.95  ? 370 THR A CG2 1 
ATOM   2852  N  N   . TYR A  1  371 ? -3.097  40.698  -6.344  1.00 23.89  ? 371 TYR A N   1 
ATOM   2853  C  CA  . TYR A  1  371 ? -4.394  41.333  -6.524  1.00 24.34  ? 371 TYR A CA  1 
ATOM   2854  C  C   . TYR A  1  371 ? -5.258  40.797  -7.680  1.00 25.16  ? 371 TYR A C   1 
ATOM   2855  O  O   . TYR A  1  371 ? -6.450  41.170  -7.790  1.00 26.33  ? 371 TYR A O   1 
ATOM   2856  C  CB  . TYR A  1  371 ? -4.234  42.842  -6.617  1.00 23.00  ? 371 TYR A CB  1 
ATOM   2857  C  CG  . TYR A  1  371 ? -4.501  43.452  -5.302  1.00 22.06  ? 371 TYR A CG  1 
ATOM   2858  C  CD1 . TYR A  1  371 ? -3.506  43.524  -4.327  1.00 20.37  ? 371 TYR A CD1 1 
ATOM   2859  C  CD2 . TYR A  1  371 ? -5.776  43.924  -5.000  1.00 21.03  ? 371 TYR A CD2 1 
ATOM   2860  C  CE1 . TYR A  1  371 ? -3.774  44.071  -3.082  1.00 20.83  ? 371 TYR A CE1 1 
ATOM   2861  C  CE2 . TYR A  1  371 ? -6.053  44.462  -3.764  1.00 20.50  ? 371 TYR A CE2 1 
ATOM   2862  C  CZ  . TYR A  1  371 ? -5.072  44.527  -2.804  1.00 20.40  ? 371 TYR A CZ  1 
ATOM   2863  O  OH  . TYR A  1  371 ? -5.413  45.092  -1.595  1.00 21.19  ? 371 TYR A OH  1 
ATOM   2864  N  N   . TYR A  1  372 ? -4.693  39.915  -8.506  1.00 24.74  ? 372 TYR A N   1 
ATOM   2865  C  CA  . TYR A  1  372 ? -5.466  39.287  -9.554  1.00 24.75  ? 372 TYR A CA  1 
ATOM   2866  C  C   . TYR A  1  372 ? -6.512  38.368  -8.873  1.00 25.02  ? 372 TYR A C   1 
ATOM   2867  O  O   . TYR A  1  372 ? -7.643  38.234  -9.364  1.00 25.71  ? 372 TYR A O   1 
ATOM   2868  C  CB  . TYR A  1  372 ? -4.590  38.506  -10.544 1.00 23.43  ? 372 TYR A CB  1 
ATOM   2869  C  CG  . TYR A  1  372 ? -5.291  38.166  -11.846 1.00 24.08  ? 372 TYR A CG  1 
ATOM   2870  C  CD1 . TYR A  1  372 ? -6.105  37.058  -11.944 1.00 24.80  ? 372 TYR A CD1 1 
ATOM   2871  C  CD2 . TYR A  1  372 ? -5.194  39.009  -12.985 1.00 26.39  ? 372 TYR A CD2 1 
ATOM   2872  C  CE1 . TYR A  1  372 ? -6.774  36.754  -13.133 1.00 25.39  ? 372 TYR A CE1 1 
ATOM   2873  C  CE2 . TYR A  1  372 ? -5.849  38.709  -14.186 1.00 24.89  ? 372 TYR A CE2 1 
ATOM   2874  C  CZ  . TYR A  1  372 ? -6.630  37.566  -14.240 1.00 25.85  ? 372 TYR A CZ  1 
ATOM   2875  O  OH  . TYR A  1  372 ? -7.269  37.195  -15.372 1.00 27.48  ? 372 TYR A OH  1 
ATOM   2876  N  N   . VAL A  1  373 ? -6.144  37.771  -7.747  1.00 23.04  ? 373 VAL A N   1 
ATOM   2877  C  CA  . VAL A  1  373 ? -7.041  36.852  -7.091  1.00 23.20  ? 373 VAL A CA  1 
ATOM   2878  C  C   . VAL A  1  373 ? -8.174  37.621  -6.443  1.00 24.39  ? 373 VAL A C   1 
ATOM   2879  O  O   . VAL A  1  373 ? -9.329  37.194  -6.487  1.00 24.78  ? 373 VAL A O   1 
ATOM   2880  C  CB  . VAL A  1  373 ? -6.328  35.950  -6.094  1.00 22.30  ? 373 VAL A CB  1 
ATOM   2881  C  CG1 . VAL A  1  373 ? -7.315  34.950  -5.512  1.00 23.06  ? 373 VAL A CG1 1 
ATOM   2882  C  CG2 . VAL A  1  373 ? -5.214  35.205  -6.811  1.00 23.03  ? 373 VAL A CG2 1 
ATOM   2883  N  N   . VAL A  1  374 ? -7.822  38.788  -5.909  1.00 25.58  ? 374 VAL A N   1 
ATOM   2884  C  CA  . VAL A  1  374 ? -8.731  39.662  -5.177  1.00 24.12  ? 374 VAL A CA  1 
ATOM   2885  C  C   . VAL A  1  374 ? -9.723  40.259  -6.159  1.00 24.78  ? 374 VAL A C   1 
ATOM   2886  O  O   . VAL A  1  374 ? -10.870 40.479  -5.812  1.00 25.94  ? 374 VAL A O   1 
ATOM   2887  C  CB  . VAL A  1  374 ? -7.953  40.768  -4.466  1.00 23.35  ? 374 VAL A CB  1 
ATOM   2888  C  CG1 . VAL A  1  374 ? -8.884  41.746  -3.764  1.00 23.83  ? 374 VAL A CG1 1 
ATOM   2889  C  CG2 . VAL A  1  374 ? -6.961  40.163  -3.477  1.00 24.07  ? 374 VAL A CG2 1 
ATOM   2890  N  N   . ALA A  1  375 ? -9.262  40.525  -7.372  1.00 24.43  ? 375 ALA A N   1 
ATOM   2891  C  CA  . ALA A  1  375 ? -10.132 40.982  -8.412  1.00 25.69  ? 375 ALA A CA  1 
ATOM   2892  C  C   . ALA A  1  375 ? -11.128 39.913  -8.782  1.00 26.19  ? 375 ALA A C   1 
ATOM   2893  O  O   . ALA A  1  375 ? -12.274 40.234  -8.942  1.00 28.19  ? 375 ALA A O   1 
ATOM   2894  C  CB  . ALA A  1  375 ? -9.333  41.395  -9.633  1.00 27.22  ? 375 ALA A CB  1 
ATOM   2895  N  N   . HIS A  1  376 ? -10.667 38.669  -8.958  1.00 25.64  ? 376 HIS A N   1 
ATOM   2896  C  CA  . HIS A  1  376 ? -11.510 37.521  -9.294  1.00 25.18  ? 376 HIS A CA  1 
ATOM   2897  C  C   . HIS A  1  376 ? -12.645 37.447  -8.306  1.00 26.62  ? 376 HIS A C   1 
ATOM   2898  O  O   . HIS A  1  376 ? -13.833 37.461  -8.682  1.00 25.62  ? 376 HIS A O   1 
ATOM   2899  C  CB  . HIS A  1  376 ? -10.715 36.188  -9.220  1.00 24.20  ? 376 HIS A CB  1 
ATOM   2900  C  CG  . HIS A  1  376 ? -11.555 34.959  -8.931  1.00 24.09  ? 376 HIS A CG  1 
ATOM   2901  N  ND1 . HIS A  1  376 ? -12.545 34.522  -9.780  1.00 24.01  ? 376 HIS A ND1 1 
ATOM   2902  C  CD2 . HIS A  1  376 ? -11.499 34.047  -7.924  1.00 24.73  ? 376 HIS A CD2 1 
ATOM   2903  C  CE1 . HIS A  1  376 ? -13.085 33.414  -9.295  1.00 26.20  ? 376 HIS A CE1 1 
ATOM   2904  N  NE2 . HIS A  1  376 ? -12.465 33.086  -8.170  1.00 26.63  ? 376 HIS A NE2 1 
ATOM   2905  N  N   . PHE A  1  377 ? -12.273 37.375  -7.031  1.00 24.61  ? 377 PHE A N   1 
ATOM   2906  C  CA  . PHE A  1  377 ? -13.275 37.072  -6.074  1.00 23.81  ? 377 PHE A CA  1 
ATOM   2907  C  C   . PHE A  1  377 ? -14.225 38.215  -5.760  1.00 24.60  ? 377 PHE A C   1 
ATOM   2908  O  O   . PHE A  1  377 ? -15.334 37.952  -5.337  1.00 22.83  ? 377 PHE A O   1 
ATOM   2909  C  CB  . PHE A  1  377 ? -12.756 36.292  -4.856  1.00 23.22  ? 377 PHE A CB  1 
ATOM   2910  C  CG  . PHE A  1  377 ? -11.857 37.033  -3.885  1.00 25.25  ? 377 PHE A CG  1 
ATOM   2911  C  CD1 . PHE A  1  377 ? -12.382 37.907  -2.945  1.00 24.97  ? 377 PHE A CD1 1 
ATOM   2912  C  CD2 . PHE A  1  377 ? -10.489 36.696  -3.778  1.00 24.98  ? 377 PHE A CD2 1 
ATOM   2913  C  CE1 . PHE A  1  377 ? -11.568 38.514  -2.003  1.00 23.72  ? 377 PHE A CE1 1 
ATOM   2914  C  CE2 . PHE A  1  377 ? -9.684  37.276  -2.812  1.00 23.77  ? 377 PHE A CE2 1 
ATOM   2915  C  CZ  . PHE A  1  377 ? -10.219 38.215  -1.950  1.00 23.80  ? 377 PHE A CZ  1 
ATOM   2916  N  N   . HIS A  1  378 ? -13.806 39.468  -5.941  1.00 25.33  ? 378 HIS A N   1 
ATOM   2917  C  CA  . HIS A  1  378 ? -14.739 40.593  -5.702  1.00 25.49  ? 378 HIS A CA  1 
ATOM   2918  C  C   . HIS A  1  378 ? -15.730 40.771  -6.868  1.00 25.85  ? 378 HIS A C   1 
ATOM   2919  O  O   . HIS A  1  378 ? -16.845 41.259  -6.666  1.00 26.07  ? 378 HIS A O   1 
ATOM   2920  C  CB  . HIS A  1  378 ? -14.020 41.891  -5.297  1.00 23.81  ? 378 HIS A CB  1 
ATOM   2921  C  CG  . HIS A  1  378 ? -13.560 41.899  -3.866  1.00 22.74  ? 378 HIS A CG  1 
ATOM   2922  N  ND1 . HIS A  1  378 ? -12.299 41.495  -3.501  1.00 24.22  ? 378 HIS A ND1 1 
ATOM   2923  C  CD2 . HIS A  1  378 ? -14.184 42.263  -2.713  1.00 23.45  ? 378 HIS A CD2 1 
ATOM   2924  C  CE1 . HIS A  1  378 ? -12.161 41.620  -2.184  1.00 25.54  ? 378 HIS A CE1 1 
ATOM   2925  N  NE2 . HIS A  1  378 ? -13.293 42.080  -1.671  1.00 23.47  ? 378 HIS A NE2 1 
ATOM   2926  N  N   . TYR A  1  379 ? -15.368 40.299  -8.056  1.00 27.46  ? 379 TYR A N   1 
ATOM   2927  C  CA  . TYR A  1  379 ? -16.314 40.237  -9.157  1.00 29.01  ? 379 TYR A CA  1 
ATOM   2928  C  C   . TYR A  1  379 ? -17.445 39.200  -8.817  1.00 29.67  ? 379 TYR A C   1 
ATOM   2929  O  O   . TYR A  1  379 ? -18.630 39.553  -8.792  1.00 28.65  ? 379 TYR A O   1 
ATOM   2930  C  CB  . TYR A  1  379 ? -15.611 40.016  -10.513 1.00 29.20  ? 379 TYR A CB  1 
ATOM   2931  C  CG  . TYR A  1  379 ? -15.342 41.325  -11.196 1.00 31.53  ? 379 TYR A CG  1 
ATOM   2932  C  CD1 . TYR A  1  379 ? -14.302 42.160  -10.759 1.00 33.04  ? 379 TYR A CD1 1 
ATOM   2933  C  CD2 . TYR A  1  379 ? -16.144 41.764  -12.246 1.00 32.83  ? 379 TYR A CD2 1 
ATOM   2934  C  CE1 . TYR A  1  379 ? -14.078 43.408  -11.331 1.00 33.79  ? 379 TYR A CE1 1 
ATOM   2935  C  CE2 . TYR A  1  379 ? -15.919 42.996  -12.857 1.00 34.49  ? 379 TYR A CE2 1 
ATOM   2936  C  CZ  . TYR A  1  379 ? -14.900 43.834  -12.386 1.00 36.26  ? 379 TYR A CZ  1 
ATOM   2937  O  OH  . TYR A  1  379 ? -14.680 45.077  -12.967 1.00 33.78  ? 379 TYR A OH  1 
ATOM   2938  N  N   . VAL A  1  380 ? -17.077 37.971  -8.493  1.00 27.63  ? 380 VAL A N   1 
ATOM   2939  C  CA  . VAL A  1  380 ? -18.080 36.982  -8.134  1.00 28.35  ? 380 VAL A CA  1 
ATOM   2940  C  C   . VAL A  1  380 ? -18.840 37.247  -6.842  1.00 27.85  ? 380 VAL A C   1 
ATOM   2941  O  O   . VAL A  1  380 ? -20.038 37.030  -6.821  1.00 27.92  ? 380 VAL A O   1 
ATOM   2942  C  CB  . VAL A  1  380 ? -17.533 35.574  -8.147  1.00 30.56  ? 380 VAL A CB  1 
ATOM   2943  C  CG1 . VAL A  1  380 ? -17.148 35.199  -9.557  1.00 30.30  ? 380 VAL A CG1 1 
ATOM   2944  C  CG2 . VAL A  1  380 ? -16.330 35.458  -7.222  1.00 34.17  ? 380 VAL A CG2 1 
ATOM   2945  N  N   . LEU A  1  381 ? -18.188 37.775  -5.808  1.00 28.71  ? 381 LEU A N   1 
ATOM   2946  C  CA  . LEU A  1  381 ? -18.834 38.124  -4.519  1.00 28.48  ? 381 LEU A CA  1 
ATOM   2947  C  C   . LEU A  1  381 ? -19.427 39.524  -4.417  1.00 31.26  ? 381 LEU A C   1 
ATOM   2948  O  O   . LEU A  1  381 ? -20.594 39.684  -4.069  1.00 33.39  ? 381 LEU A O   1 
ATOM   2949  C  CB  . LEU A  1  381 ? -17.881 37.926  -3.360  1.00 29.13  ? 381 LEU A CB  1 
ATOM   2950  C  CG  . LEU A  1  381 ? -17.551 36.460  -2.995  1.00 29.32  ? 381 LEU A CG  1 
ATOM   2951  C  CD1 . LEU A  1  381 ? -16.319 36.432  -2.114  1.00 32.18  ? 381 LEU A CD1 1 
ATOM   2952  C  CD2 . LEU A  1  381 ? -18.676 35.760  -2.253  1.00 28.58  ? 381 LEU A CD2 1 
ATOM   2953  N  N   . SER A  1  382 ? -18.670 40.564  -4.695  1.00 33.54  ? 382 SER A N   1 
ATOM   2954  C  CA  . SER A  1  382 ? -19.278 41.911  -4.619  1.00 35.75  ? 382 SER A CA  1 
ATOM   2955  C  C   . SER A  1  382 ? -20.175 42.283  -5.801  1.00 35.73  ? 382 SER A C   1 
ATOM   2956  O  O   . SER A  1  382 ? -20.945 43.227  -5.697  1.00 36.24  ? 382 SER A O   1 
ATOM   2957  C  CB  . SER A  1  382 ? -18.222 43.007  -4.406  1.00 38.34  ? 382 SER A CB  1 
ATOM   2958  O  OG  . SER A  1  382 ? -18.727 44.266  -4.820  1.00 43.10  ? 382 SER A OG  1 
ATOM   2959  N  N   . MET A  1  383 ? -20.046 41.593  -6.929  1.00 35.82  ? 383 MET A N   1 
ATOM   2960  C  CA  . MET A  1  383 ? -20.921 41.840  -8.064  1.00 36.06  ? 383 MET A CA  1 
ATOM   2961  C  C   . MET A  1  383 ? -21.730 40.621  -8.486  1.00 35.39  ? 383 MET A C   1 
ATOM   2962  O  O   . MET A  1  383 ? -22.404 40.654  -9.520  1.00 38.56  ? 383 MET A O   1 
ATOM   2963  C  CB  . MET A  1  383 ? -20.104 42.350  -9.235  1.00 37.87  ? 383 MET A CB  1 
ATOM   2964  C  CG  . MET A  1  383 ? -19.207 43.506  -8.854  1.00 40.15  ? 383 MET A CG  1 
ATOM   2965  S  SD  . MET A  1  383 ? -18.182 44.047  -10.224 1.00 42.46  ? 383 MET A SD  1 
ATOM   2966  C  CE  . MET A  1  383 ? -16.735 44.523  -9.307  1.00 44.50  ? 383 MET A CE  1 
ATOM   2967  N  N   . GLY A  1  384 ? -21.648 39.538  -7.718  1.00 33.46  ? 384 GLY A N   1 
ATOM   2968  C  CA  . GLY A  1  384 ? -22.414 38.323  -7.985  1.00 31.42  ? 384 GLY A CA  1 
ATOM   2969  C  C   . GLY A  1  384 ? -23.307 38.195  -6.788  1.00 31.45  ? 384 GLY A C   1 
ATOM   2970  O  O   . GLY A  1  384 ? -24.438 38.692  -6.817  1.00 31.77  ? 384 GLY A O   1 
ATOM   2971  N  N   . ALA A  1  385 ? -22.770 37.613  -5.714  1.00 27.84  ? 385 ALA A N   1 
ATOM   2972  C  CA  . ALA A  1  385 ? -23.512 37.475  -4.463  1.00 27.03  ? 385 ALA A CA  1 
ATOM   2973  C  C   . ALA A  1  385 ? -24.269 38.739  -4.079  1.00 26.40  ? 385 ALA A C   1 
ATOM   2974  O  O   . ALA A  1  385 ? -25.457 38.683  -3.825  1.00 29.01  ? 385 ALA A O   1 
ATOM   2975  C  CB  . ALA A  1  385 ? -22.603 37.026  -3.319  1.00 26.97  ? 385 ALA A CB  1 
ATOM   2976  N  N   . VAL A  1  386 ? -23.602 39.876  -4.051  1.00 25.15  ? 386 VAL A N   1 
ATOM   2977  C  CA  . VAL A  1  386 ? -24.234 41.129  -3.589  1.00 25.58  ? 386 VAL A CA  1 
ATOM   2978  C  C   . VAL A  1  386 ? -25.299 41.654  -4.549  1.00 25.04  ? 386 VAL A C   1 
ATOM   2979  O  O   . VAL A  1  386 ? -26.317 42.201  -4.134  1.00 21.87  ? 386 VAL A O   1 
ATOM   2980  C  CB  . VAL A  1  386 ? -23.185 42.224  -3.354  1.00 26.11  ? 386 VAL A CB  1 
ATOM   2981  C  CG1 . VAL A  1  386 ? -23.815 43.571  -3.068  1.00 26.88  ? 386 VAL A CG1 1 
ATOM   2982  C  CG2 . VAL A  1  386 ? -22.310 41.832  -2.187  1.00 27.75  ? 386 VAL A CG2 1 
ATOM   2983  N  N   . PHE A  1  387 ? -25.051 41.512  -5.836  1.00 25.49  ? 387 PHE A N   1 
ATOM   2984  C  CA  . PHE A  1  387 ? -26.027 41.938  -6.818  1.00 26.12  ? 387 PHE A CA  1 
ATOM   2985  C  C   . PHE A  1  387 ? -27.270 41.073  -6.711  1.00 26.42  ? 387 PHE A C   1 
ATOM   2986  O  O   . PHE A  1  387 ? -28.375 41.599  -6.802  1.00 28.51  ? 387 PHE A O   1 
ATOM   2987  C  CB  . PHE A  1  387 ? -25.445 41.900  -8.235  1.00 27.24  ? 387 PHE A CB  1 
ATOM   2988  C  CG  . PHE A  1  387 ? -24.687 43.156  -8.616  1.00 27.10  ? 387 PHE A CG  1 
ATOM   2989  C  CD1 . PHE A  1  387 ? -23.873 43.812  -7.705  1.00 26.74  ? 387 PHE A CD1 1 
ATOM   2990  C  CD2 . PHE A  1  387 ? -24.766 43.655  -9.894  1.00 28.09  ? 387 PHE A CD2 1 
ATOM   2991  C  CE1 . PHE A  1  387 ? -23.181 44.945  -8.059  1.00 25.65  ? 387 PHE A CE1 1 
ATOM   2992  C  CE2 . PHE A  1  387 ? -24.088 44.809  -10.238 1.00 29.47  ? 387 PHE A CE2 1 
ATOM   2993  C  CZ  . PHE A  1  387 ? -23.305 45.462  -9.312  1.00 25.82  ? 387 PHE A CZ  1 
ATOM   2994  N  N   . ALA A  1  388 ? -27.093 39.764  -6.504  1.00 24.48  ? 388 ALA A N   1 
ATOM   2995  C  CA  . ALA A  1  388 ? -28.223 38.866  -6.291  1.00 24.47  ? 388 ALA A CA  1 
ATOM   2996  C  C   . ALA A  1  388 ? -28.998 39.251  -5.015  1.00 24.35  ? 388 ALA A C   1 
ATOM   2997  O  O   . ALA A  1  388 ? -30.215 39.350  -5.047  1.00 24.54  ? 388 ALA A O   1 
ATOM   2998  C  CB  . ALA A  1  388 ? -27.772 37.411  -6.253  1.00 23.77  ? 388 ALA A CB  1 
ATOM   2999  N  N   . ILE A  1  389 ? -28.281 39.523  -3.930  1.00 25.02  ? 389 ILE A N   1 
ATOM   3000  C  CA  . ILE A  1  389 ? -28.887 39.978  -2.680  1.00 27.78  ? 389 ILE A CA  1 
ATOM   3001  C  C   . ILE A  1  389 ? -29.716 41.248  -2.878  1.00 30.09  ? 389 ILE A C   1 
ATOM   3002  O  O   . ILE A  1  389 ? -30.793 41.382  -2.284  1.00 31.58  ? 389 ILE A O   1 
ATOM   3003  C  CB  . ILE A  1  389 ? -27.838 40.211  -1.578  1.00 27.84  ? 389 ILE A CB  1 
ATOM   3004  C  CG1 . ILE A  1  389 ? -27.348 38.871  -1.042  1.00 28.63  ? 389 ILE A CG1 1 
ATOM   3005  C  CG2 . ILE A  1  389 ? -28.412 40.983  -0.410  1.00 28.49  ? 389 ILE A CG2 1 
ATOM   3006  C  CD1 . ILE A  1  389 ? -26.076 38.974  -0.233  1.00 28.27  ? 389 ILE A CD1 1 
ATOM   3007  N  N   . MET A  1  390 ? -29.218 42.162  -3.698  1.00 30.81  ? 390 MET A N   1 
ATOM   3008  C  CA  . MET A  1  390 ? -29.910 43.420  -3.959  1.00 31.14  ? 390 MET A CA  1 
ATOM   3009  C  C   . MET A  1  390 ? -31.159 43.234  -4.815  1.00 30.28  ? 390 MET A C   1 
ATOM   3010  O  O   . MET A  1  390 ? -32.221 43.807  -4.524  1.00 25.51  ? 390 MET A O   1 
ATOM   3011  C  CB  . MET A  1  390 ? -28.970 44.399  -4.637  1.00 33.95  ? 390 MET A CB  1 
ATOM   3012  C  CG  . MET A  1  390 ? -27.824 44.875  -3.740  1.00 36.43  ? 390 MET A CG  1 
ATOM   3013  S  SD  . MET A  1  390 ? -28.398 46.017  -2.500  1.00 36.98  ? 390 MET A SD  1 
ATOM   3014  C  CE  . MET A  1  390 ? -28.232 45.097  -0.995  1.00 45.06  ? 390 MET A CE  1 
ATOM   3015  N  N   . GLY A  1  391 ? -31.025 42.439  -5.872  1.00 28.30  ? 391 GLY A N   1 
ATOM   3016  C  CA  . GLY A  1  391 ? -32.153 42.159  -6.730  1.00 29.06  ? 391 GLY A CA  1 
ATOM   3017  C  C   . GLY A  1  391 ? -33.267 41.437  -5.979  1.00 28.13  ? 391 GLY A C   1 
ATOM   3018  O  O   . GLY A  1  391 ? -34.419 41.775  -6.101  1.00 27.51  ? 391 GLY A O   1 
ATOM   3019  N  N   . GLY A  1  392 ? -32.887 40.441  -5.196  1.00 26.74  ? 392 GLY A N   1 
ATOM   3020  C  CA  . GLY A  1  392 ? -33.806 39.728  -4.369  1.00 25.93  ? 392 GLY A CA  1 
ATOM   3021  C  C   . GLY A  1  392 ? -34.472 40.653  -3.392  1.00 26.20  ? 392 GLY A C   1 
ATOM   3022  O  O   . GLY A  1  392 ? -35.679 40.601  -3.259  1.00 28.87  ? 392 GLY A O   1 
ATOM   3023  N  N   . PHE A  1  393 ? -33.688 41.493  -2.713  1.00 26.84  ? 393 PHE A N   1 
ATOM   3024  C  CA  . PHE A  1  393 ? -34.215 42.448  -1.741  1.00 27.02  ? 393 PHE A CA  1 
ATOM   3025  C  C   . PHE A  1  393 ? -35.309 43.342  -2.335  1.00 27.89  ? 393 PHE A C   1 
ATOM   3026  O  O   . PHE A  1  393 ? -36.390 43.444  -1.767  1.00 28.43  ? 393 PHE A O   1 
ATOM   3027  C  CB  . PHE A  1  393 ? -33.121 43.349  -1.172  1.00 27.80  ? 393 PHE A CB  1 
ATOM   3028  C  CG  . PHE A  1  393 ? -33.615 44.231  -0.060  1.00 28.64  ? 393 PHE A CG  1 
ATOM   3029  C  CD1 . PHE A  1  393 ? -33.912 43.693  1.176   1.00 30.01  ? 393 PHE A CD1 1 
ATOM   3030  C  CD2 . PHE A  1  393 ? -33.860 45.556  -0.265  1.00 29.31  ? 393 PHE A CD2 1 
ATOM   3031  C  CE1 . PHE A  1  393 ? -34.392 44.491  2.198   1.00 30.00  ? 393 PHE A CE1 1 
ATOM   3032  C  CE2 . PHE A  1  393 ? -34.346 46.358  0.748   1.00 30.46  ? 393 PHE A CE2 1 
ATOM   3033  C  CZ  . PHE A  1  393 ? -34.625 45.820  1.979   1.00 29.84  ? 393 PHE A CZ  1 
ATOM   3034  N  N   . VAL A  1  394 ? -35.004 43.966  -3.472  1.00 27.84  ? 394 VAL A N   1 
ATOM   3035  C  CA  . VAL A  1  394 ? -35.882 44.929  -4.123  1.00 28.29  ? 394 VAL A CA  1 
ATOM   3036  C  C   . VAL A  1  394 ? -37.143 44.264  -4.728  1.00 27.93  ? 394 VAL A C   1 
ATOM   3037  O  O   . VAL A  1  394 ? -38.243 44.844  -4.744  1.00 26.59  ? 394 VAL A O   1 
ATOM   3038  C  CB  . VAL A  1  394 ? -35.105 45.753  -5.182  1.00 29.96  ? 394 VAL A CB  1 
ATOM   3039  C  CG1 . VAL A  1  394 ? -36.063 46.631  -5.971  1.00 35.05  ? 394 VAL A CG1 1 
ATOM   3040  C  CG2 . VAL A  1  394 ? -34.095 46.663  -4.508  1.00 30.21  ? 394 VAL A CG2 1 
ATOM   3041  N  N   . HIS A  1  395 ? -36.977 43.051  -5.219  1.00 27.00  ? 395 HIS A N   1 
ATOM   3042  C  CA  . HIS A  1  395 ? -38.072 42.321  -5.798  1.00 27.06  ? 395 HIS A CA  1 
ATOM   3043  C  C   . HIS A  1  395 ? -39.078 41.857  -4.743  1.00 27.60  ? 395 HIS A C   1 
ATOM   3044  O  O   . HIS A  1  395 ? -40.276 41.997  -4.934  1.00 32.91  ? 395 HIS A O   1 
ATOM   3045  C  CB  . HIS A  1  395 ? -37.523 41.146  -6.551  1.00 26.16  ? 395 HIS A CB  1 
ATOM   3046  C  CG  . HIS A  1  395 ? -38.565 40.233  -7.075  1.00 28.04  ? 395 HIS A CG  1 
ATOM   3047  N  ND1 . HIS A  1  395 ? -39.573 40.657  -7.908  1.00 29.09  ? 395 HIS A ND1 1 
ATOM   3048  C  CD2 . HIS A  1  395 ? -38.727 38.900  -6.926  1.00 28.08  ? 395 HIS A CD2 1 
ATOM   3049  C  CE1 . HIS A  1  395 ? -40.317 39.619  -8.249  1.00 30.72  ? 395 HIS A CE1 1 
ATOM   3050  N  NE2 . HIS A  1  395 ? -39.827 38.540  -7.662  1.00 29.05  ? 395 HIS A NE2 1 
ATOM   3051  N  N   . TRP A  1  396 ? -38.597 41.347  -3.620  1.00 26.09  ? 396 TRP A N   1 
ATOM   3052  C  CA  . TRP A  1  396 ? -39.463 40.684  -2.619  1.00 25.73  ? 396 TRP A CA  1 
ATOM   3053  C  C   . TRP A  1  396 ? -39.759 41.547  -1.423  1.00 25.70  ? 396 TRP A C   1 
ATOM   3054  O  O   . TRP A  1  396 ? -40.519 41.153  -0.545  1.00 25.84  ? 396 TRP A O   1 
ATOM   3055  C  CB  . TRP A  1  396 ? -38.852 39.330  -2.155  1.00 25.22  ? 396 TRP A CB  1 
ATOM   3056  C  CG  . TRP A  1  396 ? -39.091 38.167  -3.123  1.00 25.32  ? 396 TRP A CG  1 
ATOM   3057  C  CD1 . TRP A  1  396 ? -40.310 37.612  -3.459  1.00 26.47  ? 396 TRP A CD1 1 
ATOM   3058  C  CD2 . TRP A  1  396 ? -38.103 37.395  -3.829  1.00 25.69  ? 396 TRP A CD2 1 
ATOM   3059  N  NE1 . TRP A  1  396 ? -40.131 36.564  -4.332  1.00 26.20  ? 396 TRP A NE1 1 
ATOM   3060  C  CE2 . TRP A  1  396 ? -38.797 36.391  -4.562  1.00 24.26  ? 396 TRP A CE2 1 
ATOM   3061  C  CE3 . TRP A  1  396 ? -36.701 37.419  -3.878  1.00 26.07  ? 396 TRP A CE3 1 
ATOM   3062  C  CZ2 . TRP A  1  396 ? -38.163 35.489  -5.368  1.00 22.88  ? 396 TRP A CZ2 1 
ATOM   3063  C  CZ3 . TRP A  1  396 ? -36.054 36.472  -4.682  1.00 25.46  ? 396 TRP A CZ3 1 
ATOM   3064  C  CH2 . TRP A  1  396 ? -36.790 35.542  -5.426  1.00 24.57  ? 396 TRP A CH2 1 
ATOM   3065  N  N   . PHE A  1  397 ? -39.195 42.747  -1.385  1.00 26.91  ? 397 PHE A N   1 
ATOM   3066  C  CA  . PHE A  1  397 ? -39.461 43.678  -0.274  1.00 26.58  ? 397 PHE A CA  1 
ATOM   3067  C  C   . PHE A  1  397 ? -40.947 43.980  -0.059  1.00 26.73  ? 397 PHE A C   1 
ATOM   3068  O  O   . PHE A  1  397 ? -41.386 44.091  1.085   1.00 25.59  ? 397 PHE A O   1 
ATOM   3069  C  CB  . PHE A  1  397 ? -38.631 44.960  -0.438  1.00 27.67  ? 397 PHE A CB  1 
ATOM   3070  C  CG  . PHE A  1  397 ? -38.934 46.002  0.574   1.00 27.32  ? 397 PHE A CG  1 
ATOM   3071  C  CD1 . PHE A  1  397 ? -38.277 46.023  1.743   1.00 28.41  ? 397 PHE A CD1 1 
ATOM   3072  C  CD2 . PHE A  1  397 ? -39.900 46.963  0.323   1.00 29.06  ? 397 PHE A CD2 1 
ATOM   3073  C  CE1 . PHE A  1  397 ? -38.576 46.999  2.686   1.00 32.16  ? 397 PHE A CE1 1 
ATOM   3074  C  CE2 . PHE A  1  397 ? -40.223 47.926  1.252   1.00 28.68  ? 397 PHE A CE2 1 
ATOM   3075  C  CZ  . PHE A  1  397 ? -39.550 47.951  2.440   1.00 29.25  ? 397 PHE A CZ  1 
ATOM   3076  N  N   . PRO A  1  398 ? -41.719 44.145  -1.148  1.00 27.72  ? 398 PRO A N   1 
ATOM   3077  C  CA  . PRO A  1  398 ? -43.141 44.331  -0.963  1.00 30.21  ? 398 PRO A CA  1 
ATOM   3078  C  C   . PRO A  1  398 ? -43.832 43.127  -0.371  1.00 30.32  ? 398 PRO A C   1 
ATOM   3079  O  O   . PRO A  1  398 ? -44.746 43.347  0.386   1.00 27.80  ? 398 PRO A O   1 
ATOM   3080  C  CB  . PRO A  1  398 ? -43.651 44.619  -2.393  1.00 31.09  ? 398 PRO A CB  1 
ATOM   3081  C  CG  . PRO A  1  398 ? -42.487 45.238  -3.036  1.00 31.99  ? 398 PRO A CG  1 
ATOM   3082  C  CD  . PRO A  1  398 ? -41.339 44.442  -2.531  1.00 29.52  ? 398 PRO A CD  1 
ATOM   3083  N  N   . LEU A  1  399 ? -43.399 41.894  -0.716  1.00 31.66  ? 399 LEU A N   1 
ATOM   3084  C  CA  . LEU A  1  399 ? -43.885 40.658  -0.061  1.00 28.93  ? 399 LEU A CA  1 
ATOM   3085  C  C   . LEU A  1  399 ? -43.593 40.668  1.428   1.00 29.56  ? 399 LEU A C   1 
ATOM   3086  O  O   . LEU A  1  399 ? -44.454 40.382  2.259   1.00 31.62  ? 399 LEU A O   1 
ATOM   3087  C  CB  . LEU A  1  399 ? -43.262 39.411  -0.669  1.00 28.04  ? 399 LEU A CB  1 
ATOM   3088  C  CG  . LEU A  1  399 ? -43.670 38.055  -0.075  1.00 29.25  ? 399 LEU A CG  1 
ATOM   3089  C  CD1 . LEU A  1  399 ? -45.126 37.817  -0.381  1.00 30.66  ? 399 LEU A CD1 1 
ATOM   3090  C  CD2 . LEU A  1  399 ? -42.888 36.844  -0.597  1.00 30.49  ? 399 LEU A CD2 1 
ATOM   3091  N  N   . PHE A  1  400 ? -42.379 41.006  1.805   1.00 28.72  ? 400 PHE A N   1 
ATOM   3092  C  CA  . PHE A  1  400 ? -42.062 40.926  3.222   1.00 29.17  ? 400 PHE A CA  1 
ATOM   3093  C  C   . PHE A  1  400 ? -42.782 42.019  4.023   1.00 29.35  ? 400 PHE A C   1 
ATOM   3094  O  O   . PHE A  1  400 ? -43.155 41.806  5.172   1.00 34.39  ? 400 PHE A O   1 
ATOM   3095  C  CB  . PHE A  1  400 ? -40.548 41.047  3.458   1.00 30.88  ? 400 PHE A CB  1 
ATOM   3096  C  CG  . PHE A  1  400 ? -39.695 40.062  2.684   1.00 30.53  ? 400 PHE A CG  1 
ATOM   3097  C  CD1 . PHE A  1  400 ? -40.185 38.832  2.253   1.00 29.57  ? 400 PHE A CD1 1 
ATOM   3098  C  CD2 . PHE A  1  400 ? -38.365 40.367  2.435   1.00 30.42  ? 400 PHE A CD2 1 
ATOM   3099  C  CE1 . PHE A  1  400 ? -39.377 37.953  1.552   1.00 29.91  ? 400 PHE A CE1 1 
ATOM   3100  C  CE2 . PHE A  1  400 ? -37.549 39.486  1.731   1.00 31.05  ? 400 PHE A CE2 1 
ATOM   3101  C  CZ  . PHE A  1  400 ? -38.055 38.277  1.294   1.00 30.14  ? 400 PHE A CZ  1 
ATOM   3102  N  N   . SER A  1  401 ? -42.909 43.207  3.447   1.00 27.99  ? 401 SER A N   1 
ATOM   3103  C  CA  . SER A  1  401 ? -43.307 44.400  4.200   1.00 27.85  ? 401 SER A CA  1 
ATOM   3104  C  C   . SER A  1  401 ? -44.757 44.789  3.951   1.00 28.94  ? 401 SER A C   1 
ATOM   3105  O  O   . SER A  1  401 ? -45.382 45.363  4.819   1.00 31.67  ? 401 SER A O   1 
ATOM   3106  C  CB  . SER A  1  401 ? -42.413 45.601  3.802   1.00 26.30  ? 401 SER A CB  1 
ATOM   3107  O  OG  . SER A  1  401 ? -42.678 46.003  2.460   1.00 24.25  ? 401 SER A OG  1 
ATOM   3108  N  N   . GLY A  1  402 ? -45.246 44.543  2.744   1.00 25.93  ? 402 GLY A N   1 
ATOM   3109  C  CA  . GLY A  1  402 ? -46.485 45.096  2.300   1.00 26.59  ? 402 GLY A CA  1 
ATOM   3110  C  C   . GLY A  1  402 ? -46.382 46.487  1.703   1.00 28.42  ? 402 GLY A C   1 
ATOM   3111  O  O   . GLY A  1  402 ? -47.420 47.072  1.360   1.00 28.55  ? 402 GLY A O   1 
ATOM   3112  N  N   . TYR A  1  403 ? -45.165 47.033  1.598   1.00 27.29  ? 403 TYR A N   1 
ATOM   3113  C  CA  . TYR A  1  403 ? -44.966 48.392  1.115   1.00 27.01  ? 403 TYR A CA  1 
ATOM   3114  C  C   . TYR A  1  403 ? -44.143 48.359  -0.136  1.00 28.19  ? 403 TYR A C   1 
ATOM   3115  O  O   . TYR A  1  403 ? -43.364 47.419  -0.354  1.00 33.03  ? 403 TYR A O   1 
ATOM   3116  C  CB  . TYR A  1  403 ? -44.263 49.236  2.160   1.00 27.15  ? 403 TYR A CB  1 
ATOM   3117  C  CG  . TYR A  1  403 ? -45.062 49.450  3.421   1.00 29.02  ? 403 TYR A CG  1 
ATOM   3118  C  CD1 . TYR A  1  403 ? -46.373 49.959  3.378   1.00 30.06  ? 403 TYR A CD1 1 
ATOM   3119  C  CD2 . TYR A  1  403 ? -44.527 49.174  4.654   1.00 28.61  ? 403 TYR A CD2 1 
ATOM   3120  C  CE1 . TYR A  1  403 ? -47.092 50.180  4.541   1.00 28.66  ? 403 TYR A CE1 1 
ATOM   3121  C  CE2 . TYR A  1  403 ? -45.256 49.384  5.803   1.00 31.39  ? 403 TYR A CE2 1 
ATOM   3122  C  CZ  . TYR A  1  403 ? -46.540 49.884  5.744   1.00 29.18  ? 403 TYR A CZ  1 
ATOM   3123  O  OH  . TYR A  1  403 ? -47.243 50.073  6.915   1.00 30.80  ? 403 TYR A OH  1 
ATOM   3124  N  N   . THR A  1  404 ? -44.308 49.360  -0.976  1.00 25.34  ? 404 THR A N   1 
ATOM   3125  C  CA  . THR A  1  404 ? -43.426 49.479  -2.119  1.00 26.69  ? 404 THR A CA  1 
ATOM   3126  C  C   . THR A  1  404 ? -42.242 50.458  -1.873  1.00 27.41  ? 404 THR A C   1 
ATOM   3127  O  O   . THR A  1  404 ? -42.358 51.435  -1.126  1.00 25.76  ? 404 THR A O   1 
ATOM   3128  C  CB  . THR A  1  404 ? -44.201 49.928  -3.336  1.00 24.72  ? 404 THR A CB  1 
ATOM   3129  O  OG1 . THR A  1  404 ? -44.786 51.214  -3.069  1.00 25.32  ? 404 THR A OG1 1 
ATOM   3130  C  CG2 . THR A  1  404 ? -45.268 48.923  -3.643  1.00 24.79  ? 404 THR A CG2 1 
ATOM   3131  N  N   . LEU A  1  405 ? -41.117 50.168  -2.522  1.00 27.99  ? 405 LEU A N   1 
ATOM   3132  C  CA  . LEU A  1  405 ? -40.000 51.112  -2.624  1.00 29.47  ? 405 LEU A CA  1 
ATOM   3133  C  C   . LEU A  1  405 ? -40.360 52.135  -3.679  1.00 27.90  ? 405 LEU A C   1 
ATOM   3134  O  O   . LEU A  1  405 ? -41.153 51.853  -4.548  1.00 28.67  ? 405 LEU A O   1 
ATOM   3135  C  CB  . LEU A  1  405 ? -38.745 50.410  -3.122  1.00 28.26  ? 405 LEU A CB  1 
ATOM   3136  C  CG  . LEU A  1  405 ? -38.302 49.283  -2.247  1.00 29.55  ? 405 LEU A CG  1 
ATOM   3137  C  CD1 . LEU A  1  405 ? -37.292 48.468  -3.018  1.00 31.53  ? 405 LEU A CD1 1 
ATOM   3138  C  CD2 . LEU A  1  405 ? -37.752 49.799  -0.940  1.00 29.96  ? 405 LEU A CD2 1 
ATOM   3139  N  N   . ASN A  1  406 ? -39.731 53.297  -3.635  1.00 27.76  ? 406 ASN A N   1 
ATOM   3140  C  CA  . ASN A  1  406 ? -39.699 54.178  -4.800  1.00 28.52  ? 406 ASN A CA  1 
ATOM   3141  C  C   . ASN A  1  406 ? -38.736 53.647  -5.868  1.00 31.42  ? 406 ASN A C   1 
ATOM   3142  O  O   . ASN A  1  406 ? -37.527 53.581  -5.592  1.00 31.97  ? 406 ASN A O   1 
ATOM   3143  C  CB  . ASN A  1  406 ? -39.202 55.535  -4.359  1.00 29.44  ? 406 ASN A CB  1 
ATOM   3144  C  CG  . ASN A  1  406 ? -39.317 56.560  -5.440  1.00 30.66  ? 406 ASN A CG  1 
ATOM   3145  O  OD1 . ASN A  1  406 ? -38.843 56.355  -6.577  1.00 32.06  ? 406 ASN A OD1 1 
ATOM   3146  N  ND2 . ASN A  1  406 ? -39.971 57.679  -5.110  1.00 31.03  ? 406 ASN A ND2 1 
ATOM   3147  N  N   . ASP A  1  407 ? -39.234 53.320  -7.074  1.00 30.33  ? 407 ASP A N   1 
ATOM   3148  C  CA  . ASP A  1  407 ? -38.411 52.664  -8.098  1.00 29.99  ? 407 ASP A CA  1 
ATOM   3149  C  C   . ASP A  1  407 ? -37.370 53.547  -8.716  1.00 32.82  ? 407 ASP A C   1 
ATOM   3150  O  O   . ASP A  1  407 ? -36.367 53.026  -9.206  1.00 38.34  ? 407 ASP A O   1 
ATOM   3151  C  CB  . ASP A  1  407 ? -39.231 52.093  -9.246  1.00 31.31  ? 407 ASP A CB  1 
ATOM   3152  C  CG  . ASP A  1  407 ? -39.824 50.756  -8.933  1.00 34.19  ? 407 ASP A CG  1 
ATOM   3153  O  OD1 . ASP A  1  407 ? -39.641 50.226  -7.822  1.00 36.85  ? 407 ASP A OD1 1 
ATOM   3154  O  OD2 . ASP A  1  407 ? -40.490 50.211  -9.824  1.00 39.65  ? 407 ASP A OD2 1 
ATOM   3155  N  N   . THR A  1  408 ? -37.595 54.856  -8.746  1.00 31.52  ? 408 THR A N   1 
ATOM   3156  C  CA  . THR A  1  408 ? -36.629 55.766  -9.355  1.00 29.33  ? 408 THR A CA  1 
ATOM   3157  C  C   . THR A  1  408 ? -35.428 55.850  -8.442  1.00 25.36  ? 408 THR A C   1 
ATOM   3158  O  O   . THR A  1  408 ? -34.316 55.712  -8.881  1.00 21.51  ? 408 THR A O   1 
ATOM   3159  C  CB  . THR A  1  408 ? -37.243 57.167  -9.583  1.00 30.05  ? 408 THR A CB  1 
ATOM   3160  O  OG1 . THR A  1  408 ? -38.335 57.034  -10.478 1.00 29.10  ? 408 THR A OG1 1 
ATOM   3161  C  CG2 . THR A  1  408 ? -36.221 58.134  -10.218 1.00 31.04  ? 408 THR A CG2 1 
ATOM   3162  N  N   . TRP A  1  409 ? -35.670 56.071  -7.161  1.00 25.52  ? 409 TRP A N   1 
ATOM   3163  C  CA  . TRP A  1  409 ? -34.589 56.027  -6.185  1.00 28.60  ? 409 TRP A CA  1 
ATOM   3164  C  C   . TRP A  1  409 ? -33.811 54.688  -6.242  1.00 31.26  ? 409 TRP A C   1 
ATOM   3165  O  O   . TRP A  1  409 ? -32.584 54.683  -6.204  1.00 30.49  ? 409 TRP A O   1 
ATOM   3166  C  CB  . TRP A  1  409 ? -35.120 56.257  -4.778  1.00 30.38  ? 409 TRP A CB  1 
ATOM   3167  C  CG  . TRP A  1  409 ? -35.243 57.701  -4.332  1.00 31.80  ? 409 TRP A CG  1 
ATOM   3168  C  CD1 . TRP A  1  409 ? -36.329 58.274  -3.836  1.00 33.13  ? 409 TRP A CD1 1 
ATOM   3169  C  CD2 . TRP A  1  409 ? -34.204 58.688  -4.267  1.00 32.55  ? 409 TRP A CD2 1 
ATOM   3170  N  NE1 . TRP A  1  409 ? -36.072 59.574  -3.488  1.00 35.30  ? 409 TRP A NE1 1 
ATOM   3171  C  CE2 . TRP A  1  409 ? -34.763 59.844  -3.729  1.00 33.61  ? 409 TRP A CE2 1 
ATOM   3172  C  CE3 . TRP A  1  409 ? -32.858 58.697  -4.601  1.00 32.46  ? 409 TRP A CE3 1 
ATOM   3173  C  CZ2 . TRP A  1  409 ? -34.034 61.014  -3.541  1.00 35.31  ? 409 TRP A CZ2 1 
ATOM   3174  C  CZ3 . TRP A  1  409 ? -32.132 59.861  -4.409  1.00 33.26  ? 409 TRP A CZ3 1 
ATOM   3175  C  CH2 . TRP A  1  409 ? -32.717 60.998  -3.897  1.00 33.23  ? 409 TRP A CH2 1 
ATOM   3176  N  N   . ALA A  1  410 ? -34.528 53.566  -6.337  1.00 29.01  ? 410 ALA A N   1 
ATOM   3177  C  CA  . ALA A  1  410 ? -33.896 52.253  -6.445  1.00 28.84  ? 410 ALA A CA  1 
ATOM   3178  C  C   . ALA A  1  410 ? -32.950 52.175  -7.662  1.00 28.64  ? 410 ALA A C   1 
ATOM   3179  O  O   . ALA A  1  410 ? -31.893 51.570  -7.597  1.00 29.07  ? 410 ALA A O   1 
ATOM   3180  C  CB  . ALA A  1  410 ? -34.966 51.159  -6.533  1.00 26.27  ? 410 ALA A CB  1 
ATOM   3181  N  N   . LYS A  1  411 ? -33.370 52.764  -8.775  1.00 27.86  ? 411 LYS A N   1 
ATOM   3182  C  CA  . LYS A  1  411 ? -32.567 52.825  -9.974  1.00 27.28  ? 411 LYS A CA  1 
ATOM   3183  C  C   . LYS A  1  411 ? -31.318 53.679  -9.799  1.00 28.23  ? 411 LYS A C   1 
ATOM   3184  O  O   . LYS A  1  411 ? -30.260 53.314  -10.287 1.00 26.65  ? 411 LYS A O   1 
ATOM   3185  C  CB  . LYS A  1  411 ? -33.402 53.328  -11.148 1.00 27.34  ? 411 LYS A CB  1 
ATOM   3186  C  CG  . LYS A  1  411 ? -34.386 52.253  -11.610 1.00 30.24  ? 411 LYS A CG  1 
ATOM   3187  C  CD  . LYS A  1  411 ? -35.376 52.784  -12.637 1.00 33.05  ? 411 LYS A CD  1 
ATOM   3188  C  CE  . LYS A  1  411 ? -36.686 52.039  -12.626 1.00 34.04  ? 411 LYS A CE  1 
ATOM   3189  N  NZ  . LYS A  1  411 ? -37.312 52.155  -13.962 1.00 38.07  ? 411 LYS A NZ  1 
ATOM   3190  N  N   . ILE A  1  412 ? -31.445 54.816  -9.116  1.00 29.20  ? 412 ILE A N   1 
ATOM   3191  C  CA  . ILE A  1  412 ? -30.313 55.710  -8.845  1.00 28.44  ? 412 ILE A CA  1 
ATOM   3192  C  C   . ILE A  1  412 ? -29.257 54.973  -8.038  1.00 27.73  ? 412 ILE A C   1 
ATOM   3193  O  O   . ILE A  1  412 ? -28.039 55.104  -8.271  1.00 25.78  ? 412 ILE A O   1 
ATOM   3194  C  CB  . ILE A  1  412 ? -30.787 56.973  -8.094  1.00 29.85  ? 412 ILE A CB  1 
ATOM   3195  C  CG1 . ILE A  1  412 ? -31.597 57.840  -9.075  1.00 31.82  ? 412 ILE A CG1 1 
ATOM   3196  C  CG2 . ILE A  1  412 ? -29.610 57.778  -7.521  1.00 28.73  ? 412 ILE A CG2 1 
ATOM   3197  C  CD1 . ILE A  1  412 ? -32.492 58.856  -8.410  1.00 31.54  ? 412 ILE A CD1 1 
ATOM   3198  N  N   . HIS A  1  413 ? -29.752 54.203  -7.080  1.00 28.27  ? 413 HIS A N   1 
ATOM   3199  C  CA  . HIS A  1  413 ? -28.929 53.358  -6.233  1.00 29.40  ? 413 HIS A CA  1 
ATOM   3200  C  C   . HIS A  1  413 ? -28.155 52.319  -7.061  1.00 30.56  ? 413 HIS A C   1 
ATOM   3201  O  O   . HIS A  1  413 ? -26.925 52.151  -6.940  1.00 28.17  ? 413 HIS A O   1 
ATOM   3202  C  CB  . HIS A  1  413 ? -29.822 52.682  -5.217  1.00 30.35  ? 413 HIS A CB  1 
ATOM   3203  C  CG  . HIS A  1  413 ? -29.109 51.705  -4.385  1.00 32.44  ? 413 HIS A CG  1 
ATOM   3204  N  ND1 . HIS A  1  413 ? -29.430 50.375  -4.384  1.00 33.84  ? 413 HIS A ND1 1 
ATOM   3205  C  CD2 . HIS A  1  413 ? -28.024 51.846  -3.592  1.00 34.86  ? 413 HIS A CD2 1 
ATOM   3206  C  CE1 . HIS A  1  413 ? -28.596 49.740  -3.580  1.00 36.43  ? 413 HIS A CE1 1 
ATOM   3207  N  NE2 . HIS A  1  413 ? -27.732 50.607  -3.088  1.00 35.16  ? 413 HIS A NE2 1 
ATOM   3208  N  N   . PHE A  1  414 ? -28.873 51.660  -7.956  1.00 30.41  ? 414 PHE A N   1 
ATOM   3209  C  CA  . PHE A  1  414 ? -28.220 50.744  -8.869  1.00 30.46  ? 414 PHE A CA  1 
ATOM   3210  C  C   . PHE A  1  414 ? -27.077 51.426  -9.646  1.00 31.99  ? 414 PHE A C   1 
ATOM   3211  O  O   . PHE A  1  414 ? -25.955 50.889  -9.715  1.00 35.34  ? 414 PHE A O   1 
ATOM   3212  C  CB  . PHE A  1  414 ? -29.217 50.074  -9.823  1.00 27.40  ? 414 PHE A CB  1 
ATOM   3213  C  CG  . PHE A  1  414 ? -28.564 49.258  -10.860 1.00 26.89  ? 414 PHE A CG  1 
ATOM   3214  C  CD1 . PHE A  1  414 ? -28.052 48.021  -10.546 1.00 27.50  ? 414 PHE A CD1 1 
ATOM   3215  C  CD2 . PHE A  1  414 ? -28.392 49.735  -12.116 1.00 27.84  ? 414 PHE A CD2 1 
ATOM   3216  C  CE1 . PHE A  1  414 ? -27.419 47.251  -11.495 1.00 26.77  ? 414 PHE A CE1 1 
ATOM   3217  C  CE2 . PHE A  1  414 ? -27.708 48.976  -13.070 1.00 29.21  ? 414 PHE A CE2 1 
ATOM   3218  C  CZ  . PHE A  1  414 ? -27.240 47.728  -12.755 1.00 27.46  ? 414 PHE A CZ  1 
ATOM   3219  N  N   . ALA A  1  415 ? -27.347 52.586  -10.231 1.00 31.44  ? 415 ALA A N   1 
ATOM   3220  C  CA  . ALA A  1  415 ? -26.365 53.190  -11.144 1.00 33.23  ? 415 ALA A CA  1 
ATOM   3221  C  C   . ALA A  1  415 ? -25.081 53.545  -10.386 1.00 30.97  ? 415 ALA A C   1 
ATOM   3222  O  O   . ALA A  1  415 ? -23.991 53.278  -10.862 1.00 29.68  ? 415 ALA A O   1 
ATOM   3223  C  CB  . ALA A  1  415 ? -26.937 54.419  -11.860 1.00 33.76  ? 415 ALA A CB  1 
ATOM   3224  N  N   . ILE A  1  416 ? -25.256 54.061  -9.179  1.00 28.40  ? 416 ILE A N   1 
ATOM   3225  C  CA  . ILE A  1  416 ? -24.157 54.502  -8.382  1.00 29.51  ? 416 ILE A CA  1 
ATOM   3226  C  C   . ILE A  1  416 ? -23.300 53.318  -7.974  1.00 30.42  ? 416 ILE A C   1 
ATOM   3227  O  O   . ILE A  1  416 ? -22.087 53.378  -8.105  1.00 29.75  ? 416 ILE A O   1 
ATOM   3228  C  CB  . ILE A  1  416 ? -24.604 55.271  -7.133  1.00 27.72  ? 416 ILE A CB  1 
ATOM   3229  C  CG1 . ILE A  1  416 ? -25.288 56.572  -7.520  1.00 27.90  ? 416 ILE A CG1 1 
ATOM   3230  C  CG2 . ILE A  1  416 ? -23.404 55.630  -6.286  1.00 28.50  ? 416 ILE A CG2 1 
ATOM   3231  C  CD1 . ILE A  1  416 ? -26.145 57.090  -6.385  1.00 29.34  ? 416 ILE A CD1 1 
ATOM   3232  N  N   . MET A  1  417 ? -23.937 52.258  -7.501  1.00 31.49  ? 417 MET A N   1 
ATOM   3233  C  CA  . MET A  1  417 ? -23.238 51.037  -7.094  1.00 31.48  ? 417 MET A CA  1 
ATOM   3234  C  C   . MET A  1  417 ? -22.516 50.409  -8.276  1.00 31.14  ? 417 MET A C   1 
ATOM   3235  O  O   . MET A  1  417 ? -21.404 49.879  -8.115  1.00 32.85  ? 417 MET A O   1 
ATOM   3236  C  CB  . MET A  1  417 ? -24.229 50.031  -6.514  1.00 33.15  ? 417 MET A CB  1 
ATOM   3237  C  CG  . MET A  1  417 ? -23.608 48.789  -5.897  1.00 34.90  ? 417 MET A CG  1 
ATOM   3238  S  SD  . MET A  1  417 ? -23.136 49.051  -4.201  1.00 40.78  ? 417 MET A SD  1 
ATOM   3239  C  CE  . MET A  1  417 ? -22.808 47.370  -3.692  1.00 42.39  ? 417 MET A CE  1 
ATOM   3240  N  N   . PHE A  1  418 ? -23.107 50.466  -9.460  1.00 27.77  ? 418 PHE A N   1 
ATOM   3241  C  CA  . PHE A  1  418 ? -22.451 49.855  -10.610 1.00 27.75  ? 418 PHE A CA  1 
ATOM   3242  C  C   . PHE A  1  418 ? -21.087 50.525  -10.951 1.00 30.17  ? 418 PHE A C   1 
ATOM   3243  O  O   . PHE A  1  418 ? -20.111 49.843  -11.339 1.00 26.39  ? 418 PHE A O   1 
ATOM   3244  C  CB  . PHE A  1  418 ? -23.381 49.909  -11.803 1.00 27.14  ? 418 PHE A CB  1 
ATOM   3245  C  CG  . PHE A  1  418 ? -22.902 49.139  -12.985 1.00 26.68  ? 418 PHE A CG  1 
ATOM   3246  C  CD1 . PHE A  1  418 ? -23.191 47.807  -13.109 1.00 26.97  ? 418 PHE A CD1 1 
ATOM   3247  C  CD2 . PHE A  1  418 ? -22.178 49.763  -13.982 1.00 28.04  ? 418 PHE A CD2 1 
ATOM   3248  C  CE1 . PHE A  1  418 ? -22.766 47.086  -14.223 1.00 30.75  ? 418 PHE A CE1 1 
ATOM   3249  C  CE2 . PHE A  1  418 ? -21.723 49.047  -15.089 1.00 29.78  ? 418 PHE A CE2 1 
ATOM   3250  C  CZ  . PHE A  1  418 ? -22.030 47.701  -15.215 1.00 29.73  ? 418 PHE A CZ  1 
ATOM   3251  N  N   . VAL A  1  419 ? -21.041 51.851  -10.790 1.00 29.26  ? 419 VAL A N   1 
ATOM   3252  C  CA  . VAL A  1  419 ? -19.874 52.633  -11.110 1.00 29.75  ? 419 VAL A CA  1 
ATOM   3253  C  C   . VAL A  1  419 ? -18.847 52.331  -10.027 1.00 27.80  ? 419 VAL A C   1 
ATOM   3254  O  O   . VAL A  1  419 ? -17.722 51.918  -10.313 1.00 28.60  ? 419 VAL A O   1 
ATOM   3255  C  CB  . VAL A  1  419 ? -20.209 54.156  -11.191 1.00 30.86  ? 419 VAL A CB  1 
ATOM   3256  C  CG1 . VAL A  1  419 ? -18.935 54.977  -11.343 1.00 31.60  ? 419 VAL A CG1 1 
ATOM   3257  C  CG2 . VAL A  1  419 ? -21.141 54.423  -12.369 1.00 30.76  ? 419 VAL A CG2 1 
ATOM   3258  N  N   . GLY A  1  420 ? -19.273 52.513  -8.791  1.00 25.43  ? 420 GLY A N   1 
ATOM   3259  C  CA  . GLY A  1  420 ? -18.500 52.165  -7.599  1.00 26.18  ? 420 GLY A CA  1 
ATOM   3260  C  C   . GLY A  1  420 ? -17.704 50.882  -7.580  1.00 26.37  ? 420 GLY A C   1 
ATOM   3261  O  O   . GLY A  1  420 ? -16.481 50.905  -7.366  1.00 28.60  ? 420 GLY A O   1 
ATOM   3262  N  N   . VAL A  1  421 ? -18.396 49.758  -7.749  1.00 26.82  ? 421 VAL A N   1 
ATOM   3263  C  CA  . VAL A  1  421 ? -17.745 48.452  -7.681  1.00 27.01  ? 421 VAL A CA  1 
ATOM   3264  C  C   . VAL A  1  421 ? -16.813 48.260  -8.846  1.00 26.24  ? 421 VAL A C   1 
ATOM   3265  O  O   . VAL A  1  421 ? -15.754 47.671  -8.656  1.00 26.01  ? 421 VAL A O   1 
ATOM   3266  C  CB  . VAL A  1  421 ? -18.707 47.224  -7.619  1.00 26.33  ? 421 VAL A CB  1 
ATOM   3267  C  CG1 . VAL A  1  421 ? -19.517 47.263  -6.364  1.00 25.78  ? 421 VAL A CG1 1 
ATOM   3268  C  CG2 . VAL A  1  421 ? -19.586 47.094  -8.870  1.00 27.46  ? 421 VAL A CG2 1 
ATOM   3269  N  N   . ASN A  1  422 ? -17.189 48.742  -10.037 1.00 26.31  ? 422 ASN A N   1 
ATOM   3270  C  CA  . ASN A  1  422 ? -16.305 48.575  -11.207 1.00 26.56  ? 422 ASN A CA  1 
ATOM   3271  C  C   . ASN A  1  422 ? -15.027 49.438  -11.129 1.00 27.34  ? 422 ASN A C   1 
ATOM   3272  O  O   . ASN A  1  422 ? -13.951 48.957  -11.462 1.00 26.80  ? 422 ASN A O   1 
ATOM   3273  C  CB  . ASN A  1  422 ? -17.028 48.743  -12.538 1.00 24.56  ? 422 ASN A CB  1 
ATOM   3274  C  CG  . ASN A  1  422 ? -17.884 47.560  -12.862 1.00 26.15  ? 422 ASN A CG  1 
ATOM   3275  O  OD1 . ASN A  1  422 ? -19.099 47.594  -12.630 1.00 31.48  ? 422 ASN A OD1 1 
ATOM   3276  N  ND2 . ASN A  1  422 ? -17.276 46.477  -13.329 1.00 25.12  ? 422 ASN A ND2 1 
ATOM   3277  N  N   . MET A  1  423 ? -15.147 50.676  -10.661 1.00 28.62  ? 423 MET A N   1 
ATOM   3278  C  CA  . MET A  1  423 ? -13.983 51.514  -10.431 1.00 31.49  ? 423 MET A CA  1 
ATOM   3279  C  C   . MET A  1  423 ? -13.070 50.944  -9.306  1.00 31.71  ? 423 MET A C   1 
ATOM   3280  O  O   . MET A  1  423 ? -11.839 51.084  -9.379  1.00 30.87  ? 423 MET A O   1 
ATOM   3281  C  CB  . MET A  1  423 ? -14.420 52.953  -10.116 1.00 35.75  ? 423 MET A CB  1 
ATOM   3282  C  CG  . MET A  1  423 ? -13.289 53.986  -10.102 1.00 39.92  ? 423 MET A CG  1 
ATOM   3283  S  SD  . MET A  1  423 ? -13.827 55.661  -9.645  1.00 45.66  ? 423 MET A SD  1 
ATOM   3284  C  CE  . MET A  1  423 ? -14.522 56.179  -11.215 1.00 48.57  ? 423 MET A CE  1 
ATOM   3285  N  N   . THR A  1  424 ? -13.654 50.309  -8.283  1.00 29.23  ? 424 THR A N   1 
ATOM   3286  C  CA  . THR A  1  424 ? -12.870 49.728  -7.193  1.00 27.92  ? 424 THR A CA  1 
ATOM   3287  C  C   . THR A  1  424 ? -12.058 48.515  -7.651  1.00 27.42  ? 424 THR A C   1 
ATOM   3288  O  O   . THR A  1  424 ? -10.856 48.466  -7.443  1.00 26.09  ? 424 THR A O   1 
ATOM   3289  C  CB  . THR A  1  424 ? -13.763 49.311  -6.020  1.00 27.79  ? 424 THR A CB  1 
ATOM   3290  O  OG1 . THR A  1  424 ? -14.517 50.436  -5.555  1.00 25.87  ? 424 THR A OG1 1 
ATOM   3291  C  CG2 . THR A  1  424 ? -12.924 48.766  -4.875  1.00 28.37  ? 424 THR A CG2 1 
ATOM   3292  N  N   . PHE A  1  425 ? -12.709 47.578  -8.328  1.00 27.56  ? 425 PHE A N   1 
ATOM   3293  C  CA  . PHE A  1  425 ? -12.115 46.256  -8.567  1.00 28.40  ? 425 PHE A CA  1 
ATOM   3294  C  C   . PHE A  1  425 ? -11.534 46.068  -9.917  1.00 28.89  ? 425 PHE A C   1 
ATOM   3295  O  O   . PHE A  1  425 ? -10.616 45.243  -10.045 1.00 29.63  ? 425 PHE A O   1 
ATOM   3296  C  CB  . PHE A  1  425 ? -13.116 45.125  -8.257  1.00 28.07  ? 425 PHE A CB  1 
ATOM   3297  C  CG  . PHE A  1  425 ? -13.554 45.161  -6.832  1.00 27.32  ? 425 PHE A CG  1 
ATOM   3298  C  CD1 . PHE A  1  425 ? -12.633 44.907  -5.838  1.00 26.97  ? 425 PHE A CD1 1 
ATOM   3299  C  CD2 . PHE A  1  425 ? -14.817 45.561  -6.494  1.00 25.68  ? 425 PHE A CD2 1 
ATOM   3300  C  CE1 . PHE A  1  425 ? -12.996 44.993  -4.523  1.00 29.38  ? 425 PHE A CE1 1 
ATOM   3301  C  CE2 . PHE A  1  425 ? -15.197 45.674  -5.183  1.00 27.80  ? 425 PHE A CE2 1 
ATOM   3302  C  CZ  . PHE A  1  425 ? -14.291 45.389  -4.191  1.00 28.99  ? 425 PHE A CZ  1 
ATOM   3303  N  N   . PHE A  1  426 ? -11.995 46.814  -10.929 1.00 27.09  ? 426 PHE A N   1 
ATOM   3304  C  CA  . PHE A  1  426 ? -11.425 46.547  -12.235 1.00 27.51  ? 426 PHE A CA  1 
ATOM   3305  C  C   . PHE A  1  426 ? -9.895  46.760  -12.297 1.00 27.08  ? 426 PHE A C   1 
ATOM   3306  O  O   . PHE A  1  426 ? -9.178  45.855  -12.724 1.00 27.87  ? 426 PHE A O   1 
ATOM   3307  C  CB  . PHE A  1  426 ? -12.127 47.252  -13.374 1.00 27.84  ? 426 PHE A CB  1 
ATOM   3308  C  CG  . PHE A  1  426 ? -11.670 46.763  -14.696 1.00 29.05  ? 426 PHE A CG  1 
ATOM   3309  C  CD1 . PHE A  1  426 ? -12.119 45.536  -15.179 1.00 30.80  ? 426 PHE A CD1 1 
ATOM   3310  C  CD2 . PHE A  1  426 ? -10.718 47.470  -15.423 1.00 31.93  ? 426 PHE A CD2 1 
ATOM   3311  C  CE1 . PHE A  1  426 ? -11.683 45.048  -16.394 1.00 31.57  ? 426 PHE A CE1 1 
ATOM   3312  C  CE2 . PHE A  1  426 ? -10.284 46.987  -16.643 1.00 32.75  ? 426 PHE A CE2 1 
ATOM   3313  C  CZ  . PHE A  1  426 ? -10.763 45.776  -17.126 1.00 31.86  ? 426 PHE A CZ  1 
ATOM   3314  N  N   . PRO A  1  427 ? -9.400  47.927  -11.847 1.00 25.28  ? 427 PRO A N   1 
ATOM   3315  C  CA  . PRO A  1  427 ? -7.952  48.207  -11.888 1.00 26.30  ? 427 PRO A CA  1 
ATOM   3316  C  C   . PRO A  1  427 ? -7.088  47.202  -11.122 1.00 27.36  ? 427 PRO A C   1 
ATOM   3317  O  O   . PRO A  1  427 ? -5.905  47.073  -11.448 1.00 26.23  ? 427 PRO A O   1 
ATOM   3318  C  CB  . PRO A  1  427 ? -7.817  49.562  -11.201 1.00 24.77  ? 427 PRO A CB  1 
ATOM   3319  C  CG  . PRO A  1  427 ? -9.174  50.093  -11.149 1.00 25.66  ? 427 PRO A CG  1 
ATOM   3320  C  CD  . PRO A  1  427 ? -10.119 48.957  -11.096 1.00 24.22  ? 427 PRO A CD  1 
ATOM   3321  N  N   . GLN A  1  428 ? -7.675  46.520  -10.123 1.00 24.76  ? 428 GLN A N   1 
ATOM   3322  C  CA  . GLN A  1  428 ? -6.980  45.479  -9.381  1.00 24.05  ? 428 GLN A CA  1 
ATOM   3323  C  C   . GLN A  1  428 ? -6.438  44.335  -10.253 1.00 24.20  ? 428 GLN A C   1 
ATOM   3324  O  O   . GLN A  1  428 ? -5.475  43.666  -9.864  1.00 24.99  ? 428 GLN A O   1 
ATOM   3325  C  CB  . GLN A  1  428 ? -7.858  44.943  -8.235  1.00 25.01  ? 428 GLN A CB  1 
ATOM   3326  C  CG  . GLN A  1  428 ? -8.225  46.035  -7.194  1.00 24.54  ? 428 GLN A CG  1 
ATOM   3327  C  CD  . GLN A  1  428 ? -8.942  45.539  -5.952  1.00 23.22  ? 428 GLN A CD  1 
ATOM   3328  O  OE1 . GLN A  1  428 ? -9.146  46.307  -5.005  1.00 27.22  ? 428 GLN A OE1 1 
ATOM   3329  N  NE2 . GLN A  1  428 ? -9.332  44.291  -5.941  1.00 20.86  ? 428 GLN A NE2 1 
ATOM   3330  N  N   . HIS A  1  429 ? -7.014  44.109  -11.435 1.00 24.59  ? 429 HIS A N   1 
ATOM   3331  C  CA  . HIS A  1  429 ? -6.447  43.131  -12.379 1.00 24.57  ? 429 HIS A CA  1 
ATOM   3332  C  C   . HIS A  1  429 ? -5.024  43.552  -12.778 1.00 27.48  ? 429 HIS A C   1 
ATOM   3333  O  O   . HIS A  1  429 ? -4.139  42.693  -12.911 1.00 26.46  ? 429 HIS A O   1 
ATOM   3334  C  CB  . HIS A  1  429 ? -7.294  42.961  -13.661 1.00 24.16  ? 429 HIS A CB  1 
ATOM   3335  C  CG  . HIS A  1  429 ? -8.691  42.461  -13.435 1.00 27.21  ? 429 HIS A CG  1 
ATOM   3336  N  ND1 . HIS A  1  429 ? -9.797  43.282  -13.522 1.00 28.72  ? 429 HIS A ND1 1 
ATOM   3337  C  CD2 . HIS A  1  429 ? -9.168  41.213  -13.180 1.00 27.73  ? 429 HIS A CD2 1 
ATOM   3338  C  CE1 . HIS A  1  429 ? -10.889 42.562  -13.308 1.00 29.09  ? 429 HIS A CE1 1 
ATOM   3339  N  NE2 . HIS A  1  429 ? -10.535 41.304  -13.101 1.00 26.64  ? 429 HIS A NE2 1 
ATOM   3340  N  N   . PHE A  1  430 ? -4.832  44.868  -12.996 1.00 27.78  ? 430 PHE A N   1 
ATOM   3341  C  CA  . PHE A  1  430 ? -3.553  45.409  -13.403 1.00 28.34  ? 430 PHE A CA  1 
ATOM   3342  C  C   . PHE A  1  430 ? -2.535  45.264  -12.268 1.00 30.61  ? 430 PHE A C   1 
ATOM   3343  O  O   . PHE A  1  430 ? -1.416  44.781  -12.468 1.00 29.63  ? 430 PHE A O   1 
ATOM   3344  C  CB  . PHE A  1  430 ? -3.677  46.859  -13.802 1.00 29.81  ? 430 PHE A CB  1 
ATOM   3345  C  CG  . PHE A  1  430 ? -4.752  47.120  -14.815 1.00 31.26  ? 430 PHE A CG  1 
ATOM   3346  C  CD1 . PHE A  1  430 ? -4.881  46.313  -15.955 1.00 31.30  ? 430 PHE A CD1 1 
ATOM   3347  C  CD2 . PHE A  1  430 ? -5.624  48.204  -14.655 1.00 31.79  ? 430 PHE A CD2 1 
ATOM   3348  C  CE1 . PHE A  1  430 ? -5.873  46.565  -16.893 1.00 31.87  ? 430 PHE A CE1 1 
ATOM   3349  C  CE2 . PHE A  1  430 ? -6.619  48.462  -15.598 1.00 31.94  ? 430 PHE A CE2 1 
ATOM   3350  C  CZ  . PHE A  1  430 ? -6.746  47.643  -16.713 1.00 31.11  ? 430 PHE A CZ  1 
ATOM   3351  N  N   . LEU A  1  431 ? -2.947  45.626  -11.061 1.00 29.32  ? 431 LEU A N   1 
ATOM   3352  C  CA  . LEU A  1  431 ? -2.078  45.512  -9.918  1.00 27.79  ? 431 LEU A CA  1 
ATOM   3353  C  C   . LEU A  1  431 ? -1.582  44.079  -9.792  1.00 29.65  ? 431 LEU A C   1 
ATOM   3354  O  O   . LEU A  1  431 ? -0.399  43.857  -9.522  1.00 31.66  ? 431 LEU A O   1 
ATOM   3355  C  CB  . LEU A  1  431 ? -2.808  45.957  -8.654  1.00 28.34  ? 431 LEU A CB  1 
ATOM   3356  C  CG  . LEU A  1  431 ? -3.058  47.449  -8.633  1.00 29.52  ? 431 LEU A CG  1 
ATOM   3357  C  CD1 . LEU A  1  431 ? -3.902  47.911  -7.439  1.00 28.82  ? 431 LEU A CD1 1 
ATOM   3358  C  CD2 . LEU A  1  431 ? -1.717  48.166  -8.694  1.00 30.74  ? 431 LEU A CD2 1 
ATOM   3359  N  N   . GLY A  1  432 ? -2.469  43.115  -10.030 1.00 28.30  ? 432 GLY A N   1 
ATOM   3360  C  CA  . GLY A  1  432 ? -2.122  41.726  -9.895  1.00 26.97  ? 432 GLY A CA  1 
ATOM   3361  C  C   . GLY A  1  432 ? -1.239  41.197  -10.987 1.00 26.62  ? 432 GLY A C   1 
ATOM   3362  O  O   . GLY A  1  432 ? -0.267  40.516  -10.718 1.00 26.01  ? 432 GLY A O   1 
ATOM   3363  N  N   . LEU A  1  433 ? -1.550  41.500  -12.241 1.00 28.34  ? 433 LEU A N   1 
ATOM   3364  C  CA  . LEU A  1  433 ? -0.649  41.081  -13.320 1.00 27.79  ? 433 LEU A CA  1 
ATOM   3365  C  C   . LEU A  1  433 ? 0.718   41.718  -13.127 1.00 27.86  ? 433 LEU A C   1 
ATOM   3366  O  O   . LEU A  1  433 ? 1.702   41.104  -13.446 1.00 28.73  ? 433 LEU A O   1 
ATOM   3367  C  CB  . LEU A  1  433 ? -1.208  41.416  -14.695 1.00 29.27  ? 433 LEU A CB  1 
ATOM   3368  C  CG  . LEU A  1  433 ? -2.473  40.631  -15.080 1.00 29.89  ? 433 LEU A CG  1 
ATOM   3369  C  CD1 . LEU A  1  433 ? -3.259  41.389  -16.122 1.00 31.46  ? 433 LEU A CD1 1 
ATOM   3370  C  CD2 . LEU A  1  433 ? -2.194  39.243  -15.591 1.00 29.27  ? 433 LEU A CD2 1 
ATOM   3371  N  N   . SER A  1  434 ? 0.777   42.937  -12.563 1.00 28.44  ? 434 SER A N   1 
ATOM   3372  C  CA  . SER A  1  434 ? 2.025   43.681  -12.435 1.00 26.52  ? 434 SER A CA  1 
ATOM   3373  C  C   . SER A  1  434 ? 2.768   43.318  -11.160 1.00 27.20  ? 434 SER A C   1 
ATOM   3374  O  O   . SER A  1  434 ? 3.833   43.862  -10.875 1.00 29.27  ? 434 SER A O   1 
ATOM   3375  C  CB  . SER A  1  434 ? 1.784   45.191  -12.577 1.00 26.72  ? 434 SER A CB  1 
ATOM   3376  O  OG  . SER A  1  434 ? 1.136   45.745  -11.464 1.00 26.83  ? 434 SER A OG  1 
ATOM   3377  N  N   . GLY A  1  435 ? 2.195   42.394  -10.392 1.00 26.87  ? 435 GLY A N   1 
ATOM   3378  C  CA  . GLY A  1  435 ? 2.868   41.737  -9.316  1.00 24.37  ? 435 GLY A CA  1 
ATOM   3379  C  C   . GLY A  1  435 ? 2.614   42.263  -7.939  1.00 25.10  ? 435 GLY A C   1 
ATOM   3380  O  O   . GLY A  1  435 ? 3.364   41.869  -7.024  1.00 26.89  ? 435 GLY A O   1 
ATOM   3381  N  N   . MET A  1  436 ? 1.590   43.106  -7.730  1.00 24.89  ? 436 MET A N   1 
ATOM   3382  C  CA  . MET A  1  436 ? 1.369   43.651  -6.368  1.00 25.91  ? 436 MET A CA  1 
ATOM   3383  C  C   . MET A  1  436 ? 0.825   42.546  -5.496  1.00 27.03  ? 436 MET A C   1 
ATOM   3384  O  O   . MET A  1  436 ? -0.176  41.965  -5.810  1.00 27.15  ? 436 MET A O   1 
ATOM   3385  C  CB  . MET A  1  436 ? 0.409   44.842  -6.304  1.00 25.51  ? 436 MET A CB  1 
ATOM   3386  C  CG  . MET A  1  436 ? 0.314   45.435  -4.911  1.00 24.94  ? 436 MET A CG  1 
ATOM   3387  S  SD  . MET A  1  436 ? -1.125  46.502  -4.826  1.00 28.58  ? 436 MET A SD  1 
ATOM   3388  C  CE  . MET A  1  436 ? -1.324  46.642  -3.057  1.00 28.08  ? 436 MET A CE  1 
ATOM   3389  N  N   . PRO A  1  437 ? 1.481   42.259  -4.379  1.00 29.07  ? 437 PRO A N   1 
ATOM   3390  C  CA  . PRO A  1  437 ? 0.886   41.173  -3.601  1.00 28.49  ? 437 PRO A CA  1 
ATOM   3391  C  C   . PRO A  1  437 ? -0.416  41.540  -2.891  1.00 27.84  ? 437 PRO A C   1 
ATOM   3392  O  O   . PRO A  1  437 ? -0.735  42.702  -2.800  1.00 26.51  ? 437 PRO A O   1 
ATOM   3393  C  CB  . PRO A  1  437 ? 2.002   40.820  -2.610  1.00 28.93  ? 437 PRO A CB  1 
ATOM   3394  C  CG  . PRO A  1  437 ? 3.265   41.258  -3.333  1.00 30.42  ? 437 PRO A CG  1 
ATOM   3395  C  CD  . PRO A  1  437 ? 2.853   42.564  -3.931  1.00 28.48  ? 437 PRO A CD  1 
ATOM   3396  N  N   . ARG A  1  438 ? -1.147  40.524  -2.424  1.00 27.48  ? 438 ARG A N   1 
ATOM   3397  C  CA  . ARG A  1  438 ? -2.252  40.677  -1.492  1.00 26.44  ? 438 ARG A CA  1 
ATOM   3398  C  C   . ARG A  1  438 ? -1.708  40.911  -0.144  1.00 27.23  ? 438 ARG A C   1 
ATOM   3399  O  O   . ARG A  1  438 ? -0.612  40.453  0.172   1.00 29.04  ? 438 ARG A O   1 
ATOM   3400  C  CB  . ARG A  1  438 ? -2.990  39.339  -1.278  1.00 28.71  ? 438 ARG A CB  1 
ATOM   3401  C  CG  . ARG A  1  438 ? -3.775  38.902  -2.435  1.00 30.03  ? 438 ARG A CG  1 
ATOM   3402  C  CD  . ARG A  1  438 ? -4.438  37.579  -2.183  1.00 28.31  ? 438 ARG A CD  1 
ATOM   3403  N  NE  . ARG A  1  438 ? -5.504  37.583  -1.213  1.00 25.77  ? 438 ARG A NE  1 
ATOM   3404  C  CZ  . ARG A  1  438 ? -6.312  36.548  -1.034  1.00 24.99  ? 438 ARG A CZ  1 
ATOM   3405  N  NH1 . ARG A  1  438 ? -6.206  35.476  -1.794  1.00 24.83  ? 438 ARG A NH1 1 
ATOM   3406  N  NH2 . ARG A  1  438 ? -7.216  36.578  -0.080  1.00 26.25  ? 438 ARG A NH2 1 
ATOM   3407  N  N   . ARG A  1  439 ? -2.577  41.434  0.714   1.00 27.07  ? 439 ARG A N   1 
ATOM   3408  C  CA  . ARG A  1  439 ? -2.350  41.545  2.157   1.00 25.37  ? 439 ARG A CA  1 
ATOM   3409  C  C   . ARG A  1  439 ? -1.191  42.481  2.516   1.00 24.80  ? 439 ARG A C   1 
ATOM   3410  O  O   . ARG A  1  439 ? -0.594  42.376  3.569   1.00 25.04  ? 439 ARG A O   1 
ATOM   3411  C  CB  . ARG A  1  439 ? -2.256  40.163  2.769   1.00 25.57  ? 439 ARG A CB  1 
ATOM   3412  C  CG  . ARG A  1  439 ? -3.579  39.427  2.649   1.00 25.52  ? 439 ARG A CG  1 
ATOM   3413  C  CD  . ARG A  1  439 ? -3.433  37.929  2.564   1.00 25.53  ? 439 ARG A CD  1 
ATOM   3414  N  NE  . ARG A  1  439 ? -4.637  37.211  2.988   1.00 25.17  ? 439 ARG A NE  1 
ATOM   3415  C  CZ  . ARG A  1  439 ? -4.758  35.882  2.982   1.00 25.64  ? 439 ARG A CZ  1 
ATOM   3416  N  NH1 . ARG A  1  439 ? -3.747  35.090  2.615   1.00 25.69  ? 439 ARG A NH1 1 
ATOM   3417  N  NH2 . ARG A  1  439 ? -5.909  35.335  3.355   1.00 26.07  ? 439 ARG A NH2 1 
ATOM   3418  N  N   . TYR A  1  440 ? -0.991  43.483  1.657   1.00 26.19  ? 440 TYR A N   1 
ATOM   3419  C  CA  . TYR A  1  440 ? -0.011  44.540  1.836   1.00 27.75  ? 440 TYR A CA  1 
ATOM   3420  C  C   . TYR A  1  440 ? -0.658  45.863  2.245   1.00 26.97  ? 440 TYR A C   1 
ATOM   3421  O  O   . TYR A  1  440 ? -1.603  46.329  1.620   1.00 26.72  ? 440 TYR A O   1 
ATOM   3422  C  CB  . TYR A  1  440 ? 0.767   44.727  0.552   1.00 28.65  ? 440 TYR A CB  1 
ATOM   3423  C  CG  . TYR A  1  440 ? 1.997   43.830  0.398   1.00 30.32  ? 440 TYR A CG  1 
ATOM   3424  C  CD1 . TYR A  1  440 ? 2.044   42.515  0.897   1.00 27.81  ? 440 TYR A CD1 1 
ATOM   3425  C  CD2 . TYR A  1  440 ? 3.108   44.303  -0.304  1.00 30.04  ? 440 TYR A CD2 1 
ATOM   3426  C  CE1 . TYR A  1  440 ? 3.168   41.720  0.700   1.00 28.34  ? 440 TYR A CE1 1 
ATOM   3427  C  CE2 . TYR A  1  440 ? 4.238   43.530  -0.478  1.00 30.25  ? 440 TYR A CE2 1 
ATOM   3428  C  CZ  . TYR A  1  440 ? 4.270   42.245  0.018   1.00 30.06  ? 440 TYR A CZ  1 
ATOM   3429  O  OH  . TYR A  1  440 ? 5.409   41.520  -0.216  1.00 27.76  ? 440 TYR A OH  1 
ATOM   3430  N  N   . SER A  1  441 ? -0.137  46.440  3.315   1.00 27.02  ? 441 SER A N   1 
ATOM   3431  C  CA  . SER A  1  441 ? -0.527  47.772  3.779   1.00 28.44  ? 441 SER A CA  1 
ATOM   3432  C  C   . SER A  1  441 ? 0.097   48.948  2.981   1.00 28.22  ? 441 SER A C   1 
ATOM   3433  O  O   . SER A  1  441 ? -0.324  50.114  3.114   1.00 30.84  ? 441 SER A O   1 
ATOM   3434  C  CB  . SER A  1  441 ? -0.110  47.901  5.214   1.00 29.66  ? 441 SER A CB  1 
ATOM   3435  O  OG  . SER A  1  441 ? 1.302   47.871  5.225   1.00 33.08  ? 441 SER A OG  1 
ATOM   3436  N  N   . ASP A  1  442 ? 1.085   48.649  2.150   1.00 28.62  ? 442 ASP A N   1 
ATOM   3437  C  CA  . ASP A  1  442 ? 1.734   49.674  1.344   1.00 30.11  ? 442 ASP A CA  1 
ATOM   3438  C  C   . ASP A  1  442 ? 2.415   48.977  0.190   1.00 28.66  ? 442 ASP A C   1 
ATOM   3439  O  O   . ASP A  1  442 ? 2.628   47.812  0.271   1.00 35.30  ? 442 ASP A O   1 
ATOM   3440  C  CB  . ASP A  1  442 ? 2.722   50.444  2.197   1.00 31.04  ? 442 ASP A CB  1 
ATOM   3441  C  CG  . ASP A  1  442 ? 3.200   51.758  1.554   1.00 33.00  ? 442 ASP A CG  1 
ATOM   3442  O  OD1 . ASP A  1  442 ? 2.717   52.190  0.485   1.00 34.46  ? 442 ASP A OD1 1 
ATOM   3443  O  OD2 . ASP A  1  442 ? 4.117   52.372  2.129   1.00 32.61  ? 442 ASP A OD2 1 
ATOM   3444  N  N   . TYR A  1  443 ? 2.710   49.682  -0.887  1.00 27.77  ? 443 TYR A N   1 
ATOM   3445  C  CA  . TYR A  1  443 ? 3.179   49.092  -2.134  1.00 28.51  ? 443 TYR A CA  1 
ATOM   3446  C  C   . TYR A  1  443 ? 4.297   49.929  -2.742  1.00 28.64  ? 443 TYR A C   1 
ATOM   3447  O  O   . TYR A  1  443 ? 4.293   51.142  -2.626  1.00 27.09  ? 443 TYR A O   1 
ATOM   3448  C  CB  . TYR A  1  443 ? 2.032   49.085  -3.163  1.00 29.24  ? 443 TYR A CB  1 
ATOM   3449  C  CG  . TYR A  1  443 ? 1.150   50.304  -3.066  1.00 27.51  ? 443 TYR A CG  1 
ATOM   3450  C  CD1 . TYR A  1  443 ? 1.454   51.480  -3.753  1.00 26.46  ? 443 TYR A CD1 1 
ATOM   3451  C  CD2 . TYR A  1  443 ? 0.025   50.283  -2.273  1.00 29.09  ? 443 TYR A CD2 1 
ATOM   3452  C  CE1 . TYR A  1  443 ? 0.659   52.594  -3.656  1.00 26.78  ? 443 TYR A CE1 1 
ATOM   3453  C  CE2 . TYR A  1  443 ? -0.806  51.402  -2.166  1.00 30.07  ? 443 TYR A CE2 1 
ATOM   3454  C  CZ  . TYR A  1  443 ? -0.485  52.557  -2.843  1.00 28.78  ? 443 TYR A CZ  1 
ATOM   3455  O  OH  . TYR A  1  443 ? -1.313  53.648  -2.678  1.00 26.36  ? 443 TYR A OH  1 
ATOM   3456  N  N   . PRO A  1  444 ? 5.215   49.291  -3.468  1.00 29.56  ? 444 PRO A N   1 
ATOM   3457  C  CA  . PRO A  1  444 ? 6.172   50.052  -4.242  1.00 29.20  ? 444 PRO A CA  1 
ATOM   3458  C  C   . PRO A  1  444 ? 5.487   51.152  -5.093  1.00 32.14  ? 444 PRO A C   1 
ATOM   3459  O  O   . PRO A  1  444 ? 4.321   50.980  -5.525  1.00 30.36  ? 444 PRO A O   1 
ATOM   3460  C  CB  . PRO A  1  444 ? 6.804   49.004  -5.147  1.00 30.69  ? 444 PRO A CB  1 
ATOM   3461  C  CG  . PRO A  1  444 ? 6.636   47.731  -4.425  1.00 32.81  ? 444 PRO A CG  1 
ATOM   3462  C  CD  . PRO A  1  444 ? 5.330   47.842  -3.699  1.00 31.14  ? 444 PRO A CD  1 
ATOM   3463  N  N   . ASP A  1  445 ? 6.234   52.237  -5.357  1.00 30.11  ? 445 ASP A N   1 
ATOM   3464  C  CA  . ASP A  1  445 ? 5.665   53.495  -5.839  1.00 29.80  ? 445 ASP A CA  1 
ATOM   3465  C  C   . ASP A  1  445 ? 4.942   53.323  -7.184  1.00 28.79  ? 445 ASP A C   1 
ATOM   3466  O  O   . ASP A  1  445 ? 3.913   53.944  -7.420  1.00 27.80  ? 445 ASP A O   1 
ATOM   3467  C  CB  . ASP A  1  445 ? 6.751   54.583  -5.950  1.00 31.34  ? 445 ASP A CB  1 
ATOM   3468  C  CG  . ASP A  1  445 ? 7.287   55.081  -4.595  1.00 32.06  ? 445 ASP A CG  1 
ATOM   3469  O  OD1 . ASP A  1  445 ? 6.789   54.684  -3.513  1.00 30.19  ? 445 ASP A OD1 1 
ATOM   3470  O  OD2 . ASP A  1  445 ? 8.241   55.911  -4.636  1.00 36.87  ? 445 ASP A OD2 1 
ATOM   3471  N  N   . ALA A  1  446 ? 5.471   52.442  -8.029  1.00 26.32  ? 446 ALA A N   1 
ATOM   3472  C  CA  . ALA A  1  446 ? 4.863   52.099  -9.294  1.00 27.72  ? 446 ALA A CA  1 
ATOM   3473  C  C   . ALA A  1  446 ? 3.347   51.806  -9.299  1.00 31.53  ? 446 ALA A C   1 
ATOM   3474  O  O   . ALA A  1  446 ? 2.680   52.057  -10.314 1.00 35.53  ? 446 ALA A O   1 
ATOM   3475  C  CB  . ALA A  1  446 ? 5.582   50.894  -9.862  1.00 27.83  ? 446 ALA A CB  1 
ATOM   3476  N  N   . TYR A  1  447 ? 2.834   51.224  -8.208  1.00 31.33  ? 447 TYR A N   1 
ATOM   3477  C  CA  . TYR A  1  447 ? 1.465   50.700  -8.141  1.00 30.99  ? 447 TYR A CA  1 
ATOM   3478  C  C   . TYR A  1  447 ? 0.425   51.763  -7.690  1.00 31.29  ? 447 TYR A C   1 
ATOM   3479  O  O   . TYR A  1  447 ? -0.750  51.465  -7.488  1.00 32.24  ? 447 TYR A O   1 
ATOM   3480  C  CB  . TYR A  1  447 ? 1.449   49.506  -7.163  1.00 28.81  ? 447 TYR A CB  1 
ATOM   3481  C  CG  . TYR A  1  447 ? 2.287   48.326  -7.567  1.00 26.47  ? 447 TYR A CG  1 
ATOM   3482  C  CD1 . TYR A  1  447 ? 2.065   47.666  -8.756  1.00 29.49  ? 447 TYR A CD1 1 
ATOM   3483  C  CD2 . TYR A  1  447 ? 3.246   47.816  -6.741  1.00 26.88  ? 447 TYR A CD2 1 
ATOM   3484  C  CE1 . TYR A  1  447 ? 2.830   46.558  -9.123  1.00 28.72  ? 447 TYR A CE1 1 
ATOM   3485  C  CE2 . TYR A  1  447 ? 4.004   46.710  -7.099  1.00 26.10  ? 447 TYR A CE2 1 
ATOM   3486  C  CZ  . TYR A  1  447 ? 3.790   46.085  -8.294  1.00 26.79  ? 447 TYR A CZ  1 
ATOM   3487  O  OH  . TYR A  1  447 ? 4.508   44.970  -8.695  1.00 27.41  ? 447 TYR A OH  1 
ATOM   3488  N  N   . THR A  1  448 ? 0.891   52.993  -7.520  1.00 30.45  ? 448 THR A N   1 
ATOM   3489  C  CA  . THR A  1  448 ? 0.122   54.084  -6.962  1.00 29.74  ? 448 THR A CA  1 
ATOM   3490  C  C   . THR A  1  448 ? -1.148  54.419  -7.764  1.00 28.89  ? 448 THR A C   1 
ATOM   3491  O  O   . THR A  1  448 ? -2.221  54.578  -7.197  1.00 28.27  ? 448 THR A O   1 
ATOM   3492  C  CB  . THR A  1  448 ? 1.040   55.338  -6.835  1.00 29.80  ? 448 THR A CB  1 
ATOM   3493  O  OG1 . THR A  1  448 ? 2.143   55.026  -5.978  1.00 29.08  ? 448 THR A OG1 1 
ATOM   3494  C  CG2 . THR A  1  448 ? 0.314   56.507  -6.254  1.00 30.62  ? 448 THR A CG2 1 
ATOM   3495  N  N   . MET A  1  449 ? -1.038  54.538  -9.076  1.00 31.50  ? 449 MET A N   1 
ATOM   3496  C  CA  . MET A  1  449 ? -2.165  55.058  -9.815  1.00 32.35  ? 449 MET A CA  1 
ATOM   3497  C  C   . MET A  1  449 ? -3.392  54.156  -9.606  1.00 30.42  ? 449 MET A C   1 
ATOM   3498  O  O   . MET A  1  449 ? -4.482  54.657  -9.264  1.00 28.35  ? 449 MET A O   1 
ATOM   3499  C  CB  . MET A  1  449 ? -1.881  55.278  -11.300 1.00 34.09  ? 449 MET A CB  1 
ATOM   3500  C  CG  . MET A  1  449 ? -2.993  56.130  -11.943 1.00 39.69  ? 449 MET A CG  1 
ATOM   3501  S  SD  . MET A  1  449 ? -2.861  56.275  -13.718 1.00 50.30  ? 449 MET A SD  1 
ATOM   3502  C  CE  . MET A  1  449 ? -1.520  57.453  -13.772 1.00 55.20  ? 449 MET A CE  1 
ATOM   3503  N  N   . TRP A  1  450 ? -3.199  52.842  -9.765  1.00 29.39  ? 450 TRP A N   1 
ATOM   3504  C  CA  . TRP A  1  450 ? -4.323  51.907  -9.711  1.00 28.51  ? 450 TRP A CA  1 
ATOM   3505  C  C   . TRP A  1  450 ? -4.843  51.836  -8.294  1.00 26.18  ? 450 TRP A C   1 
ATOM   3506  O  O   . TRP A  1  450 ? -6.034  51.848  -8.105  1.00 24.44  ? 450 TRP A O   1 
ATOM   3507  C  CB  . TRP A  1  450 ? -3.974  50.547  -10.275 1.00 28.73  ? 450 TRP A CB  1 
ATOM   3508  C  CG  . TRP A  1  450 ? -3.479  50.603  -11.690 1.00 28.82  ? 450 TRP A CG  1 
ATOM   3509  C  CD1 . TRP A  1  450 ? -2.392  49.969  -12.184 1.00 28.61  ? 450 TRP A CD1 1 
ATOM   3510  C  CD2 . TRP A  1  450 ? -4.062  51.306  -12.793 1.00 29.51  ? 450 TRP A CD2 1 
ATOM   3511  N  NE1 . TRP A  1  450 ? -2.242  50.236  -13.515 1.00 27.23  ? 450 TRP A NE1 1 
ATOM   3512  C  CE2 . TRP A  1  450 ? -3.254  51.057  -13.912 1.00 28.43  ? 450 TRP A CE2 1 
ATOM   3513  C  CE3 . TRP A  1  450 ? -5.192  52.122  -12.943 1.00 31.60  ? 450 TRP A CE3 1 
ATOM   3514  C  CZ2 . TRP A  1  450 ? -3.524  51.596  -15.152 1.00 32.30  ? 450 TRP A CZ2 1 
ATOM   3515  C  CZ3 . TRP A  1  450 ? -5.471  52.655  -14.188 1.00 30.80  ? 450 TRP A CZ3 1 
ATOM   3516  C  CH2 . TRP A  1  450 ? -4.654  52.385  -15.274 1.00 33.77  ? 450 TRP A CH2 1 
ATOM   3517  N  N   . ASN A  1  451 ? -3.975  51.898  -7.287  1.00 26.08  ? 451 ASN A N   1 
ATOM   3518  C  CA  . ASN A  1  451 ? -4.499  51.874  -5.926  1.00 26.32  ? 451 ASN A CA  1 
ATOM   3519  C  C   . ASN A  1  451 ? -5.322  53.100  -5.638  1.00 28.33  ? 451 ASN A C   1 
ATOM   3520  O  O   . ASN A  1  451 ? -6.352  53.012  -4.973  1.00 28.26  ? 451 ASN A O   1 
ATOM   3521  C  CB  . ASN A  1  451 ? -3.384  51.662  -4.937  1.00 27.29  ? 451 ASN A CB  1 
ATOM   3522  C  CG  . ASN A  1  451 ? -3.004  50.201  -4.830  1.00 27.86  ? 451 ASN A CG  1 
ATOM   3523  O  OD1 . ASN A  1  451 ? -3.780  49.433  -4.305  1.00 26.68  ? 451 ASN A OD1 1 
ATOM   3524  N  ND2 . ASN A  1  451 ? -1.853  49.808  -5.388  1.00 28.61  ? 451 ASN A ND2 1 
ATOM   3525  N  N   . THR A  1  452 ? -4.909  54.237  -6.212  1.00 31.11  ? 452 THR A N   1 
ATOM   3526  C  CA  . THR A  1  452 ? -5.573  55.514  -5.960  1.00 31.46  ? 452 THR A CA  1 
ATOM   3527  C  C   . THR A  1  452 ? -6.975  55.531  -6.558  1.00 29.78  ? 452 THR A C   1 
ATOM   3528  O  O   . THR A  1  452 ? -7.907  55.998  -5.921  1.00 26.76  ? 452 THR A O   1 
ATOM   3529  C  CB  . THR A  1  452 ? -4.759  56.710  -6.530  1.00 31.16  ? 452 THR A CB  1 
ATOM   3530  O  OG1 . THR A  1  452 ? -3.478  56.768  -5.907  1.00 30.08  ? 452 THR A OG1 1 
ATOM   3531  C  CG2 . THR A  1  452 ? -5.486  58.036  -6.276  1.00 31.09  ? 452 THR A CG2 1 
ATOM   3532  N  N   . ILE A  1  453 ? -7.084  55.058  -7.798  1.00 29.10  ? 453 ILE A N   1 
ATOM   3533  C  CA  . ILE A  1  453 ? -8.365  54.992  -8.453  1.00 31.37  ? 453 ILE A CA  1 
ATOM   3534  C  C   . ILE A  1  453 ? -9.266  54.034  -7.679  1.00 30.00  ? 453 ILE A C   1 
ATOM   3535  O  O   . ILE A  1  453 ? -10.406 54.357  -7.401  1.00 30.00  ? 453 ILE A O   1 
ATOM   3536  C  CB  . ILE A  1  453 ? -8.215  54.589  -9.926  1.00 35.04  ? 453 ILE A CB  1 
ATOM   3537  C  CG1 . ILE A  1  453 ? -7.689  55.785  -10.739 1.00 38.30  ? 453 ILE A CG1 1 
ATOM   3538  C  CG2 . ILE A  1  453 ? -9.550  54.125  -10.519 1.00 38.05  ? 453 ILE A CG2 1 
ATOM   3539  C  CD1 . ILE A  1  453 ? -7.082  55.404  -12.091 1.00 39.22  ? 453 ILE A CD1 1 
ATOM   3540  N  N   . SER A  1  454 ? -8.717  52.884  -7.302  1.00 29.65  ? 454 SER A N   1 
ATOM   3541  C  CA  . SER A  1  454 ? -9.458  51.829  -6.663  1.00 28.74  ? 454 SER A CA  1 
ATOM   3542  C  C   . SER A  1  454 ? -10.044 52.322  -5.355  1.00 30.86  ? 454 SER A C   1 
ATOM   3543  O  O   . SER A  1  454 ? -11.220 52.085  -5.059  1.00 31.15  ? 454 SER A O   1 
ATOM   3544  C  CB  . SER A  1  454 ? -8.574  50.616  -6.422  1.00 27.76  ? 454 SER A CB  1 
ATOM   3545  O  OG  . SER A  1  454 ? -9.293  49.596  -5.755  1.00 28.17  ? 454 SER A OG  1 
ATOM   3546  N  N   . SER A  1  455 ? -9.244  53.047  -4.587  1.00 29.49  ? 455 SER A N   1 
ATOM   3547  C  CA  . SER A  1  455 ? -9.744  53.593  -3.333  1.00 28.14  ? 455 SER A CA  1 
ATOM   3548  C  C   . SER A  1  455 ? -10.866 54.632  -3.549  1.00 28.31  ? 455 SER A C   1 
ATOM   3549  O  O   . SER A  1  455 ? -11.812 54.685  -2.786  1.00 27.56  ? 455 SER A O   1 
ATOM   3550  C  CB  . SER A  1  455 ? -8.580  54.133  -2.503  1.00 27.18  ? 455 SER A CB  1 
ATOM   3551  O  OG  . SER A  1  455 ? -7.789  53.044  -2.007  1.00 25.31  ? 455 SER A OG  1 
ATOM   3552  N  N   . MET A  1  456 ? -10.784 55.411  -4.619  1.00 31.02  ? 456 MET A N   1 
ATOM   3553  C  CA  . MET A  1  456 ? -11.801 56.399  -4.926  1.00 31.23  ? 456 MET A CA  1 
ATOM   3554  C  C   . MET A  1  456 ? -13.092 55.709  -5.241  1.00 31.78  ? 456 MET A C   1 
ATOM   3555  O  O   . MET A  1  456 ? -14.156 56.184  -4.868  1.00 32.07  ? 456 MET A O   1 
ATOM   3556  C  CB  . MET A  1  456 ? -11.384 57.275  -6.100  1.00 32.11  ? 456 MET A CB  1 
ATOM   3557  C  CG  . MET A  1  456 ? -10.408 58.371  -5.676  1.00 35.28  ? 456 MET A CG  1 
ATOM   3558  S  SD  . MET A  1  456 ? -9.636  59.271  -7.040  1.00 35.93  ? 456 MET A SD  1 
ATOM   3559  C  CE  . MET A  1  456 ? -8.564  60.271  -6.019  1.00 38.43  ? 456 MET A CE  1 
ATOM   3560  N  N   . GLY A  1  457 ? -12.983 54.610  -5.976  1.00 33.08  ? 457 GLY A N   1 
ATOM   3561  C  CA  . GLY A  1  457 ? -14.107 53.726  -6.261  1.00 32.21  ? 457 GLY A CA  1 
ATOM   3562  C  C   . GLY A  1  457 ? -14.861 53.234  -5.032  1.00 30.68  ? 457 GLY A C   1 
ATOM   3563  O  O   . GLY A  1  457 ? -16.088 53.104  -5.063  1.00 29.00  ? 457 GLY A O   1 
ATOM   3564  N  N   . SER A  1  458 ? -14.130 52.951  -3.955  1.00 27.85  ? 458 SER A N   1 
ATOM   3565  C  CA  . SER A  1  458 ? -14.752 52.507  -2.739  1.00 26.95  ? 458 SER A CA  1 
ATOM   3566  C  C   . SER A  1  458 ? -15.664 53.551  -2.135  1.00 25.51  ? 458 SER A C   1 
ATOM   3567  O  O   . SER A  1  458 ? -16.650 53.204  -1.517  1.00 26.08  ? 458 SER A O   1 
ATOM   3568  C  CB  . SER A  1  458 ? -13.711 52.032  -1.717  1.00 27.11  ? 458 SER A CB  1 
ATOM   3569  O  OG  . SER A  1  458 ? -13.061 53.135  -1.090  1.00 29.44  ? 458 SER A OG  1 
ATOM   3570  N  N   . PHE A  1  459 ? -15.324 54.824  -2.297  1.00 27.10  ? 459 PHE A N   1 
ATOM   3571  C  CA  . PHE A  1  459 ? -16.163 55.940  -1.779  1.00 28.63  ? 459 PHE A CA  1 
ATOM   3572  C  C   . PHE A  1  459 ? -17.487 56.075  -2.535  1.00 25.90  ? 459 PHE A C   1 
ATOM   3573  O  O   . PHE A  1  459 ? -18.508 56.384  -1.957  1.00 23.90  ? 459 PHE A O   1 
ATOM   3574  C  CB  . PHE A  1  459 ? -15.393 57.283  -1.741  1.00 29.96  ? 459 PHE A CB  1 
ATOM   3575  C  CG  . PHE A  1  459 ? -14.626 57.506  -0.469  1.00 34.68  ? 459 PHE A CG  1 
ATOM   3576  C  CD1 . PHE A  1  459 ? -13.563 56.673  -0.116  1.00 39.77  ? 459 PHE A CD1 1 
ATOM   3577  C  CD2 . PHE A  1  459 ? -14.954 58.542  0.392   1.00 39.02  ? 459 PHE A CD2 1 
ATOM   3578  C  CE1 . PHE A  1  459 ? -12.858 56.866  1.078   1.00 39.85  ? 459 PHE A CE1 1 
ATOM   3579  C  CE2 . PHE A  1  459 ? -14.238 58.743  1.581   1.00 41.28  ? 459 PHE A CE2 1 
ATOM   3580  C  CZ  . PHE A  1  459 ? -13.194 57.896  1.920   1.00 38.69  ? 459 PHE A CZ  1 
ATOM   3581  N  N   . ILE A  1  460 ? -17.462 55.793  -3.826  1.00 26.06  ? 460 ILE A N   1 
ATOM   3582  C  CA  . ILE A  1  460 ? -18.657 55.837  -4.622  1.00 26.62  ? 460 ILE A CA  1 
ATOM   3583  C  C   . ILE A  1  460 ? -19.628 54.767  -4.145  1.00 28.80  ? 460 ILE A C   1 
ATOM   3584  O  O   . ILE A  1  460 ? -20.816 55.064  -3.910  1.00 30.11  ? 460 ILE A O   1 
ATOM   3585  C  CB  . ILE A  1  460 ? -18.339 55.686  -6.109  1.00 27.80  ? 460 ILE A CB  1 
ATOM   3586  C  CG1 . ILE A  1  460 ? -17.511 56.894  -6.579  1.00 27.85  ? 460 ILE A CG1 1 
ATOM   3587  C  CG2 . ILE A  1  460 ? -19.639 55.552  -6.899  1.00 29.40  ? 460 ILE A CG2 1 
ATOM   3588  C  CD1 . ILE A  1  460 ? -17.068 56.789  -8.019  1.00 31.50  ? 460 ILE A CD1 1 
ATOM   3589  N  N   . SER A  1  461 ? -19.134 53.539  -3.981  1.00 26.87  ? 461 SER A N   1 
ATOM   3590  C  CA  . SER A  1  461 ? -19.950 52.476  -3.411  1.00 27.63  ? 461 SER A CA  1 
ATOM   3591  C  C   . SER A  1  461 ? -20.498 52.820  -2.024  1.00 28.12  ? 461 SER A C   1 
ATOM   3592  O  O   . SER A  1  461 ? -21.614 52.398  -1.675  1.00 29.56  ? 461 SER A O   1 
ATOM   3593  C  CB  . SER A  1  461 ? -19.165 51.177  -3.343  1.00 26.49  ? 461 SER A CB  1 
ATOM   3594  O  OG  . SER A  1  461 ? -18.881 50.762  -4.651  1.00 26.55  ? 461 SER A OG  1 
ATOM   3595  N  N   . LEU A  1  462 ? -19.717 53.554  -1.225  1.00 28.58  ? 462 LEU A N   1 
ATOM   3596  C  CA  . LEU A  1  462 ? -20.195 53.997  0.102   1.00 30.09  ? 462 LEU A CA  1 
ATOM   3597  C  C   . LEU A  1  462 ? -21.465 54.845  -0.048  1.00 28.93  ? 462 LEU A C   1 
ATOM   3598  O  O   . LEU A  1  462 ? -22.396 54.745  0.762   1.00 26.67  ? 462 LEU A O   1 
ATOM   3599  C  CB  . LEU A  1  462 ? -19.124 54.789  0.871   1.00 30.62  ? 462 LEU A CB  1 
ATOM   3600  C  CG  . LEU A  1  462 ? -19.642 55.550  2.083   1.00 32.60  ? 462 LEU A CG  1 
ATOM   3601  C  CD1 . LEU A  1  462 ? -20.143 54.583  3.120   1.00 34.66  ? 462 LEU A CD1 1 
ATOM   3602  C  CD2 . LEU A  1  462 ? -18.571 56.435  2.669   1.00 35.41  ? 462 LEU A CD2 1 
ATOM   3603  N  N   . THR A  1  463 ? -21.463 55.689  -1.074  1.00 27.32  ? 463 THR A N   1 
ATOM   3604  C  CA  . THR A  1  463 ? -22.538 56.628  -1.260  1.00 28.94  ? 463 THR A CA  1 
ATOM   3605  C  C   . THR A  1  463 ? -23.842 55.870  -1.587  1.00 29.94  ? 463 THR A C   1 
ATOM   3606  O  O   . THR A  1  463 ? -24.918 56.229  -1.092  1.00 31.97  ? 463 THR A O   1 
ATOM   3607  C  CB  . THR A  1  463 ? -22.128 57.692  -2.290  1.00 28.30  ? 463 THR A CB  1 
ATOM   3608  O  OG1 . THR A  1  463 ? -21.018 58.449  -1.764  1.00 26.90  ? 463 THR A OG1 1 
ATOM   3609  C  CG2 . THR A  1  463 ? -23.273 58.609  -2.591  1.00 29.39  ? 463 THR A CG2 1 
ATOM   3610  N  N   . ALA A  1  464 ? -23.717 54.813  -2.381  1.00 29.68  ? 464 ALA A N   1 
ATOM   3611  C  CA  . ALA A  1  464 ? -24.802 53.861  -2.641  1.00 30.34  ? 464 ALA A CA  1 
ATOM   3612  C  C   . ALA A  1  464 ? -25.314 53.190  -1.376  1.00 29.58  ? 464 ALA A C   1 
ATOM   3613  O  O   . ALA A  1  464 ? -26.520 53.000  -1.231  1.00 33.63  ? 464 ALA A O   1 
ATOM   3614  C  CB  . ALA A  1  464 ? -24.362 52.794  -3.631  1.00 29.86  ? 464 ALA A CB  1 
ATOM   3615  N  N   . VAL A  1  465 ? -24.428 52.835  -0.460  1.00 26.87  ? 465 VAL A N   1 
ATOM   3616  C  CA  . VAL A  1  465 ? -24.872 52.143  0.751   1.00 26.71  ? 465 VAL A CA  1 
ATOM   3617  C  C   . VAL A  1  465 ? -25.675 53.088  1.576   1.00 27.90  ? 465 VAL A C   1 
ATOM   3618  O  O   . VAL A  1  465 ? -26.698 52.731  2.081   1.00 27.32  ? 465 VAL A O   1 
ATOM   3619  C  CB  . VAL A  1  465 ? -23.704 51.584  1.557   1.00 26.72  ? 465 VAL A CB  1 
ATOM   3620  C  CG1 . VAL A  1  465 ? -24.147 51.032  2.887   1.00 27.26  ? 465 VAL A CG1 1 
ATOM   3621  C  CG2 . VAL A  1  465 ? -23.047 50.462  0.778   1.00 28.20  ? 465 VAL A CG2 1 
ATOM   3622  N  N   . MET A  1  466 ? -25.217 54.320  1.662   1.00 30.71  ? 466 MET A N   1 
ATOM   3623  C  CA  . MET A  1  466 ? -25.902 55.317  2.404   1.00 31.25  ? 466 MET A CA  1 
ATOM   3624  C  C   . MET A  1  466 ? -27.283 55.580  1.807   1.00 30.43  ? 466 MET A C   1 
ATOM   3625  O  O   . MET A  1  466 ? -28.276 55.634  2.527   1.00 27.31  ? 466 MET A O   1 
ATOM   3626  C  CB  . MET A  1  466 ? -25.061 56.590  2.444   1.00 33.60  ? 466 MET A CB  1 
ATOM   3627  C  CG  . MET A  1  466 ? -24.117 56.704  3.637   1.00 36.38  ? 466 MET A CG  1 
ATOM   3628  S  SD  . MET A  1  466 ? -22.727 57.834  3.456   1.00 35.40  ? 466 MET A SD  1 
ATOM   3629  C  CE  . MET A  1  466 ? -23.321 59.337  2.834   1.00 43.98  ? 466 MET A CE  1 
ATOM   3630  N  N   . LEU A  1  467 ? -27.328 55.710  0.494   1.00 29.45  ? 467 LEU A N   1 
ATOM   3631  C  CA  . LEU A  1  467 ? -28.575 55.923  -0.201  1.00 32.09  ? 467 LEU A CA  1 
ATOM   3632  C  C   . LEU A  1  467 ? -29.598 54.775  -0.058  1.00 33.08  ? 467 LEU A C   1 
ATOM   3633  O  O   . LEU A  1  467 ? -30.804 55.002  -0.072  1.00 30.71  ? 467 LEU A O   1 
ATOM   3634  C  CB  . LEU A  1  467 ? -28.276 56.149  -1.671  1.00 34.94  ? 467 LEU A CB  1 
ATOM   3635  C  CG  . LEU A  1  467 ? -29.420 56.800  -2.426  1.00 40.04  ? 467 LEU A CG  1 
ATOM   3636  C  CD1 . LEU A  1  467 ? -29.705 58.179  -1.838  1.00 44.82  ? 467 LEU A CD1 1 
ATOM   3637  C  CD2 . LEU A  1  467 ? -29.055 56.931  -3.880  1.00 39.92  ? 467 LEU A CD2 1 
ATOM   3638  N  N   . MET A  1  468 ? -29.100 53.549  0.061   1.00 33.55  ? 468 MET A N   1 
ATOM   3639  C  CA  . MET A  1  468 ? -29.932 52.365  0.244   1.00 34.61  ? 468 MET A CA  1 
ATOM   3640  C  C   . MET A  1  468 ? -30.695 52.455  1.534   1.00 31.76  ? 468 MET A C   1 
ATOM   3641  O  O   . MET A  1  468 ? -31.883 52.142  1.597   1.00 28.49  ? 468 MET A O   1 
ATOM   3642  C  CB  . MET A  1  468 ? -29.078 51.092  0.272   1.00 37.31  ? 468 MET A CB  1 
ATOM   3643  C  CG  . MET A  1  468 ? -29.918 49.826  0.350   1.00 42.09  ? 468 MET A CG  1 
ATOM   3644  S  SD  . MET A  1  468 ? -28.937 48.341  0.644   1.00 50.33  ? 468 MET A SD  1 
ATOM   3645  C  CE  . MET A  1  468 ? -28.339 48.641  2.309   1.00 53.80  ? 468 MET A CE  1 
ATOM   3646  N  N   . VAL A  1  469 ? -29.992 52.893  2.567   1.00 29.77  ? 469 VAL A N   1 
ATOM   3647  C  CA  . VAL A  1  469 ? -30.599 53.071  3.887   1.00 28.61  ? 469 VAL A CA  1 
ATOM   3648  C  C   . VAL A  1  469 ? -31.730 54.095  3.817   1.00 28.29  ? 469 VAL A C   1 
ATOM   3649  O  O   . VAL A  1  469 ? -32.803 53.874  4.346   1.00 27.54  ? 469 VAL A O   1 
ATOM   3650  C  CB  . VAL A  1  469 ? -29.567 53.517  4.911   1.00 26.66  ? 469 VAL A CB  1 
ATOM   3651  C  CG1 . VAL A  1  469 ? -30.235 53.776  6.236   1.00 25.89  ? 469 VAL A CG1 1 
ATOM   3652  C  CG2 . VAL A  1  469 ? -28.519 52.427  5.072   1.00 28.34  ? 469 VAL A CG2 1 
ATOM   3653  N  N   . PHE A  1  470 ? -31.488 55.190  3.113   1.00 27.28  ? 470 PHE A N   1 
ATOM   3654  C  CA  . PHE A  1  470 ? -32.510 56.176  2.935   1.00 27.85  ? 470 PHE A CA  1 
ATOM   3655  C  C   . PHE A  1  470 ? -33.709 55.625  2.146   1.00 25.40  ? 470 PHE A C   1 
ATOM   3656  O  O   . PHE A  1  470 ? -34.852 55.938  2.469   1.00 26.12  ? 470 PHE A O   1 
ATOM   3657  C  CB  . PHE A  1  470 ? -31.941 57.432  2.292   1.00 28.53  ? 470 PHE A CB  1 
ATOM   3658  C  CG  . PHE A  1  470 ? -32.971 58.287  1.677   1.00 28.46  ? 470 PHE A CG  1 
ATOM   3659  C  CD1 . PHE A  1  470 ? -33.755 59.094  2.467   1.00 30.86  ? 470 PHE A CD1 1 
ATOM   3660  C  CD2 . PHE A  1  470 ? -33.210 58.227  0.331   1.00 28.33  ? 470 PHE A CD2 1 
ATOM   3661  C  CE1 . PHE A  1  470 ? -34.741 59.889  1.900   1.00 31.61  ? 470 PHE A CE1 1 
ATOM   3662  C  CE2 . PHE A  1  470 ? -34.189 59.010  -0.238  1.00 30.72  ? 470 PHE A CE2 1 
ATOM   3663  C  CZ  . PHE A  1  470 ? -34.955 59.841  0.546   1.00 30.32  ? 470 PHE A CZ  1 
ATOM   3664  N  N   . ILE A  1  471 ? -33.439 54.814  1.137   1.00 25.59  ? 471 ILE A N   1 
ATOM   3665  C  CA  . ILE A  1  471 ? -34.479 54.244  0.307   1.00 26.13  ? 471 ILE A CA  1 
ATOM   3666  C  C   . ILE A  1  471 ? -35.417 53.357  1.147   1.00 27.81  ? 471 ILE A C   1 
ATOM   3667  O  O   . ILE A  1  471 ? -36.640 53.420  1.003   1.00 27.50  ? 471 ILE A O   1 
ATOM   3668  C  CB  . ILE A  1  471 ? -33.872 53.483  -0.885  1.00 27.04  ? 471 ILE A CB  1 
ATOM   3669  C  CG1 . ILE A  1  471 ? -33.361 54.480  -1.914  1.00 27.86  ? 471 ILE A CG1 1 
ATOM   3670  C  CG2 . ILE A  1  471 ? -34.886 52.556  -1.559  1.00 28.77  ? 471 ILE A CG2 1 
ATOM   3671  C  CD1 . ILE A  1  471 ? -32.488 53.901  -3.024  1.00 27.83  ? 471 ILE A CD1 1 
ATOM   3672  N  N   . ILE A  1  472 ? -34.839 52.562  2.042   1.00 26.65  ? 472 ILE A N   1 
ATOM   3673  C  CA  . ILE A  1  472 ? -35.606 51.721  2.910   1.00 24.51  ? 472 ILE A CA  1 
ATOM   3674  C  C   . ILE A  1  472 ? -36.397 52.584  3.841   1.00 24.70  ? 472 ILE A C   1 
ATOM   3675  O  O   . ILE A  1  472 ? -37.540 52.282  4.069   1.00 24.94  ? 472 ILE A O   1 
ATOM   3676  C  CB  . ILE A  1  472 ? -34.736 50.752  3.733   1.00 25.72  ? 472 ILE A CB  1 
ATOM   3677  C  CG1 . ILE A  1  472 ? -34.006 49.795  2.795   1.00 28.19  ? 472 ILE A CG1 1 
ATOM   3678  C  CG2 . ILE A  1  472 ? -35.577 49.978  4.756   1.00 24.15  ? 472 ILE A CG2 1 
ATOM   3679  C  CD1 . ILE A  1  472 ? -32.971 48.912  3.483   1.00 29.67  ? 472 ILE A CD1 1 
ATOM   3680  N  N   . TRP A  1  473 ? -35.790 53.616  4.430   1.00 26.70  ? 473 TRP A N   1 
ATOM   3681  C  CA  . TRP A  1  473 ? -36.550 54.568  5.289   1.00 29.08  ? 473 TRP A CA  1 
ATOM   3682  C  C   . TRP A  1  473 ? -37.750 55.158  4.539   1.00 29.41  ? 473 TRP A C   1 
ATOM   3683  O  O   . TRP A  1  473 ? -38.852 55.158  5.051   1.00 26.98  ? 473 TRP A O   1 
ATOM   3684  C  CB  . TRP A  1  473 ? -35.696 55.743  5.759   1.00 29.56  ? 473 TRP A CB  1 
ATOM   3685  C  CG  . TRP A  1  473 ? -36.488 56.783  6.485   1.00 29.15  ? 473 TRP A CG  1 
ATOM   3686  C  CD1 . TRP A  1  473 ? -36.979 56.687  7.753   1.00 30.19  ? 473 TRP A CD1 1 
ATOM   3687  C  CD2 . TRP A  1  473 ? -36.879 58.065  6.003   1.00 28.23  ? 473 TRP A CD2 1 
ATOM   3688  N  NE1 . TRP A  1  473 ? -37.644 57.835  8.097   1.00 28.90  ? 473 TRP A NE1 1 
ATOM   3689  C  CE2 . TRP A  1  473 ? -37.596 58.701  7.039   1.00 28.81  ? 473 TRP A CE2 1 
ATOM   3690  C  CE3 . TRP A  1  473 ? -36.689 58.747  4.801   1.00 31.02  ? 473 TRP A CE3 1 
ATOM   3691  C  CZ2 . TRP A  1  473 ? -38.119 59.985  6.913   1.00 28.84  ? 473 TRP A CZ2 1 
ATOM   3692  C  CZ3 . TRP A  1  473 ? -37.223 60.032  4.669   1.00 29.95  ? 473 TRP A CZ3 1 
ATOM   3693  C  CH2 . TRP A  1  473 ? -37.916 60.635  5.724   1.00 29.95  ? 473 TRP A CH2 1 
ATOM   3694  N  N   . GLU A  1  474 ? -37.499 55.661  3.329   1.00 28.98  ? 474 GLU A N   1 
ATOM   3695  C  CA  . GLU A  1  474 ? -38.523 56.343  2.572   1.00 29.52  ? 474 GLU A CA  1 
ATOM   3696  C  C   . GLU A  1  474 ? -39.755 55.429  2.339   1.00 28.86  ? 474 GLU A C   1 
ATOM   3697  O  O   . GLU A  1  474 ? -40.878 55.882  2.447   1.00 29.98  ? 474 GLU A O   1 
ATOM   3698  C  CB  . GLU A  1  474 ? -37.941 56.902  1.258   1.00 31.96  ? 474 GLU A CB  1 
ATOM   3699  C  CG  . GLU A  1  474 ? -38.881 57.841  0.493   1.00 35.84  ? 474 GLU A CG  1 
ATOM   3700  C  CD  . GLU A  1  474 ? -40.039 57.155  -0.232  1.00 35.93  ? 474 GLU A CD  1 
ATOM   3701  O  OE1 . GLU A  1  474 ? -39.877 55.982  -0.619  1.00 34.90  ? 474 GLU A OE1 1 
ATOM   3702  O  OE2 . GLU A  1  474 ? -41.097 57.802  -0.427  1.00 35.39  ? 474 GLU A OE2 1 
ATOM   3703  N  N   . ALA A  1  475 ? -39.550 54.157  2.036   1.00 26.44  ? 475 ALA A N   1 
ATOM   3704  C  CA  . ALA A  1  475 ? -40.644 53.227  1.818   1.00 25.81  ? 475 ALA A CA  1 
ATOM   3705  C  C   . ALA A  1  475 ? -41.530 53.132  3.051   1.00 26.40  ? 475 ALA A C   1 
ATOM   3706  O  O   . ALA A  1  475 ? -42.768 53.147  2.983   1.00 27.81  ? 475 ALA A O   1 
ATOM   3707  C  CB  . ALA A  1  475 ? -40.081 51.852  1.516   1.00 26.56  ? 475 ALA A CB  1 
ATOM   3708  N  N   . PHE A  1  476 ? -40.866 53.012  4.183   1.00 26.16  ? 476 PHE A N   1 
ATOM   3709  C  CA  . PHE A  1  476 ? -41.518 52.788  5.435   1.00 27.35  ? 476 PHE A CA  1 
ATOM   3710  C  C   . PHE A  1  476 ? -42.122 54.089  5.963   1.00 29.31  ? 476 PHE A C   1 
ATOM   3711  O  O   . PHE A  1  476 ? -43.087 54.052  6.714   1.00 31.80  ? 476 PHE A O   1 
ATOM   3712  C  CB  . PHE A  1  476 ? -40.509 52.251  6.443   1.00 28.70  ? 476 PHE A CB  1 
ATOM   3713  C  CG  . PHE A  1  476 ? -40.296 50.755  6.416   1.00 28.69  ? 476 PHE A CG  1 
ATOM   3714  C  CD1 . PHE A  1  476 ? -41.326 49.889  6.650   1.00 28.94  ? 476 PHE A CD1 1 
ATOM   3715  C  CD2 . PHE A  1  476 ? -39.023 50.234  6.291   1.00 32.02  ? 476 PHE A CD2 1 
ATOM   3716  C  CE1 . PHE A  1  476 ? -41.110 48.533  6.694   1.00 29.04  ? 476 PHE A CE1 1 
ATOM   3717  C  CE2 . PHE A  1  476 ? -38.791 48.876  6.328   1.00 31.17  ? 476 PHE A CE2 1 
ATOM   3718  C  CZ  . PHE A  1  476 ? -39.842 48.024  6.535   1.00 30.49  ? 476 PHE A CZ  1 
ATOM   3719  N  N   . ALA A  1  477 ? -41.532 55.233  5.597   1.00 30.68  ? 477 ALA A N   1 
ATOM   3720  C  CA  . ALA A  1  477 ? -42.068 56.563  5.951   1.00 31.30  ? 477 ALA A CA  1 
ATOM   3721  C  C   . ALA A  1  477 ? -43.333 56.908  5.158   1.00 30.66  ? 477 ALA A C   1 
ATOM   3722  O  O   . ALA A  1  477 ? -44.199 57.581  5.665   1.00 29.22  ? 477 ALA A O   1 
ATOM   3723  C  CB  . ALA A  1  477 ? -41.012 57.644  5.728   1.00 31.50  ? 477 ALA A CB  1 
ATOM   3724  N  N   . SER A  1  478 ? -43.416 56.419  3.924   1.00 30.48  ? 478 SER A N   1 
ATOM   3725  C  CA  . SER A  1  478 ? -44.478 56.752  3.010   1.00 31.25  ? 478 SER A CA  1 
ATOM   3726  C  C   . SER A  1  478 ? -45.697 55.810  3.074   1.00 33.98  ? 478 SER A C   1 
ATOM   3727  O  O   . SER A  1  478 ? -46.850 56.275  3.015   1.00 35.91  ? 478 SER A O   1 
ATOM   3728  C  CB  . SER A  1  478 ? -43.912 56.886  1.599   1.00 29.31  ? 478 SER A CB  1 
ATOM   3729  O  OG  . SER A  1  478 ? -43.174 58.095  1.570   1.00 28.40  ? 478 SER A OG  1 
ATOM   3730  N  N   . LYS A  1  479 ? -45.457 54.517  3.241   1.00 32.15  ? 479 LYS A N   1 
ATOM   3731  C  CA  . LYS A  1  479 ? -46.531 53.543  3.427   1.00 29.87  ? 479 LYS A CA  1 
ATOM   3732  C  C   . LYS A  1  479 ? -47.474 53.529  2.274   1.00 29.31  ? 479 LYS A C   1 
ATOM   3733  O  O   . LYS A  1  479 ? -48.668 53.799  2.417   1.00 27.59  ? 479 LYS A O   1 
ATOM   3734  C  CB  . LYS A  1  479 ? -47.299 53.792  4.717   1.00 31.94  ? 479 LYS A CB  1 
ATOM   3735  C  CG  . LYS A  1  479 ? -46.476 53.648  5.977   1.00 34.45  ? 479 LYS A CG  1 
ATOM   3736  C  CD  . LYS A  1  479 ? -47.342 53.932  7.167   1.00 36.58  ? 479 LYS A CD  1 
ATOM   3737  C  CE  . LYS A  1  479 ? -46.516 53.898  8.427   1.00 42.10  ? 479 LYS A CE  1 
ATOM   3738  N  NZ  . LYS A  1  479 ? -47.390 53.611  9.607   1.00 46.73  ? 479 LYS A NZ  1 
ATOM   3739  N  N   . ARG A  1  480 ? -46.905 53.258  1.110   1.00 30.34  ? 480 ARG A N   1 
ATOM   3740  C  CA  . ARG A  1  480 ? -47.660 52.882  -0.082  1.00 29.07  ? 480 ARG A CA  1 
ATOM   3741  C  C   . ARG A  1  480 ? -47.959 51.364  -0.035  1.00 31.89  ? 480 ARG A C   1 
ATOM   3742  O  O   . ARG A  1  480 ? -47.050 50.536  -0.197  1.00 34.94  ? 480 ARG A O   1 
ATOM   3743  C  CB  . ARG A  1  480 ? -46.836 53.170  -1.314  1.00 27.87  ? 480 ARG A CB  1 
ATOM   3744  C  CG  . ARG A  1  480 ? -46.464 54.625  -1.488  1.00 27.46  ? 480 ARG A CG  1 
ATOM   3745  C  CD  . ARG A  1  480 ? -45.573 54.782  -2.688  1.00 26.81  ? 480 ARG A CD  1 
ATOM   3746  N  NE  . ARG A  1  480 ? -44.257 54.246  -2.373  1.00 27.69  ? 480 ARG A NE  1 
ATOM   3747  C  CZ  . ARG A  1  480 ? -43.217 54.935  -1.927  1.00 27.75  ? 480 ARG A CZ  1 
ATOM   3748  N  NH1 . ARG A  1  480 ? -43.260 56.254  -1.739  1.00 28.96  ? 480 ARG A NH1 1 
ATOM   3749  N  NH2 . ARG A  1  480 ? -42.103 54.281  -1.648  1.00 28.88  ? 480 ARG A NH2 1 
ATOM   3750  N  N   . GLU A  1  481 ? -49.220 50.976  0.175   1.00 31.98  ? 481 GLU A N   1 
ATOM   3751  C  CA  . GLU A  1  481 ? -49.495 49.555  0.360   1.00 31.58  ? 481 GLU A CA  1 
ATOM   3752  C  C   . GLU A  1  481 ? -49.741 48.882  -0.949  1.00 30.23  ? 481 GLU A C   1 
ATOM   3753  O  O   . GLU A  1  481 ? -50.359 49.464  -1.814  1.00 31.24  ? 481 GLU A O   1 
ATOM   3754  C  CB  . GLU A  1  481 ? -50.641 49.313  1.305   1.00 31.67  ? 481 GLU A CB  1 
ATOM   3755  C  CG  . GLU A  1  481 ? -50.306 49.772  2.702   1.00 32.48  ? 481 GLU A CG  1 
ATOM   3756  C  CD  . GLU A  1  481 ? -51.485 49.793  3.590   1.00 34.06  ? 481 GLU A CD  1 
ATOM   3757  O  OE1 . GLU A  1  481 ? -51.275 50.262  4.739   1.00 39.17  ? 481 GLU A OE1 1 
ATOM   3758  O  OE2 . GLU A  1  481 ? -52.583 49.355  3.139   1.00 33.47  ? 481 GLU A OE2 1 
ATOM   3759  N  N   . VAL A  1  482 ? -49.266 47.652  -1.058  1.00 27.73  ? 482 VAL A N   1 
ATOM   3760  C  CA  . VAL A  1  482 ? -49.416 46.873  -2.245  1.00 28.57  ? 482 VAL A CA  1 
ATOM   3761  C  C   . VAL A  1  482 ? -50.875 46.574  -2.460  1.00 28.42  ? 482 VAL A C   1 
ATOM   3762  O  O   . VAL A  1  482 ? -51.598 46.278  -1.501  1.00 29.07  ? 482 VAL A O   1 
ATOM   3763  C  CB  . VAL A  1  482 ? -48.666 45.528  -2.138  1.00 28.44  ? 482 VAL A CB  1 
ATOM   3764  C  CG1 . VAL A  1  482 ? -48.911 44.686  -3.394  1.00 29.69  ? 482 VAL A CG1 1 
ATOM   3765  C  CG2 . VAL A  1  482 ? -47.174 45.761  -1.969  1.00 29.54  ? 482 VAL A CG2 1 
ATOM   3766  N  N   . LEU A  1  483 ? -51.281 46.628  -3.721  1.00 30.65  ? 483 LEU A N   1 
ATOM   3767  C  CA  . LEU A  1  483 ? -52.632 46.269  -4.152  1.00 36.31  ? 483 LEU A CA  1 
ATOM   3768  C  C   . LEU A  1  483 ? -52.616 44.945  -4.878  1.00 39.45  ? 483 LEU A C   1 
ATOM   3769  O  O   . LEU A  1  483 ? -53.164 43.967  -4.371  1.00 52.41  ? 483 LEU A O   1 
ATOM   3770  C  CB  . LEU A  1  483 ? -53.215 47.367  -5.059  1.00 38.02  ? 483 LEU A CB  1 
ATOM   3771  C  CG  . LEU A  1  483 ? -53.705 48.600  -4.286  1.00 38.09  ? 483 LEU A CG  1 
ATOM   3772  C  CD1 . LEU A  1  483 ? -54.010 49.747  -5.220  1.00 39.22  ? 483 LEU A CD1 1 
ATOM   3773  C  CD2 . LEU A  1  483 ? -54.929 48.248  -3.460  1.00 39.08  ? 483 LEU A CD2 1 
ATOM   3774  N  N   . THR A  1  484 ? -51.941 44.922  -6.029  1.00 37.97  ? 484 THR A N   1 
ATOM   3775  C  CA  . THR A  1  484 ? -51.987 43.839  -7.002  1.00 37.49  ? 484 THR A CA  1 
ATOM   3776  C  C   . THR A  1  484 ? -50.578 43.399  -7.368  1.00 36.08  ? 484 THR A C   1 
ATOM   3777  O  O   . THR A  1  484 ? -49.700 44.238  -7.543  1.00 36.52  ? 484 THR A O   1 
ATOM   3778  C  CB  . THR A  1  484 ? -52.657 44.329  -8.291  1.00 39.43  ? 484 THR A CB  1 
ATOM   3779  O  OG1 . THR A  1  484 ? -53.991 44.731  -7.987  1.00 46.16  ? 484 THR A OG1 1 
ATOM   3780  C  CG2 . THR A  1  484 ? -52.716 43.236  -9.358  1.00 43.47  ? 484 THR A CG2 1 
ATOM   3781  N  N   . VAL A  1  485 ? -50.393 42.093  -7.531  1.00 33.50  ? 485 VAL A N   1 
ATOM   3782  C  CA  . VAL A  1  485 ? -49.136 41.515  -7.942  1.00 35.94  ? 485 VAL A CA  1 
ATOM   3783  C  C   . VAL A  1  485 ? -49.346 40.694  -9.222  1.00 36.74  ? 485 VAL A C   1 
ATOM   3784  O  O   . VAL A  1  485 ? -50.268 39.893  -9.294  1.00 42.38  ? 485 VAL A O   1 
ATOM   3785  C  CB  . VAL A  1  485 ? -48.570 40.662  -6.789  1.00 38.10  ? 485 VAL A CB  1 
ATOM   3786  C  CG1 . VAL A  1  485 ? -47.363 39.817  -7.229  1.00 39.04  ? 485 VAL A CG1 1 
ATOM   3787  C  CG2 . VAL A  1  485 ? -48.181 41.572  -5.633  1.00 37.91  ? 485 VAL A CG2 1 
ATOM   3788  N  N   . ASP A  1  486 ? -48.503 40.903  -10.233 1.00 37.82  ? 486 ASP A N   1 
ATOM   3789  C  CA  . ASP A  1  486 ? -48.586 40.142  -11.493 1.00 37.91  ? 486 ASP A CA  1 
ATOM   3790  C  C   . ASP A  1  486 ? -48.007 38.741  -11.353 1.00 34.92  ? 486 ASP A C   1 
ATOM   3791  O  O   . ASP A  1  486 ? -47.121 38.484  -10.523 1.00 30.59  ? 486 ASP A O   1 
ATOM   3792  C  CB  . ASP A  1  486 ? -47.805 40.826  -12.610 1.00 42.22  ? 486 ASP A CB  1 
ATOM   3793  C  CG  . ASP A  1  486 ? -48.345 42.142  -12.974 1.00 44.31  ? 486 ASP A CG  1 
ATOM   3794  O  OD1 . ASP A  1  486 ? -49.326 42.575  -12.366 1.00 63.39  ? 486 ASP A OD1 1 
ATOM   3795  O  OD2 . ASP A  1  486 ? -47.784 42.778  -13.867 1.00 51.42  ? 486 ASP A OD2 1 
ATOM   3796  N  N   . LEU A  1  487 ? -48.513 37.857  -12.204 1.00 33.65  ? 487 LEU A N   1 
ATOM   3797  C  CA  . LEU A  1  487 ? -47.946 36.544  -12.407 1.00 37.19  ? 487 LEU A CA  1 
ATOM   3798  C  C   . LEU A  1  487 ? -47.955 35.682  -11.162 1.00 35.68  ? 487 LEU A C   1 
ATOM   3799  O  O   . LEU A  1  487 ? -47.017 34.925  -10.918 1.00 38.11  ? 487 LEU A O   1 
ATOM   3800  C  CB  . LEU A  1  487 ? -46.513 36.651  -12.955 1.00 42.18  ? 487 LEU A CB  1 
ATOM   3801  C  CG  . LEU A  1  487 ? -46.288 37.615  -14.117 1.00 45.05  ? 487 LEU A CG  1 
ATOM   3802  C  CD1 . LEU A  1  487 ? -44.822 37.607  -14.522 1.00 48.60  ? 487 LEU A CD1 1 
ATOM   3803  C  CD2 . LEU A  1  487 ? -47.178 37.264  -15.290 1.00 43.79  ? 487 LEU A CD2 1 
ATOM   3804  N  N   . THR A  1  488 ? -49.027 35.770  -10.388 1.00 33.38  ? 488 THR A N   1 
ATOM   3805  C  CA  . THR A  1  488 ? -49.168 34.919  -9.210  1.00 31.82  ? 488 THR A CA  1 
ATOM   3806  C  C   . THR A  1  488 ? -49.391 33.421  -9.527  1.00 29.93  ? 488 THR A C   1 
ATOM   3807  O  O   . THR A  1  488 ? -49.151 32.555  -8.693  1.00 31.79  ? 488 THR A O   1 
ATOM   3808  C  CB  . THR A  1  488 ? -50.308 35.407  -8.309  1.00 32.86  ? 488 THR A CB  1 
ATOM   3809  O  OG1 . THR A  1  488 ? -51.571 35.265  -8.988  1.00 30.75  ? 488 THR A OG1 1 
ATOM   3810  C  CG2 . THR A  1  488 ? -50.070 36.865  -7.859  1.00 32.29  ? 488 THR A CG2 1 
ATOM   3811  N  N   . THR A  1  489 ? -49.811 33.094  -10.729 1.00 29.35  ? 489 THR A N   1 
ATOM   3812  C  CA  . THR A  1  489 ? -50.025 31.708  -11.055 1.00 30.65  ? 489 THR A CA  1 
ATOM   3813  C  C   . THR A  1  489 ? -48.762 30.840  -11.061 1.00 30.73  ? 489 THR A C   1 
ATOM   3814  O  O   . THR A  1  489 ? -48.872 29.611  -10.892 1.00 31.83  ? 489 THR A O   1 
ATOM   3815  C  CB  . THR A  1  489 ? -50.778 31.537  -12.379 1.00 32.62  ? 489 THR A CB  1 
ATOM   3816  O  OG1 . THR A  1  489 ? -50.060 32.184  -13.417 1.00 35.74  ? 489 THR A OG1 1 
ATOM   3817  C  CG2 . THR A  1  489 ? -52.201 32.121  -12.275 1.00 31.67  ? 489 THR A CG2 1 
ATOM   3818  N  N   . THR A  1  490 ? -47.583 31.448  -11.230 1.00 30.16  ? 490 THR A N   1 
ATOM   3819  C  CA  . THR A  1  490 ? -46.329 30.706  -11.272 1.00 27.23  ? 490 THR A CA  1 
ATOM   3820  C  C   . THR A  1  490 ? -45.379 31.206  -10.205 1.00 27.67  ? 490 THR A C   1 
ATOM   3821  O  O   . THR A  1  490 ? -44.193 30.903  -10.232 1.00 31.28  ? 490 THR A O   1 
ATOM   3822  C  CB  . THR A  1  490 ? -45.760 30.739  -12.695 1.00 28.51  ? 490 THR A CB  1 
ATOM   3823  O  OG1 . THR A  1  490 ? -45.770 32.074  -13.197 1.00 31.34  ? 490 THR A OG1 1 
ATOM   3824  C  CG2 . THR A  1  490 ? -46.681 29.971  -13.608 1.00 30.02  ? 490 THR A CG2 1 
ATOM   3825  N  N   . ASN A  1  491 ? -45.924 31.909  -9.215  1.00 26.04  ? 491 ASN A N   1 
ATOM   3826  C  CA  . ASN A  1  491 ? -45.167 32.477  -8.136  1.00 25.37  ? 491 ASN A CA  1 
ATOM   3827  C  C   . ASN A  1  491 ? -45.983 32.467  -6.861  1.00 26.97  ? 491 ASN A C   1 
ATOM   3828  O  O   . ASN A  1  491 ? -46.409 33.520  -6.376  1.00 31.78  ? 491 ASN A O   1 
ATOM   3829  C  CB  . ASN A  1  491 ? -44.750 33.896  -8.477  1.00 25.07  ? 491 ASN A CB  1 
ATOM   3830  C  CG  . ASN A  1  491 ? -43.837 33.944  -9.673  1.00 23.89  ? 491 ASN A CG  1 
ATOM   3831  O  OD1 . ASN A  1  491 ? -42.643 33.724  -9.548  1.00 22.12  ? 491 ASN A OD1 1 
ATOM   3832  N  ND2 . ASN A  1  491 ? -44.410 34.191  -10.851 1.00 24.08  ? 491 ASN A ND2 1 
ATOM   3833  N  N   . LEU A  1  492 ? -46.111 31.260  -6.301  1.00 25.57  ? 492 LEU A N   1 
ATOM   3834  C  CA  . LEU A  1  492 ? -46.933 30.952  -5.146  1.00 24.85  ? 492 LEU A CA  1 
ATOM   3835  C  C   . LEU A  1  492 ? -46.735 31.832  -3.960  1.00 27.01  ? 492 LEU A C   1 
ATOM   3836  O  O   . LEU A  1  492 ? -47.717 32.115  -3.211  1.00 27.30  ? 492 LEU A O   1 
ATOM   3837  C  CB  . LEU A  1  492 ? -46.658 29.537  -4.685  1.00 25.55  ? 492 LEU A CB  1 
ATOM   3838  C  CG  . LEU A  1  492 ? -47.439 29.026  -3.485  1.00 24.56  ? 492 LEU A CG  1 
ATOM   3839  C  CD1 . LEU A  1  492 ? -48.926 29.203  -3.723  1.00 23.35  ? 492 LEU A CD1 1 
ATOM   3840  C  CD2 . LEU A  1  492 ? -47.073 27.540  -3.283  1.00 25.92  ? 492 LEU A CD2 1 
ATOM   3841  N  N   . GLU A  1  493 ? -45.482 32.246  -3.755  1.00 25.97  ? 493 GLU A N   1 
ATOM   3842  C  CA  . GLU A  1  493 ? -45.123 33.039  -2.575  1.00 26.03  ? 493 GLU A CA  1 
ATOM   3843  C  C   . GLU A  1  493 ? -45.905 34.367  -2.452  1.00 25.95  ? 493 GLU A C   1 
ATOM   3844  O  O   . GLU A  1  493 ? -46.134 34.824  -1.320  1.00 28.35  ? 493 GLU A O   1 
ATOM   3845  C  CB  . GLU A  1  493 ? -43.595 33.290  -2.488  1.00 26.60  ? 493 GLU A CB  1 
ATOM   3846  C  CG  . GLU A  1  493 ? -42.998 34.396  -3.368  1.00 25.13  ? 493 GLU A CG  1 
ATOM   3847  C  CD  . GLU A  1  493 ? -42.577 33.933  -4.715  1.00 25.77  ? 493 GLU A CD  1 
ATOM   3848  O  OE1 . GLU A  1  493 ? -42.956 32.830  -5.109  1.00 25.13  ? 493 GLU A OE1 1 
ATOM   3849  O  OE2 . GLU A  1  493 ? -41.843 34.684  -5.405  1.00 29.82  ? 493 GLU A OE2 1 
ATOM   3850  N  N   . TRP A  1  494 ? -46.331 34.958  -3.577  1.00 24.01  ? 494 TRP A N   1 
ATOM   3851  C  CA  . TRP A  1  494 ? -47.152 36.183  -3.532  1.00 25.92  ? 494 TRP A CA  1 
ATOM   3852  C  C   . TRP A  1  494 ? -48.654 35.953  -3.267  1.00 27.76  ? 494 TRP A C   1 
ATOM   3853  O  O   . TRP A  1  494 ? -49.408 36.892  -2.979  1.00 29.43  ? 494 TRP A O   1 
ATOM   3854  C  CB  . TRP A  1  494 ? -47.022 36.938  -4.843  1.00 25.84  ? 494 TRP A CB  1 
ATOM   3855  C  CG  . TRP A  1  494 ? -45.661 37.367  -5.115  1.00 26.16  ? 494 TRP A CG  1 
ATOM   3856  C  CD1 . TRP A  1  494 ? -44.695 36.650  -5.756  1.00 26.14  ? 494 TRP A CD1 1 
ATOM   3857  C  CD2 . TRP A  1  494 ? -45.066 38.601  -4.727  1.00 23.87  ? 494 TRP A CD2 1 
ATOM   3858  N  NE1 . TRP A  1  494 ? -43.543 37.373  -5.812  1.00 25.57  ? 494 TRP A NE1 1 
ATOM   3859  C  CE2 . TRP A  1  494 ? -43.745 38.583  -5.193  1.00 24.89  ? 494 TRP A CE2 1 
ATOM   3860  C  CE3 . TRP A  1  494 ? -45.534 39.730  -4.067  1.00 23.76  ? 494 TRP A CE3 1 
ATOM   3861  C  CZ2 . TRP A  1  494 ? -42.876 39.655  -5.011  1.00 24.18  ? 494 TRP A CZ2 1 
ATOM   3862  C  CZ3 . TRP A  1  494 ? -44.696 40.795  -3.899  1.00 23.90  ? 494 TRP A CZ3 1 
ATOM   3863  C  CH2 . TRP A  1  494 ? -43.374 40.755  -4.376  1.00 25.05  ? 494 TRP A CH2 1 
ATOM   3864  N  N   . LEU A  1  495 ? -49.091 34.704  -3.366  1.00 29.79  ? 495 LEU A N   1 
ATOM   3865  C  CA  . LEU A  1  495 ? -50.505 34.403  -3.472  1.00 32.12  ? 495 LEU A CA  1 
ATOM   3866  C  C   . LEU A  1  495 ? -51.283 34.623  -2.164  1.00 31.21  ? 495 LEU A C   1 
ATOM   3867  O  O   . LEU A  1  495 ? -52.505 34.655  -2.186  1.00 31.80  ? 495 LEU A O   1 
ATOM   3868  C  CB  . LEU A  1  495 ? -50.661 32.970  -3.951  1.00 34.37  ? 495 LEU A CB  1 
ATOM   3869  C  CG  . LEU A  1  495 ? -51.918 32.636  -4.691  1.00 39.87  ? 495 LEU A CG  1 
ATOM   3870  C  CD1 . LEU A  1  495 ? -52.201 33.629  -5.790  1.00 44.06  ? 495 LEU A CD1 1 
ATOM   3871  C  CD2 . LEU A  1  495 ? -51.765 31.252  -5.294  1.00 43.73  ? 495 LEU A CD2 1 
ATOM   3872  N  N   . ASN A  1  496 ? -50.587 34.778  -1.039  1.00 27.93  ? 496 ASN A N   1 
ATOM   3873  C  CA  . ASN A  1  496 ? -51.248 35.009  0.203   1.00 26.34  ? 496 ASN A CA  1 
ATOM   3874  C  C   . ASN A  1  496 ? -51.253 36.473  0.574   1.00 24.06  ? 496 ASN A C   1 
ATOM   3875  O  O   . ASN A  1  496 ? -51.430 36.794  1.715   1.00 25.82  ? 496 ASN A O   1 
ATOM   3876  C  CB  . ASN A  1  496 ? -50.605 34.153  1.302   1.00 29.10  ? 496 ASN A CB  1 
ATOM   3877  C  CG  . ASN A  1  496 ? -51.080 32.709  1.276   1.00 30.21  ? 496 ASN A CG  1 
ATOM   3878  O  OD1 . ASN A  1  496 ? -52.208 32.408  1.686   1.00 32.80  ? 496 ASN A OD1 1 
ATOM   3879  N  ND2 . ASN A  1  496 ? -50.229 31.814  0.795   1.00 26.82  ? 496 ASN A ND2 1 
ATOM   3880  N  N   . GLY A  1  497 ? -51.112 37.389  -0.362  1.00 23.73  ? 497 GLY A N   1 
ATOM   3881  C  CA  . GLY A  1  497 ? -51.106 38.823  -0.007  1.00 25.16  ? 497 GLY A CA  1 
ATOM   3882  C  C   . GLY A  1  497 ? -49.783 39.339  0.560   1.00 27.13  ? 497 GLY A C   1 
ATOM   3883  O  O   . GLY A  1  497 ? -48.854 38.556  0.783   1.00 28.59  ? 497 GLY A O   1 
ATOM   3884  N  N   . CYS A  1  498 ? -49.688 40.656  0.774   1.00 27.22  ? 498 CYS A N   1 
ATOM   3885  C  CA  . CYS A  1  498 ? -48.428 41.304  1.135   1.00 26.67  ? 498 CYS A CA  1 
ATOM   3886  C  C   . CYS A  1  498 ? -48.657 42.186  2.354   1.00 27.94  ? 498 CYS A C   1 
ATOM   3887  O  O   . CYS A  1  498 ? -49.386 43.161  2.224   1.00 31.83  ? 498 CYS A O   1 
ATOM   3888  C  CB  . CYS A  1  498 ? -47.906 42.168  -0.008  1.00 25.87  ? 498 CYS A CB  1 
ATOM   3889  S  SG  . CYS A  1  498 ? -47.678 41.371  -1.598  1.00 29.82  ? 498 CYS A SG  1 
ATOM   3890  N  N   . PRO A  1  499 ? -48.068 41.904  3.528   1.00 28.73  ? 499 PRO A N   1 
ATOM   3891  C  CA  . PRO A  1  499 ? -47.318 40.702  3.795   1.00 29.31  ? 499 PRO A CA  1 
ATOM   3892  C  C   . PRO A  1  499 ? -48.279 39.540  4.035   1.00 29.32  ? 499 PRO A C   1 
ATOM   3893  O  O   . PRO A  1  499 ? -49.427 39.759  4.397   1.00 31.28  ? 499 PRO A O   1 
ATOM   3894  C  CB  . PRO A  1  499 ? -46.548 41.043  5.074   1.00 30.22  ? 499 PRO A CB  1 
ATOM   3895  C  CG  . PRO A  1  499 ? -47.434 41.979  5.806   1.00 30.05  ? 499 PRO A CG  1 
ATOM   3896  C  CD  . PRO A  1  499 ? -48.259 42.698  4.759   1.00 29.95  ? 499 PRO A CD  1 
ATOM   3897  N  N   . PRO A  1  500 ? -47.800 38.311  3.861   1.00 27.57  ? 500 PRO A N   1 
ATOM   3898  C  CA  . PRO A  1  500 ? -48.662 37.186  4.129   1.00 26.47  ? 500 PRO A CA  1 
ATOM   3899  C  C   . PRO A  1  500 ? -48.939 37.079  5.606   1.00 27.38  ? 500 PRO A C   1 
ATOM   3900  O  O   . PRO A  1  500 ? -48.187 37.614  6.409   1.00 29.38  ? 500 PRO A O   1 
ATOM   3901  C  CB  . PRO A  1  500 ? -47.853 36.000  3.639   1.00 26.15  ? 500 PRO A CB  1 
ATOM   3902  C  CG  . PRO A  1  500 ? -46.440 36.430  3.783   1.00 27.40  ? 500 PRO A CG  1 
ATOM   3903  C  CD  . PRO A  1  500 ? -46.425 37.903  3.519   1.00 26.12  ? 500 PRO A CD  1 
ATOM   3904  N  N   . PRO A  1  501 ? -50.045 36.426  5.978   1.00 28.74  ? 501 PRO A N   1 
ATOM   3905  C  CA  . PRO A  1  501 ? -50.326 36.282  7.404   1.00 29.39  ? 501 PRO A CA  1 
ATOM   3906  C  C   . PRO A  1  501 ? -49.293 35.408  8.139   1.00 29.78  ? 501 PRO A C   1 
ATOM   3907  O  O   . PRO A  1  501 ? -48.580 34.650  7.502   1.00 31.48  ? 501 PRO A O   1 
ATOM   3908  C  CB  . PRO A  1  501 ? -51.698 35.619  7.441   1.00 30.24  ? 501 PRO A CB  1 
ATOM   3909  C  CG  . PRO A  1  501 ? -51.940 35.107  6.061   1.00 31.03  ? 501 PRO A CG  1 
ATOM   3910  C  CD  . PRO A  1  501 ? -51.141 35.945  5.127   1.00 28.13  ? 501 PRO A CD  1 
ATOM   3911  N  N   . TYR A  1  502 ? -49.231 35.566  9.464   1.00 28.21  ? 502 TYR A N   1 
ATOM   3912  C  CA  . TYR A  1  502 ? -48.348 34.842  10.353  1.00 27.09  ? 502 TYR A CA  1 
ATOM   3913  C  C   . TYR A  1  502 ? -48.374 33.362  10.029  1.00 29.75  ? 502 TYR A C   1 
ATOM   3914  O  O   . TYR A  1  502 ? -47.325 32.753  9.778   1.00 32.49  ? 502 TYR A O   1 
ATOM   3915  C  CB  . TYR A  1  502 ? -48.772 35.115  11.796  1.00 28.10  ? 502 TYR A CB  1 
ATOM   3916  C  CG  . TYR A  1  502 ? -47.791 34.672  12.850  1.00 29.02  ? 502 TYR A CG  1 
ATOM   3917  C  CD1 . TYR A  1  502 ? -46.680 35.445  13.159  1.00 28.88  ? 502 TYR A CD1 1 
ATOM   3918  C  CD2 . TYR A  1  502 ? -47.979 33.501  13.535  1.00 29.06  ? 502 TYR A CD2 1 
ATOM   3919  C  CE1 . TYR A  1  502 ? -45.771 35.042  14.112  1.00 29.33  ? 502 TYR A CE1 1 
ATOM   3920  C  CE2 . TYR A  1  502 ? -47.083 33.103  14.502  1.00 30.43  ? 502 TYR A CE2 1 
ATOM   3921  C  CZ  . TYR A  1  502 ? -45.985 33.869  14.776  1.00 29.70  ? 502 TYR A CZ  1 
ATOM   3922  O  OH  . TYR A  1  502 ? -45.107 33.448  15.738  1.00 33.22  ? 502 TYR A OH  1 
ATOM   3923  N  N   . HIS A  1  503 ? -49.568 32.781  9.977   1.00 30.81  ? 503 HIS A N   1 
ATOM   3924  C  CA  . HIS A  1  503 ? -49.728 31.395  9.563   1.00 31.12  ? 503 HIS A CA  1 
ATOM   3925  C  C   . HIS A  1  503 ? -50.300 31.386  8.171   1.00 31.25  ? 503 HIS A C   1 
ATOM   3926  O  O   . HIS A  1  503 ? -51.380 31.927  7.931   1.00 35.68  ? 503 HIS A O   1 
ATOM   3927  C  CB  . HIS A  1  503 ? -50.646 30.651  10.504  1.00 33.68  ? 503 HIS A CB  1 
ATOM   3928  C  CG  . HIS A  1  503 ? -50.073 30.441  11.864  1.00 34.68  ? 503 HIS A CG  1 
ATOM   3929  N  ND1 . HIS A  1  503 ? -48.953 29.675  12.083  1.00 36.94  ? 503 HIS A ND1 1 
ATOM   3930  C  CD2 . HIS A  1  503 ? -50.480 30.872  13.080  1.00 39.15  ? 503 HIS A CD2 1 
ATOM   3931  C  CE1 . HIS A  1  503 ? -48.678 29.658  13.376  1.00 40.72  ? 503 HIS A CE1 1 
ATOM   3932  N  NE2 . HIS A  1  503 ? -49.582 30.387  14.004  1.00 40.81  ? 503 HIS A NE2 1 
ATOM   3933  N  N   . THR A  1  504 ? -49.540 30.819  7.246   1.00 30.03  ? 504 THR A N   1 
ATOM   3934  C  CA  . THR A  1  504 ? -50.000 30.545  5.909   1.00 28.60  ? 504 THR A CA  1 
ATOM   3935  C  C   . THR A  1  504 ? -50.045 29.054  5.750   1.00 28.56  ? 504 THR A C   1 
ATOM   3936  O  O   . THR A  1  504 ? -49.382 28.295  6.522   1.00 25.18  ? 504 THR A O   1 
ATOM   3937  C  CB  . THR A  1  504 ? -49.064 31.127  4.886   1.00 29.05  ? 504 THR A CB  1 
ATOM   3938  O  OG1 . THR A  1  504 ? -47.721 31.001  5.380   1.00 31.52  ? 504 THR A OG1 1 
ATOM   3939  C  CG2 . THR A  1  504 ? -49.417 32.575  4.679   1.00 30.12  ? 504 THR A CG2 1 
ATOM   3940  N  N   . PHE A  1  505 ? -50.889 28.648  4.800   1.00 26.92  ? 505 PHE A N   1 
ATOM   3941  C  CA  . PHE A  1  505 ? -51.217 27.249  4.561   1.00 27.77  ? 505 PHE A CA  1 
ATOM   3942  C  C   . PHE A  1  505 ? -51.661 26.450  5.782   1.00 28.08  ? 505 PHE A C   1 
ATOM   3943  O  O   . PHE A  1  505 ? -51.328 25.272  5.901   1.00 29.99  ? 505 PHE A O   1 
ATOM   3944  C  CB  . PHE A  1  505 ? -50.020 26.574  3.908   1.00 30.40  ? 505 PHE A CB  1 
ATOM   3945  C  CG  . PHE A  1  505 ? -49.471 27.346  2.767   1.00 31.24  ? 505 PHE A CG  1 
ATOM   3946  C  CD1 . PHE A  1  505 ? -50.089 27.318  1.563   1.00 31.26  ? 505 PHE A CD1 1 
ATOM   3947  C  CD2 . PHE A  1  505 ? -48.369 28.134  2.924   1.00 34.60  ? 505 PHE A CD2 1 
ATOM   3948  C  CE1 . PHE A  1  505 ? -49.610 28.057  0.506   1.00 33.04  ? 505 PHE A CE1 1 
ATOM   3949  C  CE2 . PHE A  1  505 ? -47.874 28.873  1.865   1.00 34.49  ? 505 PHE A CE2 1 
ATOM   3950  C  CZ  . PHE A  1  505 ? -48.503 28.841  0.657   1.00 30.51  ? 505 PHE A CZ  1 
ATOM   3951  N  N   . GLU A  1  506 ? -52.404 27.071  6.693   1.00 30.21  ? 506 GLU A N   1 
ATOM   3952  C  CA  . GLU A  1  506 ? -53.095 26.314  7.752   1.00 32.09  ? 506 GLU A CA  1 
ATOM   3953  C  C   . GLU A  1  506 ? -53.973 25.236  7.126   1.00 28.37  ? 506 GLU A C   1 
ATOM   3954  O  O   . GLU A  1  506 ? -54.058 24.153  7.638   1.00 28.25  ? 506 GLU A O   1 
ATOM   3955  C  CB  . GLU A  1  506 ? -53.945 27.214  8.625   1.00 35.46  ? 506 GLU A CB  1 
ATOM   3956  C  CG  . GLU A  1  506 ? -53.137 28.000  9.621   1.00 42.70  ? 506 GLU A CG  1 
ATOM   3957  C  CD  . GLU A  1  506 ? -53.980 28.539  10.753  1.00 47.64  ? 506 GLU A CD  1 
ATOM   3958  O  OE1 . GLU A  1  506 ? -54.786 29.457  10.468  1.00 51.96  ? 506 GLU A OE1 1 
ATOM   3959  O  OE2 . GLU A  1  506 ? -53.821 28.046  11.897  1.00 48.42  ? 506 GLU A OE2 1 
ATOM   3960  N  N   . GLU A  1  507 ? -54.572 25.546  5.997   1.00 26.44  ? 507 GLU A N   1 
ATOM   3961  C  CA  . GLU A  1  507 ? -55.141 24.570  5.162   1.00 30.18  ? 507 GLU A CA  1 
ATOM   3962  C  C   . GLU A  1  507 ? -54.194 24.440  4.005   1.00 32.19  ? 507 GLU A C   1 
ATOM   3963  O  O   . GLU A  1  507 ? -53.987 25.403  3.284   1.00 32.80  ? 507 GLU A O   1 
ATOM   3964  C  CB  . GLU A  1  507 ? -56.529 25.013  4.696   1.00 32.61  ? 507 GLU A CB  1 
ATOM   3965  C  CG  . GLU A  1  507 ? -57.137 24.101  3.651   1.00 36.20  ? 507 GLU A CG  1 
ATOM   3966  C  CD  . GLU A  1  507 ? -58.659 24.052  3.720   1.00 40.11  ? 507 GLU A CD  1 
ATOM   3967  O  OE1 . GLU A  1  507 ? -59.324 25.077  3.475   1.00 43.90  ? 507 GLU A OE1 1 
ATOM   3968  O  OE2 . GLU A  1  507 ? -59.187 22.969  4.026   1.00 43.71  ? 507 GLU A OE2 1 
ATOM   3969  N  N   . PRO A  1  508 ? -53.620 23.241  3.793   1.00 37.05  ? 508 PRO A N   1 
ATOM   3970  C  CA  . PRO A  1  508 ? -52.640 23.087  2.696   1.00 34.17  ? 508 PRO A CA  1 
ATOM   3971  C  C   . PRO A  1  508 ? -53.202 23.325  1.320   1.00 31.84  ? 508 PRO A C   1 
ATOM   3972  O  O   . PRO A  1  508 ? -54.407 23.325  1.154   1.00 32.57  ? 508 PRO A O   1 
ATOM   3973  C  CB  . PRO A  1  508 ? -52.161 21.624  2.842   1.00 35.03  ? 508 PRO A CB  1 
ATOM   3974  C  CG  . PRO A  1  508 ? -53.202 20.960  3.649   1.00 35.92  ? 508 PRO A CG  1 
ATOM   3975  C  CD  . PRO A  1  508 ? -53.698 22.013  4.606   1.00 37.11  ? 508 PRO A CD  1 
ATOM   3976  N  N   . THR A  1  509 ? -52.325 23.508  0.333   1.00 32.19  ? 509 THR A N   1 
ATOM   3977  C  CA  . THR A  1  509 ? -52.772 23.601  -1.048  1.00 31.75  ? 509 THR A CA  1 
ATOM   3978  C  C   . THR A  1  509 ? -53.433 22.292  -1.413  1.00 31.61  ? 509 THR A C   1 
ATOM   3979  O  O   . THR A  1  509 ? -53.244 21.286  -0.711  1.00 31.99  ? 509 THR A O   1 
ATOM   3980  C  CB  . THR A  1  509 ? -51.631 23.872  -2.079  1.00 31.24  ? 509 THR A CB  1 
ATOM   3981  O  OG1 . THR A  1  509 ? -50.735 22.738  -2.164  1.00 27.25  ? 509 THR A OG1 1 
ATOM   3982  C  CG2 . THR A  1  509 ? -50.878 25.208  -1.763  1.00 32.57  ? 509 THR A CG2 1 
ATOM   3983  N  N   . TYR A  1  510 ? -54.174 22.316  -2.527  1.00 30.71  ? 510 TYR A N   1 
ATOM   3984  C  CA  . TYR A  1  510 ? -54.760 21.126  -3.142  1.00 28.94  ? 510 TYR A CA  1 
ATOM   3985  C  C   . TYR A  1  510 ? -54.070 20.907  -4.447  1.00 26.13  ? 510 TYR A C   1 
ATOM   3986  O  O   . TYR A  1  510 ? -54.134 21.791  -5.271  1.00 23.70  ? 510 TYR A O   1 
ATOM   3987  C  CB  . TYR A  1  510 ? -56.259 21.353  -3.404  1.00 31.33  ? 510 TYR A CB  1 
ATOM   3988  C  CG  . TYR A  1  510 ? -56.955 20.219  -4.135  1.00 31.59  ? 510 TYR A CG  1 
ATOM   3989  C  CD1 . TYR A  1  510 ? -56.950 20.147  -5.519  1.00 30.69  ? 510 TYR A CD1 1 
ATOM   3990  C  CD2 . TYR A  1  510 ? -57.626 19.206  -3.416  1.00 33.25  ? 510 TYR A CD2 1 
ATOM   3991  C  CE1 . TYR A  1  510 ? -57.581 19.100  -6.175  1.00 34.45  ? 510 TYR A CE1 1 
ATOM   3992  C  CE2 . TYR A  1  510 ? -58.271 18.153  -4.064  1.00 34.06  ? 510 TYR A CE2 1 
ATOM   3993  C  CZ  . TYR A  1  510 ? -58.261 18.105  -5.443  1.00 36.17  ? 510 TYR A CZ  1 
ATOM   3994  O  OH  . TYR A  1  510 ? -58.914 17.065  -6.094  1.00 38.42  ? 510 TYR A OH  1 
ATOM   3995  N  N   . VAL A  1  511 ? -53.438 19.732  -4.636  1.00 26.57  ? 511 VAL A N   1 
ATOM   3996  C  CA  . VAL A  1  511 ? -52.768 19.334  -5.900  1.00 29.28  ? 511 VAL A CA  1 
ATOM   3997  C  C   . VAL A  1  511 ? -53.073 17.870  -6.272  1.00 32.61  ? 511 VAL A C   1 
ATOM   3998  O  O   . VAL A  1  511 ? -52.778 16.997  -5.490  1.00 32.37  ? 511 VAL A O   1 
ATOM   3999  C  CB  . VAL A  1  511 ? -51.215 19.476  -5.822  1.00 29.60  ? 511 VAL A CB  1 
ATOM   4000  C  CG1 . VAL A  1  511 ? -50.577 19.155  -7.165  1.00 29.54  ? 511 VAL A CG1 1 
ATOM   4001  C  CG2 . VAL A  1  511 ? -50.790 20.868  -5.341  1.00 28.76  ? 511 VAL A CG2 1 
ATOM   4002  N  N   . ASN A  1  512 ? -53.630 17.623  -7.469  1.00 39.17  ? 512 ASN A N   1 
ATOM   4003  C  CA  . ASN A  1  512 ? -54.056 16.267  -7.912  1.00 45.22  ? 512 ASN A CA  1 
ATOM   4004  C  C   . ASN A  1  512 ? -52.898 15.426  -8.352  1.00 47.39  ? 512 ASN A C   1 
ATOM   4005  O  O   . ASN A  1  512 ? -51.957 15.925  -8.984  1.00 44.81  ? 512 ASN A O   1 
ATOM   4006  C  CB  . ASN A  1  512 ? -54.962 16.304  -9.175  1.00 43.39  ? 512 ASN A CB  1 
ATOM   4007  C  CG  . ASN A  1  512 ? -56.333 16.804  -8.892  1.00 44.86  ? 512 ASN A CG  1 
ATOM   4008  O  OD1 . ASN A  1  512 ? -56.897 16.499  -7.853  1.00 50.85  ? 512 ASN A OD1 1 
ATOM   4009  N  ND2 . ASN A  1  512 ? -56.886 17.596  -9.806  1.00 45.58  ? 512 ASN A ND2 1 
ATOM   4010  N  N   . LEU A  1  513 ? -53.070 14.130  -8.157  1.00 54.03  ? 513 LEU A N   1 
ATOM   4011  C  CA  . LEU A  1  513 ? -52.143 13.141  -8.668  1.00 66.64  ? 513 LEU A CA  1 
ATOM   4012  C  C   . LEU A  1  513 ? -52.381 12.876  -10.155 1.00 73.06  ? 513 LEU A C   1 
ATOM   4013  O  O   . LEU A  1  513 ? -51.419 12.826  -10.927 1.00 87.20  ? 513 LEU A O   1 
ATOM   4014  C  CB  . LEU A  1  513 ? -52.286 11.845  -7.878  1.00 74.55  ? 513 LEU A CB  1 
ATOM   4015  C  CG  . LEU A  1  513 ? -51.159 10.831  -8.045  1.00 83.83  ? 513 LEU A CG  1 
ATOM   4016  C  CD1 . LEU A  1  513 ? -49.893 11.318  -7.345  1.00 84.80  ? 513 LEU A CD1 1 
ATOM   4017  C  CD2 . LEU A  1  513 ? -51.613 9.459   -7.538  1.00 88.40  ? 513 LEU A CD2 1 
ATOM   4018  N  N   . LYS A  1  514 ? -53.641 12.687  -10.549 1.00 73.12  ? 514 LYS A N   1 
ATOM   4019  C  CA  . LYS A  1  514 ? -54.022 12.426  -11.970 1.00 86.66  ? 514 LYS A CA  1 
ATOM   4020  C  C   . LYS A  1  514 ? -53.825 10.969  -12.403 1.00 92.15  ? 514 LYS A C   1 
ATOM   4021  O  O   . LYS A  1  514 ? -53.992 10.674  -13.587 1.00 86.31  ? 514 LYS A O   1 
ATOM   4022  C  CB  . LYS A  1  514 ? -53.319 13.369  -12.995 1.00 86.77  ? 514 LYS A CB  1 
ATOM   4023  C  CG  . LYS A  1  514 ? -53.587 14.861  -12.802 1.00 84.34  ? 514 LYS A CG  1 
ATOM   4024  C  CD  . LYS A  1  514 ? -52.871 15.716  -13.836 1.00 81.37  ? 514 LYS A CD  1 
ATOM   4025  C  CE  . LYS A  1  514 ? -53.786 16.803  -14.388 1.00 85.93  ? 514 LYS A CE  1 
ATOM   4026  N  NZ  . LYS A  1  514 ? -54.196 17.877  -13.431 1.00 79.81  ? 514 LYS A NZ  1 
ATOM   4027  O  OXT . LYS A  1  514 ? -53.533 10.065  -11.606 1.00 93.42  ? 514 LYS A OXT 1 
HETATM 4028  N  N   . FME B  2  1   ? 11.009  44.482  -12.447 1.00 36.47  ? 1   FME B N   1 
HETATM 4029  C  CN  . FME B  2  1   ? 11.762  43.769  -11.607 1.00 37.07  ? 1   FME B CN  1 
HETATM 4030  O  O1  . FME B  2  1   ? 12.531  43.004  -12.066 1.00 42.16  ? 1   FME B O1  1 
HETATM 4031  C  CA  . FME B  2  1   ? 10.077  45.326  -11.663 1.00 35.67  ? 1   FME B CA  1 
HETATM 4032  C  CB  . FME B  2  1   ? 10.711  46.474  -10.860 1.00 32.95  ? 1   FME B CB  1 
HETATM 4033  C  CG  . FME B  2  1   ? 11.394  47.481  -11.753 1.00 33.95  ? 1   FME B CG  1 
HETATM 4034  S  SD  . FME B  2  1   ? 12.279  48.551  -10.693 1.00 37.76  ? 1   FME B SD  1 
HETATM 4035  C  CE  . FME B  2  1   ? 11.005  49.741  -10.430 1.00 44.00  ? 1   FME B CE  1 
HETATM 4036  C  C   . FME B  2  1   ? 8.919   45.862  -12.418 1.00 33.09  ? 1   FME B C   1 
HETATM 4037  O  O   . FME B  2  1   ? 8.903   45.937  -13.676 1.00 29.83  ? 1   FME B O   1 
ATOM   4038  N  N   . ALA B  2  2   ? 7.926   46.191  -11.613 1.00 31.87  ? 2   ALA B N   1 
ATOM   4039  C  CA  . ALA B  2  2   ? 6.818   46.937  -12.068 1.00 34.85  ? 2   ALA B CA  1 
ATOM   4040  C  C   . ALA B  2  2   ? 7.246   48.384  -12.270 1.00 32.71  ? 2   ALA B C   1 
ATOM   4041  O  O   . ALA B  2  2   ? 8.047   48.917  -11.503 1.00 37.72  ? 2   ALA B O   1 
ATOM   4042  C  CB  . ALA B  2  2   ? 5.688   46.844  -11.057 1.00 38.19  ? 2   ALA B CB  1 
ATOM   4043  N  N   . TYR B  2  3   ? 6.675   48.987  -13.298 1.00 33.64  ? 3   TYR B N   1 
ATOM   4044  C  CA  . TYR B  2  3   ? 6.783   50.414  -13.607 1.00 36.28  ? 3   TYR B CA  1 
ATOM   4045  C  C   . TYR B  2  3   ? 5.387   51.097  -13.550 1.00 38.93  ? 3   TYR B C   1 
ATOM   4046  O  O   . TYR B  2  3   ? 4.356   50.420  -13.561 1.00 39.01  ? 3   TYR B O   1 
ATOM   4047  C  CB  . TYR B  2  3   ? 7.360   50.596  -15.006 1.00 36.74  ? 3   TYR B CB  1 
ATOM   4048  C  CG  . TYR B  2  3   ? 6.711   49.715  -16.069 1.00 36.02  ? 3   TYR B CG  1 
ATOM   4049  C  CD1 . TYR B  2  3   ? 5.579   50.128  -16.773 1.00 34.67  ? 3   TYR B CD1 1 
ATOM   4050  C  CD2 . TYR B  2  3   ? 7.239   48.467  -16.364 1.00 35.53  ? 3   TYR B CD2 1 
ATOM   4051  C  CE1 . TYR B  2  3   ? 5.008   49.310  -17.762 1.00 32.81  ? 3   TYR B CE1 1 
ATOM   4052  C  CE2 . TYR B  2  3   ? 6.670   47.643  -17.341 1.00 35.93  ? 3   TYR B CE2 1 
ATOM   4053  C  CZ  . TYR B  2  3   ? 5.555   48.065  -18.045 1.00 33.28  ? 3   TYR B CZ  1 
ATOM   4054  O  OH  . TYR B  2  3   ? 4.991   47.216  -18.997 1.00 32.39  ? 3   TYR B OH  1 
ATOM   4055  N  N   . PRO B  2  4   ? 5.350   52.437  -13.538 1.00 39.32  ? 4   PRO B N   1 
ATOM   4056  C  CA  . PRO B  2  4   ? 4.054   53.098  -13.409 1.00 39.25  ? 4   PRO B CA  1 
ATOM   4057  C  C   . PRO B  2  4   ? 3.019   52.960  -14.560 1.00 37.08  ? 4   PRO B C   1 
ATOM   4058  O  O   . PRO B  2  4   ? 3.369   52.950  -15.741 1.00 36.86  ? 4   PRO B O   1 
ATOM   4059  C  CB  . PRO B  2  4   ? 4.439   54.563  -13.165 1.00 37.57  ? 4   PRO B CB  1 
ATOM   4060  C  CG  . PRO B  2  4   ? 5.786   54.504  -12.541 1.00 38.30  ? 4   PRO B CG  1 
ATOM   4061  C  CD  . PRO B  2  4   ? 6.458   53.390  -13.308 1.00 41.87  ? 4   PRO B CD  1 
ATOM   4062  N  N   . MET B  2  5   ? 1.745   52.885  -14.151 1.00 35.85  ? 5   MET B N   1 
ATOM   4063  C  CA  . MET B  2  5   ? 0.629   52.577  -15.001 1.00 36.24  ? 5   MET B CA  1 
ATOM   4064  C  C   . MET B  2  5   ? 0.784   51.259  -15.729 1.00 34.17  ? 5   MET B C   1 
ATOM   4065  O  O   . MET B  2  5   ? 0.242   51.093  -16.840 1.00 34.91  ? 5   MET B O   1 
ATOM   4066  C  CB  . MET B  2  5   ? 0.386   53.660  -16.023 1.00 40.80  ? 5   MET B CB  1 
ATOM   4067  C  CG  . MET B  2  5   ? -0.182  54.924  -15.468 1.00 49.97  ? 5   MET B CG  1 
ATOM   4068  S  SD  . MET B  2  5   ? -0.449  56.097  -16.831 1.00 55.82  ? 5   MET B SD  1 
ATOM   4069  C  CE  . MET B  2  5   ? -1.867  55.328  -17.636 1.00 52.34  ? 5   MET B CE  1 
ATOM   4070  N  N   . GLN B  2  6   ? 1.486   50.300  -15.135 1.00 30.16  ? 6   GLN B N   1 
ATOM   4071  C  CA  . GLN B  2  6   ? 1.607   49.011  -15.802 1.00 29.45  ? 6   GLN B CA  1 
ATOM   4072  C  C   . GLN B  2  6   ? 0.226   48.317  -15.894 1.00 29.59  ? 6   GLN B C   1 
ATOM   4073  O  O   . GLN B  2  6   ? -0.574  48.383  -14.965 1.00 28.61  ? 6   GLN B O   1 
ATOM   4074  C  CB  . GLN B  2  6   ? 2.629   48.146  -15.093 1.00 29.12  ? 6   GLN B CB  1 
ATOM   4075  C  CG  . GLN B  2  6   ? 2.902   46.837  -15.802 1.00 29.81  ? 6   GLN B CG  1 
ATOM   4076  C  CD  . GLN B  2  6   ? 4.088   46.105  -15.232 1.00 30.53  ? 6   GLN B CD  1 
ATOM   4077  O  OE1 . GLN B  2  6   ? 4.794   46.632  -14.394 1.00 32.52  ? 6   GLN B OE1 1 
ATOM   4078  N  NE2 . GLN B  2  6   ? 4.314   44.871  -15.695 1.00 33.11  ? 6   GLN B NE2 1 
ATOM   4079  N  N   . LEU B  2  7   ? -0.047  47.678  -17.027 1.00 31.01  ? 7   LEU B N   1 
ATOM   4080  C  CA  . LEU B  2  7   ? -1.291  46.926  -17.230 1.00 33.11  ? 7   LEU B CA  1 
ATOM   4081  C  C   . LEU B  2  7   ? -1.131  45.408  -17.108 1.00 32.43  ? 7   LEU B C   1 
ATOM   4082  O  O   . LEU B  2  7   ? -1.980  44.736  -16.549 1.00 30.86  ? 7   LEU B O   1 
ATOM   4083  C  CB  . LEU B  2  7   ? -1.881  47.247  -18.607 1.00 34.35  ? 7   LEU B CB  1 
ATOM   4084  C  CG  . LEU B  2  7   ? -2.357  48.671  -18.861 1.00 36.26  ? 7   LEU B CG  1 
ATOM   4085  C  CD1 . LEU B  2  7   ? -3.100  48.667  -20.164 1.00 39.66  ? 7   LEU B CD1 1 
ATOM   4086  C  CD2 . LEU B  2  7   ? -3.269  49.209  -17.774 1.00 39.45  ? 7   LEU B CD2 1 
ATOM   4087  N  N   . GLY B  2  8   ? -0.050  44.873  -17.655 1.00 33.76  ? 8   GLY B N   1 
ATOM   4088  C  CA  . GLY B  2  8   ? 0.142   43.416  -17.759 1.00 31.18  ? 8   GLY B CA  1 
ATOM   4089  C  C   . GLY B  2  8   ? 1.320   42.913  -16.955 1.00 29.29  ? 8   GLY B C   1 
ATOM   4090  O  O   . GLY B  2  8   ? 1.712   43.516  -15.942 1.00 28.94  ? 8   GLY B O   1 
ATOM   4091  N  N   . PHE B  2  9   ? 1.867   41.790  -17.396 1.00 26.17  ? 9   PHE B N   1 
ATOM   4092  C  CA  . PHE B  2  9   ? 2.963   41.164  -16.689 1.00 26.79  ? 9   PHE B CA  1 
ATOM   4093  C  C   . PHE B  2  9   ? 4.251   41.960  -16.861 1.00 28.43  ? 9   PHE B C   1 
ATOM   4094  O  O   . PHE B  2  9   ? 4.482   42.578  -17.904 1.00 30.29  ? 9   PHE B O   1 
ATOM   4095  C  CB  . PHE B  2  9   ? 3.198   39.740  -17.201 1.00 27.88  ? 9   PHE B CB  1 
ATOM   4096  C  CG  . PHE B  2  9   ? 2.206   38.719  -16.703 1.00 27.43  ? 9   PHE B CG  1 
ATOM   4097  C  CD1 . PHE B  2  9   ? 2.030   38.506  -15.353 1.00 28.30  ? 9   PHE B CD1 1 
ATOM   4098  C  CD2 . PHE B  2  9   ? 1.505   37.921  -17.583 1.00 28.49  ? 9   PHE B CD2 1 
ATOM   4099  C  CE1 . PHE B  2  9   ? 1.120   37.570  -14.882 1.00 29.83  ? 9   PHE B CE1 1 
ATOM   4100  C  CE2 . PHE B  2  9   ? 0.611   36.944  -17.124 1.00 29.98  ? 9   PHE B CE2 1 
ATOM   4101  C  CZ  . PHE B  2  9   ? 0.416   36.760  -15.768 1.00 29.80  ? 9   PHE B CZ  1 
ATOM   4102  N  N   . GLN B  2  10  ? 5.090   41.929  -15.826 1.00 28.57  ? 10  GLN B N   1 
ATOM   4103  C  CA  . GLN B  2  10  ? 6.495   42.326  -15.937 1.00 27.94  ? 10  GLN B CA  1 
ATOM   4104  C  C   . GLN B  2  10  ? 7.162   41.575  -17.101 1.00 31.15  ? 10  GLN B C   1 
ATOM   4105  O  O   . GLN B  2  10  ? 6.882   40.374  -17.326 1.00 31.19  ? 10  GLN B O   1 
ATOM   4106  C  CB  . GLN B  2  10  ? 7.231   42.003  -14.648 1.00 26.59  ? 10  GLN B CB  1 
ATOM   4107  C  CG  . GLN B  2  10  ? 6.770   42.868  -13.506 1.00 27.31  ? 10  GLN B CG  1 
ATOM   4108  C  CD  . GLN B  2  10  ? 7.527   42.628  -12.237 1.00 28.77  ? 10  GLN B CD  1 
ATOM   4109  O  OE1 . GLN B  2  10  ? 8.700   42.196  -12.265 1.00 30.63  ? 10  GLN B OE1 1 
ATOM   4110  N  NE2 . GLN B  2  10  ? 6.875   42.921  -11.099 1.00 25.83  ? 10  GLN B NE2 1 
ATOM   4111  N  N   . ASP B  2  11  ? 8.017   42.265  -17.858 1.00 32.44  ? 11  ASP B N   1 
ATOM   4112  C  CA  . ASP B  2  11  ? 8.760   41.599  -18.942 1.00 34.20  ? 11  ASP B CA  1 
ATOM   4113  C  C   . ASP B  2  11  ? 9.482   40.361  -18.422 1.00 31.17  ? 11  ASP B C   1 
ATOM   4114  O  O   . ASP B  2  11  ? 9.987   40.350  -17.305 1.00 29.86  ? 11  ASP B O   1 
ATOM   4115  C  CB  . ASP B  2  11  ? 9.777   42.542  -19.614 1.00 36.90  ? 11  ASP B CB  1 
ATOM   4116  C  CG  . ASP B  2  11  ? 9.128   43.614  -20.481 1.00 37.75  ? 11  ASP B CG  1 
ATOM   4117  O  OD1 . ASP B  2  11  ? 7.871   43.746  -20.562 1.00 38.50  ? 11  ASP B OD1 1 
ATOM   4118  O  OD2 . ASP B  2  11  ? 9.914   44.351  -21.077 1.00 35.75  ? 11  ASP B OD2 1 
ATOM   4119  N  N   . ALA B  2  12  ? 9.494   39.320  -19.244 1.00 32.51  ? 12  ALA B N   1 
ATOM   4120  C  CA  . ALA B  2  12  ? 10.036  38.024  -18.864 1.00 35.07  ? 12  ALA B CA  1 
ATOM   4121  C  C   . ALA B  2  12  ? 11.556  38.094  -18.862 1.00 36.40  ? 12  ALA B C   1 
ATOM   4122  O  O   . ALA B  2  12  ? 12.152  38.666  -19.762 1.00 34.13  ? 12  ALA B O   1 
ATOM   4123  C  CB  . ALA B  2  12  ? 9.588   36.949  -19.858 1.00 36.05  ? 12  ALA B CB  1 
ATOM   4124  N  N   . THR B  2  13  ? 12.146  37.485  -17.854 1.00 35.09  ? 13  THR B N   1 
ATOM   4125  C  CA  . THR B  2  13  ? 13.562  37.366  -17.721 1.00 38.21  ? 13  THR B CA  1 
ATOM   4126  C  C   . THR B  2  13  ? 14.023  35.936  -17.919 1.00 40.33  ? 13  THR B C   1 
ATOM   4127  O  O   . THR B  2  13  ? 15.209  35.704  -18.139 1.00 41.67  ? 13  THR B O   1 
ATOM   4128  C  CB  . THR B  2  13  ? 13.931  37.797  -16.305 1.00 43.18  ? 13  THR B CB  1 
ATOM   4129  O  OG1 . THR B  2  13  ? 13.320  39.062  -16.039 1.00 42.33  ? 13  THR B OG1 1 
ATOM   4130  C  CG2 . THR B  2  13  ? 15.448  37.888  -16.097 1.00 46.14  ? 13  THR B CG2 1 
ATOM   4131  N  N   . SER B  2  14  ? 13.099  34.976  -17.815 1.00 40.76  ? 14  SER B N   1 
ATOM   4132  C  CA  . SER B  2  14  ? 13.422  33.556  -17.921 1.00 36.61  ? 14  SER B CA  1 
ATOM   4133  C  C   . SER B  2  14  ? 12.607  32.998  -19.064 1.00 35.73  ? 14  SER B C   1 
ATOM   4134  O  O   . SER B  2  14  ? 11.548  33.537  -19.379 1.00 34.48  ? 14  SER B O   1 
ATOM   4135  C  CB  . SER B  2  14  ? 13.042  32.836  -16.638 1.00 38.79  ? 14  SER B CB  1 
ATOM   4136  O  OG  . SER B  2  14  ? 11.628  32.638  -16.554 1.00 39.17  ? 14  SER B OG  1 
ATOM   4137  N  N   . PRO B  2  15  ? 13.073  31.905  -19.685 1.00 35.72  ? 15  PRO B N   1 
ATOM   4138  C  CA  . PRO B  2  15  ? 12.289  31.258  -20.749 1.00 36.60  ? 15  PRO B CA  1 
ATOM   4139  C  C   . PRO B  2  15  ? 10.902  30.769  -20.347 1.00 35.56  ? 15  PRO B C   1 
ATOM   4140  O  O   . PRO B  2  15  ? 9.998   30.785  -21.170 1.00 35.16  ? 15  PRO B O   1 
ATOM   4141  C  CB  . PRO B  2  15  ? 13.164  30.066  -21.155 1.00 36.46  ? 15  PRO B CB  1 
ATOM   4142  C  CG  . PRO B  2  15  ? 14.527  30.526  -20.810 1.00 36.01  ? 15  PRO B CG  1 
ATOM   4143  C  CD  . PRO B  2  15  ? 14.373  31.242  -19.509 1.00 36.01  ? 15  PRO B CD  1 
ATOM   4144  N  N   . ILE B  2  16  ? 10.763  30.332  -19.097 1.00 38.77  ? 16  ILE B N   1 
ATOM   4145  C  CA  . ILE B  2  16  ? 9.511   29.820  -18.578 1.00 38.16  ? 16  ILE B CA  1 
ATOM   4146  C  C   . ILE B  2  16  ? 8.532   30.957  -18.390 1.00 36.32  ? 16  ILE B C   1 
ATOM   4147  O  O   . ILE B  2  16  ? 7.380   30.808  -18.758 1.00 40.11  ? 16  ILE B O   1 
ATOM   4148  C  CB  . ILE B  2  16  ? 9.709   28.981  -17.308 1.00 42.52  ? 16  ILE B CB  1 
ATOM   4149  C  CG1 . ILE B  2  16  ? 8.483   28.153  -17.022 1.00 50.81  ? 16  ILE B CG1 1 
ATOM   4150  C  CG2 . ILE B  2  16  ? 10.016  29.808  -16.088 1.00 49.41  ? 16  ILE B CG2 1 
ATOM   4151  C  CD1 . ILE B  2  16  ? 8.580   26.811  -17.709 1.00 61.30  ? 16  ILE B CD1 1 
ATOM   4152  N  N   . MET B  2  17  ? 8.982   32.115  -17.914 1.00 32.54  ? 17  MET B N   1 
ATOM   4153  C  CA  . MET B  2  17  ? 8.105   33.294  -17.856 1.00 31.61  ? 17  MET B CA  1 
ATOM   4154  C  C   . MET B  2  17  ? 7.636   33.775  -19.233 1.00 33.58  ? 17  MET B C   1 
ATOM   4155  O  O   . MET B  2  17  ? 6.556   34.356  -19.382 1.00 31.26  ? 17  MET B O   1 
ATOM   4156  C  CB  . MET B  2  17  ? 8.774   34.443  -17.116 1.00 30.73  ? 17  MET B CB  1 
ATOM   4157  C  CG  . MET B  2  17  ? 7.852   35.617  -16.824 1.00 31.18  ? 17  MET B CG  1 
ATOM   4158  S  SD  . MET B  2  17  ? 6.405   35.129  -15.885 1.00 29.73  ? 17  MET B SD  1 
ATOM   4159  C  CE  . MET B  2  17  ? 5.070   36.003  -16.689 1.00 30.73  ? 17  MET B CE  1 
ATOM   4160  N  N   . GLU B  2  18  ? 8.457   33.531  -20.241 1.00 38.25  ? 18  GLU B N   1 
ATOM   4161  C  CA  . GLU B  2  18  ? 8.112   33.850  -21.615 1.00 37.16  ? 18  GLU B CA  1 
ATOM   4162  C  C   . GLU B  2  18  ? 6.973   32.942  -22.070 1.00 35.10  ? 18  GLU B C   1 
ATOM   4163  O  O   . GLU B  2  18  ? 6.028   33.404  -22.677 1.00 32.01  ? 18  GLU B O   1 
ATOM   4164  C  CB  . GLU B  2  18  ? 9.341   33.706  -22.528 1.00 41.43  ? 18  GLU B CB  1 
ATOM   4165  C  CG  . GLU B  2  18  ? 9.426   34.810  -23.568 1.00 47.69  ? 18  GLU B CG  1 
ATOM   4166  C  CD  . GLU B  2  18  ? 10.218  34.449  -24.814 1.00 51.94  ? 18  GLU B CD  1 
ATOM   4167  O  OE1 . GLU B  2  18  ? 9.572   34.438  -25.946 1.00 46.73  ? 18  GLU B OE1 1 
ATOM   4168  O  OE2 . GLU B  2  18  ? 11.461  34.204  -24.628 1.00 46.66  ? 18  GLU B OE2 1 
ATOM   4169  N  N   . GLU B  2  19  ? 7.054   31.656  -21.746 1.00 33.85  ? 19  GLU B N   1 
ATOM   4170  C  CA  . GLU B  2  19  ? 5.991   30.719  -22.097 1.00 34.65  ? 19  GLU B CA  1 
ATOM   4171  C  C   . GLU B  2  19  ? 4.704   31.116  -21.419 1.00 32.11  ? 19  GLU B C   1 
ATOM   4172  O  O   . GLU B  2  19  ? 3.678   31.012  -22.018 1.00 29.83  ? 19  GLU B O   1 
ATOM   4173  C  CB  . GLU B  2  19  ? 6.319   29.313  -21.624 1.00 38.15  ? 19  GLU B CB  1 
ATOM   4174  C  CG  . GLU B  2  19  ? 7.520   28.697  -22.289 1.00 40.40  ? 19  GLU B CG  1 
ATOM   4175  C  CD  . GLU B  2  19  ? 7.260   28.206  -23.686 1.00 43.98  ? 19  GLU B CD  1 
ATOM   4176  O  OE1 . GLU B  2  19  ? 8.159   27.542  -24.218 1.00 57.12  ? 19  GLU B OE1 1 
ATOM   4177  O  OE2 . GLU B  2  19  ? 6.188   28.448  -24.258 1.00 49.08  ? 19  GLU B OE2 1 
ATOM   4178  N  N   . LEU B  2  20  ? 4.788   31.562  -20.166 1.00 28.60  ? 20  LEU B N   1 
ATOM   4179  C  CA  . LEU B  2  20  ? 3.645   32.022  -19.438 1.00 29.18  ? 20  LEU B CA  1 
ATOM   4180  C  C   . LEU B  2  20  ? 3.002   33.251  -20.052 1.00 31.55  ? 20  LEU B C   1 
ATOM   4181  O  O   . LEU B  2  20  ? 1.767   33.282  -20.199 1.00 32.19  ? 20  LEU B O   1 
ATOM   4182  C  CB  . LEU B  2  20  ? 3.981   32.244  -17.963 1.00 29.58  ? 20  LEU B CB  1 
ATOM   4183  C  CG  . LEU B  2  20  ? 4.310   30.963  -17.151 1.00 29.20  ? 20  LEU B CG  1 
ATOM   4184  C  CD1 . LEU B  2  20  ? 4.728   31.367  -15.758 1.00 28.89  ? 20  LEU B CD1 1 
ATOM   4185  C  CD2 . LEU B  2  20  ? 3.162   29.957  -17.055 1.00 30.16  ? 20  LEU B CD2 1 
ATOM   4186  N  N   . LEU B  2  21  ? 3.811   34.233  -20.449 1.00 33.15  ? 21  LEU B N   1 
ATOM   4187  C  CA  . LEU B  2  21  ? 3.305   35.388  -21.209 1.00 33.94  ? 21  LEU B CA  1 
ATOM   4188  C  C   . LEU B  2  21  ? 2.418   35.009  -22.377 1.00 32.86  ? 21  LEU B C   1 
ATOM   4189  O  O   . LEU B  2  21  ? 1.309   35.535  -22.514 1.00 34.59  ? 21  LEU B O   1 
ATOM   4190  C  CB  . LEU B  2  21  ? 4.446   36.220  -21.768 1.00 35.84  ? 21  LEU B CB  1 
ATOM   4191  C  CG  . LEU B  2  21  ? 5.108   37.073  -20.708 1.00 41.53  ? 21  LEU B CG  1 
ATOM   4192  C  CD1 . LEU B  2  21  ? 6.286   37.834  -21.311 1.00 45.52  ? 21  LEU B CD1 1 
ATOM   4193  C  CD2 . LEU B  2  21  ? 4.106   38.031  -20.099 1.00 43.61  ? 21  LEU B CD2 1 
ATOM   4194  N  N   . HIS B  2  22  ? 2.914   34.099  -23.202 1.00 31.29  ? 22  HIS B N   1 
ATOM   4195  C  CA  . HIS B  2  22  ? 2.232   33.693  -24.435 1.00 35.45  ? 22  HIS B CA  1 
ATOM   4196  C  C   . HIS B  2  22  ? 0.987   32.832  -24.140 1.00 35.23  ? 22  HIS B C   1 
ATOM   4197  O  O   . HIS B  2  22  ? 0.006   32.923  -24.860 1.00 31.53  ? 22  HIS B O   1 
ATOM   4198  C  CB  . HIS B  2  22  ? 3.178   32.928  -25.408 1.00 37.15  ? 22  HIS B CB  1 
ATOM   4199  C  CG  . HIS B  2  22  ? 4.397   33.700  -25.805 1.00 41.57  ? 22  HIS B CG  1 
ATOM   4200  N  ND1 . HIS B  2  22  ? 4.336   34.991  -26.286 1.00 43.87  ? 22  HIS B ND1 1 
ATOM   4201  C  CD2 . HIS B  2  22  ? 5.717   33.372  -25.773 1.00 46.66  ? 22  HIS B CD2 1 
ATOM   4202  C  CE1 . HIS B  2  22  ? 5.568   35.431  -26.516 1.00 47.98  ? 22  HIS B CE1 1 
ATOM   4203  N  NE2 . HIS B  2  22  ? 6.424   34.470  -26.214 1.00 48.41  ? 22  HIS B NE2 1 
ATOM   4204  N  N   . PHE B  2  23  ? 1.063   31.984  -23.110 1.00 35.44  ? 23  PHE B N   1 
ATOM   4205  C  CA  . PHE B  2  23  ? -0.072  31.233  -22.635 1.00 32.58  ? 23  PHE B CA  1 
ATOM   4206  C  C   . PHE B  2  23  ? -1.161  32.156  -22.104 1.00 32.83  ? 23  PHE B C   1 
ATOM   4207  O  O   . PHE B  2  23  ? -2.353  31.893  -22.289 1.00 32.33  ? 23  PHE B O   1 
ATOM   4208  C  CB  . PHE B  2  23  ? 0.315   30.266  -21.538 1.00 32.64  ? 23  PHE B CB  1 
ATOM   4209  C  CG  . PHE B  2  23  ? -0.867  29.524  -20.991 1.00 34.07  ? 23  PHE B CG  1 
ATOM   4210  C  CD1 . PHE B  2  23  ? -1.617  28.694  -21.819 1.00 35.66  ? 23  PHE B CD1 1 
ATOM   4211  C  CD2 . PHE B  2  23  ? -1.308  29.735  -19.708 1.00 35.19  ? 23  PHE B CD2 1 
ATOM   4212  C  CE1 . PHE B  2  23  ? -2.738  28.041  -21.340 1.00 33.99  ? 23  PHE B CE1 1 
ATOM   4213  C  CE2 . PHE B  2  23  ? -2.447  29.082  -19.228 1.00 35.87  ? 23  PHE B CE2 1 
ATOM   4214  C  CZ  . PHE B  2  23  ? -3.154  28.240  -20.046 1.00 32.26  ? 23  PHE B CZ  1 
ATOM   4215  N  N   . HIS B  2  24  ? -0.761  33.235  -21.443 1.00 32.55  ? 24  HIS B N   1 
ATOM   4216  C  CA  . HIS B  2  24  ? -1.736  34.198  -20.939 1.00 33.09  ? 24  HIS B CA  1 
ATOM   4217  C  C   . HIS B  2  24  ? -2.470  34.898  -22.053 1.00 33.52  ? 24  HIS B C   1 
ATOM   4218  O  O   . HIS B  2  24  ? -3.630  35.201  -21.910 1.00 33.66  ? 24  HIS B O   1 
ATOM   4219  C  CB  . HIS B  2  24  ? -1.097  35.256  -20.034 1.00 31.80  ? 24  HIS B CB  1 
ATOM   4220  C  CG  . HIS B  2  24  ? -2.089  36.199  -19.440 1.00 31.43  ? 24  HIS B CG  1 
ATOM   4221  N  ND1 . HIS B  2  24  ? -2.125  37.538  -19.753 1.00 32.29  ? 24  HIS B ND1 1 
ATOM   4222  C  CD2 . HIS B  2  24  ? -3.114  35.988  -18.582 1.00 34.27  ? 24  HIS B CD2 1 
ATOM   4223  C  CE1 . HIS B  2  24  ? -3.088  38.124  -19.067 1.00 33.16  ? 24  HIS B CE1 1 
ATOM   4224  N  NE2 . HIS B  2  24  ? -3.696  37.210  -18.335 1.00 33.43  ? 24  HIS B NE2 1 
ATOM   4225  N  N   . ASP B  2  25  ? -1.781  35.184  -23.151 1.00 36.35  ? 25  ASP B N   1 
ATOM   4226  C  CA  . ASP B  2  25  ? -2.383  35.911  -24.284 1.00 34.87  ? 25  ASP B CA  1 
ATOM   4227  C  C   . ASP B  2  25  ? -3.416  35.022  -24.968 1.00 35.71  ? 25  ASP B C   1 
ATOM   4228  O  O   . ASP B  2  25  ? -4.466  35.502  -25.384 1.00 36.27  ? 25  ASP B O   1 
ATOM   4229  C  CB  . ASP B  2  25  ? -1.310  36.346  -25.308 1.00 34.73  ? 25  ASP B CB  1 
ATOM   4230  C  CG  . ASP B  2  25  ? -0.528  37.580  -24.873 1.00 33.70  ? 25  ASP B CG  1 
ATOM   4231  O  OD1 . ASP B  2  25  ? -0.892  38.265  -23.903 1.00 28.96  ? 25  ASP B OD1 1 
ATOM   4232  O  OD2 . ASP B  2  25  ? 0.479   37.874  -25.529 1.00 35.37  ? 25  ASP B OD2 1 
ATOM   4233  N  N   . HIS B  2  26  ? -3.081  33.739  -25.087 1.00 31.93  ? 26  HIS B N   1 
ATOM   4234  C  CA  . HIS B  2  26  ? -3.965  32.709  -25.582 1.00 31.77  ? 26  HIS B CA  1 
ATOM   4235  C  C   . HIS B  2  26  ? -5.233  32.634  -24.727 1.00 32.97  ? 26  HIS B C   1 
ATOM   4236  O  O   . HIS B  2  26  ? -6.329  32.608  -25.248 1.00 34.10  ? 26  HIS B O   1 
ATOM   4237  C  CB  . HIS B  2  26  ? -3.207  31.379  -25.526 1.00 30.77  ? 26  HIS B CB  1 
ATOM   4238  C  CG  . HIS B  2  26  ? -4.004  30.210  -25.950 1.00 33.81  ? 26  HIS B CG  1 
ATOM   4239  N  ND1 . HIS B  2  26  ? -4.502  30.075  -27.232 1.00 37.61  ? 26  HIS B ND1 1 
ATOM   4240  C  CD2 . HIS B  2  26  ? -4.354  29.083  -25.285 1.00 39.04  ? 26  HIS B CD2 1 
ATOM   4241  C  CE1 . HIS B  2  26  ? -5.146  28.922  -27.327 1.00 39.84  ? 26  HIS B CE1 1 
ATOM   4242  N  NE2 . HIS B  2  26  ? -5.074  28.301  -26.159 1.00 40.23  ? 26  HIS B NE2 1 
ATOM   4243  N  N   . THR B  2  27  ? -5.062  32.606  -23.409 1.00 31.66  ? 27  THR B N   1 
ATOM   4244  C  CA  . THR B  2  27  ? -6.171  32.470  -22.496 1.00 32.69  ? 27  THR B CA  1 
ATOM   4245  C  C   . THR B  2  27  ? -7.044  33.745  -22.462 1.00 32.41  ? 27  THR B C   1 
ATOM   4246  O  O   . THR B  2  27  ? -8.253  33.659  -22.455 1.00 31.46  ? 27  THR B O   1 
ATOM   4247  C  CB  . THR B  2  27  ? -5.674  32.034  -21.092 1.00 32.51  ? 27  THR B CB  1 
ATOM   4248  O  OG1 . THR B  2  27  ? -5.024  30.755  -21.192 1.00 34.49  ? 27  THR B OG1 1 
ATOM   4249  C  CG2 . THR B  2  27  ? -6.800  31.854  -20.168 1.00 33.48  ? 27  THR B CG2 1 
ATOM   4250  N  N   . LEU B  2  28  ? -6.426  34.914  -22.494 1.00 32.98  ? 28  LEU B N   1 
ATOM   4251  C  CA  . LEU B  2  28  ? -7.137  36.184  -22.443 1.00 33.02  ? 28  LEU B CA  1 
ATOM   4252  C  C   . LEU B  2  28  ? -7.927  36.460  -23.748 1.00 35.79  ? 28  LEU B C   1 
ATOM   4253  O  O   . LEU B  2  28  ? -9.009  37.060  -23.728 1.00 36.89  ? 28  LEU B O   1 
ATOM   4254  C  CB  . LEU B  2  28  ? -6.128  37.306  -22.166 1.00 34.11  ? 28  LEU B CB  1 
ATOM   4255  C  CG  . LEU B  2  28  ? -6.690  38.669  -21.786 1.00 37.63  ? 28  LEU B CG  1 
ATOM   4256  C  CD1 . LEU B  2  28  ? -7.514  38.514  -20.512 1.00 42.63  ? 28  LEU B CD1 1 
ATOM   4257  C  CD2 . LEU B  2  28  ? -5.595  39.700  -21.573 1.00 36.46  ? 28  LEU B CD2 1 
ATOM   4258  N  N   . MET B  2  29  ? -7.369  36.044  -24.877 1.00 35.76  ? 29  MET B N   1 
ATOM   4259  C  CA  . MET B  2  29  ? -8.076  36.047  -26.155 1.00 38.87  ? 29  MET B CA  1 
ATOM   4260  C  C   . MET B  2  29  ? -9.465  35.403  -25.994 1.00 38.23  ? 29  MET B C   1 
ATOM   4261  O  O   . MET B  2  29  ? -10.494 36.020  -26.357 1.00 39.33  ? 29  MET B O   1 
ATOM   4262  C  CB  . MET B  2  29  ? -7.249  35.276  -27.203 1.00 40.95  ? 29  MET B CB  1 
ATOM   4263  C  CG  . MET B  2  29  ? -7.828  35.182  -28.607 1.00 44.75  ? 29  MET B CG  1 
ATOM   4264  S  SD  . MET B  2  29  ? -6.691  34.361  -29.744 1.00 52.65  ? 29  MET B SD  1 
ATOM   4265  C  CE  . MET B  2  29  ? -6.687  32.646  -29.205 1.00 52.34  ? 29  MET B CE  1 
ATOM   4266  N  N   . ILE B  2  30  ? -9.470  34.195  -25.416 1.00 34.23  ? 30  ILE B N   1 
ATOM   4267  C  CA  . ILE B  2  30  ? -10.689 33.427  -25.164 1.00 32.96  ? 30  ILE B CA  1 
ATOM   4268  C  C   . ILE B  2  30  ? -11.601 34.099  -24.133 1.00 30.89  ? 30  ILE B C   1 
ATOM   4269  O  O   . ILE B  2  30  ? -12.825 34.160  -24.322 1.00 31.06  ? 30  ILE B O   1 
ATOM   4270  C  CB  . ILE B  2  30  ? -10.358 32.003  -24.736 1.00 33.67  ? 30  ILE B CB  1 
ATOM   4271  C  CG1 . ILE B  2  30  ? -9.765  31.241  -25.928 1.00 33.39  ? 30  ILE B CG1 1 
ATOM   4272  C  CG2 . ILE B  2  30  ? -11.599 31.291  -24.208 1.00 35.92  ? 30  ILE B CG2 1 
ATOM   4273  C  CD1 . ILE B  2  30  ? -8.865  30.091  -25.514 1.00 34.41  ? 30  ILE B CD1 1 
ATOM   4274  N  N   . VAL B  2  31  ? -11.012 34.625  -23.074 1.00 28.84  ? 31  VAL B N   1 
ATOM   4275  C  CA  . VAL B  2  31  ? -11.768 35.406  -22.094 1.00 29.64  ? 31  VAL B CA  1 
ATOM   4276  C  C   . VAL B  2  31  ? -12.496 36.548  -22.803 1.00 31.91  ? 31  VAL B C   1 
ATOM   4277  O  O   . VAL B  2  31  ? -13.687 36.779  -22.549 1.00 28.94  ? 31  VAL B O   1 
ATOM   4278  C  CB  . VAL B  2  31  ? -10.869 35.934  -20.964 1.00 27.25  ? 31  VAL B CB  1 
ATOM   4279  C  CG1 . VAL B  2  31  ? -11.578 36.977  -20.125 1.00 29.18  ? 31  VAL B CG1 1 
ATOM   4280  C  CG2 . VAL B  2  31  ? -10.451 34.797  -20.073 1.00 28.00  ? 31  VAL B CG2 1 
ATOM   4281  N  N   . PHE B  2  32  ? -11.777 37.238  -23.702 1.00 37.22  ? 32  PHE B N   1 
ATOM   4282  C  CA  . PHE B  2  32  ? -12.339 38.368  -24.443 1.00 37.65  ? 32  PHE B CA  1 
ATOM   4283  C  C   . PHE B  2  32  ? -13.424 37.921  -25.404 1.00 36.55  ? 32  PHE B C   1 
ATOM   4284  O  O   . PHE B  2  32  ? -14.398 38.656  -25.582 1.00 29.90  ? 32  PHE B O   1 
ATOM   4285  C  CB  . PHE B  2  32  ? -11.274 39.177  -25.208 1.00 39.18  ? 32  PHE B CB  1 
ATOM   4286  C  CG  . PHE B  2  32  ? -10.464 40.120  -24.342 1.00 42.13  ? 32  PHE B CG  1 
ATOM   4287  C  CD1 . PHE B  2  32  ? -11.060 40.905  -23.350 1.00 45.53  ? 32  PHE B CD1 1 
ATOM   4288  C  CD2 . PHE B  2  32  ? -9.097  40.257  -24.548 1.00 40.34  ? 32  PHE B CD2 1 
ATOM   4289  C  CE1 . PHE B  2  32  ? -10.293 41.769  -22.560 1.00 46.67  ? 32  PHE B CE1 1 
ATOM   4290  C  CE2 . PHE B  2  32  ? -8.345  41.113  -23.776 1.00 41.46  ? 32  PHE B CE2 1 
ATOM   4291  C  CZ  . PHE B  2  32  ? -8.931  41.862  -22.777 1.00 45.07  ? 32  PHE B CZ  1 
ATOM   4292  N  N   . LEU B  2  33  ? -13.241 36.737  -26.010 1.00 35.77  ? 33  LEU B N   1 
ATOM   4293  C  CA  . LEU B  2  33  ? -14.224 36.171  -26.929 1.00 38.44  ? 33  LEU B CA  1 
ATOM   4294  C  C   . LEU B  2  33  ? -15.538 35.924  -26.173 1.00 39.57  ? 33  LEU B C   1 
ATOM   4295  O  O   . LEU B  2  33  ? -16.620 36.386  -26.596 1.00 35.95  ? 33  LEU B O   1 
ATOM   4296  C  CB  . LEU B  2  33  ? -13.705 34.872  -27.525 1.00 41.05  ? 33  LEU B CB  1 
ATOM   4297  C  CG  . LEU B  2  33  ? -14.419 34.131  -28.661 1.00 46.23  ? 33  LEU B CG  1 
ATOM   4298  C  CD1 . LEU B  2  33  ? -13.718 32.776  -28.852 1.00 49.30  ? 33  LEU B CD1 1 
ATOM   4299  C  CD2 . LEU B  2  33  ? -15.897 33.853  -28.415 1.00 49.23  ? 33  LEU B CD2 1 
ATOM   4300  N  N   . ILE B  2  34  ? -15.429 35.224  -25.044 1.00 34.83  ? 34  ILE B N   1 
ATOM   4301  C  CA  . ILE B  2  34  ? -16.597 34.841  -24.284 1.00 33.00  ? 34  ILE B CA  1 
ATOM   4302  C  C   . ILE B  2  34  ? -17.319 36.000  -23.617 1.00 33.47  ? 34  ILE B C   1 
ATOM   4303  O  O   . ILE B  2  34  ? -18.540 36.026  -23.640 1.00 36.49  ? 34  ILE B O   1 
ATOM   4304  C  CB  . ILE B  2  34  ? -16.244 33.749  -23.290 1.00 32.12  ? 34  ILE B CB  1 
ATOM   4305  C  CG1 . ILE B  2  34  ? -16.012 32.457  -24.057 1.00 33.72  ? 34  ILE B CG1 1 
ATOM   4306  C  CG2 . ILE B  2  34  ? -17.347 33.529  -22.275 1.00 32.46  ? 34  ILE B CG2 1 
ATOM   4307  C  CD1 . ILE B  2  34  ? -15.051 31.545  -23.344 1.00 37.08  ? 34  ILE B CD1 1 
ATOM   4308  N  N   . SER B  2  35  ? -16.606 36.954  -23.032 1.00 33.64  ? 35  SER B N   1 
ATOM   4309  C  CA  . SER B  2  35  ? -17.287 38.066  -22.363 1.00 35.32  ? 35  SER B CA  1 
ATOM   4310  C  C   . SER B  2  35  ? -17.967 39.013  -23.362 1.00 35.06  ? 35  SER B C   1 
ATOM   4311  O  O   . SER B  2  35  ? -19.044 39.517  -23.088 1.00 35.65  ? 35  SER B O   1 
ATOM   4312  C  CB  . SER B  2  35  ? -16.335 38.822  -21.430 1.00 35.46  ? 35  SER B CB  1 
ATOM   4313  O  OG  . SER B  2  35  ? -15.186 39.199  -22.124 1.00 39.22  ? 35  SER B OG  1 
ATOM   4314  N  N   . SER B  2  36  ? -17.361 39.225  -24.528 1.00 35.07  ? 36  SER B N   1 
ATOM   4315  C  CA  . SER B  2  36  ? -17.978 40.074  -25.545 1.00 35.33  ? 36  SER B CA  1 
ATOM   4316  C  C   . SER B  2  36  ? -19.209 39.390  -26.151 1.00 36.76  ? 36  SER B C   1 
ATOM   4317  O  O   . SER B  2  36  ? -20.210 40.053  -26.431 1.00 39.44  ? 36  SER B O   1 
ATOM   4318  C  CB  . SER B  2  36  ? -16.976 40.477  -26.616 1.00 32.91  ? 36  SER B CB  1 
ATOM   4319  O  OG  . SER B  2  36  ? -16.611 39.363  -27.390 1.00 37.56  ? 36  SER B OG  1 
ATOM   4320  N  N   . LEU B  2  37  ? -19.134 38.071  -26.316 1.00 35.21  ? 37  LEU B N   1 
ATOM   4321  C  CA  . LEU B  2  37  ? -20.260 37.267  -26.790 1.00 36.38  ? 37  LEU B CA  1 
ATOM   4322  C  C   . LEU B  2  37  ? -21.483 37.371  -25.877 1.00 36.92  ? 37  LEU B C   1 
ATOM   4323  O  O   . LEU B  2  37  ? -22.578 37.602  -26.353 1.00 37.06  ? 37  LEU B O   1 
ATOM   4324  C  CB  . LEU B  2  37  ? -19.868 35.783  -26.922 1.00 36.75  ? 37  LEU B CB  1 
ATOM   4325  C  CG  . LEU B  2  37  ? -20.898 34.870  -27.606 1.00 40.07  ? 37  LEU B CG  1 
ATOM   4326  C  CD1 . LEU B  2  37  ? -21.147 35.361  -29.030 1.00 43.33  ? 37  LEU B CD1 1 
ATOM   4327  C  CD2 . LEU B  2  37  ? -20.446 33.414  -27.659 1.00 41.53  ? 37  LEU B CD2 1 
ATOM   4328  N  N   . VAL B  2  38  ? -21.261 37.166  -24.578 1.00 35.45  ? 38  VAL B N   1 
ATOM   4329  C  CA  . VAL B  2  38  ? -22.287 37.237  -23.569 1.00 33.64  ? 38  VAL B CA  1 
ATOM   4330  C  C   . VAL B  2  38  ? -22.884 38.644  -23.516 1.00 37.38  ? 38  VAL B C   1 
ATOM   4331  O  O   . VAL B  2  38  ? -24.100 38.794  -23.359 1.00 39.13  ? 38  VAL B O   1 
ATOM   4332  C  CB  . VAL B  2  38  ? -21.723 36.816  -22.198 1.00 33.16  ? 38  VAL B CB  1 
ATOM   4333  C  CG1 . VAL B  2  38  ? -22.575 37.308  -21.047 1.00 32.79  ? 38  VAL B CG1 1 
ATOM   4334  C  CG2 . VAL B  2  38  ? -21.567 35.314  -22.136 1.00 32.68  ? 38  VAL B CG2 1 
ATOM   4335  N  N   . LEU B  2  39  ? -22.055 39.673  -23.645 1.00 37.78  ? 39  LEU B N   1 
ATOM   4336  C  CA  . LEU B  2  39  ? -22.548 41.057  -23.564 1.00 37.32  ? 39  LEU B CA  1 
ATOM   4337  C  C   . LEU B  2  39  ? -23.390 41.407  -24.791 1.00 36.11  ? 39  LEU B C   1 
ATOM   4338  O  O   . LEU B  2  39  ? -24.373 42.115  -24.704 1.00 33.39  ? 39  LEU B O   1 
ATOM   4339  C  CB  . LEU B  2  39  ? -21.363 42.016  -23.486 1.00 40.35  ? 39  LEU B CB  1 
ATOM   4340  C  CG  . LEU B  2  39  ? -21.679 43.496  -23.359 1.00 42.05  ? 39  LEU B CG  1 
ATOM   4341  C  CD1 . LEU B  2  39  ? -22.490 43.759  -22.114 1.00 45.09  ? 39  LEU B CD1 1 
ATOM   4342  C  CD2 . LEU B  2  39  ? -20.385 44.265  -23.273 1.00 46.52  ? 39  LEU B CD2 1 
ATOM   4343  N  N   . TYR B  2  40  ? -22.966 40.922  -25.944 1.00 34.44  ? 40  TYR B N   1 
ATOM   4344  C  CA  . TYR B  2  40  ? -23.665 41.185  -27.174 1.00 35.90  ? 40  TYR B CA  1 
ATOM   4345  C  C   . TYR B  2  40  ? -25.015 40.478  -27.114 1.00 34.39  ? 40  TYR B C   1 
ATOM   4346  O  O   . TYR B  2  40  ? -26.035 41.088  -27.401 1.00 32.05  ? 40  TYR B O   1 
ATOM   4347  C  CB  . TYR B  2  40  ? -22.817 40.739  -28.360 1.00 38.21  ? 40  TYR B CB  1 
ATOM   4348  C  CG  . TYR B  2  40  ? -23.383 41.020  -29.703 1.00 42.88  ? 40  TYR B CG  1 
ATOM   4349  C  CD1 . TYR B  2  40  ? -24.426 40.241  -30.203 1.00 48.49  ? 40  TYR B CD1 1 
ATOM   4350  C  CD2 . TYR B  2  40  ? -22.862 42.030  -30.514 1.00 48.72  ? 40  TYR B CD2 1 
ATOM   4351  C  CE1 . TYR B  2  40  ? -24.970 40.467  -31.451 1.00 50.84  ? 40  TYR B CE1 1 
ATOM   4352  C  CE2 . TYR B  2  40  ? -23.382 42.260  -31.793 1.00 52.89  ? 40  TYR B CE2 1 
ATOM   4353  C  CZ  . TYR B  2  40  ? -24.444 41.472  -32.251 1.00 56.05  ? 40  TYR B CZ  1 
ATOM   4354  O  OH  . TYR B  2  40  ? -25.020 41.648  -33.499 1.00 64.70  ? 40  TYR B OH  1 
ATOM   4355  N  N   . ILE B  2  41  ? -25.020 39.213  -26.719 1.00 35.33  ? 41  ILE B N   1 
ATOM   4356  C  CA  . ILE B  2  41  ? -26.273 38.446  -26.587 1.00 37.52  ? 41  ILE B CA  1 
ATOM   4357  C  C   . ILE B  2  41  ? -27.260 39.068  -25.566 1.00 37.82  ? 41  ILE B C   1 
ATOM   4358  O  O   . ILE B  2  41  ? -28.456 39.101  -25.808 1.00 34.44  ? 41  ILE B O   1 
ATOM   4359  C  CB  . ILE B  2  41  ? -26.000 36.961  -26.282 1.00 38.41  ? 41  ILE B CB  1 
ATOM   4360  C  CG1 . ILE B  2  41  ? -25.340 36.276  -27.493 1.00 42.61  ? 41  ILE B CG1 1 
ATOM   4361  C  CG2 . ILE B  2  41  ? -27.292 36.220  -25.991 1.00 40.91  ? 41  ILE B CG2 1 
ATOM   4362  C  CD1 . ILE B  2  41  ? -24.717 34.926  -27.188 1.00 44.59  ? 41  ILE B CD1 1 
ATOM   4363  N  N   . ILE B  2  42  ? -26.759 39.575  -24.445 1.00 39.46  ? 42  ILE B N   1 
ATOM   4364  C  CA  . ILE B  2  42  ? -27.601 40.261  -23.470 1.00 37.91  ? 42  ILE B CA  1 
ATOM   4365  C  C   . ILE B  2  42  ? -28.288 41.445  -24.151 1.00 38.61  ? 42  ILE B C   1 
ATOM   4366  O  O   . ILE B  2  42  ? -29.480 41.615  -24.033 1.00 40.45  ? 42  ILE B O   1 
ATOM   4367  C  CB  . ILE B  2  42  ? -26.781 40.749  -22.260 1.00 40.03  ? 42  ILE B CB  1 
ATOM   4368  C  CG1 . ILE B  2  42  ? -26.426 39.588  -21.366 1.00 44.52  ? 42  ILE B CG1 1 
ATOM   4369  C  CG2 . ILE B  2  42  ? -27.538 41.750  -21.399 1.00 42.79  ? 42  ILE B CG2 1 
ATOM   4370  C  CD1 . ILE B  2  42  ? -25.382 39.952  -20.324 1.00 46.32  ? 42  ILE B CD1 1 
ATOM   4371  N  N   . SER B  2  43  ? -27.538 42.269  -24.859 1.00 37.06  ? 43  SER B N   1 
ATOM   4372  C  CA  . SER B  2  43  ? -28.117 43.457  -25.467 1.00 37.91  ? 43  SER B CA  1 
ATOM   4373  C  C   . SER B  2  43  ? -29.037 43.155  -26.669 1.00 35.68  ? 43  SER B C   1 
ATOM   4374  O  O   . SER B  2  43  ? -29.937 43.908  -26.979 1.00 34.93  ? 43  SER B O   1 
ATOM   4375  C  CB  . SER B  2  43  ? -26.998 44.418  -25.862 1.00 37.97  ? 43  SER B CB  1 
ATOM   4376  O  OG  . SER B  2  43  ? -26.186 43.792  -26.788 1.00 38.63  ? 43  SER B OG  1 
ATOM   4377  N  N   . LEU B  2  44  ? -28.782 42.053  -27.337 1.00 34.59  ? 44  LEU B N   1 
ATOM   4378  C  CA  . LEU B  2  44  ? -29.682 41.518  -28.323 1.00 36.76  ? 44  LEU B CA  1 
ATOM   4379  C  C   . LEU B  2  44  ? -31.032 41.185  -27.697 1.00 39.22  ? 44  LEU B C   1 
ATOM   4380  O  O   . LEU B  2  44  ? -32.077 41.511  -28.252 1.00 42.52  ? 44  LEU B O   1 
ATOM   4381  C  CB  . LEU B  2  44  ? -29.077 40.240  -28.908 1.00 40.29  ? 44  LEU B CB  1 
ATOM   4382  C  CG  . LEU B  2  44  ? -29.701 39.561  -30.117 1.00 45.32  ? 44  LEU B CG  1 
ATOM   4383  C  CD1 . LEU B  2  44  ? -29.854 40.527  -31.272 1.00 47.08  ? 44  LEU B CD1 1 
ATOM   4384  C  CD2 . LEU B  2  44  ? -28.797 38.416  -30.545 1.00 48.58  ? 44  LEU B CD2 1 
ATOM   4385  N  N   . MET B  2  45  ? -31.003 40.568  -26.519 1.00 38.71  ? 45  MET B N   1 
ATOM   4386  C  CA  . MET B  2  45  ? -32.206 40.047  -25.892 1.00 36.67  ? 45  MET B CA  1 
ATOM   4387  C  C   . MET B  2  45  ? -33.123 41.161  -25.416 1.00 38.07  ? 45  MET B C   1 
ATOM   4388  O  O   . MET B  2  45  ? -34.356 40.960  -25.327 1.00 42.66  ? 45  MET B O   1 
ATOM   4389  C  CB  . MET B  2  45  ? -31.857 39.152  -24.720 1.00 35.14  ? 45  MET B CB  1 
ATOM   4390  C  CG  . MET B  2  45  ? -31.032 37.960  -25.090 1.00 36.91  ? 45  MET B CG  1 
ATOM   4391  S  SD  . MET B  2  45  ? -31.954 36.698  -25.907 1.00 38.73  ? 45  MET B SD  1 
ATOM   4392  C  CE  . MET B  2  45  ? -31.107 36.555  -27.452 1.00 37.51  ? 45  MET B CE  1 
ATOM   4393  N  N   . LEU B  2  46  ? -32.525 42.319  -25.130 1.00 36.36  ? 46  LEU B N   1 
ATOM   4394  C  CA  . LEU B  2  46  ? -33.206 43.439  -24.501 1.00 37.23  ? 46  LEU B CA  1 
ATOM   4395  C  C   . LEU B  2  46  ? -33.561 44.575  -25.459 1.00 37.35  ? 46  LEU B C   1 
ATOM   4396  O  O   . LEU B  2  46  ? -33.914 45.641  -24.986 1.00 38.36  ? 46  LEU B O   1 
ATOM   4397  C  CB  . LEU B  2  46  ? -32.306 44.020  -23.414 1.00 39.93  ? 46  LEU B CB  1 
ATOM   4398  C  CG  . LEU B  2  46  ? -31.842 43.095  -22.291 1.00 42.80  ? 46  LEU B CG  1 
ATOM   4399  C  CD1 . LEU B  2  46  ? -30.831 43.861  -21.421 1.00 46.16  ? 46  LEU B CD1 1 
ATOM   4400  C  CD2 . LEU B  2  46  ? -33.004 42.541  -21.476 1.00 40.77  ? 46  LEU B CD2 1 
ATOM   4401  N  N   . THR B  2  47  ? -33.489 44.344  -26.780 1.00 36.79  ? 47  THR B N   1 
ATOM   4402  C  CA  . THR B  2  47  ? -33.638 45.393  -27.799 1.00 33.24  ? 47  THR B CA  1 
ATOM   4403  C  C   . THR B  2  47  ? -34.739 45.110  -28.856 1.00 34.86  ? 47  THR B C   1 
ATOM   4404  O  O   . THR B  2  47  ? -34.681 45.631  -29.964 1.00 37.33  ? 47  THR B O   1 
ATOM   4405  C  CB  . THR B  2  47  ? -32.290 45.643  -28.505 1.00 31.30  ? 47  THR B CB  1 
ATOM   4406  O  OG1 . THR B  2  47  ? -31.654 44.391  -28.755 1.00 31.64  ? 47  THR B OG1 1 
ATOM   4407  C  CG2 . THR B  2  47  ? -31.383 46.495  -27.663 1.00 29.05  ? 47  THR B CG2 1 
ATOM   4408  N  N   . THR B  2  48  ? -35.758 44.326  -28.506 1.00 35.88  ? 48  THR B N   1 
ATOM   4409  C  CA  . THR B  2  48  ? -36.877 44.071  -29.412 1.00 33.60  ? 48  THR B CA  1 
ATOM   4410  C  C   . THR B  2  48  ? -38.209 44.106  -28.671 1.00 34.59  ? 48  THR B C   1 
ATOM   4411  O  O   . THR B  2  48  ? -38.302 43.743  -27.503 1.00 33.39  ? 48  THR B O   1 
ATOM   4412  C  CB  . THR B  2  48  ? -36.704 42.751  -30.191 1.00 34.46  ? 48  THR B CB  1 
ATOM   4413  O  OG1 . THR B  2  48  ? -37.740 42.633  -31.166 1.00 39.51  ? 48  THR B OG1 1 
ATOM   4414  C  CG2 . THR B  2  48  ? -36.760 41.530  -29.298 1.00 35.09  ? 48  THR B CG2 1 
ATOM   4415  N  N   . LYS B  2  49  ? -39.247 44.558  -29.365 1.00 38.11  ? 49  LYS B N   1 
ATOM   4416  C  CA  . LYS B  2  49  ? -40.594 44.532  -28.821 1.00 39.53  ? 49  LYS B CA  1 
ATOM   4417  C  C   . LYS B  2  49  ? -41.240 43.173  -29.138 1.00 37.11  ? 49  LYS B C   1 
ATOM   4418  O  O   . LYS B  2  49  ? -42.279 42.837  -28.590 1.00 38.96  ? 49  LYS B O   1 
ATOM   4419  C  CB  . LYS B  2  49  ? -41.402 45.694  -29.373 1.00 45.75  ? 49  LYS B CB  1 
ATOM   4420  C  CG  . LYS B  2  49  ? -41.023 47.048  -28.809 1.00 50.10  ? 49  LYS B CG  1 
ATOM   4421  C  CD  . LYS B  2  49  ? -41.428 47.148  -27.345 1.00 59.99  ? 49  LYS B CD  1 
ATOM   4422  C  CE  . LYS B  2  49  ? -41.610 48.587  -26.867 1.00 67.85  ? 49  LYS B CE  1 
ATOM   4423  N  NZ  . LYS B  2  49  ? -40.392 49.406  -27.161 1.00 74.47  ? 49  LYS B NZ  1 
ATOM   4424  N  N   . LEU B  2  50  ? -40.595 42.371  -29.973 1.00 32.96  ? 50  LEU B N   1 
ATOM   4425  C  CA  . LEU B  2  50  ? -41.085 41.045  -30.280 1.00 33.59  ? 50  LEU B CA  1 
ATOM   4426  C  C   . LEU B  2  50  ? -41.044 40.107  -29.088 1.00 32.52  ? 50  LEU B C   1 
ATOM   4427  O  O   . LEU B  2  50  ? -40.028 39.996  -28.425 1.00 37.54  ? 50  LEU B O   1 
ATOM   4428  C  CB  . LEU B  2  50  ? -40.275 40.428  -31.428 1.00 35.07  ? 50  LEU B CB  1 
ATOM   4429  C  CG  . LEU B  2  50  ? -40.383 41.152  -32.772 1.00 37.00  ? 50  LEU B CG  1 
ATOM   4430  C  CD1 . LEU B  2  50  ? -39.564 40.393  -33.783 1.00 39.61  ? 50  LEU B CD1 1 
ATOM   4431  C  CD2 . LEU B  2  50  ? -41.829 41.287  -33.271 1.00 39.57  ? 50  LEU B CD2 1 
ATOM   4432  N  N   . THR B  2  51  ? -42.152 39.419  -28.846 1.00 30.53  ? 51  THR B N   1 
ATOM   4433  C  CA  . THR B  2  51  ? -42.276 38.554  -27.725 1.00 30.96  ? 51  THR B CA  1 
ATOM   4434  C  C   . THR B  2  51  ? -42.556 37.108  -28.123 1.00 33.76  ? 51  THR B C   1 
ATOM   4435  O  O   . THR B  2  51  ? -43.068 36.815  -29.196 1.00 33.88  ? 51  THR B O   1 
ATOM   4436  C  CB  . THR B  2  51  ? -43.389 39.023  -26.788 1.00 29.54  ? 51  THR B CB  1 
ATOM   4437  O  OG1 . THR B  2  51  ? -44.592 39.054  -27.511 1.00 29.57  ? 51  THR B OG1 1 
ATOM   4438  C  CG2 . THR B  2  51  ? -43.108 40.414  -26.234 1.00 30.52  ? 51  THR B CG2 1 
ATOM   4439  N  N   . HIS B  2  52  ? -42.236 36.214  -27.196 1.00 35.06  ? 52  HIS B N   1 
ATOM   4440  C  CA  . HIS B  2  52  ? -42.457 34.800  -27.336 1.00 35.68  ? 52  HIS B CA  1 
ATOM   4441  C  C   . HIS B  2  52  ? -42.319 34.280  -25.936 1.00 35.83  ? 52  HIS B C   1 
ATOM   4442  O  O   . HIS B  2  52  ? -41.245 33.896  -25.515 1.00 33.44  ? 52  HIS B O   1 
ATOM   4443  C  CB  . HIS B  2  52  ? -41.432 34.190  -28.267 1.00 37.88  ? 52  HIS B CB  1 
ATOM   4444  C  CG  . HIS B  2  52  ? -41.589 32.716  -28.444 1.00 39.00  ? 52  HIS B CG  1 
ATOM   4445  N  ND1 . HIS B  2  52  ? -42.419 31.954  -27.658 1.00 41.52  ? 52  HIS B ND1 1 
ATOM   4446  C  CD2 . HIS B  2  52  ? -40.979 31.861  -29.292 1.00 38.04  ? 52  HIS B CD2 1 
ATOM   4447  C  CE1 . HIS B  2  52  ? -42.322 30.691  -28.034 1.00 43.11  ? 52  HIS B CE1 1 
ATOM   4448  N  NE2 . HIS B  2  52  ? -41.457 30.615  -29.026 1.00 38.64  ? 52  HIS B NE2 1 
ATOM   4449  N  N   . THR B  2  53  ? -43.428 34.376  -25.210 1.00 38.66  ? 53  THR B N   1 
ATOM   4450  C  CA  . THR B  2  53  ? -43.501 34.066  -23.805 1.00 37.52  ? 53  THR B CA  1 
ATOM   4451  C  C   . THR B  2  53  ? -44.061 32.708  -23.569 1.00 37.49  ? 53  THR B C   1 
ATOM   4452  O  O   . THR B  2  53  ? -44.075 32.310  -22.430 1.00 41.35  ? 53  THR B O   1 
ATOM   4453  C  CB  . THR B  2  53  ? -44.374 35.063  -22.998 1.00 38.39  ? 53  THR B CB  1 
ATOM   4454  O  OG1 . THR B  2  53  ? -45.716 35.032  -23.477 1.00 39.55  ? 53  THR B OG1 1 
ATOM   4455  C  CG2 . THR B  2  53  ? -43.841 36.480  -23.076 1.00 38.32  ? 53  THR B CG2 1 
ATOM   4456  N  N   . SER B  2  54  ? -44.494 31.969  -24.592 1.00 41.92  ? 54  SER B N   1 
ATOM   4457  C  CA  . SER B  2  54  ? -44.898 30.573  -24.373 1.00 46.48  ? 54  SER B CA  1 
ATOM   4458  C  C   . SER B  2  54  ? -43.668 29.707  -24.188 1.00 51.42  ? 54  SER B C   1 
ATOM   4459  O  O   . SER B  2  54  ? -42.546 30.143  -24.486 1.00 51.34  ? 54  SER B O   1 
ATOM   4460  C  CB  . SER B  2  54  ? -45.750 30.049  -25.518 1.00 51.41  ? 54  SER B CB  1 
ATOM   4461  O  OG  . SER B  2  54  ? -45.024 29.931  -26.724 1.00 56.25  ? 54  SER B OG  1 
ATOM   4462  N  N   . THR B  2  55  ? -43.864 28.480  -23.707 1.00 58.80  ? 55  THR B N   1 
ATOM   4463  C  CA  . THR B  2  55  ? -42.718 27.612  -23.358 1.00 62.80  ? 55  THR B CA  1 
ATOM   4464  C  C   . THR B  2  55  ? -41.876 27.300  -24.568 1.00 59.68  ? 55  THR B C   1 
ATOM   4465  O  O   . THR B  2  55  ? -42.400 27.210  -25.691 1.00 55.02  ? 55  THR B O   1 
ATOM   4466  C  CB  . THR B  2  55  ? -43.132 26.246  -22.775 1.00 68.62  ? 55  THR B CB  1 
ATOM   4467  O  OG1 . THR B  2  55  ? -43.970 25.567  -23.723 1.00 69.03  ? 55  THR B OG1 1 
ATOM   4468  C  CG2 . THR B  2  55  ? -43.841 26.406  -21.419 1.00 67.78  ? 55  THR B CG2 1 
ATOM   4469  N  N   . MET B  2  56  ? -40.582 27.119  -24.308 1.00 59.82  ? 56  MET B N   1 
ATOM   4470  C  CA  . MET B  2  56  ? -39.577 26.788  -25.330 1.00 60.32  ? 56  MET B CA  1 
ATOM   4471  C  C   . MET B  2  56  ? -38.890 25.447  -25.020 1.00 58.81  ? 56  MET B C   1 
ATOM   4472  O  O   . MET B  2  56  ? -38.498 25.200  -23.880 1.00 55.06  ? 56  MET B O   1 
ATOM   4473  C  CB  . MET B  2  56  ? -38.505 27.879  -25.382 1.00 56.63  ? 56  MET B CB  1 
ATOM   4474  C  CG  . MET B  2  56  ? -39.014 29.291  -25.524 1.00 55.03  ? 56  MET B CG  1 
ATOM   4475  S  SD  . MET B  2  56  ? -37.641 30.454  -25.541 1.00 57.08  ? 56  MET B SD  1 
ATOM   4476  C  CE  . MET B  2  56  ? -38.500 31.865  -26.255 1.00 57.50  ? 56  MET B CE  1 
ATOM   4477  N  N   . ASP B  2  57  ? -38.725 24.598  -26.032 1.00 63.06  ? 57  ASP B N   1 
ATOM   4478  C  CA  . ASP B  2  57  ? -38.034 23.319  -25.827 1.00 73.51  ? 57  ASP B CA  1 
ATOM   4479  C  C   . ASP B  2  57  ? -36.512 23.536  -25.898 1.00 73.45  ? 57  ASP B C   1 
ATOM   4480  O  O   . ASP B  2  57  ? -36.012 24.236  -26.804 1.00 65.87  ? 57  ASP B O   1 
ATOM   4481  C  CB  . ASP B  2  57  ? -38.496 22.225  -26.817 1.00 77.88  ? 57  ASP B CB  1 
ATOM   4482  C  CG  . ASP B  2  57  ? -38.785 20.882  -26.117 1.00 83.32  ? 57  ASP B CG  1 
ATOM   4483  O  OD1 . ASP B  2  57  ? -39.907 20.736  -25.573 1.00 90.69  ? 57  ASP B OD1 1 
ATOM   4484  O  OD2 . ASP B  2  57  ? -37.904 19.986  -26.099 1.00 75.64  ? 57  ASP B OD2 1 
ATOM   4485  N  N   . ALA B  2  58  ? -35.810 22.902  -24.948 1.00 72.26  ? 58  ALA B N   1 
ATOM   4486  C  CA  . ALA B  2  58  ? -34.373 23.077  -24.695 1.00 78.20  ? 58  ALA B CA  1 
ATOM   4487  C  C   . ALA B  2  58  ? -33.440 21.924  -25.115 1.00 82.55  ? 58  ALA B C   1 
ATOM   4488  O  O   . ALA B  2  58  ? -32.231 22.113  -25.153 1.00 84.50  ? 58  ALA B O   1 
ATOM   4489  C  CB  . ALA B  2  58  ? -34.165 23.341  -23.207 1.00 78.00  ? 58  ALA B CB  1 
ATOM   4490  N  N   . GLN B  2  59  ? -33.963 20.741  -25.426 1.00 95.28  ? 59  GLN B N   1 
ATOM   4491  C  CA  . GLN B  2  59  ? -33.097 19.554  -25.545 1.00 107.49 ? 59  GLN B CA  1 
ATOM   4492  C  C   . GLN B  2  59  ? -32.186 19.562  -26.809 1.00 108.44 ? 59  GLN B C   1 
ATOM   4493  O  O   . GLN B  2  59  ? -31.375 18.650  -26.959 1.00 132.89 ? 59  GLN B O   1 
ATOM   4494  C  CB  . GLN B  2  59  ? -33.901 18.223  -25.411 1.00 111.13 ? 59  GLN B CB  1 
ATOM   4495  C  CG  . GLN B  2  59  ? -34.795 18.069  -24.150 1.00 117.05 ? 59  GLN B CG  1 
ATOM   4496  C  CD  . GLN B  2  59  ? -34.115 17.487  -22.886 1.00 119.10 ? 59  GLN B CD  1 
ATOM   4497  O  OE1 . GLN B  2  59  ? -33.463 16.433  -22.925 1.00 108.65 ? 59  GLN B OE1 1 
ATOM   4498  N  NE2 . GLN B  2  59  ? -34.321 18.155  -21.744 1.00 108.88 ? 59  GLN B NE2 1 
ATOM   4499  N  N   . GLU B  2  60  ? -32.293 20.573  -27.684 1.00 97.16  ? 60  GLU B N   1 
ATOM   4500  C  CA  . GLU B  2  60  ? -31.406 20.716  -28.869 1.00 95.28  ? 60  GLU B CA  1 
ATOM   4501  C  C   . GLU B  2  60  ? -30.286 21.735  -28.695 1.00 80.32  ? 60  GLU B C   1 
ATOM   4502  O  O   . GLU B  2  60  ? -29.129 21.478  -29.043 1.00 71.45  ? 60  GLU B O   1 
ATOM   4503  C  CB  . GLU B  2  60  ? -32.217 21.118  -30.112 1.00 102.89 ? 60  GLU B CB  1 
ATOM   4504  C  CG  . GLU B  2  60  ? -33.008 19.978  -30.743 1.00 109.77 ? 60  GLU B CG  1 
ATOM   4505  C  CD  . GLU B  2  60  ? -33.947 20.433  -31.854 1.00 116.42 ? 60  GLU B CD  1 
ATOM   4506  O  OE1 . GLU B  2  60  ? -34.421 19.561  -32.619 1.00 114.99 ? 60  GLU B OE1 1 
ATOM   4507  O  OE2 . GLU B  2  60  ? -34.226 21.651  -31.966 1.00 116.93 ? 60  GLU B OE2 1 
ATOM   4508  N  N   . VAL B  2  61  ? -30.645 22.911  -28.197 1.00 74.01  ? 61  VAL B N   1 
ATOM   4509  C  CA  . VAL B  2  61  ? -29.701 24.031  -28.117 1.00 72.43  ? 61  VAL B CA  1 
ATOM   4510  C  C   . VAL B  2  61  ? -28.675 23.847  -26.999 1.00 64.34  ? 61  VAL B C   1 
ATOM   4511  O  O   . VAL B  2  61  ? -27.598 24.431  -27.046 1.00 65.20  ? 61  VAL B O   1 
ATOM   4512  C  CB  . VAL B  2  61  ? -30.430 25.407  -27.994 1.00 74.44  ? 61  VAL B CB  1 
ATOM   4513  C  CG1 . VAL B  2  61  ? -30.959 25.649  -26.580 1.00 72.46  ? 61  VAL B CG1 1 
ATOM   4514  C  CG2 . VAL B  2  61  ? -29.521 26.551  -28.443 1.00 74.63  ? 61  VAL B CG2 1 
ATOM   4515  N  N   . GLU B  2  62  ? -29.007 23.027  -26.006 1.00 61.83  ? 62  GLU B N   1 
ATOM   4516  C  CA  . GLU B  2  62  ? -28.115 22.779  -24.872 1.00 60.28  ? 62  GLU B CA  1 
ATOM   4517  C  C   . GLU B  2  62  ? -26.883 21.951  -25.250 1.00 57.91  ? 62  GLU B C   1 
ATOM   4518  O  O   . GLU B  2  62  ? -25.892 21.952  -24.521 1.00 66.63  ? 62  GLU B O   1 
ATOM   4519  C  CB  . GLU B  2  62  ? -28.864 22.057  -23.740 1.00 61.39  ? 62  GLU B CB  1 
ATOM   4520  C  CG  . GLU B  2  62  ? -30.086 22.797  -23.193 1.00 58.24  ? 62  GLU B CG  1 
ATOM   4521  C  CD  . GLU B  2  62  ? -30.083 22.964  -21.696 1.00 55.28  ? 62  GLU B CD  1 
ATOM   4522  O  OE1 . GLU B  2  62  ? -31.003 23.628  -21.183 1.00 50.83  ? 62  GLU B OE1 1 
ATOM   4523  O  OE2 . GLU B  2  62  ? -29.178 22.408  -21.040 1.00 58.02  ? 62  GLU B OE2 1 
ATOM   4524  N  N   . THR B  2  63  ? -26.987 21.202  -26.345 1.00 50.55  ? 63  THR B N   1 
ATOM   4525  C  CA  . THR B  2  63  ? -25.888 20.449  -26.886 1.00 52.05  ? 63  THR B CA  1 
ATOM   4526  C  C   . THR B  2  63  ? -24.792 21.390  -27.348 1.00 52.72  ? 63  THR B C   1 
ATOM   4527  O  O   . THR B  2  63  ? -23.632 21.192  -27.021 1.00 48.58  ? 63  THR B O   1 
ATOM   4528  C  CB  . THR B  2  63  ? -26.369 19.574  -28.061 1.00 51.56  ? 63  THR B CB  1 
ATOM   4529  O  OG1 . THR B  2  63  ? -27.370 18.677  -27.578 1.00 53.63  ? 63  THR B OG1 1 
ATOM   4530  C  CG2 . THR B  2  63  ? -25.225 18.770  -28.679 1.00 49.84  ? 63  THR B CG2 1 
ATOM   4531  N  N   . ILE B  2  64  ? -25.172 22.420  -28.094 1.00 52.69  ? 64  ILE B N   1 
ATOM   4532  C  CA  . ILE B  2  64  ? -24.218 23.385  -28.574 1.00 55.59  ? 64  ILE B CA  1 
ATOM   4533  C  C   . ILE B  2  64  ? -23.516 23.944  -27.368 1.00 53.14  ? 64  ILE B C   1 
ATOM   4534  O  O   . ILE B  2  64  ? -22.289 23.896  -27.292 1.00 55.89  ? 64  ILE B O   1 
ATOM   4535  C  CB  . ILE B  2  64  ? -24.903 24.520  -29.336 1.00 63.93  ? 64  ILE B CB  1 
ATOM   4536  C  CG1 . ILE B  2  64  ? -25.496 23.970  -30.645 1.00 73.35  ? 64  ILE B CG1 1 
ATOM   4537  C  CG2 . ILE B  2  64  ? -23.933 25.668  -29.619 1.00 61.89  ? 64  ILE B CG2 1 
ATOM   4538  C  CD1 . ILE B  2  64  ? -26.775 24.678  -31.049 1.00 77.67  ? 64  ILE B CD1 1 
ATOM   4539  N  N   . TRP B  2  65  ? -24.293 24.409  -26.395 1.00 47.59  ? 65  TRP B N   1 
ATOM   4540  C  CA  . TRP B  2  65  ? -23.707 25.133  -25.268 1.00 50.78  ? 65  TRP B CA  1 
ATOM   4541  C  C   . TRP B  2  65  ? -23.110 24.330  -24.085 1.00 45.93  ? 65  TRP B C   1 
ATOM   4542  O  O   . TRP B  2  65  ? -22.822 24.865  -23.025 1.00 41.87  ? 65  TRP B O   1 
ATOM   4543  C  CB  . TRP B  2  65  ? -24.612 26.297  -24.851 1.00 53.49  ? 65  TRP B CB  1 
ATOM   4544  C  CG  . TRP B  2  65  ? -25.846 26.078  -24.107 1.00 54.00  ? 65  TRP B CG  1 
ATOM   4545  C  CD1 . TRP B  2  65  ? -26.081 25.186  -23.093 1.00 59.60  ? 65  TRP B CD1 1 
ATOM   4546  C  CD2 . TRP B  2  65  ? -27.034 26.883  -24.220 1.00 54.69  ? 65  TRP B CD2 1 
ATOM   4547  N  NE1 . TRP B  2  65  ? -27.370 25.365  -22.591 1.00 59.13  ? 65  TRP B NE1 1 
ATOM   4548  C  CE2 . TRP B  2  65  ? -27.966 26.401  -23.264 1.00 52.68  ? 65  TRP B CE2 1 
ATOM   4549  C  CE3 . TRP B  2  65  ? -27.413 27.934  -25.058 1.00 47.56  ? 65  TRP B CE3 1 
ATOM   4550  C  CZ2 . TRP B  2  65  ? -29.223 26.955  -23.110 1.00 47.16  ? 65  TRP B CZ2 1 
ATOM   4551  C  CZ3 . TRP B  2  65  ? -28.666 28.465  -24.906 1.00 47.34  ? 65  TRP B CZ3 1 
ATOM   4552  C  CH2 . TRP B  2  65  ? -29.559 27.975  -23.937 1.00 47.51  ? 65  TRP B CH2 1 
ATOM   4553  N  N   . THR B  2  66  ? -22.909 23.045  -24.340 1.00 45.43  ? 66  THR B N   1 
ATOM   4554  C  CA  . THR B  2  66  ? -22.197 22.117  -23.513 1.00 46.21  ? 66  THR B CA  1 
ATOM   4555  C  C   . THR B  2  66  ? -20.912 21.729  -24.260 1.00 47.95  ? 66  THR B C   1 
ATOM   4556  O  O   . THR B  2  66  ? -19.820 21.894  -23.726 1.00 48.01  ? 66  THR B O   1 
ATOM   4557  C  CB  . THR B  2  66  ? -23.102 20.889  -23.210 1.00 44.93  ? 66  THR B CB  1 
ATOM   4558  O  OG1 . THR B  2  66  ? -23.877 21.165  -22.047 1.00 43.28  ? 66  THR B OG1 1 
ATOM   4559  C  CG2 . THR B  2  66  ? -22.320 19.620  -22.944 1.00 47.85  ? 66  THR B CG2 1 
ATOM   4560  N  N   . ILE B  2  67  ? -21.044 21.229  -25.485 1.00 46.72  ? 67  ILE B N   1 
ATOM   4561  C  CA  . ILE B  2  67  ? -19.913 20.693  -26.227 1.00 51.13  ? 67  ILE B CA  1 
ATOM   4562  C  C   . ILE B  2  67  ? -18.894 21.795  -26.606 1.00 50.84  ? 67  ILE B C   1 
ATOM   4563  O  O   . ILE B  2  67  ? -17.672 21.551  -26.625 1.00 47.41  ? 67  ILE B O   1 
ATOM   4564  C  CB  . ILE B  2  67  ? -20.364 19.913  -27.498 1.00 54.26  ? 67  ILE B CB  1 
ATOM   4565  C  CG1 . ILE B  2  67  ? -21.365 18.802  -27.146 1.00 60.46  ? 67  ILE B CG1 1 
ATOM   4566  C  CG2 . ILE B  2  67  ? -19.160 19.309  -28.222 1.00 56.34  ? 67  ILE B CG2 1 
ATOM   4567  C  CD1 . ILE B  2  67  ? -20.875 17.757  -26.163 1.00 64.20  ? 67  ILE B CD1 1 
ATOM   4568  N  N   . LEU B  2  68  ? -19.376 22.995  -26.899 1.00 47.79  ? 68  LEU B N   1 
ATOM   4569  C  CA  . LEU B  2  68  ? -18.462 24.046  -27.305 1.00 51.03  ? 68  LEU B CA  1 
ATOM   4570  C  C   . LEU B  2  68  ? -17.604 24.516  -26.150 1.00 46.05  ? 68  LEU B C   1 
ATOM   4571  O  O   . LEU B  2  68  ? -16.394 24.630  -26.291 1.00 45.22  ? 68  LEU B O   1 
ATOM   4572  C  CB  . LEU B  2  68  ? -19.174 25.220  -27.979 1.00 55.36  ? 68  LEU B CB  1 
ATOM   4573  C  CG  . LEU B  2  68  ? -18.909 25.200  -29.481 1.00 59.86  ? 68  LEU B CG  1 
ATOM   4574  C  CD1 . LEU B  2  68  ? -20.013 25.943  -30.214 1.00 65.16  ? 68  LEU B CD1 1 
ATOM   4575  C  CD2 . LEU B  2  68  ? -17.531 25.804  -29.762 1.00 62.41  ? 68  LEU B CD2 1 
ATOM   4576  N  N   . PRO B  2  69  ? -18.216 24.786  -25.004 1.00 41.16  ? 69  PRO B N   1 
ATOM   4577  C  CA  . PRO B  2  69  ? -17.313 25.102  -23.911 1.00 40.44  ? 69  PRO B CA  1 
ATOM   4578  C  C   . PRO B  2  69  ? -16.265 24.032  -23.635 1.00 37.80  ? 69  PRO B C   1 
ATOM   4579  O  O   . PRO B  2  69  ? -15.149 24.379  -23.314 1.00 38.97  ? 69  PRO B O   1 
ATOM   4580  C  CB  . PRO B  2  69  ? -18.269 25.339  -22.749 1.00 38.52  ? 69  PRO B CB  1 
ATOM   4581  C  CG  . PRO B  2  69  ? -19.414 26.014  -23.427 1.00 40.39  ? 69  PRO B CG  1 
ATOM   4582  C  CD  . PRO B  2  69  ? -19.587 25.215  -24.701 1.00 41.37  ? 69  PRO B CD  1 
ATOM   4583  N  N   . ALA B  2  70  ? -16.600 22.756  -23.815 1.00 37.18  ? 70  ALA B N   1 
ATOM   4584  C  CA  . ALA B  2  70  ? -15.682 21.652  -23.516 1.00 37.19  ? 70  ALA B CA  1 
ATOM   4585  C  C   . ALA B  2  70  ? -14.507 21.602  -24.453 1.00 38.04  ? 70  ALA B C   1 
ATOM   4586  O  O   . ALA B  2  70  ? -13.422 21.203  -24.054 1.00 40.39  ? 70  ALA B O   1 
ATOM   4587  C  CB  . ALA B  2  70  ? -16.405 20.297  -23.542 1.00 36.86  ? 70  ALA B CB  1 
ATOM   4588  N  N   . ILE B  2  71  ? -14.734 21.925  -25.715 1.00 40.55  ? 71  ILE B N   1 
ATOM   4589  C  CA  . ILE B  2  71  ? -13.644 21.970  -26.686 1.00 44.06  ? 71  ILE B CA  1 
ATOM   4590  C  C   . ILE B  2  71  ? -12.738 23.167  -26.328 1.00 42.17  ? 71  ILE B C   1 
ATOM   4591  O  O   . ILE B  2  71  ? -11.499 23.062  -26.364 1.00 41.51  ? 71  ILE B O   1 
ATOM   4592  C  CB  . ILE B  2  71  ? -14.175 22.026  -28.145 1.00 49.44  ? 71  ILE B CB  1 
ATOM   4593  C  CG1 . ILE B  2  71  ? -14.920 20.731  -28.501 1.00 50.27  ? 71  ILE B CG1 1 
ATOM   4594  C  CG2 . ILE B  2  71  ? -13.031 22.199  -29.141 1.00 51.50  ? 71  ILE B CG2 1 
ATOM   4595  C  CD1 . ILE B  2  71  ? -15.701 20.809  -29.803 1.00 52.37  ? 71  ILE B CD1 1 
ATOM   4596  N  N   . ILE B  2  72  ? -13.355 24.274  -25.915 1.00 38.26  ? 72  ILE B N   1 
ATOM   4597  C  CA  . ILE B  2  72  ? -12.616 25.486  -25.607 1.00 38.92  ? 72  ILE B CA  1 
ATOM   4598  C  C   . ILE B  2  72  ? -11.699 25.249  -24.418 1.00 38.83  ? 72  ILE B C   1 
ATOM   4599  O  O   . ILE B  2  72  ? -10.551 25.697  -24.436 1.00 36.99  ? 72  ILE B O   1 
ATOM   4600  C  CB  . ILE B  2  72  ? -13.546 26.697  -25.368 1.00 39.10  ? 72  ILE B CB  1 
ATOM   4601  C  CG1 . ILE B  2  72  ? -14.249 27.068  -26.679 1.00 40.55  ? 72  ILE B CG1 1 
ATOM   4602  C  CG2 . ILE B  2  72  ? -12.752 27.895  -24.861 1.00 38.59  ? 72  ILE B CG2 1 
ATOM   4603  C  CD1 . ILE B  2  72  ? -15.387 28.029  -26.502 1.00 41.93  ? 72  ILE B CD1 1 
ATOM   4604  N  N   . LEU B  2  73  ? -12.201 24.537  -23.407 1.00 38.05  ? 73  LEU B N   1 
ATOM   4605  C  CA  . LEU B  2  73  ? -11.405 24.219  -22.226 1.00 39.08  ? 73  LEU B CA  1 
ATOM   4606  C  C   . LEU B  2  73  ? -10.274 23.261  -22.521 1.00 37.62  ? 73  LEU B C   1 
ATOM   4607  O  O   . LEU B  2  73  ? -9.277  23.326  -21.852 1.00 38.73  ? 73  LEU B O   1 
ATOM   4608  C  CB  . LEU B  2  73  ? -12.238 23.605  -21.123 1.00 39.13  ? 73  LEU B CB  1 
ATOM   4609  C  CG  . LEU B  2  73  ? -13.321 24.494  -20.542 1.00 41.72  ? 73  LEU B CG  1 
ATOM   4610  C  CD1 . LEU B  2  73  ? -14.244 23.591  -19.711 1.00 43.08  ? 73  LEU B CD1 1 
ATOM   4611  C  CD2 . LEU B  2  73  ? -12.731 25.660  -19.762 1.00 38.98  ? 73  LEU B CD2 1 
ATOM   4612  N  N   . ILE B  2  74  ? -10.435 22.359  -23.483 1.00 39.80  ? 74  ILE B N   1 
ATOM   4613  C  CA  . ILE B  2  74  ? -9.310  21.552  -23.948 1.00 43.42  ? 74  ILE B CA  1 
ATOM   4614  C  C   . ILE B  2  74  ? -8.223  22.471  -24.583 1.00 44.79  ? 74  ILE B C   1 
ATOM   4615  O  O   . ILE B  2  74  ? -7.030  22.314  -24.301 1.00 46.25  ? 74  ILE B O   1 
ATOM   4616  C  CB  . ILE B  2  74  ? -9.763  20.458  -24.920 1.00 44.72  ? 74  ILE B CB  1 
ATOM   4617  C  CG1 . ILE B  2  74  ? -10.646 19.440  -24.181 1.00 46.25  ? 74  ILE B CG1 1 
ATOM   4618  C  CG2 . ILE B  2  74  ? -8.560  19.740  -25.528 1.00 45.17  ? 74  ILE B CG2 1 
ATOM   4619  C  CD1 . ILE B  2  74  ? -11.440 18.533  -25.105 1.00 47.15  ? 74  ILE B CD1 1 
ATOM   4620  N  N   . LEU B  2  75  ? -8.639  23.451  -25.377 1.00 39.76  ? 75  LEU B N   1 
ATOM   4621  C  CA  . LEU B  2  75  ? -7.702  24.390  -25.985 1.00 41.51  ? 75  LEU B CA  1 
ATOM   4622  C  C   . LEU B  2  75  ? -6.906  25.292  -25.010 1.00 41.15  ? 75  LEU B C   1 
ATOM   4623  O  O   . LEU B  2  75  ? -5.867  25.862  -25.403 1.00 39.72  ? 75  LEU B O   1 
ATOM   4624  C  CB  . LEU B  2  75  ? -8.422  25.231  -27.051 1.00 46.26  ? 75  LEU B CB  1 
ATOM   4625  C  CG  . LEU B  2  75  ? -8.491  24.682  -28.514 1.00 50.67  ? 75  LEU B CG  1 
ATOM   4626  C  CD1 . LEU B  2  75  ? -8.242  23.181  -28.712 1.00 47.53  ? 75  LEU B CD1 1 
ATOM   4627  C  CD2 . LEU B  2  75  ? -9.803  25.121  -29.182 1.00 52.44  ? 75  LEU B CD2 1 
ATOM   4628  N  N   . ILE B  2  76  ? -7.391  25.418  -23.767 1.00 38.71  ? 76  ILE B N   1 
ATOM   4629  C  CA  . ILE B  2  76  ? -6.655  26.054  -22.683 1.00 37.11  ? 76  ILE B CA  1 
ATOM   4630  C  C   . ILE B  2  76  ? -5.826  24.981  -21.976 1.00 37.17  ? 76  ILE B C   1 
ATOM   4631  O  O   . ILE B  2  76  ? -4.670  25.218  -21.685 1.00 37.42  ? 76  ILE B O   1 
ATOM   4632  C  CB  . ILE B  2  76  ? -7.590  26.765  -21.659 1.00 39.39  ? 76  ILE B CB  1 
ATOM   4633  C  CG1 . ILE B  2  76  ? -8.413  27.876  -22.339 1.00 42.15  ? 76  ILE B CG1 1 
ATOM   4634  C  CG2 . ILE B  2  76  ? -6.794  27.368  -20.507 1.00 37.99  ? 76  ILE B CG2 1 
ATOM   4635  C  CD1 . ILE B  2  76  ? -9.688  28.222  -21.592 1.00 41.12  ? 76  ILE B CD1 1 
ATOM   4636  N  N   . ALA B  2  77  ? -6.394  23.802  -21.707 1.00 35.97  ? 77  ALA B N   1 
ATOM   4637  C  CA  . ALA B  2  77  ? -5.727  22.813  -20.821 1.00 35.04  ? 77  ALA B CA  1 
ATOM   4638  C  C   . ALA B  2  77  ? -4.455  22.242  -21.398 1.00 34.18  ? 77  ALA B C   1 
ATOM   4639  O  O   . ALA B  2  77  ? -3.496  22.033  -20.679 1.00 35.06  ? 77  ALA B O   1 
ATOM   4640  C  CB  . ALA B  2  77  ? -6.656  21.661  -20.455 1.00 36.18  ? 77  ALA B CB  1 
ATOM   4641  N  N   . LEU B  2  78  ? -4.457  21.955  -22.687 1.00 36.27  ? 78  LEU B N   1 
ATOM   4642  C  CA  . LEU B  2  78  ? -3.279  21.352  -23.323 1.00 40.10  ? 78  LEU B CA  1 
ATOM   4643  C  C   . LEU B  2  78  ? -2.013  22.219  -23.191 1.00 37.97  ? 78  LEU B C   1 
ATOM   4644  O  O   . LEU B  2  78  ? -1.031  21.769  -22.608 1.00 37.33  ? 78  LEU B O   1 
ATOM   4645  C  CB  . LEU B  2  78  ? -3.587  20.985  -24.789 1.00 43.03  ? 78  LEU B CB  1 
ATOM   4646  C  CG  . LEU B  2  78  ? -4.583  19.823  -24.929 1.00 46.07  ? 78  LEU B CG  1 
ATOM   4647  C  CD1 . LEU B  2  78  ? -4.948  19.563  -26.378 1.00 47.40  ? 78  LEU B CD1 1 
ATOM   4648  C  CD2 . LEU B  2  78  ? -4.059  18.546  -24.298 1.00 49.62  ? 78  LEU B CD2 1 
ATOM   4649  N  N   . PRO B  2  79  ? -2.050  23.479  -23.686 1.00 37.11  ? 79  PRO B N   1 
ATOM   4650  C  CA  . PRO B  2  79  ? -0.894  24.335  -23.405 1.00 35.90  ? 79  PRO B CA  1 
ATOM   4651  C  C   . PRO B  2  79  ? -0.623  24.566  -21.908 1.00 36.57  ? 79  PRO B C   1 
ATOM   4652  O  O   . PRO B  2  79  ? 0.530   24.728  -21.500 1.00 34.52  ? 79  PRO B O   1 
ATOM   4653  C  CB  . PRO B  2  79  ? -1.229  25.664  -24.114 1.00 34.18  ? 79  PRO B CB  1 
ATOM   4654  C  CG  . PRO B  2  79  ? -2.670  25.594  -24.482 1.00 35.51  ? 79  PRO B CG  1 
ATOM   4655  C  CD  . PRO B  2  79  ? -3.038  24.142  -24.571 1.00 35.29  ? 79  PRO B CD  1 
ATOM   4656  N  N   . SER B  2  80  ? -1.678  24.619  -21.101 1.00 36.24  ? 80  SER B N   1 
ATOM   4657  C  CA  . SER B  2  80  ? -1.490  24.869  -19.682 1.00 33.70  ? 80  SER B CA  1 
ATOM   4658  C  C   . SER B  2  80  ? -0.652  23.773  -19.087 1.00 33.13  ? 80  SER B C   1 
ATOM   4659  O  O   . SER B  2  80  ? 0.285   24.044  -18.359 1.00 31.94  ? 80  SER B O   1 
ATOM   4660  C  CB  . SER B  2  80  ? -2.809  24.952  -18.944 1.00 32.11  ? 80  SER B CB  1 
ATOM   4661  O  OG  . SER B  2  80  ? -2.595  25.490  -17.662 1.00 30.20  ? 80  SER B OG  1 
ATOM   4662  N  N   . LEU B  2  81  ? -0.995  22.536  -19.409 1.00 32.81  ? 81  LEU B N   1 
ATOM   4663  C  CA  . LEU B  2  81  ? -0.373  21.393  -18.766 1.00 37.55  ? 81  LEU B CA  1 
ATOM   4664  C  C   . LEU B  2  81  ? 1.025   21.176  -19.277 1.00 37.70  ? 81  LEU B C   1 
ATOM   4665  O  O   . LEU B  2  81  ? 1.923   20.957  -18.473 1.00 36.41  ? 81  LEU B O   1 
ATOM   4666  C  CB  . LEU B  2  81  ? -1.234  20.127  -18.925 1.00 39.85  ? 81  LEU B CB  1 
ATOM   4667  C  CG  . LEU B  2  81  ? -2.559  20.281  -18.173 1.00 40.91  ? 81  LEU B CG  1 
ATOM   4668  C  CD1 . LEU B  2  81  ? -3.490  19.144  -18.520 1.00 45.78  ? 81  LEU B CD1 1 
ATOM   4669  C  CD2 . LEU B  2  81  ? -2.347  20.335  -16.674 1.00 43.49  ? 81  LEU B CD2 1 
ATOM   4670  N  N   . ARG B  2  82  ? 1.197   21.281  -20.599 1.00 41.02  ? 82  ARG B N   1 
ATOM   4671  C  CA  . ARG B  2  82  ? 2.518   21.401  -21.241 1.00 44.28  ? 82  ARG B CA  1 
ATOM   4672  C  C   . ARG B  2  82  ? 3.487   22.270  -20.429 1.00 39.64  ? 82  ARG B C   1 
ATOM   4673  O  O   . ARG B  2  82  ? 4.539   21.818  -20.024 1.00 42.70  ? 82  ARG B O   1 
ATOM   4674  C  CB  . ARG B  2  82  ? 2.385   21.974  -22.651 1.00 48.16  ? 82  ARG B CB  1 
ATOM   4675  C  CG  . ARG B  2  82  ? 3.572   21.685  -23.553 1.00 54.92  ? 82  ARG B CG  1 
ATOM   4676  C  CD  . ARG B  2  82  ? 3.455   22.469  -24.845 1.00 62.87  ? 82  ARG B CD  1 
ATOM   4677  N  NE  . ARG B  2  82  ? 3.873   23.849  -24.612 1.00 73.88  ? 82  ARG B NE  1 
ATOM   4678  C  CZ  . ARG B  2  82  ? 5.093   24.349  -24.855 1.00 81.92  ? 82  ARG B CZ  1 
ATOM   4679  N  NH1 . ARG B  2  82  ? 6.060   23.599  -25.396 1.00 85.61  ? 82  ARG B NH1 1 
ATOM   4680  N  NH2 . ARG B  2  82  ? 5.351   25.631  -24.571 1.00 80.49  ? 82  ARG B NH2 1 
ATOM   4681  N  N   . ILE B  2  83  ? 3.093   23.496  -20.139 1.00 38.41  ? 83  ILE B N   1 
ATOM   4682  C  CA  . ILE B  2  83  ? 3.942   24.401  -19.379 1.00 37.21  ? 83  ILE B CA  1 
ATOM   4683  C  C   . ILE B  2  83  ? 4.150   23.914  -17.969 1.00 38.74  ? 83  ILE B C   1 
ATOM   4684  O  O   . ILE B  2  83  ? 5.234   24.122  -17.398 1.00 38.91  ? 83  ILE B O   1 
ATOM   4685  C  CB  . ILE B  2  83  ? 3.417   25.853  -19.376 1.00 32.78  ? 83  ILE B CB  1 
ATOM   4686  C  CG1 . ILE B  2  83  ? 3.451   26.358  -20.814 1.00 35.37  ? 83  ILE B CG1 1 
ATOM   4687  C  CG2 . ILE B  2  83  ? 4.298   26.740  -18.495 1.00 31.27  ? 83  ILE B CG2 1 
ATOM   4688  C  CD1 . ILE B  2  83  ? 2.638   27.608  -21.095 1.00 39.01  ? 83  ILE B CD1 1 
ATOM   4689  N  N   . LEU B  2  84  ? 3.124   23.301  -17.381 1.00 37.69  ? 84  LEU B N   1 
ATOM   4690  C  CA  . LEU B  2  84  ? 3.250   22.852  -15.993 1.00 37.29  ? 84  LEU B CA  1 
ATOM   4691  C  C   . LEU B  2  84  ? 4.394   21.798  -15.850 1.00 38.16  ? 84  LEU B C   1 
ATOM   4692  O  O   . LEU B  2  84  ? 5.138   21.809  -14.864 1.00 34.85  ? 84  LEU B O   1 
ATOM   4693  C  CB  . LEU B  2  84  ? 1.904   22.333  -15.441 1.00 35.63  ? 84  LEU B CB  1 
ATOM   4694  C  CG  . LEU B  2  84  ? 1.933   21.895  -13.969 1.00 34.75  ? 84  LEU B CG  1 
ATOM   4695  C  CD1 . LEU B  2  84  ? 2.008   23.081  -13.010 1.00 33.11  ? 84  LEU B CD1 1 
ATOM   4696  C  CD2 . LEU B  2  84  ? 0.749   20.994  -13.693 1.00 37.19  ? 84  LEU B CD2 1 
ATOM   4697  N  N   . TYR B  2  85  ? 4.504   20.914  -16.839 1.00 39.63  ? 85  TYR B N   1 
ATOM   4698  C  CA  . TYR B  2  85  ? 5.456   19.813  -16.817 1.00 40.82  ? 85  TYR B CA  1 
ATOM   4699  C  C   . TYR B  2  85  ? 6.865   20.274  -17.183 1.00 45.56  ? 85  TYR B C   1 
ATOM   4700  O  O   . TYR B  2  85  ? 7.844   19.738  -16.702 1.00 49.93  ? 85  TYR B O   1 
ATOM   4701  C  CB  . TYR B  2  85  ? 4.981   18.651  -17.696 1.00 37.70  ? 85  TYR B CB  1 
ATOM   4702  C  CG  . TYR B  2  85  ? 3.945   17.795  -16.973 1.00 39.00  ? 85  TYR B CG  1 
ATOM   4703  C  CD1 . TYR B  2  85  ? 4.325   16.767  -16.123 1.00 36.12  ? 85  TYR B CD1 1 
ATOM   4704  C  CD2 . TYR B  2  85  ? 2.577   18.048  -17.110 1.00 39.75  ? 85  TYR B CD2 1 
ATOM   4705  C  CE1 . TYR B  2  85  ? 3.372   16.000  -15.455 1.00 36.27  ? 85  TYR B CE1 1 
ATOM   4706  C  CE2 . TYR B  2  85  ? 1.638   17.298  -16.433 1.00 39.22  ? 85  TYR B CE2 1 
ATOM   4707  C  CZ  . TYR B  2  85  ? 2.041   16.271  -15.612 1.00 36.70  ? 85  TYR B CZ  1 
ATOM   4708  O  OH  . TYR B  2  85  ? 1.092   15.538  -14.946 1.00 37.86  ? 85  TYR B OH  1 
ATOM   4709  N  N   . MET B  2  86  ? 6.937   21.286  -18.016 1.00 47.60  ? 86  MET B N   1 
ATOM   4710  C  CA  . MET B  2  86  ? 8.169   21.975  -18.332 1.00 49.09  ? 86  MET B CA  1 
ATOM   4711  C  C   . MET B  2  86  ? 8.801   22.669  -17.110 1.00 48.05  ? 86  MET B C   1 
ATOM   4712  O  O   . MET B  2  86  ? 10.001  22.619  -16.938 1.00 53.87  ? 86  MET B O   1 
ATOM   4713  C  CB  . MET B  2  86  ? 7.820   22.980  -19.414 1.00 54.03  ? 86  MET B CB  1 
ATOM   4714  C  CG  . MET B  2  86  ? 8.950   23.580  -20.200 1.00 57.12  ? 86  MET B CG  1 
ATOM   4715  S  SD  . MET B  2  86  ? 8.189   24.674  -21.396 1.00 61.75  ? 86  MET B SD  1 
ATOM   4716  C  CE  . MET B  2  86  ? 7.297   23.474  -22.368 1.00 54.64  ? 86  MET B CE  1 
ATOM   4717  N  N   . MET B  2  87  ? 7.983   23.290  -16.263 1.00 50.67  ? 87  MET B N   1 
ATOM   4718  C  CA  . MET B  2  87  ? 8.416   23.974  -15.025 1.00 51.22  ? 87  MET B CA  1 
ATOM   4719  C  C   . MET B  2  87  ? 9.038   23.059  -13.965 1.00 54.15  ? 87  MET B C   1 
ATOM   4720  O  O   . MET B  2  87  ? 9.712   23.510  -13.014 1.00 53.98  ? 87  MET B O   1 
ATOM   4721  C  CB  . MET B  2  87  ? 7.213   24.655  -14.358 1.00 52.32  ? 87  MET B CB  1 
ATOM   4722  C  CG  . MET B  2  87  ? 6.830   26.002  -14.918 1.00 56.14  ? 87  MET B CG  1 
ATOM   4723  S  SD  . MET B  2  87  ? 5.384   26.796  -14.179 1.00 59.84  ? 87  MET B SD  1 
ATOM   4724  C  CE  . MET B  2  87  ? 5.192   25.910  -12.629 1.00 66.24  ? 87  MET B CE  1 
ATOM   4725  N  N   . ASP B  2  88  ? 8.736   21.785  -14.100 1.00 55.90  ? 88  ASP B N   1 
ATOM   4726  C  CA  . ASP B  2  88  ? 9.044   20.792  -13.117 1.00 61.50  ? 88  ASP B CA  1 
ATOM   4727  C  C   . ASP B  2  88  ? 10.289  19.990  -13.543 1.00 68.61  ? 88  ASP B C   1 
ATOM   4728  O  O   . ASP B  2  88  ? 11.148  19.728  -12.711 1.00 68.10  ? 88  ASP B O   1 
ATOM   4729  C  CB  . ASP B  2  88  ? 7.797   19.895  -13.010 1.00 58.32  ? 88  ASP B CB  1 
ATOM   4730  C  CG  . ASP B  2  88  ? 7.862   18.928  -11.874 1.00 59.51  ? 88  ASP B CG  1 
ATOM   4731  O  OD1 . ASP B  2  88  ? 7.584   19.396  -10.732 1.00 58.63  ? 88  ASP B OD1 1 
ATOM   4732  O  OD2 . ASP B  2  88  ? 8.160   17.719  -12.144 1.00 53.49  ? 88  ASP B OD2 1 
ATOM   4733  N  N   . GLU B  2  89  ? 10.394  19.677  -14.843 1.00 79.58  ? 89  GLU B N   1 
ATOM   4734  C  CA  . GLU B  2  89  ? 11.219  18.581  -15.378 1.00 92.71  ? 89  GLU B CA  1 
ATOM   4735  C  C   . GLU B  2  89  ? 12.697  18.650  -15.036 1.00 106.32 ? 89  GLU B C   1 
ATOM   4736  O  O   . GLU B  2  89  ? 13.236  19.757  -14.936 1.00 92.85  ? 89  GLU B O   1 
ATOM   4737  C  CB  . GLU B  2  89  ? 11.098  18.484  -16.918 1.00 94.70  ? 89  GLU B CB  1 
ATOM   4738  C  CG  . GLU B  2  89  ? 11.798  19.581  -17.733 1.00 94.90  ? 89  GLU B CG  1 
ATOM   4739  C  CD  . GLU B  2  89  ? 11.668  19.388  -19.247 1.00 102.81 ? 89  GLU B CD  1 
ATOM   4740  O  OE1 . GLU B  2  89  ? 11.187  18.317  -19.689 1.00 104.89 ? 89  GLU B OE1 1 
ATOM   4741  O  OE2 . GLU B  2  89  ? 12.053  20.311  -20.007 1.00 98.39  ? 89  GLU B OE2 1 
ATOM   4742  N  N   . ILE B  2  90  ? 13.294  17.452  -14.857 1.00 120.14 ? 90  ILE B N   1 
ATOM   4743  C  CA  . ILE B  2  90  ? 14.765  17.163  -14.790 1.00 123.60 ? 90  ILE B CA  1 
ATOM   4744  C  C   . ILE B  2  90  ? 15.680  18.183  -15.507 1.00 117.10 ? 90  ILE B C   1 
ATOM   4745  O  O   . ILE B  2  90  ? 15.630  18.340  -16.737 1.00 121.81 ? 90  ILE B O   1 
ATOM   4746  C  CB  . ILE B  2  90  ? 15.076  15.703  -15.285 1.00 128.38 ? 90  ILE B CB  1 
ATOM   4747  C  CG1 . ILE B  2  90  ? 16.588  15.440  -15.508 1.00 124.59 ? 90  ILE B CG1 1 
ATOM   4748  C  CG2 . ILE B  2  90  ? 14.302  15.368  -16.569 1.00 126.77 ? 90  ILE B CG2 1 
ATOM   4749  C  CD1 . ILE B  2  90  ? 17.515  15.806  -14.364 1.00 119.42 ? 90  ILE B CD1 1 
ATOM   4750  N  N   . ASN B  2  91  ? 16.547  18.823  -14.722 1.00 93.37  ? 91  ASN B N   1 
ATOM   4751  C  CA  . ASN B  2  91  ? 17.071  20.138  -15.075 1.00 86.87  ? 91  ASN B CA  1 
ATOM   4752  C  C   . ASN B  2  91  ? 18.607  20.202  -15.261 1.00 83.01  ? 91  ASN B C   1 
ATOM   4753  O  O   . ASN B  2  91  ? 19.083  21.008  -16.065 1.00 76.40  ? 91  ASN B O   1 
ATOM   4754  C  CB  . ASN B  2  91  ? 16.575  21.169  -14.029 1.00 86.67  ? 91  ASN B CB  1 
ATOM   4755  C  CG  . ASN B  2  91  ? 15.332  20.688  -13.241 1.00 85.11  ? 91  ASN B CG  1 
ATOM   4756  O  OD1 . ASN B  2  91  ? 15.460  19.921  -12.273 1.00 72.48  ? 91  ASN B OD1 1 
ATOM   4757  N  ND2 . ASN B  2  91  ? 14.126  21.145  -13.651 1.00 68.98  ? 91  ASN B ND2 1 
ATOM   4758  N  N   . ASN B  2  92  ? 19.359  19.356  -14.543 1.00 77.03  ? 92  ASN B N   1 
ATOM   4759  C  CA  . ASN B  2  92  ? 20.840  19.390  -14.495 1.00 73.57  ? 92  ASN B CA  1 
ATOM   4760  C  C   . ASN B  2  92  ? 21.414  20.733  -13.990 1.00 61.23  ? 92  ASN B C   1 
ATOM   4761  O  O   . ASN B  2  92  ? 22.031  21.477  -14.745 1.00 64.53  ? 92  ASN B O   1 
ATOM   4762  C  CB  . ASN B  2  92  ? 21.482  18.932  -15.833 1.00 83.58  ? 92  ASN B CB  1 
ATOM   4763  C  CG  . ASN B  2  92  ? 21.612  17.399  -15.946 1.00 95.69  ? 92  ASN B CG  1 
ATOM   4764  O  OD1 . ASN B  2  92  ? 22.627  16.895  -16.440 1.00 91.55  ? 92  ASN B OD1 1 
ATOM   4765  N  ND2 . ASN B  2  92  ? 20.587  16.655  -15.483 1.00 99.89  ? 92  ASN B ND2 1 
ATOM   4766  N  N   . PRO B  2  93  ? 21.223  21.032  -12.689 1.00 48.34  ? 93  PRO B N   1 
ATOM   4767  C  CA  . PRO B  2  93  ? 21.643  22.324  -12.175 1.00 44.88  ? 93  PRO B CA  1 
ATOM   4768  C  C   . PRO B  2  93  ? 23.134  22.398  -11.865 1.00 42.33  ? 93  PRO B C   1 
ATOM   4769  O  O   . PRO B  2  93  ? 23.750  21.400  -11.501 1.00 37.31  ? 93  PRO B O   1 
ATOM   4770  C  CB  . PRO B  2  93  ? 20.800  22.493  -10.898 1.00 44.80  ? 93  PRO B CB  1 
ATOM   4771  C  CG  . PRO B  2  93  ? 20.497  21.109  -10.456 1.00 44.65  ? 93  PRO B CG  1 
ATOM   4772  C  CD  . PRO B  2  93  ? 20.514  20.235  -11.673 1.00 44.01  ? 93  PRO B CD  1 
ATOM   4773  N  N   . SER B  2  94  ? 23.678  23.603  -11.991 1.00 41.52  ? 94  SER B N   1 
ATOM   4774  C  CA  . SER B  2  94  ? 25.101  23.873  -11.774 1.00 41.24  ? 94  SER B CA  1 
ATOM   4775  C  C   . SER B  2  94  ? 25.382  24.363  -10.384 1.00 39.98  ? 94  SER B C   1 
ATOM   4776  O  O   . SER B  2  94  ? 26.499  24.230  -9.906  1.00 40.67  ? 94  SER B O   1 
ATOM   4777  C  CB  . SER B  2  94  ? 25.559  24.938  -12.742 1.00 41.21  ? 94  SER B CB  1 
ATOM   4778  O  OG  . SER B  2  94  ? 25.432  24.484  -14.079 1.00 45.92  ? 94  SER B OG  1 
ATOM   4779  N  N   . LEU B  2  95  ? 24.361  24.938  -9.747  1.00 39.68  ? 95  LEU B N   1 
ATOM   4780  C  CA  . LEU B  2  95  ? 24.468  25.505  -8.424  1.00 35.25  ? 95  LEU B CA  1 
ATOM   4781  C  C   . LEU B  2  95  ? 23.158  25.252  -7.672  1.00 33.44  ? 95  LEU B C   1 
ATOM   4782  O  O   . LEU B  2  95  ? 22.102  25.257  -8.283  1.00 33.78  ? 95  LEU B O   1 
ATOM   4783  C  CB  . LEU B  2  95  ? 24.765  27.005  -8.563  1.00 36.48  ? 95  LEU B CB  1 
ATOM   4784  C  CG  . LEU B  2  95  ? 24.836  27.859  -7.295  1.00 39.43  ? 95  LEU B CG  1 
ATOM   4785  C  CD1 . LEU B  2  95  ? 25.963  27.412  -6.387  1.00 41.17  ? 95  LEU B CD1 1 
ATOM   4786  C  CD2 . LEU B  2  95  ? 25.036  29.323  -7.651  1.00 43.86  ? 95  LEU B CD2 1 
ATOM   4787  N  N   . THR B  2  96  ? 23.249  24.999  -6.362  1.00 30.96  ? 96  THR B N   1 
ATOM   4788  C  CA  . THR B  2  96  ? 22.127  24.964  -5.455  1.00 28.55  ? 96  THR B CA  1 
ATOM   4789  C  C   . THR B  2  96  ? 22.273  26.112  -4.474  1.00 29.69  ? 96  THR B C   1 
ATOM   4790  O  O   . THR B  2  96  ? 23.289  26.220  -3.843  1.00 31.87  ? 96  THR B O   1 
ATOM   4791  C  CB  . THR B  2  96  ? 22.050  23.650  -4.659  1.00 27.43  ? 96  THR B CB  1 
ATOM   4792  O  OG1 . THR B  2  96  ? 21.684  22.579  -5.528  1.00 25.54  ? 96  THR B OG1 1 
ATOM   4793  C  CG2 . THR B  2  96  ? 20.984  23.727  -3.555  1.00 28.37  ? 96  THR B CG2 1 
ATOM   4794  N  N   . VAL B  2  97  ? 21.236  26.936  -4.334  1.00 29.57  ? 97  VAL B N   1 
ATOM   4795  C  CA  . VAL B  2  97  ? 21.170  27.980  -3.334  1.00 31.07  ? 97  VAL B CA  1 
ATOM   4796  C  C   . VAL B  2  97  ? 19.928  27.719  -2.480  1.00 31.99  ? 97  VAL B C   1 
ATOM   4797  O  O   . VAL B  2  97  ? 18.945  27.219  -2.983  1.00 33.12  ? 97  VAL B O   1 
ATOM   4798  C  CB  . VAL B  2  97  ? 21.041  29.341  -4.016  1.00 34.20  ? 97  VAL B CB  1 
ATOM   4799  C  CG1 . VAL B  2  97  ? 21.139  30.462  -2.994  1.00 36.57  ? 97  VAL B CG1 1 
ATOM   4800  C  CG2 . VAL B  2  97  ? 22.102  29.489  -5.107  1.00 36.52  ? 97  VAL B CG2 1 
ATOM   4801  N  N   . LYS B  2  98  ? 19.996  28.028  -1.192  1.00 29.23  ? 98  LYS B N   1 
ATOM   4802  C  CA  . LYS B  2  98  ? 18.887  27.862  -0.290  1.00 30.26  ? 98  LYS B CA  1 
ATOM   4803  C  C   . LYS B  2  98  ? 18.430  29.212  0.223   1.00 30.21  ? 98  LYS B C   1 
ATOM   4804  O  O   . LYS B  2  98  ? 19.246  30.052  0.550   1.00 28.80  ? 98  LYS B O   1 
ATOM   4805  C  CB  . LYS B  2  98  ? 19.297  27.057  0.919   1.00 31.39  ? 98  LYS B CB  1 
ATOM   4806  C  CG  . LYS B  2  98  ? 19.449  25.571  0.697   1.00 31.50  ? 98  LYS B CG  1 
ATOM   4807  C  CD  . LYS B  2  98  ? 20.164  24.997  1.892   1.00 33.88  ? 98  LYS B CD  1 
ATOM   4808  C  CE  . LYS B  2  98  ? 21.685  25.082  1.736   1.00 35.81  ? 98  LYS B CE  1 
ATOM   4809  N  NZ  . LYS B  2  98  ? 22.423  25.034  3.035   1.00 37.80  ? 98  LYS B NZ  1 
ATOM   4810  N  N   . THR B  2  99  ? 17.134  29.419  0.326   1.00 29.56  ? 99  THR B N   1 
ATOM   4811  C  CA  . THR B  2  99  ? 16.648  30.630  0.981   1.00 32.92  ? 99  THR B CA  1 
ATOM   4812  C  C   . THR B  2  99  ? 15.760  30.291  2.179   1.00 33.39  ? 99  THR B C   1 
ATOM   4813  O  O   . THR B  2  99  ? 14.952  29.372  2.118   1.00 38.35  ? 99  THR B O   1 
ATOM   4814  C  CB  . THR B  2  99  ? 15.986  31.588  -0.018  1.00 33.37  ? 99  THR B CB  1 
ATOM   4815  O  OG1 . THR B  2  99  ? 15.565  32.752  0.681   1.00 38.44  ? 99  THR B OG1 1 
ATOM   4816  C  CG2 . THR B  2  99  ? 14.834  30.982  -0.694  1.00 35.72  ? 99  THR B CG2 1 
ATOM   4817  N  N   . MET B  2  100 ? 15.943  30.985  3.289   1.00 30.61  ? 100 MET B N   1 
ATOM   4818  C  CA  . MET B  2  100 ? 15.220  30.650  4.483   1.00 30.11  ? 100 MET B CA  1 
ATOM   4819  C  C   . MET B  2  100 ? 14.425  31.878  4.864   1.00 31.37  ? 100 MET B C   1 
ATOM   4820  O  O   . MET B  2  100 ? 15.001  32.959  5.015   1.00 32.79  ? 100 MET B O   1 
ATOM   4821  C  CB  . MET B  2  100 ? 16.175  30.228  5.586   1.00 32.19  ? 100 MET B CB  1 
ATOM   4822  C  CG  . MET B  2  100 ? 16.954  28.947  5.301   1.00 34.57  ? 100 MET B CG  1 
ATOM   4823  S  SD  . MET B  2  100 ? 15.940  27.436  5.177   1.00 38.29  ? 100 MET B SD  1 
ATOM   4824  C  CE  . MET B  2  100 ? 15.334  27.395  6.840   1.00 35.16  ? 100 MET B CE  1 
ATOM   4825  N  N   . GLY B  2  101 ? 13.096  31.735  4.944   1.00 27.07  ? 101 GLY B N   1 
ATOM   4826  C  CA  . GLY B  2  101 ? 12.220  32.833  5.316   1.00 24.20  ? 101 GLY B CA  1 
ATOM   4827  C  C   . GLY B  2  101 ? 12.327  33.097  6.806   1.00 23.68  ? 101 GLY B C   1 
ATOM   4828  O  O   . GLY B  2  101 ? 12.557  32.179  7.568   1.00 20.84  ? 101 GLY B O   1 
ATOM   4829  N  N   . HIS B  2  102 ? 12.167  34.361  7.203   1.00 23.32  ? 102 HIS B N   1 
ATOM   4830  C  CA  . HIS B  2  102 ? 12.146  34.771  8.597   1.00 24.83  ? 102 HIS B CA  1 
ATOM   4831  C  C   . HIS B  2  102 ? 11.229  35.957  8.744   1.00 25.46  ? 102 HIS B C   1 
ATOM   4832  O  O   . HIS B  2  102 ? 11.032  36.739  7.796   1.00 24.29  ? 102 HIS B O   1 
ATOM   4833  C  CB  . HIS B  2  102 ? 13.536  35.282  9.074   1.00 28.08  ? 102 HIS B CB  1 
ATOM   4834  C  CG  . HIS B  2  102 ? 14.660  34.318  8.834   1.00 30.05  ? 102 HIS B CG  1 
ATOM   4835  N  ND1 . HIS B  2  102 ? 15.078  33.401  9.783   1.00 28.19  ? 102 HIS B ND1 1 
ATOM   4836  C  CD2 . HIS B  2  102 ? 15.435  34.121  7.743   1.00 29.08  ? 102 HIS B CD2 1 
ATOM   4837  C  CE1 . HIS B  2  102 ? 16.054  32.678  9.278   1.00 29.25  ? 102 HIS B CE1 1 
ATOM   4838  N  NE2 . HIS B  2  102 ? 16.294  33.098  8.044   1.00 31.18  ? 102 HIS B NE2 1 
ATOM   4839  N  N   . GLN B  2  103 ? 10.734  36.143  9.956   1.00 26.07  ? 103 GLN B N   1 
ATOM   4840  C  CA  . GLN B  2  103 ? 10.074  37.377  10.302  1.00 29.33  ? 103 GLN B CA  1 
ATOM   4841  C  C   . GLN B  2  103 ? 11.147  38.437  10.622  1.00 28.60  ? 103 GLN B C   1 
ATOM   4842  O  O   . GLN B  2  103 ? 11.684  38.425  11.737  1.00 29.22  ? 103 GLN B O   1 
ATOM   4843  C  CB  . GLN B  2  103 ? 9.133   37.170  11.494  1.00 30.03  ? 103 GLN B CB  1 
ATOM   4844  C  CG  . GLN B  2  103 ? 7.898   36.346  11.151  1.00 32.04  ? 103 GLN B CG  1 
ATOM   4845  C  CD  . GLN B  2  103 ? 6.906   36.258  12.308  1.00 31.08  ? 103 GLN B CD  1 
ATOM   4846  O  OE1 . GLN B  2  103 ? 7.309   36.086  13.446  1.00 30.81  ? 103 GLN B OE1 1 
ATOM   4847  N  NE2 . GLN B  2  103 ? 5.604   36.348  12.009  1.00 29.67  ? 103 GLN B NE2 1 
ATOM   4848  N  N   . TRP B  2  104 ? 11.461  39.390  9.743   1.00 26.11  ? 104 TRP B N   1 
ATOM   4849  C  CA  . TRP B  2  104 ? 10.884  39.660  8.436   1.00 27.91  ? 104 TRP B CA  1 
ATOM   4850  C  C   . TRP B  2  104 ? 12.068  40.025  7.539   1.00 25.93  ? 104 TRP B C   1 
ATOM   4851  O  O   . TRP B  2  104 ? 12.450  41.187  7.378   1.00 26.33  ? 104 TRP B O   1 
ATOM   4852  C  CB  . TRP B  2  104 ? 9.822   40.815  8.503   1.00 28.81  ? 104 TRP B CB  1 
ATOM   4853  C  CG  . TRP B  2  104 ? 8.594   40.384  9.137   1.00 28.73  ? 104 TRP B CG  1 
ATOM   4854  C  CD1 . TRP B  2  104 ? 7.612   39.626  8.577   1.00 29.53  ? 104 TRP B CD1 1 
ATOM   4855  C  CD2 . TRP B  2  104 ? 8.216   40.581  10.499  1.00 29.07  ? 104 TRP B CD2 1 
ATOM   4856  N  NE1 . TRP B  2  104 ? 6.603   39.372  9.503   1.00 29.55  ? 104 TRP B NE1 1 
ATOM   4857  C  CE2 . TRP B  2  104 ? 6.957   39.948  10.687  1.00 27.64  ? 104 TRP B CE2 1 
ATOM   4858  C  CE3 . TRP B  2  104 ? 8.789   41.258  11.565  1.00 28.94  ? 104 TRP B CE3 1 
ATOM   4859  C  CZ2 . TRP B  2  104 ? 6.291   39.974  11.885  1.00 27.69  ? 104 TRP B CZ2 1 
ATOM   4860  C  CZ3 . TRP B  2  104 ? 8.112   41.273  12.785  1.00 27.49  ? 104 TRP B CZ3 1 
ATOM   4861  C  CH2 . TRP B  2  104 ? 6.882   40.640  12.926  1.00 28.32  ? 104 TRP B CH2 1 
ATOM   4862  N  N   . TYR B  2  105 ? 12.711  38.999  7.044   1.00 25.61  ? 105 TYR B N   1 
ATOM   4863  C  CA  . TYR B  2  105 ? 13.874  39.170  6.180   1.00 28.75  ? 105 TYR B CA  1 
ATOM   4864  C  C   . TYR B  2  105 ? 14.174  37.794  5.604   1.00 28.63  ? 105 TYR B C   1 
ATOM   4865  O  O   . TYR B  2  105 ? 13.723  36.783  6.157   1.00 28.41  ? 105 TYR B O   1 
ATOM   4866  C  CB  . TYR B  2  105 ? 15.097  39.704  6.963   1.00 26.99  ? 105 TYR B CB  1 
ATOM   4867  C  CG  . TYR B  2  105 ? 15.611  38.747  7.988   1.00 26.86  ? 105 TYR B CG  1 
ATOM   4868  C  CD1 . TYR B  2  105 ? 15.007  38.652  9.229   1.00 27.21  ? 105 TYR B CD1 1 
ATOM   4869  C  CD2 . TYR B  2  105 ? 16.713  37.916  7.711   1.00 27.02  ? 105 TYR B CD2 1 
ATOM   4870  C  CE1 . TYR B  2  105 ? 15.485  37.768  10.182  1.00 28.32  ? 105 TYR B CE1 1 
ATOM   4871  C  CE2 . TYR B  2  105 ? 17.206  37.037  8.654   1.00 25.48  ? 105 TYR B CE2 1 
ATOM   4872  C  CZ  . TYR B  2  105 ? 16.589  36.967  9.876   1.00 28.22  ? 105 TYR B CZ  1 
ATOM   4873  O  OH  . TYR B  2  105 ? 17.038  36.075  10.811  1.00 31.04  ? 105 TYR B OH  1 
ATOM   4874  N  N   . TRP B  2  106 ? 14.916  37.745  4.517   1.00 27.32  ? 106 TRP B N   1 
ATOM   4875  C  CA  . TRP B  2  106 ? 15.304  36.460  3.965   1.00 29.57  ? 106 TRP B CA  1 
ATOM   4876  C  C   . TRP B  2  106 ? 16.788  36.255  4.262   1.00 31.59  ? 106 TRP B C   1 
ATOM   4877  O  O   . TRP B  2  106 ? 17.549  37.215  4.308   1.00 32.31  ? 106 TRP B O   1 
ATOM   4878  C  CB  . TRP B  2  106 ? 15.087  36.436  2.467   1.00 30.30  ? 106 TRP B CB  1 
ATOM   4879  C  CG  . TRP B  2  106 ? 13.699  36.562  2.080   1.00 31.07  ? 106 TRP B CG  1 
ATOM   4880  C  CD1 . TRP B  2  106 ? 13.052  37.714  1.768   1.00 31.81  ? 106 TRP B CD1 1 
ATOM   4881  C  CD2 . TRP B  2  106 ? 12.756  35.505  1.936   1.00 31.46  ? 106 TRP B CD2 1 
ATOM   4882  N  NE1 . TRP B  2  106 ? 11.755  37.448  1.459   1.00 36.04  ? 106 TRP B NE1 1 
ATOM   4883  C  CE2 . TRP B  2  106 ? 11.540  36.094  1.535   1.00 34.04  ? 106 TRP B CE2 1 
ATOM   4884  C  CE3 . TRP B  2  106 ? 12.817  34.121  2.100   1.00 31.83  ? 106 TRP B CE3 1 
ATOM   4885  C  CZ2 . TRP B  2  106 ? 10.380  35.343  1.287   1.00 32.15  ? 106 TRP B CZ2 1 
ATOM   4886  C  CZ3 . TRP B  2  106 ? 11.670  33.365  1.863   1.00 34.31  ? 106 TRP B CZ3 1 
ATOM   4887  C  CH2 . TRP B  2  106 ? 10.462  33.981  1.457   1.00 34.36  ? 106 TRP B CH2 1 
ATOM   4888  N  N   . SER B  2  107 ? 17.200  35.008  4.430   1.00 30.91  ? 107 SER B N   1 
ATOM   4889  C  CA  . SER B  2  107 ? 18.619  34.692  4.547   1.00 29.61  ? 107 SER B CA  1 
ATOM   4890  C  C   . SER B  2  107 ? 18.905  33.705  3.453   1.00 27.69  ? 107 SER B C   1 
ATOM   4891  O  O   . SER B  2  107 ? 18.048  32.966  3.071   1.00 25.52  ? 107 SER B O   1 
ATOM   4892  C  CB  . SER B  2  107 ? 18.943  34.139  5.931   1.00 28.96  ? 107 SER B CB  1 
ATOM   4893  O  OG  . SER B  2  107 ? 18.504  32.808  6.005   1.00 28.97  ? 107 SER B OG  1 
ATOM   4894  N  N   . TYR B  2  108 ? 20.102  33.753  2.903   1.00 30.03  ? 108 TYR B N   1 
ATOM   4895  C  CA  . TYR B  2  108 ? 20.466  32.900  1.778   1.00 31.36  ? 108 TYR B CA  1 
ATOM   4896  C  C   . TYR B  2  108 ? 21.690  32.024  2.122   1.00 30.84  ? 108 TYR B C   1 
ATOM   4897  O  O   . TYR B  2  108 ? 22.552  32.448  2.875   1.00 33.16  ? 108 TYR B O   1 
ATOM   4898  C  CB  . TYR B  2  108 ? 20.691  33.780  0.557   1.00 31.58  ? 108 TYR B CB  1 
ATOM   4899  C  CG  . TYR B  2  108 ? 19.437  34.546  0.146   1.00 31.19  ? 108 TYR B CG  1 
ATOM   4900  C  CD1 . TYR B  2  108 ? 19.156  35.788  0.672   1.00 31.63  ? 108 TYR B CD1 1 
ATOM   4901  C  CD2 . TYR B  2  108 ? 18.538  34.023  -0.755  1.00 29.76  ? 108 TYR B CD2 1 
ATOM   4902  C  CE1 . TYR B  2  108 ? 18.003  36.479  0.316   1.00 30.60  ? 108 TYR B CE1 1 
ATOM   4903  C  CE2 . TYR B  2  108 ? 17.397  34.721  -1.125  1.00 28.38  ? 108 TYR B CE2 1 
ATOM   4904  C  CZ  . TYR B  2  108 ? 17.129  35.939  -0.577  1.00 27.95  ? 108 TYR B CZ  1 
ATOM   4905  O  OH  . TYR B  2  108 ? 16.022  36.664  -0.963  1.00 27.98  ? 108 TYR B OH  1 
ATOM   4906  N  N   . GLU B  2  109 ? 21.725  30.791  1.619   1.00 30.39  ? 109 GLU B N   1 
ATOM   4907  C  CA  . GLU B  2  109 ? 22.810  29.857  1.907   1.00 32.12  ? 109 GLU B CA  1 
ATOM   4908  C  C   . GLU B  2  109 ? 23.389  29.304  0.618   1.00 32.94  ? 109 GLU B C   1 
ATOM   4909  O  O   . GLU B  2  109 ? 22.653  28.783  -0.205  1.00 34.95  ? 109 GLU B O   1 
ATOM   4910  C  CB  . GLU B  2  109 ? 22.323  28.725  2.806   1.00 32.37  ? 109 GLU B CB  1 
ATOM   4911  C  CG  . GLU B  2  109 ? 21.920  29.212  4.203   1.00 33.21  ? 109 GLU B CG  1 
ATOM   4912  C  CD  . GLU B  2  109 ? 21.279  28.148  5.066   1.00 32.42  ? 109 GLU B CD  1 
ATOM   4913  O  OE1 . GLU B  2  109 ? 21.338  26.959  4.721   1.00 33.17  ? 109 GLU B OE1 1 
ATOM   4914  O  OE2 . GLU B  2  109 ? 20.740  28.502  6.118   1.00 33.16  ? 109 GLU B OE2 1 
ATOM   4915  N  N   . TYR B  2  110 ? 24.697  29.470  0.416   1.00 32.90  ? 110 TYR B N   1 
ATOM   4916  C  CA  . TYR B  2  110 ? 25.373  28.823  -0.721  1.00 34.15  ? 110 TYR B CA  1 
ATOM   4917  C  C   . TYR B  2  110 ? 26.402  27.920  -0.048  1.00 33.18  ? 110 TYR B C   1 
ATOM   4918  O  O   . TYR B  2  110 ? 27.404  28.408  0.443   1.00 34.86  ? 110 TYR B O   1 
ATOM   4919  C  CB  . TYR B  2  110 ? 26.049  29.810  -1.709  1.00 31.76  ? 110 TYR B CB  1 
ATOM   4920  C  CG  . TYR B  2  110 ? 25.253  30.995  -2.264  1.00 29.21  ? 110 TYR B CG  1 
ATOM   4921  C  CD1 . TYR B  2  110 ? 24.631  31.922  -1.430  1.00 30.06  ? 110 TYR B CD1 1 
ATOM   4922  C  CD2 . TYR B  2  110 ? 25.208  31.238  -3.635  1.00 28.27  ? 110 TYR B CD2 1 
ATOM   4923  C  CE1 . TYR B  2  110 ? 23.950  33.031  -1.958  1.00 29.64  ? 110 TYR B CE1 1 
ATOM   4924  C  CE2 . TYR B  2  110 ? 24.535  32.331  -4.160  1.00 28.42  ? 110 TYR B CE2 1 
ATOM   4925  C  CZ  . TYR B  2  110 ? 23.914  33.235  -3.320  1.00 28.78  ? 110 TYR B CZ  1 
ATOM   4926  O  OH  . TYR B  2  110 ? 23.287  34.352  -3.848  1.00 27.07  ? 110 TYR B OH  1 
ATOM   4927  N  N   . THR B  2  111 ? 26.107  26.626  -0.002  1.00 32.49  ? 111 THR B N   1 
ATOM   4928  C  CA  . THR B  2  111 ? 26.862  25.642  0.748   1.00 31.33  ? 111 THR B CA  1 
ATOM   4929  C  C   . THR B  2  111 ? 27.317  24.474  -0.133  1.00 31.46  ? 111 THR B C   1 
ATOM   4930  O  O   . THR B  2  111 ? 27.559  23.397  0.381   1.00 34.89  ? 111 THR B O   1 
ATOM   4931  C  CB  . THR B  2  111 ? 26.034  25.091  1.947   1.00 32.85  ? 111 THR B CB  1 
ATOM   4932  O  OG1 . THR B  2  111 ? 24.830  24.446  1.491   1.00 31.14  ? 111 THR B OG1 1 
ATOM   4933  C  CG2 . THR B  2  111 ? 25.686  26.201  2.911   1.00 34.57  ? 111 THR B CG2 1 
ATOM   4934  N  N   . ASP B  2  112 ? 27.427  24.657  -1.450  1.00 32.30  ? 112 ASP B N   1 
ATOM   4935  C  CA  . ASP B  2  112 ? 28.027  23.630  -2.309  1.00 33.89  ? 112 ASP B CA  1 
ATOM   4936  C  C   . ASP B  2  112 ? 29.548  23.391  -2.023  1.00 40.18  ? 112 ASP B C   1 
ATOM   4937  O  O   . ASP B  2  112 ? 30.009  22.260  -2.191  1.00 36.36  ? 112 ASP B O   1 
ATOM   4938  C  CB  . ASP B  2  112 ? 27.856  23.957  -3.781  1.00 33.43  ? 112 ASP B CB  1 
ATOM   4939  C  CG  . ASP B  2  112 ? 26.445  23.661  -4.329  1.00 34.44  ? 112 ASP B CG  1 
ATOM   4940  O  OD1 . ASP B  2  112 ? 25.809  22.646  -3.976  1.00 34.50  ? 112 ASP B OD1 1 
ATOM   4941  O  OD2 . ASP B  2  112 ? 26.007  24.433  -5.202  1.00 31.91  ? 112 ASP B OD2 1 
ATOM   4942  N  N   . TYR B  2  113 ? 30.302  24.441  -1.627  1.00 45.18  ? 113 TYR B N   1 
ATOM   4943  C  CA  . TYR B  2  113 ? 31.767  24.353  -1.321  1.00 47.26  ? 113 TYR B CA  1 
ATOM   4944  C  C   . TYR B  2  113 ? 32.082  24.903  0.059   1.00 48.44  ? 113 TYR B C   1 
ATOM   4945  O  O   . TYR B  2  113 ? 32.485  24.178  0.957   1.00 52.58  ? 113 TYR B O   1 
ATOM   4946  C  CB  . TYR B  2  113 ? 32.603  25.089  -2.373  1.00 52.00  ? 113 TYR B CB  1 
ATOM   4947  C  CG  . TYR B  2  113 ? 32.055  24.959  -3.770  1.00 65.10  ? 113 TYR B CG  1 
ATOM   4948  C  CD1 . TYR B  2  113 ? 32.074  23.722  -4.452  1.00 71.11  ? 113 TYR B CD1 1 
ATOM   4949  C  CD2 . TYR B  2  113 ? 31.489  26.067  -4.421  1.00 78.78  ? 113 TYR B CD2 1 
ATOM   4950  C  CE1 . TYR B  2  113 ? 31.554  23.605  -5.742  1.00 77.04  ? 113 TYR B CE1 1 
ATOM   4951  C  CE2 . TYR B  2  113 ? 30.955  25.959  -5.711  1.00 83.52  ? 113 TYR B CE2 1 
ATOM   4952  C  CZ  . TYR B  2  113 ? 30.991  24.737  -6.366  1.00 82.40  ? 113 TYR B CZ  1 
ATOM   4953  O  OH  . TYR B  2  113 ? 30.456  24.665  -7.627  1.00 89.92  ? 113 TYR B OH  1 
ATOM   4954  N  N   . GLU B  2  114 ? 31.852  26.196  0.225   1.00 53.39  ? 114 GLU B N   1 
ATOM   4955  C  CA  . GLU B  2  114 ? 32.009  26.901  1.493   1.00 54.88  ? 114 GLU B CA  1 
ATOM   4956  C  C   . GLU B  2  114 ? 30.669  27.066  2.158   1.00 48.21  ? 114 GLU B C   1 
ATOM   4957  O  O   . GLU B  2  114 ? 29.658  26.952  1.533   1.00 55.84  ? 114 GLU B O   1 
ATOM   4958  C  CB  . GLU B  2  114 ? 32.625  28.298  1.232   1.00 61.27  ? 114 GLU B CB  1 
ATOM   4959  C  CG  . GLU B  2  114 ? 34.083  28.260  0.763   1.00 64.93  ? 114 GLU B CG  1 
ATOM   4960  C  CD  . GLU B  2  114 ? 34.963  27.479  1.730   1.00 71.76  ? 114 GLU B CD  1 
ATOM   4961  O  OE1 . GLU B  2  114 ? 34.882  27.753  2.957   1.00 75.50  ? 114 GLU B OE1 1 
ATOM   4962  O  OE2 . GLU B  2  114 ? 35.696  26.570  1.273   1.00 73.37  ? 114 GLU B OE2 1 
ATOM   4963  N  N   . ASP B  2  115 ? 30.670  27.352  3.435   1.00 47.15  ? 115 ASP B N   1 
ATOM   4964  C  CA  . ASP B  2  115 ? 29.461  27.655  4.146   1.00 50.68  ? 115 ASP B CA  1 
ATOM   4965  C  C   . ASP B  2  115 ? 29.217  29.166  4.101   1.00 47.03  ? 115 ASP B C   1 
ATOM   4966  O  O   . ASP B  2  115 ? 29.428  29.863  5.076   1.00 53.29  ? 115 ASP B O   1 
ATOM   4967  C  CB  . ASP B  2  115 ? 29.566  27.125  5.580   1.00 60.85  ? 115 ASP B CB  1 
ATOM   4968  C  CG  . ASP B  2  115 ? 29.641  25.582  5.634   1.00 69.70  ? 115 ASP B CG  1 
ATOM   4969  O  OD1 . ASP B  2  115 ? 28.828  24.896  4.966   1.00 68.64  ? 115 ASP B OD1 1 
ATOM   4970  O  OD2 . ASP B  2  115 ? 30.521  25.055  6.348   1.00 76.17  ? 115 ASP B OD2 1 
ATOM   4971  N  N   . LEU B  2  116 ? 28.793  29.665  2.948   1.00 40.38  ? 116 LEU B N   1 
ATOM   4972  C  CA  . LEU B  2  116 ? 28.444  31.071  2.791   1.00 36.82  ? 116 LEU B CA  1 
ATOM   4973  C  C   . LEU B  2  116 ? 26.969  31.272  3.143   1.00 34.93  ? 116 LEU B C   1 
ATOM   4974  O  O   . LEU B  2  116 ? 26.089  30.549  2.661   1.00 30.56  ? 116 LEU B O   1 
ATOM   4975  C  CB  . LEU B  2  116 ? 28.731  31.525  1.354   1.00 36.90  ? 116 LEU B CB  1 
ATOM   4976  C  CG  . LEU B  2  116 ? 28.072  32.765  0.757   1.00 36.78  ? 116 LEU B CG  1 
ATOM   4977  C  CD1 . LEU B  2  116 ? 28.343  34.005  1.568   1.00 40.75  ? 116 LEU B CD1 1 
ATOM   4978  C  CD2 . LEU B  2  116 ? 28.539  32.949  -0.671  1.00 36.32  ? 116 LEU B CD2 1 
ATOM   4979  N  N   . SER B  2  117 ? 26.708  32.266  3.982   1.00 34.58  ? 117 SER B N   1 
ATOM   4980  C  CA  . SER B  2  117 ? 25.349  32.684  4.251   1.00 35.16  ? 117 SER B CA  1 
ATOM   4981  C  C   . SER B  2  117 ? 25.243  34.100  4.799   1.00 33.77  ? 117 SER B C   1 
ATOM   4982  O  O   . SER B  2  117 ? 26.113  34.581  5.483   1.00 32.30  ? 117 SER B O   1 
ATOM   4983  C  CB  . SER B  2  117 ? 24.675  31.714  5.208   1.00 37.33  ? 117 SER B CB  1 
ATOM   4984  O  OG  . SER B  2  117 ? 25.388  31.676  6.411   1.00 37.34  ? 117 SER B OG  1 
ATOM   4985  N  N   . PHE B  2  118 ? 24.135  34.752  4.501   1.00 33.17  ? 118 PHE B N   1 
ATOM   4986  C  CA  . PHE B  2  118 ? 23.953  36.140  4.856   1.00 31.80  ? 118 PHE B CA  1 
ATOM   4987  C  C   . PHE B  2  118 ? 22.474  36.466  4.982   1.00 30.94  ? 118 PHE B C   1 
ATOM   4988  O  O   . PHE B  2  118 ? 21.634  35.747  4.492   1.00 30.70  ? 118 PHE B O   1 
ATOM   4989  C  CB  . PHE B  2  118 ? 24.640  37.051  3.817   1.00 32.11  ? 118 PHE B CB  1 
ATOM   4990  C  CG  . PHE B  2  118 ? 24.209  36.832  2.368   1.00 30.91  ? 118 PHE B CG  1 
ATOM   4991  C  CD1 . PHE B  2  118 ? 24.841  35.893  1.572   1.00 32.64  ? 118 PHE B CD1 1 
ATOM   4992  C  CD2 . PHE B  2  118 ? 23.193  37.601  1.791   1.00 29.63  ? 118 PHE B CD2 1 
ATOM   4993  C  CE1 . PHE B  2  118 ? 24.445  35.698  0.240   1.00 31.94  ? 118 PHE B CE1 1 
ATOM   4994  C  CE2 . PHE B  2  118 ? 22.809  37.412  0.469   1.00 27.69  ? 118 PHE B CE2 1 
ATOM   4995  C  CZ  . PHE B  2  118 ? 23.434  36.473  -0.313  1.00 28.41  ? 118 PHE B CZ  1 
ATOM   4996  N  N   . ASP B  2  119 ? 22.183  37.573  5.630   1.00 31.88  ? 119 ASP B N   1 
ATOM   4997  C  CA  . ASP B  2  119 ? 20.832  38.038  5.836   1.00 29.74  ? 119 ASP B CA  1 
ATOM   4998  C  C   . ASP B  2  119 ? 20.568  39.150  4.841   1.00 30.84  ? 119 ASP B C   1 
ATOM   4999  O  O   . ASP B  2  119 ? 21.497  39.806  4.402   1.00 35.07  ? 119 ASP B O   1 
ATOM   5000  C  CB  . ASP B  2  119 ? 20.668  38.522  7.261   1.00 29.03  ? 119 ASP B CB  1 
ATOM   5001  C  CG  . ASP B  2  119 ? 20.751  37.403  8.283   1.00 27.98  ? 119 ASP B CG  1 
ATOM   5002  O  OD1 . ASP B  2  119 ? 20.600  36.210  7.902   1.00 29.06  ? 119 ASP B OD1 1 
ATOM   5003  O  OD2 . ASP B  2  119 ? 20.894  37.737  9.487   1.00 26.92  ? 119 ASP B OD2 1 
ATOM   5004  N  N   . SER B  2  120 ? 19.305  39.312  4.450   1.00 29.15  ? 120 SER B N   1 
ATOM   5005  C  CA  . SER B  2  120 ? 18.905  40.252  3.420   1.00 27.76  ? 120 SER B CA  1 
ATOM   5006  C  C   . SER B  2  120 ? 17.665  40.955  3.897   1.00 28.09  ? 120 SER B C   1 
ATOM   5007  O  O   . SER B  2  120 ? 16.605  40.322  4.040   1.00 30.71  ? 120 SER B O   1 
ATOM   5008  C  CB  . SER B  2  120 ? 18.649  39.543  2.125   1.00 27.31  ? 120 SER B CB  1 
ATOM   5009  O  OG  . SER B  2  120 ? 18.369  40.477  1.101   1.00 29.81  ? 120 SER B OG  1 
ATOM   5010  N  N   . TYR B  2  121 ? 17.829  42.244  4.191   1.00 25.98  ? 121 TYR B N   1 
ATOM   5011  C  CA  . TYR B  2  121 ? 16.808  43.087  4.764   1.00 26.27  ? 121 TYR B CA  1 
ATOM   5012  C  C   . TYR B  2  121 ? 16.496  44.253  3.869   1.00 27.72  ? 121 TYR B C   1 
ATOM   5013  O  O   . TYR B  2  121 ? 17.360  44.718  3.152   1.00 30.62  ? 121 TYR B O   1 
ATOM   5014  C  CB  . TYR B  2  121 ? 17.301  43.687  6.033   1.00 25.40  ? 121 TYR B CB  1 
ATOM   5015  C  CG  . TYR B  2  121 ? 17.182  42.857  7.268   1.00 27.36  ? 121 TYR B CG  1 
ATOM   5016  C  CD1 . TYR B  2  121 ? 18.157  41.881  7.606   1.00 29.47  ? 121 TYR B CD1 1 
ATOM   5017  C  CD2 . TYR B  2  121 ? 16.156  43.095  8.165   1.00 27.91  ? 121 TYR B CD2 1 
ATOM   5018  C  CE1 . TYR B  2  121 ? 18.068  41.159  8.804   1.00 29.00  ? 121 TYR B CE1 1 
ATOM   5019  C  CE2 . TYR B  2  121 ? 16.057  42.383  9.356   1.00 29.09  ? 121 TYR B CE2 1 
ATOM   5020  C  CZ  . TYR B  2  121 ? 16.998  41.423  9.671   1.00 29.57  ? 121 TYR B CZ  1 
ATOM   5021  O  OH  . TYR B  2  121 ? 16.839  40.782  10.878  1.00 31.30  ? 121 TYR B OH  1 
ATOM   5022  N  N   . MET B  2  122 ? 15.263  44.753  3.968   1.00 28.84  ? 122 MET B N   1 
ATOM   5023  C  CA  . MET B  2  122 ? 14.773  45.878  3.171   1.00 27.70  ? 122 MET B CA  1 
ATOM   5024  C  C   . MET B  2  122 ? 15.528  47.117  3.587   1.00 27.91  ? 122 MET B C   1 
ATOM   5025  O  O   . MET B  2  122 ? 15.706  47.301  4.776   1.00 27.31  ? 122 MET B O   1 
ATOM   5026  C  CB  . MET B  2  122 ? 13.281  46.123  3.447   1.00 28.95  ? 122 MET B CB  1 
ATOM   5027  C  CG  . MET B  2  122 ? 12.649  47.169  2.534   1.00 30.21  ? 122 MET B CG  1 
ATOM   5028  S  SD  . MET B  2  122 ? 10.937  47.592  2.846   1.00 31.37  ? 122 MET B SD  1 
ATOM   5029  C  CE  . MET B  2  122 ? 11.040  48.418  4.433   1.00 32.74  ? 122 MET B CE  1 
ATOM   5030  N  N   . ILE B  2  123 ? 15.950  47.957  2.626   1.00 28.32  ? 123 ILE B N   1 
ATOM   5031  C  CA  . ILE B  2  123 ? 16.505  49.263  2.952   1.00 28.98  ? 123 ILE B CA  1 
ATOM   5032  C  C   . ILE B  2  123 ? 15.330  50.109  3.426   1.00 30.93  ? 123 ILE B C   1 
ATOM   5033  O  O   . ILE B  2  123 ? 14.378  50.322  2.666   1.00 33.61  ? 123 ILE B O   1 
ATOM   5034  C  CB  . ILE B  2  123 ? 17.161  50.005  1.762   1.00 31.07  ? 123 ILE B CB  1 
ATOM   5035  C  CG1 . ILE B  2  123 ? 18.282  49.211  1.053   1.00 33.11  ? 123 ILE B CG1 1 
ATOM   5036  C  CG2 . ILE B  2  123 ? 17.743  51.335  2.215   1.00 31.45  ? 123 ILE B CG2 1 
ATOM   5037  C  CD1 . ILE B  2  123 ? 19.316  48.654  1.976   1.00 34.32  ? 123 ILE B CD1 1 
ATOM   5038  N  N   . PRO B  2  124 ? 15.386  50.618  4.669   1.00 31.80  ? 124 PRO B N   1 
ATOM   5039  C  CA  . PRO B  2  124 ? 14.384  51.605  5.058   1.00 32.69  ? 124 PRO B CA  1 
ATOM   5040  C  C   . PRO B  2  124 ? 14.371  52.841  4.160   1.00 33.91  ? 124 PRO B C   1 
ATOM   5041  O  O   . PRO B  2  124 ? 15.345  53.169  3.520   1.00 34.88  ? 124 PRO B O   1 
ATOM   5042  C  CB  . PRO B  2  124 ? 14.780  52.008  6.467   1.00 33.31  ? 124 PRO B CB  1 
ATOM   5043  C  CG  . PRO B  2  124 ? 15.898  51.107  6.883   1.00 32.78  ? 124 PRO B CG  1 
ATOM   5044  C  CD  . PRO B  2  124 ? 16.460  50.470  5.670   1.00 33.53  ? 124 PRO B CD  1 
ATOM   5045  N  N   . THR B  2  125 ? 13.228  53.492  4.107   1.00 39.99  ? 125 THR B N   1 
ATOM   5046  C  CA  . THR B  2  125 ? 12.970  54.615  3.203   1.00 39.71  ? 125 THR B CA  1 
ATOM   5047  C  C   . THR B  2  125 ? 13.884  55.819  3.508   1.00 39.64  ? 125 THR B C   1 
ATOM   5048  O  O   . THR B  2  125 ? 14.417  56.453  2.590   1.00 38.37  ? 125 THR B O   1 
ATOM   5049  C  CB  . THR B  2  125 ? 11.481  55.022  3.308   1.00 37.52  ? 125 THR B CB  1 
ATOM   5050  O  OG1 . THR B  2  125 ? 10.671  53.877  3.013   1.00 36.29  ? 125 THR B OG1 1 
ATOM   5051  C  CG2 . THR B  2  125 ? 11.146  56.154  2.329   1.00 38.32  ? 125 THR B CG2 1 
ATOM   5052  N  N   . SER B  2  126 ? 14.058  56.105  4.795   1.00 37.07  ? 126 SER B N   1 
ATOM   5053  C  CA  . SER B  2  126 ? 14.894  57.184  5.226   1.00 39.31  ? 126 SER B CA  1 
ATOM   5054  C  C   . SER B  2  126 ? 16.356  56.923  4.816   1.00 43.49  ? 126 SER B C   1 
ATOM   5055  O  O   . SER B  2  126 ? 17.067  57.856  4.477   1.00 49.48  ? 126 SER B O   1 
ATOM   5056  C  CB  . SER B  2  126 ? 14.761  57.352  6.725   1.00 38.40  ? 126 SER B CB  1 
ATOM   5057  O  OG  . SER B  2  126 ? 15.306  56.224  7.375   1.00 38.83  ? 126 SER B OG  1 
ATOM   5058  N  N   . GLU B  2  127 ? 16.780  55.660  4.783   1.00 42.23  ? 127 GLU B N   1 
ATOM   5059  C  CA  . GLU B  2  127 ? 18.146  55.305  4.398   1.00 39.73  ? 127 GLU B CA  1 
ATOM   5060  C  C   . GLU B  2  127 ? 18.389  55.051  2.908   1.00 37.36  ? 127 GLU B C   1 
ATOM   5061  O  O   . GLU B  2  127 ? 19.460  54.569  2.543   1.00 36.60  ? 127 GLU B O   1 
ATOM   5062  C  CB  . GLU B  2  127 ? 18.629  54.113  5.219   1.00 42.65  ? 127 GLU B CB  1 
ATOM   5063  C  CG  . GLU B  2  127 ? 18.756  54.450  6.700   1.00 49.71  ? 127 GLU B CG  1 
ATOM   5064  C  CD  . GLU B  2  127 ? 19.083  53.240  7.568   1.00 59.27  ? 127 GLU B CD  1 
ATOM   5065  O  OE1 . GLU B  2  127 ? 18.766  53.317  8.772   1.00 69.32  ? 127 GLU B OE1 1 
ATOM   5066  O  OE2 . GLU B  2  127 ? 19.641  52.224  7.063   1.00 60.34  ? 127 GLU B OE2 1 
ATOM   5067  N  N   . LEU B  2  128 ? 17.456  55.392  2.028   1.00 35.23  ? 128 LEU B N   1 
ATOM   5068  C  CA  . LEU B  2  128 ? 17.653  55.093  0.588   1.00 36.58  ? 128 LEU B CA  1 
ATOM   5069  C  C   . LEU B  2  128 ? 18.537  56.133  -0.113  1.00 37.86  ? 128 LEU B C   1 
ATOM   5070  O  O   . LEU B  2  128 ? 18.451  57.315  0.182   1.00 35.63  ? 128 LEU B O   1 
ATOM   5071  C  CB  . LEU B  2  128 ? 16.317  55.084  -0.151  1.00 37.12  ? 128 LEU B CB  1 
ATOM   5072  C  CG  . LEU B  2  128 ? 15.229  54.037  0.070   1.00 36.80  ? 128 LEU B CG  1 
ATOM   5073  C  CD1 . LEU B  2  128 ? 13.916  54.586  -0.480  1.00 38.11  ? 128 LEU B CD1 1 
ATOM   5074  C  CD2 . LEU B  2  128 ? 15.589  52.726  -0.631  1.00 37.15  ? 128 LEU B CD2 1 
ATOM   5075  N  N   . LYS B  2  129 ? 19.334  55.712  -1.081  1.00 40.14  ? 129 LYS B N   1 
ATOM   5076  C  CA  . LYS B  2  129 ? 20.121  56.665  -1.846  1.00 46.10  ? 129 LYS B CA  1 
ATOM   5077  C  C   . LYS B  2  129 ? 19.309  57.078  -3.062  1.00 44.60  ? 129 LYS B C   1 
ATOM   5078  O  O   . LYS B  2  129 ? 18.449  56.336  -3.460  1.00 46.31  ? 129 LYS B O   1 
ATOM   5079  C  CB  . LYS B  2  129 ? 21.432  56.049  -2.259  1.00 49.75  ? 129 LYS B CB  1 
ATOM   5080  C  CG  . LYS B  2  129 ? 22.294  55.693  -1.071  1.00 52.66  ? 129 LYS B CG  1 
ATOM   5081  C  CD  . LYS B  2  129 ? 23.410  54.749  -1.483  1.00 55.18  ? 129 LYS B CD  1 
ATOM   5082  C  CE  . LYS B  2  129 ? 24.151  54.225  -0.266  1.00 59.08  ? 129 LYS B CE  1 
ATOM   5083  N  NZ  . LYS B  2  129 ? 24.437  52.784  -0.498  1.00 65.00  ? 129 LYS B NZ  1 
ATOM   5084  N  N   . PRO B  2  130 ? 19.553  58.280  -3.627  1.00 46.87  ? 130 PRO B N   1 
ATOM   5085  C  CA  . PRO B  2  130 ? 18.727  58.765  -4.741  1.00 44.94  ? 130 PRO B CA  1 
ATOM   5086  C  C   . PRO B  2  130 ? 18.613  57.815  -5.915  1.00 41.30  ? 130 PRO B C   1 
ATOM   5087  O  O   . PRO B  2  130 ? 19.603  57.239  -6.365  1.00 39.02  ? 130 PRO B O   1 
ATOM   5088  C  CB  . PRO B  2  130 ? 19.421  60.053  -5.138  1.00 45.53  ? 130 PRO B CB  1 
ATOM   5089  C  CG  . PRO B  2  130 ? 19.828  60.603  -3.807  1.00 48.81  ? 130 PRO B CG  1 
ATOM   5090  C  CD  . PRO B  2  130 ? 20.321  59.398  -3.035  1.00 48.82  ? 130 PRO B CD  1 
ATOM   5091  N  N   . GLY B  2  131 ? 17.380  57.612  -6.356  1.00 37.14  ? 131 GLY B N   1 
ATOM   5092  C  CA  . GLY B  2  131 ? 17.108  56.616  -7.369  1.00 38.96  ? 131 GLY B CA  1 
ATOM   5093  C  C   . GLY B  2  131 ? 16.943  55.174  -6.924  1.00 35.58  ? 131 GLY B C   1 
ATOM   5094  O  O   . GLY B  2  131 ? 16.705  54.297  -7.769  1.00 34.39  ? 131 GLY B O   1 
ATOM   5095  N  N   . GLU B  2  132 ? 17.101  54.930  -5.627  1.00 33.87  ? 132 GLU B N   1 
ATOM   5096  C  CA  . GLU B  2  132 ? 16.762  53.661  -5.033  1.00 37.11  ? 132 GLU B CA  1 
ATOM   5097  C  C   . GLU B  2  132 ? 15.249  53.611  -4.813  1.00 35.46  ? 132 GLU B C   1 
ATOM   5098  O  O   . GLU B  2  132 ? 14.582  54.643  -4.765  1.00 32.97  ? 132 GLU B O   1 
ATOM   5099  C  CB  . GLU B  2  132 ? 17.541  53.419  -3.738  1.00 39.42  ? 132 GLU B CB  1 
ATOM   5100  C  CG  . GLU B  2  132 ? 19.008  53.142  -4.041  1.00 43.85  ? 132 GLU B CG  1 
ATOM   5101  C  CD  . GLU B  2  132 ? 19.798  52.508  -2.908  1.00 47.36  ? 132 GLU B CD  1 
ATOM   5102  O  OE1 . GLU B  2  132 ? 20.724  51.739  -3.266  1.00 50.82  ? 132 GLU B OE1 1 
ATOM   5103  O  OE2 . GLU B  2  132 ? 19.536  52.790  -1.700  1.00 45.94  ? 132 GLU B OE2 1 
ATOM   5104  N  N   . LEU B  2  133 ? 14.721  52.398  -4.779  1.00 33.61  ? 133 LEU B N   1 
ATOM   5105  C  CA  . LEU B  2  133 ? 13.265  52.180  -4.815  1.00 34.74  ? 133 LEU B CA  1 
ATOM   5106  C  C   . LEU B  2  133 ? 12.652  51.921  -3.471  1.00 30.98  ? 133 LEU B C   1 
ATOM   5107  O  O   . LEU B  2  133 ? 13.070  51.021  -2.762  1.00 28.86  ? 133 LEU B O   1 
ATOM   5108  C  CB  . LEU B  2  133 ? 12.955  51.032  -5.747  1.00 34.60  ? 133 LEU B CB  1 
ATOM   5109  C  CG  . LEU B  2  133 ? 13.213  51.476  -7.179  1.00 35.75  ? 133 LEU B CG  1 
ATOM   5110  C  CD1 . LEU B  2  133 ? 13.483  50.282  -8.034  1.00 37.62  ? 133 LEU B CD1 1 
ATOM   5111  C  CD2 . LEU B  2  133 ? 11.991  52.226  -7.690  1.00 40.35  ? 133 LEU B CD2 1 
ATOM   5112  N  N   . ARG B  2  134 ? 11.655  52.724  -3.130  1.00 29.36  ? 134 ARG B N   1 
ATOM   5113  C  CA  . ARG B  2  134 ? 10.958  52.552  -1.854  1.00 30.86  ? 134 ARG B CA  1 
ATOM   5114  C  C   . ARG B  2  134 ? 10.346  51.110  -1.794  1.00 31.27  ? 134 ARG B C   1 
ATOM   5115  O  O   . ARG B  2  134 ? 9.834   50.595  -2.801  1.00 27.71  ? 134 ARG B O   1 
ATOM   5116  C  CB  . ARG B  2  134 ? 9.899   53.638  -1.678  1.00 28.55  ? 134 ARG B CB  1 
ATOM   5117  C  CG  . ARG B  2  134 ? 9.505   53.898  -0.250  1.00 28.36  ? 134 ARG B CG  1 
ATOM   5118  C  CD  . ARG B  2  134 ? 8.442   54.967  -0.240  1.00 28.81  ? 134 ARG B CD  1 
ATOM   5119  N  NE  . ARG B  2  134 ? 7.230   54.469  -0.890  1.00 31.39  ? 134 ARG B NE  1 
ATOM   5120  C  CZ  . ARG B  2  134 ? 6.161   53.965  -0.265  1.00 31.39  ? 134 ARG B CZ  1 
ATOM   5121  N  NH1 . ARG B  2  134 ? 6.096   53.910  1.060   1.00 31.21  ? 134 ARG B NH1 1 
ATOM   5122  N  NH2 . ARG B  2  134 ? 5.124   53.537  -0.984  1.00 32.13  ? 134 ARG B NH2 1 
ATOM   5123  N  N   . LEU B  2  135 ? 10.557  50.457  -0.648  1.00 29.79  ? 135 LEU B N   1 
ATOM   5124  C  CA  . LEU B  2  135 ? 10.110  49.123  -0.352  1.00 29.09  ? 135 LEU B CA  1 
ATOM   5125  C  C   . LEU B  2  135 ? 10.711  47.947  -1.146  1.00 30.72  ? 135 LEU B C   1 
ATOM   5126  O  O   . LEU B  2  135 ? 10.336  46.768  -0.857  1.00 33.70  ? 135 LEU B O   1 
ATOM   5127  C  CB  . LEU B  2  135 ? 8.572   49.044  -0.440  1.00 28.20  ? 135 LEU B CB  1 
ATOM   5128  C  CG  . LEU B  2  135 ? 7.785   50.140  0.267   1.00 28.43  ? 135 LEU B CG  1 
ATOM   5129  C  CD1 . LEU B  2  135 ? 6.268   49.876  0.144   1.00 29.26  ? 135 LEU B CD1 1 
ATOM   5130  C  CD2 . LEU B  2  135 ? 8.241   50.312  1.724   1.00 25.88  ? 135 LEU B CD2 1 
ATOM   5131  N  N   . LEU B  2  136 ? 11.563  48.188  -2.143  1.00 28.14  ? 136 LEU B N   1 
ATOM   5132  C  CA  . LEU B  2  136 ? 12.079  47.055  -2.935  1.00 29.44  ? 136 LEU B CA  1 
ATOM   5133  C  C   . LEU B  2  136 ? 13.560  46.750  -2.718  1.00 32.09  ? 136 LEU B C   1 
ATOM   5134  O  O   . LEU B  2  136 ? 14.003  45.627  -3.020  1.00 30.27  ? 136 LEU B O   1 
ATOM   5135  C  CB  . LEU B  2  136 ? 11.843  47.272  -4.423  1.00 30.24  ? 136 LEU B CB  1 
ATOM   5136  C  CG  . LEU B  2  136 ? 10.420  47.330  -4.947  1.00 31.16  ? 136 LEU B CG  1 
ATOM   5137  C  CD1 . LEU B  2  136 ? 10.407  47.935  -6.329  1.00 28.85  ? 136 LEU B CD1 1 
ATOM   5138  C  CD2 . LEU B  2  136 ? 9.803   45.943  -4.951  1.00 34.02  ? 136 LEU B CD2 1 
ATOM   5139  N  N   . GLU B  2  137 ? 14.336  47.737  -2.254  1.00 32.16  ? 137 GLU B N   1 
ATOM   5140  C  CA  . GLU B  2  137 ? 15.783  47.558  -2.216  1.00 33.51  ? 137 GLU B CA  1 
ATOM   5141  C  C   . GLU B  2  137 ? 16.095  46.738  -0.992  1.00 32.90  ? 137 GLU B C   1 
ATOM   5142  O  O   . GLU B  2  137 ? 15.521  46.967  0.073   1.00 32.24  ? 137 GLU B O   1 
ATOM   5143  C  CB  . GLU B  2  137 ? 16.589  48.888  -2.111  1.00 32.84  ? 137 GLU B CB  1 
ATOM   5144  C  CG  . GLU B  2  137 ? 16.611  49.822  -3.298  1.00 31.80  ? 137 GLU B CG  1 
ATOM   5145  C  CD  . GLU B  2  137 ? 16.913  49.188  -4.660  1.00 32.80  ? 137 GLU B CD  1 
ATOM   5146  O  OE1 . GLU B  2  137 ? 17.563  48.137  -4.747  1.00 31.68  ? 137 GLU B OE1 1 
ATOM   5147  O  OE2 . GLU B  2  137 ? 16.478  49.769  -5.681  1.00 33.34  ? 137 GLU B OE2 1 
ATOM   5148  N  N   . VAL B  2  138 ? 17.044  45.820  -1.138  1.00 33.73  ? 138 VAL B N   1 
ATOM   5149  C  CA  . VAL B  2  138 ? 17.640  45.172  0.023   1.00 34.48  ? 138 VAL B CA  1 
ATOM   5150  C  C   . VAL B  2  138 ? 19.096  45.632  0.183   1.00 32.44  ? 138 VAL B C   1 
ATOM   5151  O  O   . VAL B  2  138 ? 19.697  46.115  -0.773  1.00 26.98  ? 138 VAL B O   1 
ATOM   5152  C  CB  . VAL B  2  138 ? 17.540  43.635  -0.062  1.00 34.61  ? 138 VAL B CB  1 
ATOM   5153  C  CG1 . VAL B  2  138 ? 16.075  43.205  -0.259  1.00 35.61  ? 138 VAL B CG1 1 
ATOM   5154  C  CG2 . VAL B  2  138 ? 18.432  43.081  -1.162  1.00 31.17  ? 138 VAL B CG2 1 
ATOM   5155  N  N   . ASP B  2  139 ? 19.623  45.442  1.393   1.00 31.44  ? 139 ASP B N   1 
ATOM   5156  C  CA  . ASP B  2  139 ? 21.024  45.721  1.724   1.00 31.41  ? 139 ASP B CA  1 
ATOM   5157  C  C   . ASP B  2  139 ? 21.974  44.721  1.101   1.00 32.77  ? 139 ASP B C   1 
ATOM   5158  O  O   . ASP B  2  139 ? 22.980  45.144  0.558   1.00 33.57  ? 139 ASP B O   1 
ATOM   5159  C  CB  . ASP B  2  139 ? 21.279  45.842  3.249   1.00 31.64  ? 139 ASP B CB  1 
ATOM   5160  C  CG  . ASP B  2  139 ? 20.864  44.605  4.044   1.00 32.94  ? 139 ASP B CG  1 
ATOM   5161  O  OD1 . ASP B  2  139 ? 20.484  43.571  3.480   1.00 34.47  ? 139 ASP B OD1 1 
ATOM   5162  O  OD2 . ASP B  2  139 ? 20.895  44.664  5.272   1.00 37.08  ? 139 ASP B OD2 1 
ATOM   5163  N  N   . ASN B  2  140 ? 21.651  43.415  1.141   1.00 34.23  ? 140 ASN B N   1 
ATOM   5164  C  CA  . ASN B  2  140 ? 22.506  42.379  0.561   1.00 33.56  ? 140 ASN B CA  1 
ATOM   5165  C  C   . ASN B  2  140 ? 21.701  41.606  -0.474  1.00 33.22  ? 140 ASN B C   1 
ATOM   5166  O  O   . ASN B  2  140 ? 20.828  40.817  -0.155  1.00 34.43  ? 140 ASN B O   1 
ATOM   5167  C  CB  . ASN B  2  140 ? 23.065  41.415  1.640   1.00 35.93  ? 140 ASN B CB  1 
ATOM   5168  C  CG  . ASN B  2  140 ? 23.941  42.108  2.688   1.00 38.21  ? 140 ASN B CG  1 
ATOM   5169  O  OD1 . ASN B  2  140 ? 24.597  43.111  2.414   1.00 42.89  ? 140 ASN B OD1 1 
ATOM   5170  N  ND2 . ASN B  2  140 ? 23.934  41.579  3.916   1.00 41.68  ? 140 ASN B ND2 1 
ATOM   5171  N  N   . ARG B  2  141 ? 22.030  41.795  -1.730  1.00 34.26  ? 141 ARG B N   1 
ATOM   5172  C  CA  . ARG B  2  141 ? 21.337  41.091  -2.810  1.00 35.86  ? 141 ARG B CA  1 
ATOM   5173  C  C   . ARG B  2  141 ? 21.757  39.629  -2.941  1.00 35.59  ? 141 ARG B C   1 
ATOM   5174  O  O   . ARG B  2  141 ? 22.741  39.181  -2.390  1.00 39.40  ? 141 ARG B O   1 
ATOM   5175  C  CB  . ARG B  2  141 ? 21.579  41.803  -4.146  1.00 36.36  ? 141 ARG B CB  1 
ATOM   5176  C  CG  . ARG B  2  141 ? 21.244  43.284  -4.092  1.00 35.31  ? 141 ARG B CG  1 
ATOM   5177  C  CD  . ARG B  2  141 ? 21.446  43.928  -5.440  1.00 34.77  ? 141 ARG B CD  1 
ATOM   5178  N  NE  . ARG B  2  141 ? 21.224  45.360  -5.272  1.00 34.60  ? 141 ARG B NE  1 
ATOM   5179  C  CZ  . ARG B  2  141 ? 21.882  46.331  -5.902  1.00 34.07  ? 141 ARG B CZ  1 
ATOM   5180  N  NH1 . ARG B  2  141 ? 22.838  46.086  -6.804  1.00 34.98  ? 141 ARG B NH1 1 
ATOM   5181  N  NH2 . ARG B  2  141 ? 21.548  47.580  -5.647  1.00 34.16  ? 141 ARG B NH2 1 
ATOM   5182  N  N   . VAL B  2  142 ? 20.983  38.913  -3.719  1.00 33.92  ? 142 VAL B N   1 
ATOM   5183  C  CA  . VAL B  2  142 ? 21.212  37.545  -3.999  1.00 32.97  ? 142 VAL B CA  1 
ATOM   5184  C  C   . VAL B  2  142 ? 21.953  37.560  -5.309  1.00 34.53  ? 142 VAL B C   1 
ATOM   5185  O  O   . VAL B  2  142 ? 21.334  37.637  -6.389  1.00 32.85  ? 142 VAL B O   1 
ATOM   5186  C  CB  . VAL B  2  142 ? 19.895  36.760  -4.175  1.00 32.49  ? 142 VAL B CB  1 
ATOM   5187  C  CG1 . VAL B  2  142 ? 20.162  35.268  -4.340  1.00 30.55  ? 142 VAL B CG1 1 
ATOM   5188  C  CG2 . VAL B  2  142 ? 19.001  37.005  -2.984  1.00 35.81  ? 142 VAL B CG2 1 
ATOM   5189  N  N   . VAL B  2  143 ? 23.274  37.429  -5.224  1.00 33.92  ? 143 VAL B N   1 
ATOM   5190  C  CA  . VAL B  2  143 ? 24.100  37.383  -6.428  1.00 31.04  ? 143 VAL B CA  1 
ATOM   5191  C  C   . VAL B  2  143 ? 24.065  35.943  -6.924  1.00 27.54  ? 143 VAL B C   1 
ATOM   5192  O  O   . VAL B  2  143 ? 24.161  35.038  -6.124  1.00 27.16  ? 143 VAL B O   1 
ATOM   5193  C  CB  . VAL B  2  143 ? 25.535  37.876  -6.130  1.00 32.37  ? 143 VAL B CB  1 
ATOM   5194  C  CG1 . VAL B  2  143 ? 26.365  37.955  -7.406  1.00 32.13  ? 143 VAL B CG1 1 
ATOM   5195  C  CG2 . VAL B  2  143 ? 25.479  39.231  -5.440  1.00 32.47  ? 143 VAL B CG2 1 
ATOM   5196  N  N   . LEU B  2  144 ? 23.867  35.768  -8.228  1.00 26.93  ? 144 LEU B N   1 
ATOM   5197  C  CA  . LEU B  2  144 ? 23.754  34.487  -8.872  1.00 29.76  ? 144 LEU B CA  1 
ATOM   5198  C  C   . LEU B  2  144 ? 24.344  34.626  -10.248 1.00 30.25  ? 144 LEU B C   1 
ATOM   5199  O  O   . LEU B  2  144 ? 24.297  35.715  -10.826 1.00 30.00  ? 144 LEU B O   1 
ATOM   5200  C  CB  . LEU B  2  144 ? 22.283  34.108  -9.085  1.00 32.78  ? 144 LEU B CB  1 
ATOM   5201  C  CG  . LEU B  2  144 ? 21.453  33.893  -7.835  1.00 37.77  ? 144 LEU B CG  1 
ATOM   5202  C  CD1 . LEU B  2  144 ? 19.967  33.859  -8.208  1.00 41.39  ? 144 LEU B CD1 1 
ATOM   5203  C  CD2 . LEU B  2  144 ? 21.929  32.625  -7.105  1.00 38.40  ? 144 LEU B CD2 1 
ATOM   5204  N  N   . PRO B  2  145 ? 24.844  33.523  -10.812 1.00 30.65  ? 145 PRO B N   1 
ATOM   5205  C  CA  . PRO B  2  145 ? 25.382  33.588  -12.158 1.00 33.00  ? 145 PRO B CA  1 
ATOM   5206  C  C   . PRO B  2  145 ? 24.276  33.582  -13.176 1.00 35.32  ? 145 PRO B C   1 
ATOM   5207  O  O   . PRO B  2  145 ? 23.376  32.760  -13.081 1.00 38.67  ? 145 PRO B O   1 
ATOM   5208  C  CB  . PRO B  2  145 ? 26.211  32.315  -12.281 1.00 34.64  ? 145 PRO B CB  1 
ATOM   5209  C  CG  . PRO B  2  145 ? 25.652  31.391  -11.252 1.00 34.45  ? 145 PRO B CG  1 
ATOM   5210  C  CD  . PRO B  2  145 ? 25.129  32.250  -10.148 1.00 32.57  ? 145 PRO B CD  1 
ATOM   5211  N  N   . MET B  2  146 ? 24.348  34.474  -14.149 1.00 35.64  ? 146 MET B N   1 
ATOM   5212  C  CA  . MET B  2  146 ? 23.415  34.474  -15.251 1.00 37.15  ? 146 MET B CA  1 
ATOM   5213  C  C   . MET B  2  146 ? 23.595  33.274  -16.162 1.00 37.01  ? 146 MET B C   1 
ATOM   5214  O  O   . MET B  2  146 ? 24.549  32.538  -16.030 1.00 36.32  ? 146 MET B O   1 
ATOM   5215  C  CB  . MET B  2  146 ? 23.529  35.751  -16.055 1.00 39.48  ? 146 MET B CB  1 
ATOM   5216  C  CG  . MET B  2  146 ? 24.794  35.871  -16.861 1.00 42.83  ? 146 MET B CG  1 
ATOM   5217  S  SD  . MET B  2  146 ? 24.990  37.539  -17.479 1.00 46.69  ? 146 MET B SD  1 
ATOM   5218  C  CE  . MET B  2  146 ? 26.226  37.206  -18.724 1.00 51.32  ? 146 MET B CE  1 
ATOM   5219  N  N   . GLU B  2  147 ? 22.633  33.076  -17.066 1.00 38.62  ? 147 GLU B N   1 
ATOM   5220  C  CA  . GLU B  2  147 ? 22.622  31.964  -18.039 1.00 39.51  ? 147 GLU B CA  1 
ATOM   5221  C  C   . GLU B  2  147 ? 22.935  30.563  -17.522 1.00 39.93  ? 147 GLU B C   1 
ATOM   5222  O  O   . GLU B  2  147 ? 23.359  29.710  -18.278 1.00 46.11  ? 147 GLU B O   1 
ATOM   5223  C  CB  . GLU B  2  147 ? 23.518  32.316  -19.223 1.00 40.78  ? 147 GLU B CB  1 
ATOM   5224  C  CG  . GLU B  2  147 ? 22.979  33.518  -19.994 1.00 46.28  ? 147 GLU B CG  1 
ATOM   5225  C  CD  . GLU B  2  147 ? 23.982  34.083  -20.975 1.00 46.28  ? 147 GLU B CD  1 
ATOM   5226  O  OE1 . GLU B  2  147 ? 23.649  34.167  -22.171 1.00 48.07  ? 147 GLU B OE1 1 
ATOM   5227  O  OE2 . GLU B  2  147 ? 25.091  34.453  -20.535 1.00 44.56  ? 147 GLU B OE2 1 
ATOM   5228  N  N   . MET B  2  148 ? 22.682  30.316  -16.246 1.00 43.77  ? 148 MET B N   1 
ATOM   5229  C  CA  . MET B  2  148 ? 22.982  29.048  -15.624 1.00 45.84  ? 148 MET B CA  1 
ATOM   5230  C  C   . MET B  2  148 ? 21.730  28.561  -14.928 1.00 46.15  ? 148 MET B C   1 
ATOM   5231  O  O   . MET B  2  148 ? 20.931  29.392  -14.451 1.00 43.40  ? 148 MET B O   1 
ATOM   5232  C  CB  . MET B  2  148 ? 24.117  29.213  -14.627 1.00 51.53  ? 148 MET B CB  1 
ATOM   5233  C  CG  . MET B  2  148 ? 25.470  29.241  -15.333 1.00 60.92  ? 148 MET B CG  1 
ATOM   5234  S  SD  . MET B  2  148 ? 26.965  29.022  -14.334 1.00 70.75  ? 148 MET B SD  1 
ATOM   5235  C  CE  . MET B  2  148 ? 26.374  28.242  -12.838 1.00 71.53  ? 148 MET B CE  1 
ATOM   5236  N  N   . THR B  2  149 ? 21.572  27.228  -14.892 1.00 40.78  ? 149 THR B N   1 
ATOM   5237  C  CA  . THR B  2  149 ? 20.488  26.571  -14.170 1.00 38.16  ? 149 THR B CA  1 
ATOM   5238  C  C   . THR B  2  149 ? 20.820  26.403  -12.665 1.00 39.01  ? 149 THR B C   1 
ATOM   5239  O  O   . THR B  2  149 ? 21.816  25.764  -12.273 1.00 36.77  ? 149 THR B O   1 
ATOM   5240  C  CB  . THR B  2  149 ? 20.083  25.248  -14.834 1.00 37.30  ? 149 THR B CB  1 
ATOM   5241  O  OG1 . THR B  2  149 ? 19.534  25.541  -16.111 1.00 39.11  ? 149 THR B OG1 1 
ATOM   5242  C  CG2 . THR B  2  149 ? 18.988  24.558  -14.065 1.00 38.56  ? 149 THR B CG2 1 
ATOM   5243  N  N   . ILE B  2  150 ? 19.955  27.003  -11.843 1.00 36.44  ? 150 ILE B N   1 
ATOM   5244  C  CA  . ILE B  2  150 ? 20.124  27.078  -10.410 1.00 36.21  ? 150 ILE B CA  1 
ATOM   5245  C  C   . ILE B  2  150 ? 18.965  26.380  -9.685  1.00 33.90  ? 150 ILE B C   1 
ATOM   5246  O  O   . ILE B  2  150 ? 17.801  26.605  -9.992  1.00 36.02  ? 150 ILE B O   1 
ATOM   5247  C  CB  . ILE B  2  150 ? 20.241  28.543  -10.009 1.00 36.04  ? 150 ILE B CB  1 
ATOM   5248  C  CG1 . ILE B  2  150 ? 21.427  29.142  -10.791 1.00 39.16  ? 150 ILE B CG1 1 
ATOM   5249  C  CG2 . ILE B  2  150 ? 20.409  28.701  -8.502  1.00 34.84  ? 150 ILE B CG2 1 
ATOM   5250  C  CD1 . ILE B  2  150 ? 21.763  30.558  -10.393 1.00 42.11  ? 150 ILE B CD1 1 
ATOM   5251  N  N   . ARG B  2  151 ? 19.302  25.511  -8.750  1.00 30.37  ? 151 ARG B N   1 
ATOM   5252  C  CA  . ARG B  2  151 ? 18.332  24.942  -7.881  1.00 33.47  ? 151 ARG B CA  1 
ATOM   5253  C  C   . ARG B  2  151 ? 18.147  25.876  -6.709  1.00 35.44  ? 151 ARG B C   1 
ATOM   5254  O  O   . ARG B  2  151 ? 19.090  26.115  -5.961  1.00 34.76  ? 151 ARG B O   1 
ATOM   5255  C  CB  . ARG B  2  151 ? 18.788  23.589  -7.377  1.00 35.48  ? 151 ARG B CB  1 
ATOM   5256  C  CG  . ARG B  2  151 ? 17.702  22.863  -6.613  1.00 34.56  ? 151 ARG B CG  1 
ATOM   5257  C  CD  . ARG B  2  151 ? 18.276  21.729  -5.817  1.00 35.48  ? 151 ARG B CD  1 
ATOM   5258  N  NE  . ARG B  2  151 ? 18.417  20.559  -6.663  1.00 35.35  ? 151 ARG B NE  1 
ATOM   5259  C  CZ  . ARG B  2  151 ? 19.552  19.971  -7.056  1.00 37.47  ? 151 ARG B CZ  1 
ATOM   5260  N  NH1 . ARG B  2  151 ? 20.775  20.430  -6.720  1.00 36.67  ? 151 ARG B NH1 1 
ATOM   5261  N  NH2 . ARG B  2  151 ? 19.456  18.881  -7.825  1.00 38.41  ? 151 ARG B NH2 1 
ATOM   5262  N  N   . MET B  2  152 ? 16.939  26.426  -6.564  1.00 35.61  ? 152 MET B N   1 
ATOM   5263  C  CA  . MET B  2  152 ? 16.576  27.174  -5.366  1.00 37.55  ? 152 MET B CA  1 
ATOM   5264  C  C   . MET B  2  152 ? 15.814  26.199  -4.464  1.00 35.65  ? 152 MET B C   1 
ATOM   5265  O  O   . MET B  2  152 ? 14.880  25.528  -4.931  1.00 35.36  ? 152 MET B O   1 
ATOM   5266  C  CB  . MET B  2  152 ? 15.717  28.369  -5.711  1.00 41.18  ? 152 MET B CB  1 
ATOM   5267  C  CG  . MET B  2  152 ? 16.459  29.461  -6.473  1.00 48.86  ? 152 MET B CG  1 
ATOM   5268  S  SD  . MET B  2  152 ? 17.650  30.429  -5.505  1.00 52.63  ? 152 MET B SD  1 
ATOM   5269  C  CE  . MET B  2  152 ? 16.903  30.567  -3.882  1.00 45.91  ? 152 MET B CE  1 
ATOM   5270  N  N   . LEU B  2  153 ? 16.240  26.101  -3.205  1.00 30.34  ? 153 LEU B N   1 
ATOM   5271  C  CA  . LEU B  2  153 ? 15.503  25.410  -2.171  1.00 30.62  ? 153 LEU B CA  1 
ATOM   5272  C  C   . LEU B  2  153 ? 14.965  26.449  -1.246  1.00 28.96  ? 153 LEU B C   1 
ATOM   5273  O  O   . LEU B  2  153 ? 15.723  27.246  -0.712  1.00 29.65  ? 153 LEU B O   1 
ATOM   5274  C  CB  . LEU B  2  153 ? 16.406  24.454  -1.381  1.00 32.29  ? 153 LEU B CB  1 
ATOM   5275  C  CG  . LEU B  2  153 ? 16.875  23.266  -2.225  1.00 33.40  ? 153 LEU B CG  1 
ATOM   5276  C  CD1 . LEU B  2  153 ? 17.952  22.502  -1.468  1.00 34.72  ? 153 LEU B CD1 1 
ATOM   5277  C  CD2 . LEU B  2  153 ? 15.693  22.377  -2.618  1.00 33.84  ? 153 LEU B CD2 1 
ATOM   5278  N  N   . VAL B  2  154 ? 13.658  26.431  -1.045  1.00 28.61  ? 154 VAL B N   1 
ATOM   5279  C  CA  . VAL B  2  154 ? 12.989  27.411  -0.221  1.00 28.56  ? 154 VAL B CA  1 
ATOM   5280  C  C   . VAL B  2  154 ? 12.437  26.730  0.995   1.00 28.66  ? 154 VAL B C   1 
ATOM   5281  O  O   . VAL B  2  154 ? 11.873  25.636  0.899   1.00 33.91  ? 154 VAL B O   1 
ATOM   5282  C  CB  . VAL B  2  154 ? 11.857  28.053  -1.009  1.00 29.35  ? 154 VAL B CB  1 
ATOM   5283  C  CG1 . VAL B  2  154 ? 11.144  29.095  -0.182  1.00 29.06  ? 154 VAL B CG1 1 
ATOM   5284  C  CG2 . VAL B  2  154 ? 12.423  28.652  -2.282  1.00 30.70  ? 154 VAL B CG2 1 
ATOM   5285  N  N   . SER B  2  155 ? 12.616  27.375  2.142   1.00 27.72  ? 155 SER B N   1 
ATOM   5286  C  CA  . SER B  2  155 ? 12.036  26.925  3.422   1.00 26.79  ? 155 SER B CA  1 
ATOM   5287  C  C   . SER B  2  155 ? 11.877  28.109  4.379   1.00 25.63  ? 155 SER B C   1 
ATOM   5288  O  O   . SER B  2  155 ? 12.169  29.226  3.999   1.00 22.74  ? 155 SER B O   1 
ATOM   5289  C  CB  . SER B  2  155 ? 12.840  25.786  4.069   1.00 25.27  ? 155 SER B CB  1 
ATOM   5290  O  OG  . SER B  2  155 ? 12.197  25.290  5.243   1.00 25.32  ? 155 SER B OG  1 
ATOM   5291  N  N   . SER B  2  156 ? 11.360  27.856  5.586   1.00 26.35  ? 156 SER B N   1 
ATOM   5292  C  CA  . SER B  2  156 ? 11.215  28.899  6.598   1.00 27.60  ? 156 SER B CA  1 
ATOM   5293  C  C   . SER B  2  156 ? 11.724  28.389  7.913   1.00 28.18  ? 156 SER B C   1 
ATOM   5294  O  O   . SER B  2  156 ? 11.767  27.197  8.141   1.00 28.50  ? 156 SER B O   1 
ATOM   5295  C  CB  . SER B  2  156 ? 9.761   29.327  6.742   1.00 26.08  ? 156 SER B CB  1 
ATOM   5296  O  OG  . SER B  2  156 ? 9.596   30.168  7.864   1.00 25.96  ? 156 SER B OG  1 
ATOM   5297  N  N   . GLU B  2  157 ? 12.152  29.307  8.758   1.00 29.82  ? 157 GLU B N   1 
ATOM   5298  C  CA  . GLU B  2  157 ? 12.531  28.975  10.104  1.00 32.78  ? 157 GLU B CA  1 
ATOM   5299  C  C   . GLU B  2  157 ? 11.504  29.438  11.094  1.00 32.19  ? 157 GLU B C   1 
ATOM   5300  O  O   . GLU B  2  157 ? 11.755  29.325  12.276  1.00 35.87  ? 157 GLU B O   1 
ATOM   5301  C  CB  . GLU B  2  157 ? 13.923  29.533  10.426  1.00 37.61  ? 157 GLU B CB  1 
ATOM   5302  C  CG  . GLU B  2  157 ? 14.995  28.442  10.276  1.00 45.74  ? 157 GLU B CG  1 
ATOM   5303  C  CD  . GLU B  2  157 ? 16.423  28.939  10.405  1.00 49.48  ? 157 GLU B CD  1 
ATOM   5304  O  OE1 . GLU B  2  157 ? 17.206  28.756  9.447   1.00 48.15  ? 157 GLU B OE1 1 
ATOM   5305  O  OE2 . GLU B  2  157 ? 16.750  29.521  11.471  1.00 58.14  ? 157 GLU B OE2 1 
ATOM   5306  N  N   . ASP B  2  158 ? 10.371  29.989  10.642  1.00 29.99  ? 158 ASP B N   1 
ATOM   5307  C  CA  . ASP B  2  158 ? 9.299   30.397  11.572  1.00 29.54  ? 158 ASP B CA  1 
ATOM   5308  C  C   . ASP B  2  158 ? 7.861   30.150  11.035  1.00 29.12  ? 158 ASP B C   1 
ATOM   5309  O  O   . ASP B  2  158 ? 7.359   29.061  11.204  1.00 31.58  ? 158 ASP B O   1 
ATOM   5310  C  CB  . ASP B  2  158 ? 9.519   31.821  12.183  1.00 28.03  ? 158 ASP B CB  1 
ATOM   5311  C  CG  . ASP B  2  158 ? 9.792   32.926  11.156  1.00 29.92  ? 158 ASP B CG  1 
ATOM   5312  O  OD1 . ASP B  2  158 ? 9.238   32.920  10.023  1.00 30.18  ? 158 ASP B OD1 1 
ATOM   5313  O  OD2 . ASP B  2  158 ? 10.512  33.883  11.539  1.00 29.18  ? 158 ASP B OD2 1 
ATOM   5314  N  N   . VAL B  2  159 ? 7.251   31.129  10.371  1.00 26.50  ? 159 VAL B N   1 
ATOM   5315  C  CA  . VAL B  2  159 ? 5.933   31.047  9.834   1.00 25.93  ? 159 VAL B CA  1 
ATOM   5316  C  C   . VAL B  2  159 ? 6.024   30.865  8.328   1.00 26.96  ? 159 VAL B C   1 
ATOM   5317  O  O   . VAL B  2  159 ? 7.106   30.725  7.788   1.00 24.43  ? 159 VAL B O   1 
ATOM   5318  C  CB  . VAL B  2  159 ? 5.150   32.311  10.158  1.00 26.27  ? 159 VAL B CB  1 
ATOM   5319  C  CG1 . VAL B  2  159 ? 5.000   32.461  11.656  1.00 25.24  ? 159 VAL B CG1 1 
ATOM   5320  C  CG2 . VAL B  2  159 ? 5.774   33.575  9.524   1.00 26.74  ? 159 VAL B CG2 1 
ATOM   5321  N  N   . LEU B  2  160 ? 4.884   30.828  7.643   1.00 28.59  ? 160 LEU B N   1 
ATOM   5322  C  CA  . LEU B  2  160 ? 4.918   30.679  6.188   1.00 28.85  ? 160 LEU B CA  1 
ATOM   5323  C  C   . LEU B  2  160 ? 5.419   31.981  5.596   1.00 26.11  ? 160 LEU B C   1 
ATOM   5324  O  O   . LEU B  2  160 ? 5.087   33.067  6.084   1.00 23.63  ? 160 LEU B O   1 
ATOM   5325  C  CB  . LEU B  2  160 ? 3.542   30.352  5.610   1.00 29.46  ? 160 LEU B CB  1 
ATOM   5326  C  CG  . LEU B  2  160 ? 2.830   29.136  6.207   1.00 31.88  ? 160 LEU B CG  1 
ATOM   5327  C  CD1 . LEU B  2  160 ? 1.459   28.978  5.545   1.00 32.39  ? 160 LEU B CD1 1 
ATOM   5328  C  CD2 . LEU B  2  160 ? 3.636   27.851  6.079   1.00 30.77  ? 160 LEU B CD2 1 
ATOM   5329  N  N   . HIS B  2  161 ? 6.247   31.867  4.575   1.00 23.84  ? 161 HIS B N   1 
ATOM   5330  C  CA  . HIS B  2  161 ? 6.538   33.001  3.716   1.00 23.64  ? 161 HIS B CA  1 
ATOM   5331  C  C   . HIS B  2  161 ? 6.374   32.447  2.352   1.00 21.86  ? 161 HIS B C   1 
ATOM   5332  O  O   . HIS B  2  161 ? 6.041   31.319  2.229   1.00 22.52  ? 161 HIS B O   1 
ATOM   5333  C  CB  . HIS B  2  161 ? 7.948   33.540  3.929   1.00 23.87  ? 161 HIS B CB  1 
ATOM   5334  C  CG  . HIS B  2  161 ? 8.215   33.962  5.330   1.00 22.39  ? 161 HIS B CG  1 
ATOM   5335  N  ND1 . HIS B  2  161 ? 7.926   35.236  5.789   1.00 25.44  ? 161 HIS B ND1 1 
ATOM   5336  C  CD2 . HIS B  2  161 ? 8.737   33.285  6.375   1.00 20.85  ? 161 HIS B CD2 1 
ATOM   5337  C  CE1 . HIS B  2  161 ? 8.247   35.314  7.069   1.00 21.72  ? 161 HIS B CE1 1 
ATOM   5338  N  NE2 . HIS B  2  161 ? 8.742   34.144  7.449   1.00 21.22  ? 161 HIS B NE2 1 
ATOM   5339  N  N   . SER B  2  162 ? 6.594   33.233  1.330   1.00 22.07  ? 162 SER B N   1 
ATOM   5340  C  CA  . SER B  2  162 ? 6.609   32.712  -0.006  1.00 23.76  ? 162 SER B CA  1 
ATOM   5341  C  C   . SER B  2  162 ? 7.605   33.542  -0.800  1.00 25.57  ? 162 SER B C   1 
ATOM   5342  O  O   . SER B  2  162 ? 7.525   34.779  -0.790  1.00 27.76  ? 162 SER B O   1 
ATOM   5343  C  CB  . SER B  2  162 ? 5.239   32.797  -0.647  1.00 22.48  ? 162 SER B CB  1 
ATOM   5344  O  OG  . SER B  2  162 ? 5.289   32.271  -1.959  1.00 21.74  ? 162 SER B OG  1 
ATOM   5345  N  N   . TRP B  2  163 ? 8.515   32.851  -1.491  1.00 27.39  ? 163 TRP B N   1 
ATOM   5346  C  CA  . TRP B  2  163 ? 9.621   33.472  -2.198  1.00 27.24  ? 163 TRP B CA  1 
ATOM   5347  C  C   . TRP B  2  163 ? 9.191   33.597  -3.627  1.00 27.44  ? 163 TRP B C   1 
ATOM   5348  O  O   . TRP B  2  163 ? 8.982   32.582  -4.291  1.00 28.70  ? 163 TRP B O   1 
ATOM   5349  C  CB  . TRP B  2  163 ? 10.863  32.604  -2.085  1.00 28.37  ? 163 TRP B CB  1 
ATOM   5350  C  CG  . TRP B  2  163 ? 12.135  33.284  -2.453  1.00 28.67  ? 163 TRP B CG  1 
ATOM   5351  C  CD1 . TRP B  2  163 ? 12.839  34.147  -1.682  1.00 30.23  ? 163 TRP B CD1 1 
ATOM   5352  C  CD2 . TRP B  2  163 ? 12.885  33.112  -3.654  1.00 28.26  ? 163 TRP B CD2 1 
ATOM   5353  N  NE1 . TRP B  2  163 ? 13.975  34.529  -2.324  1.00 29.88  ? 163 TRP B NE1 1 
ATOM   5354  C  CE2 . TRP B  2  163 ? 14.027  33.918  -3.544  1.00 28.33  ? 163 TRP B CE2 1 
ATOM   5355  C  CE3 . TRP B  2  163 ? 12.702  32.352  -4.811  1.00 29.69  ? 163 TRP B CE3 1 
ATOM   5356  C  CZ2 . TRP B  2  163 ? 14.989  34.002  -4.543  1.00 28.57  ? 163 TRP B CZ2 1 
ATOM   5357  C  CZ3 . TRP B  2  163 ? 13.658  32.440  -5.815  1.00 32.23  ? 163 TRP B CZ3 1 
ATOM   5358  C  CH2 . TRP B  2  163 ? 14.798  33.262  -5.667  1.00 30.10  ? 163 TRP B CH2 1 
ATOM   5359  N  N   . ALA B  2  164 ? 9.060   34.843  -4.082  1.00 27.28  ? 164 ALA B N   1 
ATOM   5360  C  CA  . ALA B  2  164 ? 8.544   35.163  -5.396  1.00 29.42  ? 164 ALA B CA  1 
ATOM   5361  C  C   . ALA B  2  164 ? 9.460   36.133  -6.104  1.00 28.02  ? 164 ALA B C   1 
ATOM   5362  O  O   . ALA B  2  164 ? 9.939   37.063  -5.481  1.00 29.37  ? 164 ALA B O   1 
ATOM   5363  C  CB  . ALA B  2  164 ? 7.154   35.811  -5.270  1.00 30.64  ? 164 ALA B CB  1 
ATOM   5364  N  N   . VAL B  2  165 ? 9.649   35.933  -7.410  1.00 26.86  ? 165 VAL B N   1 
ATOM   5365  C  CA  . VAL B  2  165 ? 10.274  36.905  -8.270  1.00 26.59  ? 165 VAL B CA  1 
ATOM   5366  C  C   . VAL B  2  165 ? 9.465   36.847  -9.566  1.00 25.55  ? 165 VAL B C   1 
ATOM   5367  O  O   . VAL B  2  165 ? 9.653   35.926  -10.358 1.00 25.93  ? 165 VAL B O   1 
ATOM   5368  C  CB  . VAL B  2  165 ? 11.784  36.589  -8.526  1.00 29.24  ? 165 VAL B CB  1 
ATOM   5369  C  CG1 . VAL B  2  165 ? 12.434  37.712  -9.306  1.00 30.61  ? 165 VAL B CG1 1 
ATOM   5370  C  CG2 . VAL B  2  165 ? 12.546  36.417  -7.221  1.00 30.52  ? 165 VAL B CG2 1 
ATOM   5371  N  N   . PRO B  2  166 ? 8.541   37.811  -9.782  1.00 26.44  ? 166 PRO B N   1 
ATOM   5372  C  CA  . PRO B  2  166 ? 7.629   37.754  -10.913 1.00 28.82  ? 166 PRO B CA  1 
ATOM   5373  C  C   . PRO B  2  166 ? 8.243   37.620  -12.297 1.00 29.24  ? 166 PRO B C   1 
ATOM   5374  O  O   . PRO B  2  166 ? 7.756   36.820  -13.129 1.00 30.56  ? 166 PRO B O   1 
ATOM   5375  C  CB  . PRO B  2  166 ? 6.874   39.064  -10.793 1.00 28.31  ? 166 PRO B CB  1 
ATOM   5376  C  CG  . PRO B  2  166 ? 6.745   39.220  -9.358  1.00 27.80  ? 166 PRO B CG  1 
ATOM   5377  C  CD  . PRO B  2  166 ? 8.058   38.784  -8.799  1.00 26.73  ? 166 PRO B CD  1 
ATOM   5378  N  N   . SER B  2  167 ? 9.282   38.408  -12.548 1.00 30.90  ? 167 SER B N   1 
ATOM   5379  C  CA  . SER B  2  167 ? 9.892   38.469  -13.889 1.00 30.54  ? 167 SER B CA  1 
ATOM   5380  C  C   . SER B  2  167 ? 10.575  37.182  -14.311 1.00 28.85  ? 167 SER B C   1 
ATOM   5381  O  O   . SER B  2  167 ? 10.733  36.956  -15.505 1.00 33.16  ? 167 SER B O   1 
ATOM   5382  C  CB  . SER B  2  167 ? 10.831  39.703  -14.004 1.00 33.51  ? 167 SER B CB  1 
ATOM   5383  O  OG  . SER B  2  167 ? 11.973  39.632  -13.171 1.00 33.71  ? 167 SER B OG  1 
ATOM   5384  N  N   . LEU B  2  168 ? 10.940  36.329  -13.354 1.00 29.47  ? 168 LEU B N   1 
ATOM   5385  C  CA  . LEU B  2  168 ? 11.480  34.968  -13.627 1.00 31.49  ? 168 LEU B CA  1 
ATOM   5386  C  C   . LEU B  2  168 ? 10.452  33.841  -13.571 1.00 31.61  ? 168 LEU B C   1 
ATOM   5387  O  O   . LEU B  2  168 ? 10.808  32.687  -13.799 1.00 30.90  ? 168 LEU B O   1 
ATOM   5388  C  CB  . LEU B  2  168 ? 12.636  34.612  -12.654 1.00 33.83  ? 168 LEU B CB  1 
ATOM   5389  C  CG  . LEU B  2  168 ? 14.025  35.247  -12.894 1.00 35.01  ? 168 LEU B CG  1 
ATOM   5390  C  CD1 . LEU B  2  168 ? 13.994  36.754  -12.675 1.00 36.05  ? 168 LEU B CD1 1 
ATOM   5391  C  CD2 . LEU B  2  168 ? 15.017  34.635  -11.937 1.00 36.73  ? 168 LEU B CD2 1 
ATOM   5392  N  N   . GLY B  2  169 ? 9.200   34.161  -13.220 1.00 30.44  ? 169 GLY B N   1 
ATOM   5393  C  CA  . GLY B  2  169 ? 8.135   33.194  -13.215 1.00 28.07  ? 169 GLY B CA  1 
ATOM   5394  C  C   . GLY B  2  169 ? 8.184   32.319  -12.003 1.00 28.23  ? 169 GLY B C   1 
ATOM   5395  O  O   . GLY B  2  169 ? 7.838   31.155  -12.098 1.00 27.37  ? 169 GLY B O   1 
ATOM   5396  N  N   . LEU B  2  170 ? 8.586   32.883  -10.858 1.00 28.58  ? 170 LEU B N   1 
ATOM   5397  C  CA  . LEU B  2  170 ? 8.814   32.087  -9.637  1.00 30.84  ? 170 LEU B CA  1 
ATOM   5398  C  C   . LEU B  2  170 ? 7.944   32.473  -8.458  1.00 28.48  ? 170 LEU B C   1 
ATOM   5399  O  O   . LEU B  2  170 ? 7.784   33.632  -8.135  1.00 25.65  ? 170 LEU B O   1 
ATOM   5400  C  CB  . LEU B  2  170 ? 10.276  32.192  -9.152  1.00 33.87  ? 170 LEU B CB  1 
ATOM   5401  C  CG  . LEU B  2  170 ? 11.369  31.896  -10.163 1.00 36.56  ? 170 LEU B CG  1 
ATOM   5402  C  CD1 . LEU B  2  170 ? 12.720  32.241  -9.535  1.00 39.61  ? 170 LEU B CD1 1 
ATOM   5403  C  CD2 . LEU B  2  170 ? 11.316  30.452  -10.612 1.00 35.77  ? 170 LEU B CD2 1 
ATOM   5404  N  N   . LYS B  2  171 ? 7.437   31.456  -7.792  1.00 29.70  ? 171 LYS B N   1 
ATOM   5405  C  CA  . LYS B  2  171 ? 6.721   31.632  -6.549  1.00 31.54  ? 171 LYS B CA  1 
ATOM   5406  C  C   . LYS B  2  171 ? 6.656   30.279  -5.870  1.00 29.33  ? 171 LYS B C   1 
ATOM   5407  O  O   . LYS B  2  171 ? 6.057   29.347  -6.413  1.00 31.71  ? 171 LYS B O   1 
ATOM   5408  C  CB  . LYS B  2  171 ? 5.298   32.185  -6.759  1.00 30.06  ? 171 LYS B CB  1 
ATOM   5409  C  CG  . LYS B  2  171 ? 4.723   32.667  -5.450  1.00 29.59  ? 171 LYS B CG  1 
ATOM   5410  C  CD  . LYS B  2  171 ? 3.379   33.323  -5.642  1.00 31.24  ? 171 LYS B CD  1 
ATOM   5411  C  CE  . LYS B  2  171 ? 3.474   34.783  -6.010  1.00 30.63  ? 171 LYS B CE  1 
ATOM   5412  N  NZ  . LYS B  2  171 ? 2.765   34.971  -7.277  1.00 33.59  ? 171 LYS B NZ  1 
ATOM   5413  N  N   . THR B  2  172 ? 7.263   30.194  -4.691  1.00 27.43  ? 172 THR B N   1 
ATOM   5414  C  CA  . THR B  2  172 ? 7.389   28.949  -3.967  1.00 27.82  ? 172 THR B CA  1 
ATOM   5415  C  C   . THR B  2  172 ? 7.225   29.324  -2.537  1.00 26.69  ? 172 THR B C   1 
ATOM   5416  O  O   . THR B  2  172 ? 7.940   30.180  -2.017  1.00 26.45  ? 172 THR B O   1 
ATOM   5417  C  CB  . THR B  2  172 ? 8.777   28.304  -4.189  1.00 29.77  ? 172 THR B CB  1 
ATOM   5418  O  OG1 . THR B  2  172 ? 8.936   27.988  -5.590  1.00 33.48  ? 172 THR B OG1 1 
ATOM   5419  C  CG2 . THR B  2  172 ? 8.907   27.040  -3.395  1.00 29.16  ? 172 THR B CG2 1 
ATOM   5420  N  N   . ASP B  2  173 ? 6.248   28.710  -1.902  1.00 26.57  ? 173 ASP B N   1 
ATOM   5421  C  CA  . ASP B  2  173 ? 6.007   28.962  -0.516  1.00 27.32  ? 173 ASP B CA  1 
ATOM   5422  C  C   . ASP B  2  173 ? 7.130   28.404  0.344   1.00 25.83  ? 173 ASP B C   1 
ATOM   5423  O  O   . ASP B  2  173 ? 7.727   27.338  0.050   1.00 24.38  ? 173 ASP B O   1 
ATOM   5424  C  CB  . ASP B  2  173 ? 4.656   28.380  -0.082  1.00 29.73  ? 173 ASP B CB  1 
ATOM   5425  C  CG  . ASP B  2  173 ? 3.476   29.188  -0.595  1.00 29.72  ? 173 ASP B CG  1 
ATOM   5426  O  OD1 . ASP B  2  173 ? 3.643   30.111  -1.421  1.00 29.18  ? 173 ASP B OD1 1 
ATOM   5427  O  OD2 . ASP B  2  173 ? 2.365   28.877  -0.168  1.00 30.77  ? 173 ASP B OD2 1 
ATOM   5428  N  N   . ALA B  2  174 ? 7.381   29.141  1.416   1.00 25.01  ? 174 ALA B N   1 
ATOM   5429  C  CA  . ALA B  2  174 ? 8.434   28.852  2.378   1.00 25.99  ? 174 ALA B CA  1 
ATOM   5430  C  C   . ALA B  2  174 ? 7.758   28.309  3.622   1.00 25.45  ? 174 ALA B C   1 
ATOM   5431  O  O   . ALA B  2  174 ? 7.091   29.038  4.364   1.00 24.10  ? 174 ALA B O   1 
ATOM   5432  C  CB  . ALA B  2  174 ? 9.239   30.109  2.697   1.00 26.33  ? 174 ALA B CB  1 
ATOM   5433  N  N   . ILE B  2  175 ? 7.925   27.002  3.818   1.00 27.18  ? 175 ILE B N   1 
ATOM   5434  C  CA  . ILE B  2  175 ? 7.237   26.246  4.851   1.00 27.36  ? 175 ILE B CA  1 
ATOM   5435  C  C   . ILE B  2  175 ? 8.255   25.573  5.813   1.00 26.02  ? 175 ILE B C   1 
ATOM   5436  O  O   . ILE B  2  175 ? 9.059   24.745  5.353   1.00 25.44  ? 175 ILE B O   1 
ATOM   5437  C  CB  . ILE B  2  175 ? 6.388   25.144  4.161   1.00 28.20  ? 175 ILE B CB  1 
ATOM   5438  C  CG1 . ILE B  2  175 ? 5.362   25.776  3.224   1.00 28.67  ? 175 ILE B CG1 1 
ATOM   5439  C  CG2 . ILE B  2  175 ? 5.721   24.261  5.224   1.00 28.29  ? 175 ILE B CG2 1 
ATOM   5440  C  CD1 . ILE B  2  175 ? 4.952   24.881  2.093   1.00 30.24  ? 175 ILE B CD1 1 
ATOM   5441  N  N   . PRO B  2  176 ? 8.178   25.868  7.134   1.00 25.94  ? 176 PRO B N   1 
ATOM   5442  C  CA  . PRO B  2  176 ? 9.055   25.219  8.099   1.00 25.57  ? 176 PRO B CA  1 
ATOM   5443  C  C   . PRO B  2  176 ? 8.968   23.701  8.047   1.00 27.04  ? 176 PRO B C   1 
ATOM   5444  O  O   . PRO B  2  176 ? 7.871   23.149  7.915   1.00 28.94  ? 176 PRO B O   1 
ATOM   5445  C  CB  . PRO B  2  176 ? 8.566   25.707  9.458   1.00 25.31  ? 176 PRO B CB  1 
ATOM   5446  C  CG  . PRO B  2  176 ? 7.569   26.760  9.210   1.00 27.83  ? 176 PRO B CG  1 
ATOM   5447  C  CD  . PRO B  2  176 ? 7.105   26.636  7.803   1.00 28.66  ? 176 PRO B CD  1 
ATOM   5448  N  N   . GLY B  2  177 ? 10.132  23.057  8.121   1.00 26.40  ? 177 GLY B N   1 
ATOM   5449  C  CA  . GLY B  2  177 ? 10.237  21.622  8.159   1.00 25.69  ? 177 GLY B CA  1 
ATOM   5450  C  C   . GLY B  2  177 ? 10.144  21.020  6.794   1.00 26.34  ? 177 GLY B C   1 
ATOM   5451  O  O   . GLY B  2  177 ? 10.173  19.826  6.660   1.00 29.51  ? 177 GLY B O   1 
ATOM   5452  N  N   . ARG B  2  178 ? 10.083  21.848  5.762   1.00 28.02  ? 178 ARG B N   1 
ATOM   5453  C  CA  . ARG B  2  178 ? 9.962   21.373  4.400   1.00 26.90  ? 178 ARG B CA  1 
ATOM   5454  C  C   . ARG B  2  178 ? 10.897  22.172  3.517   1.00 28.21  ? 178 ARG B C   1 
ATOM   5455  O  O   . ARG B  2  178 ? 11.137  23.385  3.719   1.00 26.57  ? 178 ARG B O   1 
ATOM   5456  C  CB  . ARG B  2  178 ? 8.539   21.609  3.937   1.00 27.70  ? 178 ARG B CB  1 
ATOM   5457  C  CG  . ARG B  2  178 ? 8.158   20.958  2.634   1.00 26.98  ? 178 ARG B CG  1 
ATOM   5458  C  CD  . ARG B  2  178 ? 6.962   21.661  2.060   1.00 27.83  ? 178 ARG B CD  1 
ATOM   5459  N  NE  . ARG B  2  178 ? 6.480   20.952  0.881   1.00 31.34  ? 178 ARG B NE  1 
ATOM   5460  C  CZ  . ARG B  2  178 ? 5.474   20.071  0.837   1.00 31.69  ? 178 ARG B CZ  1 
ATOM   5461  N  NH1 . ARG B  2  178 ? 4.771   19.748  1.907   1.00 33.19  ? 178 ARG B NH1 1 
ATOM   5462  N  NH2 . ARG B  2  178 ? 5.147   19.529  -0.322  1.00 33.69  ? 178 ARG B NH2 1 
ATOM   5463  N  N   . LEU B  2  179 ? 11.360  21.478  2.494   1.00 29.18  ? 179 LEU B N   1 
ATOM   5464  C  CA  . LEU B  2  179 ? 12.313  21.984  1.577   1.00 31.81  ? 179 LEU B CA  1 
ATOM   5465  C  C   . LEU B  2  179 ? 11.674  21.914  0.203   1.00 31.87  ? 179 LEU B C   1 
ATOM   5466  O  O   . LEU B  2  179 ? 11.617  20.845  -0.399  1.00 33.15  ? 179 LEU B O   1 
ATOM   5467  C  CB  . LEU B  2  179 ? 13.542  21.089  1.682   1.00 33.56  ? 179 LEU B CB  1 
ATOM   5468  C  CG  . LEU B  2  179 ? 14.919  21.663  1.501   1.00 38.32  ? 179 LEU B CG  1 
ATOM   5469  C  CD1 . LEU B  2  179 ? 15.179  22.744  2.550   1.00 38.95  ? 179 LEU B CD1 1 
ATOM   5470  C  CD2 . LEU B  2  179 ? 15.927  20.512  1.605   1.00 39.02  ? 179 LEU B CD2 1 
ATOM   5471  N  N   . ASN B  2  180 ? 11.189  23.060  -0.283  1.00 31.34  ? 180 ASN B N   1 
ATOM   5472  C  CA  . ASN B  2  180 ? 10.577  23.154  -1.607  1.00 30.93  ? 180 ASN B CA  1 
ATOM   5473  C  C   . ASN B  2  180 ? 11.579  23.593  -2.642  1.00 30.16  ? 180 ASN B C   1 
ATOM   5474  O  O   . ASN B  2  180 ? 12.263  24.576  -2.457  1.00 32.04  ? 180 ASN B O   1 
ATOM   5475  C  CB  . ASN B  2  180 ? 9.438   24.176  -1.618  1.00 32.47  ? 180 ASN B CB  1 
ATOM   5476  C  CG  . ASN B  2  180 ? 8.110   23.618  -1.110  1.00 33.17  ? 180 ASN B CG  1 
ATOM   5477  O  OD1 . ASN B  2  180 ? 7.869   22.400  -1.073  1.00 31.66  ? 180 ASN B OD1 1 
ATOM   5478  N  ND2 . ASN B  2  180 ? 7.208   24.532  -0.785  1.00 32.25  ? 180 ASN B ND2 1 
ATOM   5479  N  N   . GLN B  2  181 ? 11.602  22.886  -3.759  1.00 30.14  ? 181 GLN B N   1 
ATOM   5480  C  CA  . GLN B  2  181 ? 12.499  23.150  -4.871  1.00 31.47  ? 181 GLN B CA  1 
ATOM   5481  C  C   . GLN B  2  181 ? 11.809  23.885  -5.973  1.00 31.78  ? 181 GLN B C   1 
ATOM   5482  O  O   . GLN B  2  181 ? 10.701  23.539  -6.356  1.00 35.64  ? 181 GLN B O   1 
ATOM   5483  C  CB  . GLN B  2  181 ? 12.983  21.824  -5.453  1.00 33.03  ? 181 GLN B CB  1 
ATOM   5484  C  CG  . GLN B  2  181 ? 13.946  21.907  -6.630  1.00 32.99  ? 181 GLN B CG  1 
ATOM   5485  C  CD  . GLN B  2  181 ? 14.553  20.544  -6.915  1.00 32.65  ? 181 GLN B CD  1 
ATOM   5486  O  OE1 . GLN B  2  181 ? 15.631  20.234  -6.466  1.00 33.54  ? 181 GLN B OE1 1 
ATOM   5487  N  NE2 . GLN B  2  181 ? 13.815  19.709  -7.573  1.00 34.84  ? 181 GLN B NE2 1 
ATOM   5488  N  N   . THR B  2  182 ? 12.490  24.877  -6.517  1.00 31.49  ? 182 THR B N   1 
ATOM   5489  C  CA  . THR B  2  182 ? 12.159  25.427  -7.823  1.00 30.03  ? 182 THR B CA  1 
ATOM   5490  C  C   . THR B  2  182 ? 13.469  25.712  -8.548  1.00 32.80  ? 182 THR B C   1 
ATOM   5491  O  O   . THR B  2  182 ? 14.548  25.646  -7.959  1.00 35.96  ? 182 THR B O   1 
ATOM   5492  C  CB  . THR B  2  182 ? 11.314  26.696  -7.720  1.00 28.61  ? 182 THR B CB  1 
ATOM   5493  O  OG1 . THR B  2  182 ? 10.886  27.067  -9.036  1.00 30.26  ? 182 THR B OG1 1 
ATOM   5494  C  CG2 . THR B  2  182 ? 12.096  27.840  -7.106  1.00 27.12  ? 182 THR B CG2 1 
ATOM   5495  N  N   . THR B  2  183 ? 13.377  25.983  -9.831  1.00 35.74  ? 183 THR B N   1 
ATOM   5496  C  CA  . THR B  2  183 ? 14.544  26.141  -10.658 1.00 39.66  ? 183 THR B CA  1 
ATOM   5497  C  C   . THR B  2  183 ? 14.480  27.519  -11.260 1.00 40.50  ? 183 THR B C   1 
ATOM   5498  O  O   . THR B  2  183 ? 13.414  28.033  -11.547 1.00 39.97  ? 183 THR B O   1 
ATOM   5499  C  CB  . THR B  2  183 ? 14.676  25.031  -11.722 1.00 43.14  ? 183 THR B CB  1 
ATOM   5500  O  OG1 . THR B  2  183 ? 13.441  24.363  -11.864 1.00 53.08  ? 183 THR B OG1 1 
ATOM   5501  C  CG2 . THR B  2  183 ? 15.626  23.942  -11.253 1.00 51.34  ? 183 THR B CG2 1 
ATOM   5502  N  N   . LEU B  2  184 ? 15.659  28.106  -11.418 1.00 44.05  ? 184 LEU B N   1 
ATOM   5503  C  CA  . LEU B  2  184 ? 15.846  29.501  -11.798 1.00 42.59  ? 184 LEU B CA  1 
ATOM   5504  C  C   . LEU B  2  184 ? 16.858  29.528  -12.958 1.00 39.92  ? 184 LEU B C   1 
ATOM   5505  O  O   . LEU B  2  184 ? 17.864  28.825  -12.935 1.00 39.18  ? 184 LEU B O   1 
ATOM   5506  C  CB  . LEU B  2  184 ? 16.340  30.234  -10.559 1.00 43.10  ? 184 LEU B CB  1 
ATOM   5507  C  CG  . LEU B  2  184 ? 16.565  31.728  -10.570 1.00 46.98  ? 184 LEU B CG  1 
ATOM   5508  C  CD1 . LEU B  2  184 ? 16.592  32.257  -9.144  1.00 49.70  ? 184 LEU B CD1 1 
ATOM   5509  C  CD2 . LEU B  2  184 ? 17.850  32.090  -11.313 1.00 49.76  ? 184 LEU B CD2 1 
ATOM   5510  N  N   . MET B  2  185 ? 16.552  30.296  -13.985 1.00 39.85  ? 185 MET B N   1 
ATOM   5511  C  CA  . MET B  2  185 ? 17.376  30.396  -15.167 1.00 42.19  ? 185 MET B CA  1 
ATOM   5512  C  C   . MET B  2  185 ? 17.156  31.796  -15.705 1.00 41.19  ? 185 MET B C   1 
ATOM   5513  O  O   . MET B  2  185 ? 16.168  32.049  -16.333 1.00 43.67  ? 185 MET B O   1 
ATOM   5514  C  CB  . MET B  2  185 ? 16.952  29.339  -16.186 1.00 46.66  ? 185 MET B CB  1 
ATOM   5515  C  CG  . MET B  2  185 ? 18.078  28.657  -16.953 1.00 56.83  ? 185 MET B CG  1 
ATOM   5516  S  SD  . MET B  2  185 ? 19.068  29.686  -18.061 1.00 60.46  ? 185 MET B SD  1 
ATOM   5517  C  CE  . MET B  2  185 ? 17.800  30.470  -19.054 1.00 65.16  ? 185 MET B CE  1 
ATOM   5518  N  N   . SER B  2  186 ? 18.053  32.725  -15.419 1.00 43.72  ? 186 SER B N   1 
ATOM   5519  C  CA  . SER B  2  186 ? 17.977  34.049  -16.034 1.00 43.77  ? 186 SER B CA  1 
ATOM   5520  C  C   . SER B  2  186 ? 18.664  34.150  -17.396 1.00 41.77  ? 186 SER B C   1 
ATOM   5521  O  O   . SER B  2  186 ? 19.851  33.901  -17.515 1.00 51.58  ? 186 SER B O   1 
ATOM   5522  C  CB  . SER B  2  186 ? 18.578  35.094  -15.134 1.00 45.06  ? 186 SER B CB  1 
ATOM   5523  O  OG  . SER B  2  186 ? 18.251  36.358  -15.667 1.00 45.19  ? 186 SER B OG  1 
ATOM   5524  N  N   . SER B  2  187 ? 17.922  34.587  -18.399 1.00 39.41  ? 187 SER B N   1 
ATOM   5525  C  CA  . SER B  2  187 ? 18.481  34.828  -19.715 1.00 37.00  ? 187 SER B CA  1 
ATOM   5526  C  C   . SER B  2  187 ? 19.336  36.062  -19.798 1.00 35.47  ? 187 SER B C   1 
ATOM   5527  O  O   . SER B  2  187 ? 20.063  36.197  -20.756 1.00 34.89  ? 187 SER B O   1 
ATOM   5528  C  CB  . SER B  2  187 ? 17.385  34.903  -20.745 1.00 36.22  ? 187 SER B CB  1 
ATOM   5529  O  OG  . SER B  2  187 ? 16.812  33.607  -20.841 1.00 39.54  ? 187 SER B OG  1 
ATOM   5530  N  N   . ARG B  2  188 ? 19.302  36.919  -18.775 1.00 34.13  ? 188 ARG B N   1 
ATOM   5531  C  CA  . ARG B  2  188 ? 19.933  38.232  -18.818 1.00 32.60  ? 188 ARG B CA  1 
ATOM   5532  C  C   . ARG B  2  188 ? 20.527  38.627  -17.479 1.00 35.08  ? 188 ARG B C   1 
ATOM   5533  O  O   . ARG B  2  188 ? 20.023  38.214  -16.439 1.00 40.32  ? 188 ARG B O   1 
ATOM   5534  C  CB  . ARG B  2  188 ? 18.895  39.287  -19.199 1.00 30.20  ? 188 ARG B CB  1 
ATOM   5535  C  CG  . ARG B  2  188 ? 18.242  39.064  -20.550 1.00 29.60  ? 188 ARG B CG  1 
ATOM   5536  C  CD  . ARG B  2  188 ? 17.613  40.333  -21.118 1.00 29.53  ? 188 ARG B CD  1 
ATOM   5537  N  NE  . ARG B  2  188 ? 16.890  41.107  -20.110 1.00 30.53  ? 188 ARG B NE  1 
ATOM   5538  C  CZ  . ARG B  2  188 ? 15.633  40.880  -19.714 1.00 31.93  ? 188 ARG B CZ  1 
ATOM   5539  N  NH1 . ARG B  2  188 ? 14.923  39.863  -20.201 1.00 31.54  ? 188 ARG B NH1 1 
ATOM   5540  N  NH2 . ARG B  2  188 ? 15.100  41.655  -18.786 1.00 31.29  ? 188 ARG B NH2 1 
ATOM   5541  N  N   . PRO B  2  189 ? 21.566  39.477  -17.488 1.00 34.12  ? 189 PRO B N   1 
ATOM   5542  C  CA  . PRO B  2  189 ? 22.056  40.024  -16.227 1.00 31.53  ? 189 PRO B CA  1 
ATOM   5543  C  C   . PRO B  2  189 ? 21.113  41.064  -15.717 1.00 28.51  ? 189 PRO B C   1 
ATOM   5544  O  O   . PRO B  2  189 ? 20.283  41.499  -16.450 1.00 31.09  ? 189 PRO B O   1 
ATOM   5545  C  CB  . PRO B  2  189 ? 23.354  40.730  -16.636 1.00 31.35  ? 189 PRO B CB  1 
ATOM   5546  C  CG  . PRO B  2  189 ? 23.082  41.169  -18.027 1.00 32.95  ? 189 PRO B CG  1 
ATOM   5547  C  CD  . PRO B  2  189 ? 22.306  40.030  -18.640 1.00 35.03  ? 189 PRO B CD  1 
ATOM   5548  N  N   . GLY B  2  190 ? 21.289  41.501  -14.485 1.00 28.23  ? 190 GLY B N   1 
ATOM   5549  C  CA  . GLY B  2  190 ? 20.606  42.667  -14.000 1.00 28.67  ? 190 GLY B CA  1 
ATOM   5550  C  C   . GLY B  2  190 ? 20.144  42.524  -12.557 1.00 30.22  ? 190 GLY B C   1 
ATOM   5551  O  O   . GLY B  2  190 ? 20.608  41.676  -11.827 1.00 35.17  ? 190 GLY B O   1 
ATOM   5552  N  N   . LEU B  2  191 ? 19.209  43.384  -12.194 1.00 32.27  ? 191 LEU B N   1 
ATOM   5553  C  CA  . LEU B  2  191 ? 18.481  43.382  -10.952 1.00 33.16  ? 191 LEU B CA  1 
ATOM   5554  C  C   . LEU B  2  191 ? 16.969  43.030  -11.197 1.00 33.93  ? 191 LEU B C   1 
ATOM   5555  O  O   . LEU B  2  191 ? 16.286  43.673  -11.982 1.00 35.20  ? 191 LEU B O   1 
ATOM   5556  C  CB  . LEU B  2  191 ? 18.625  44.787  -10.337 1.00 33.31  ? 191 LEU B CB  1 
ATOM   5557  C  CG  . LEU B  2  191 ? 20.070  45.281  -10.144 1.00 33.37  ? 191 LEU B CG  1 
ATOM   5558  C  CD1 . LEU B  2  191 ? 20.064  46.593  -9.402  1.00 34.21  ? 191 LEU B CD1 1 
ATOM   5559  C  CD2 . LEU B  2  191 ? 20.894  44.286  -9.329  1.00 34.14  ? 191 LEU B CD2 1 
ATOM   5560  N  N   . TYR B  2  192 ? 16.472  42.003  -10.512 1.00 35.12  ? 192 TYR B N   1 
ATOM   5561  C  CA  . TYR B  2  192 ? 15.075  41.515  -10.616 1.00 31.06  ? 192 TYR B CA  1 
ATOM   5562  C  C   . TYR B  2  192 ? 14.505  41.403  -9.219  1.00 29.45  ? 192 TYR B C   1 
ATOM   5563  O  O   . TYR B  2  192 ? 15.124  40.802  -8.340  1.00 29.12  ? 192 TYR B O   1 
ATOM   5564  C  CB  . TYR B  2  192 ? 15.013  40.200  -11.382 1.00 30.97  ? 192 TYR B CB  1 
ATOM   5565  C  CG  . TYR B  2  192 ? 15.656  40.429  -12.727 1.00 33.96  ? 192 TYR B CG  1 
ATOM   5566  C  CD1 . TYR B  2  192 ? 14.992  41.146  -13.707 1.00 33.05  ? 192 TYR B CD1 1 
ATOM   5567  C  CD2 . TYR B  2  192 ? 16.986  40.063  -12.965 1.00 33.55  ? 192 TYR B CD2 1 
ATOM   5568  C  CE1 . TYR B  2  192 ? 15.593  41.410  -14.920 1.00 35.77  ? 192 TYR B CE1 1 
ATOM   5569  C  CE2 . TYR B  2  192 ? 17.596  40.334  -14.173 1.00 33.36  ? 192 TYR B CE2 1 
ATOM   5570  C  CZ  . TYR B  2  192 ? 16.906  41.006  -15.145 1.00 34.03  ? 192 TYR B CZ  1 
ATOM   5571  O  OH  . TYR B  2  192 ? 17.492  41.299  -16.337 1.00 31.64  ? 192 TYR B OH  1 
ATOM   5572  N  N   . TYR B  2  193 ? 13.344  42.022  -9.024  1.00 27.35  ? 193 TYR B N   1 
ATOM   5573  C  CA  . TYR B  2  193 ? 12.809  42.265  -7.705  1.00 29.08  ? 193 TYR B CA  1 
ATOM   5574  C  C   . TYR B  2  193 ? 11.551  41.406  -7.471  1.00 29.63  ? 193 TYR B C   1 
ATOM   5575  O  O   . TYR B  2  193 ? 10.837  41.006  -8.401  1.00 33.63  ? 193 TYR B O   1 
ATOM   5576  C  CB  . TYR B  2  193 ? 12.492  43.745  -7.512  1.00 29.55  ? 193 TYR B CB  1 
ATOM   5577  C  CG  . TYR B  2  193 ? 13.686  44.704  -7.495  1.00 29.82  ? 193 TYR B CG  1 
ATOM   5578  C  CD1 . TYR B  2  193 ? 14.332  45.101  -8.667  1.00 32.48  ? 193 TYR B CD1 1 
ATOM   5579  C  CD2 . TYR B  2  193 ? 14.127  45.256  -6.313  1.00 32.13  ? 193 TYR B CD2 1 
ATOM   5580  C  CE1 . TYR B  2  193 ? 15.409  45.983  -8.629  1.00 33.52  ? 193 TYR B CE1 1 
ATOM   5581  C  CE2 . TYR B  2  193 ? 15.167  46.144  -6.274  1.00 32.57  ? 193 TYR B CE2 1 
ATOM   5582  C  CZ  . TYR B  2  193 ? 15.805  46.500  -7.428  1.00 32.75  ? 193 TYR B CZ  1 
ATOM   5583  O  OH  . TYR B  2  193 ? 16.830  47.386  -7.338  1.00 34.31  ? 193 TYR B OH  1 
ATOM   5584  N  N   . GLY B  2  194 ? 11.313  41.119  -6.209  1.00 28.06  ? 194 GLY B N   1 
ATOM   5585  C  CA  . GLY B  2  194 ? 10.249  40.247  -5.790  1.00 27.67  ? 194 GLY B CA  1 
ATOM   5586  C  C   . GLY B  2  194 ? 9.931   40.591  -4.360  1.00 27.70  ? 194 GLY B C   1 
ATOM   5587  O  O   . GLY B  2  194 ? 10.657  41.367  -3.709  1.00 24.26  ? 194 GLY B O   1 
ATOM   5588  N  N   . GLN B  2  195 ? 8.814   40.060  -3.873  1.00 28.06  ? 195 GLN B N   1 
ATOM   5589  C  CA  . GLN B  2  195 ? 8.345   40.429  -2.539  1.00 29.05  ? 195 GLN B CA  1 
ATOM   5590  C  C   . GLN B  2  195 ? 7.665   39.243  -1.864  1.00 26.27  ? 195 GLN B C   1 
ATOM   5591  O  O   . GLN B  2  195 ? 7.178   38.339  -2.513  1.00 27.17  ? 195 GLN B O   1 
ATOM   5592  C  CB  . GLN B  2  195 ? 7.391   41.631  -2.646  1.00 31.16  ? 195 GLN B CB  1 
ATOM   5593  C  CG  . GLN B  2  195 ? 7.950   42.964  -3.117  1.00 29.93  ? 195 GLN B CG  1 
ATOM   5594  C  CD  . GLN B  2  195 ? 6.858   44.032  -3.212  1.00 28.19  ? 195 GLN B CD  1 
ATOM   5595  O  OE1 . GLN B  2  195 ? 6.098   44.017  -4.162  1.00 28.44  ? 195 GLN B OE1 1 
ATOM   5596  N  NE2 . GLN B  2  195 ? 6.771   44.936  -2.236  1.00 24.97  ? 195 GLN B NE2 1 
ATOM   5597  N  N   . CYS B  2  196 ? 7.645   39.226  -0.556  1.00 25.93  ? 196 CYS B N   1 
ATOM   5598  C  CA  . CYS B  2  196 ? 7.087   38.057  0.126   1.00 26.84  ? 196 CYS B CA  1 
ATOM   5599  C  C   . CYS B  2  196 ? 5.594   37.960  -0.221  1.00 27.13  ? 196 CYS B C   1 
ATOM   5600  O  O   . CYS B  2  196 ? 4.883   38.970  -0.285  1.00 26.57  ? 196 CYS B O   1 
ATOM   5601  C  CB  . CYS B  2  196 ? 7.313   38.160  1.640   1.00 27.87  ? 196 CYS B CB  1 
ATOM   5602  S  SG  . CYS B  2  196 ? 6.602   36.856  2.671   1.00 25.84  ? 196 CYS B SG  1 
ATOM   5603  N  N   . SER B  2  197 ? 5.162   36.731  -0.465  1.00 25.72  ? 197 SER B N   1 
ATOM   5604  C  CA  . SER B  2  197 ? 3.897   36.442  -1.053  1.00 25.26  ? 197 SER B CA  1 
ATOM   5605  C  C   . SER B  2  197 ? 3.088   35.429  -0.248  1.00 26.66  ? 197 SER B C   1 
ATOM   5606  O  O   . SER B  2  197 ? 2.319   34.663  -0.804  1.00 27.48  ? 197 SER B O   1 
ATOM   5607  C  CB  . SER B  2  197 ? 4.164   35.969  -2.466  1.00 26.32  ? 197 SER B CB  1 
ATOM   5608  O  OG  . SER B  2  197 ? 4.564   37.077  -3.256  1.00 24.50  ? 197 SER B OG  1 
ATOM   5609  N  N   . GLU B  2  198 ? 3.312   35.418  1.063   1.00 27.48  ? 198 GLU B N   1 
ATOM   5610  C  CA  . GLU B  2  198 ? 2.477   34.767  2.037   1.00 25.01  ? 198 GLU B CA  1 
ATOM   5611  C  C   . GLU B  2  198 ? 2.639   35.533  3.356   1.00 25.16  ? 198 GLU B C   1 
ATOM   5612  O  O   . GLU B  2  198 ? 3.797   36.054  3.849   1.00 31.95  ? 198 GLU B O   1 
ATOM   5613  C  CB  . GLU B  2  198 ? 2.720   33.256  2.109   1.00 26.79  ? 198 GLU B CB  1 
ATOM   5614  C  CG  . GLU B  2  198 ? 1.759   32.447  2.989   1.00 28.03  ? 198 GLU B CG  1 
ATOM   5615  C  CD  . GLU B  2  198 ? 0.291   32.400  2.525   1.00 27.88  ? 198 GLU B CD  1 
ATOM   5616  O  OE1 . GLU B  2  198 ? -0.005  32.362  1.304   1.00 22.55  ? 198 GLU B OE1 1 
ATOM   5617  O  OE2 . GLU B  2  198 ? -0.575  32.385  3.434   1.00 26.07  ? 198 GLU B OE2 1 
ATOM   5618  N  N   . ILE B  2  199 ? 1.407   35.845  3.767   1.00 25.46  ? 199 ILE B N   1 
ATOM   5619  C  CA  . ILE B  2  199 ? 1.146   36.721  4.854   1.00 24.81  ? 199 ILE B CA  1 
ATOM   5620  C  C   . ILE B  2  199 ? 1.811   36.049  6.013   1.00 25.69  ? 199 ILE B C   1 
ATOM   5621  O  O   . ILE B  2  199 ? 1.478   34.891  6.363   1.00 24.54  ? 199 ILE B O   1 
ATOM   5622  C  CB  . ILE B  2  199 ? -0.357  37.042  5.144   1.00 25.28  ? 199 ILE B CB  1 
ATOM   5623  C  CG1 . ILE B  2  199 ? -0.446  37.953  6.379   1.00 26.52  ? 199 ILE B CG1 1 
ATOM   5624  C  CG2 . ILE B  2  199 ? -1.186  35.794  5.420   1.00 26.47  ? 199 ILE B CG2 1 
ATOM   5625  C  CD1 . ILE B  2  199 ? -1.727  38.685  6.596   1.00 28.04  ? 199 ILE B CD1 1 
ATOM   5626  N  N   . CYS B  2  200 ? 2.768   36.790  6.572   1.00 26.80  ? 200 CYS B N   1 
ATOM   5627  C  CA  . CYS B  2  200 ? 3.667   36.302  7.605   1.00 27.98  ? 200 CYS B CA  1 
ATOM   5628  C  C   . CYS B  2  200 ? 3.666   37.223  8.790   1.00 29.75  ? 200 CYS B C   1 
ATOM   5629  O  O   . CYS B  2  200 ? 4.537   37.109  9.643   1.00 32.55  ? 200 CYS B O   1 
ATOM   5630  C  CB  . CYS B  2  200 ? 5.060   36.234  7.021   1.00 27.38  ? 200 CYS B CB  1 
ATOM   5631  S  SG  . CYS B  2  200 ? 5.645   37.774  6.259   1.00 26.26  ? 200 CYS B SG  1 
ATOM   5632  N  N   . GLY B  2  201 ? 2.699   38.137  8.860   1.00 28.96  ? 201 GLY B N   1 
ATOM   5633  C  CA  . GLY B  2  201 ? 2.580   39.006  10.018  1.00 29.68  ? 201 GLY B CA  1 
ATOM   5634  C  C   . GLY B  2  201 ? 2.728   40.474  9.676   1.00 30.27  ? 201 GLY B C   1 
ATOM   5635  O  O   . GLY B  2  201 ? 2.502   40.868  8.526   1.00 28.41  ? 201 GLY B O   1 
ATOM   5636  N  N   . SER B  2  202 ? 3.102   41.253  10.704  1.00 31.53  ? 202 SER B N   1 
ATOM   5637  C  CA  . SER B  2  202 ? 3.269   42.747  10.693  1.00 33.94  ? 202 SER B CA  1 
ATOM   5638  C  C   . SER B  2  202 ? 4.015   43.373  9.557   1.00 33.84  ? 202 SER B C   1 
ATOM   5639  O  O   . SER B  2  202 ? 3.691   44.491  9.150   1.00 34.95  ? 202 SER B O   1 
ATOM   5640  C  CB  . SER B  2  202 ? 4.063   43.189  11.917  1.00 33.75  ? 202 SER B CB  1 
ATOM   5641  O  OG  . SER B  2  202 ? 3.185   43.424  12.968  1.00 41.15  ? 202 SER B OG  1 
ATOM   5642  N  N   . ASN B  2  203 ? 5.068   42.703  9.112   1.00 31.40  ? 203 ASN B N   1 
ATOM   5643  C  CA  . ASN B  2  203 ? 5.958   43.291  8.127   1.00 33.96  ? 203 ASN B CA  1 
ATOM   5644  C  C   . ASN B  2  203 ? 6.025   42.452  6.869   1.00 31.51  ? 203 ASN B C   1 
ATOM   5645  O  O   . ASN B  2  203 ? 6.964   42.519  6.101   1.00 31.16  ? 203 ASN B O   1 
ATOM   5646  C  CB  . ASN B  2  203 ? 7.335   43.521  8.742   1.00 36.04  ? 203 ASN B CB  1 
ATOM   5647  C  CG  . ASN B  2  203 ? 7.352   44.684  9.721   1.00 37.51  ? 203 ASN B CG  1 
ATOM   5648  O  OD1 . ASN B  2  203 ? 7.824   45.748  9.407   1.00 43.05  ? 203 ASN B OD1 1 
ATOM   5649  N  ND2 . ASN B  2  203 ? 6.883   44.455  10.921  1.00 43.31  ? 203 ASN B ND2 1 
ATOM   5650  N  N   . HIS B  2  204 ? 4.981   41.676  6.654   1.00 30.53  ? 204 HIS B N   1 
ATOM   5651  C  CA  . HIS B  2  204 ? 4.766   40.974  5.410   1.00 27.67  ? 204 HIS B CA  1 
ATOM   5652  C  C   . HIS B  2  204 ? 5.044   41.902  4.227   1.00 27.43  ? 204 HIS B C   1 
ATOM   5653  O  O   . HIS B  2  204 ? 5.641   41.461  3.252   1.00 23.83  ? 204 HIS B O   1 
ATOM   5654  C  CB  . HIS B  2  204 ? 3.324   40.493  5.444   1.00 27.23  ? 204 HIS B CB  1 
ATOM   5655  C  CG  . HIS B  2  204 ? 2.818   39.930  4.169   1.00 25.70  ? 204 HIS B CG  1 
ATOM   5656  N  ND1 . HIS B  2  204 ? 3.491   38.973  3.453   1.00 28.04  ? 204 HIS B ND1 1 
ATOM   5657  C  CD2 . HIS B  2  204 ? 1.673   40.170  3.501   1.00 26.78  ? 204 HIS B CD2 1 
ATOM   5658  C  CE1 . HIS B  2  204 ? 2.792   38.665  2.374   1.00 27.96  ? 204 HIS B CE1 1 
ATOM   5659  N  NE2 . HIS B  2  204 ? 1.672   39.366  2.391   1.00 28.80  ? 204 HIS B NE2 1 
ATOM   5660  N  N   . SER B  2  205 ? 4.684   43.193  4.328   1.00 26.88  ? 205 SER B N   1 
ATOM   5661  C  CA  . SER B  2  205 ? 4.871   44.097  3.186   1.00 28.70  ? 205 SER B CA  1 
ATOM   5662  C  C   . SER B  2  205 ? 6.343   44.502  2.895   1.00 30.21  ? 205 SER B C   1 
ATOM   5663  O  O   . SER B  2  205 ? 6.626   45.045  1.814   1.00 30.61  ? 205 SER B O   1 
ATOM   5664  C  CB  . SER B  2  205 ? 4.010   45.350  3.344   1.00 29.90  ? 205 SER B CB  1 
ATOM   5665  O  OG  . SER B  2  205 ? 2.670   45.045  3.674   1.00 28.69  ? 205 SER B OG  1 
ATOM   5666  N  N   . PHE B  2  206 ? 7.261   44.177  3.815   1.00 29.31  ? 206 PHE B N   1 
ATOM   5667  C  CA  . PHE B  2  206 ? 8.579   44.801  3.916   1.00 26.81  ? 206 PHE B CA  1 
ATOM   5668  C  C   . PHE B  2  206 ? 9.698   43.763  4.028   1.00 26.16  ? 206 PHE B C   1 
ATOM   5669  O  O   . PHE B  2  206 ? 10.621  43.907  4.814   1.00 28.53  ? 206 PHE B O   1 
ATOM   5670  C  CB  . PHE B  2  206 ? 8.549   45.707  5.135   1.00 27.25  ? 206 PHE B CB  1 
ATOM   5671  C  CG  . PHE B  2  206 ? 7.376   46.670  5.140   1.00 29.93  ? 206 PHE B CG  1 
ATOM   5672  C  CD1 . PHE B  2  206 ? 7.204   47.586  4.115   1.00 28.87  ? 206 PHE B CD1 1 
ATOM   5673  C  CD2 . PHE B  2  206 ? 6.430   46.652  6.151   1.00 28.94  ? 206 PHE B CD2 1 
ATOM   5674  C  CE1 . PHE B  2  206 ? 6.111   48.466  4.115   1.00 29.66  ? 206 PHE B CE1 1 
ATOM   5675  C  CE2 . PHE B  2  206 ? 5.351   47.536  6.144   1.00 29.11  ? 206 PHE B CE2 1 
ATOM   5676  C  CZ  . PHE B  2  206 ? 5.183   48.437  5.125   1.00 27.00  ? 206 PHE B CZ  1 
ATOM   5677  N  N   . MET B  2  207 ? 9.614   42.695  3.245   1.00 27.29  ? 207 MET B N   1 
ATOM   5678  C  CA  . MET B  2  207 ? 10.706  41.743  3.143   1.00 24.75  ? 207 MET B CA  1 
ATOM   5679  C  C   . MET B  2  207 ? 10.895  41.297  1.712   1.00 24.01  ? 207 MET B C   1 
ATOM   5680  O  O   . MET B  2  207 ? 10.539  40.190  1.353   1.00 25.06  ? 207 MET B O   1 
ATOM   5681  C  CB  . MET B  2  207 ? 10.524  40.575  4.099   1.00 27.23  ? 207 MET B CB  1 
ATOM   5682  C  CG  . MET B  2  207 ? 9.154   39.899  4.189   1.00 28.73  ? 207 MET B CG  1 
ATOM   5683  S  SD  . MET B  2  207 ? 9.112   38.488  5.336   1.00 28.23  ? 207 MET B SD  1 
ATOM   5684  C  CE  . MET B  2  207 ? 10.327  37.453  4.525   1.00 26.10  ? 207 MET B CE  1 
ATOM   5685  N  N   . PRO B  2  208 ? 11.480  42.176  0.886   1.00 24.27  ? 208 PRO B N   1 
ATOM   5686  C  CA  . PRO B  2  208 ? 11.607  41.921  -0.513  1.00 25.68  ? 208 PRO B CA  1 
ATOM   5687  C  C   . PRO B  2  208 ? 12.853  41.129  -0.845  1.00 27.02  ? 208 PRO B C   1 
ATOM   5688  O  O   . PRO B  2  208 ? 13.654  40.801  0.045   1.00 28.36  ? 208 PRO B O   1 
ATOM   5689  C  CB  . PRO B  2  208 ? 11.673  43.332  -1.117  1.00 24.66  ? 208 PRO B CB  1 
ATOM   5690  C  CG  . PRO B  2  208 ? 12.370  44.127  -0.094  1.00 23.17  ? 208 PRO B CG  1 
ATOM   5691  C  CD  . PRO B  2  208 ? 11.945  43.542  1.213   1.00 24.76  ? 208 PRO B CD  1 
ATOM   5692  N  N   . ILE B  2  209 ? 12.963  40.854  -2.141  1.00 25.97  ? 209 ILE B N   1 
ATOM   5693  C  CA  . ILE B  2  209 ? 13.866  39.943  -2.721  1.00 27.77  ? 209 ILE B CA  1 
ATOM   5694  C  C   . ILE B  2  209 ? 14.498  40.630  -3.933  1.00 28.12  ? 209 ILE B C   1 
ATOM   5695  O  O   . ILE B  2  209 ? 13.808  41.144  -4.786  1.00 25.60  ? 209 ILE B O   1 
ATOM   5696  C  CB  . ILE B  2  209 ? 13.085  38.731  -3.205  1.00 28.77  ? 209 ILE B CB  1 
ATOM   5697  C  CG1 . ILE B  2  209 ? 12.588  37.955  -2.003  1.00 32.01  ? 209 ILE B CG1 1 
ATOM   5698  C  CG2 . ILE B  2  209 ? 13.944  37.847  -4.093  1.00 28.85  ? 209 ILE B CG2 1 
ATOM   5699  C  CD1 . ILE B  2  209 ? 11.365  37.101  -2.301  1.00 34.68  ? 209 ILE B CD1 1 
ATOM   5700  N  N   . VAL B  2  210 ? 15.823  40.644  -3.985  1.00 29.58  ? 210 VAL B N   1 
ATOM   5701  C  CA  . VAL B  2  210 ? 16.547  41.237  -5.102  1.00 30.17  ? 210 VAL B CA  1 
ATOM   5702  C  C   . VAL B  2  210 ? 17.599  40.222  -5.520  1.00 30.20  ? 210 VAL B C   1 
ATOM   5703  O  O   . VAL B  2  210 ? 18.423  39.844  -4.712  1.00 34.15  ? 210 VAL B O   1 
ATOM   5704  C  CB  . VAL B  2  210 ? 17.198  42.587  -4.735  1.00 28.46  ? 210 VAL B CB  1 
ATOM   5705  C  CG1 . VAL B  2  210 ? 17.799  43.255  -5.958  1.00 27.82  ? 210 VAL B CG1 1 
ATOM   5706  C  CG2 . VAL B  2  210 ? 16.156  43.502  -4.111  1.00 29.69  ? 210 VAL B CG2 1 
ATOM   5707  N  N   . LEU B  2  211 ? 17.488  39.775  -6.764  1.00 28.24  ? 211 LEU B N   1 
ATOM   5708  C  CA  . LEU B  2  211 ? 18.486  39.028  -7.442  1.00 29.55  ? 211 LEU B CA  1 
ATOM   5709  C  C   . LEU B  2  211 ? 19.390  39.984  -8.214  1.00 33.21  ? 211 LEU B C   1 
ATOM   5710  O  O   . LEU B  2  211 ? 18.914  40.939  -8.855  1.00 38.28  ? 211 LEU B O   1 
ATOM   5711  C  CB  . LEU B  2  211 ? 17.824  38.084  -8.441  1.00 28.52  ? 211 LEU B CB  1 
ATOM   5712  C  CG  . LEU B  2  211 ? 16.659  37.239  -7.935  1.00 29.60  ? 211 LEU B CG  1 
ATOM   5713  C  CD1 . LEU B  2  211 ? 16.273  36.195  -8.979  1.00 29.75  ? 211 LEU B CD1 1 
ATOM   5714  C  CD2 . LEU B  2  211 ? 16.968  36.617  -6.594  1.00 29.73  ? 211 LEU B CD2 1 
ATOM   5715  N  N   . GLU B  2  212 ? 20.687  39.705  -8.181  1.00 35.04  ? 212 GLU B N   1 
ATOM   5716  C  CA  . GLU B  2  212 ? 21.688  40.388  -9.012  1.00 32.80  ? 212 GLU B CA  1 
ATOM   5717  C  C   . GLU B  2  212 ? 22.336  39.332  -9.857  1.00 30.92  ? 212 GLU B C   1 
ATOM   5718  O  O   . GLU B  2  212 ? 23.068  38.491  -9.364  1.00 29.97  ? 212 GLU B O   1 
ATOM   5719  C  CB  . GLU B  2  212 ? 22.700  41.093  -8.120  1.00 33.37  ? 212 GLU B CB  1 
ATOM   5720  C  CG  . GLU B  2  212 ? 23.917  41.603  -8.866  1.00 34.73  ? 212 GLU B CG  1 
ATOM   5721  C  CD  . GLU B  2  212 ? 24.691  42.617  -8.084  1.00 36.45  ? 212 GLU B CD  1 
ATOM   5722  O  OE1 . GLU B  2  212 ? 24.070  43.590  -7.561  1.00 38.11  ? 212 GLU B OE1 1 
ATOM   5723  O  OE2 . GLU B  2  212 ? 25.925  42.448  -8.015  1.00 37.47  ? 212 GLU B OE2 1 
ATOM   5724  N  N   . LEU B  2  213 ? 22.026  39.346  -11.139 1.00 36.42  ? 213 LEU B N   1 
ATOM   5725  C  CA  . LEU B  2  213 ? 22.512  38.332  -12.081 1.00 36.02  ? 213 LEU B CA  1 
ATOM   5726  C  C   . LEU B  2  213 ? 23.726  38.875  -12.843 1.00 38.79  ? 213 LEU B C   1 
ATOM   5727  O  O   . LEU B  2  213 ? 23.673  39.932  -13.509 1.00 36.61  ? 213 LEU B O   1 
ATOM   5728  C  CB  . LEU B  2  213 ? 21.410  37.918  -13.062 1.00 38.55  ? 213 LEU B CB  1 
ATOM   5729  C  CG  . LEU B  2  213 ? 20.398  36.893  -12.550 1.00 38.43  ? 213 LEU B CG  1 
ATOM   5730  C  CD1 . LEU B  2  213 ? 21.019  35.503  -12.406 1.00 39.91  ? 213 LEU B CD1 1 
ATOM   5731  C  CD2 . LEU B  2  213 ? 19.796  37.343  -11.237 1.00 39.18  ? 213 LEU B CD2 1 
ATOM   5732  N  N   . VAL B  2  214 ? 24.824  38.137  -12.716 1.00 38.26  ? 214 VAL B N   1 
ATOM   5733  C  CA  . VAL B  2  214 ? 26.103  38.552  -13.218 1.00 36.38  ? 214 VAL B CA  1 
ATOM   5734  C  C   . VAL B  2  214 ? 26.822  37.357  -13.834 1.00 36.45  ? 214 VAL B C   1 
ATOM   5735  O  O   . VAL B  2  214 ? 26.438  36.210  -13.664 1.00 31.96  ? 214 VAL B O   1 
ATOM   5736  C  CB  . VAL B  2  214 ? 26.962  39.160  -12.108 1.00 35.97  ? 214 VAL B CB  1 
ATOM   5737  C  CG1 . VAL B  2  214 ? 26.275  40.360  -11.475 1.00 38.04  ? 214 VAL B CG1 1 
ATOM   5738  C  CG2 . VAL B  2  214 ? 27.280  38.122  -11.045 1.00 38.66  ? 214 VAL B CG2 1 
ATOM   5739  N  N   . PRO B  2  215 ? 27.900  37.627  -14.553 1.00 40.28  ? 215 PRO B N   1 
ATOM   5740  C  CA  . PRO B  2  215 ? 28.651  36.488  -15.084 1.00 38.62  ? 215 PRO B CA  1 
ATOM   5741  C  C   . PRO B  2  215 ? 29.320  35.638  -14.003 1.00 35.53  ? 215 PRO B C   1 
ATOM   5742  O  O   . PRO B  2  215 ? 29.666  36.121  -12.906 1.00 32.15  ? 215 PRO B O   1 
ATOM   5743  C  CB  . PRO B  2  215 ? 29.706  37.155  -15.956 1.00 40.54  ? 215 PRO B CB  1 
ATOM   5744  C  CG  . PRO B  2  215 ? 29.139  38.496  -16.290 1.00 41.78  ? 215 PRO B CG  1 
ATOM   5745  C  CD  . PRO B  2  215 ? 28.405  38.917  -15.061 1.00 40.39  ? 215 PRO B CD  1 
ATOM   5746  N  N   . LEU B  2  216 ? 29.522  34.376  -14.333 1.00 34.53  ? 216 LEU B N   1 
ATOM   5747  C  CA  . LEU B  2  216 ? 30.147  33.441  -13.416 1.00 35.08  ? 216 LEU B CA  1 
ATOM   5748  C  C   . LEU B  2  216 ? 31.392  33.999  -12.686 1.00 35.78  ? 216 LEU B C   1 
ATOM   5749  O  O   . LEU B  2  216 ? 31.410  33.989  -11.453 1.00 34.95  ? 216 LEU B O   1 
ATOM   5750  C  CB  . LEU B  2  216 ? 30.427  32.101  -14.116 1.00 32.54  ? 216 LEU B CB  1 
ATOM   5751  C  CG  . LEU B  2  216 ? 31.080  31.041  -13.223 1.00 34.39  ? 216 LEU B CG  1 
ATOM   5752  C  CD1 . LEU B  2  216 ? 30.182  30.607  -12.087 1.00 35.08  ? 216 LEU B CD1 1 
ATOM   5753  C  CD2 . LEU B  2  216 ? 31.462  29.827  -14.029 1.00 37.05  ? 216 LEU B CD2 1 
ATOM   5754  N  N   . LYS B  2  217 ? 32.402  34.504  -13.401 1.00 41.27  ? 217 LYS B N   1 
ATOM   5755  C  CA  . LYS B  2  217 ? 33.663  34.871  -12.724 1.00 47.25  ? 217 LYS B CA  1 
ATOM   5756  C  C   . LYS B  2  217 ? 33.447  35.933  -11.642 1.00 45.00  ? 217 LYS B C   1 
ATOM   5757  O  O   . LYS B  2  217 ? 34.062  35.885  -10.562 1.00 45.82  ? 217 LYS B O   1 
ATOM   5758  C  CB  . LYS B  2  217 ? 34.780  35.264  -13.703 1.00 58.92  ? 217 LYS B CB  1 
ATOM   5759  C  CG  . LYS B  2  217 ? 34.687  36.659  -14.324 1.00 71.46  ? 217 LYS B CG  1 
ATOM   5760  C  CD  . LYS B  2  217 ? 36.057  37.247  -14.696 1.00 81.72  ? 217 LYS B CD  1 
ATOM   5761  C  CE  . LYS B  2  217 ? 36.093  38.786  -14.664 1.00 88.62  ? 217 LYS B CE  1 
ATOM   5762  N  NZ  . LYS B  2  217 ? 36.172  39.388  -13.284 1.00 90.68  ? 217 LYS B NZ  1 
ATOM   5763  N  N   . TYR B  2  218 ? 32.530  36.856  -11.901 1.00 41.66  ? 218 TYR B N   1 
ATOM   5764  C  CA  . TYR B  2  218 ? 32.128  37.840  -10.890 1.00 40.23  ? 218 TYR B CA  1 
ATOM   5765  C  C   . TYR B  2  218 ? 31.403  37.209  -9.696  1.00 39.19  ? 218 TYR B C   1 
ATOM   5766  O  O   . TYR B  2  218 ? 31.592  37.623  -8.518  1.00 39.24  ? 218 TYR B O   1 
ATOM   5767  C  CB  . TYR B  2  218 ? 31.257  38.925  -11.522 1.00 43.76  ? 218 TYR B CB  1 
ATOM   5768  C  CG  . TYR B  2  218 ? 32.037  39.858  -12.416 1.00 42.53  ? 218 TYR B CG  1 
ATOM   5769  C  CD1 . TYR B  2  218 ? 32.664  40.977  -11.882 1.00 42.57  ? 218 TYR B CD1 1 
ATOM   5770  C  CD2 . TYR B  2  218 ? 32.149  39.626  -13.782 1.00 42.90  ? 218 TYR B CD2 1 
ATOM   5771  C  CE1 . TYR B  2  218 ? 33.399  41.838  -12.675 1.00 42.59  ? 218 TYR B CE1 1 
ATOM   5772  C  CE2 . TYR B  2  218 ? 32.871  40.490  -14.590 1.00 44.85  ? 218 TYR B CE2 1 
ATOM   5773  C  CZ  . TYR B  2  218 ? 33.498  41.592  -14.021 1.00 45.01  ? 218 TYR B CZ  1 
ATOM   5774  O  OH  . TYR B  2  218 ? 34.202  42.479  -14.777 1.00 47.81  ? 218 TYR B OH  1 
ATOM   5775  N  N   . PHE B  2  219 ? 30.571  36.212  -10.003 1.00 37.46  ? 219 PHE B N   1 
ATOM   5776  C  CA  . PHE B  2  219 ? 29.873  35.453  -8.974  1.00 34.19  ? 219 PHE B CA  1 
ATOM   5777  C  C   . PHE B  2  219 ? 30.881  34.741  -8.051  1.00 33.31  ? 219 PHE B C   1 
ATOM   5778  O  O   . PHE B  2  219 ? 30.755  34.827  -6.825  1.00 31.72  ? 219 PHE B O   1 
ATOM   5779  C  CB  . PHE B  2  219 ? 28.809  34.490  -9.583  1.00 33.80  ? 219 PHE B CB  1 
ATOM   5780  C  CG  . PHE B  2  219 ? 28.339  33.471  -8.609  1.00 33.74  ? 219 PHE B CG  1 
ATOM   5781  C  CD1 . PHE B  2  219 ? 27.465  33.829  -7.618  1.00 33.57  ? 219 PHE B CD1 1 
ATOM   5782  C  CD2 . PHE B  2  219 ? 28.851  32.182  -8.627  1.00 33.13  ? 219 PHE B CD2 1 
ATOM   5783  C  CE1 . PHE B  2  219 ? 27.108  32.917  -6.668  1.00 35.68  ? 219 PHE B CE1 1 
ATOM   5784  C  CE2 . PHE B  2  219 ? 28.492  31.263  -7.689  1.00 32.71  ? 219 PHE B CE2 1 
ATOM   5785  C  CZ  . PHE B  2  219 ? 27.620  31.624  -6.706  1.00 35.28  ? 219 PHE B CZ  1 
ATOM   5786  N  N   . GLU B  2  220 ? 31.889  34.079  -8.629  1.00 35.38  ? 220 GLU B N   1 
ATOM   5787  C  CA  . GLU B  2  220 ? 32.970  33.427  -7.828  1.00 37.53  ? 220 GLU B CA  1 
ATOM   5788  C  C   . GLU B  2  220 ? 33.708  34.385  -6.888  1.00 34.81  ? 220 GLU B C   1 
ATOM   5789  O  O   . GLU B  2  220 ? 33.990  34.056  -5.725  1.00 34.25  ? 220 GLU B O   1 
ATOM   5790  C  CB  . GLU B  2  220 ? 33.998  32.739  -8.722  1.00 40.19  ? 220 GLU B CB  1 
ATOM   5791  C  CG  . GLU B  2  220 ? 33.474  31.512  -9.451  1.00 45.78  ? 220 GLU B CG  1 
ATOM   5792  C  CD  . GLU B  2  220 ? 34.317  31.126  -10.654 1.00 50.84  ? 220 GLU B CD  1 
ATOM   5793  O  OE1 . GLU B  2  220 ? 33.886  30.270  -11.467 1.00 57.64  ? 220 GLU B OE1 1 
ATOM   5794  O  OE2 . GLU B  2  220 ? 35.417  31.676  -10.791 1.00 57.42  ? 220 GLU B OE2 1 
ATOM   5795  N  N   . LYS B  2  221 ? 34.016  35.565  -7.390  1.00 32.54  ? 221 LYS B N   1 
ATOM   5796  C  CA  . LYS B  2  221 ? 34.798  36.528  -6.613  1.00 36.26  ? 221 LYS B CA  1 
ATOM   5797  C  C   . LYS B  2  221 ? 33.982  37.110  -5.495  1.00 34.43  ? 221 LYS B C   1 
ATOM   5798  O  O   . LYS B  2  221 ? 34.476  37.316  -4.382  1.00 32.50  ? 221 LYS B O   1 
ATOM   5799  C  CB  . LYS B  2  221 ? 35.311  37.658  -7.512  1.00 41.19  ? 221 LYS B CB  1 
ATOM   5800  C  CG  . LYS B  2  221 ? 36.412  37.231  -8.474  1.00 43.40  ? 221 LYS B CG  1 
ATOM   5801  C  CD  . LYS B  2  221 ? 36.881  38.438  -9.252  1.00 48.82  ? 221 LYS B CD  1 
ATOM   5802  C  CE  . LYS B  2  221 ? 38.119  38.137  -10.060 1.00 56.27  ? 221 LYS B CE  1 
ATOM   5803  N  NZ  . LYS B  2  221 ? 37.888  36.988  -10.980 1.00 60.17  ? 221 LYS B NZ  1 
ATOM   5804  N  N   . TRP B  2  222 ? 32.716  37.376  -5.806  1.00 34.68  ? 222 TRP B N   1 
ATOM   5805  C  CA  . TRP B  2  222 ? 31.766  37.866  -4.814  1.00 32.75  ? 222 TRP B CA  1 
ATOM   5806  C  C   . TRP B  2  222 ? 31.567  36.833  -3.685  1.00 31.49  ? 222 TRP B C   1 
ATOM   5807  O  O   . TRP B  2  222 ? 31.611  37.184  -2.536  1.00 30.20  ? 222 TRP B O   1 
ATOM   5808  C  CB  . TRP B  2  222 ? 30.434  38.305  -5.504  1.00 33.06  ? 222 TRP B CB  1 
ATOM   5809  C  CG  . TRP B  2  222 ? 29.291  38.528  -4.518  1.00 31.15  ? 222 TRP B CG  1 
ATOM   5810  C  CD1 . TRP B  2  222 ? 28.983  39.677  -3.867  1.00 30.28  ? 222 TRP B CD1 1 
ATOM   5811  C  CD2 . TRP B  2  222 ? 28.372  37.529  -4.046  1.00 31.55  ? 222 TRP B CD2 1 
ATOM   5812  N  NE1 . TRP B  2  222 ? 27.928  39.468  -3.019  1.00 33.87  ? 222 TRP B NE1 1 
ATOM   5813  C  CE2 . TRP B  2  222 ? 27.523  38.156  -3.117  1.00 33.62  ? 222 TRP B CE2 1 
ATOM   5814  C  CE3 . TRP B  2  222 ? 28.183  36.169  -4.335  1.00 31.42  ? 222 TRP B CE3 1 
ATOM   5815  C  CZ2 . TRP B  2  222 ? 26.483  37.475  -2.469  1.00 31.88  ? 222 TRP B CZ2 1 
ATOM   5816  C  CZ3 . TRP B  2  222 ? 27.150  35.486  -3.697  1.00 33.83  ? 222 TRP B CZ3 1 
ATOM   5817  C  CH2 . TRP B  2  222 ? 26.312  36.149  -2.769  1.00 33.02  ? 222 TRP B CH2 1 
ATOM   5818  N  N   . SER B  2  223 ? 31.377  35.563  -4.016  1.00 35.07  ? 223 SER B N   1 
ATOM   5819  C  CA  . SER B  2  223 ? 31.190  34.513  -2.992  1.00 36.79  ? 223 SER B CA  1 
ATOM   5820  C  C   . SER B  2  223 ? 32.340  34.481  -2.014  1.00 36.63  ? 223 SER B C   1 
ATOM   5821  O  O   . SER B  2  223 ? 32.134  34.409  -0.789  1.00 33.72  ? 223 SER B O   1 
ATOM   5822  C  CB  . SER B  2  223 ? 31.085  33.141  -3.638  1.00 37.58  ? 223 SER B CB  1 
ATOM   5823  O  OG  . SER B  2  223 ? 30.228  33.201  -4.742  1.00 43.83  ? 223 SER B OG  1 
ATOM   5824  N  N   . ALA B  2  224 ? 33.555  34.519  -2.578  1.00 37.50  ? 224 ALA B N   1 
ATOM   5825  C  CA  . ALA B  2  224 ? 34.796  34.541  -1.794  1.00 33.59  ? 224 ALA B CA  1 
ATOM   5826  C  C   . ALA B  2  224 ? 34.823  35.717  -0.861  1.00 32.40  ? 224 ALA B C   1 
ATOM   5827  O  O   . ALA B  2  224 ? 35.179  35.548  0.312   1.00 31.92  ? 224 ALA B O   1 
ATOM   5828  C  CB  . ALA B  2  224 ? 36.012  34.573  -2.695  1.00 33.98  ? 224 ALA B CB  1 
ATOM   5829  N  N   . SER B  2  225 ? 34.466  36.901  -1.374  1.00 32.31  ? 225 SER B N   1 
ATOM   5830  C  CA  . SER B  2  225 ? 34.416  38.144  -0.546  1.00 32.54  ? 225 SER B CA  1 
ATOM   5831  C  C   . SER B  2  225 ? 33.355  38.140  0.557   1.00 32.28  ? 225 SER B C   1 
ATOM   5832  O  O   . SER B  2  225 ? 33.435  38.955  1.457   1.00 31.97  ? 225 SER B O   1 
ATOM   5833  C  CB  . SER B  2  225 ? 34.186  39.387  -1.424  1.00 33.62  ? 225 SER B CB  1 
ATOM   5834  O  OG  . SER B  2  225 ? 32.855  39.410  -1.962  1.00 35.26  ? 225 SER B OG  1 
ATOM   5835  N  N   . MET B  2  226 ? 32.346  37.266  0.462   1.00 35.60  ? 226 MET B N   1 
ATOM   5836  C  CA  . MET B  2  226 ? 31.232  37.175  1.446   1.00 38.94  ? 226 MET B CA  1 
ATOM   5837  C  C   . MET B  2  226 ? 31.394  36.137  2.570   1.00 41.85  ? 226 MET B C   1 
ATOM   5838  O  O   . MET B  2  226 ? 30.474  35.964  3.363   1.00 45.11  ? 226 MET B O   1 
ATOM   5839  C  CB  . MET B  2  226 ? 29.921  36.856  0.717   1.00 37.36  ? 226 MET B CB  1 
ATOM   5840  C  CG  . MET B  2  226 ? 29.428  37.958  -0.183  1.00 40.31  ? 226 MET B CG  1 
ATOM   5841  S  SD  . MET B  2  226 ? 28.944  39.403  0.737   1.00 38.66  ? 226 MET B SD  1 
ATOM   5842  C  CE  . MET B  2  226 ? 27.384  38.805  1.386   1.00 43.98  ? 226 MET B CE  1 
ATOM   5843  N  N   . LEU B  2  227 ? 32.524  35.439  2.630   1.00 44.60  ? 227 LEU B N   1 
ATOM   5844  C  CA  . LEU B  2  227 ? 32.753  34.421  3.660   1.00 48.55  ? 227 LEU B CA  1 
ATOM   5845  C  C   . LEU B  2  227 ? 33.060  35.036  5.001   1.00 54.31  ? 227 LEU B C   1 
ATOM   5846  O  O   . LEU B  2  227 ? 32.954  34.305  5.982   1.00 68.12  ? 227 LEU B O   1 
ATOM   5847  C  CB  . LEU B  2  227 ? 33.888  33.468  3.274   1.00 47.05  ? 227 LEU B CB  1 
ATOM   5848  C  CG  . LEU B  2  227 ? 33.684  32.682  1.970   1.00 49.13  ? 227 LEU B CG  1 
ATOM   5849  C  CD1 . LEU B  2  227 ? 34.884  31.809  1.651   1.00 48.75  ? 227 LEU B CD1 1 
ATOM   5850  C  CD2 . LEU B  2  227 ? 32.432  31.828  2.047   1.00 51.17  ? 227 LEU B CD2 1 
ATOM   5851  O  OXT . LEU B  2  227 ? 33.393  36.213  5.151   1.00 51.91  ? 227 LEU B OXT 1 
ATOM   5852  N  N   . HIS C  3  3   ? -58.322 26.475  12.607  1.00 71.56  ? 3   HIS C N   1 
ATOM   5853  C  CA  . HIS C  3  3   ? -57.961 25.039  12.788  1.00 69.76  ? 3   HIS C CA  1 
ATOM   5854  C  C   . HIS C  3  3   ? -57.122 24.573  11.593  1.00 59.95  ? 3   HIS C C   1 
ATOM   5855  O  O   . HIS C  3  3   ? -57.447 24.904  10.454  1.00 60.31  ? 3   HIS C O   1 
ATOM   5856  C  CB  . HIS C  3  3   ? -59.247 24.207  12.922  1.00 79.16  ? 3   HIS C CB  1 
ATOM   5857  C  CG  . HIS C  3  3   ? -59.018 22.739  13.147  1.00 96.30  ? 3   HIS C CG  1 
ATOM   5858  N  ND1 . HIS C  3  3   ? -57.883 22.237  13.752  1.00 106.80 ? 3   HIS C ND1 1 
ATOM   5859  C  CD2 . HIS C  3  3   ? -59.797 21.664  12.869  1.00 105.63 ? 3   HIS C CD2 1 
ATOM   5860  C  CE1 . HIS C  3  3   ? -57.961 20.918  13.818  1.00 107.65 ? 3   HIS C CE1 1 
ATOM   5861  N  NE2 . HIS C  3  3   ? -59.114 20.545  13.291  1.00 110.33 ? 3   HIS C NE2 1 
ATOM   5862  N  N   . GLN C  3  4   ? -56.059 23.810  11.850  1.00 43.30  ? 4   GLN C N   1 
ATOM   5863  C  CA  . GLN C  3  4   ? -55.216 23.300  10.791  1.00 38.78  ? 4   GLN C CA  1 
ATOM   5864  C  C   . GLN C  3  4   ? -55.779 22.006  10.161  1.00 37.90  ? 4   GLN C C   1 
ATOM   5865  O  O   . GLN C  3  4   ? -56.286 21.167  10.886  1.00 38.97  ? 4   GLN C O   1 
ATOM   5866  C  CB  . GLN C  3  4   ? -53.768 23.067  11.303  1.00 37.22  ? 4   GLN C CB  1 
ATOM   5867  C  CG  . GLN C  3  4   ? -53.530 21.756  12.032  1.00 32.32  ? 4   GLN C CG  1 
ATOM   5868  C  CD  . GLN C  3  4   ? -52.117 21.575  12.485  1.00 30.74  ? 4   GLN C CD  1 
ATOM   5869  O  OE1 . GLN C  3  4   ? -51.552 22.458  13.143  1.00 29.79  ? 4   GLN C OE1 1 
ATOM   5870  N  NE2 . GLN C  3  4   ? -51.532 20.406  12.169  1.00 27.10  ? 4   GLN C NE2 1 
ATOM   5871  N  N   . THR C  3  5   ? -55.642 21.853  8.832   1.00 34.50  ? 5   THR C N   1 
ATOM   5872  C  CA  . THR C  3  5   ? -55.909 20.599  8.103   1.00 34.51  ? 5   THR C CA  1 
ATOM   5873  C  C   . THR C  3  5   ? -54.646 19.959  7.411   1.00 33.36  ? 5   THR C C   1 
ATOM   5874  O  O   . THR C  3  5   ? -54.746 19.293  6.380   1.00 31.60  ? 5   THR C O   1 
ATOM   5875  C  CB  . THR C  3  5   ? -57.066 20.799  7.103   1.00 38.41  ? 5   THR C CB  1 
ATOM   5876  O  OG1 . THR C  3  5   ? -56.768 21.826  6.169   1.00 35.56  ? 5   THR C OG1 1 
ATOM   5877  C  CG2 . THR C  3  5   ? -58.321 21.221  7.835   1.00 40.96  ? 5   THR C CG2 1 
ATOM   5878  N  N   . HIS C  3  6   ? -53.461 20.168  7.996   1.00 29.29  ? 6   HIS C N   1 
ATOM   5879  C  CA  . HIS C  3  6   ? -52.264 19.450  7.597   1.00 27.06  ? 6   HIS C CA  1 
ATOM   5880  C  C   . HIS C  3  6   ? -51.820 18.724  8.838   1.00 26.67  ? 6   HIS C C   1 
ATOM   5881  O  O   . HIS C  3  6   ? -52.312 19.018  9.922   1.00 26.85  ? 6   HIS C O   1 
ATOM   5882  C  CB  . HIS C  3  6   ? -51.148 20.394  7.083   1.00 27.39  ? 6   HIS C CB  1 
ATOM   5883  C  CG  . HIS C  3  6   ? -50.759 21.449  8.060   1.00 24.56  ? 6   HIS C CG  1 
ATOM   5884  N  ND1 . HIS C  3  6   ? -49.969 21.183  9.145   1.00 22.53  ? 6   HIS C ND1 1 
ATOM   5885  C  CD2 . HIS C  3  6   ? -51.107 22.754  8.156   1.00 25.57  ? 6   HIS C CD2 1 
ATOM   5886  C  CE1 . HIS C  3  6   ? -49.867 22.271  9.889   1.00 24.45  ? 6   HIS C CE1 1 
ATOM   5887  N  NE2 . HIS C  3  6   ? -50.536 23.245  9.303   1.00 23.60  ? 6   HIS C NE2 1 
ATOM   5888  N  N   . ALA C  3  7   ? -50.865 17.816  8.710   1.00 24.73  ? 7   ALA C N   1 
ATOM   5889  C  CA  . ALA C  3  7   ? -50.527 16.983  9.820   1.00 26.09  ? 7   ALA C CA  1 
ATOM   5890  C  C   . ALA C  3  7   ? -49.227 17.315  10.411  1.00 25.67  ? 7   ALA C C   1 
ATOM   5891  O  O   . ALA C  3  7   ? -48.617 16.438  10.997  1.00 26.62  ? 7   ALA C O   1 
ATOM   5892  C  CB  . ALA C  3  7   ? -50.508 15.543  9.379   1.00 28.51  ? 7   ALA C CB  1 
ATOM   5893  N  N   . TYR C  3  8   ? -48.798 18.565  10.288  1.00 26.94  ? 8   TYR C N   1 
ATOM   5894  C  CA  . TYR C  3  8   ? -47.451 19.004  10.744  1.00 29.51  ? 8   TYR C CA  1 
ATOM   5895  C  C   . TYR C  3  8   ? -47.569 19.800  12.006  1.00 30.50  ? 8   TYR C C   1 
ATOM   5896  O  O   . TYR C  3  8   ? -48.658 20.272  12.368  1.00 35.18  ? 8   TYR C O   1 
ATOM   5897  C  CB  . TYR C  3  8   ? -46.726 19.867  9.693   1.00 29.52  ? 8   TYR C CB  1 
ATOM   5898  C  CG  . TYR C  3  8   ? -46.431 19.117  8.443   1.00 27.23  ? 8   TYR C CG  1 
ATOM   5899  C  CD1 . TYR C  3  8   ? -45.443 18.167  8.423   1.00 27.72  ? 8   TYR C CD1 1 
ATOM   5900  C  CD2 . TYR C  3  8   ? -47.168 19.321  7.299   1.00 27.87  ? 8   TYR C CD2 1 
ATOM   5901  C  CE1 . TYR C  3  8   ? -45.180 17.448  7.286   1.00 28.40  ? 8   TYR C CE1 1 
ATOM   5902  C  CE2 . TYR C  3  8   ? -46.908 18.595  6.149   1.00 27.43  ? 8   TYR C CE2 1 
ATOM   5903  C  CZ  . TYR C  3  8   ? -45.913 17.666  6.160   1.00 27.88  ? 8   TYR C CZ  1 
ATOM   5904  O  OH  . TYR C  3  8   ? -45.645 16.931  5.042   1.00 29.99  ? 8   TYR C OH  1 
ATOM   5905  N  N   . HIS C  3  9   ? -46.447 19.953  12.680  1.00 28.21  ? 9   HIS C N   1 
ATOM   5906  C  CA  . HIS C  3  9   ? -46.488 20.443  14.039  1.00 29.67  ? 9   HIS C CA  1 
ATOM   5907  C  C   . HIS C  3  9   ? -46.051 21.881  14.092  1.00 30.17  ? 9   HIS C C   1 
ATOM   5908  O  O   . HIS C  3  9   ? -44.894 22.209  13.804  1.00 31.63  ? 9   HIS C O   1 
ATOM   5909  C  CB  . HIS C  3  9   ? -45.610 19.551  14.904  1.00 30.46  ? 9   HIS C CB  1 
ATOM   5910  C  CG  . HIS C  3  9   ? -45.593 19.911  16.351  1.00 30.28  ? 9   HIS C CG  1 
ATOM   5911  N  ND1 . HIS C  3  9   ? -44.537 19.588  17.171  1.00 30.64  ? 9   HIS C ND1 1 
ATOM   5912  C  CD2 . HIS C  3  9   ? -46.484 20.577  17.122  1.00 31.72  ? 9   HIS C CD2 1 
ATOM   5913  C  CE1 . HIS C  3  9   ? -44.793 20.022  18.394  1.00 33.33  ? 9   HIS C CE1 1 
ATOM   5914  N  NE2 . HIS C  3  9   ? -45.968 20.627  18.394  1.00 30.48  ? 9   HIS C NE2 1 
ATOM   5915  N  N   . MET C  3  10  ? -46.988 22.741  14.464  1.00 30.38  ? 10  MET C N   1 
ATOM   5916  C  CA  . MET C  3  10  ? -46.695 24.126  14.764  1.00 30.13  ? 10  MET C CA  1 
ATOM   5917  C  C   . MET C  3  10  ? -46.327 24.193  16.228  1.00 29.54  ? 10  MET C C   1 
ATOM   5918  O  O   . MET C  3  10  ? -47.145 23.954  17.035  1.00 32.59  ? 10  MET C O   1 
ATOM   5919  C  CB  . MET C  3  10  ? -47.906 25.000  14.493  1.00 30.72  ? 10  MET C CB  1 
ATOM   5920  C  CG  . MET C  3  10  ? -48.403 24.962  13.051  1.00 32.79  ? 10  MET C CG  1 
ATOM   5921  S  SD  . MET C  3  10  ? -47.222 25.671  11.896  1.00 34.17  ? 10  MET C SD  1 
ATOM   5922  C  CE  . MET C  3  10  ? -46.496 24.163  11.262  1.00 30.65  ? 10  MET C CE  1 
ATOM   5923  N  N   . VAL C  3  11  ? -45.094 24.583  16.539  1.00 29.42  ? 11  VAL C N   1 
ATOM   5924  C  CA  . VAL C  3  11  ? -44.512 24.456  17.841  1.00 28.07  ? 11  VAL C CA  1 
ATOM   5925  C  C   . VAL C  3  11  ? -44.754 25.743  18.597  1.00 27.56  ? 11  VAL C C   1 
ATOM   5926  O  O   . VAL C  3  11  ? -44.681 26.823  18.042  1.00 25.42  ? 11  VAL C O   1 
ATOM   5927  C  CB  . VAL C  3  11  ? -42.975 24.165  17.709  1.00 31.47  ? 11  VAL C CB  1 
ATOM   5928  C  CG1 . VAL C  3  11  ? -42.261 24.095  19.071  1.00 31.95  ? 11  VAL C CG1 1 
ATOM   5929  C  CG2 . VAL C  3  11  ? -42.737 22.883  16.903  1.00 31.93  ? 11  VAL C CG2 1 
ATOM   5930  N  N   . ASN C  3  12  ? -44.993 25.607  19.897  1.00 28.21  ? 12  ASN C N   1 
ATOM   5931  C  CA  . ASN C  3  12  ? -45.330 26.738  20.725  1.00 29.28  ? 12  ASN C CA  1 
ATOM   5932  C  C   . ASN C  3  12  ? -44.106 27.575  20.857  1.00 30.19  ? 12  ASN C C   1 
ATOM   5933  O  O   . ASN C  3  12  ? -43.012 27.049  20.945  1.00 37.68  ? 12  ASN C O   1 
ATOM   5934  C  CB  . ASN C  3  12  ? -45.744 26.313  22.141  1.00 29.73  ? 12  ASN C CB  1 
ATOM   5935  C  CG  . ASN C  3  12  ? -47.024 25.489  22.191  1.00 28.98  ? 12  ASN C CG  1 
ATOM   5936  O  OD1 . ASN C  3  12  ? -47.301 24.893  23.232  1.00 31.50  ? 12  ASN C OD1 1 
ATOM   5937  N  ND2 . ASN C  3  12  ? -47.815 25.468  21.107  1.00 24.89  ? 12  ASN C ND2 1 
ATOM   5938  N  N   . PRO C  3  13  ? -44.272 28.883  20.918  1.00 30.99  ? 13  PRO C N   1 
ATOM   5939  C  CA  . PRO C  3  13  ? -43.085 29.719  21.084  1.00 30.70  ? 13  PRO C CA  1 
ATOM   5940  C  C   . PRO C  3  13  ? -42.209 29.239  22.242  1.00 31.44  ? 13  PRO C C   1 
ATOM   5941  O  O   . PRO C  3  13  ? -42.746 28.859  23.269  1.00 35.59  ? 13  PRO C O   1 
ATOM   5942  C  CB  . PRO C  3  13  ? -43.689 31.081  21.368  1.00 29.80  ? 13  PRO C CB  1 
ATOM   5943  C  CG  . PRO C  3  13  ? -44.960 31.050  20.592  1.00 28.60  ? 13  PRO C CG  1 
ATOM   5944  C  CD  . PRO C  3  13  ? -45.496 29.682  20.728  1.00 28.37  ? 13  PRO C CD  1 
ATOM   5945  N  N   . SER C  3  14  ? -40.889 29.229  22.072  1.00 29.56  ? 14  SER C N   1 
ATOM   5946  C  CA  . SER C  3  14  ? -40.016 28.525  23.024  1.00 29.29  ? 14  SER C CA  1 
ATOM   5947  C  C   . SER C  3  14  ? -38.802 29.344  23.404  1.00 29.52  ? 14  SER C C   1 
ATOM   5948  O  O   . SER C  3  14  ? -38.180 29.925  22.535  1.00 35.02  ? 14  SER C O   1 
ATOM   5949  C  CB  . SER C  3  14  ? -39.550 27.188  22.438  1.00 27.51  ? 14  SER C CB  1 
ATOM   5950  O  OG  . SER C  3  14  ? -38.875 26.386  23.403  1.00 26.35  ? 14  SER C OG  1 
ATOM   5951  N  N   . PRO C  3  15  ? -38.435 29.370  24.694  1.00 27.88  ? 15  PRO C N   1 
ATOM   5952  C  CA  . PRO C  3  15  ? -37.221 30.100  25.103  1.00 28.16  ? 15  PRO C CA  1 
ATOM   5953  C  C   . PRO C  3  15  ? -35.895 29.332  24.947  1.00 27.50  ? 15  PRO C C   1 
ATOM   5954  O  O   . PRO C  3  15  ? -34.844 29.926  25.135  1.00 27.82  ? 15  PRO C O   1 
ATOM   5955  C  CB  . PRO C  3  15  ? -37.457 30.356  26.576  1.00 27.40  ? 15  PRO C CB  1 
ATOM   5956  C  CG  . PRO C  3  15  ? -38.293 29.200  27.003  1.00 27.75  ? 15  PRO C CG  1 
ATOM   5957  C  CD  . PRO C  3  15  ? -39.088 28.717  25.831  1.00 26.32  ? 15  PRO C CD  1 
ATOM   5958  N  N   . TRP C  3  16  ? -35.941 28.048  24.626  1.00 26.72  ? 16  TRP C N   1 
ATOM   5959  C  CA  . TRP C  3  16  ? -34.733 27.205  24.698  1.00 28.77  ? 16  TRP C CA  1 
ATOM   5960  C  C   . TRP C  3  16  ? -33.711 27.425  23.557  1.00 29.12  ? 16  TRP C C   1 
ATOM   5961  O  O   . TRP C  3  16  ? -32.521 27.206  23.754  1.00 27.98  ? 16  TRP C O   1 
ATOM   5962  C  CB  . TRP C  3  16  ? -35.107 25.711  24.767  1.00 29.93  ? 16  TRP C CB  1 
ATOM   5963  C  CG  . TRP C  3  16  ? -36.124 25.402  25.754  1.00 30.12  ? 16  TRP C CG  1 
ATOM   5964  C  CD1 . TRP C  3  16  ? -37.203 24.613  25.573  1.00 30.67  ? 16  TRP C CD1 1 
ATOM   5965  C  CD2 . TRP C  3  16  ? -36.214 25.921  27.088  1.00 30.96  ? 16  TRP C CD2 1 
ATOM   5966  N  NE1 . TRP C  3  16  ? -37.956 24.579  26.716  1.00 31.16  ? 16  TRP C NE1 1 
ATOM   5967  C  CE2 . TRP C  3  16  ? -37.377 25.388  27.656  1.00 30.05  ? 16  TRP C CE2 1 
ATOM   5968  C  CE3 . TRP C  3  16  ? -35.436 26.807  27.850  1.00 30.93  ? 16  TRP C CE3 1 
ATOM   5969  C  CZ2 . TRP C  3  16  ? -37.775 25.688  28.954  1.00 30.68  ? 16  TRP C CZ2 1 
ATOM   5970  C  CZ3 . TRP C  3  16  ? -35.835 27.100  29.123  1.00 30.63  ? 16  TRP C CZ3 1 
ATOM   5971  C  CH2 . TRP C  3  16  ? -36.994 26.545  29.664  1.00 30.14  ? 16  TRP C CH2 1 
ATOM   5972  N  N   . PRO C  3  17  ? -34.186 27.809  22.349  1.00 29.15  ? 17  PRO C N   1 
ATOM   5973  C  CA  . PRO C  3  17  ? -33.232 28.241  21.368  1.00 26.83  ? 17  PRO C CA  1 
ATOM   5974  C  C   . PRO C  3  17  ? -32.371 29.373  21.881  1.00 26.07  ? 17  PRO C C   1 
ATOM   5975  O  O   . PRO C  3  17  ? -31.159 29.270  21.787  1.00 24.94  ? 17  PRO C O   1 
ATOM   5976  C  CB  . PRO C  3  17  ? -34.119 28.652  20.216  1.00 27.46  ? 17  PRO C CB  1 
ATOM   5977  C  CG  . PRO C  3  17  ? -35.193 27.615  20.277  1.00 28.02  ? 17  PRO C CG  1 
ATOM   5978  C  CD  . PRO C  3  17  ? -35.515 27.597  21.731  1.00 27.72  ? 17  PRO C CD  1 
ATOM   5979  N  N   . LEU C  3  18  ? -32.985 30.411  22.443  1.00 29.48  ? 18  LEU C N   1 
ATOM   5980  C  CA  . LEU C  3  18  ? -32.251 31.563  23.029  1.00 31.51  ? 18  LEU C CA  1 
ATOM   5981  C  C   . LEU C  3  18  ? -31.252 31.126  24.113  1.00 31.03  ? 18  LEU C C   1 
ATOM   5982  O  O   . LEU C  3  18  ? -30.091 31.536  24.093  1.00 31.40  ? 18  LEU C O   1 
ATOM   5983  C  CB  . LEU C  3  18  ? -33.224 32.640  23.566  1.00 32.07  ? 18  LEU C CB  1 
ATOM   5984  C  CG  . LEU C  3  18  ? -32.628 33.903  24.231  1.00 33.53  ? 18  LEU C CG  1 
ATOM   5985  C  CD1 . LEU C  3  18  ? -31.587 34.586  23.374  1.00 33.88  ? 18  LEU C CD1 1 
ATOM   5986  C  CD2 . LEU C  3  18  ? -33.730 34.913  24.525  1.00 33.99  ? 18  LEU C CD2 1 
ATOM   5987  N  N   . THR C  3  19  ? -31.692 30.252  25.013  1.00 31.23  ? 19  THR C N   1 
ATOM   5988  C  CA  . THR C  3  19  ? -30.863 29.859  26.155  1.00 30.31  ? 19  THR C CA  1 
ATOM   5989  C  C   . THR C  3  19  ? -29.786 28.919  25.708  1.00 30.72  ? 19  THR C C   1 
ATOM   5990  O  O   . THR C  3  19  ? -28.704 28.965  26.246  1.00 34.32  ? 19  THR C O   1 
ATOM   5991  C  CB  . THR C  3  19  ? -31.651 29.208  27.312  1.00 30.46  ? 19  THR C CB  1 
ATOM   5992  O  OG1 . THR C  3  19  ? -32.193 27.933  26.941  1.00 28.27  ? 19  THR C OG1 1 
ATOM   5993  C  CG2 . THR C  3  19  ? -32.744 30.144  27.797  1.00 31.85  ? 19  THR C CG2 1 
ATOM   5994  N  N   . GLY C  3  20  ? -30.078 28.093  24.715  1.00 28.05  ? 20  GLY C N   1 
ATOM   5995  C  CA  . GLY C  3  20  ? -29.052 27.288  24.086  1.00 30.45  ? 20  GLY C CA  1 
ATOM   5996  C  C   . GLY C  3  20  ? -27.969 28.118  23.403  1.00 30.01  ? 20  GLY C C   1 
ATOM   5997  O  O   . GLY C  3  20  ? -26.768 27.788  23.470  1.00 27.86  ? 20  GLY C O   1 
ATOM   5998  N  N   . ALA C  3  21  ? -28.395 29.191  22.745  1.00 29.31  ? 21  ALA C N   1 
ATOM   5999  C  CA  . ALA C  3  21  ? -27.480 30.058  22.044  1.00 30.04  ? 21  ALA C CA  1 
ATOM   6000  C  C   . ALA C  3  21  ? -26.629 30.787  23.049  1.00 30.51  ? 21  ALA C C   1 
ATOM   6001  O  O   . ALA C  3  21  ? -25.398 30.838  22.917  1.00 30.65  ? 21  ALA C O   1 
ATOM   6002  C  CB  . ALA C  3  21  ? -28.243 31.066  21.186  1.00 30.78  ? 21  ALA C CB  1 
ATOM   6003  N  N   . LEU C  3  22  ? -27.282 31.356  24.060  1.00 30.61  ? 22  LEU C N   1 
ATOM   6004  C  CA  . LEU C  3  22  ? -26.532 32.034  25.111  1.00 32.36  ? 22  LEU C CA  1 
ATOM   6005  C  C   . LEU C  3  22  ? -25.596 31.062  25.808  1.00 30.97  ? 22  LEU C C   1 
ATOM   6006  O  O   . LEU C  3  22  ? -24.476 31.422  26.170  1.00 29.96  ? 22  LEU C O   1 
ATOM   6007  C  CB  . LEU C  3  22  ? -27.456 32.740  26.110  1.00 32.25  ? 22  LEU C CB  1 
ATOM   6008  C  CG  . LEU C  3  22  ? -28.180 33.957  25.544  1.00 32.75  ? 22  LEU C CG  1 
ATOM   6009  C  CD1 . LEU C  3  22  ? -28.986 34.589  26.656  1.00 36.13  ? 22  LEU C CD1 1 
ATOM   6010  C  CD2 . LEU C  3  22  ? -27.199 34.940  24.957  1.00 32.72  ? 22  LEU C CD2 1 
ATOM   6011  N  N   . SER C  3  23  ? -26.034 29.822  25.956  1.00 30.37  ? 23  SER C N   1 
ATOM   6012  C  CA  . SER C  3  23  ? -25.223 28.847  26.651  1.00 30.86  ? 23  SER C CA  1 
ATOM   6013  C  C   . SER C  3  23  ? -23.966 28.486  25.841  1.00 30.77  ? 23  SER C C   1 
ATOM   6014  O  O   . SER C  3  23  ? -22.905 28.227  26.427  1.00 34.24  ? 23  SER C O   1 
ATOM   6015  C  CB  . SER C  3  23  ? -26.052 27.625  27.082  1.00 31.10  ? 23  SER C CB  1 
ATOM   6016  O  OG  . SER C  3  23  ? -26.239 26.777  25.984  1.00 38.14  ? 23  SER C OG  1 
ATOM   6017  N  N   . ALA C  3  24  ? -24.083 28.498  24.515  1.00 28.19  ? 24  ALA C N   1 
ATOM   6018  C  CA  . ALA C  3  24  ? -22.955 28.379  23.619  1.00 25.69  ? 24  ALA C CA  1 
ATOM   6019  C  C   . ALA C  3  24  ? -21.987 29.567  23.758  1.00 25.27  ? 24  ALA C C   1 
ATOM   6020  O  O   . ALA C  3  24  ? -20.771 29.383  23.673  1.00 25.30  ? 24  ALA C O   1 
ATOM   6021  C  CB  . ALA C  3  24  ? -23.440 28.239  22.175  1.00 26.43  ? 24  ALA C CB  1 
ATOM   6022  N  N   . LEU C  3  25  ? -22.500 30.769  23.992  1.00 26.12  ? 25  LEU C N   1 
ATOM   6023  C  CA  . LEU C  3  25  ? -21.624 31.908  24.223  1.00 27.20  ? 25  LEU C CA  1 
ATOM   6024  C  C   . LEU C  3  25  ? -20.796 31.725  25.479  1.00 27.74  ? 25  LEU C C   1 
ATOM   6025  O  O   . LEU C  3  25  ? -19.611 32.030  25.504  1.00 26.82  ? 25  LEU C O   1 
ATOM   6026  C  CB  . LEU C  3  25  ? -22.416 33.204  24.325  1.00 28.58  ? 25  LEU C CB  1 
ATOM   6027  C  CG  . LEU C  3  25  ? -21.574 34.447  24.658  1.00 31.34  ? 25  LEU C CG  1 
ATOM   6028  C  CD1 . LEU C  3  25  ? -20.492 34.719  23.638  1.00 31.66  ? 25  LEU C CD1 1 
ATOM   6029  C  CD2 . LEU C  3  25  ? -22.455 35.673  24.792  1.00 33.56  ? 25  LEU C CD2 1 
ATOM   6030  N  N   . LEU C  3  26  ? -21.430 31.206  26.517  1.00 30.10  ? 26  LEU C N   1 
ATOM   6031  C  CA  . LEU C  3  26  ? -20.794 31.094  27.825  1.00 29.97  ? 26  LEU C CA  1 
ATOM   6032  C  C   . LEU C  3  26  ? -19.762 29.994  27.856  1.00 29.69  ? 26  LEU C C   1 
ATOM   6033  O  O   . LEU C  3  26  ? -18.778 30.149  28.541  1.00 26.78  ? 26  LEU C O   1 
ATOM   6034  C  CB  . LEU C  3  26  ? -21.831 30.834  28.928  1.00 29.98  ? 26  LEU C CB  1 
ATOM   6035  C  CG  . LEU C  3  26  ? -22.969 31.844  29.095  1.00 30.24  ? 26  LEU C CG  1 
ATOM   6036  C  CD1 . LEU C  3  26  ? -23.950 31.430  30.195  1.00 30.49  ? 26  LEU C CD1 1 
ATOM   6037  C  CD2 . LEU C  3  26  ? -22.440 33.247  29.336  1.00 31.13  ? 26  LEU C CD2 1 
ATOM   6038  N  N   . MET C  3  27  ? -20.006 28.881  27.154  1.00 30.70  ? 27  MET C N   1 
ATOM   6039  C  CA  . MET C  3  27  ? -19.043 27.782  27.082  1.00 32.60  ? 27  MET C CA  1 
ATOM   6040  C  C   . MET C  3  27  ? -17.830 28.198  26.256  1.00 34.19  ? 27  MET C C   1 
ATOM   6041  O  O   . MET C  3  27  ? -16.703 27.890  26.626  1.00 34.00  ? 27  MET C O   1 
ATOM   6042  C  CB  . MET C  3  27  ? -19.647 26.508  26.479  1.00 33.53  ? 27  MET C CB  1 
ATOM   6043  C  CG  . MET C  3  27  ? -20.607 25.745  27.391  1.00 36.58  ? 27  MET C CG  1 
ATOM   6044  S  SD  . MET C  3  27  ? -21.252 24.196  26.678  1.00 38.31  ? 27  MET C SD  1 
ATOM   6045  C  CE  . MET C  3  27  ? -22.324 24.922  25.448  1.00 37.39  ? 27  MET C CE  1 
ATOM   6046  N  N   . THR C  3  28  ? -18.052 28.868  25.124  1.00 35.02  ? 28  THR C N   1 
ATOM   6047  C  CA  . THR C  3  28  ? -16.935 29.315  24.292  1.00 34.14  ? 28  THR C CA  1 
ATOM   6048  C  C   . THR C  3  28  ? -16.113 30.423  24.957  1.00 33.69  ? 28  THR C C   1 
ATOM   6049  O  O   . THR C  3  28  ? -14.887 30.365  24.971  1.00 31.73  ? 28  THR C O   1 
ATOM   6050  C  CB  . THR C  3  28  ? -17.406 29.863  22.956  1.00 33.66  ? 28  THR C CB  1 
ATOM   6051  O  OG1 . THR C  3  28  ? -18.469 30.794  23.189  1.00 33.41  ? 28  THR C OG1 1 
ATOM   6052  C  CG2 . THR C  3  28  ? -17.862 28.737  22.088  1.00 35.05  ? 28  THR C CG2 1 
ATOM   6053  N  N   . SER C  3  29  ? -16.778 31.444  25.495  1.00 35.44  ? 29  SER C N   1 
ATOM   6054  C  CA  . SER C  3  29  ? -16.039 32.516  26.134  1.00 33.58  ? 29  SER C CA  1 
ATOM   6055  C  C   . SER C  3  29  ? -15.452 31.954  27.441  1.00 34.18  ? 29  SER C C   1 
ATOM   6056  O  O   . SER C  3  29  ? -14.342 32.294  27.837  1.00 35.98  ? 29  SER C O   1 
ATOM   6057  C  CB  . SER C  3  29  ? -16.875 33.794  26.211  1.00 33.36  ? 29  SER C CB  1 
ATOM   6058  O  OG  . SER C  3  29  ? -17.849 33.750  27.193  1.00 38.86  ? 29  SER C OG  1 
ATOM   6059  N  N   . GLY C  3  30  ? -16.119 30.956  28.005  1.00 34.36  ? 30  GLY C N   1 
ATOM   6060  C  CA  . GLY C  3  30  ? -15.621 30.228  29.174  1.00 34.55  ? 30  GLY C CA  1 
ATOM   6061  C  C   . GLY C  3  30  ? -14.326 29.495  28.973  1.00 33.50  ? 30  GLY C C   1 
ATOM   6062  O  O   . GLY C  3  30  ? -13.427 29.594  29.786  1.00 34.89  ? 30  GLY C O   1 
ATOM   6063  N  N   . LEU C  3  31  ? -14.253 28.736  27.897  1.00 34.31  ? 31  LEU C N   1 
ATOM   6064  C  CA  . LEU C  3  31  ? -13.044 28.034  27.510  1.00 34.82  ? 31  LEU C CA  1 
ATOM   6065  C  C   . LEU C  3  31  ? -11.898 29.010  27.205  1.00 35.94  ? 31  LEU C C   1 
ATOM   6066  O  O   . LEU C  3  31  ? -10.742 28.682  27.414  1.00 36.98  ? 31  LEU C O   1 
ATOM   6067  C  CB  . LEU C  3  31  ? -13.308 27.173  26.267  1.00 36.06  ? 31  LEU C CB  1 
ATOM   6068  C  CG  . LEU C  3  31  ? -13.953 25.822  26.489  1.00 37.52  ? 31  LEU C CG  1 
ATOM   6069  C  CD1 . LEU C  3  31  ? -14.561 25.321  25.184  1.00 41.13  ? 31  LEU C CD1 1 
ATOM   6070  C  CD2 . LEU C  3  31  ? -12.945 24.817  27.003  1.00 38.14  ? 31  LEU C CD2 1 
ATOM   6071  N  N   . THR C  3  32  ? -12.227 30.178  26.663  1.00 37.48  ? 32  THR C N   1 
ATOM   6072  C  CA  . THR C  3  32  ? -11.252 31.223  26.407  1.00 38.55  ? 32  THR C CA  1 
ATOM   6073  C  C   . THR C  3  32  ? -10.691 31.734  27.740  1.00 39.02  ? 32  THR C C   1 
ATOM   6074  O  O   . THR C  3  32  ? -9.465  31.866  27.910  1.00 34.83  ? 32  THR C O   1 
ATOM   6075  C  CB  . THR C  3  32  ? -11.874 32.354  25.562  1.00 38.39  ? 32  THR C CB  1 
ATOM   6076  O  OG1 . THR C  3  32  ? -12.380 31.797  24.340  1.00 39.35  ? 32  THR C OG1 1 
ATOM   6077  C  CG2 . THR C  3  32  ? -10.850 33.418  25.228  1.00 37.48  ? 32  THR C CG2 1 
ATOM   6078  N  N   . MET C  3  33  ? -11.605 31.965  28.685  1.00 41.65  ? 33  MET C N   1 
ATOM   6079  C  CA  . MET C  3  33  ? -11.245 32.378  30.043  1.00 41.49  ? 33  MET C CA  1 
ATOM   6080  C  C   . MET C  3  33  ? -10.376 31.277  30.658  1.00 38.25  ? 33  MET C C   1 
ATOM   6081  O  O   . MET C  3  33  ? -9.363  31.565  31.262  1.00 34.57  ? 33  MET C O   1 
ATOM   6082  C  CB  . MET C  3  33  ? -12.498 32.716  30.905  1.00 45.56  ? 33  MET C CB  1 
ATOM   6083  C  CG  . MET C  3  33  ? -12.511 34.130  31.507  1.00 54.59  ? 33  MET C CG  1 
ATOM   6084  S  SD  . MET C  3  33  ? -12.131 35.461  30.307  1.00 67.68  ? 33  MET C SD  1 
ATOM   6085  C  CE  . MET C  3  33  ? -11.452 36.765  31.342  1.00 60.80  ? 33  MET C CE  1 
ATOM   6086  N  N   . TRP C  3  34  ? -10.720 30.013  30.436  1.00 37.92  ? 34  TRP C N   1 
ATOM   6087  C  CA  . TRP C  3  34  ? -9.949  28.935  31.026  1.00 38.59  ? 34  TRP C CA  1 
ATOM   6088  C  C   . TRP C  3  34  ? -8.555  28.836  30.452  1.00 40.14  ? 34  TRP C C   1 
ATOM   6089  O  O   . TRP C  3  34  ? -7.598  28.762  31.205  1.00 43.62  ? 34  TRP C O   1 
ATOM   6090  C  CB  . TRP C  3  34  ? -10.651 27.621  30.879  1.00 40.80  ? 34  TRP C CB  1 
ATOM   6091  C  CG  . TRP C  3  34  ? -10.018 26.532  31.636  1.00 42.81  ? 34  TRP C CG  1 
ATOM   6092  C  CD1 . TRP C  3  34  ? -9.498  26.593  32.882  1.00 46.10  ? 34  TRP C CD1 1 
ATOM   6093  C  CD2 . TRP C  3  34  ? -9.863  25.197  31.198  1.00 41.78  ? 34  TRP C CD2 1 
ATOM   6094  N  NE1 . TRP C  3  34  ? -9.021  25.360  33.249  1.00 45.84  ? 34  TRP C NE1 1 
ATOM   6095  C  CE2 . TRP C  3  34  ? -9.234  24.491  32.225  1.00 41.42  ? 34  TRP C CE2 1 
ATOM   6096  C  CE3 . TRP C  3  34  ? -10.196 24.531  30.022  1.00 46.21  ? 34  TRP C CE3 1 
ATOM   6097  C  CZ2 . TRP C  3  34  ? -8.935  23.163  32.128  1.00 46.28  ? 34  TRP C CZ2 1 
ATOM   6098  C  CZ3 . TRP C  3  34  ? -9.893  23.215  29.915  1.00 50.34  ? 34  TRP C CZ3 1 
ATOM   6099  C  CH2 . TRP C  3  34  ? -9.261  22.532  30.964  1.00 49.99  ? 34  TRP C CH2 1 
ATOM   6100  N  N   . PHE C  3  35  ? -8.445  28.861  29.129  1.00 38.89  ? 35  PHE C N   1 
ATOM   6101  C  CA  . PHE C  3  35  ? -7.159  28.709  28.467  1.00 37.12  ? 35  PHE C CA  1 
ATOM   6102  C  C   . PHE C  3  35  ? -6.150  29.856  28.690  1.00 37.16  ? 35  PHE C C   1 
ATOM   6103  O  O   . PHE C  3  35  ? -4.957  29.605  28.671  1.00 37.42  ? 35  PHE C O   1 
ATOM   6104  C  CB  . PHE C  3  35  ? -7.357  28.536  26.965  1.00 37.96  ? 35  PHE C CB  1 
ATOM   6105  C  CG  . PHE C  3  35  ? -7.946  27.206  26.532  1.00 39.53  ? 35  PHE C CG  1 
ATOM   6106  C  CD1 . PHE C  3  35  ? -7.737  26.019  27.236  1.00 40.73  ? 35  PHE C CD1 1 
ATOM   6107  C  CD2 . PHE C  3  35  ? -8.638  27.136  25.330  1.00 38.47  ? 35  PHE C CD2 1 
ATOM   6108  C  CE1 . PHE C  3  35  ? -8.237  24.814  26.761  1.00 40.50  ? 35  PHE C CE1 1 
ATOM   6109  C  CE2 . PHE C  3  35  ? -9.123  25.928  24.853  1.00 39.95  ? 35  PHE C CE2 1 
ATOM   6110  C  CZ  . PHE C  3  35  ? -8.931  24.772  25.573  1.00 39.11  ? 35  PHE C CZ  1 
ATOM   6111  N  N   . HIS C  3  36  ? -6.617  31.090  28.864  1.00 35.93  ? 36  HIS C N   1 
ATOM   6112  C  CA  . HIS C  3  36  ? -5.737  32.257  28.874  1.00 38.73  ? 36  HIS C CA  1 
ATOM   6113  C  C   . HIS C  3  36  ? -5.705  33.070  30.164  1.00 42.97  ? 36  HIS C C   1 
ATOM   6114  O  O   . HIS C  3  36  ? -4.671  33.640  30.499  1.00 46.85  ? 36  HIS C O   1 
ATOM   6115  C  CB  . HIS C  3  36  ? -6.090  33.210  27.738  1.00 36.53  ? 36  HIS C CB  1 
ATOM   6116  C  CG  . HIS C  3  36  ? -5.864  32.633  26.386  1.00 37.52  ? 36  HIS C CG  1 
ATOM   6117  N  ND1 . HIS C  3  36  ? -6.886  32.094  25.644  1.00 41.10  ? 36  HIS C ND1 1 
ATOM   6118  C  CD2 . HIS C  3  36  ? -4.745  32.491  25.640  1.00 40.34  ? 36  HIS C CD2 1 
ATOM   6119  C  CE1 . HIS C  3  36  ? -6.412  31.638  24.502  1.00 38.22  ? 36  HIS C CE1 1 
ATOM   6120  N  NE2 . HIS C  3  36  ? -5.114  31.863  24.471  1.00 40.68  ? 36  HIS C NE2 1 
ATOM   6121  N  N   . PHE C  3  37  ? -6.828  33.173  30.861  1.00 51.16  ? 37  PHE C N   1 
ATOM   6122  C  CA  . PHE C  3  37  ? -6.902  33.968  32.108  1.00 54.61  ? 37  PHE C CA  1 
ATOM   6123  C  C   . PHE C  3  37  ? -7.167  33.028  33.305  1.00 51.51  ? 37  PHE C C   1 
ATOM   6124  O  O   . PHE C  3  37  ? -7.742  33.413  34.297  1.00 50.68  ? 37  PHE C O   1 
ATOM   6125  C  CB  . PHE C  3  37  ? -7.924  35.132  31.959  1.00 54.16  ? 37  PHE C CB  1 
ATOM   6126  C  CG  . PHE C  3  37  ? -7.760  35.950  30.660  1.00 60.65  ? 37  PHE C CG  1 
ATOM   6127  C  CD1 . PHE C  3  37  ? -6.774  36.940  30.540  1.00 62.08  ? 37  PHE C CD1 1 
ATOM   6128  C  CD2 . PHE C  3  37  ? -8.602  35.721  29.539  1.00 62.59  ? 37  PHE C CD2 1 
ATOM   6129  C  CE1 . PHE C  3  37  ? -6.644  37.676  29.358  1.00 62.42  ? 37  PHE C CE1 1 
ATOM   6130  C  CE2 . PHE C  3  37  ? -8.470  36.458  28.363  1.00 53.93  ? 37  PHE C CE2 1 
ATOM   6131  C  CZ  . PHE C  3  37  ? -7.493  37.432  28.276  1.00 59.19  ? 37  PHE C CZ  1 
ATOM   6132  N  N   . ASN C  3  38  ? -6.646  31.810  33.187  1.00 55.24  ? 38  ASN C N   1 
ATOM   6133  C  CA  . ASN C  3  38  ? -6.880  30.687  34.081  1.00 61.19  ? 38  ASN C CA  1 
ATOM   6134  C  C   . ASN C  3  38  ? -8.078  30.766  35.036  1.00 58.43  ? 38  ASN C C   1 
ATOM   6135  O  O   . ASN C  3  38  ? -7.923  30.900  36.243  1.00 68.31  ? 38  ASN C O   1 
ATOM   6136  C  CB  . ASN C  3  38  ? -5.568  30.319  34.818  1.00 69.83  ? 38  ASN C CB  1 
ATOM   6137  C  CG  . ASN C  3  38  ? -5.325  28.809  34.833  1.00 80.45  ? 38  ASN C CG  1 
ATOM   6138  O  OD1 . ASN C  3  38  ? -6.282  28.014  34.950  1.00 92.09  ? 38  ASN C OD1 1 
ATOM   6139  N  ND2 . ASN C  3  38  ? -4.059  28.400  34.680  1.00 70.85  ? 38  ASN C ND2 1 
ATOM   6140  N  N   . SER C  3  39  ? -9.277  30.694  34.479  1.00 51.38  ? 39  SER C N   1 
ATOM   6141  C  CA  . SER C  3  39  ? -10.481 30.669  35.291  1.00 50.30  ? 39  SER C CA  1 
ATOM   6142  C  C   . SER C  3  39  ? -11.609 29.844  34.690  1.00 45.47  ? 39  SER C C   1 
ATOM   6143  O  O   . SER C  3  39  ? -11.926 29.974  33.508  1.00 45.62  ? 39  SER C O   1 
ATOM   6144  C  CB  . SER C  3  39  ? -10.964 32.083  35.530  1.00 50.31  ? 39  SER C CB  1 
ATOM   6145  O  OG  . SER C  3  39  ? -12.183 32.045  36.250  1.00 55.52  ? 39  SER C OG  1 
ATOM   6146  N  N   . MET C  3  40  ? -12.230 29.026  35.529  1.00 43.42  ? 40  MET C N   1 
ATOM   6147  C  CA  . MET C  3  40  ? -13.301 28.117  35.107  1.00 47.45  ? 40  MET C CA  1 
ATOM   6148  C  C   . MET C  3  40  ? -14.724 28.611  35.334  1.00 43.37  ? 40  MET C C   1 
ATOM   6149  O  O   . MET C  3  40  ? -15.664 27.956  34.914  1.00 44.24  ? 40  MET C O   1 
ATOM   6150  C  CB  . MET C  3  40  ? -13.150 26.780  35.812  1.00 52.25  ? 40  MET C CB  1 
ATOM   6151  C  CG  . MET C  3  40  ? -11.843 26.093  35.486  1.00 60.00  ? 40  MET C CG  1 
ATOM   6152  S  SD  . MET C  3  40  ? -12.100 24.379  35.028  1.00 69.54  ? 40  MET C SD  1 
ATOM   6153  C  CE  . MET C  3  40  ? -12.836 23.783  36.559  1.00 74.24  ? 40  MET C CE  1 
ATOM   6154  N  N   . THR C  3  41  ? -14.888 29.752  35.982  1.00 44.01  ? 41  THR C N   1 
ATOM   6155  C  CA  . THR C  3  41  ? -16.211 30.238  36.382  1.00 46.32  ? 41  THR C CA  1 
ATOM   6156  C  C   . THR C  3  41  ? -17.219 30.303  35.225  1.00 42.98  ? 41  THR C C   1 
ATOM   6157  O  O   . THR C  3  41  ? -18.281 29.680  35.313  1.00 39.37  ? 41  THR C O   1 
ATOM   6158  C  CB  . THR C  3  41  ? -16.083 31.632  37.047  1.00 54.38  ? 41  THR C CB  1 
ATOM   6159  O  OG1 . THR C  3  41  ? -15.390 31.489  38.294  1.00 53.09  ? 41  THR C OG1 1 
ATOM   6160  C  CG2 . THR C  3  41  ? -17.472 32.325  37.277  1.00 53.67  ? 41  THR C CG2 1 
ATOM   6161  N  N   . LEU C  3  42  ? -16.884 31.074  34.178  1.00 40.88  ? 42  LEU C N   1 
ATOM   6162  C  CA  . LEU C  3  42  ? -17.723 31.159  32.971  1.00 38.97  ? 42  LEU C CA  1 
ATOM   6163  C  C   . LEU C  3  42  ? -18.046 29.811  32.352  1.00 36.77  ? 42  LEU C C   1 
ATOM   6164  O  O   . LEU C  3  42  ? -19.191 29.546  31.990  1.00 38.36  ? 42  LEU C O   1 
ATOM   6165  C  CB  . LEU C  3  42  ? -17.088 32.000  31.874  1.00 35.91  ? 42  LEU C CB  1 
ATOM   6166  C  CG  . LEU C  3  42  ? -17.642 33.396  31.726  1.00 38.92  ? 42  LEU C CG  1 
ATOM   6167  C  CD1 . LEU C  3  42  ? -17.067 33.972  30.457  1.00 38.00  ? 42  LEU C CD1 1 
ATOM   6168  C  CD2 . LEU C  3  42  ? -19.171 33.441  31.707  1.00 39.71  ? 42  LEU C CD2 1 
ATOM   6169  N  N   . LEU C  3  43  ? -17.027 28.987  32.213  1.00 34.58  ? 43  LEU C N   1 
ATOM   6170  C  CA  . LEU C  3  43  ? -17.190 27.671  31.641  1.00 36.73  ? 43  LEU C CA  1 
ATOM   6171  C  C   . LEU C  3  43  ? -18.230 26.848  32.387  1.00 38.98  ? 43  LEU C C   1 
ATOM   6172  O  O   . LEU C  3  43  ? -19.108 26.254  31.772  1.00 39.99  ? 43  LEU C O   1 
ATOM   6173  C  CB  . LEU C  3  43  ? -15.860 26.922  31.612  1.00 33.61  ? 43  LEU C CB  1 
ATOM   6174  C  CG  . LEU C  3  43  ? -15.915 25.509  31.045  1.00 33.43  ? 43  LEU C CG  1 
ATOM   6175  C  CD1 . LEU C  3  43  ? -16.526 25.471  29.664  1.00 33.97  ? 43  LEU C CD1 1 
ATOM   6176  C  CD2 . LEU C  3  43  ? -14.523 24.947  31.006  1.00 35.77  ? 43  LEU C CD2 1 
ATOM   6177  N  N   . MET C  3  44  ? -18.135 26.832  33.709  1.00 43.86  ? 44  MET C N   1 
ATOM   6178  C  CA  . MET C  3  44  ? -19.067 26.073  34.519  1.00 43.90  ? 44  MET C CA  1 
ATOM   6179  C  C   . MET C  3  44  ? -20.458 26.621  34.409  1.00 38.19  ? 44  MET C C   1 
ATOM   6180  O  O   . MET C  3  44  ? -21.386 25.856  34.318  1.00 35.88  ? 44  MET C O   1 
ATOM   6181  C  CB  . MET C  3  44  ? -18.609 26.006  35.957  1.00 51.73  ? 44  MET C CB  1 
ATOM   6182  C  CG  . MET C  3  44  ? -17.532 24.947  36.137  1.00 61.32  ? 44  MET C CG  1 
ATOM   6183  S  SD  . MET C  3  44  ? -16.934 24.878  37.841  1.00 90.58  ? 44  MET C SD  1 
ATOM   6184  C  CE  . MET C  3  44  ? -16.668 26.594  38.323  1.00 79.86  ? 44  MET C CE  1 
ATOM   6185  N  N   . ILE C  3  45  ? -20.611 27.929  34.346  1.00 37.16  ? 45  ILE C N   1 
ATOM   6186  C  CA  . ILE C  3  45  ? -21.939 28.483  34.167  1.00 40.59  ? 45  ILE C CA  1 
ATOM   6187  C  C   . ILE C  3  45  ? -22.526 28.054  32.814  1.00 37.67  ? 45  ILE C C   1 
ATOM   6188  O  O   . ILE C  3  45  ? -23.695 27.682  32.734  1.00 42.04  ? 45  ILE C O   1 
ATOM   6189  C  CB  . ILE C  3  45  ? -21.948 30.012  34.274  1.00 45.91  ? 45  ILE C CB  1 
ATOM   6190  C  CG1 . ILE C  3  45  ? -21.553 30.450  35.674  1.00 46.30  ? 45  ILE C CG1 1 
ATOM   6191  C  CG2 . ILE C  3  45  ? -23.348 30.569  33.974  1.00 47.45  ? 45  ILE C CG2 1 
ATOM   6192  C  CD1 . ILE C  3  45  ? -21.302 31.951  35.757  1.00 50.80  ? 45  ILE C CD1 1 
ATOM   6193  N  N   . GLY C  3  46  ? -21.724 28.094  31.759  1.00 34.44  ? 46  GLY C N   1 
ATOM   6194  C  CA  . GLY C  3  46  ? -22.189 27.683  30.429  1.00 32.70  ? 46  GLY C CA  1 
ATOM   6195  C  C   . GLY C  3  46  ? -22.583 26.211  30.383  1.00 31.32  ? 46  GLY C C   1 
ATOM   6196  O  O   . GLY C  3  46  ? -23.631 25.854  29.861  1.00 29.36  ? 46  GLY C O   1 
ATOM   6197  N  N   . LEU C  3  47  ? -21.737 25.351  30.933  1.00 31.87  ? 47  LEU C N   1 
ATOM   6198  C  CA  . LEU C  3  47  ? -22.063 23.920  31.038  1.00 34.13  ? 47  LEU C CA  1 
ATOM   6199  C  C   . LEU C  3  47  ? -23.392 23.680  31.737  1.00 32.50  ? 47  LEU C C   1 
ATOM   6200  O  O   . LEU C  3  47  ? -24.139 22.842  31.309  1.00 30.60  ? 47  LEU C O   1 
ATOM   6201  C  CB  . LEU C  3  47  ? -20.945 23.140  31.750  1.00 36.19  ? 47  LEU C CB  1 
ATOM   6202  C  CG  . LEU C  3  47  ? -19.662 22.841  30.938  1.00 38.93  ? 47  LEU C CG  1 
ATOM   6203  C  CD1 . LEU C  3  47  ? -18.595 22.191  31.798  1.00 41.64  ? 47  LEU C CD1 1 
ATOM   6204  C  CD2 . LEU C  3  47  ? -19.953 21.918  29.778  1.00 40.52  ? 47  LEU C CD2 1 
ATOM   6205  N  N   . THR C  3  48  ? -23.686 24.454  32.778  1.00 33.37  ? 48  THR C N   1 
ATOM   6206  C  CA  . THR C  3  48  ? -24.910 24.295  33.542  1.00 36.63  ? 48  THR C CA  1 
ATOM   6207  C  C   . THR C  3  48  ? -26.126 24.713  32.726  1.00 37.15  ? 48  THR C C   1 
ATOM   6208  O  O   . THR C  3  48  ? -27.176 24.016  32.768  1.00 37.85  ? 48  THR C O   1 
ATOM   6209  C  CB  . THR C  3  48  ? -24.923 25.077  34.905  1.00 37.31  ? 48  THR C CB  1 
ATOM   6210  O  OG1 . THR C  3  48  ? -23.787 24.716  35.676  1.00 34.48  ? 48  THR C OG1 1 
ATOM   6211  C  CG2 . THR C  3  48  ? -26.183 24.701  35.761  1.00 37.99  ? 48  THR C CG2 1 
ATOM   6212  N  N   . THR C  3  49  ? -26.010 25.833  32.010  1.00 34.45  ? 49  THR C N   1 
ATOM   6213  C  CA  . THR C  3  49  ? -27.154 26.320  31.240  1.00 33.08  ? 49  THR C CA  1 
ATOM   6214  C  C   . THR C  3  49  ? -27.346 25.484  29.996  1.00 31.76  ? 49  THR C C   1 
ATOM   6215  O  O   . THR C  3  49  ? -28.465 25.344  29.520  1.00 33.28  ? 49  THR C O   1 
ATOM   6216  C  CB  . THR C  3  49  ? -26.989 27.782  30.881  1.00 34.30  ? 49  THR C CB  1 
ATOM   6217  O  OG1 . THR C  3  49  ? -25.713 27.969  30.268  1.00 34.37  ? 49  THR C OG1 1 
ATOM   6218  C  CG2 . THR C  3  49  ? -27.061 28.617  32.136  1.00 34.05  ? 49  THR C CG2 1 
ATOM   6219  N  N   . ASN C  3  50  ? -26.265 24.886  29.501  1.00 32.72  ? 50  ASN C N   1 
ATOM   6220  C  CA  . ASN C  3  50  ? -26.362 23.906  28.426  1.00 34.11  ? 50  ASN C CA  1 
ATOM   6221  C  C   . ASN C  3  50  ? -27.202 22.697  28.790  1.00 33.77  ? 50  ASN C C   1 
ATOM   6222  O  O   . ASN C  3  50  ? -28.072 22.309  28.023  1.00 33.09  ? 50  ASN C O   1 
ATOM   6223  C  CB  . ASN C  3  50  ? -24.997 23.422  27.936  1.00 33.65  ? 50  ASN C CB  1 
ATOM   6224  C  CG  . ASN C  3  50  ? -25.134 22.597  26.670  1.00 34.63  ? 50  ASN C CG  1 
ATOM   6225  O  OD1 . ASN C  3  50  ? -25.498 23.144  25.631  1.00 35.11  ? 50  ASN C OD1 1 
ATOM   6226  N  ND2 . ASN C  3  50  ? -24.965 21.275  26.774  1.00 31.11  ? 50  ASN C ND2 1 
ATOM   6227  N  N   . MET C  3  51  ? -26.927 22.110  29.951  1.00 39.43  ? 51  MET C N   1 
ATOM   6228  C  CA  . MET C  3  51  ? -27.617 20.881  30.400  1.00 43.09  ? 51  MET C CA  1 
ATOM   6229  C  C   . MET C  3  51  ? -29.083 21.201  30.693  1.00 39.30  ? 51  MET C C   1 
ATOM   6230  O  O   . MET C  3  51  ? -29.985 20.426  30.361  1.00 39.52  ? 51  MET C O   1 
ATOM   6231  C  CB  . MET C  3  51  ? -27.015 20.296  31.684  1.00 53.18  ? 51  MET C CB  1 
ATOM   6232  C  CG  . MET C  3  51  ? -25.501 20.164  31.817  1.00 60.98  ? 51  MET C CG  1 
ATOM   6233  S  SD  . MET C  3  51  ? -24.881 18.649  31.127  1.00 82.07  ? 51  MET C SD  1 
ATOM   6234  C  CE  . MET C  3  51  ? -24.713 19.139  29.402  1.00 79.97  ? 51  MET C CE  1 
ATOM   6235  N  N   . LEU C  3  52  ? -29.312 22.328  31.356  1.00 34.59  ? 52  LEU C N   1 
ATOM   6236  C  CA  . LEU C  3  52  ? -30.665 22.791  31.595  1.00 34.53  ? 52  LEU C CA  1 
ATOM   6237  C  C   . LEU C  3  52  ? -31.455 23.016  30.306  1.00 33.33  ? 52  LEU C C   1 
ATOM   6238  O  O   . LEU C  3  52  ? -32.618 22.630  30.221  1.00 35.31  ? 52  LEU C O   1 
ATOM   6239  C  CB  . LEU C  3  52  ? -30.662 24.079  32.406  1.00 36.28  ? 52  LEU C CB  1 
ATOM   6240  C  CG  . LEU C  3  52  ? -30.330 24.023  33.883  1.00 37.35  ? 52  LEU C CG  1 
ATOM   6241  C  CD1 . LEU C  3  52  ? -30.188 25.454  34.381  1.00 41.84  ? 52  LEU C CD1 1 
ATOM   6242  C  CD2 . LEU C  3  52  ? -31.422 23.312  34.656  1.00 38.37  ? 52  LEU C CD2 1 
ATOM   6243  N  N   . THR C  3  53  ? -30.835 23.648  29.317  1.00 32.89  ? 53  THR C N   1 
ATOM   6244  C  CA  . THR C  3  53  ? -31.488 23.847  28.039  1.00 32.50  ? 53  THR C CA  1 
ATOM   6245  C  C   . THR C  3  53  ? -31.836 22.522  27.358  1.00 33.33  ? 53  THR C C   1 
ATOM   6246  O  O   . THR C  3  53  ? -32.962 22.356  26.879  1.00 32.95  ? 53  THR C O   1 
ATOM   6247  C  CB  . THR C  3  53  ? -30.636 24.706  27.116  1.00 31.64  ? 53  THR C CB  1 
ATOM   6248  O  OG1 . THR C  3  53  ? -30.569 26.035  27.648  1.00 35.47  ? 53  THR C OG1 1 
ATOM   6249  C  CG2 . THR C  3  53  ? -31.241 24.755  25.705  1.00 31.61  ? 53  THR C CG2 1 
ATOM   6250  N  N   . MET C  3  54  ? -30.866 21.609  27.301  1.00 34.06  ? 54  MET C N   1 
ATOM   6251  C  CA  . MET C  3  54  ? -31.069 20.270  26.728  1.00 35.66  ? 54  MET C CA  1 
ATOM   6252  C  C   . MET C  3  54  ? -32.187 19.474  27.424  1.00 36.72  ? 54  MET C C   1 
ATOM   6253  O  O   . MET C  3  54  ? -33.001 18.784  26.774  1.00 35.47  ? 54  MET C O   1 
ATOM   6254  C  CB  . MET C  3  54  ? -29.751 19.464  26.771  1.00 37.94  ? 54  MET C CB  1 
ATOM   6255  C  CG  . MET C  3  54  ? -28.831 19.791  25.602  1.00 44.15  ? 54  MET C CG  1 
ATOM   6256  S  SD  . MET C  3  54  ? -27.132 19.140  25.552  1.00 51.96  ? 54  MET C SD  1 
ATOM   6257  C  CE  . MET C  3  54  ? -27.181 17.916  26.823  1.00 54.80  ? 54  MET C CE  1 
ATOM   6258  N  N   . TYR C  3  55  ? -32.196 19.555  28.755  1.00 35.34  ? 55  TYR C N   1 
ATOM   6259  C  CA  . TYR C  3  55  ? -33.173 18.857  29.555  1.00 35.57  ? 55  TYR C CA  1 
ATOM   6260  C  C   . TYR C  3  55  ? -34.602 19.353  29.227  1.00 33.61  ? 55  TYR C C   1 
ATOM   6261  O  O   . TYR C  3  55  ? -35.507 18.564  28.987  1.00 32.01  ? 55  TYR C O   1 
ATOM   6262  C  CB  . TYR C  3  55  ? -32.855 18.995  31.067  1.00 37.40  ? 55  TYR C CB  1 
ATOM   6263  C  CG  . TYR C  3  55  ? -33.996 18.479  31.880  1.00 38.94  ? 55  TYR C CG  1 
ATOM   6264  C  CD1 . TYR C  3  55  ? -34.165 17.123  32.096  1.00 40.70  ? 55  TYR C CD1 1 
ATOM   6265  C  CD2 . TYR C  3  55  ? -34.984 19.350  32.332  1.00 42.28  ? 55  TYR C CD2 1 
ATOM   6266  C  CE1 . TYR C  3  55  ? -35.275 16.649  32.781  1.00 41.94  ? 55  TYR C CE1 1 
ATOM   6267  C  CE2 . TYR C  3  55  ? -36.090 18.890  33.013  1.00 42.04  ? 55  TYR C CE2 1 
ATOM   6268  C  CZ  . TYR C  3  55  ? -36.229 17.546  33.229  1.00 42.16  ? 55  TYR C CZ  1 
ATOM   6269  O  OH  . TYR C  3  55  ? -37.324 17.134  33.919  1.00 49.28  ? 55  TYR C OH  1 
ATOM   6270  N  N   . GLN C  3  56  ? -34.786 20.660  29.222  1.00 29.59  ? 56  GLN C N   1 
ATOM   6271  C  CA  . GLN C  3  56  ? -36.095 21.218  29.002  1.00 29.79  ? 56  GLN C CA  1 
ATOM   6272  C  C   . GLN C  3  56  ? -36.541 21.080  27.561  1.00 31.53  ? 56  GLN C C   1 
ATOM   6273  O  O   . GLN C  3  56  ? -37.738 20.806  27.304  1.00 34.54  ? 56  GLN C O   1 
ATOM   6274  C  CB  . GLN C  3  56  ? -36.154 22.680  29.466  1.00 30.63  ? 56  GLN C CB  1 
ATOM   6275  C  CG  . GLN C  3  56  ? -36.120 22.785  30.987  1.00 31.35  ? 56  GLN C CG  1 
ATOM   6276  C  CD  . GLN C  3  56  ? -35.734 24.156  31.511  1.00 32.40  ? 56  GLN C CD  1 
ATOM   6277  O  OE1 . GLN C  3  56  ? -36.588 24.870  32.032  1.00 30.57  ? 56  GLN C OE1 1 
ATOM   6278  N  NE2 . GLN C  3  56  ? -34.447 24.527  31.390  1.00 30.38  ? 56  GLN C NE2 1 
ATOM   6279  N  N   . TRP C  3  57  ? -35.609 21.268  26.611  1.00 28.87  ? 57  TRP C N   1 
ATOM   6280  C  CA  . TRP C  3  57  ? -35.967 21.207  25.196  1.00 26.69  ? 57  TRP C CA  1 
ATOM   6281  C  C   . TRP C  3  57  ? -36.471 19.786  24.907  1.00 27.31  ? 57  TRP C C   1 
ATOM   6282  O  O   . TRP C  3  57  ? -37.543 19.610  24.351  1.00 26.26  ? 57  TRP C O   1 
ATOM   6283  C  CB  . TRP C  3  57  ? -34.756 21.576  24.347  1.00 27.85  ? 57  TRP C CB  1 
ATOM   6284  C  CG  . TRP C  3  57  ? -34.978 21.782  22.887  1.00 25.77  ? 57  TRP C CG  1 
ATOM   6285  C  CD1 . TRP C  3  57  ? -35.826 21.105  22.061  1.00 27.38  ? 57  TRP C CD1 1 
ATOM   6286  C  CD2 . TRP C  3  57  ? -34.272 22.693  22.070  1.00 25.92  ? 57  TRP C CD2 1 
ATOM   6287  N  NE1 . TRP C  3  57  ? -35.734 21.584  20.782  1.00 27.92  ? 57  TRP C NE1 1 
ATOM   6288  C  CE2 . TRP C  3  57  ? -34.786 22.573  20.764  1.00 26.48  ? 57  TRP C CE2 1 
ATOM   6289  C  CE3 . TRP C  3  57  ? -33.268 23.633  22.319  1.00 27.12  ? 57  TRP C CE3 1 
ATOM   6290  C  CZ2 . TRP C  3  57  ? -34.309 23.325  19.708  1.00 26.09  ? 57  TRP C CZ2 1 
ATOM   6291  C  CZ3 . TRP C  3  57  ? -32.797 24.385  21.260  1.00 27.42  ? 57  TRP C CZ3 1 
ATOM   6292  C  CH2 . TRP C  3  57  ? -33.319 24.230  19.973  1.00 26.63  ? 57  TRP C CH2 1 
ATOM   6293  N  N   . TRP C  3  58  ? -35.704 18.778  25.308  1.00 27.45  ? 58  TRP C N   1 
ATOM   6294  C  CA  . TRP C  3  58  ? -36.093 17.398  25.009  1.00 28.91  ? 58  TRP C CA  1 
ATOM   6295  C  C   . TRP C  3  58  ? -37.266 16.889  25.872  1.00 29.35  ? 58  TRP C C   1 
ATOM   6296  O  O   . TRP C  3  58  ? -38.036 16.026  25.454  1.00 27.15  ? 58  TRP C O   1 
ATOM   6297  C  CB  . TRP C  3  58  ? -34.879 16.481  25.091  1.00 27.53  ? 58  TRP C CB  1 
ATOM   6298  C  CG  . TRP C  3  58  ? -33.989 16.652  23.926  1.00 27.43  ? 58  TRP C CG  1 
ATOM   6299  C  CD1 . TRP C  3  58  ? -34.382 16.811  22.635  1.00 28.07  ? 58  TRP C CD1 1 
ATOM   6300  C  CD2 . TRP C  3  58  ? -32.554 16.634  23.911  1.00 26.47  ? 58  TRP C CD2 1 
ATOM   6301  N  NE1 . TRP C  3  58  ? -33.292 16.917  21.823  1.00 29.69  ? 58  TRP C NE1 1 
ATOM   6302  C  CE2 . TRP C  3  58  ? -32.153 16.798  22.570  1.00 26.66  ? 58  TRP C CE2 1 
ATOM   6303  C  CE3 . TRP C  3  58  ? -31.576 16.514  24.894  1.00 27.21  ? 58  TRP C CE3 1 
ATOM   6304  C  CZ2 . TRP C  3  58  ? -30.803 16.861  22.171  1.00 26.67  ? 58  TRP C CZ2 1 
ATOM   6305  C  CZ3 . TRP C  3  58  ? -30.212 16.566  24.494  1.00 27.70  ? 58  TRP C CZ3 1 
ATOM   6306  C  CH2 . TRP C  3  58  ? -29.850 16.741  23.139  1.00 25.97  ? 58  TRP C CH2 1 
ATOM   6307  N  N   . ARG C  3  59  ? -37.405 17.450  27.063  1.00 28.91  ? 59  ARG C N   1 
ATOM   6308  C  CA  . ARG C  3  59  ? -38.618 17.285  27.824  1.00 29.44  ? 59  ARG C CA  1 
ATOM   6309  C  C   . ARG C  3  59  ? -39.831 17.731  27.034  1.00 27.16  ? 59  ARG C C   1 
ATOM   6310  O  O   . ARG C  3  59  ? -40.798 16.987  26.873  1.00 27.52  ? 59  ARG C O   1 
ATOM   6311  C  CB  . ARG C  3  59  ? -38.534 18.083  29.100  1.00 30.25  ? 59  ARG C CB  1 
ATOM   6312  C  CG  . ARG C  3  59  ? -39.769 18.041  29.951  1.00 30.72  ? 59  ARG C CG  1 
ATOM   6313  C  CD  . ARG C  3  59  ? -39.727 19.193  30.929  1.00 31.43  ? 59  ARG C CD  1 
ATOM   6314  N  NE  . ARG C  3  59  ? -40.021 20.435  30.251  1.00 33.13  ? 59  ARG C NE  1 
ATOM   6315  C  CZ  . ARG C  3  59  ? -39.945 21.629  30.805  1.00 33.00  ? 59  ARG C CZ  1 
ATOM   6316  N  NH1 . ARG C  3  59  ? -39.593 21.748  32.071  1.00 34.44  ? 59  ARG C NH1 1 
ATOM   6317  N  NH2 . ARG C  3  59  ? -40.230 22.698  30.076  1.00 33.66  ? 59  ARG C NH2 1 
ATOM   6318  N  N   . ASP C  3  60  ? -39.788 18.939  26.522  1.00 26.81  ? 60  ASP C N   1 
ATOM   6319  C  CA  . ASP C  3  60  ? -40.937 19.411  25.771  1.00 26.43  ? 60  ASP C CA  1 
ATOM   6320  C  C   . ASP C  3  60  ? -41.231 18.550  24.540  1.00 26.59  ? 60  ASP C C   1 
ATOM   6321  O  O   . ASP C  3  60  ? -42.367 18.469  24.104  1.00 27.83  ? 60  ASP C O   1 
ATOM   6322  C  CB  . ASP C  3  60  ? -40.750 20.849  25.339  1.00 26.98  ? 60  ASP C CB  1 
ATOM   6323  C  CG  . ASP C  3  60  ? -40.675 21.794  26.479  1.00 27.33  ? 60  ASP C CG  1 
ATOM   6324  O  OD1 . ASP C  3  60  ? -40.850 21.340  27.632  1.00 28.81  ? 60  ASP C OD1 1 
ATOM   6325  O  OD2 . ASP C  3  60  ? -40.425 22.985  26.206  1.00 25.58  ? 60  ASP C OD2 1 
ATOM   6326  N  N   . VAL C  3  61  ? -40.217 17.939  23.949  1.00 26.49  ? 61  VAL C N   1 
ATOM   6327  C  CA  . VAL C  3  61  ? -40.438 17.138  22.734  1.00 27.77  ? 61  VAL C CA  1 
ATOM   6328  C  C   . VAL C  3  61  ? -41.207 15.886  23.117  1.00 28.03  ? 61  VAL C C   1 
ATOM   6329  O  O   . VAL C  3  61  ? -42.068 15.409  22.369  1.00 28.19  ? 61  VAL C O   1 
ATOM   6330  C  CB  . VAL C  3  61  ? -39.089 16.809  22.034  1.00 26.75  ? 61  VAL C CB  1 
ATOM   6331  C  CG1 . VAL C  3  61  ? -39.237 15.793  20.890  1.00 27.07  ? 61  VAL C CG1 1 
ATOM   6332  C  CG2 . VAL C  3  61  ? -38.486 18.098  21.513  1.00 26.60  ? 61  VAL C CG2 1 
ATOM   6333  N  N   . ILE C  3  62  ? -40.886 15.370  24.303  1.00 29.73  ? 62  ILE C N   1 
ATOM   6334  C  CA  . ILE C  3  62  ? -41.580 14.215  24.849  1.00 30.96  ? 62  ILE C CA  1 
ATOM   6335  C  C   . ILE C  3  62  ? -43.029 14.601  25.188  1.00 30.21  ? 62  ILE C C   1 
ATOM   6336  O  O   . ILE C  3  62  ? -43.970 13.876  24.877  1.00 31.99  ? 62  ILE C O   1 
ATOM   6337  C  CB  . ILE C  3  62  ? -40.828 13.652  26.053  1.00 30.84  ? 62  ILE C CB  1 
ATOM   6338  C  CG1 . ILE C  3  62  ? -39.510 13.036  25.581  1.00 30.20  ? 62  ILE C CG1 1 
ATOM   6339  C  CG2 . ILE C  3  62  ? -41.656 12.569  26.744  1.00 32.23  ? 62  ILE C CG2 1 
ATOM   6340  C  CD1 . ILE C  3  62  ? -38.488 12.962  26.680  1.00 31.24  ? 62  ILE C CD1 1 
ATOM   6341  N  N   . ARG C  3  63  ? -43.197 15.773  25.763  1.00 29.86  ? 63  ARG C N   1 
ATOM   6342  C  CA  . ARG C  3  63  ? -44.521 16.275  26.025  1.00 31.11  ? 63  ARG C CA  1 
ATOM   6343  C  C   . ARG C  3  63  ? -45.334 16.391  24.740  1.00 30.11  ? 63  ARG C C   1 
ATOM   6344  O  O   . ARG C  3  63  ? -46.482 15.969  24.697  1.00 31.56  ? 63  ARG C O   1 
ATOM   6345  C  CB  . ARG C  3  63  ? -44.457 17.620  26.766  1.00 30.42  ? 63  ARG C CB  1 
ATOM   6346  C  CG  . ARG C  3  63  ? -43.874 17.538  28.163  1.00 30.38  ? 63  ARG C CG  1 
ATOM   6347  C  CD  . ARG C  3  63  ? -43.583 18.921  28.679  1.00 31.08  ? 63  ARG C CD  1 
ATOM   6348  N  NE  . ARG C  3  63  ? -43.370 18.939  30.118  1.00 31.11  ? 63  ARG C NE  1 
ATOM   6349  C  CZ  . ARG C  3  63  ? -43.323 20.051  30.841  1.00 31.04  ? 63  ARG C CZ  1 
ATOM   6350  N  NH1 . ARG C  3  63  ? -43.451 21.253  30.281  1.00 34.22  ? 63  ARG C NH1 1 
ATOM   6351  N  NH2 . ARG C  3  63  ? -43.144 19.972  32.143  1.00 33.01  ? 63  ARG C NH2 1 
ATOM   6352  N  N   . GLU C  3  64  ? -44.732 16.944  23.692  1.00 31.21  ? 64  GLU C N   1 
ATOM   6353  C  CA  . GLU C  3  64  ? -45.444 17.213  22.433  1.00 28.49  ? 64  GLU C CA  1 
ATOM   6354  C  C   . GLU C  3  64  ? -45.803 15.909  21.711  1.00 28.13  ? 64  GLU C C   1 
ATOM   6355  O  O   . GLU C  3  64  ? -46.761 15.893  20.957  1.00 27.55  ? 64  GLU C O   1 
ATOM   6356  C  CB  . GLU C  3  64  ? -44.591 18.075  21.524  1.00 27.81  ? 64  GLU C CB  1 
ATOM   6357  C  CG  . GLU C  3  64  ? -44.347 19.485  22.077  1.00 29.36  ? 64  GLU C CG  1 
ATOM   6358  C  CD  . GLU C  3  64  ? -43.110 20.198  21.500  1.00 28.27  ? 64  GLU C CD  1 
ATOM   6359  O  OE1 . GLU C  3  64  ? -43.044 21.414  21.658  1.00 26.04  ? 64  GLU C OE1 1 
ATOM   6360  O  OE2 . GLU C  3  64  ? -42.224 19.563  20.874  1.00 27.60  ? 64  GLU C OE2 1 
ATOM   6361  N  N   . SER C  3  65  ? -45.072 14.823  21.985  1.00 27.20  ? 65  SER C N   1 
ATOM   6362  C  CA  . SER C  3  65  ? -45.221 13.568  21.249  1.00 27.90  ? 65  SER C CA  1 
ATOM   6363  C  C   . SER C  3  65  ? -45.976 12.471  22.049  1.00 29.22  ? 65  SER C C   1 
ATOM   6364  O  O   . SER C  3  65  ? -47.021 11.993  21.604  1.00 29.36  ? 65  SER C O   1 
ATOM   6365  C  CB  . SER C  3  65  ? -43.857 13.050  20.799  1.00 25.25  ? 65  SER C CB  1 
ATOM   6366  O  OG  . SER C  3  65  ? -43.008 12.867  21.921  1.00 26.55  ? 65  SER C OG  1 
ATOM   6367  N  N   . THR C  3  66  ? -45.439 12.066  23.191  1.00 30.22  ? 66  THR C N   1 
ATOM   6368  C  CA  . THR C  3  66  ? -46.065 11.034  24.007  1.00 33.06  ? 66  THR C CA  1 
ATOM   6369  C  C   . THR C  3  66  ? -47.383 11.541  24.601  1.00 33.43  ? 66  THR C C   1 
ATOM   6370  O  O   . THR C  3  66  ? -48.400 10.823  24.569  1.00 35.46  ? 66  THR C O   1 
ATOM   6371  C  CB  . THR C  3  66  ? -45.127 10.581  25.138  1.00 34.52  ? 66  THR C CB  1 
ATOM   6372  O  OG1 . THR C  3  66  ? -43.903 10.080  24.571  1.00 33.98  ? 66  THR C OG1 1 
ATOM   6373  C  CG2 . THR C  3  66  ? -45.782 9.487   25.986  1.00 34.64  ? 66  THR C CG2 1 
ATOM   6374  N  N   . PHE C  3  67  ? -47.362 12.789  25.077  1.00 33.52  ? 67  PHE C N   1 
ATOM   6375  C  CA  . PHE C  3  67  ? -48.468 13.372  25.808  1.00 33.31  ? 67  PHE C CA  1 
ATOM   6376  C  C   . PHE C  3  67  ? -49.454 14.184  25.002  1.00 33.51  ? 67  PHE C C   1 
ATOM   6377  O  O   . PHE C  3  67  ? -50.622 14.177  25.335  1.00 40.06  ? 67  PHE C O   1 
ATOM   6378  C  CB  . PHE C  3  67  ? -47.956 14.170  27.007  1.00 34.15  ? 67  PHE C CB  1 
ATOM   6379  C  CG  . PHE C  3  67  ? -47.014 13.398  27.890  1.00 34.04  ? 67  PHE C CG  1 
ATOM   6380  C  CD1 . PHE C  3  67  ? -47.088 12.006  28.004  1.00 36.15  ? 67  PHE C CD1 1 
ATOM   6381  C  CD2 . PHE C  3  67  ? -46.057 14.061  28.633  1.00 34.43  ? 67  PHE C CD2 1 
ATOM   6382  C  CE1 . PHE C  3  67  ? -46.198 11.303  28.812  1.00 35.63  ? 67  PHE C CE1 1 
ATOM   6383  C  CE2 . PHE C  3  67  ? -45.178 13.357  29.446  1.00 33.32  ? 67  PHE C CE2 1 
ATOM   6384  C  CZ  . PHE C  3  67  ? -45.249 11.985  29.537  1.00 34.33  ? 67  PHE C CZ  1 
ATOM   6385  N  N   . GLN C  3  68  ? -49.044 14.860  23.940  1.00 33.25  ? 68  GLN C N   1 
ATOM   6386  C  CA  . GLN C  3  68  ? -50.000 15.676  23.152  1.00 32.44  ? 68  GLN C CA  1 
ATOM   6387  C  C   . GLN C  3  68  ? -50.353 15.089  21.790  1.00 32.23  ? 68  GLN C C   1 
ATOM   6388  O  O   . GLN C  3  68  ? -51.228 15.631  21.070  1.00 32.62  ? 68  GLN C O   1 
ATOM   6389  C  CB  . GLN C  3  68  ? -49.478 17.098  22.992  1.00 33.25  ? 68  GLN C CB  1 
ATOM   6390  C  CG  . GLN C  3  68  ? -49.294 17.820  24.312  1.00 35.09  ? 68  GLN C CG  1 
ATOM   6391  C  CD  . GLN C  3  68  ? -48.786 19.237  24.145  1.00 37.14  ? 68  GLN C CD  1 
ATOM   6392  O  OE1 . GLN C  3  68  ? -48.049 19.551  23.185  1.00 39.28  ? 68  GLN C OE1 1 
ATOM   6393  N  NE2 . GLN C  3  68  ? -49.174 20.115  25.083  1.00 33.23  ? 68  GLN C NE2 1 
ATOM   6394  N  N   . GLY C  3  69  ? -49.678 14.005  21.417  1.00 30.35  ? 69  GLY C N   1 
ATOM   6395  C  CA  . GLY C  3  69  ? -49.982 13.332  20.168  1.00 30.98  ? 69  GLY C CA  1 
ATOM   6396  C  C   . GLY C  3  69  ? -49.671 14.100  18.907  1.00 30.42  ? 69  GLY C C   1 
ATOM   6397  O  O   . GLY C  3  69  ? -50.266 13.829  17.885  1.00 32.71  ? 69  GLY C O   1 
ATOM   6398  N  N   . HIS C  3  70  ? -48.728 15.043  18.969  1.00 31.21  ? 70  HIS C N   1 
ATOM   6399  C  CA  . HIS C  3  70  ? -48.340 15.856  17.792  1.00 28.81  ? 70  HIS C CA  1 
ATOM   6400  C  C   . HIS C  3  70  ? -47.521 15.146  16.702  1.00 28.37  ? 70  HIS C C   1 
ATOM   6401  O  O   . HIS C  3  70  ? -47.401 15.703  15.608  1.00 27.29  ? 70  HIS C O   1 
ATOM   6402  C  CB  . HIS C  3  70  ? -47.596 17.126  18.219  1.00 26.98  ? 70  HIS C CB  1 
ATOM   6403  C  CG  . HIS C  3  70  ? -48.478 18.148  18.846  1.00 27.17  ? 70  HIS C CG  1 
ATOM   6404  N  ND1 . HIS C  3  70  ? -49.511 18.759  18.159  1.00 24.61  ? 70  HIS C ND1 1 
ATOM   6405  C  CD2 . HIS C  3  70  ? -48.466 18.695  20.083  1.00 28.64  ? 70  HIS C CD2 1 
ATOM   6406  C  CE1 . HIS C  3  70  ? -50.119 19.608  18.965  1.00 27.52  ? 70  HIS C CE1 1 
ATOM   6407  N  NE2 . HIS C  3  70  ? -49.501 19.599  20.135  1.00 29.00  ? 70  HIS C NE2 1 
ATOM   6408  N  N   . HIS C  3  71  ? -46.956 13.966  16.993  1.00 26.91  ? 71  HIS C N   1 
ATOM   6409  C  CA  . HIS C  3  71  ? -46.077 13.289  16.047  1.00 27.58  ? 71  HIS C CA  1 
ATOM   6410  C  C   . HIS C  3  71  ? -46.858 12.318  15.186  1.00 28.44  ? 71  HIS C C   1 
ATOM   6411  O  O   . HIS C  3  71  ? -46.878 11.118  15.416  1.00 29.51  ? 71  HIS C O   1 
ATOM   6412  C  CB  . HIS C  3  71  ? -44.903 12.586  16.738  1.00 29.24  ? 71  HIS C CB  1 
ATOM   6413  C  CG  . HIS C  3  71  ? -43.862 13.530  17.250  1.00 28.60  ? 71  HIS C CG  1 
ATOM   6414  N  ND1 . HIS C  3  71  ? -42.575 13.129  17.528  1.00 28.74  ? 71  HIS C ND1 1 
ATOM   6415  C  CD2 . HIS C  3  71  ? -43.924 14.854  17.542  1.00 27.33  ? 71  HIS C CD2 1 
ATOM   6416  C  CE1 . HIS C  3  71  ? -41.892 14.165  17.987  1.00 29.26  ? 71  HIS C CE1 1 
ATOM   6417  N  NE2 . HIS C  3  71  ? -42.688 15.222  18.003  1.00 27.97  ? 71  HIS C NE2 1 
ATOM   6418  N  N   . THR C  3  72  ? -47.500 12.890  14.178  1.00 28.84  ? 72  THR C N   1 
ATOM   6419  C  CA  . THR C  3  72  ? -48.144 12.163  13.107  1.00 26.93  ? 72  THR C CA  1 
ATOM   6420  C  C   . THR C  3  72  ? -47.078 11.495  12.233  1.00 26.51  ? 72  THR C C   1 
ATOM   6421  O  O   . THR C  3  72  ? -45.894 11.815  12.332  1.00 27.01  ? 72  THR C O   1 
ATOM   6422  C  CB  . THR C  3  72  ? -48.951 13.154  12.253  1.00 26.35  ? 72  THR C CB  1 
ATOM   6423  O  OG1 . THR C  3  72  ? -48.064 14.168  11.729  1.00 24.81  ? 72  THR C OG1 1 
ATOM   6424  C  CG2 . THR C  3  72  ? -50.015 13.846  13.114  1.00 25.88  ? 72  THR C CG2 1 
ATOM   6425  N  N   . PRO C  3  73  ? -47.488 10.569  11.360  1.00 27.99  ? 73  PRO C N   1 
ATOM   6426  C  CA  . PRO C  3  73  ? -46.493 9.946   10.474  1.00 28.85  ? 73  PRO C CA  1 
ATOM   6427  C  C   . PRO C  3  73  ? -45.679 10.954  9.675   1.00 29.07  ? 73  PRO C C   1 
ATOM   6428  O  O   . PRO C  3  73  ? -44.543 10.693  9.367   1.00 28.17  ? 73  PRO C O   1 
ATOM   6429  C  CB  . PRO C  3  73  ? -47.356 9.096   9.521   1.00 27.24  ? 73  PRO C CB  1 
ATOM   6430  C  CG  . PRO C  3  73  ? -48.476 8.687   10.391  1.00 28.79  ? 73  PRO C CG  1 
ATOM   6431  C  CD  . PRO C  3  73  ? -48.816 9.938   11.192  1.00 28.22  ? 73  PRO C CD  1 
ATOM   6432  N  N   . ALA C  3  74  ? -46.270 12.090  9.342   1.00 27.98  ? 74  ALA C N   1 
ATOM   6433  C  CA  . ALA C  3  74  ? -45.576 13.079  8.581   1.00 26.99  ? 74  ALA C CA  1 
ATOM   6434  C  C   . ALA C  3  74  ? -44.464 13.670  9.426   1.00 27.71  ? 74  ALA C C   1 
ATOM   6435  O  O   . ALA C  3  74  ? -43.334 13.771  8.984   1.00 27.61  ? 74  ALA C O   1 
ATOM   6436  C  CB  . ALA C  3  74  ? -46.544 14.161  8.143   1.00 27.61  ? 74  ALA C CB  1 
ATOM   6437  N  N   . VAL C  3  75  ? -44.791 14.022  10.656  1.00 28.75  ? 75  VAL C N   1 
ATOM   6438  C  CA  . VAL C  3  75  ? -43.816 14.558  11.580  1.00 31.00  ? 75  VAL C CA  1 
ATOM   6439  C  C   . VAL C  3  75  ? -42.726 13.530  11.884  1.00 33.09  ? 75  VAL C C   1 
ATOM   6440  O  O   . VAL C  3  75  ? -41.547 13.861  11.936  1.00 28.66  ? 75  VAL C O   1 
ATOM   6441  C  CB  . VAL C  3  75  ? -44.502 15.087  12.858  1.00 32.76  ? 75  VAL C CB  1 
ATOM   6442  C  CG1 . VAL C  3  75  ? -43.483 15.439  13.927  1.00 33.79  ? 75  VAL C CG1 1 
ATOM   6443  C  CG2 . VAL C  3  75  ? -45.338 16.332  12.527  1.00 34.73  ? 75  VAL C CG2 1 
ATOM   6444  N  N   . GLN C  3  76  ? -43.127 12.274  12.029  1.00 37.40  ? 76  GLN C N   1 
ATOM   6445  C  CA  . GLN C  3  76  ? -42.177 11.237  12.362  1.00 39.15  ? 76  GLN C CA  1 
ATOM   6446  C  C   . GLN C  3  76  ? -41.143 10.979  11.258  1.00 37.01  ? 76  GLN C C   1 
ATOM   6447  O  O   . GLN C  3  76  ? -39.963 10.689  11.543  1.00 33.81  ? 76  GLN C O   1 
ATOM   6448  C  CB  . GLN C  3  76  ? -42.902 9.973   12.753  1.00 42.79  ? 76  GLN C CB  1 
ATOM   6449  C  CG  . GLN C  3  76  ? -42.000 9.069   13.551  1.00 51.57  ? 76  GLN C CG  1 
ATOM   6450  C  CD  . GLN C  3  76  ? -42.657 7.759   13.893  1.00 58.70  ? 76  GLN C CD  1 
ATOM   6451  O  OE1 . GLN C  3  76  ? -43.906 7.670   13.907  1.00 46.42  ? 76  GLN C OE1 1 
ATOM   6452  N  NE2 . GLN C  3  76  ? -41.817 6.721   14.185  1.00 49.60  ? 76  GLN C NE2 1 
ATOM   6453  N  N   . LYS C  3  77  ? -41.589 11.154  10.018  1.00 36.05  ? 77  LYS C N   1 
ATOM   6454  C  CA  . LYS C  3  77  ? -40.777 10.990  8.809   1.00 36.41  ? 77  LYS C CA  1 
ATOM   6455  C  C   . LYS C  3  77  ? -39.698 12.102  8.749   1.00 36.51  ? 77  LYS C C   1 
ATOM   6456  O  O   . LYS C  3  77  ? -38.520 11.849  8.438   1.00 34.76  ? 77  LYS C O   1 
ATOM   6457  C  CB  . LYS C  3  77  ? -41.693 11.050  7.611   1.00 39.03  ? 77  LYS C CB  1 
ATOM   6458  C  CG  . LYS C  3  77  ? -41.210 10.462  6.315   1.00 50.88  ? 77  LYS C CG  1 
ATOM   6459  C  CD  . LYS C  3  77  ? -42.421 10.223  5.384   1.00 61.65  ? 77  LYS C CD  1 
ATOM   6460  C  CE  . LYS C  3  77  ? -42.048 10.271  3.905   1.00 72.03  ? 77  LYS C CE  1 
ATOM   6461  N  NZ  . LYS C  3  77  ? -40.883 9.386   3.585   1.00 79.19  ? 77  LYS C NZ  1 
ATOM   6462  N  N   . GLY C  3  78  ? -40.091 13.317  9.096   1.00 31.92  ? 78  GLY C N   1 
ATOM   6463  C  CA  . GLY C  3  78  ? -39.152 14.402  9.159   1.00 32.28  ? 78  GLY C CA  1 
ATOM   6464  C  C   . GLY C  3  78  ? -38.045 14.144  10.139  1.00 30.45  ? 78  GLY C C   1 
ATOM   6465  O  O   . GLY C  3  78  ? -36.897 14.416  9.851   1.00 30.92  ? 78  GLY C O   1 
ATOM   6466  N  N   . LEU C  3  79  ? -38.398 13.590  11.287  1.00 30.34  ? 79  LEU C N   1 
ATOM   6467  C  CA  . LEU C  3  79  ? -37.453 13.378  12.341  1.00 31.74  ? 79  LEU C CA  1 
ATOM   6468  C  C   . LEU C  3  79  ? -36.437 12.330  11.937  1.00 31.99  ? 79  LEU C C   1 
ATOM   6469  O  O   . LEU C  3  79  ? -35.300 12.436  12.324  1.00 30.95  ? 79  LEU C O   1 
ATOM   6470  C  CB  . LEU C  3  79  ? -38.137 13.020  13.661  1.00 33.64  ? 79  LEU C CB  1 
ATOM   6471  C  CG  . LEU C  3  79  ? -38.905 14.137  14.381  1.00 36.10  ? 79  LEU C CG  1 
ATOM   6472  C  CD1 . LEU C  3  79  ? -39.704 13.548  15.543  1.00 38.48  ? 79  LEU C CD1 1 
ATOM   6473  C  CD2 . LEU C  3  79  ? -38.024 15.270  14.908  1.00 36.76  ? 79  LEU C CD2 1 
ATOM   6474  N  N   . ARG C  3  80  ? -36.841 11.367  11.120  1.00 34.11  ? 80  ARG C N   1 
ATOM   6475  C  CA  . ARG C  3  80  ? -35.922 10.383  10.565  1.00 36.76  ? 80  ARG C CA  1 
ATOM   6476  C  C   . ARG C  3  80  ? -34.870 10.996  9.652   1.00 33.34  ? 80  ARG C C   1 
ATOM   6477  O  O   . ARG C  3  80  ? -33.697 10.664  9.773   1.00 28.61  ? 80  ARG C O   1 
ATOM   6478  C  CB  . ARG C  3  80  ? -36.680 9.325   9.756   1.00 39.98  ? 80  ARG C CB  1 
ATOM   6479  C  CG  . ARG C  3  80  ? -37.451 8.412   10.622  1.00 44.45  ? 80  ARG C CG  1 
ATOM   6480  C  CD  . ARG C  3  80  ? -38.468 7.592   9.846   1.00 52.27  ? 80  ARG C CD  1 
ATOM   6481  N  NE  . ARG C  3  80  ? -39.225 6.833   10.831  1.00 58.36  ? 80  ARG C NE  1 
ATOM   6482  C  CZ  . ARG C  3  80  ? -38.775 5.760   11.488  1.00 58.76  ? 80  ARG C CZ  1 
ATOM   6483  N  NH1 . ARG C  3  80  ? -37.574 5.214   11.219  1.00 52.98  ? 80  ARG C NH1 1 
ATOM   6484  N  NH2 . ARG C  3  80  ? -39.572 5.207   12.407  1.00 63.10  ? 80  ARG C NH2 1 
ATOM   6485  N  N   . TYR C  3  81  ? -35.316 11.838  8.715   1.00 31.09  ? 81  TYR C N   1 
ATOM   6486  C  CA  . TYR C  3  81  ? -34.400 12.572  7.859   1.00 31.66  ? 81  TYR C CA  1 
ATOM   6487  C  C   . TYR C  3  81  ? -33.460 13.391  8.731   1.00 27.71  ? 81  TYR C C   1 
ATOM   6488  O  O   . TYR C  3  81  ? -32.268 13.339  8.557   1.00 25.17  ? 81  TYR C O   1 
ATOM   6489  C  CB  . TYR C  3  81  ? -35.116 13.476  6.847   1.00 34.90  ? 81  TYR C CB  1 
ATOM   6490  C  CG  . TYR C  3  81  ? -35.934 12.724  5.812   1.00 38.14  ? 81  TYR C CG  1 
ATOM   6491  C  CD1 . TYR C  3  81  ? -35.355 11.772  4.995   1.00 44.53  ? 81  TYR C CD1 1 
ATOM   6492  C  CD2 . TYR C  3  81  ? -37.281 12.998  5.635   1.00 41.50  ? 81  TYR C CD2 1 
ATOM   6493  C  CE1 . TYR C  3  81  ? -36.105 11.079  4.053   1.00 48.73  ? 81  TYR C CE1 1 
ATOM   6494  C  CE2 . TYR C  3  81  ? -38.041 12.332  4.704   1.00 44.94  ? 81  TYR C CE2 1 
ATOM   6495  C  CZ  . TYR C  3  81  ? -37.460 11.357  3.924   1.00 49.61  ? 81  TYR C CZ  1 
ATOM   6496  O  OH  . TYR C  3  81  ? -38.235 10.685  2.997   1.00 52.12  ? 81  TYR C OH  1 
ATOM   6497  N  N   . GLY C  3  82  ? -34.007 14.105  9.697   1.00 25.97  ? 82  GLY C N   1 
ATOM   6498  C  CA  . GLY C  3  82  ? -33.211 14.928  10.573  1.00 25.22  ? 82  GLY C CA  1 
ATOM   6499  C  C   . GLY C  3  82  ? -32.032 14.214  11.160  1.00 25.73  ? 82  GLY C C   1 
ATOM   6500  O  O   . GLY C  3  82  ? -30.917 14.722  11.166  1.00 26.17  ? 82  GLY C O   1 
ATOM   6501  N  N   . MET C  3  83  ? -32.293 13.006  11.625  1.00 27.25  ? 83  MET C N   1 
ATOM   6502  C  CA  . MET C  3  83  ? -31.353 12.246  12.408  1.00 26.73  ? 83  MET C CA  1 
ATOM   6503  C  C   . MET C  3  83  ? -30.322 11.572  11.514  1.00 26.20  ? 83  MET C C   1 
ATOM   6504  O  O   . MET C  3  83  ? -29.152 11.446  11.892  1.00 28.54  ? 83  MET C O   1 
ATOM   6505  C  CB  . MET C  3  83  ? -32.108 11.209  13.235  1.00 26.59  ? 83  MET C CB  1 
ATOM   6506  C  CG  . MET C  3  83  ? -31.276 10.507  14.280  1.00 26.69  ? 83  MET C CG  1 
ATOM   6507  S  SD  . MET C  3  83  ? -30.717 11.612  15.575  1.00 27.42  ? 83  MET C SD  1 
ATOM   6508  C  CE  . MET C  3  83  ? -29.426 10.557  16.219  1.00 28.10  ? 83  MET C CE  1 
ATOM   6509  N  N   . ILE C  3  84  ? -30.729 11.152  10.329  1.00 25.50  ? 84  ILE C N   1 
ATOM   6510  C  CA  . ILE C  3  84  ? -29.791 10.591  9.419   1.00 25.97  ? 84  ILE C CA  1 
ATOM   6511  C  C   . ILE C  3  84  ? -28.806 11.669  9.024   1.00 25.33  ? 84  ILE C C   1 
ATOM   6512  O  O   . ILE C  3  84  ? -27.617 11.421  9.034   1.00 24.35  ? 84  ILE C O   1 
ATOM   6513  C  CB  . ILE C  3  84  ? -30.482 9.988   8.221   1.00 28.83  ? 84  ILE C CB  1 
ATOM   6514  C  CG1 . ILE C  3  84  ? -31.004 8.631   8.628   1.00 34.11  ? 84  ILE C CG1 1 
ATOM   6515  C  CG2 . ILE C  3  84  ? -29.493 9.753   7.083   1.00 32.05  ? 84  ILE C CG2 1 
ATOM   6516  C  CD1 . ILE C  3  84  ? -32.200 8.183   7.807   1.00 38.74  ? 84  ILE C CD1 1 
ATOM   6517  N  N   . LEU C  3  85  ? -29.326 12.854  8.708   1.00 24.79  ? 85  LEU C N   1 
ATOM   6518  C  CA  . LEU C  3  85  ? -28.552 14.002  8.247   1.00 24.70  ? 85  LEU C CA  1 
ATOM   6519  C  C   . LEU C  3  85  ? -27.553 14.418  9.311   1.00 24.91  ? 85  LEU C C   1 
ATOM   6520  O  O   . LEU C  3  85  ? -26.395 14.756  9.018   1.00 24.92  ? 85  LEU C O   1 
ATOM   6521  C  CB  . LEU C  3  85  ? -29.470 15.204  7.905   1.00 23.99  ? 85  LEU C CB  1 
ATOM   6522  C  CG  . LEU C  3  85  ? -30.386 15.021  6.704   1.00 25.16  ? 85  LEU C CG  1 
ATOM   6523  C  CD1 . LEU C  3  85  ? -31.366 16.180  6.515   1.00 26.22  ? 85  LEU C CD1 1 
ATOM   6524  C  CD2 . LEU C  3  85  ? -29.566 14.770  5.445   1.00 24.85  ? 85  LEU C CD2 1 
ATOM   6525  N  N   . PHE C  3  86  ? -28.023 14.426  10.547  1.00 25.08  ? 86  PHE C N   1 
ATOM   6526  C  CA  . PHE C  3  86  ? -27.172 14.766  11.667  1.00 25.11  ? 86  PHE C CA  1 
ATOM   6527  C  C   . PHE C  3  86  ? -26.018 13.753  11.760  1.00 24.30  ? 86  PHE C C   1 
ATOM   6528  O  O   . PHE C  3  86  ? -24.875 14.122  11.940  1.00 21.49  ? 86  PHE C O   1 
ATOM   6529  C  CB  . PHE C  3  86  ? -27.973 14.794  12.965  1.00 25.01  ? 86  PHE C CB  1 
ATOM   6530  C  CG  . PHE C  3  86  ? -27.125 14.954  14.158  1.00 26.76  ? 86  PHE C CG  1 
ATOM   6531  C  CD1 . PHE C  3  86  ? -26.437 16.135  14.357  1.00 26.84  ? 86  PHE C CD1 1 
ATOM   6532  C  CD2 . PHE C  3  86  ? -26.967 13.900  15.073  1.00 29.51  ? 86  PHE C CD2 1 
ATOM   6533  C  CE1 . PHE C  3  86  ? -25.579 16.287  15.439  1.00 28.27  ? 86  PHE C CE1 1 
ATOM   6534  C  CE2 . PHE C  3  86  ? -26.114 14.045  16.168  1.00 30.15  ? 86  PHE C CE2 1 
ATOM   6535  C  CZ  . PHE C  3  86  ? -25.423 15.247  16.349  1.00 28.78  ? 86  PHE C CZ  1 
ATOM   6536  N  N   . ILE C  3  87  ? -26.336 12.480  11.624  1.00 24.26  ? 87  ILE C N   1 
ATOM   6537  C  CA  . ILE C  3  87  ? -25.309 11.443  11.704  1.00 26.22  ? 87  ILE C CA  1 
ATOM   6538  C  C   . ILE C  3  87  ? -24.264 11.624  10.601  1.00 25.59  ? 87  ILE C C   1 
ATOM   6539  O  O   . ILE C  3  87  ? -23.059 11.443  10.840  1.00 27.89  ? 87  ILE C O   1 
ATOM   6540  C  CB  . ILE C  3  87  ? -25.929 10.015  11.656  1.00 24.55  ? 87  ILE C CB  1 
ATOM   6541  C  CG1 . ILE C  3  87  ? -26.529 9.722   13.014  1.00 25.78  ? 87  ILE C CG1 1 
ATOM   6542  C  CG2 . ILE C  3  87  ? -24.872 8.979   11.331  1.00 23.68  ? 87  ILE C CG2 1 
ATOM   6543  C  CD1 . ILE C  3  87  ? -27.292 8.424   13.054  1.00 28.25  ? 87  ILE C CD1 1 
ATOM   6544  N  N   . ILE C  3  88  ? -24.752 11.943  9.410   1.00 25.12  ? 88  ILE C N   1 
ATOM   6545  C  CA  . ILE C  3  88  ? -23.911 12.245  8.284   1.00 27.27  ? 88  ILE C CA  1 
ATOM   6546  C  C   . ILE C  3  88  ? -22.895 13.360  8.576   1.00 28.01  ? 88  ILE C C   1 
ATOM   6547  O  O   . ILE C  3  88  ? -21.699 13.184  8.302   1.00 30.02  ? 88  ILE C O   1 
ATOM   6548  C  CB  . ILE C  3  88  ? -24.734 12.562  7.032   1.00 26.04  ? 88  ILE C CB  1 
ATOM   6549  C  CG1 . ILE C  3  88  ? -25.282 11.264  6.486   1.00 26.68  ? 88  ILE C CG1 1 
ATOM   6550  C  CG2 . ILE C  3  88  ? -23.855 13.149  5.946   1.00 27.33  ? 88  ILE C CG2 1 
ATOM   6551  C  CD1 . ILE C  3  88  ? -26.218 11.485  5.327   1.00 26.48  ? 88  ILE C CD1 1 
ATOM   6552  N  N   . SER C  3  89  ? -23.356 14.482  9.117   1.00 26.57  ? 89  SER C N   1 
ATOM   6553  C  CA  . SER C  3  89  ? -22.431 15.535  9.520   1.00 26.96  ? 89  SER C CA  1 
ATOM   6554  C  C   . SER C  3  89  ? -21.361 15.050  10.529  1.00 26.25  ? 89  SER C C   1 
ATOM   6555  O  O   . SER C  3  89  ? -20.208 15.486  10.464  1.00 24.86  ? 89  SER C O   1 
ATOM   6556  C  CB  . SER C  3  89  ? -23.194 16.784  10.045  1.00 27.92  ? 89  SER C CB  1 
ATOM   6557  O  OG  . SER C  3  89  ? -23.703 16.597  11.370  1.00 29.17  ? 89  SER C OG  1 
ATOM   6558  N  N   . GLU C  3  90  ? -21.742 14.172  11.455  1.00 25.74  ? 90  GLU C N   1 
ATOM   6559  C  CA  . GLU C  3  90  ? -20.806 13.604  12.424  1.00 28.18  ? 90  GLU C CA  1 
ATOM   6560  C  C   . GLU C  3  90  ? -19.745 12.730  11.774  1.00 29.37  ? 90  GLU C C   1 
ATOM   6561  O  O   . GLU C  3  90  ? -18.583 12.762  12.182  1.00 29.82  ? 90  GLU C O   1 
ATOM   6562  C  CB  . GLU C  3  90  ? -21.530 12.795  13.475  1.00 28.80  ? 90  GLU C CB  1 
ATOM   6563  C  CG  . GLU C  3  90  ? -22.325 13.668  14.405  1.00 31.40  ? 90  GLU C CG  1 
ATOM   6564  C  CD  . GLU C  3  90  ? -21.864 13.581  15.833  1.00 34.12  ? 90  GLU C CD  1 
ATOM   6565  O  OE1 . GLU C  3  90  ? -22.663 13.149  16.691  1.00 37.88  ? 90  GLU C OE1 1 
ATOM   6566  O  OE2 . GLU C  3  90  ? -20.703 13.937  16.100  1.00 37.59  ? 90  GLU C OE2 1 
ATOM   6567  N  N   . VAL C  3  91  ? -20.140 11.986  10.747  1.00 30.05  ? 91  VAL C N   1 
ATOM   6568  C  CA  . VAL C  3  91  ? -19.204 11.179  9.979   1.00 30.84  ? 91  VAL C CA  1 
ATOM   6569  C  C   . VAL C  3  91  ? -18.138 12.058  9.351   1.00 30.44  ? 91  VAL C C   1 
ATOM   6570  O  O   . VAL C  3  91  ? -16.972 11.693  9.344   1.00 30.19  ? 91  VAL C O   1 
ATOM   6571  C  CB  . VAL C  3  91  ? -19.912 10.358  8.867   1.00 31.03  ? 91  VAL C CB  1 
ATOM   6572  C  CG1 . VAL C  3  91  ? -18.923 9.696   7.917   1.00 29.19  ? 91  VAL C CG1 1 
ATOM   6573  C  CG2 . VAL C  3  91  ? -20.780 9.292   9.489   1.00 33.66  ? 91  VAL C CG2 1 
ATOM   6574  N  N   . LEU C  3  92  ? -18.547 13.185  8.789   1.00 30.44  ? 92  LEU C N   1 
ATOM   6575  C  CA  . LEU C  3  92  ? -17.586 14.109  8.162   1.00 29.75  ? 92  LEU C CA  1 
ATOM   6576  C  C   . LEU C  3  92  ? -16.690 14.813  9.190   1.00 27.72  ? 92  LEU C C   1 
ATOM   6577  O  O   . LEU C  3  92  ? -15.531 15.092  8.935   1.00 27.50  ? 92  LEU C O   1 
ATOM   6578  C  CB  . LEU C  3  92  ? -18.307 15.114  7.266   1.00 30.27  ? 92  LEU C CB  1 
ATOM   6579  C  CG  . LEU C  3  92  ? -18.517 14.680  5.792   1.00 32.38  ? 92  LEU C CG  1 
ATOM   6580  C  CD1 . LEU C  3  92  ? -17.203 14.416  5.074   1.00 31.20  ? 92  LEU C CD1 1 
ATOM   6581  C  CD2 . LEU C  3  92  ? -19.439 13.478  5.616   1.00 33.09  ? 92  LEU C CD2 1 
ATOM   6582  N  N   . PHE C  3  93  ? -17.223 15.064  10.369  1.00 28.99  ? 93  PHE C N   1 
ATOM   6583  C  CA  . PHE C  3  93  ? -16.423 15.569  11.459  1.00 28.33  ? 93  PHE C CA  1 
ATOM   6584  C  C   . PHE C  3  93  ? -15.268 14.596  11.768  1.00 29.13  ? 93  PHE C C   1 
ATOM   6585  O  O   . PHE C  3  93  ? -14.085 14.993  11.814  1.00 26.70  ? 93  PHE C O   1 
ATOM   6586  C  CB  . PHE C  3  93  ? -17.316 15.780  12.673  1.00 28.79  ? 93  PHE C CB  1 
ATOM   6587  C  CG  . PHE C  3  93  ? -16.609 16.380  13.856  1.00 29.53  ? 93  PHE C CG  1 
ATOM   6588  C  CD1 . PHE C  3  93  ? -16.054 17.653  13.778  1.00 29.82  ? 93  PHE C CD1 1 
ATOM   6589  C  CD2 . PHE C  3  93  ? -16.529 15.700  15.047  1.00 30.19  ? 93  PHE C CD2 1 
ATOM   6590  C  CE1 . PHE C  3  93  ? -15.430 18.218  14.855  1.00 30.70  ? 93  PHE C CE1 1 
ATOM   6591  C  CE2 . PHE C  3  93  ? -15.884 16.260  16.132  1.00 31.87  ? 93  PHE C CE2 1 
ATOM   6592  C  CZ  . PHE C  3  93  ? -15.327 17.518  16.038  1.00 30.92  ? 93  PHE C CZ  1 
ATOM   6593  N  N   . PHE C  3  94  ? -15.620 13.329  11.971  1.00 28.04  ? 94  PHE C N   1 
ATOM   6594  C  CA  . PHE C  3  94  ? -14.608 12.304  12.251  1.00 28.15  ? 94  PHE C CA  1 
ATOM   6595  C  C   . PHE C  3  94  ? -13.622 12.138  11.139  1.00 28.39  ? 94  PHE C C   1 
ATOM   6596  O  O   . PHE C  3  94  ? -12.441 11.861  11.378  1.00 27.07  ? 94  PHE C O   1 
ATOM   6597  C  CB  . PHE C  3  94  ? -15.225 10.938  12.618  1.00 26.69  ? 94  PHE C CB  1 
ATOM   6598  C  CG  . PHE C  3  94  ? -15.551 10.849  14.053  1.00 27.33  ? 94  PHE C CG  1 
ATOM   6599  C  CD1 . PHE C  3  94  ? -14.551 10.590  14.970  1.00 27.34  ? 94  PHE C CD1 1 
ATOM   6600  C  CD2 . PHE C  3  94  ? -16.835 11.145  14.514  1.00 27.77  ? 94  PHE C CD2 1 
ATOM   6601  C  CE1 . PHE C  3  94  ? -14.825 10.569  16.322  1.00 26.52  ? 94  PHE C CE1 1 
ATOM   6602  C  CE2 . PHE C  3  94  ? -17.125 11.113  15.859  1.00 26.95  ? 94  PHE C CE2 1 
ATOM   6603  C  CZ  . PHE C  3  94  ? -16.120 10.828  16.760  1.00 27.85  ? 94  PHE C CZ  1 
ATOM   6604  N  N   . THR C  3  95  ? -14.113 12.294  9.926   1.00 28.12  ? 95  THR C N   1 
ATOM   6605  C  CA  . THR C  3  95  ? -13.280 12.140  8.762   1.00 30.66  ? 95  THR C CA  1 
ATOM   6606  C  C   . THR C  3  95  ? -12.098 13.091  8.798   1.00 31.51  ? 95  THR C C   1 
ATOM   6607  O  O   . THR C  3  95  ? -11.025 12.688  8.429   1.00 30.02  ? 95  THR C O   1 
ATOM   6608  C  CB  . THR C  3  95  ? -14.118 12.305  7.506   1.00 32.93  ? 95  THR C CB  1 
ATOM   6609  O  OG1 . THR C  3  95  ? -14.993 11.166  7.403   1.00 35.60  ? 95  THR C OG1 1 
ATOM   6610  C  CG2 . THR C  3  95  ? -13.274 12.378  6.307   1.00 34.54  ? 95  THR C CG2 1 
ATOM   6611  N  N   . GLY C  3  96  ? -12.289 14.331  9.262   1.00 32.45  ? 96  GLY C N   1 
ATOM   6612  C  CA  . GLY C  3  96  ? -11.175 15.275  9.455   1.00 31.27  ? 96  GLY C CA  1 
ATOM   6613  C  C   . GLY C  3  96  ? -10.006 14.696  10.245  1.00 30.86  ? 96  GLY C C   1 
ATOM   6614  O  O   . GLY C  3  96  ? -8.850  14.900  9.904   1.00 29.66  ? 96  GLY C O   1 
ATOM   6615  N  N   . PHE C  3  97  ? -10.328 13.959  11.299  1.00 30.00  ? 97  PHE C N   1 
ATOM   6616  C  CA  . PHE C  3  97  ? -9.333  13.366  12.184  1.00 29.23  ? 97  PHE C CA  1 
ATOM   6617  C  C   . PHE C  3  97  ? -8.722  12.100  11.603  1.00 29.49  ? 97  PHE C C   1 
ATOM   6618  O  O   . PHE C  3  97  ? -7.591  11.792  11.887  1.00 34.00  ? 97  PHE C O   1 
ATOM   6619  C  CB  . PHE C  3  97  ? -9.954  13.071  13.554  1.00 29.93  ? 97  PHE C CB  1 
ATOM   6620  C  CG  . PHE C  3  97  ? -10.512 14.292  14.250  1.00 29.88  ? 97  PHE C CG  1 
ATOM   6621  C  CD1 . PHE C  3  97  ? -9.663  15.310  14.712  1.00 32.02  ? 97  PHE C CD1 1 
ATOM   6622  C  CD2 . PHE C  3  97  ? -11.868 14.415  14.489  1.00 30.52  ? 97  PHE C CD2 1 
ATOM   6623  C  CE1 . PHE C  3  97  ? -10.173 16.445  15.354  1.00 31.75  ? 97  PHE C CE1 1 
ATOM   6624  C  CE2 . PHE C  3  97  ? -12.384 15.547  15.136  1.00 32.55  ? 97  PHE C CE2 1 
ATOM   6625  C  CZ  . PHE C  3  97  ? -11.536 16.565  15.565  1.00 30.91  ? 97  PHE C CZ  1 
ATOM   6626  N  N   . PHE C  3  98  ? -9.449  11.362  10.784  1.00 29.93  ? 98  PHE C N   1 
ATOM   6627  C  CA  . PHE C  3  98  ? -8.845  10.242  10.075  1.00 31.56  ? 98  PHE C CA  1 
ATOM   6628  C  C   . PHE C  3  98  ? -7.866  10.705  8.979   1.00 29.36  ? 98  PHE C C   1 
ATOM   6629  O  O   . PHE C  3  98  ? -6.832  10.110  8.795   1.00 29.22  ? 98  PHE C O   1 
ATOM   6630  C  CB  . PHE C  3  98  ? -9.919  9.303   9.512   1.00 33.29  ? 98  PHE C CB  1 
ATOM   6631  C  CG  . PHE C  3  98  ? -10.525 8.361   10.546  1.00 35.32  ? 98  PHE C CG  1 
ATOM   6632  C  CD1 . PHE C  3  98  ? -9.910  7.173   10.863  1.00 38.72  ? 98  PHE C CD1 1 
ATOM   6633  C  CD2 . PHE C  3  98  ? -11.716 8.651   11.161  1.00 36.68  ? 98  PHE C CD2 1 
ATOM   6634  C  CE1 . PHE C  3  98  ? -10.478 6.294   11.767  1.00 38.73  ? 98  PHE C CE1 1 
ATOM   6635  C  CE2 . PHE C  3  98  ? -12.277 7.790   12.079  1.00 37.39  ? 98  PHE C CE2 1 
ATOM   6636  C  CZ  . PHE C  3  98  ? -11.665 6.603   12.376  1.00 36.11  ? 98  PHE C CZ  1 
ATOM   6637  N  N   . TRP C  3  99  ? -8.223  11.757  8.252   1.00 29.48  ? 99  TRP C N   1 
ATOM   6638  C  CA  . TRP C  3  99  ? -7.337  12.456  7.335   1.00 29.18  ? 99  TRP C CA  1 
ATOM   6639  C  C   . TRP C  3  99  ? -6.050  12.843  8.072   1.00 29.87  ? 99  TRP C C   1 
ATOM   6640  O  O   . TRP C  3  99  ? -4.968  12.606  7.603   1.00 29.82  ? 99  TRP C O   1 
ATOM   6641  C  CB  . TRP C  3  99  ? -7.989  13.761  6.860   1.00 30.19  ? 99  TRP C CB  1 
ATOM   6642  C  CG  . TRP C  3  99  ? -7.380  14.392  5.624   1.00 31.75  ? 99  TRP C CG  1 
ATOM   6643  C  CD1 . TRP C  3  99  ? -6.082  14.341  5.197   1.00 29.54  ? 99  TRP C CD1 1 
ATOM   6644  C  CD2 . TRP C  3  99  ? -8.081  15.179  4.661   1.00 31.71  ? 99  TRP C CD2 1 
ATOM   6645  N  NE1 . TRP C  3  99  ? -5.949  15.000  4.020   1.00 30.14  ? 99  TRP C NE1 1 
ATOM   6646  C  CE2 . TRP C  3  99  ? -7.156  15.541  3.670   1.00 30.84  ? 99  TRP C CE2 1 
ATOM   6647  C  CE3 . TRP C  3  99  ? -9.412  15.607  4.538   1.00 32.98  ? 99  TRP C CE3 1 
ATOM   6648  C  CZ2 . TRP C  3  99  ? -7.516  16.301  2.562   1.00 32.02  ? 99  TRP C CZ2 1 
ATOM   6649  C  CZ3 . TRP C  3  99  ? -9.770  16.372  3.423   1.00 33.34  ? 99  TRP C CZ3 1 
ATOM   6650  C  CH2 . TRP C  3  99  ? -8.827  16.707  2.457   1.00 31.29  ? 99  TRP C CH2 1 
ATOM   6651  N  N   . ALA C  3  100 ? -6.195  13.452  9.233   1.00 28.97  ? 100 ALA C N   1 
ATOM   6652  C  CA  . ALA C  3  100 ? -5.075  13.946  9.951   1.00 27.96  ? 100 ALA C CA  1 
ATOM   6653  C  C   . ALA C  3  100 ? -4.144  12.806  10.348  1.00 30.09  ? 100 ALA C C   1 
ATOM   6654  O  O   . ALA C  3  100 ? -2.917  12.935  10.264  1.00 32.88  ? 100 ALA C O   1 
ATOM   6655  C  CB  . ALA C  3  100 ? -5.551  14.726  11.142  1.00 27.09  ? 100 ALA C CB  1 
ATOM   6656  N  N   . PHE C  3  101 ? -4.724  11.690  10.755  1.00 30.40  ? 101 PHE C N   1 
ATOM   6657  C  CA  . PHE C  3  101 ? -3.951  10.507  11.089  1.00 30.63  ? 101 PHE C CA  1 
ATOM   6658  C  C   . PHE C  3  101 ? -3.215  9.941   9.879   1.00 30.70  ? 101 PHE C C   1 
ATOM   6659  O  O   . PHE C  3  101 ? -2.033  9.629   9.959   1.00 28.97  ? 101 PHE C O   1 
ATOM   6660  C  CB  . PHE C  3  101 ? -4.833  9.392   11.691  1.00 30.87  ? 101 PHE C CB  1 
ATOM   6661  C  CG  . PHE C  3  101 ? -4.111  8.080   11.803  1.00 31.21  ? 101 PHE C CG  1 
ATOM   6662  C  CD1 . PHE C  3  101 ? -3.170  7.881   12.800  1.00 30.28  ? 101 PHE C CD1 1 
ATOM   6663  C  CD2 . PHE C  3  101 ? -4.307  7.071   10.857  1.00 32.63  ? 101 PHE C CD2 1 
ATOM   6664  C  CE1 . PHE C  3  101 ? -2.462  6.690   12.876  1.00 30.68  ? 101 PHE C CE1 1 
ATOM   6665  C  CE2 . PHE C  3  101 ? -3.607  5.876   10.945  1.00 32.06  ? 101 PHE C CE2 1 
ATOM   6666  C  CZ  . PHE C  3  101 ? -2.683  5.689   11.953  1.00 31.13  ? 101 PHE C CZ  1 
ATOM   6667  N  N   . TYR C  3  102 ? -3.941  9.727   8.794   1.00 30.86  ? 102 TYR C N   1 
ATOM   6668  C  CA  . TYR C  3  102 ? -3.361  9.133   7.608   1.00 33.23  ? 102 TYR C CA  1 
ATOM   6669  C  C   . TYR C  3  102 ? -2.295  10.055  6.980   1.00 30.60  ? 102 TYR C C   1 
ATOM   6670  O  O   . TYR C  3  102 ? -1.260  9.614   6.489   1.00 30.59  ? 102 TYR C O   1 
ATOM   6671  C  CB  . TYR C  3  102 ? -4.473  8.712   6.649   1.00 36.15  ? 102 TYR C CB  1 
ATOM   6672  C  CG  . TYR C  3  102 ? -5.084  7.381   7.041   1.00 40.61  ? 102 TYR C CG  1 
ATOM   6673  C  CD1 . TYR C  3  102 ? -4.302  6.222   7.025   1.00 47.47  ? 102 TYR C CD1 1 
ATOM   6674  C  CD2 . TYR C  3  102 ? -6.421  7.258   7.402   1.00 42.81  ? 102 TYR C CD2 1 
ATOM   6675  C  CE1 . TYR C  3  102 ? -4.818  4.992   7.372   1.00 45.86  ? 102 TYR C CE1 1 
ATOM   6676  C  CE2 . TYR C  3  102 ? -6.953  6.022   7.758   1.00 44.44  ? 102 TYR C CE2 1 
ATOM   6677  C  CZ  . TYR C  3  102 ? -6.130  4.900   7.739   1.00 46.53  ? 102 TYR C CZ  1 
ATOM   6678  O  OH  . TYR C  3  102 ? -6.583  3.662   8.072   1.00 47.39  ? 102 TYR C OH  1 
ATOM   6679  N  N   . HIS C  3  103 ? -2.513  11.343  7.086   1.00 28.38  ? 103 HIS C N   1 
ATOM   6680  C  CA  . HIS C  3  103 ? -1.578  12.289  6.552   1.00 29.63  ? 103 HIS C CA  1 
ATOM   6681  C  C   . HIS C  3  103 ? -0.230  12.220  7.276   1.00 30.06  ? 103 HIS C C   1 
ATOM   6682  O  O   . HIS C  3  103 ? 0.814   12.309  6.658   1.00 28.13  ? 103 HIS C O   1 
ATOM   6683  C  CB  . HIS C  3  103 ? -2.139  13.701  6.642   1.00 27.98  ? 103 HIS C CB  1 
ATOM   6684  C  CG  . HIS C  3  103 ? -1.201  14.740  6.141   1.00 28.28  ? 103 HIS C CG  1 
ATOM   6685  N  ND1 . HIS C  3  103 ? -1.301  15.283  4.880   1.00 28.12  ? 103 HIS C ND1 1 
ATOM   6686  C  CD2 . HIS C  3  103 ? -0.123  15.319  6.719   1.00 28.94  ? 103 HIS C CD2 1 
ATOM   6687  C  CE1 . HIS C  3  103 ? -0.343  16.179  4.716   1.00 29.22  ? 103 HIS C CE1 1 
ATOM   6688  N  NE2 . HIS C  3  103 ? 0.395   16.212  5.814   1.00 29.07  ? 103 HIS C NE2 1 
ATOM   6689  N  N   . SER C  3  104 ? -0.286  12.125  8.590   1.00 31.07  ? 104 SER C N   1 
ATOM   6690  C  CA  . SER C  3  104 ? 0.905   12.081  9.409   1.00 33.71  ? 104 SER C CA  1 
ATOM   6691  C  C   . SER C  3  104 ? 1.641   10.714  9.327   1.00 33.41  ? 104 SER C C   1 
ATOM   6692  O  O   . SER C  3  104 ? 2.867   10.690  9.218   1.00 34.19  ? 104 SER C O   1 
ATOM   6693  C  CB  . SER C  3  104 ? 0.526   12.441  10.841  1.00 35.86  ? 104 SER C CB  1 
ATOM   6694  O  OG  . SER C  3  104 ? -0.068  13.735  10.871  1.00 44.43  ? 104 SER C OG  1 
ATOM   6695  N  N   . SER C  3  105 ? 0.893   9.604   9.302   1.00 31.93  ? 105 SER C N   1 
ATOM   6696  C  CA  . SER C  3  105 ? 1.464   8.256   9.401   1.00 31.55  ? 105 SER C CA  1 
ATOM   6697  C  C   . SER C  3  105 ? 1.974   7.656   8.099   1.00 33.81  ? 105 SER C C   1 
ATOM   6698  O  O   . SER C  3  105 ? 2.969   6.921   8.100   1.00 37.05  ? 105 SER C O   1 
ATOM   6699  C  CB  . SER C  3  105 ? 0.476   7.289   10.059  1.00 30.71  ? 105 SER C CB  1 
ATOM   6700  O  OG  . SER C  3  105 ? -0.732  7.152   9.328   1.00 31.65  ? 105 SER C OG  1 
ATOM   6701  N  N   . LEU C  3  106 ? 1.298   7.933   6.998   1.00 34.69  ? 106 LEU C N   1 
ATOM   6702  C  CA  . LEU C  3  106 ? 1.772   7.485   5.703   1.00 36.87  ? 106 LEU C CA  1 
ATOM   6703  C  C   . LEU C  3  106 ? 2.995   8.250   5.228   1.00 39.88  ? 106 LEU C C   1 
ATOM   6704  O  O   . LEU C  3  106 ? 3.657   7.797   4.298   1.00 45.55  ? 106 LEU C O   1 
ATOM   6705  C  CB  . LEU C  3  106 ? 0.679   7.618   4.637   1.00 37.73  ? 106 LEU C CB  1 
ATOM   6706  C  CG  . LEU C  3  106 ? -0.565  6.760   4.789   1.00 38.09  ? 106 LEU C CG  1 
ATOM   6707  C  CD1 . LEU C  3  106 ? -1.568  7.125   3.706   1.00 38.39  ? 106 LEU C CD1 1 
ATOM   6708  C  CD2 . LEU C  3  106 ? -0.202  5.297   4.693   1.00 36.45  ? 106 LEU C CD2 1 
ATOM   6709  N  N   . ALA C  3  107 ? 3.285   9.410   5.820   1.00 40.91  ? 107 ALA C N   1 
ATOM   6710  C  CA  . ALA C  3  107 ? 4.435   10.221  5.387   1.00 42.22  ? 107 ALA C CA  1 
ATOM   6711  C  C   . ALA C  3  107 ? 5.127   10.806  6.577   1.00 39.24  ? 107 ALA C C   1 
ATOM   6712  O  O   . ALA C  3  107 ? 5.129   12.021  6.777   1.00 35.96  ? 107 ALA C O   1 
ATOM   6713  C  CB  . ALA C  3  107 ? 3.981   11.330  4.458   1.00 46.12  ? 107 ALA C CB  1 
ATOM   6714  N  N   . PRO C  3  108 ? 5.717   9.938   7.389   1.00 37.23  ? 108 PRO C N   1 
ATOM   6715  C  CA  . PRO C  3  108 ? 6.333   10.442  8.611   1.00 38.59  ? 108 PRO C CA  1 
ATOM   6716  C  C   . PRO C  3  108 ? 7.575   11.313  8.334   1.00 37.91  ? 108 PRO C C   1 
ATOM   6717  O  O   . PRO C  3  108 ? 8.394   10.966  7.520   1.00 48.27  ? 108 PRO C O   1 
ATOM   6718  C  CB  . PRO C  3  108 ? 6.664   9.160   9.395   1.00 37.88  ? 108 PRO C CB  1 
ATOM   6719  C  CG  . PRO C  3  108 ? 6.616   8.050   8.396   1.00 35.80  ? 108 PRO C CG  1 
ATOM   6720  C  CD  . PRO C  3  108 ? 5.948   8.509   7.159   1.00 35.31  ? 108 PRO C CD  1 
ATOM   6721  N  N   . THR C  3  109 ? 7.699   12.428  9.025   1.00 38.04  ? 109 THR C N   1 
ATOM   6722  C  CA  . THR C  3  109 ? 8.729   13.433  8.767   1.00 38.00  ? 109 THR C CA  1 
ATOM   6723  C  C   . THR C  3  109 ? 10.055  13.140  9.468   1.00 37.12  ? 109 THR C C   1 
ATOM   6724  O  O   . THR C  3  109 ? 10.080  12.342  10.388  1.00 31.99  ? 109 THR C O   1 
ATOM   6725  C  CB  . THR C  3  109 ? 8.235   14.815  9.261   1.00 38.26  ? 109 THR C CB  1 
ATOM   6726  O  OG1 . THR C  3  109 ? 8.056   14.779  10.675  1.00 33.86  ? 109 THR C OG1 1 
ATOM   6727  C  CG2 . THR C  3  109 ? 6.896   15.159  8.613   1.00 39.03  ? 109 THR C CG2 1 
ATOM   6728  N  N   . PRO C  3  110 ? 11.158  13.839  9.070   1.00 42.08  ? 110 PRO C N   1 
ATOM   6729  C  CA  . PRO C  3  110 ? 12.493  13.634  9.676   1.00 38.75  ? 110 PRO C CA  1 
ATOM   6730  C  C   . PRO C  3  110 ? 12.516  13.840  11.165  1.00 39.75  ? 110 PRO C C   1 
ATOM   6731  O  O   . PRO C  3  110 ? 13.256  13.157  11.866  1.00 40.63  ? 110 PRO C O   1 
ATOM   6732  C  CB  . PRO C  3  110 ? 13.329  14.708  9.009   1.00 38.06  ? 110 PRO C CB  1 
ATOM   6733  C  CG  . PRO C  3  110 ? 12.721  14.822  7.664   1.00 39.84  ? 110 PRO C CG  1 
ATOM   6734  C  CD  . PRO C  3  110 ? 11.259  14.835  7.984   1.00 40.90  ? 110 PRO C CD  1 
ATOM   6735  N  N   . GLU C  3  111 ? 11.695  14.768  11.642  1.00 41.42  ? 111 GLU C N   1 
ATOM   6736  C  CA  . GLU C  3  111 ? 11.641  15.081  13.057  1.00 43.51  ? 111 GLU C CA  1 
ATOM   6737  C  C   . GLU C  3  111 ? 11.178  13.928  13.957  1.00 42.26  ? 111 GLU C C   1 
ATOM   6738  O  O   . GLU C  3  111 ? 11.554  13.877  15.116  1.00 43.16  ? 111 GLU C O   1 
ATOM   6739  C  CB  . GLU C  3  111 ? 10.817  16.356  13.265  1.00 48.36  ? 111 GLU C CB  1 
ATOM   6740  C  CG  . GLU C  3  111 ? 11.490  17.598  12.647  1.00 57.95  ? 111 GLU C CG  1 
ATOM   6741  C  CD  . GLU C  3  111 ? 12.868  17.892  13.292  1.00 68.69  ? 111 GLU C CD  1 
ATOM   6742  O  OE1 . GLU C  3  111 ? 13.942  17.833  12.586  1.00 54.18  ? 111 GLU C OE1 1 
ATOM   6743  O  OE2 . GLU C  3  111 ? 12.858  18.133  14.537  1.00 70.22  ? 111 GLU C OE2 1 
ATOM   6744  N  N   . LEU C  3  112 ? 10.385  13.015  13.408  1.00 40.32  ? 112 LEU C N   1 
ATOM   6745  C  CA  . LEU C  3  112 ? 9.969   11.775  14.069  1.00 42.70  ? 112 LEU C CA  1 
ATOM   6746  C  C   . LEU C  3  112 ? 10.942  10.601  13.917  1.00 40.70  ? 112 LEU C C   1 
ATOM   6747  O  O   . LEU C  3  112 ? 10.665  9.528   14.431  1.00 42.27  ? 112 LEU C O   1 
ATOM   6748  C  CB  . LEU C  3  112 ? 8.667   11.277  13.418  1.00 41.72  ? 112 LEU C CB  1 
ATOM   6749  C  CG  . LEU C  3  112 ? 7.488   12.210  13.503  1.00 43.15  ? 112 LEU C CG  1 
ATOM   6750  C  CD1 . LEU C  3  112 ? 6.351   11.528  12.791  1.00 45.65  ? 112 LEU C CD1 1 
ATOM   6751  C  CD2 . LEU C  3  112 ? 7.116   12.542  14.939  1.00 47.71  ? 112 LEU C CD2 1 
ATOM   6752  N  N   . GLY C  3  113 ? 12.005  10.788  13.133  1.00 40.75  ? 113 GLY C N   1 
ATOM   6753  C  CA  . GLY C  3  113 ? 12.838  9.715   12.597  1.00 36.16  ? 113 GLY C CA  1 
ATOM   6754  C  C   . GLY C  3  113 ? 12.438  9.160   11.245  1.00 36.08  ? 113 GLY C C   1 
ATOM   6755  O  O   . GLY C  3  113 ? 12.996  8.160   10.803  1.00 35.27  ? 113 GLY C O   1 
ATOM   6756  N  N   . GLY C  3  114 ? 11.473  9.773   10.570  1.00 35.69  ? 114 GLY C N   1 
ATOM   6757  C  CA  . GLY C  3  114 ? 11.106  9.329   9.239   1.00 34.10  ? 114 GLY C CA  1 
ATOM   6758  C  C   . GLY C  3  114 ? 10.452  7.963   9.192   1.00 35.55  ? 114 GLY C C   1 
ATOM   6759  O  O   . GLY C  3  114 ? 10.445  7.328   8.154   1.00 37.54  ? 114 GLY C O   1 
ATOM   6760  N  N   . CYS C  3  115 ? 9.858   7.527   10.301  1.00 38.02  ? 115 CYS C N   1 
ATOM   6761  C  CA  . CYS C  3  115 ? 9.215   6.212   10.411  1.00 38.02  ? 115 CYS C CA  1 
ATOM   6762  C  C   . CYS C  3  115 ? 7.954   6.317   11.264  1.00 38.48  ? 115 CYS C C   1 
ATOM   6763  O  O   . CYS C  3  115 ? 7.794   7.262   12.032  1.00 41.23  ? 115 CYS C O   1 
ATOM   6764  C  CB  . CYS C  3  115 ? 10.161  5.246   11.107  1.00 41.66  ? 115 CYS C CB  1 
ATOM   6765  S  SG  . CYS C  3  115 ? 10.664  5.870   12.731  1.00 43.01  ? 115 CYS C SG  1 
ATOM   6766  N  N   . TRP C  3  116 ? 7.077   5.329   11.142  1.00 39.02  ? 116 TRP C N   1 
ATOM   6767  C  CA  . TRP C  3  116 ? 5.872   5.260   11.949  1.00 38.94  ? 116 TRP C CA  1 
ATOM   6768  C  C   . TRP C  3  116 ? 5.695   3.841   12.509  1.00 39.40  ? 116 TRP C C   1 
ATOM   6769  O  O   . TRP C  3  116 ? 5.720   2.880   11.722  1.00 41.27  ? 116 TRP C O   1 
ATOM   6770  C  CB  . TRP C  3  116 ? 4.659   5.655   11.115  1.00 38.60  ? 116 TRP C CB  1 
ATOM   6771  C  CG  . TRP C  3  116 ? 3.460   5.922   11.919  1.00 35.71  ? 116 TRP C CG  1 
ATOM   6772  C  CD1 . TRP C  3  116 ? 2.519   5.012   12.297  1.00 37.98  ? 116 TRP C CD1 1 
ATOM   6773  C  CD2 . TRP C  3  116 ? 3.055   7.179   12.454  1.00 36.37  ? 116 TRP C CD2 1 
ATOM   6774  N  NE1 . TRP C  3  116 ? 1.554   5.616   13.068  1.00 41.66  ? 116 TRP C NE1 1 
ATOM   6775  C  CE2 . TRP C  3  116 ? 1.849   6.952   13.179  1.00 39.37  ? 116 TRP C CE2 1 
ATOM   6776  C  CE3 . TRP C  3  116 ? 3.595   8.480   12.410  1.00 36.35  ? 116 TRP C CE3 1 
ATOM   6777  C  CZ2 . TRP C  3  116 ? 1.142   7.989   13.828  1.00 37.62  ? 116 TRP C CZ2 1 
ATOM   6778  C  CZ3 . TRP C  3  116 ? 2.901   9.517   13.055  1.00 38.48  ? 116 TRP C CZ3 1 
ATOM   6779  C  CH2 . TRP C  3  116 ? 1.675   9.259   13.763  1.00 39.28  ? 116 TRP C CH2 1 
ATOM   6780  N  N   . PRO C  3  117 ? 5.485   3.696   13.826  1.00 37.69  ? 117 PRO C N   1 
ATOM   6781  C  CA  . PRO C  3  117 ? 5.321   4.816   14.785  1.00 37.93  ? 117 PRO C CA  1 
ATOM   6782  C  C   . PRO C  3  117 ? 6.612   5.593   14.994  1.00 37.26  ? 117 PRO C C   1 
ATOM   6783  O  O   . PRO C  3  117 ? 7.679   5.066   14.750  1.00 41.40  ? 117 PRO C O   1 
ATOM   6784  C  CB  . PRO C  3  117 ? 4.912   4.143   16.109  1.00 39.74  ? 117 PRO C CB  1 
ATOM   6785  C  CG  . PRO C  3  117 ? 4.620   2.694   15.776  1.00 40.07  ? 117 PRO C CG  1 
ATOM   6786  C  CD  . PRO C  3  117 ? 5.177   2.378   14.412  1.00 38.15  ? 117 PRO C CD  1 
ATOM   6787  N  N   . PRO C  3  118 ? 6.515   6.843   15.447  1.00 35.52  ? 118 PRO C N   1 
ATOM   6788  C  CA  . PRO C  3  118 ? 7.758   7.554   15.672  1.00 35.75  ? 118 PRO C CA  1 
ATOM   6789  C  C   . PRO C  3  118 ? 8.713   6.870   16.652  1.00 35.85  ? 118 PRO C C   1 
ATOM   6790  O  O   . PRO C  3  118 ? 8.304   6.105   17.529  1.00 36.68  ? 118 PRO C O   1 
ATOM   6791  C  CB  . PRO C  3  118 ? 7.295   8.901   16.254  1.00 33.05  ? 118 PRO C CB  1 
ATOM   6792  C  CG  . PRO C  3  118 ? 5.884   9.040   15.816  1.00 33.35  ? 118 PRO C CG  1 
ATOM   6793  C  CD  . PRO C  3  118 ? 5.337   7.658   15.797  1.00 33.24  ? 118 PRO C CD  1 
ATOM   6794  N  N   . THR C  3  119 ? 9.981   7.212   16.505  1.00 35.89  ? 119 THR C N   1 
ATOM   6795  C  CA  . THR C  3  119 ? 11.027  6.829   17.418  1.00 34.82  ? 119 THR C CA  1 
ATOM   6796  C  C   . THR C  3  119 ? 10.661  7.344   18.768  1.00 35.26  ? 119 THR C C   1 
ATOM   6797  O  O   . THR C  3  119 ? 10.293  8.503   18.898  1.00 44.75  ? 119 THR C O   1 
ATOM   6798  C  CB  . THR C  3  119 ? 12.354  7.452   16.955  1.00 34.92  ? 119 THR C CB  1 
ATOM   6799  O  OG1 . THR C  3  119 ? 12.673  6.927   15.651  1.00 34.29  ? 119 THR C OG1 1 
ATOM   6800  C  CG2 . THR C  3  119 ? 13.495  7.172   17.957  1.00 34.77  ? 119 THR C CG2 1 
ATOM   6801  N  N   . GLY C  3  120 ? 10.732  6.483   19.774  1.00 36.70  ? 120 GLY C N   1 
ATOM   6802  C  CA  . GLY C  3  120 ? 10.430  6.861   21.154  1.00 37.80  ? 120 GLY C CA  1 
ATOM   6803  C  C   . GLY C  3  120 ? 8.993   6.592   21.609  1.00 39.51  ? 120 GLY C C   1 
ATOM   6804  O  O   . GLY C  3  120 ? 8.657   6.881   22.767  1.00 39.73  ? 120 GLY C O   1 
ATOM   6805  N  N   . ILE C  3  121 ? 8.150   6.049   20.721  1.00 38.40  ? 121 ILE C N   1 
ATOM   6806  C  CA  . ILE C  3  121 ? 6.749   5.778   21.038  1.00 38.89  ? 121 ILE C CA  1 
ATOM   6807  C  C   . ILE C  3  121 ? 6.582   4.274   21.173  1.00 38.05  ? 121 ILE C C   1 
ATOM   6808  O  O   . ILE C  3  121 ? 6.912   3.513   20.246  1.00 38.22  ? 121 ILE C O   1 
ATOM   6809  C  CB  . ILE C  3  121 ? 5.823   6.316   19.921  1.00 39.18  ? 121 ILE C CB  1 
ATOM   6810  C  CG1 . ILE C  3  121 ? 5.800   7.855   19.934  1.00 39.59  ? 121 ILE C CG1 1 
ATOM   6811  C  CG2 . ILE C  3  121 ? 4.405   5.737   20.009  1.00 38.46  ? 121 ILE C CG2 1 
ATOM   6812  C  CD1 . ILE C  3  121 ? 4.807   8.474   20.891  1.00 40.31  ? 121 ILE C CD1 1 
ATOM   6813  N  N   . HIS C  3  122 ? 6.044   3.846   22.303  1.00 40.98  ? 122 HIS C N   1 
ATOM   6814  C  CA  . HIS C  3  122 ? 5.731   2.425   22.515  1.00 45.12  ? 122 HIS C CA  1 
ATOM   6815  C  C   . HIS C  3  122 ? 4.236   2.261   22.400  1.00 39.97  ? 122 HIS C C   1 
ATOM   6816  O  O   . HIS C  3  122 ? 3.506   2.612   23.297  1.00 41.11  ? 122 HIS C O   1 
ATOM   6817  C  CB  . HIS C  3  122 ? 6.245   1.976   23.875  1.00 53.49  ? 122 HIS C CB  1 
ATOM   6818  C  CG  . HIS C  3  122 ? 7.723   2.110   24.000  1.00 63.55  ? 122 HIS C CG  1 
ATOM   6819  N  ND1 . HIS C  3  122 ? 8.583   1.067   23.737  1.00 68.79  ? 122 HIS C ND1 1 
ATOM   6820  C  CD2 . HIS C  3  122 ? 8.500   3.184   24.287  1.00 67.26  ? 122 HIS C CD2 1 
ATOM   6821  C  CE1 . HIS C  3  122 ? 9.829   1.481   23.895  1.00 75.29  ? 122 HIS C CE1 1 
ATOM   6822  N  NE2 . HIS C  3  122 ? 9.807   2.762   24.224  1.00 74.03  ? 122 HIS C NE2 1 
ATOM   6823  N  N   . PRO C  3  123 ? 3.758   1.778   21.272  1.00 38.26  ? 123 PRO C N   1 
ATOM   6824  C  CA  . PRO C  3  123 ? 2.305   1.729   21.146  1.00 37.61  ? 123 PRO C CA  1 
ATOM   6825  C  C   . PRO C  3  123 ? 1.652   0.606   21.940  1.00 38.25  ? 123 PRO C C   1 
ATOM   6826  O  O   . PRO C  3  123 ? 2.301   -0.370  22.301  1.00 41.08  ? 123 PRO C O   1 
ATOM   6827  C  CB  . PRO C  3  123 ? 2.083   1.505   19.645  1.00 36.99  ? 123 PRO C CB  1 
ATOM   6828  C  CG  . PRO C  3  123 ? 3.437   1.489   19.008  1.00 38.02  ? 123 PRO C CG  1 
ATOM   6829  C  CD  . PRO C  3  123 ? 4.442   1.272   20.078  1.00 38.40  ? 123 PRO C CD  1 
ATOM   6830  N  N   . LEU C  3  124 ? 0.351   0.737   22.159  1.00 38.37  ? 124 LEU C N   1 
ATOM   6831  C  CA  . LEU C  3  124 ? -0.424  -0.313  22.820  1.00 40.20  ? 124 LEU C CA  1 
ATOM   6832  C  C   . LEU C  3  124 ? -0.488  -1.536  21.925  1.00 39.01  ? 124 LEU C C   1 
ATOM   6833  O  O   . LEU C  3  124 ? -0.373  -1.440  20.705  1.00 42.52  ? 124 LEU C O   1 
ATOM   6834  C  CB  . LEU C  3  124 ? -1.844  0.162   23.134  1.00 43.52  ? 124 LEU C CB  1 
ATOM   6835  C  CG  . LEU C  3  124 ? -1.966  1.465   23.939  1.00 46.95  ? 124 LEU C CG  1 
ATOM   6836  C  CD1 . LEU C  3  124 ? -3.378  2.011   23.908  1.00 48.14  ? 124 LEU C CD1 1 
ATOM   6837  C  CD2 . LEU C  3  124 ? -1.497  1.255   25.368  1.00 50.42  ? 124 LEU C CD2 1 
ATOM   6838  N  N   . ASN C  3  125 ? -0.657  -2.697  22.536  1.00 38.37  ? 125 ASN C N   1 
ATOM   6839  C  CA  . ASN C  3  125 ? -0.815  -3.939  21.792  1.00 36.56  ? 125 ASN C CA  1 
ATOM   6840  C  C   . ASN C  3  125 ? -2.275  -4.046  21.385  1.00 33.32  ? 125 ASN C C   1 
ATOM   6841  O  O   . ASN C  3  125 ? -3.144  -4.041  22.234  1.00 34.64  ? 125 ASN C O   1 
ATOM   6842  C  CB  . ASN C  3  125 ? -0.440  -5.126  22.675  1.00 39.23  ? 125 ASN C CB  1 
ATOM   6843  C  CG  . ASN C  3  125 ? -0.419  -6.442  21.914  1.00 43.57  ? 125 ASN C CG  1 
ATOM   6844  O  OD1 . ASN C  3  125 ? -1.042  -6.619  20.846  1.00 44.38  ? 125 ASN C OD1 1 
ATOM   6845  N  ND2 . ASN C  3  125 ? 0.309   -7.384  22.467  1.00 51.05  ? 125 ASN C ND2 1 
ATOM   6846  N  N   . PRO C  3  126 ? -2.557  -4.162  20.098  1.00 31.41  ? 126 PRO C N   1 
ATOM   6847  C  CA  . PRO C  3  126 ? -3.957  -4.204  19.673  1.00 33.96  ? 126 PRO C CA  1 
ATOM   6848  C  C   . PRO C  3  126 ? -4.730  -5.499  19.996  1.00 36.69  ? 126 PRO C C   1 
ATOM   6849  O  O   . PRO C  3  126 ? -5.987  -5.527  19.947  1.00 34.64  ? 126 PRO C O   1 
ATOM   6850  C  CB  . PRO C  3  126 ? -3.855  -3.993  18.159  1.00 32.32  ? 126 PRO C CB  1 
ATOM   6851  C  CG  . PRO C  3  126 ? -2.512  -4.530  17.807  1.00 31.61  ? 126 PRO C CG  1 
ATOM   6852  C  CD  . PRO C  3  126 ? -1.643  -4.107  18.952  1.00 31.62  ? 126 PRO C CD  1 
ATOM   6853  N  N   . LEU C  3  127 ? -3.995  -6.559  20.323  1.00 40.60  ? 127 LEU C N   1 
ATOM   6854  C  CA  . LEU C  3  127 ? -4.611  -7.826  20.723  1.00 40.88  ? 127 LEU C CA  1 
ATOM   6855  C  C   . LEU C  3  127 ? -4.948  -7.907  22.189  1.00 37.61  ? 127 LEU C C   1 
ATOM   6856  O  O   . LEU C  3  127 ? -5.471  -8.919  22.603  1.00 42.17  ? 127 LEU C O   1 
ATOM   6857  C  CB  . LEU C  3  127 ? -3.707  -8.991  20.372  1.00 43.72  ? 127 LEU C CB  1 
ATOM   6858  C  CG  . LEU C  3  127 ? -3.490  -9.146  18.888  1.00 45.01  ? 127 LEU C CG  1 
ATOM   6859  C  CD1 . LEU C  3  127 ? -2.283  -10.033 18.648  1.00 44.99  ? 127 LEU C CD1 1 
ATOM   6860  C  CD2 . LEU C  3  127 ? -4.768  -9.672  18.246  1.00 47.53  ? 127 LEU C CD2 1 
ATOM   6861  N  N   . GLU C  3  128 ? -4.695  -6.862  22.967  1.00 35.10  ? 128 GLU C N   1 
ATOM   6862  C  CA  . GLU C  3  128 ? -5.048  -6.866  24.376  1.00 36.30  ? 128 GLU C CA  1 
ATOM   6863  C  C   . GLU C  3  128 ? -6.352  -6.065  24.602  1.00 34.97  ? 128 GLU C C   1 
ATOM   6864  O  O   . GLU C  3  128 ? -7.369  -6.443  24.035  1.00 35.76  ? 128 GLU C O   1 
ATOM   6865  C  CB  . GLU C  3  128 ? -3.841  -6.417  25.226  1.00 39.79  ? 128 GLU C CB  1 
ATOM   6866  C  CG  . GLU C  3  128 ? -2.677  -7.391  25.157  1.00 44.47  ? 128 GLU C CG  1 
ATOM   6867  C  CD  . GLU C  3  128 ? -1.395  -6.901  25.818  1.00 51.98  ? 128 GLU C CD  1 
ATOM   6868  O  OE1 . GLU C  3  128 ? -0.434  -7.712  25.856  1.00 55.55  ? 128 GLU C OE1 1 
ATOM   6869  O  OE2 . GLU C  3  128 ? -1.343  -5.738  26.305  1.00 54.01  ? 128 GLU C OE2 1 
ATOM   6870  N  N   . VAL C  3  129 ? -6.351  -4.986  25.395  1.00 33.83  ? 129 VAL C N   1 
ATOM   6871  C  CA  . VAL C  3  129 ? -7.580  -4.270  25.684  1.00 35.84  ? 129 VAL C CA  1 
ATOM   6872  C  C   . VAL C  3  129 ? -8.318  -3.712  24.449  1.00 35.17  ? 129 VAL C C   1 
ATOM   6873  O  O   . VAL C  3  129 ? -9.538  -3.741  24.406  1.00 38.99  ? 129 VAL C O   1 
ATOM   6874  C  CB  . VAL C  3  129 ? -7.356  -3.161  26.716  1.00 38.44  ? 129 VAL C CB  1 
ATOM   6875  C  CG1 . VAL C  3  129 ? -8.611  -2.316  26.896  1.00 40.56  ? 129 VAL C CG1 1 
ATOM   6876  C  CG2 . VAL C  3  129 ? -6.990  -3.763  28.061  1.00 39.73  ? 129 VAL C CG2 1 
ATOM   6877  N  N   . PRO C  3  130 ? -7.599  -3.207  23.448  1.00 33.36  ? 130 PRO C N   1 
ATOM   6878  C  CA  . PRO C  3  130 ? -8.308  -2.790  22.249  1.00 33.42  ? 130 PRO C CA  1 
ATOM   6879  C  C   . PRO C  3  130 ? -9.154  -3.878  21.584  1.00 33.67  ? 130 PRO C C   1 
ATOM   6880  O  O   . PRO C  3  130 ? -10.188 -3.582  21.002  1.00 33.82  ? 130 PRO C O   1 
ATOM   6881  C  CB  . PRO C  3  130 ? -7.160  -2.339  21.332  1.00 34.36  ? 130 PRO C CB  1 
ATOM   6882  C  CG  . PRO C  3  130 ? -6.142  -1.778  22.270  1.00 33.65  ? 130 PRO C CG  1 
ATOM   6883  C  CD  . PRO C  3  130 ? -6.189  -2.764  23.416  1.00 35.13  ? 130 PRO C CD  1 
ATOM   6884  N  N   . LEU C  3  131 ? -8.709  -5.131  21.648  1.00 36.19  ? 131 LEU C N   1 
ATOM   6885  C  CA  . LEU C  3  131 ? -9.502  -6.251  21.132  1.00 35.22  ? 131 LEU C CA  1 
ATOM   6886  C  C   . LEU C  3  131 ? -10.732 -6.448  22.023  1.00 33.25  ? 131 LEU C C   1 
ATOM   6887  O  O   . LEU C  3  131 ? -11.838 -6.687  21.548  1.00 33.49  ? 131 LEU C O   1 
ATOM   6888  C  CB  . LEU C  3  131 ? -8.666  -7.540  21.061  1.00 34.28  ? 131 LEU C CB  1 
ATOM   6889  C  CG  . LEU C  3  131 ? -9.417  -8.712  20.410  1.00 35.23  ? 131 LEU C CG  1 
ATOM   6890  C  CD1 . LEU C  3  131 ? -9.769  -8.398  18.968  1.00 34.38  ? 131 LEU C CD1 1 
ATOM   6891  C  CD2 . LEU C  3  131 ? -8.588  -9.981  20.495  1.00 35.38  ? 131 LEU C CD2 1 
ATOM   6892  N  N   . LEU C  3  132 ? -10.506 -6.355  23.323  1.00 31.09  ? 132 LEU C N   1 
ATOM   6893  C  CA  . LEU C  3  132 ? -11.579 -6.393  24.275  1.00 33.02  ? 132 LEU C CA  1 
ATOM   6894  C  C   . LEU C  3  132 ? -12.614 -5.263  24.008  1.00 33.48  ? 132 LEU C C   1 
ATOM   6895  O  O   . LEU C  3  132 ? -13.792 -5.548  23.939  1.00 40.74  ? 132 LEU C O   1 
ATOM   6896  C  CB  . LEU C  3  132 ? -11.014 -6.369  25.712  1.00 31.86  ? 132 LEU C CB  1 
ATOM   6897  C  CG  . LEU C  3  132 ? -12.076 -6.318  26.805  1.00 32.65  ? 132 LEU C CG  1 
ATOM   6898  C  CD1 . LEU C  3  132 ? -13.124 -7.390  26.609  1.00 33.75  ? 132 LEU C CD1 1 
ATOM   6899  C  CD2 . LEU C  3  132 ? -11.447 -6.395  28.184  1.00 33.06  ? 132 LEU C CD2 1 
ATOM   6900  N  N   . ASN C  3  133 ? -12.180 -4.014  23.835  1.00 32.46  ? 133 ASN C N   1 
ATOM   6901  C  CA  . ASN C  3  133 ? -13.093 -2.905  23.522  1.00 33.16  ? 133 ASN C CA  1 
ATOM   6902  C  C   . ASN C  3  133 ? -13.943 -3.208  22.302  1.00 29.64  ? 133 ASN C C   1 
ATOM   6903  O  O   . ASN C  3  133 ? -15.162 -2.964  22.255  1.00 28.66  ? 133 ASN C O   1 
ATOM   6904  C  CB  . ASN C  3  133 ? -12.302 -1.635  23.249  1.00 36.88  ? 133 ASN C CB  1 
ATOM   6905  C  CG  . ASN C  3  133 ? -11.792 -0.978  24.505  1.00 39.74  ? 133 ASN C CG  1 
ATOM   6906  O  OD1 . ASN C  3  133 ? -12.461 -0.997  25.515  1.00 45.85  ? 133 ASN C OD1 1 
ATOM   6907  N  ND2 . ASN C  3  133 ? -10.607 -0.357  24.432  1.00 46.61  ? 133 ASN C ND2 1 
ATOM   6908  N  N   . THR C  3  134 ? -13.282 -3.764  21.313  1.00 27.15  ? 134 THR C N   1 
ATOM   6909  C  CA  . THR C  3  134 ? -13.912 -4.083  20.084  1.00 27.11  ? 134 THR C CA  1 
ATOM   6910  C  C   . THR C  3  134 ? -15.011 -5.115  20.276  1.00 28.68  ? 134 THR C C   1 
ATOM   6911  O  O   . THR C  3  134 ? -16.120 -4.962  19.727  1.00 31.28  ? 134 THR C O   1 
ATOM   6912  C  CB  . THR C  3  134 ? -12.851 -4.553  19.077  1.00 27.96  ? 134 THR C CB  1 
ATOM   6913  O  OG1 . THR C  3  134 ? -11.940 -3.476  18.851  1.00 26.88  ? 134 THR C OG1 1 
ATOM   6914  C  CG2 . THR C  3  134 ? -13.470 -4.952  17.729  1.00 27.97  ? 134 THR C CG2 1 
ATOM   6915  N  N   . SER C  3  135 ? -14.744 -6.164  21.047  1.00 28.95  ? 135 SER C N   1 
ATOM   6916  C  CA  . SER C  3  135 ? -15.778 -7.199  21.238  1.00 31.81  ? 135 SER C CA  1 
ATOM   6917  C  C   . SER C  3  135 ? -16.925 -6.674  22.090  1.00 30.70  ? 135 SER C C   1 
ATOM   6918  O  O   . SER C  3  135 ? -18.060 -7.137  21.950  1.00 35.77  ? 135 SER C O   1 
ATOM   6919  C  CB  . SER C  3  135 ? -15.209 -8.489  21.853  1.00 32.30  ? 135 SER C CB  1 
ATOM   6920  O  OG  . SER C  3  135 ? -14.990 -8.278  23.231  1.00 35.22  ? 135 SER C OG  1 
ATOM   6921  N  N   . VAL C  3  136 ? -16.611 -5.747  22.988  1.00 29.43  ? 136 VAL C N   1 
ATOM   6922  C  CA  . VAL C  3  136 ? -17.615 -5.151  23.847  1.00 31.93  ? 136 VAL C CA  1 
ATOM   6923  C  C   . VAL C  3  136 ? -18.629 -4.341  23.012  1.00 33.12  ? 136 VAL C C   1 
ATOM   6924  O  O   . VAL C  3  136 ? -19.848 -4.533  23.158  1.00 30.02  ? 136 VAL C O   1 
ATOM   6925  C  CB  . VAL C  3  136 ? -16.960 -4.272  24.934  1.00 32.69  ? 136 VAL C CB  1 
ATOM   6926  C  CG1 . VAL C  3  136 ? -17.971 -3.343  25.624  1.00 31.95  ? 136 VAL C CG1 1 
ATOM   6927  C  CG2 . VAL C  3  136 ? -16.205 -5.139  25.941  1.00 32.22  ? 136 VAL C CG2 1 
ATOM   6928  N  N   . LEU C  3  137 ? -18.131 -3.469  22.127  1.00 34.09  ? 137 LEU C N   1 
ATOM   6929  C  CA  . LEU C  3  137 ? -19.039 -2.634  21.332  1.00 33.33  ? 137 LEU C CA  1 
ATOM   6930  C  C   . LEU C  3  137 ? -19.795 -3.451  20.293  1.00 29.90  ? 137 LEU C C   1 
ATOM   6931  O  O   . LEU C  3  137 ? -21.001 -3.286  20.143  1.00 30.23  ? 137 LEU C O   1 
ATOM   6932  C  CB  . LEU C  3  137 ? -18.335 -1.435  20.706  1.00 33.74  ? 137 LEU C CB  1 
ATOM   6933  C  CG  . LEU C  3  137 ? -17.953 -0.307  21.662  1.00 33.55  ? 137 LEU C CG  1 
ATOM   6934  C  CD1 . LEU C  3  137 ? -17.304 0.752   20.805  1.00 34.94  ? 137 LEU C CD1 1 
ATOM   6935  C  CD2 . LEU C  3  137 ? -19.121 0.295   22.418  1.00 33.40  ? 137 LEU C CD2 1 
ATOM   6936  N  N   . LEU C  3  138 ? -19.134 -4.364  19.619  1.00 29.55  ? 138 LEU C N   1 
ATOM   6937  C  CA  . LEU C  3  138 ? -19.874 -5.249  18.693  1.00 31.69  ? 138 LEU C CA  1 
ATOM   6938  C  C   . LEU C  3  138 ? -20.968 -6.069  19.421  1.00 29.49  ? 138 LEU C C   1 
ATOM   6939  O  O   . LEU C  3  138 ? -22.066 -6.268  18.903  1.00 28.67  ? 138 LEU C O   1 
ATOM   6940  C  CB  . LEU C  3  138 ? -18.905 -6.184  17.970  1.00 33.07  ? 138 LEU C CB  1 
ATOM   6941  C  CG  . LEU C  3  138 ? -17.939 -5.543  16.963  1.00 33.84  ? 138 LEU C CG  1 
ATOM   6942  C  CD1 . LEU C  3  138 ? -16.814 -6.515  16.622  1.00 34.97  ? 138 LEU C CD1 1 
ATOM   6943  C  CD2 . LEU C  3  138 ? -18.689 -5.125  15.702  1.00 34.48  ? 138 LEU C CD2 1 
ATOM   6944  N  N   . ALA C  3  139 ? -20.681 -6.515  20.635  1.00 28.72  ? 139 ALA C N   1 
ATOM   6945  C  CA  . ALA C  3  139 ? -21.676 -7.266  21.390  1.00 31.17  ? 139 ALA C CA  1 
ATOM   6946  C  C   . ALA C  3  139 ? -22.892 -6.371  21.745  1.00 30.92  ? 139 ALA C C   1 
ATOM   6947  O  O   . ALA C  3  139 ? -24.042 -6.809  21.636  1.00 30.06  ? 139 ALA C O   1 
ATOM   6948  C  CB  . ALA C  3  139 ? -21.045 -7.907  22.623  1.00 31.46  ? 139 ALA C CB  1 
ATOM   6949  N  N   . SER C  3  140 ? -22.620 -5.121  22.108  1.00 29.05  ? 140 SER C N   1 
ATOM   6950  C  CA  . SER C  3  140 ? -23.655 -4.133  22.334  1.00 29.71  ? 140 SER C CA  1 
ATOM   6951  C  C   . SER C  3  140 ? -24.533 -3.892  21.098  1.00 30.13  ? 140 SER C C   1 
ATOM   6952  O  O   . SER C  3  140 ? -25.712 -3.564  21.220  1.00 31.19  ? 140 SER C O   1 
ATOM   6953  C  CB  . SER C  3  140 ? -23.048 -2.804  22.865  1.00 30.90  ? 140 SER C CB  1 
ATOM   6954  O  OG  . SER C  3  140 ? -22.487 -1.976  21.843  1.00 30.47  ? 140 SER C OG  1 
ATOM   6955  N  N   . GLY C  3  141 ? -23.960 -4.029  19.911  1.00 31.12  ? 141 GLY C N   1 
ATOM   6956  C  CA  . GLY C  3  141 ? -24.736 -3.983  18.672  1.00 30.76  ? 141 GLY C CA  1 
ATOM   6957  C  C   . GLY C  3  141 ? -25.743 -5.101  18.546  1.00 30.87  ? 141 GLY C C   1 
ATOM   6958  O  O   . GLY C  3  141 ? -26.838 -4.908  18.055  1.00 31.57  ? 141 GLY C O   1 
ATOM   6959  N  N   . VAL C  3  142 ? -25.366 -6.286  19.002  1.00 32.92  ? 142 VAL C N   1 
ATOM   6960  C  CA  . VAL C  3  142 ? -26.273 -7.442  19.009  1.00 31.53  ? 142 VAL C CA  1 
ATOM   6961  C  C   . VAL C  3  142 ? -27.373 -7.255  20.030  1.00 29.63  ? 142 VAL C C   1 
ATOM   6962  O  O   . VAL C  3  142 ? -28.523 -7.510  19.722  1.00 30.67  ? 142 VAL C O   1 
ATOM   6963  C  CB  . VAL C  3  142 ? -25.508 -8.758  19.262  1.00 30.54  ? 142 VAL C CB  1 
ATOM   6964  C  CG1 . VAL C  3  142 ? -26.422 -9.967  19.260  1.00 30.51  ? 142 VAL C CG1 1 
ATOM   6965  C  CG2 . VAL C  3  142 ? -24.476 -8.916  18.165  1.00 32.43  ? 142 VAL C CG2 1 
ATOM   6966  N  N   . SER C  3  143 ? -27.017 -6.830  21.234  1.00 28.24  ? 143 SER C N   1 
ATOM   6967  C  CA  . SER C  3  143 ? -27.980 -6.666  22.285  1.00 29.72  ? 143 SER C CA  1 
ATOM   6968  C  C   . SER C  3  143 ? -28.981 -5.510  21.988  1.00 31.57  ? 143 SER C C   1 
ATOM   6969  O  O   . SER C  3  143 ? -30.165 -5.630  22.287  1.00 30.86  ? 143 SER C O   1 
ATOM   6970  C  CB  . SER C  3  143 ? -27.269 -6.517  23.636  1.00 31.54  ? 143 SER C CB  1 
ATOM   6971  O  OG  . SER C  3  143 ? -26.404 -5.385  23.685  1.00 31.39  ? 143 SER C OG  1 
ATOM   6972  N  N   . ILE C  3  144 ? -28.531 -4.417  21.368  1.00 32.65  ? 144 ILE C N   1 
ATOM   6973  C  CA  . ILE C  3  144 ? -29.443 -3.300  21.033  1.00 31.80  ? 144 ILE C CA  1 
ATOM   6974  C  C   . ILE C  3  144 ? -30.440 -3.772  19.991  1.00 31.48  ? 144 ILE C C   1 
ATOM   6975  O  O   . ILE C  3  144 ? -31.567 -3.302  19.975  1.00 34.81  ? 144 ILE C O   1 
ATOM   6976  C  CB  . ILE C  3  144 ? -28.701 -2.023  20.560  1.00 32.62  ? 144 ILE C CB  1 
ATOM   6977  C  CG1 . ILE C  3  144 ? -29.627 -0.825  20.409  1.00 36.01  ? 144 ILE C CG1 1 
ATOM   6978  C  CG2 . ILE C  3  144 ? -28.053 -2.212  19.201  1.00 34.83  ? 144 ILE C CG2 1 
ATOM   6979  C  CD1 . ILE C  3  144 ? -29.929 -0.124  21.699  1.00 40.50  ? 144 ILE C CD1 1 
ATOM   6980  N  N   . THR C  3  145 ? -30.032 -4.691  19.126  1.00 29.37  ? 145 THR C N   1 
ATOM   6981  C  CA  . THR C  3  145 ? -30.921 -5.258  18.106  1.00 30.73  ? 145 THR C CA  1 
ATOM   6982  C  C   . THR C  3  145 ? -31.972 -6.197  18.703  1.00 30.13  ? 145 THR C C   1 
ATOM   6983  O  O   . THR C  3  145 ? -33.160 -6.144  18.335  1.00 30.77  ? 145 THR C O   1 
ATOM   6984  C  CB  . THR C  3  145 ? -30.074 -5.950  17.002  1.00 32.20  ? 145 THR C CB  1 
ATOM   6985  O  OG1 . THR C  3  145 ? -29.189 -4.967  16.468  1.00 32.66  ? 145 THR C OG1 1 
ATOM   6986  C  CG2 . THR C  3  145 ? -30.933 -6.531  15.846  1.00 30.81  ? 145 THR C CG2 1 
ATOM   6987  N  N   . TRP C  3  146 ? -31.548 -7.038  19.633  1.00 29.92  ? 146 TRP C N   1 
ATOM   6988  C  CA  . TRP C  3  146 ? -32.513 -7.797  20.430  1.00 30.99  ? 146 TRP C CA  1 
ATOM   6989  C  C   . TRP C  3  146 ? -33.508 -6.855  21.142  1.00 29.69  ? 146 TRP C C   1 
ATOM   6990  O  O   . TRP C  3  146 ? -34.728 -7.051  21.070  1.00 31.06  ? 146 TRP C O   1 
ATOM   6991  C  CB  . TRP C  3  146 ? -31.766 -8.684  21.425  1.00 32.89  ? 146 TRP C CB  1 
ATOM   6992  C  CG  . TRP C  3  146 ? -32.598 -9.302  22.510  1.00 32.25  ? 146 TRP C CG  1 
ATOM   6993  C  CD1 . TRP C  3  146 ? -33.922 -9.696  22.465  1.00 31.01  ? 146 TRP C CD1 1 
ATOM   6994  C  CD2 . TRP C  3  146 ? -32.128 -9.640  23.788  1.00 30.47  ? 146 TRP C CD2 1 
ATOM   6995  N  NE1 . TRP C  3  146 ? -34.292 -10.216 23.668  1.00 30.30  ? 146 TRP C NE1 1 
ATOM   6996  C  CE2 . TRP C  3  146 ? -33.212 -10.195 24.501  1.00 29.70  ? 146 TRP C CE2 1 
ATOM   6997  C  CE3 . TRP C  3  146 ? -30.897 -9.505  24.417  1.00 29.51  ? 146 TRP C CE3 1 
ATOM   6998  C  CZ2 . TRP C  3  146 ? -33.094 -10.602 25.804  1.00 31.58  ? 146 TRP C CZ2 1 
ATOM   6999  C  CZ3 . TRP C  3  146 ? -30.775 -9.911  25.714  1.00 30.90  ? 146 TRP C CZ3 1 
ATOM   7000  C  CH2 . TRP C  3  146 ? -31.843 -10.463 26.396  1.00 32.60  ? 146 TRP C CH2 1 
ATOM   7001  N  N   . ALA C  3  147 ? -32.998 -5.816  21.786  1.00 27.72  ? 147 ALA C N   1 
ATOM   7002  C  CA  . ALA C  3  147 ? -33.873 -4.834  22.443  1.00 28.53  ? 147 ALA C CA  1 
ATOM   7003  C  C   . ALA C  3  147 ? -34.896 -4.274  21.502  1.00 28.95  ? 147 ALA C C   1 
ATOM   7004  O  O   . ALA C  3  147 ? -36.075 -4.184  21.828  1.00 29.89  ? 147 ALA C O   1 
ATOM   7005  C  CB  . ALA C  3  147 ? -33.084 -3.693  23.068  1.00 29.72  ? 147 ALA C CB  1 
ATOM   7006  N  N   . HIS C  3  148 ? -34.455 -3.949  20.304  1.00 31.21  ? 148 HIS C N   1 
ATOM   7007  C  CA  . HIS C  3  148 ? -35.363 -3.409  19.318  1.00 32.96  ? 148 HIS C CA  1 
ATOM   7008  C  C   . HIS C  3  148 ? -36.468 -4.385  18.870  1.00 33.48  ? 148 HIS C C   1 
ATOM   7009  O  O   . HIS C  3  148 ? -37.657 -3.998  18.796  1.00 33.32  ? 148 HIS C O   1 
ATOM   7010  C  CB  . HIS C  3  148 ? -34.611 -2.907  18.112  1.00 33.06  ? 148 HIS C CB  1 
ATOM   7011  C  CG  . HIS C  3  148 ? -35.445 -2.059  17.235  1.00 32.37  ? 148 HIS C CG  1 
ATOM   7012  N  ND1 . HIS C  3  148 ? -35.203 -1.934  15.893  1.00 35.01  ? 148 HIS C ND1 1 
ATOM   7013  C  CD2 . HIS C  3  148 ? -36.548 -1.328  17.499  1.00 32.76  ? 148 HIS C CD2 1 
ATOM   7014  C  CE1 . HIS C  3  148 ? -36.128 -1.157  15.365  1.00 36.26  ? 148 HIS C CE1 1 
ATOM   7015  N  NE2 . HIS C  3  148 ? -36.956 -0.778  16.319  1.00 35.04  ? 148 HIS C NE2 1 
ATOM   7016  N  N   . HIS C  3  149 ? -36.077 -5.626  18.598  1.00 32.48  ? 149 HIS C N   1 
ATOM   7017  C  CA  . HIS C  3  149 ? -37.036 -6.651  18.215  1.00 33.31  ? 149 HIS C CA  1 
ATOM   7018  C  C   . HIS C  3  149 ? -37.976 -7.008  19.330  1.00 32.95  ? 149 HIS C C   1 
ATOM   7019  O  O   . HIS C  3  149 ? -39.133 -7.291  19.067  1.00 29.98  ? 149 HIS C O   1 
ATOM   7020  C  CB  . HIS C  3  149 ? -36.358 -7.910  17.714  1.00 36.06  ? 149 HIS C CB  1 
ATOM   7021  C  CG  . HIS C  3  149 ? -35.885 -7.814  16.300  1.00 39.14  ? 149 HIS C CG  1 
ATOM   7022  N  ND1 . HIS C  3  149 ? -34.628 -7.355  15.972  1.00 48.10  ? 149 HIS C ND1 1 
ATOM   7023  C  CD2 . HIS C  3  149 ? -36.483 -8.131  15.134  1.00 39.12  ? 149 HIS C CD2 1 
ATOM   7024  C  CE1 . HIS C  3  149 ? -34.467 -7.401  14.662  1.00 45.30  ? 149 HIS C CE1 1 
ATOM   7025  N  NE2 . HIS C  3  149 ? -35.578 -7.867  14.131  1.00 46.03  ? 149 HIS C NE2 1 
ATOM   7026  N  N   . SER C  3  150 ? -37.492 -7.018  20.565  1.00 34.35  ? 150 SER C N   1 
ATOM   7027  C  CA  . SER C  3  150 ? -38.391 -7.229  21.698  1.00 35.57  ? 150 SER C CA  1 
ATOM   7028  C  C   . SER C  3  150 ? -39.508 -6.189  21.733  1.00 35.86  ? 150 SER C C   1 
ATOM   7029  O  O   . SER C  3  150 ? -40.696 -6.527  21.893  1.00 34.74  ? 150 SER C O   1 
ATOM   7030  C  CB  . SER C  3  150 ? -37.618 -7.208  23.002  1.00 36.94  ? 150 SER C CB  1 
ATOM   7031  O  OG  . SER C  3  150 ? -36.845 -8.381  23.099  1.00 41.33  ? 150 SER C OG  1 
ATOM   7032  N  N   . LEU C  3  151 ? -39.109 -4.926  21.580  1.00 36.93  ? 151 LEU C N   1 
ATOM   7033  C  CA  . LEU C  3  151 ? -40.045 -3.811  21.568  1.00 35.98  ? 151 LEU C CA  1 
ATOM   7034  C  C   . LEU C  3  151 ? -41.048 -3.935  20.442  1.00 36.92  ? 151 LEU C C   1 
ATOM   7035  O  O   . LEU C  3  151 ? -42.223 -3.823  20.719  1.00 34.65  ? 151 LEU C O   1 
ATOM   7036  C  CB  . LEU C  3  151 ? -39.332 -2.478  21.428  1.00 36.07  ? 151 LEU C CB  1 
ATOM   7037  C  CG  . LEU C  3  151 ? -40.218 -1.233  21.434  1.00 36.20  ? 151 LEU C CG  1 
ATOM   7038  C  CD1 . LEU C  3  151 ? -40.856 -1.068  22.801  1.00 37.35  ? 151 LEU C CD1 1 
ATOM   7039  C  CD2 . LEU C  3  151 ? -39.382 -0.024  21.084  1.00 38.22  ? 151 LEU C CD2 1 
ATOM   7040  N  N   . MET C  3  152 ? -40.572 -4.138  19.195  1.00 40.32  ? 152 MET C N   1 
ATOM   7041  C  CA  . MET C  3  152 ? -41.438 -4.268  18.011  1.00 38.67  ? 152 MET C CA  1 
ATOM   7042  C  C   . MET C  3  152 ? -42.434 -5.442  18.283  1.00 37.73  ? 152 MET C C   1 
ATOM   7043  O  O   . MET C  3  152 ? -43.605 -5.329  17.945  1.00 37.72  ? 152 MET C O   1 
ATOM   7044  C  CB  . MET C  3  152 ? -40.658 -4.407  16.634  1.00 40.76  ? 152 MET C CB  1 
ATOM   7045  C  CG  . MET C  3  152 ? -39.695 -3.263  16.135  1.00 43.07  ? 152 MET C CG  1 
ATOM   7046  S  SD  . MET C  3  152 ? -40.313 -1.677  15.410  1.00 59.04  ? 152 MET C SD  1 
ATOM   7047  C  CE  . MET C  3  152 ? -39.167 -0.195  15.438  1.00 27.56  ? 152 MET C CE  1 
ATOM   7048  N  N   . GLU C  3  153 ? -42.002 -6.505  18.970  1.00 37.07  ? 153 GLU C N   1 
ATOM   7049  C  CA  . GLU C  3  153 ? -42.894 -7.639  19.397  1.00 37.51  ? 153 GLU C CA  1 
ATOM   7050  C  C   . GLU C  3  153 ? -43.704 -7.419  20.684  1.00 39.59  ? 153 GLU C C   1 
ATOM   7051  O  O   . GLU C  3  153 ? -44.465 -8.287  21.079  1.00 41.88  ? 153 GLU C O   1 
ATOM   7052  C  CB  . GLU C  3  153 ? -42.105 -8.954  19.564  1.00 36.44  ? 153 GLU C CB  1 
ATOM   7053  C  CG  . GLU C  3  153 ? -41.504 -9.492  18.279  1.00 37.39  ? 153 GLU C CG  1 
ATOM   7054  C  CD  . GLU C  3  153 ? -40.563 -10.666 18.494  1.00 39.76  ? 153 GLU C CD  1 
ATOM   7055  O  OE1 . GLU C  3  153 ? -40.583 -11.329 19.581  1.00 43.20  ? 153 GLU C OE1 1 
ATOM   7056  O  OE2 . GLU C  3  153 ? -39.814 -10.944 17.538  1.00 38.17  ? 153 GLU C OE2 1 
ATOM   7057  N  N   . GLY C  3  154 ? -43.549 -6.285  21.349  1.00 40.84  ? 154 GLY C N   1 
ATOM   7058  C  CA  . GLY C  3  154 ? -44.350 -5.980  22.536  1.00 41.38  ? 154 GLY C CA  1 
ATOM   7059  C  C   . GLY C  3  154 ? -43.883 -6.615  23.849  1.00 41.44  ? 154 GLY C C   1 
ATOM   7060  O  O   . GLY C  3  154 ? -44.585 -6.574  24.873  1.00 40.43  ? 154 GLY C O   1 
ATOM   7061  N  N   . ASP C  3  155 ? -42.679 -7.158  23.838  1.00 39.78  ? 155 ASP C N   1 
ATOM   7062  C  CA  . ASP C  3  155 ? -42.126 -7.808  24.997  1.00 37.76  ? 155 ASP C CA  1 
ATOM   7063  C  C   . ASP C  3  155 ? -41.391 -6.756  25.842  1.00 38.76  ? 155 ASP C C   1 
ATOM   7064  O  O   . ASP C  3  155 ? -40.228 -6.431  25.596  1.00 40.01  ? 155 ASP C O   1 
ATOM   7065  C  CB  . ASP C  3  155 ? -41.178 -8.895  24.511  1.00 37.80  ? 155 ASP C CB  1 
ATOM   7066  C  CG  . ASP C  3  155 ? -40.696 -9.790  25.605  1.00 36.28  ? 155 ASP C CG  1 
ATOM   7067  O  OD1 . ASP C  3  155 ? -40.776 -9.424  26.800  1.00 37.73  ? 155 ASP C OD1 1 
ATOM   7068  O  OD2 . ASP C  3  155 ? -40.210 -10.870 25.238  1.00 36.49  ? 155 ASP C OD2 1 
ATOM   7069  N  N   . ARG C  3  156 ? -42.071 -6.254  26.858  1.00 35.84  ? 156 ARG C N   1 
ATOM   7070  C  CA  . ARG C  3  156 ? -41.525 -5.231  27.728  1.00 34.87  ? 156 ARG C CA  1 
ATOM   7071  C  C   . ARG C  3  156 ? -40.297 -5.696  28.469  1.00 34.76  ? 156 ARG C C   1 
ATOM   7072  O  O   . ARG C  3  156 ? -39.309 -4.981  28.533  1.00 36.85  ? 156 ARG C O   1 
ATOM   7073  C  CB  . ARG C  3  156 ? -42.579 -4.762  28.735  1.00 35.01  ? 156 ARG C CB  1 
ATOM   7074  C  CG  . ARG C  3  156 ? -42.073 -3.891  29.877  1.00 35.26  ? 156 ARG C CG  1 
ATOM   7075  C  CD  . ARG C  3  156 ? -43.221 -3.397  30.714  1.00 34.49  ? 156 ARG C CD  1 
ATOM   7076  N  NE  . ARG C  3  156 ? -42.702 -2.610  31.826  1.00 38.09  ? 156 ARG C NE  1 
ATOM   7077  C  CZ  . ARG C  3  156 ? -42.498 -1.284  31.824  1.00 38.27  ? 156 ARG C CZ  1 
ATOM   7078  N  NH1 . ARG C  3  156 ? -42.740 -0.539  30.733  1.00 37.76  ? 156 ARG C NH1 1 
ATOM   7079  N  NH2 . ARG C  3  156 ? -42.025 -0.696  32.934  1.00 36.16  ? 156 ARG C NH2 1 
ATOM   7080  N  N   . LYS C  3  157 ? -40.370 -6.876  29.049  1.00 38.95  ? 157 LYS C N   1 
ATOM   7081  C  CA  . LYS C  3  157 ? -39.354 -7.312  29.987  1.00 43.89  ? 157 LYS C CA  1 
ATOM   7082  C  C   . LYS C  3  157 ? -38.029 -7.516  29.262  1.00 42.10  ? 157 LYS C C   1 
ATOM   7083  O  O   . LYS C  3  157 ? -36.981 -7.140  29.779  1.00 42.57  ? 157 LYS C O   1 
ATOM   7084  C  CB  . LYS C  3  157 ? -39.766 -8.604  30.704  1.00 51.78  ? 157 LYS C CB  1 
ATOM   7085  C  CG  . LYS C  3  157 ? -38.928 -8.916  31.943  1.00 62.61  ? 157 LYS C CG  1 
ATOM   7086  C  CD  . LYS C  3  157 ? -38.346 -10.338 31.973  1.00 72.28  ? 157 LYS C CD  1 
ATOM   7087  C  CE  . LYS C  3  157 ? -39.328 -11.365 32.531  1.00 79.54  ? 157 LYS C CE  1 
ATOM   7088  N  NZ  . LYS C  3  157 ? -38.966 -12.751 32.126  1.00 84.68  ? 157 LYS C NZ  1 
ATOM   7089  N  N   . HIS C  3  158 ? -38.087 -8.093  28.065  1.00 38.97  ? 158 HIS C N   1 
ATOM   7090  C  CA  . HIS C  3  158 ? -36.881 -8.432  27.349  1.00 38.07  ? 158 HIS C CA  1 
ATOM   7091  C  C   . HIS C  3  158 ? -36.231 -7.249  26.721  1.00 35.76  ? 158 HIS C C   1 
ATOM   7092  O  O   . HIS C  3  158 ? -34.999 -7.230  26.551  1.00 34.33  ? 158 HIS C O   1 
ATOM   7093  C  CB  . HIS C  3  158 ? -37.142 -9.521  26.338  1.00 39.04  ? 158 HIS C CB  1 
ATOM   7094  C  CG  . HIS C  3  158 ? -37.327 -10.841 26.990  1.00 42.11  ? 158 HIS C CG  1 
ATOM   7095  N  ND1 . HIS C  3  158 ? -38.464 -11.595 26.844  1.00 47.29  ? 158 HIS C ND1 1 
ATOM   7096  C  CD2 . HIS C  3  158 ? -36.553 -11.495 27.883  1.00 43.55  ? 158 HIS C CD2 1 
ATOM   7097  C  CE1 . HIS C  3  158 ? -38.368 -12.677 27.587  1.00 47.60  ? 158 HIS C CE1 1 
ATOM   7098  N  NE2 . HIS C  3  158 ? -37.211 -12.646 28.218  1.00 44.86  ? 158 HIS C NE2 1 
ATOM   7099  N  N   . MET C  3  159 ? -37.059 -6.266  26.410  1.00 32.70  ? 159 MET C N   1 
ATOM   7100  C  CA  . MET C  3  159 ? -36.590 -5.002  25.907  1.00 32.57  ? 159 MET C CA  1 
ATOM   7101  C  C   . MET C  3  159 ? -35.747 -4.362  26.980  1.00 30.99  ? 159 MET C C   1 
ATOM   7102  O  O   . MET C  3  159 ? -34.618 -4.013  26.759  1.00 29.30  ? 159 MET C O   1 
ATOM   7103  C  CB  . MET C  3  159 ? -37.789 -4.125  25.566  1.00 33.94  ? 159 MET C CB  1 
ATOM   7104  C  CG  . MET C  3  159 ? -37.522 -2.923  24.686  1.00 33.85  ? 159 MET C CG  1 
ATOM   7105  S  SD  . MET C  3  159 ? -36.673 -1.647  25.551  1.00 34.97  ? 159 MET C SD  1 
ATOM   7106  C  CE  . MET C  3  159 ? -37.083 -0.280  24.444  1.00 36.69  ? 159 MET C CE  1 
ATOM   7107  N  N   . LEU C  3  160 ? -36.304 -4.231  28.163  1.00 32.05  ? 160 LEU C N   1 
ATOM   7108  C  CA  . LEU C  3  160 ? -35.569 -3.617  29.242  1.00 34.26  ? 160 LEU C CA  1 
ATOM   7109  C  C   . LEU C  3  160 ? -34.281 -4.363  29.513  1.00 32.08  ? 160 LEU C C   1 
ATOM   7110  O  O   . LEU C  3  160 ? -33.229 -3.769  29.739  1.00 31.09  ? 160 LEU C O   1 
ATOM   7111  C  CB  . LEU C  3  160 ? -36.441 -3.534  30.497  1.00 35.40  ? 160 LEU C CB  1 
ATOM   7112  C  CG  . LEU C  3  160 ? -37.484 -2.408  30.405  1.00 36.51  ? 160 LEU C CG  1 
ATOM   7113  C  CD1 . LEU C  3  160 ? -38.550 -2.606  31.458  1.00 38.20  ? 160 LEU C CD1 1 
ATOM   7114  C  CD2 . LEU C  3  160 ? -36.869 -1.003  30.542  1.00 36.83  ? 160 LEU C CD2 1 
ATOM   7115  N  N   . GLN C  3  161 ? -34.358 -5.670  29.447  1.00 33.85  ? 161 GLN C N   1 
ATOM   7116  C  CA  . GLN C  3  161 ? -33.208 -6.514  29.750  1.00 37.14  ? 161 GLN C CA  1 
ATOM   7117  C  C   . GLN C  3  161 ? -32.070 -6.303  28.734  1.00 33.87  ? 161 GLN C C   1 
ATOM   7118  O  O   . GLN C  3  161 ? -30.889 -6.121  29.078  1.00 32.37  ? 161 GLN C O   1 
ATOM   7119  C  CB  . GLN C  3  161 ? -33.684 -7.951  29.786  1.00 38.80  ? 161 GLN C CB  1 
ATOM   7120  C  CG  . GLN C  3  161 ? -32.729 -8.928  30.418  1.00 46.17  ? 161 GLN C CG  1 
ATOM   7121  C  CD  . GLN C  3  161 ? -33.262 -10.355 30.291  1.00 52.78  ? 161 GLN C CD  1 
ATOM   7122  O  OE1 . GLN C  3  161 ? -34.447 -10.624 30.602  1.00 62.96  ? 161 GLN C OE1 1 
ATOM   7123  N  NE2 . GLN C  3  161 ? -32.413 -11.267 29.805  1.00 47.71  ? 161 GLN C NE2 1 
ATOM   7124  N  N   . ALA C  3  162 ? -32.470 -6.317  27.475  1.00 31.06  ? 162 ALA C N   1 
ATOM   7125  C  CA  . ALA C  3  162 ? -31.566 -6.184  26.368  1.00 28.54  ? 162 ALA C CA  1 
ATOM   7126  C  C   . ALA C  3  162 ? -30.985 -4.798  26.370  1.00 28.84  ? 162 ALA C C   1 
ATOM   7127  O  O   . ALA C  3  162 ? -29.810 -4.622  26.113  1.00 28.85  ? 162 ALA C O   1 
ATOM   7128  C  CB  . ALA C  3  162 ? -32.307 -6.441  25.086  1.00 26.57  ? 162 ALA C CB  1 
ATOM   7129  N  N   . LEU C  3  163 ? -31.817 -3.808  26.661  1.00 30.92  ? 163 LEU C N   1 
ATOM   7130  C  CA  . LEU C  3  163 ? -31.360 -2.435  26.747  1.00 33.06  ? 163 LEU C CA  1 
ATOM   7131  C  C   . LEU C  3  163 ? -30.342 -2.263  27.895  1.00 35.07  ? 163 LEU C C   1 
ATOM   7132  O  O   . LEU C  3  163 ? -29.310 -1.602  27.728  1.00 38.05  ? 163 LEU C O   1 
ATOM   7133  C  CB  . LEU C  3  163 ? -32.553 -1.472  26.888  1.00 31.83  ? 163 LEU C CB  1 
ATOM   7134  C  CG  . LEU C  3  163 ? -32.201 0.021   26.860  1.00 33.17  ? 163 LEU C CG  1 
ATOM   7135  C  CD1 . LEU C  3  163 ? -31.243 0.378   25.719  1.00 35.67  ? 163 LEU C CD1 1 
ATOM   7136  C  CD2 . LEU C  3  163 ? -33.483 0.814   26.722  1.00 33.79  ? 163 LEU C CD2 1 
ATOM   7137  N  N   . PHE C  3  164 ? -30.611 -2.903  29.032  1.00 34.41  ? 164 PHE C N   1 
ATOM   7138  C  CA  . PHE C  3  164 ? -29.737 -2.789  30.197  1.00 33.34  ? 164 PHE C CA  1 
ATOM   7139  C  C   . PHE C  3  164 ? -28.353 -3.337  29.897  1.00 31.05  ? 164 PHE C C   1 
ATOM   7140  O  O   . PHE C  3  164 ? -27.339 -2.775  30.321  1.00 27.70  ? 164 PHE C O   1 
ATOM   7141  C  CB  . PHE C  3  164 ? -30.361 -3.497  31.423  1.00 34.73  ? 164 PHE C CB  1 
ATOM   7142  C  CG  . PHE C  3  164 ? -29.444 -3.563  32.613  1.00 36.18  ? 164 PHE C CG  1 
ATOM   7143  C  CD1 . PHE C  3  164 ? -29.248 -2.436  33.421  1.00 37.99  ? 164 PHE C CD1 1 
ATOM   7144  C  CD2 . PHE C  3  164 ? -28.744 -4.734  32.905  1.00 35.07  ? 164 PHE C CD2 1 
ATOM   7145  C  CE1 . PHE C  3  164 ? -28.359 -2.483  34.487  1.00 37.82  ? 164 PHE C CE1 1 
ATOM   7146  C  CE2 . PHE C  3  164 ? -27.886 -4.796  33.985  1.00 36.19  ? 164 PHE C CE2 1 
ATOM   7147  C  CZ  . PHE C  3  164 ? -27.689 -3.671  34.772  1.00 38.29  ? 164 PHE C CZ  1 
ATOM   7148  N  N   . ILE C  3  165 ? -28.331 -4.453  29.172  1.00 33.54  ? 165 ILE C N   1 
ATOM   7149  C  CA  . ILE C  3  165 ? -27.088 -5.124  28.809  1.00 32.54  ? 165 ILE C CA  1 
ATOM   7150  C  C   . ILE C  3  165 ? -26.251 -4.208  27.912  1.00 32.23  ? 165 ILE C C   1 
ATOM   7151  O  O   . ILE C  3  165 ? -25.059 -4.097  28.081  1.00 31.87  ? 165 ILE C O   1 
ATOM   7152  C  CB  . ILE C  3  165 ? -27.359 -6.484  28.123  1.00 32.25  ? 165 ILE C CB  1 
ATOM   7153  C  CG1 . ILE C  3  165 ? -27.940 -7.448  29.132  1.00 34.63  ? 165 ILE C CG1 1 
ATOM   7154  C  CG2 . ILE C  3  165 ? -26.054 -7.088  27.589  1.00 33.64  ? 165 ILE C CG2 1 
ATOM   7155  C  CD1 . ILE C  3  165 ? -28.520 -8.700  28.520  1.00 38.05  ? 165 ILE C CD1 1 
ATOM   7156  N  N   . THR C  3  166 ? -26.911 -3.598  26.934  1.00 35.20  ? 166 THR C N   1 
ATOM   7157  C  CA  . THR C  3  166 ? -26.310 -2.641  26.002  1.00 33.60  ? 166 THR C CA  1 
ATOM   7158  C  C   . THR C  3  166 ? -25.590 -1.528  26.769  1.00 31.33  ? 166 THR C C   1 
ATOM   7159  O  O   . THR C  3  166 ? -24.427 -1.222  26.521  1.00 29.32  ? 166 THR C O   1 
ATOM   7160  C  CB  . THR C  3  166 ? -27.422 -2.054  25.079  1.00 33.21  ? 166 THR C CB  1 
ATOM   7161  O  OG1 . THR C  3  166 ? -28.161 -3.130  24.460  1.00 30.02  ? 166 THR C OG1 1 
ATOM   7162  C  CG2 . THR C  3  166 ? -26.836 -1.144  23.988  1.00 34.25  ? 166 THR C CG2 1 
ATOM   7163  N  N   . ILE C  3  167 ? -26.303 -0.955  27.725  1.00 31.40  ? 167 ILE C N   1 
ATOM   7164  C  CA  . ILE C  3  167 ? -25.826 0.199   28.483  1.00 29.47  ? 167 ILE C CA  1 
ATOM   7165  C  C   . ILE C  3  167 ? -24.628 -0.235  29.278  1.00 30.26  ? 167 ILE C C   1 
ATOM   7166  O  O   . ILE C  3  167 ? -23.622 0.440   29.247  1.00 32.66  ? 167 ILE C O   1 
ATOM   7167  C  CB  . ILE C  3  167 ? -26.933 0.758   29.395  1.00 28.26  ? 167 ILE C CB  1 
ATOM   7168  C  CG1 . ILE C  3  167 ? -28.020 1.386   28.533  1.00 29.03  ? 167 ILE C CG1 1 
ATOM   7169  C  CG2 . ILE C  3  167 ? -26.378 1.791   30.367  1.00 29.12  ? 167 ILE C CG2 1 
ATOM   7170  C  CD1 . ILE C  3  167 ? -29.344 1.593   29.223  1.00 29.72  ? 167 ILE C CD1 1 
ATOM   7171  N  N   . THR C  3  168 ? -24.741 -1.364  29.971  1.00 29.85  ? 168 THR C N   1 
ATOM   7172  C  CA  . THR C  3  168 ? -23.639 -1.947  30.736  1.00 32.00  ? 168 THR C CA  1 
ATOM   7173  C  C   . THR C  3  168 ? -22.390 -2.172  29.888  1.00 31.26  ? 168 THR C C   1 
ATOM   7174  O  O   . THR C  3  168 ? -21.265 -1.893  30.319  1.00 29.09  ? 168 THR C O   1 
ATOM   7175  C  CB  . THR C  3  168 ? -24.100 -3.273  31.379  1.00 37.10  ? 168 THR C CB  1 
ATOM   7176  O  OG1 . THR C  3  168 ? -25.132 -2.975  32.325  1.00 38.24  ? 168 THR C OG1 1 
ATOM   7177  C  CG2 . THR C  3  168 ? -22.977 -4.000  32.095  1.00 38.53  ? 168 THR C CG2 1 
ATOM   7178  N  N   . LEU C  3  169 ? -22.588 -2.633  28.663  1.00 29.53  ? 169 LEU C N   1 
ATOM   7179  C  CA  . LEU C  3  169 ? -21.475 -2.787  27.734  1.00 30.01  ? 169 LEU C CA  1 
ATOM   7180  C  C   . LEU C  3  169 ? -20.837 -1.465  27.298  1.00 30.47  ? 169 LEU C C   1 
ATOM   7181  O  O   . LEU C  3  169 ? -19.626 -1.348  27.194  1.00 28.13  ? 169 LEU C O   1 
ATOM   7182  C  CB  . LEU C  3  169 ? -21.936 -3.579  26.528  1.00 30.58  ? 169 LEU C CB  1 
ATOM   7183  C  CG  . LEU C  3  169 ? -22.249 -5.049  26.837  1.00 29.48  ? 169 LEU C CG  1 
ATOM   7184  C  CD1 . LEU C  3  169 ? -22.993 -5.685  25.683  1.00 29.47  ? 169 LEU C CD1 1 
ATOM   7185  C  CD2 . LEU C  3  169 ? -20.965 -5.821  27.116  1.00 30.46  ? 169 LEU C CD2 1 
ATOM   7186  N  N   . GLY C  3  170 ? -21.661 -0.462  27.068  1.00 33.31  ? 170 GLY C N   1 
ATOM   7187  C  CA  . GLY C  3  170 ? -21.168 0.891   26.800  1.00 33.98  ? 170 GLY C CA  1 
ATOM   7188  C  C   . GLY C  3  170 ? -20.383 1.493   27.944  1.00 34.11  ? 170 GLY C C   1 
ATOM   7189  O  O   . GLY C  3  170 ? -19.424 2.239   27.719  1.00 35.95  ? 170 GLY C O   1 
ATOM   7190  N  N   . VAL C  3  171 ? -20.815 1.211   29.169  1.00 33.58  ? 171 VAL C N   1 
ATOM   7191  C  CA  . VAL C  3  171 ? -20.125 1.692   30.371  1.00 34.17  ? 171 VAL C CA  1 
ATOM   7192  C  C   . VAL C  3  171 ? -18.794 0.934   30.497  1.00 35.16  ? 171 VAL C C   1 
ATOM   7193  O  O   . VAL C  3  171 ? -17.733 1.527   30.708  1.00 38.06  ? 171 VAL C O   1 
ATOM   7194  C  CB  . VAL C  3  171 ? -21.022 1.536   31.633  1.00 34.10  ? 171 VAL C CB  1 
ATOM   7195  C  CG1 . VAL C  3  171 ? -20.213 1.570   32.925  1.00 35.57  ? 171 VAL C CG1 1 
ATOM   7196  C  CG2 . VAL C  3  171 ? -22.087 2.625   31.664  1.00 33.59  ? 171 VAL C CG2 1 
ATOM   7197  N  N   . TYR C  3  172 ? -18.844 -0.373  30.348  1.00 33.22  ? 172 TYR C N   1 
ATOM   7198  C  CA  . TYR C  3  172 ? -17.620 -1.170  30.377  1.00 36.92  ? 172 TYR C CA  1 
ATOM   7199  C  C   . TYR C  3  172 ? -16.543 -0.659  29.375  1.00 36.47  ? 172 TYR C C   1 
ATOM   7200  O  O   . TYR C  3  172 ? -15.352 -0.570  29.693  1.00 36.51  ? 172 TYR C O   1 
ATOM   7201  C  CB  . TYR C  3  172 ? -17.992 -2.623  30.096  1.00 36.56  ? 172 TYR C CB  1 
ATOM   7202  C  CG  . TYR C  3  172 ? -16.939 -3.683  30.282  1.00 38.68  ? 172 TYR C CG  1 
ATOM   7203  C  CD1 . TYR C  3  172 ? -15.932 -3.595  31.244  1.00 39.05  ? 172 TYR C CD1 1 
ATOM   7204  C  CD2 . TYR C  3  172 ? -17.019 -4.851  29.533  1.00 39.64  ? 172 TYR C CD2 1 
ATOM   7205  C  CE1 . TYR C  3  172 ? -15.003 -4.635  31.397  1.00 40.22  ? 172 TYR C CE1 1 
ATOM   7206  C  CE2 . TYR C  3  172 ? -16.122 -5.880  29.693  1.00 40.11  ? 172 TYR C CE2 1 
ATOM   7207  C  CZ  . TYR C  3  172 ? -15.117 -5.779  30.615  1.00 41.06  ? 172 TYR C CZ  1 
ATOM   7208  O  OH  . TYR C  3  172 ? -14.269 -6.857  30.702  1.00 43.27  ? 172 TYR C OH  1 
ATOM   7209  N  N   . PHE C  3  173 ? -16.972 -0.312  28.172  1.00 34.29  ? 173 PHE C N   1 
ATOM   7210  C  CA  . PHE C  3  173 ? -16.064 0.229   27.187  1.00 32.84  ? 173 PHE C CA  1 
ATOM   7211  C  C   . PHE C  3  173 ? -15.441 1.545   27.721  1.00 34.88  ? 173 PHE C C   1 
ATOM   7212  O  O   . PHE C  3  173 ? -14.224 1.739   27.686  1.00 32.19  ? 173 PHE C O   1 
ATOM   7213  C  CB  . PHE C  3  173 ? -16.808 0.446   25.859  1.00 32.62  ? 173 PHE C CB  1 
ATOM   7214  C  CG  . PHE C  3  173 ? -15.999 1.180   24.844  1.00 32.05  ? 173 PHE C CG  1 
ATOM   7215  C  CD1 . PHE C  3  173 ? -15.838 2.565   24.939  1.00 31.47  ? 173 PHE C CD1 1 
ATOM   7216  C  CD2 . PHE C  3  173 ? -15.374 0.498   23.819  1.00 31.69  ? 173 PHE C CD2 1 
ATOM   7217  C  CE1 . PHE C  3  173 ? -15.048 3.253   24.040  1.00 32.45  ? 173 PHE C CE1 1 
ATOM   7218  C  CE2 . PHE C  3  173 ? -14.614 1.184   22.899  1.00 33.25  ? 173 PHE C CE2 1 
ATOM   7219  C  CZ  . PHE C  3  173 ? -14.458 2.568   23.007  1.00 34.35  ? 173 PHE C CZ  1 
ATOM   7220  N  N   . THR C  3  174 ? -16.289 2.453   28.194  1.00 34.73  ? 174 THR C N   1 
ATOM   7221  C  CA  . THR C  3  174 ? -15.829 3.729   28.694  1.00 34.53  ? 174 THR C CA  1 
ATOM   7222  C  C   . THR C  3  174 ? -14.778 3.536   29.809  1.00 36.72  ? 174 THR C C   1 
ATOM   7223  O  O   . THR C  3  174 ? -13.735 4.200   29.787  1.00 34.38  ? 174 THR C O   1 
ATOM   7224  C  CB  . THR C  3  174 ? -17.022 4.578   29.162  1.00 33.17  ? 174 THR C CB  1 
ATOM   7225  O  OG1 . THR C  3  174 ? -17.917 4.787   28.069  1.00 34.31  ? 174 THR C OG1 1 
ATOM   7226  C  CG2 . THR C  3  174 ? -16.588 5.907   29.618  1.00 34.13  ? 174 THR C CG2 1 
ATOM   7227  N  N   . LEU C  3  175 ? -15.049 2.615   30.743  1.00 36.74  ? 175 LEU C N   1 
ATOM   7228  C  CA  . LEU C  3  175 ? -14.154 2.337   31.871  1.00 37.77  ? 175 LEU C CA  1 
ATOM   7229  C  C   . LEU C  3  175 ? -12.850 1.730   31.375  1.00 36.45  ? 175 LEU C C   1 
ATOM   7230  O  O   . LEU C  3  175 ? -11.769 2.180   31.708  1.00 36.80  ? 175 LEU C O   1 
ATOM   7231  C  CB  . LEU C  3  175 ? -14.802 1.371   32.892  1.00 41.90  ? 175 LEU C CB  1 
ATOM   7232  C  CG  . LEU C  3  175 ? -15.909 1.913   33.840  1.00 47.14  ? 175 LEU C CG  1 
ATOM   7233  C  CD1 . LEU C  3  175 ? -16.293 0.854   34.864  1.00 46.39  ? 175 LEU C CD1 1 
ATOM   7234  C  CD2 . LEU C  3  175 ? -15.544 3.219   34.561  1.00 45.49  ? 175 LEU C CD2 1 
ATOM   7235  N  N   . LEU C  3  176 ? -12.950 0.703   30.563  1.00 35.14  ? 176 LEU C N   1 
ATOM   7236  C  CA  . LEU C  3  176 ? -11.755 0.124   29.952  1.00 35.84  ? 176 LEU C CA  1 
ATOM   7237  C  C   . LEU C  3  176 ? -10.883 1.150   29.242  1.00 37.05  ? 176 LEU C C   1 
ATOM   7238  O  O   . LEU C  3  176 ? -9.649  1.076   29.316  1.00 38.42  ? 176 LEU C O   1 
ATOM   7239  C  CB  . LEU C  3  176 ? -12.148 -0.974  28.968  1.00 34.29  ? 176 LEU C CB  1 
ATOM   7240  C  CG  . LEU C  3  176 ? -12.516 -2.284  29.634  1.00 33.68  ? 176 LEU C CG  1 
ATOM   7241  C  CD1 . LEU C  3  176 ? -13.516 -3.024  28.800  1.00 37.27  ? 176 LEU C CD1 1 
ATOM   7242  C  CD2 . LEU C  3  176 ? -11.291 -3.148  29.776  1.00 35.71  ? 176 LEU C CD2 1 
ATOM   7243  N  N   . GLN C  3  177 ? -11.528 2.080   28.536  1.00 36.19  ? 177 GLN C N   1 
ATOM   7244  C  CA  . GLN C  3  177 ? -10.820 3.089   27.756  1.00 35.54  ? 177 GLN C CA  1 
ATOM   7245  C  C   . GLN C  3  177 ? -10.190 4.128   28.688  1.00 35.98  ? 177 GLN C C   1 
ATOM   7246  O  O   . GLN C  3  177 ? -9.041  4.551   28.482  1.00 35.03  ? 177 GLN C O   1 
ATOM   7247  C  CB  . GLN C  3  177 ? -11.742 3.719   26.705  1.00 36.55  ? 177 GLN C CB  1 
ATOM   7248  C  CG  . GLN C  3  177 ? -11.043 4.548   25.635  1.00 39.44  ? 177 GLN C CG  1 
ATOM   7249  C  CD  . GLN C  3  177 ? -10.248 3.726   24.617  1.00 41.09  ? 177 GLN C CD  1 
ATOM   7250  O  OE1 . GLN C  3  177 ? -9.485  2.822   24.972  1.00 44.25  ? 177 GLN C OE1 1 
ATOM   7251  N  NE2 . GLN C  3  177 ? -10.400 4.064   23.342  1.00 38.88  ? 177 GLN C NE2 1 
ATOM   7252  N  N   . ALA C  3  178 ? -10.900 4.501   29.752  1.00 35.99  ? 178 ALA C N   1 
ATOM   7253  C  CA  . ALA C  3  178 ? -10.308 5.361   30.767  1.00 34.24  ? 178 ALA C CA  1 
ATOM   7254  C  C   . ALA C  3  178 ? -9.032  4.762   31.349  1.00 37.60  ? 178 ALA C C   1 
ATOM   7255  O  O   . ALA C  3  178 ? -8.061  5.459   31.580  1.00 38.55  ? 178 ALA C O   1 
ATOM   7256  C  CB  . ALA C  3  178 ? -11.293 5.611   31.861  1.00 34.06  ? 178 ALA C CB  1 
ATOM   7257  N  N   . SER C  3  179 ? -9.055  3.456   31.577  1.00 39.22  ? 179 SER C N   1 
ATOM   7258  C  CA  . SER C  3  179 ? -7.925  2.743   32.114  1.00 40.61  ? 179 SER C CA  1 
ATOM   7259  C  C   . SER C  3  179 ? -6.720  2.758   31.140  1.00 40.53  ? 179 SER C C   1 
ATOM   7260  O  O   . SER C  3  179 ? -5.588  3.068   31.532  1.00 40.54  ? 179 SER C O   1 
ATOM   7261  C  CB  . SER C  3  179 ? -8.358  1.324   32.530  1.00 40.42  ? 179 SER C CB  1 
ATOM   7262  O  OG  . SER C  3  179 ? -7.467  0.352   32.033  1.00 50.98  ? 179 SER C OG  1 
ATOM   7263  N  N   . GLU C  3  180 ? -6.978  2.434   29.884  1.00 39.82  ? 180 GLU C N   1 
ATOM   7264  C  CA  . GLU C  3  180 ? -5.954  2.453   28.836  1.00 43.13  ? 180 GLU C CA  1 
ATOM   7265  C  C   . GLU C  3  180 ? -5.208  3.783   28.721  1.00 42.34  ? 180 GLU C C   1 
ATOM   7266  O  O   . GLU C  3  180 ? -3.974  3.831   28.597  1.00 40.83  ? 180 GLU C O   1 
ATOM   7267  C  CB  . GLU C  3  180 ? -6.607  2.130   27.500  1.00 49.66  ? 180 GLU C CB  1 
ATOM   7268  C  CG  . GLU C  3  180 ? -6.854  0.634   27.302  1.00 55.48  ? 180 GLU C CG  1 
ATOM   7269  C  CD  . GLU C  3  180 ? -5.686  -0.016  26.574  1.00 60.18  ? 180 GLU C CD  1 
ATOM   7270  O  OE1 . GLU C  3  180 ? -4.870  -0.682  27.270  1.00 52.03  ? 180 GLU C OE1 1 
ATOM   7271  O  OE2 . GLU C  3  180 ? -5.595  0.184   25.316  1.00 58.89  ? 180 GLU C OE2 1 
ATOM   7272  N  N   . TYR C  3  181 ? -6.003  4.843   28.752  1.00 38.22  ? 181 TYR C N   1 
ATOM   7273  C  CA  . TYR C  3  181 ? -5.544  6.220   28.754  1.00 36.14  ? 181 TYR C CA  1 
ATOM   7274  C  C   . TYR C  3  181 ? -4.566  6.440   29.875  1.00 35.83  ? 181 TYR C C   1 
ATOM   7275  O  O   . TYR C  3  181 ? -3.477  6.934   29.668  1.00 35.51  ? 181 TYR C O   1 
ATOM   7276  C  CB  . TYR C  3  181 ? -6.765  7.165   28.935  1.00 33.87  ? 181 TYR C CB  1 
ATOM   7277  C  CG  . TYR C  3  181 ? -7.427  7.580   27.658  1.00 32.06  ? 181 TYR C CG  1 
ATOM   7278  C  CD1 . TYR C  3  181 ? -7.400  6.783   26.510  1.00 33.69  ? 181 TYR C CD1 1 
ATOM   7279  C  CD2 . TYR C  3  181 ? -8.054  8.794   27.577  1.00 34.22  ? 181 TYR C CD2 1 
ATOM   7280  C  CE1 . TYR C  3  181 ? -7.995  7.203   25.329  1.00 33.30  ? 181 TYR C CE1 1 
ATOM   7281  C  CE2 . TYR C  3  181 ? -8.641  9.219   26.406  1.00 34.37  ? 181 TYR C CE2 1 
ATOM   7282  C  CZ  . TYR C  3  181 ? -8.617  8.418   25.308  1.00 32.63  ? 181 TYR C CZ  1 
ATOM   7283  O  OH  . TYR C  3  181 ? -9.170  8.902   24.204  1.00 34.81  ? 181 TYR C OH  1 
ATOM   7284  N  N   . TYR C  3  182 ? -4.972  6.068   31.073  1.00 39.54  ? 182 TYR C N   1 
ATOM   7285  C  CA  . TYR C  3  182 ? -4.140  6.264   32.252  1.00 42.95  ? 182 TYR C CA  1 
ATOM   7286  C  C   . TYR C  3  182 ? -2.843  5.402   32.170  1.00 40.59  ? 182 TYR C C   1 
ATOM   7287  O  O   . TYR C  3  182 ? -1.795  5.873   32.545  1.00 36.40  ? 182 TYR C O   1 
ATOM   7288  C  CB  . TYR C  3  182 ? -4.941  5.986   33.543  1.00 43.44  ? 182 TYR C CB  1 
ATOM   7289  C  CG  . TYR C  3  182 ? -4.104  6.217   34.760  1.00 45.36  ? 182 TYR C CG  1 
ATOM   7290  C  CD1 . TYR C  3  182 ? -3.915  7.501   35.255  1.00 51.94  ? 182 TYR C CD1 1 
ATOM   7291  C  CD2 . TYR C  3  182 ? -3.443  5.160   35.384  1.00 48.62  ? 182 TYR C CD2 1 
ATOM   7292  C  CE1 . TYR C  3  182 ? -3.112  7.730   36.366  1.00 53.77  ? 182 TYR C CE1 1 
ATOM   7293  C  CE2 . TYR C  3  182 ? -2.630  5.372   36.481  1.00 51.41  ? 182 TYR C CE2 1 
ATOM   7294  C  CZ  . TYR C  3  182 ? -2.474  6.654   36.964  1.00 53.25  ? 182 TYR C CZ  1 
ATOM   7295  O  OH  . TYR C  3  182 ? -1.690  6.861   38.045  1.00 59.62  ? 182 TYR C OH  1 
ATOM   7296  N  N   . GLU C  3  183 ? -2.935  4.170   31.668  1.00 36.39  ? 183 GLU C N   1 
ATOM   7297  C  CA  . GLU C  3  183 ? -1.796  3.307   31.617  1.00 38.94  ? 183 GLU C CA  1 
ATOM   7298  C  C   . GLU C  3  183 ? -0.931  3.614   30.411  1.00 42.28  ? 183 GLU C C   1 
ATOM   7299  O  O   . GLU C  3  183 ? 0.212   3.152   30.364  1.00 45.55  ? 183 GLU C O   1 
ATOM   7300  C  CB  . GLU C  3  183 ? -2.227  1.844   31.510  1.00 43.07  ? 183 GLU C CB  1 
ATOM   7301  C  CG  . GLU C  3  183 ? -3.011  1.287   32.681  1.00 46.36  ? 183 GLU C CG  1 
ATOM   7302  C  CD  . GLU C  3  183 ? -2.241  1.291   33.999  1.00 51.33  ? 183 GLU C CD  1 
ATOM   7303  O  OE1 . GLU C  3  183 ? -0.992  1.249   34.015  1.00 48.57  ? 183 GLU C OE1 1 
ATOM   7304  O  OE2 . GLU C  3  183 ? -2.916  1.356   35.043  1.00 63.04  ? 183 GLU C OE2 1 
ATOM   7305  N  N   . ALA C  3  184 ? -1.449  4.337   29.409  1.00 39.56  ? 184 ALA C N   1 
ATOM   7306  C  CA  . ALA C  3  184 ? -0.692  4.489   28.172  1.00 35.95  ? 184 ALA C CA  1 
ATOM   7307  C  C   . ALA C  3  184 ? 0.653   5.219   28.414  1.00 38.14  ? 184 ALA C C   1 
ATOM   7308  O  O   . ALA C  3  184 ? 0.714   6.260   29.128  1.00 39.69  ? 184 ALA C O   1 
ATOM   7309  C  CB  . ALA C  3  184 ? -1.500  5.198   27.110  1.00 35.29  ? 184 ALA C CB  1 
ATOM   7310  N  N   . PRO C  3  185 ? 1.731   4.685   27.821  1.00 34.34  ? 185 PRO C N   1 
ATOM   7311  C  CA  . PRO C  3  185 ? 3.055   5.258   27.960  1.00 36.39  ? 185 PRO C CA  1 
ATOM   7312  C  C   . PRO C  3  185 ? 3.347   6.485   27.101  1.00 39.07  ? 185 PRO C C   1 
ATOM   7313  O  O   . PRO C  3  185 ? 4.487   6.966   27.110  1.00 45.15  ? 185 PRO C O   1 
ATOM   7314  C  CB  . PRO C  3  185 ? 3.950   4.120   27.519  1.00 35.49  ? 185 PRO C CB  1 
ATOM   7315  C  CG  . PRO C  3  185 ? 3.150   3.468   26.469  1.00 36.49  ? 185 PRO C CG  1 
ATOM   7316  C  CD  . PRO C  3  185 ? 1.751   3.485   26.977  1.00 34.91  ? 185 PRO C CD  1 
ATOM   7317  N  N   . PHE C  3  186 ? 2.353   6.979   26.367  1.00 36.70  ? 186 PHE C N   1 
ATOM   7318  C  CA  . PHE C  3  186 ? 2.489   8.205   25.584  1.00 35.82  ? 186 PHE C CA  1 
ATOM   7319  C  C   . PHE C  3  186 ? 1.320   9.118   25.979  1.00 33.98  ? 186 PHE C C   1 
ATOM   7320  O  O   . PHE C  3  186 ? 0.295   8.636   26.480  1.00 31.62  ? 186 PHE C O   1 
ATOM   7321  C  CB  . PHE C  3  186 ? 2.525   7.889   24.078  1.00 34.71  ? 186 PHE C CB  1 
ATOM   7322  C  CG  . PHE C  3  186 ? 1.432   6.969   23.643  1.00 35.63  ? 186 PHE C CG  1 
ATOM   7323  C  CD1 . PHE C  3  186 ? 1.600   5.597   23.693  1.00 36.06  ? 186 PHE C CD1 1 
ATOM   7324  C  CD2 . PHE C  3  186 ? 0.197   7.474   23.250  1.00 35.90  ? 186 PHE C CD2 1 
ATOM   7325  C  CE1 . PHE C  3  186 ? 0.566   4.754   23.324  1.00 37.31  ? 186 PHE C CE1 1 
ATOM   7326  C  CE2 . PHE C  3  186 ? -0.838  6.642   22.885  1.00 34.47  ? 186 PHE C CE2 1 
ATOM   7327  C  CZ  . PHE C  3  186 ? -0.657  5.279   22.923  1.00 37.33  ? 186 PHE C CZ  1 
ATOM   7328  N  N   . THR C  3  187 ? 1.507   10.424  25.810  1.00 32.28  ? 187 THR C N   1 
ATOM   7329  C  CA  . THR C  3  187 ? 0.464   11.428  26.069  1.00 32.56  ? 187 THR C CA  1 
ATOM   7330  C  C   . THR C  3  187 ? 0.036   12.238  24.843  1.00 30.92  ? 187 THR C C   1 
ATOM   7331  O  O   . THR C  3  187 ? 0.589   12.092  23.765  1.00 29.23  ? 187 THR C O   1 
ATOM   7332  C  CB  . THR C  3  187 ? 0.922   12.457  27.098  1.00 33.58  ? 187 THR C CB  1 
ATOM   7333  O  OG1 . THR C  3  187 ? 1.886   13.321  26.492  1.00 32.80  ? 187 THR C OG1 1 
ATOM   7334  C  CG2 . THR C  3  187 ? 1.494   11.760  28.297  1.00 36.84  ? 187 THR C CG2 1 
ATOM   7335  N  N   . ILE C  3  188 ? -0.958  13.111  25.033  1.00 31.34  ? 188 ILE C N   1 
ATOM   7336  C  CA  . ILE C  3  188 ? -1.373  14.019  23.983  1.00 32.28  ? 188 ILE C CA  1 
ATOM   7337  C  C   . ILE C  3  188 ? -0.233  14.927  23.519  1.00 31.28  ? 188 ILE C C   1 
ATOM   7338  O  O   . ILE C  3  188 ? -0.206  15.329  22.382  1.00 34.81  ? 188 ILE C O   1 
ATOM   7339  C  CB  . ILE C  3  188 ? -2.610  14.831  24.405  1.00 32.07  ? 188 ILE C CB  1 
ATOM   7340  C  CG1 . ILE C  3  188 ? -3.340  15.374  23.163  1.00 30.96  ? 188 ILE C CG1 1 
ATOM   7341  C  CG2 . ILE C  3  188 ? -2.246  15.912  25.415  1.00 32.20  ? 188 ILE C CG2 1 
ATOM   7342  C  CD1 . ILE C  3  188 ? -4.648  16.055  23.470  1.00 30.78  ? 188 ILE C CD1 1 
ATOM   7343  N  N   . SER C  3  189 ? 0.727   15.211  24.389  1.00 32.62  ? 189 SER C N   1 
ATOM   7344  C  CA  . SER C  3  189 ? 1.868   16.067  24.040  1.00 32.35  ? 189 SER C CA  1 
ATOM   7345  C  C   . SER C  3  189 ? 3.005   15.311  23.374  1.00 29.82  ? 189 SER C C   1 
ATOM   7346  O  O   . SER C  3  189 ? 4.017   15.908  23.043  1.00 30.01  ? 189 SER C O   1 
ATOM   7347  C  CB  . SER C  3  189 ? 2.386   16.809  25.277  1.00 32.41  ? 189 SER C CB  1 
ATOM   7348  O  OG  . SER C  3  189 ? 2.687   15.886  26.322  1.00 36.63  ? 189 SER C OG  1 
ATOM   7349  N  N   . ASP C  3  190 ? 2.853   14.021  23.135  1.00 28.19  ? 190 ASP C N   1 
ATOM   7350  C  CA  . ASP C  3  190 ? 3.913   13.269  22.496  1.00 28.76  ? 190 ASP C CA  1 
ATOM   7351  C  C   . ASP C  3  190 ? 3.830   13.314  20.961  1.00 29.23  ? 190 ASP C C   1 
ATOM   7352  O  O   . ASP C  3  190 ? 3.718   12.274  20.247  1.00 26.27  ? 190 ASP C O   1 
ATOM   7353  C  CB  . ASP C  3  190 ? 3.984   11.849  23.055  1.00 30.79  ? 190 ASP C CB  1 
ATOM   7354  C  CG  . ASP C  3  190 ? 4.482   11.813  24.496  1.00 32.00  ? 190 ASP C CG  1 
ATOM   7355  O  OD1 . ASP C  3  190 ? 5.183   12.759  24.945  1.00 31.45  ? 190 ASP C OD1 1 
ATOM   7356  O  OD2 . ASP C  3  190 ? 4.165   10.809  25.178  1.00 36.15  ? 190 ASP C OD2 1 
ATOM   7357  N  N   . GLY C  3  191 ? 3.968   14.544  20.463  1.00 26.93  ? 191 GLY C N   1 
ATOM   7358  C  CA  . GLY C  3  191 ? 3.968   14.812  19.049  1.00 26.83  ? 191 GLY C CA  1 
ATOM   7359  C  C   . GLY C  3  191 ? 2.689   14.394  18.362  1.00 26.63  ? 191 GLY C C   1 
ATOM   7360  O  O   . GLY C  3  191 ? 1.645   14.233  18.992  1.00 24.54  ? 191 GLY C O   1 
ATOM   7361  N  N   . VAL C  3  192 ? 2.795   14.187  17.053  1.00 26.16  ? 192 VAL C N   1 
ATOM   7362  C  CA  . VAL C  3  192 ? 1.628   13.980  16.243  1.00 27.39  ? 192 VAL C CA  1 
ATOM   7363  C  C   . VAL C  3  192 ? 1.024   12.603  16.516  1.00 28.93  ? 192 VAL C C   1 
ATOM   7364  O  O   . VAL C  3  192 ? -0.154  12.395  16.247  1.00 29.20  ? 192 VAL C O   1 
ATOM   7365  C  CB  . VAL C  3  192 ? 1.936   14.219  14.748  1.00 25.99  ? 192 VAL C CB  1 
ATOM   7366  C  CG1 . VAL C  3  192 ? 2.674   13.056  14.131  1.00 27.36  ? 192 VAL C CG1 1 
ATOM   7367  C  CG2 . VAL C  3  192 ? 0.683   14.479  14.007  1.00 25.82  ? 192 VAL C CG2 1 
ATOM   7368  N  N   . TYR C  3  193 ? 1.824   11.672  17.050  1.00 28.49  ? 193 TYR C N   1 
ATOM   7369  C  CA  . TYR C  3  193 ? 1.317   10.351  17.375  1.00 28.34  ? 193 TYR C CA  1 
ATOM   7370  C  C   . TYR C  3  193 ? 0.360   10.529  18.534  1.00 29.03  ? 193 TYR C C   1 
ATOM   7371  O  O   . TYR C  3  193 ? -0.750  10.060  18.500  1.00 30.11  ? 193 TYR C O   1 
ATOM   7372  C  CB  . TYR C  3  193 ? 2.425   9.332   17.761  1.00 29.46  ? 193 TYR C CB  1 
ATOM   7373  C  CG  . TYR C  3  193 ? 1.839   7.969   18.081  1.00 27.43  ? 193 TYR C CG  1 
ATOM   7374  C  CD1 . TYR C  3  193 ? 1.318   7.686   19.332  1.00 29.41  ? 193 TYR C CD1 1 
ATOM   7375  C  CD2 . TYR C  3  193 ? 1.739   7.003   17.115  1.00 28.31  ? 193 TYR C CD2 1 
ATOM   7376  C  CE1 . TYR C  3  193 ? 0.724   6.456   19.589  1.00 31.90  ? 193 TYR C CE1 1 
ATOM   7377  C  CE2 . TYR C  3  193 ? 1.164   5.753   17.374  1.00 28.96  ? 193 TYR C CE2 1 
ATOM   7378  C  CZ  . TYR C  3  193 ? 0.656   5.497   18.596  1.00 29.89  ? 193 TYR C CZ  1 
ATOM   7379  O  OH  . TYR C  3  193 ? 0.058   4.293   18.828  1.00 35.35  ? 193 TYR C OH  1 
ATOM   7380  N  N   . GLY C  3  194 ? 0.807   11.198  19.575  1.00 29.29  ? 194 GLY C N   1 
ATOM   7381  C  CA  . GLY C  3  194 ? -0.052  11.461  20.695  1.00 29.19  ? 194 GLY C CA  1 
ATOM   7382  C  C   . GLY C  3  194 ? -1.272  12.300  20.311  1.00 29.10  ? 194 GLY C C   1 
ATOM   7383  O  O   . GLY C  3  194 ? -2.361  12.072  20.822  1.00 26.95  ? 194 GLY C O   1 
ATOM   7384  N  N   . SER C  3  195 ? -1.055  13.283  19.435  1.00 27.74  ? 195 SER C N   1 
ATOM   7385  C  CA  . SER C  3  195 ? -2.084  14.228  19.037  1.00 27.79  ? 195 SER C CA  1 
ATOM   7386  C  C   . SER C  3  195 ? -3.214  13.508  18.295  1.00 27.14  ? 195 SER C C   1 
ATOM   7387  O  O   . SER C  3  195 ? -4.382  13.662  18.634  1.00 28.04  ? 195 SER C O   1 
ATOM   7388  C  CB  . SER C  3  195 ? -1.498  15.364  18.157  1.00 27.33  ? 195 SER C CB  1 
ATOM   7389  O  OG  . SER C  3  195 ? -0.517  16.144  18.846  1.00 23.98  ? 195 SER C OG  1 
ATOM   7390  N  N   . THR C  3  196 ? -2.857  12.708  17.311  1.00 26.04  ? 196 THR C N   1 
ATOM   7391  C  CA  . THR C  3  196 ? -3.849  11.985  16.545  1.00 27.77  ? 196 THR C CA  1 
ATOM   7392  C  C   . THR C  3  196 ? -4.587  10.890  17.355  1.00 32.58  ? 196 THR C C   1 
ATOM   7393  O  O   . THR C  3  196 ? -5.790  10.659  17.168  1.00 34.52  ? 196 THR C O   1 
ATOM   7394  C  CB  . THR C  3  196 ? -3.215  11.337  15.311  1.00 26.66  ? 196 THR C CB  1 
ATOM   7395  O  OG1 . THR C  3  196 ? -2.087  10.566  15.705  1.00 26.58  ? 196 THR C OG1 1 
ATOM   7396  C  CG2 . THR C  3  196 ? -2.762  12.384  14.345  1.00 26.28  ? 196 THR C CG2 1 
ATOM   7397  N  N   . PHE C  3  197 ? -3.865  10.206  18.241  1.00 32.25  ? 197 PHE C N   1 
ATOM   7398  C  CA  . PHE C  3  197 ? -4.419  9.127   19.020  1.00 28.67  ? 197 PHE C CA  1 
ATOM   7399  C  C   . PHE C  3  197 ? -5.482  9.647   19.984  1.00 29.73  ? 197 PHE C C   1 
ATOM   7400  O  O   . PHE C  3  197 ? -6.594  9.145   20.007  1.00 29.82  ? 197 PHE C O   1 
ATOM   7401  C  CB  . PHE C  3  197 ? -3.297  8.425   19.808  1.00 28.94  ? 197 PHE C CB  1 
ATOM   7402  C  CG  . PHE C  3  197 ? -3.759  7.197   20.556  1.00 30.25  ? 197 PHE C CG  1 
ATOM   7403  C  CD1 . PHE C  3  197 ? -4.334  7.304   21.822  1.00 31.31  ? 197 PHE C CD1 1 
ATOM   7404  C  CD2 . PHE C  3  197 ? -3.653  5.945   19.988  1.00 29.27  ? 197 PHE C CD2 1 
ATOM   7405  C  CE1 . PHE C  3  197 ? -4.784  6.177   22.488  1.00 31.51  ? 197 PHE C CE1 1 
ATOM   7406  C  CE2 . PHE C  3  197 ? -4.104  4.828   20.659  1.00 29.69  ? 197 PHE C CE2 1 
ATOM   7407  C  CZ  . PHE C  3  197 ? -4.667  4.942   21.896  1.00 29.84  ? 197 PHE C CZ  1 
ATOM   7408  N  N   . PHE C  3  198 ? -5.123  10.619  20.813  1.00 29.52  ? 198 PHE C N   1 
ATOM   7409  C  CA  . PHE C  3  198 ? -6.009  11.065  21.880  1.00 30.07  ? 198 PHE C CA  1 
ATOM   7410  C  C   . PHE C  3  198 ? -7.139  11.974  21.422  1.00 30.65  ? 198 PHE C C   1 
ATOM   7411  O  O   . PHE C  3  198 ? -8.208  11.943  22.015  1.00 31.43  ? 198 PHE C O   1 
ATOM   7412  C  CB  . PHE C  3  198 ? -5.237  11.680  23.068  1.00 30.67  ? 198 PHE C CB  1 
ATOM   7413  C  CG  . PHE C  3  198 ? -4.480  10.654  23.866  1.00 33.40  ? 198 PHE C CG  1 
ATOM   7414  C  CD1 . PHE C  3  198 ? -5.158  9.729   24.647  1.00 32.22  ? 198 PHE C CD1 1 
ATOM   7415  C  CD2 . PHE C  3  198 ? -3.087  10.564  23.787  1.00 35.11  ? 198 PHE C CD2 1 
ATOM   7416  C  CE1 . PHE C  3  198 ? -4.472  8.762   25.370  1.00 34.05  ? 198 PHE C CE1 1 
ATOM   7417  C  CE2 . PHE C  3  198 ? -2.396  9.588   24.506  1.00 34.02  ? 198 PHE C CE2 1 
ATOM   7418  C  CZ  . PHE C  3  198 ? -3.081  8.688   25.292  1.00 33.34  ? 198 PHE C CZ  1 
ATOM   7419  N  N   . VAL C  3  199 ? -6.929  12.776  20.388  1.00 29.92  ? 199 VAL C N   1 
ATOM   7420  C  CA  . VAL C  3  199 ? -8.015  13.583  19.857  1.00 29.28  ? 199 VAL C CA  1 
ATOM   7421  C  C   . VAL C  3  199 ? -9.020  12.702  19.097  1.00 27.75  ? 199 VAL C C   1 
ATOM   7422  O  O   . VAL C  3  199 ? -10.211 12.891  19.246  1.00 30.31  ? 199 VAL C O   1 
ATOM   7423  C  CB  . VAL C  3  199 ? -7.503  14.737  18.981  1.00 30.10  ? 199 VAL C CB  1 
ATOM   7424  C  CG1 . VAL C  3  199 ? -8.654  15.443  18.289  1.00 31.82  ? 199 VAL C CG1 1 
ATOM   7425  C  CG2 . VAL C  3  199 ? -6.686  15.714  19.808  1.00 30.32  ? 199 VAL C CG2 1 
ATOM   7426  N  N   . ALA C  3  200 ? -8.576  11.740  18.303  1.00 27.32  ? 200 ALA C N   1 
ATOM   7427  C  CA  . ALA C  3  200 ? -9.529  10.850  17.614  1.00 27.67  ? 200 ALA C CA  1 
ATOM   7428  C  C   . ALA C  3  200 ? -10.281 9.906   18.592  1.00 29.75  ? 200 ALA C C   1 
ATOM   7429  O  O   . ALA C  3  200 ? -11.514 9.849   18.550  1.00 31.22  ? 200 ALA C O   1 
ATOM   7430  C  CB  . ALA C  3  200 ? -8.849  10.039  16.523  1.00 27.78  ? 200 ALA C CB  1 
ATOM   7431  N  N   . THR C  3  201 ? -9.546  9.169   19.445  1.00 28.21  ? 201 THR C N   1 
ATOM   7432  C  CA  . THR C  3  201 ? -10.159 8.204   20.367  1.00 27.45  ? 201 THR C CA  1 
ATOM   7433  C  C   . THR C  3  201 ? -10.940 8.943   21.407  1.00 27.92  ? 201 THR C C   1 
ATOM   7434  O  O   . THR C  3  201 ? -11.933 8.433   21.904  1.00 33.46  ? 201 THR C O   1 
ATOM   7435  C  CB  . THR C  3  201 ? -9.167  7.215   21.060  1.00 26.71  ? 201 THR C CB  1 
ATOM   7436  O  OG1 . THR C  3  201 ? -8.207  7.891   21.896  1.00 26.53  ? 201 THR C OG1 1 
ATOM   7437  C  CG2 . THR C  3  201 ? -8.459  6.395   20.056  1.00 26.90  ? 201 THR C CG2 1 
ATOM   7438  N  N   . GLY C  3  202 ? -10.500 10.155  21.732  1.00 28.09  ? 202 GLY C N   1 
ATOM   7439  C  CA  . GLY C  3  202 ? -11.154 10.977  22.755  1.00 28.47  ? 202 GLY C CA  1 
ATOM   7440  C  C   . GLY C  3  202 ? -12.489 11.484  22.294  1.00 28.48  ? 202 GLY C C   1 
ATOM   7441  O  O   . GLY C  3  202 ? -13.426 11.407  23.025  1.00 28.40  ? 202 GLY C O   1 
ATOM   7442  N  N   . PHE C  3  203 ? -12.579 11.967  21.059  1.00 29.42  ? 203 PHE C N   1 
ATOM   7443  C  CA  . PHE C  3  203 ? -13.852 12.415  20.525  1.00 29.52  ? 203 PHE C CA  1 
ATOM   7444  C  C   . PHE C  3  203 ? -14.809 11.251  20.390  1.00 28.09  ? 203 PHE C C   1 
ATOM   7445  O  O   . PHE C  3  203 ? -16.035 11.411  20.590  1.00 23.50  ? 203 PHE C O   1 
ATOM   7446  C  CB  . PHE C  3  203 ? -13.714 13.173  19.191  1.00 31.45  ? 203 PHE C CB  1 
ATOM   7447  C  CG  . PHE C  3  203 ? -13.599 14.679  19.364  1.00 33.84  ? 203 PHE C CG  1 
ATOM   7448  C  CD1 . PHE C  3  203 ? -14.709 15.435  19.750  1.00 34.53  ? 203 PHE C CD1 1 
ATOM   7449  C  CD2 . PHE C  3  203 ? -12.399 15.345  19.129  1.00 33.39  ? 203 PHE C CD2 1 
ATOM   7450  C  CE1 . PHE C  3  203 ? -14.616 16.814  19.896  1.00 33.23  ? 203 PHE C CE1 1 
ATOM   7451  C  CE2 . PHE C  3  203 ? -12.306 16.721  19.297  1.00 33.64  ? 203 PHE C CE2 1 
ATOM   7452  C  CZ  . PHE C  3  203 ? -13.404 17.451  19.675  1.00 32.16  ? 203 PHE C CZ  1 
ATOM   7453  N  N   . HIS C  3  204 ? -14.240 10.090  20.071  1.00 28.84  ? 204 HIS C N   1 
ATOM   7454  C  CA  . HIS C  3  204 ? -15.018 8.861   19.997  1.00 31.50  ? 204 HIS C CA  1 
ATOM   7455  C  C   . HIS C  3  204 ? -15.582 8.515   21.382  1.00 31.58  ? 204 HIS C C   1 
ATOM   7456  O  O   . HIS C  3  204 ? -16.783 8.262   21.531  1.00 30.20  ? 204 HIS C O   1 
ATOM   7457  C  CB  . HIS C  3  204 ? -14.208 7.678   19.436  1.00 30.29  ? 204 HIS C CB  1 
ATOM   7458  C  CG  . HIS C  3  204 ? -14.990 6.412   19.450  1.00 28.78  ? 204 HIS C CG  1 
ATOM   7459  N  ND1 . HIS C  3  204 ? -14.836 5.466   20.426  1.00 29.23  ? 204 HIS C ND1 1 
ATOM   7460  C  CD2 . HIS C  3  204 ? -16.029 6.005   18.689  1.00 28.60  ? 204 HIS C CD2 1 
ATOM   7461  C  CE1 . HIS C  3  204 ? -15.717 4.501   20.236  1.00 29.97  ? 204 HIS C CE1 1 
ATOM   7462  N  NE2 . HIS C  3  204 ? -16.459 4.809   19.193  1.00 28.20  ? 204 HIS C NE2 1 
ATOM   7463  N  N   . GLY C  3  205 ? -14.702 8.562   22.376  1.00 31.65  ? 205 GLY C N   1 
ATOM   7464  C  CA  . GLY C  3  205 ? -15.082 8.326   23.746  1.00 33.77  ? 205 GLY C CA  1 
ATOM   7465  C  C   . GLY C  3  205 ? -16.163 9.256   24.224  1.00 31.78  ? 205 GLY C C   1 
ATOM   7466  O  O   . GLY C  3  205 ? -17.125 8.840   24.869  1.00 33.15  ? 205 GLY C O   1 
ATOM   7467  N  N   . LEU C  3  206 ? -16.013 10.523  23.897  1.00 31.96  ? 206 LEU C N   1 
ATOM   7468  C  CA  . LEU C  3  206 ? -17.048 11.463  24.203  1.00 32.94  ? 206 LEU C CA  1 
ATOM   7469  C  C   . LEU C  3  206 ? -18.378 11.019  23.559  1.00 33.09  ? 206 LEU C C   1 
ATOM   7470  O  O   . LEU C  3  206 ? -19.427 11.207  24.159  1.00 34.68  ? 206 LEU C O   1 
ATOM   7471  C  CB  . LEU C  3  206 ? -16.664 12.865  23.739  1.00 32.62  ? 206 LEU C CB  1 
ATOM   7472  C  CG  . LEU C  3  206 ? -17.829 13.844  23.959  1.00 34.07  ? 206 LEU C CG  1 
ATOM   7473  C  CD1 . LEU C  3  206 ? -18.071 14.053  25.435  1.00 34.36  ? 206 LEU C CD1 1 
ATOM   7474  C  CD2 . LEU C  3  206 ? -17.556 15.173  23.293  1.00 38.44  ? 206 LEU C CD2 1 
ATOM   7475  N  N   . HIS C  3  207 ? -18.323 10.477  22.342  1.00 29.92  ? 207 HIS C N   1 
ATOM   7476  C  CA  . HIS C  3  207 ? -19.509 10.068  21.642  1.00 31.36  ? 207 HIS C CA  1 
ATOM   7477  C  C   . HIS C  3  207 ? -20.133 8.813   22.273  1.00 33.42  ? 207 HIS C C   1 
ATOM   7478  O  O   . HIS C  3  207 ? -21.390 8.677   22.336  1.00 32.57  ? 207 HIS C O   1 
ATOM   7479  C  CB  . HIS C  3  207 ? -19.220 9.841   20.152  1.00 31.04  ? 207 HIS C CB  1 
ATOM   7480  C  CG  . HIS C  3  207 ? -19.273 11.086  19.350  1.00 28.84  ? 207 HIS C CG  1 
ATOM   7481  N  ND1 . HIS C  3  207 ? -18.280 12.029  19.391  1.00 29.77  ? 207 HIS C ND1 1 
ATOM   7482  C  CD2 . HIS C  3  207 ? -20.201 11.554  18.490  1.00 31.43  ? 207 HIS C CD2 1 
ATOM   7483  C  CE1 . HIS C  3  207 ? -18.605 13.043  18.609  1.00 31.38  ? 207 HIS C CE1 1 
ATOM   7484  N  NE2 . HIS C  3  207 ? -19.756 12.769  18.031  1.00 30.54  ? 207 HIS C NE2 1 
ATOM   7485  N  N   . VAL C  3  208 ? -19.277 7.918   22.764  1.00 33.94  ? 208 VAL C N   1 
ATOM   7486  C  CA  . VAL C  3  208 ? -19.755 6.728   23.481  1.00 33.79  ? 208 VAL C CA  1 
ATOM   7487  C  C   . VAL C  3  208 ? -20.576 7.142   24.699  1.00 33.03  ? 208 VAL C C   1 
ATOM   7488  O  O   . VAL C  3  208 ? -21.581 6.533   24.990  1.00 31.97  ? 208 VAL C O   1 
ATOM   7489  C  CB  . VAL C  3  208 ? -18.611 5.790   23.886  1.00 32.35  ? 208 VAL C CB  1 
ATOM   7490  C  CG1 . VAL C  3  208 ? -19.125 4.633   24.709  1.00 35.07  ? 208 VAL C CG1 1 
ATOM   7491  C  CG2 . VAL C  3  208 ? -17.946 5.202   22.662  1.00 33.18  ? 208 VAL C CG2 1 
ATOM   7492  N  N   . ILE C  3  209 ? -20.140 8.188   25.388  1.00 34.43  ? 209 ILE C N   1 
ATOM   7493  C  CA  . ILE C  3  209 ? -20.831 8.702   26.589  1.00 34.86  ? 209 ILE C CA  1 
ATOM   7494  C  C   . ILE C  3  209 ? -22.155 9.379   26.253  1.00 32.68  ? 209 ILE C C   1 
ATOM   7495  O  O   . ILE C  3  209 ? -23.124 9.235   26.988  1.00 34.88  ? 209 ILE C O   1 
ATOM   7496  C  CB  . ILE C  3  209 ? -19.889 9.635   27.393  1.00 36.50  ? 209 ILE C CB  1 
ATOM   7497  C  CG1 . ILE C  3  209 ? -18.834 8.762   28.077  1.00 35.63  ? 209 ILE C CG1 1 
ATOM   7498  C  CG2 . ILE C  3  209 ? -20.626 10.484  28.432  1.00 38.16  ? 209 ILE C CG2 1 
ATOM   7499  C  CD1 . ILE C  3  209 ? -17.654 9.533   28.626  1.00 38.46  ? 209 ILE C CD1 1 
ATOM   7500  N  N   . ILE C  3  210 ? -22.180 10.116  25.157  1.00 30.02  ? 210 ILE C N   1 
ATOM   7501  C  CA  . ILE C  3  210 ? -23.389 10.737  24.662  1.00 31.05  ? 210 ILE C CA  1 
ATOM   7502  C  C   . ILE C  3  210 ? -24.420 9.687   24.248  1.00 32.39  ? 210 ILE C C   1 
ATOM   7503  O  O   . ILE C  3  210 ? -25.619 9.828   24.538  1.00 32.89  ? 210 ILE C O   1 
ATOM   7504  C  CB  . ILE C  3  210 ? -23.070 11.632  23.454  1.00 32.58  ? 210 ILE C CB  1 
ATOM   7505  C  CG1 . ILE C  3  210 ? -22.354 12.909  23.926  1.00 33.98  ? 210 ILE C CG1 1 
ATOM   7506  C  CG2 . ILE C  3  210 ? -24.343 11.990  22.679  1.00 32.74  ? 210 ILE C CG2 1 
ATOM   7507  C  CD1 . ILE C  3  210 ? -21.740 13.754  22.829  1.00 33.97  ? 210 ILE C CD1 1 
ATOM   7508  N  N   . GLY C  3  211 ? -23.952 8.682   23.513  1.00 29.67  ? 211 GLY C N   1 
ATOM   7509  C  CA  . GLY C  3  211 ? -24.784 7.578   23.110  1.00 30.93  ? 211 GLY C CA  1 
ATOM   7510  C  C   . GLY C  3  211 ? -25.301 6.719   24.262  1.00 31.02  ? 211 GLY C C   1 
ATOM   7511  O  O   . GLY C  3  211 ? -26.453 6.278   24.244  1.00 31.46  ? 211 GLY C O   1 
ATOM   7512  N  N   . SER C  3  212 ? -24.446 6.464   25.245  1.00 31.06  ? 212 SER C N   1 
ATOM   7513  C  CA  . SER C  3  212 ? -24.843 5.742   26.469  1.00 31.94  ? 212 SER C CA  1 
ATOM   7514  C  C   . SER C  3  212 ? -25.906 6.527   27.228  1.00 31.30  ? 212 SER C C   1 
ATOM   7515  O  O   . SER C  3  212 ? -26.887 5.963   27.667  1.00 30.58  ? 212 SER C O   1 
ATOM   7516  C  CB  . SER C  3  212 ? -23.616 5.460   27.345  1.00 30.17  ? 212 SER C CB  1 
ATOM   7517  O  OG  . SER C  3  212 ? -22.773 4.499   26.697  1.00 29.73  ? 212 SER C OG  1 
ATOM   7518  N  N   . THR C  3  213 ? -25.722 7.839   27.335  1.00 31.29  ? 213 THR C N   1 
ATOM   7519  C  CA  . THR C  3  213 ? -26.703 8.727   27.972  1.00 30.88  ? 213 THR C CA  1 
ATOM   7520  C  C   . THR C  3  213 ? -28.052 8.669   27.256  1.00 30.78  ? 213 THR C C   1 
ATOM   7521  O  O   . THR C  3  213 ? -29.110 8.612   27.890  1.00 31.81  ? 213 THR C O   1 
ATOM   7522  C  CB  . THR C  3  213 ? -26.194 10.185  28.031  1.00 31.55  ? 213 THR C CB  1 
ATOM   7523  O  OG1 . THR C  3  213 ? -25.012 10.243  28.842  1.00 30.51  ? 213 THR C OG1 1 
ATOM   7524  C  CG2 . THR C  3  213 ? -27.231 11.086  28.655  1.00 32.70  ? 213 THR C CG2 1 
ATOM   7525  N  N   . PHE C  3  214 ? -27.997 8.655   25.939  1.00 29.81  ? 214 PHE C N   1 
ATOM   7526  C  CA  . PHE C  3  214 ? -29.186 8.569   25.117  1.00 29.83  ? 214 PHE C CA  1 
ATOM   7527  C  C   . PHE C  3  214 ? -29.922 7.235   25.372  1.00 30.64  ? 214 PHE C C   1 
ATOM   7528  O  O   . PHE C  3  214 ? -31.167 7.223   25.545  1.00 31.39  ? 214 PHE C O   1 
ATOM   7529  C  CB  . PHE C  3  214 ? -28.805 8.793   23.634  1.00 29.60  ? 214 PHE C CB  1 
ATOM   7530  C  CG  . PHE C  3  214 ? -29.958 9.096   22.699  1.00 28.27  ? 214 PHE C CG  1 
ATOM   7531  C  CD1 . PHE C  3  214 ? -31.275 9.288   23.133  1.00 28.98  ? 214 PHE C CD1 1 
ATOM   7532  C  CD2 . PHE C  3  214 ? -29.701 9.190   21.351  1.00 29.15  ? 214 PHE C CD2 1 
ATOM   7533  C  CE1 . PHE C  3  214 ? -32.305 9.546   22.228  1.00 29.30  ? 214 PHE C CE1 1 
ATOM   7534  C  CE2 . PHE C  3  214 ? -30.727 9.455   20.441  1.00 30.87  ? 214 PHE C CE2 1 
ATOM   7535  C  CZ  . PHE C  3  214 ? -32.033 9.637   20.883  1.00 28.91  ? 214 PHE C CZ  1 
ATOM   7536  N  N   . LEU C  3  215 ? -29.175 6.134   25.451  1.00 29.43  ? 215 LEU C N   1 
ATOM   7537  C  CA  . LEU C  3  215 ? -29.776 4.824   25.759  1.00 30.18  ? 215 LEU C CA  1 
ATOM   7538  C  C   . LEU C  3  215 ? -30.443 4.788   27.149  1.00 29.53  ? 215 LEU C C   1 
ATOM   7539  O  O   . LEU C  3  215 ? -31.504 4.205   27.324  1.00 32.58  ? 215 LEU C O   1 
ATOM   7540  C  CB  . LEU C  3  215 ? -28.747 3.705   25.650  1.00 31.24  ? 215 LEU C CB  1 
ATOM   7541  C  CG  . LEU C  3  215 ? -28.105 3.445   24.278  1.00 32.68  ? 215 LEU C CG  1 
ATOM   7542  C  CD1 . LEU C  3  215 ? -26.924 2.494   24.437  1.00 34.43  ? 215 LEU C CD1 1 
ATOM   7543  C  CD2 . LEU C  3  215 ? -29.093 2.925   23.253  1.00 33.76  ? 215 LEU C CD2 1 
ATOM   7544  N  N   . ILE C  3  216 ? -29.842 5.459   28.116  1.00 30.20  ? 216 ILE C N   1 
ATOM   7545  C  CA  . ILE C  3  216 ? -30.398 5.583   29.454  1.00 29.47  ? 216 ILE C CA  1 
ATOM   7546  C  C   . ILE C  3  216 ? -31.679 6.404   29.433  1.00 31.73  ? 216 ILE C C   1 
ATOM   7547  O  O   . ILE C  3  216 ? -32.672 5.996   30.039  1.00 31.22  ? 216 ILE C O   1 
ATOM   7548  C  CB  . ILE C  3  216 ? -29.352 6.161   30.410  1.00 31.24  ? 216 ILE C CB  1 
ATOM   7549  C  CG1 . ILE C  3  216 ? -28.252 5.088   30.646  1.00 30.55  ? 216 ILE C CG1 1 
ATOM   7550  C  CG2 . ILE C  3  216 ? -29.999 6.592   31.731  1.00 32.60  ? 216 ILE C CG2 1 
ATOM   7551  C  CD1 . ILE C  3  216 ? -27.007 5.629   31.318  1.00 31.23  ? 216 ILE C CD1 1 
ATOM   7552  N  N   . VAL C  3  217 ? -31.693 7.526   28.704  1.00 32.27  ? 217 VAL C N   1 
ATOM   7553  C  CA  . VAL C  3  217 ? -32.952 8.266   28.501  1.00 30.28  ? 217 VAL C CA  1 
ATOM   7554  C  C   . VAL C  3  217 ? -34.014 7.326   27.943  1.00 31.63  ? 217 VAL C C   1 
ATOM   7555  O  O   . VAL C  3  217 ? -35.118 7.300   28.440  1.00 33.10  ? 217 VAL C O   1 
ATOM   7556  C  CB  . VAL C  3  217 ? -32.802 9.488   27.586  1.00 29.72  ? 217 VAL C CB  1 
ATOM   7557  C  CG1 . VAL C  3  217 ? -34.162 10.157  27.350  1.00 29.72  ? 217 VAL C CG1 1 
ATOM   7558  C  CG2 . VAL C  3  217 ? -31.842 10.507  28.195  1.00 30.10  ? 217 VAL C CG2 1 
ATOM   7559  N  N   . CYS C  3  218 ? -33.667 6.519   26.945  1.00 33.35  ? 218 CYS C N   1 
ATOM   7560  C  CA  . CYS C  3  218 ? -34.601 5.498   26.431  1.00 33.70  ? 218 CYS C CA  1 
ATOM   7561  C  C   . CYS C  3  218 ? -35.051 4.443   27.442  1.00 31.58  ? 218 CYS C C   1 
ATOM   7562  O  O   . CYS C  3  218 ? -36.223 4.066   27.425  1.00 29.63  ? 218 CYS C O   1 
ATOM   7563  C  CB  . CYS C  3  218 ? -34.016 4.776   25.219  1.00 32.22  ? 218 CYS C CB  1 
ATOM   7564  S  SG  . CYS C  3  218 ? -33.782 5.904   23.882  1.00 32.88  ? 218 CYS C SG  1 
ATOM   7565  N  N   . PHE C  3  219 ? -34.116 3.951   28.258  1.00 30.96  ? 219 PHE C N   1 
ATOM   7566  C  CA  . PHE C  3  219 ? -34.404 2.974   29.320  1.00 31.96  ? 219 PHE C CA  1 
ATOM   7567  C  C   . PHE C  3  219 ? -35.537 3.472   30.223  1.00 34.54  ? 219 PHE C C   1 
ATOM   7568  O  O   . PHE C  3  219 ? -36.557 2.801   30.386  1.00 31.85  ? 219 PHE C O   1 
ATOM   7569  C  CB  . PHE C  3  219 ? -33.152 2.713   30.154  1.00 32.03  ? 219 PHE C CB  1 
ATOM   7570  C  CG  . PHE C  3  219 ? -33.302 1.588   31.128  1.00 36.01  ? 219 PHE C CG  1 
ATOM   7571  C  CD1 . PHE C  3  219 ? -33.130 0.282   30.724  1.00 37.22  ? 219 PHE C CD1 1 
ATOM   7572  C  CD2 . PHE C  3  219 ? -33.645 1.832   32.452  1.00 38.93  ? 219 PHE C CD2 1 
ATOM   7573  C  CE1 . PHE C  3  219 ? -33.287 -0.754  31.603  1.00 37.79  ? 219 PHE C CE1 1 
ATOM   7574  C  CE2 . PHE C  3  219 ? -33.803 0.794   33.349  1.00 38.08  ? 219 PHE C CE2 1 
ATOM   7575  C  CZ  . PHE C  3  219 ? -33.616 -0.499  32.921  1.00 38.86  ? 219 PHE C CZ  1 
ATOM   7576  N  N   . PHE C  3  220 ? -35.355 4.677   30.764  1.00 37.89  ? 220 PHE C N   1 
ATOM   7577  C  CA  . PHE C  3  220 ? -36.320 5.294   31.667  1.00 38.34  ? 220 PHE C CA  1 
ATOM   7578  C  C   . PHE C  3  220 ? -37.658 5.579   31.003  1.00 37.44  ? 220 PHE C C   1 
ATOM   7579  O  O   . PHE C  3  220 ? -38.721 5.325   31.611  1.00 34.42  ? 220 PHE C O   1 
ATOM   7580  C  CB  . PHE C  3  220 ? -35.724 6.532   32.376  1.00 40.53  ? 220 PHE C CB  1 
ATOM   7581  C  CG  . PHE C  3  220 ? -34.763 6.155   33.486  1.00 46.91  ? 220 PHE C CG  1 
ATOM   7582  C  CD1 . PHE C  3  220 ? -35.223 5.486   34.627  1.00 52.29  ? 220 PHE C CD1 1 
ATOM   7583  C  CD2 . PHE C  3  220 ? -33.389 6.385   33.371  1.00 53.49  ? 220 PHE C CD2 1 
ATOM   7584  C  CE1 . PHE C  3  220 ? -34.337 5.091   35.635  1.00 55.98  ? 220 PHE C CE1 1 
ATOM   7585  C  CE2 . PHE C  3  220 ? -32.501 5.994   34.375  1.00 53.56  ? 220 PHE C CE2 1 
ATOM   7586  C  CZ  . PHE C  3  220 ? -32.974 5.347   35.505  1.00 56.32  ? 220 PHE C CZ  1 
ATOM   7587  N  N   . ARG C  3  221 ? -37.611 6.046   29.754  1.00 34.73  ? 221 ARG C N   1 
ATOM   7588  C  CA  . ARG C  3  221 ? -38.827 6.261   28.985  1.00 33.73  ? 221 ARG C CA  1 
ATOM   7589  C  C   . ARG C  3  221 ? -39.610 4.950   28.742  1.00 34.06  ? 221 ARG C C   1 
ATOM   7590  O  O   . ARG C  3  221 ? -40.845 4.966   28.708  1.00 32.46  ? 221 ARG C O   1 
ATOM   7591  C  CB  . ARG C  3  221 ? -38.515 6.928   27.639  1.00 35.04  ? 221 ARG C CB  1 
ATOM   7592  C  CG  . ARG C  3  221 ? -38.169 8.401   27.729  1.00 35.93  ? 221 ARG C CG  1 
ATOM   7593  C  CD  . ARG C  3  221 ? -38.104 9.027   26.353  1.00 35.49  ? 221 ARG C CD  1 
ATOM   7594  N  NE  . ARG C  3  221 ? -39.458 9.236   25.856  1.00 35.53  ? 221 ARG C NE  1 
ATOM   7595  C  CZ  . ARG C  3  221 ? -39.841 9.231   24.583  1.00 33.48  ? 221 ARG C CZ  1 
ATOM   7596  N  NH1 . ARG C  3  221 ? -38.985 9.035   23.594  1.00 31.24  ? 221 ARG C NH1 1 
ATOM   7597  N  NH2 . ARG C  3  221 ? -41.128 9.422   24.308  1.00 33.48  ? 221 ARG C NH2 1 
ATOM   7598  N  N   . GLN C  3  222 ? -38.892 3.838   28.551  1.00 33.76  ? 222 GLN C N   1 
ATOM   7599  C  CA  . GLN C  3  222 ? -39.505 2.522   28.390  1.00 34.21  ? 222 GLN C CA  1 
ATOM   7600  C  C   . GLN C  3  222 ? -40.093 2.095   29.725  1.00 35.27  ? 222 GLN C C   1 
ATOM   7601  O  O   . GLN C  3  222 ? -41.195 1.594   29.751  1.00 35.14  ? 222 GLN C O   1 
ATOM   7602  C  CB  . GLN C  3  222 ? -38.495 1.484   27.888  1.00 33.49  ? 222 GLN C CB  1 
ATOM   7603  C  CG  . GLN C  3  222 ? -38.969 0.044   27.973  1.00 34.90  ? 222 GLN C CG  1 
ATOM   7604  C  CD  . GLN C  3  222 ? -40.147 -0.274  27.072  1.00 36.06  ? 222 GLN C CD  1 
ATOM   7605  O  OE1 . GLN C  3  222 ? -40.598 0.554   26.268  1.00 32.00  ? 222 GLN C OE1 1 
ATOM   7606  N  NE2 . GLN C  3  222 ? -40.624 -1.514  27.174  1.00 34.04  ? 222 GLN C NE2 1 
ATOM   7607  N  N   . LEU C  3  223 ? -39.366 2.288   30.826  1.00 35.12  ? 223 LEU C N   1 
ATOM   7608  C  CA  . LEU C  3  223 ? -39.924 2.013   32.158  1.00 36.27  ? 223 LEU C CA  1 
ATOM   7609  C  C   . LEU C  3  223 ? -41.261 2.697   32.421  1.00 36.26  ? 223 LEU C C   1 
ATOM   7610  O  O   . LEU C  3  223 ? -42.096 2.139   33.134  1.00 38.23  ? 223 LEU C O   1 
ATOM   7611  C  CB  . LEU C  3  223 ? -38.978 2.447   33.284  1.00 35.99  ? 223 LEU C CB  1 
ATOM   7612  C  CG  . LEU C  3  223 ? -37.921 1.471   33.747  1.00 37.90  ? 223 LEU C CG  1 
ATOM   7613  C  CD1 . LEU C  3  223 ? -37.059 2.115   34.824  1.00 40.25  ? 223 LEU C CD1 1 
ATOM   7614  C  CD2 . LEU C  3  223 ? -38.544 0.192   34.258  1.00 39.19  ? 223 LEU C CD2 1 
ATOM   7615  N  N   . LYS C  3  224 ? -41.426 3.907   31.880  1.00 35.23  ? 224 LYS C N   1 
ATOM   7616  C  CA  . LYS C  3  224 ? -42.619 4.716   32.046  1.00 34.73  ? 224 LYS C CA  1 
ATOM   7617  C  C   . LYS C  3  224 ? -43.583 4.551   30.915  1.00 32.77  ? 224 LYS C C   1 
ATOM   7618  O  O   . LYS C  3  224 ? -44.491 5.334   30.768  1.00 37.89  ? 224 LYS C O   1 
ATOM   7619  C  CB  . LYS C  3  224 ? -42.241 6.182   32.225  1.00 38.90  ? 224 LYS C CB  1 
ATOM   7620  C  CG  . LYS C  3  224 ? -41.212 6.347   33.326  1.00 47.40  ? 224 LYS C CG  1 
ATOM   7621  C  CD  . LYS C  3  224 ? -41.420 7.572   34.200  1.00 63.54  ? 224 LYS C CD  1 
ATOM   7622  C  CE  . LYS C  3  224 ? -41.152 7.222   35.672  1.00 74.68  ? 224 LYS C CE  1 
ATOM   7623  N  NZ  . LYS C  3  224 ? -41.043 8.429   36.550  1.00 79.36  ? 224 LYS C NZ  1 
ATOM   7624  N  N   . PHE C  3  225 ? -43.412 3.508   30.127  1.00 31.59  ? 225 PHE C N   1 
ATOM   7625  C  CA  . PHE C  3  225 ? -44.367 3.125   29.093  1.00 34.09  ? 225 PHE C CA  1 
ATOM   7626  C  C   . PHE C  3  225 ? -44.566 4.128   27.901  1.00 32.39  ? 225 PHE C C   1 
ATOM   7627  O  O   . PHE C  3  225 ? -45.611 4.116   27.236  1.00 33.48  ? 225 PHE C O   1 
ATOM   7628  C  CB  . PHE C  3  225 ? -45.727 2.770   29.745  1.00 36.20  ? 225 PHE C CB  1 
ATOM   7629  C  CG  . PHE C  3  225 ? -45.714 1.541   30.623  1.00 34.61  ? 225 PHE C CG  1 
ATOM   7630  C  CD1 . PHE C  3  225 ? -45.272 1.611   31.926  1.00 34.70  ? 225 PHE C CD1 1 
ATOM   7631  C  CD2 . PHE C  3  225 ? -46.238 0.335   30.157  1.00 36.72  ? 225 PHE C CD2 1 
ATOM   7632  C  CE1 . PHE C  3  225 ? -45.289 0.498   32.750  1.00 34.68  ? 225 PHE C CE1 1 
ATOM   7633  C  CE2 . PHE C  3  225 ? -46.259 -0.788  30.968  1.00 37.95  ? 225 PHE C CE2 1 
ATOM   7634  C  CZ  . PHE C  3  225 ? -45.781 -0.700  32.276  1.00 36.41  ? 225 PHE C CZ  1 
ATOM   7635  N  N   . HIS C  3  226 ? -43.596 4.989   27.621  1.00 29.74  ? 226 HIS C N   1 
ATOM   7636  C  CA  . HIS C  3  226 ? -43.781 5.986   26.566  1.00 29.71  ? 226 HIS C CA  1 
ATOM   7637  C  C   . HIS C  3  226 ? -43.845 5.337   25.197  1.00 29.59  ? 226 HIS C C   1 
ATOM   7638  O  O   . HIS C  3  226 ? -44.568 5.793   24.322  1.00 31.57  ? 226 HIS C O   1 
ATOM   7639  C  CB  . HIS C  3  226 ? -42.629 6.967   26.564  1.00 30.95  ? 226 HIS C CB  1 
ATOM   7640  C  CG  . HIS C  3  226 ? -42.593 7.868   27.740  1.00 32.19  ? 226 HIS C CG  1 
ATOM   7641  N  ND1 . HIS C  3  226 ? -41.737 8.943   27.806  1.00 34.20  ? 226 HIS C ND1 1 
ATOM   7642  C  CD2 . HIS C  3  226 ? -43.310 7.878   28.892  1.00 34.48  ? 226 HIS C CD2 1 
ATOM   7643  C  CE1 . HIS C  3  226 ? -41.923 9.578   28.953  1.00 36.04  ? 226 HIS C CE1 1 
ATOM   7644  N  NE2 . HIS C  3  226 ? -42.883 8.961   29.627  1.00 34.65  ? 226 HIS C NE2 1 
ATOM   7645  N  N   . PHE C  3  227 ? -43.068 4.277   25.006  1.00 31.33  ? 227 PHE C N   1 
ATOM   7646  C  CA  . PHE C  3  227 ? -42.974 3.627   23.713  1.00 32.79  ? 227 PHE C CA  1 
ATOM   7647  C  C   . PHE C  3  227 ? -44.143 2.693   23.464  1.00 33.80  ? 227 PHE C C   1 
ATOM   7648  O  O   . PHE C  3  227 ? -44.507 1.901   24.342  1.00 36.90  ? 227 PHE C O   1 
ATOM   7649  C  CB  . PHE C  3  227 ? -41.671 2.833   23.609  1.00 33.62  ? 227 PHE C CB  1 
ATOM   7650  C  CG  . PHE C  3  227 ? -40.431 3.664   23.744  1.00 34.60  ? 227 PHE C CG  1 
ATOM   7651  C  CD1 . PHE C  3  227 ? -40.298 4.886   23.087  1.00 36.99  ? 227 PHE C CD1 1 
ATOM   7652  C  CD2 . PHE C  3  227 ? -39.379 3.224   24.509  1.00 36.68  ? 227 PHE C CD2 1 
ATOM   7653  C  CE1 . PHE C  3  227 ? -39.156 5.656   23.217  1.00 35.02  ? 227 PHE C CE1 1 
ATOM   7654  C  CE2 . PHE C  3  227 ? -38.227 4.001   24.639  1.00 37.10  ? 227 PHE C CE2 1 
ATOM   7655  C  CZ  . PHE C  3  227 ? -38.124 5.215   23.995  1.00 35.08  ? 227 PHE C CZ  1 
ATOM   7656  N  N   . THR C  3  228 ? -44.721 2.781   22.270  1.00 33.23  ? 228 THR C N   1 
ATOM   7657  C  CA  . THR C  3  228 ? -45.577 1.708   21.748  1.00 32.74  ? 228 THR C CA  1 
ATOM   7658  C  C   . THR C  3  228 ? -44.809 0.793   20.809  1.00 34.09  ? 228 THR C C   1 
ATOM   7659  O  O   . THR C  3  228 ? -43.701 1.092   20.338  1.00 33.01  ? 228 THR C O   1 
ATOM   7660  C  CB  . THR C  3  228 ? -46.782 2.241   20.957  1.00 33.33  ? 228 THR C CB  1 
ATOM   7661  O  OG1 . THR C  3  228 ? -46.367 2.631   19.644  1.00 32.15  ? 228 THR C OG1 1 
ATOM   7662  C  CG2 . THR C  3  228 ? -47.451 3.406   21.671  1.00 31.46  ? 228 THR C CG2 1 
ATOM   7663  N  N   . SER C  3  229 ? -45.427 -0.323  20.487  1.00 36.33  ? 229 SER C N   1 
ATOM   7664  C  CA  . SER C  3  229 ? -44.752 -1.328  19.680  1.00 37.56  ? 229 SER C CA  1 
ATOM   7665  C  C   . SER C  3  229 ? -44.484 -0.793  18.280  1.00 37.95  ? 229 SER C C   1 
ATOM   7666  O  O   . SER C  3  229 ? -43.673 -1.343  17.547  1.00 36.94  ? 229 SER C O   1 
ATOM   7667  C  CB  . SER C  3  229 ? -45.592 -2.600  19.625  1.00 37.20  ? 229 SER C CB  1 
ATOM   7668  O  OG  . SER C  3  229 ? -46.919 -2.304  19.183  1.00 39.01  ? 229 SER C OG  1 
ATOM   7669  N  N   . ASN C  3  230 ? -45.181 0.269   17.908  1.00 40.92  ? 230 ASN C N   1 
ATOM   7670  C  CA  . ASN C  3  230 ? -45.010 0.872   16.598  1.00 46.05  ? 230 ASN C CA  1 
ATOM   7671  C  C   . ASN C  3  230 ? -44.310 2.222   16.582  1.00 38.37  ? 230 ASN C C   1 
ATOM   7672  O  O   . ASN C  3  230 ? -43.692 2.549   15.604  1.00 40.74  ? 230 ASN C O   1 
ATOM   7673  C  CB  . ASN C  3  230 ? -46.361 0.959   15.891  1.00 56.84  ? 230 ASN C CB  1 
ATOM   7674  C  CG  . ASN C  3  230 ? -46.735 -0.355  15.241  1.00 70.64  ? 230 ASN C CG  1 
ATOM   7675  O  OD1 . ASN C  3  230 ? -46.303 -0.649  14.115  1.00 80.84  ? 230 ASN C OD1 1 
ATOM   7676  N  ND2 . ASN C  3  230 ? -47.504 -1.176  15.960  1.00 74.76  ? 230 ASN C ND2 1 
ATOM   7677  N  N   . HIS C  3  231 ? -44.364 2.971   17.663  1.00 33.04  ? 231 HIS C N   1 
ATOM   7678  C  CA  . HIS C  3  231 ? -43.958 4.327   17.641  1.00 31.15  ? 231 HIS C CA  1 
ATOM   7679  C  C   . HIS C  3  231 ? -42.971 4.502   18.757  1.00 30.70  ? 231 HIS C C   1 
ATOM   7680  O  O   . HIS C  3  231 ? -43.334 4.533   19.910  1.00 29.59  ? 231 HIS C O   1 
ATOM   7681  C  CB  . HIS C  3  231 ? -45.189 5.232   17.800  1.00 31.07  ? 231 HIS C CB  1 
ATOM   7682  C  CG  . HIS C  3  231 ? -44.916 6.691   17.590  1.00 30.39  ? 231 HIS C CG  1 
ATOM   7683  N  ND1 . HIS C  3  231 ? -45.913 7.598   17.304  1.00 30.06  ? 231 HIS C ND1 1 
ATOM   7684  C  CD2 . HIS C  3  231 ? -43.761 7.397   17.607  1.00 30.83  ? 231 HIS C CD2 1 
ATOM   7685  C  CE1 . HIS C  3  231 ? -45.387 8.802   17.190  1.00 32.04  ? 231 HIS C CE1 1 
ATOM   7686  N  NE2 . HIS C  3  231 ? -44.082 8.709   17.377  1.00 31.74  ? 231 HIS C NE2 1 
ATOM   7687  N  N   . HIS C  3  232 ? -41.706 4.652   18.392  1.00 32.19  ? 232 HIS C N   1 
ATOM   7688  C  CA  . HIS C  3  232 ? -40.665 4.814   19.367  1.00 31.74  ? 232 HIS C CA  1 
ATOM   7689  C  C   . HIS C  3  232 ? -39.449 5.370   18.651  1.00 30.87  ? 232 HIS C C   1 
ATOM   7690  O  O   . HIS C  3  232 ? -38.368 4.772   18.667  1.00 28.90  ? 232 HIS C O   1 
ATOM   7691  C  CB  . HIS C  3  232 ? -40.370 3.441   20.004  1.00 33.01  ? 232 HIS C CB  1 
ATOM   7692  C  CG  . HIS C  3  232 ? -40.298 2.338   19.004  1.00 30.73  ? 232 HIS C CG  1 
ATOM   7693  N  ND1 . HIS C  3  232 ? -41.362 1.518   18.747  1.00 32.48  ? 232 HIS C ND1 1 
ATOM   7694  C  CD2 . HIS C  3  232 ? -39.316 1.954   18.161  1.00 33.11  ? 232 HIS C CD2 1 
ATOM   7695  C  CE1 . HIS C  3  232 ? -41.046 0.676   17.780  1.00 33.24  ? 232 HIS C CE1 1 
ATOM   7696  N  NE2 . HIS C  3  232 ? -39.807 0.920   17.404  1.00 32.75  ? 232 HIS C NE2 1 
ATOM   7697  N  N   . PHE C  3  233 ? -39.601 6.531   18.032  1.00 30.74  ? 233 PHE C N   1 
ATOM   7698  C  CA  . PHE C  3  233 ? -38.512 7.019   17.175  1.00 30.09  ? 233 PHE C CA  1 
ATOM   7699  C  C   . PHE C  3  233 ? -37.298 7.320   17.992  1.00 29.50  ? 233 PHE C C   1 
ATOM   7700  O  O   . PHE C  3  233 ? -36.178 7.092   17.533  1.00 31.83  ? 233 PHE C O   1 
ATOM   7701  C  CB  . PHE C  3  233 ? -38.864 8.260   16.347  1.00 30.25  ? 233 PHE C CB  1 
ATOM   7702  C  CG  . PHE C  3  233 ? -37.703 8.752   15.533  1.00 29.15  ? 233 PHE C CG  1 
ATOM   7703  C  CD1 . PHE C  3  233 ? -37.174 7.953   14.551  1.00 31.01  ? 233 PHE C CD1 1 
ATOM   7704  C  CD2 . PHE C  3  233 ? -37.099 9.946   15.810  1.00 27.38  ? 233 PHE C CD2 1 
ATOM   7705  C  CE1 . PHE C  3  233 ? -36.081 8.367   13.839  1.00 29.81  ? 233 PHE C CE1 1 
ATOM   7706  C  CE2 . PHE C  3  233 ? -36.021 10.357  15.111  1.00 27.00  ? 233 PHE C CE2 1 
ATOM   7707  C  CZ  . PHE C  3  233 ? -35.510 9.563   14.131  1.00 28.55  ? 233 PHE C CZ  1 
ATOM   7708  N  N   . GLY C  3  234 ? -37.537 7.843   19.187  1.00 28.54  ? 234 GLY C N   1 
ATOM   7709  C  CA  . GLY C  3  234 ? -36.507 8.076   20.198  1.00 29.46  ? 234 GLY C CA  1 
ATOM   7710  C  C   . GLY C  3  234 ? -35.560 6.914   20.400  1.00 30.43  ? 234 GLY C C   1 
ATOM   7711  O  O   . GLY C  3  234 ? -34.336 7.118   20.503  1.00 30.15  ? 234 GLY C O   1 
ATOM   7712  N  N   . PHE C  3  235 ? -36.119 5.698   20.437  1.00 28.40  ? 235 PHE C N   1 
ATOM   7713  C  CA  . PHE C  3  235 ? -35.311 4.501   20.514  1.00 27.81  ? 235 PHE C CA  1 
ATOM   7714  C  C   . PHE C  3  235 ? -34.572 4.217   19.211  1.00 25.93  ? 235 PHE C C   1 
ATOM   7715  O  O   . PHE C  3  235 ? -33.428 3.790   19.214  1.00 25.24  ? 235 PHE C O   1 
ATOM   7716  C  CB  . PHE C  3  235 ? -36.148 3.274   20.918  1.00 29.68  ? 235 PHE C CB  1 
ATOM   7717  C  CG  . PHE C  3  235 ? -35.324 2.040   21.106  1.00 28.71  ? 235 PHE C CG  1 
ATOM   7718  C  CD1 . PHE C  3  235 ? -34.589 1.872   22.239  1.00 31.32  ? 235 PHE C CD1 1 
ATOM   7719  C  CD2 . PHE C  3  235 ? -35.223 1.104   20.108  1.00 30.16  ? 235 PHE C CD2 1 
ATOM   7720  C  CE1 . PHE C  3  235 ? -33.786 0.744   22.402  1.00 35.84  ? 235 PHE C CE1 1 
ATOM   7721  C  CE2 . PHE C  3  235 ? -34.416 -0.005  20.243  1.00 33.10  ? 235 PHE C CE2 1 
ATOM   7722  C  CZ  . PHE C  3  235 ? -33.703 -0.203  21.402  1.00 33.77  ? 235 PHE C CZ  1 
ATOM   7723  N  N   . GLU C  3  236 ? -35.220 4.413   18.091  1.00 26.53  ? 236 GLU C N   1 
ATOM   7724  C  CA  . GLU C  3  236 ? -34.554 4.138   16.824  1.00 28.88  ? 236 GLU C CA  1 
ATOM   7725  C  C   . GLU C  3  236 ? -33.348 5.032   16.568  1.00 28.13  ? 236 GLU C C   1 
ATOM   7726  O  O   . GLU C  3  236 ? -32.309 4.574   16.085  1.00 27.70  ? 236 GLU C O   1 
ATOM   7727  C  CB  . GLU C  3  236 ? -35.521 4.299   15.688  1.00 30.38  ? 236 GLU C CB  1 
ATOM   7728  C  CG  . GLU C  3  236 ? -36.534 3.182   15.643  1.00 34.14  ? 236 GLU C CG  1 
ATOM   7729  C  CD  . GLU C  3  236 ? -37.454 3.406   14.477  1.00 38.51  ? 236 GLU C CD  1 
ATOM   7730  O  OE1 . GLU C  3  236 ? -38.538 3.987   14.687  1.00 38.64  ? 236 GLU C OE1 1 
ATOM   7731  O  OE2 . GLU C  3  236 ? -37.041 3.079   13.337  1.00 44.04  ? 236 GLU C OE2 1 
ATOM   7732  N  N   . ALA C  3  237 ? -33.506 6.301   16.913  1.00 27.49  ? 237 ALA C N   1 
ATOM   7733  C  CA  . ALA C  3  237 ? -32.459 7.273   16.759  1.00 27.67  ? 237 ALA C CA  1 
ATOM   7734  C  C   . ALA C  3  237 ? -31.264 6.912   17.629  1.00 27.05  ? 237 ALA C C   1 
ATOM   7735  O  O   . ALA C  3  237 ? -30.108 7.130   17.238  1.00 27.55  ? 237 ALA C O   1 
ATOM   7736  C  CB  . ALA C  3  237 ? -32.982 8.661   17.101  1.00 26.94  ? 237 ALA C CB  1 
ATOM   7737  N  N   . ALA C  3  238 ? -31.540 6.367   18.799  1.00 25.26  ? 238 ALA C N   1 
ATOM   7738  C  CA  . ALA C  3  238 ? -30.482 6.071   19.723  1.00 28.44  ? 238 ALA C CA  1 
ATOM   7739  C  C   . ALA C  3  238 ? -29.740 4.841   19.250  1.00 26.50  ? 238 ALA C C   1 
ATOM   7740  O  O   . ALA C  3  238 ? -28.537 4.738   19.388  1.00 26.89  ? 238 ALA C O   1 
ATOM   7741  C  CB  . ALA C  3  238 ? -31.022 5.880   21.133  1.00 31.99  ? 238 ALA C CB  1 
ATOM   7742  N  N   . ALA C  3  239 ? -30.471 3.921   18.678  1.00 26.16  ? 239 ALA C N   1 
ATOM   7743  C  CA  . ALA C  3  239 ? -29.874 2.736   18.105  1.00 27.45  ? 239 ALA C CA  1 
ATOM   7744  C  C   . ALA C  3  239 ? -29.055 3.089   16.871  1.00 26.82  ? 239 ALA C C   1 
ATOM   7745  O  O   . ALA C  3  239 ? -27.977 2.535   16.687  1.00 29.97  ? 239 ALA C O   1 
ATOM   7746  C  CB  . ALA C  3  239 ? -30.962 1.694   17.762  1.00 26.83  ? 239 ALA C CB  1 
ATOM   7747  N  N   . TRP C  3  240 ? -29.566 3.957   16.006  1.00 25.63  ? 240 TRP C N   1 
ATOM   7748  C  CA  . TRP C  3  240 ? -28.774 4.400   14.871  1.00 26.99  ? 240 TRP C CA  1 
ATOM   7749  C  C   . TRP C  3  240 ? -27.509 5.111   15.379  1.00 26.67  ? 240 TRP C C   1 
ATOM   7750  O  O   . TRP C  3  240 ? -26.421 4.855   14.911  1.00 25.53  ? 240 TRP C O   1 
ATOM   7751  C  CB  . TRP C  3  240 ? -29.527 5.363   13.942  1.00 28.71  ? 240 TRP C CB  1 
ATOM   7752  C  CG  . TRP C  3  240 ? -30.772 4.871   13.384  1.00 30.82  ? 240 TRP C CG  1 
ATOM   7753  C  CD1 . TRP C  3  240 ? -31.234 3.590   13.409  1.00 33.20  ? 240 TRP C CD1 1 
ATOM   7754  C  CD2 . TRP C  3  240 ? -31.757 5.644   12.690  1.00 32.17  ? 240 TRP C CD2 1 
ATOM   7755  N  NE1 . TRP C  3  240 ? -32.461 3.519   12.799  1.00 34.48  ? 240 TRP C NE1 1 
ATOM   7756  C  CE2 . TRP C  3  240 ? -32.798 4.763   12.332  1.00 34.49  ? 240 TRP C CE2 1 
ATOM   7757  C  CE3 . TRP C  3  240 ? -31.851 6.989   12.317  1.00 33.91  ? 240 TRP C CE3 1 
ATOM   7758  C  CZ2 . TRP C  3  240 ? -33.929 5.190   11.630  1.00 35.27  ? 240 TRP C CZ2 1 
ATOM   7759  C  CZ3 . TRP C  3  240 ? -32.973 7.418   11.623  1.00 34.31  ? 240 TRP C CZ3 1 
ATOM   7760  C  CH2 . TRP C  3  240 ? -33.987 6.526   11.276  1.00 36.81  ? 240 TRP C CH2 1 
ATOM   7761  N  N   . TYR C  3  241 ? -27.665 6.006   16.341  1.00 28.02  ? 241 TYR C N   1 
ATOM   7762  C  CA  . TYR C  3  241 ? -26.511 6.686   16.900  1.00 30.36  ? 241 TYR C CA  1 
ATOM   7763  C  C   . TYR C  3  241 ? -25.519 5.684   17.525  1.00 29.91  ? 241 TYR C C   1 
ATOM   7764  O  O   . TYR C  3  241 ? -24.297 5.860   17.449  1.00 30.05  ? 241 TYR C O   1 
ATOM   7765  C  CB  . TYR C  3  241 ? -26.949 7.734   17.921  1.00 30.51  ? 241 TYR C CB  1 
ATOM   7766  C  CG  . TYR C  3  241 ? -25.911 8.773   18.209  1.00 32.52  ? 241 TYR C CG  1 
ATOM   7767  C  CD1 . TYR C  3  241 ? -25.709 9.834   17.355  1.00 34.84  ? 241 TYR C CD1 1 
ATOM   7768  C  CD2 . TYR C  3  241 ? -25.129 8.695   19.332  1.00 35.62  ? 241 TYR C CD2 1 
ATOM   7769  C  CE1 . TYR C  3  241 ? -24.754 10.796  17.619  1.00 35.25  ? 241 TYR C CE1 1 
ATOM   7770  C  CE2 . TYR C  3  241 ? -24.176 9.653   19.618  1.00 36.75  ? 241 TYR C CE2 1 
ATOM   7771  C  CZ  . TYR C  3  241 ? -23.987 10.698  18.760  1.00 36.58  ? 241 TYR C CZ  1 
ATOM   7772  O  OH  . TYR C  3  241 ? -23.035 11.631  19.090  1.00 38.11  ? 241 TYR C OH  1 
ATOM   7773  N  N   . TRP C  3  242 ? -26.041 4.644   18.158  1.00 29.88  ? 242 TRP C N   1 
ATOM   7774  C  CA  . TRP C  3  242 ? -25.173 3.646   18.794  1.00 30.11  ? 242 TRP C CA  1 
ATOM   7775  C  C   . TRP C  3  242 ? -24.319 2.843   17.758  1.00 28.16  ? 242 TRP C C   1 
ATOM   7776  O  O   . TRP C  3  242 ? -23.127 2.678   17.919  1.00 28.31  ? 242 TRP C O   1 
ATOM   7777  C  CB  . TRP C  3  242 ? -25.981 2.721   19.707  1.00 28.32  ? 242 TRP C CB  1 
ATOM   7778  C  CG  . TRP C  3  242 ? -25.112 1.930   20.598  1.00 29.60  ? 242 TRP C CG  1 
ATOM   7779  C  CD1 . TRP C  3  242 ? -24.900 0.591   20.545  1.00 30.47  ? 242 TRP C CD1 1 
ATOM   7780  C  CD2 . TRP C  3  242 ? -24.300 2.428   21.670  1.00 31.30  ? 242 TRP C CD2 1 
ATOM   7781  N  NE1 . TRP C  3  242 ? -24.024 0.211   21.535  1.00 31.74  ? 242 TRP C NE1 1 
ATOM   7782  C  CE2 . TRP C  3  242 ? -23.634 1.322   22.236  1.00 31.88  ? 242 TRP C CE2 1 
ATOM   7783  C  CE3 . TRP C  3  242 ? -24.060 3.703   22.198  1.00 31.45  ? 242 TRP C CE3 1 
ATOM   7784  C  CZ2 . TRP C  3  242 ? -22.723 1.452   23.289  1.00 30.98  ? 242 TRP C CZ2 1 
ATOM   7785  C  CZ3 . TRP C  3  242 ? -23.163 3.827   23.271  1.00 31.22  ? 242 TRP C CZ3 1 
ATOM   7786  C  CH2 . TRP C  3  242 ? -22.508 2.702   23.794  1.00 31.07  ? 242 TRP C CH2 1 
ATOM   7787  N  N   . HIS C  3  243 ? -24.951 2.378   16.693  1.00 27.59  ? 243 HIS C N   1 
ATOM   7788  C  CA  . HIS C  3  243 ? -24.262 1.721   15.606  1.00 26.45  ? 243 HIS C CA  1 
ATOM   7789  C  C   . HIS C  3  243 ? -23.244 2.614   14.946  1.00 27.71  ? 243 HIS C C   1 
ATOM   7790  O  O   . HIS C  3  243 ? -22.205 2.133   14.550  1.00 29.40  ? 243 HIS C O   1 
ATOM   7791  C  CB  . HIS C  3  243 ? -25.258 1.249   14.573  1.00 25.30  ? 243 HIS C CB  1 
ATOM   7792  C  CG  . HIS C  3  243 ? -26.030 0.056   15.011  1.00 27.73  ? 243 HIS C CG  1 
ATOM   7793  N  ND1 . HIS C  3  243 ? -27.406 -0.007  14.951  1.00 28.27  ? 243 HIS C ND1 1 
ATOM   7794  C  CD2 . HIS C  3  243 ? -25.620 -1.116  15.542  1.00 30.19  ? 243 HIS C CD2 1 
ATOM   7795  C  CE1 . HIS C  3  243 ? -27.805 -1.184  15.386  1.00 29.18  ? 243 HIS C CE1 1 
ATOM   7796  N  NE2 . HIS C  3  243 ? -26.747 -1.861  15.790  1.00 29.36  ? 243 HIS C NE2 1 
ATOM   7797  N  N   . PHE C  3  244 ? -23.568 3.893   14.767  1.00 26.50  ? 244 PHE C N   1 
ATOM   7798  C  CA  . PHE C  3  244 ? -22.582 4.870   14.373  1.00 27.48  ? 244 PHE C CA  1 
ATOM   7799  C  C   . PHE C  3  244 ? -21.304 4.828   15.245  1.00 28.46  ? 244 PHE C C   1 
ATOM   7800  O  O   . PHE C  3  244 ? -20.193 4.784   14.737  1.00 27.91  ? 244 PHE C O   1 
ATOM   7801  C  CB  . PHE C  3  244 ? -23.222 6.267   14.379  1.00 27.14  ? 244 PHE C CB  1 
ATOM   7802  C  CG  . PHE C  3  244 ? -22.233 7.404   14.399  1.00 26.41  ? 244 PHE C CG  1 
ATOM   7803  C  CD1 . PHE C  3  244 ? -21.422 7.656   13.305  1.00 26.56  ? 244 PHE C CD1 1 
ATOM   7804  C  CD2 . PHE C  3  244 ? -22.132 8.235   15.507  1.00 27.21  ? 244 PHE C CD2 1 
ATOM   7805  C  CE1 . PHE C  3  244 ? -20.543 8.734   13.308  1.00 26.53  ? 244 PHE C CE1 1 
ATOM   7806  C  CE2 . PHE C  3  244 ? -21.233 9.304   15.523  1.00 27.36  ? 244 PHE C CE2 1 
ATOM   7807  C  CZ  . PHE C  3  244 ? -20.437 9.553   14.418  1.00 24.98  ? 244 PHE C CZ  1 
ATOM   7808  N  N   . VAL C  3  245 ? -21.475 4.849   16.555  1.00 30.53  ? 245 VAL C N   1 
ATOM   7809  C  CA  . VAL C  3  245 ? -20.342 4.866   17.483  1.00 33.05  ? 245 VAL C CA  1 
ATOM   7810  C  C   . VAL C  3  245 ? -19.498 3.601   17.335  1.00 33.73  ? 245 VAL C C   1 
ATOM   7811  O  O   . VAL C  3  245 ? -18.270 3.627   17.443  1.00 33.94  ? 245 VAL C O   1 
ATOM   7812  C  CB  . VAL C  3  245 ? -20.871 5.044   18.925  1.00 35.47  ? 245 VAL C CB  1 
ATOM   7813  C  CG1 . VAL C  3  245 ? -19.904 4.523   19.974  1.00 39.86  ? 245 VAL C CG1 1 
ATOM   7814  C  CG2 . VAL C  3  245 ? -21.179 6.510   19.164  1.00 37.40  ? 245 VAL C CG2 1 
ATOM   7815  N  N   . ASP C  3  246 ? -20.200 2.503   17.122  1.00 33.42  ? 246 ASP C N   1 
ATOM   7816  C  CA  . ASP C  3  246 ? -19.644 1.187   16.954  1.00 34.98  ? 246 ASP C CA  1 
ATOM   7817  C  C   . ASP C  3  246 ? -18.741 1.189   15.739  1.00 32.80  ? 246 ASP C C   1 
ATOM   7818  O  O   . ASP C  3  246 ? -17.603 0.786   15.793  1.00 35.68  ? 246 ASP C O   1 
ATOM   7819  C  CB  . ASP C  3  246 ? -20.826 0.250   16.741  1.00 42.00  ? 246 ASP C CB  1 
ATOM   7820  C  CG  . ASP C  3  246 ? -20.518 -1.200  16.965  1.00 49.12  ? 246 ASP C CG  1 
ATOM   7821  O  OD1 . ASP C  3  246 ? -19.350 -1.643  16.786  1.00 48.16  ? 246 ASP C OD1 1 
ATOM   7822  O  OD2 . ASP C  3  246 ? -21.534 -1.894  17.292  1.00 61.26  ? 246 ASP C OD2 1 
ATOM   7823  N  N   . VAL C  3  247 ? -19.262 1.665   14.637  1.00 31.22  ? 247 VAL C N   1 
ATOM   7824  C  CA  . VAL C  3  247 ? -18.582 1.601   13.379  1.00 31.95  ? 247 VAL C CA  1 
ATOM   7825  C  C   . VAL C  3  247 ? -17.359 2.502   13.395  1.00 31.07  ? 247 VAL C C   1 
ATOM   7826  O  O   . VAL C  3  247 ? -16.304 2.122   12.884  1.00 28.36  ? 247 VAL C O   1 
ATOM   7827  C  CB  . VAL C  3  247 ? -19.547 1.987   12.250  1.00 36.50  ? 247 VAL C CB  1 
ATOM   7828  C  CG1 . VAL C  3  247 ? -18.809 2.169   10.945  1.00 41.87  ? 247 VAL C CG1 1 
ATOM   7829  C  CG2 . VAL C  3  247 ? -20.620 0.905   12.066  1.00 37.02  ? 247 VAL C CG2 1 
ATOM   7830  N  N   . VAL C  3  248 ? -17.497 3.682   13.999  1.00 28.71  ? 248 VAL C N   1 
ATOM   7831  C  CA  . VAL C  3  248 ? -16.379 4.602   14.142  1.00 28.10  ? 248 VAL C CA  1 
ATOM   7832  C  C   . VAL C  3  248 ? -15.265 3.928   14.925  1.00 29.71  ? 248 VAL C C   1 
ATOM   7833  O  O   . VAL C  3  248 ? -14.093 4.137   14.617  1.00 30.75  ? 248 VAL C O   1 
ATOM   7834  C  CB  . VAL C  3  248 ? -16.788 5.935   14.806  1.00 27.88  ? 248 VAL C CB  1 
ATOM   7835  C  CG1 . VAL C  3  248 ? -15.566 6.770   15.178  1.00 28.09  ? 248 VAL C CG1 1 
ATOM   7836  C  CG2 . VAL C  3  248 ? -17.698 6.728   13.880  1.00 27.14  ? 248 VAL C CG2 1 
ATOM   7837  N  N   . TRP C  3  249 ? -15.619 3.130   15.937  1.00 30.26  ? 249 TRP C N   1 
ATOM   7838  C  CA  . TRP C  3  249 ? -14.604 2.394   16.682  1.00 28.75  ? 249 TRP C CA  1 
ATOM   7839  C  C   . TRP C  3  249 ? -13.870 1.413   15.784  1.00 28.35  ? 249 TRP C C   1 
ATOM   7840  O  O   . TRP C  3  249 ? -12.649 1.340   15.836  1.00 25.14  ? 249 TRP C O   1 
ATOM   7841  C  CB  . TRP C  3  249 ? -15.163 1.644   17.913  1.00 29.11  ? 249 TRP C CB  1 
ATOM   7842  C  CG  . TRP C  3  249 ? -14.079 0.781   18.530  1.00 29.65  ? 249 TRP C CG  1 
ATOM   7843  C  CD1 . TRP C  3  249 ? -13.904 -0.562  18.373  1.00 28.64  ? 249 TRP C CD1 1 
ATOM   7844  C  CD2 . TRP C  3  249 ? -12.958 1.245   19.268  1.00 29.51  ? 249 TRP C CD2 1 
ATOM   7845  N  NE1 . TRP C  3  249 ? -12.769 -0.971  19.029  1.00 29.83  ? 249 TRP C NE1 1 
ATOM   7846  C  CE2 . TRP C  3  249 ? -12.161 0.121   19.569  1.00 29.68  ? 249 TRP C CE2 1 
ATOM   7847  C  CE3 . TRP C  3  249 ? -12.562 2.502   19.727  1.00 30.04  ? 249 TRP C CE3 1 
ATOM   7848  C  CZ2 . TRP C  3  249 ? -11.004 0.212   20.295  1.00 30.43  ? 249 TRP C CZ2 1 
ATOM   7849  C  CZ3 . TRP C  3  249 ? -11.403 2.600   20.448  1.00 31.82  ? 249 TRP C CZ3 1 
ATOM   7850  C  CH2 . TRP C  3  249 ? -10.627 1.460   20.729  1.00 31.28  ? 249 TRP C CH2 1 
ATOM   7851  N  N   . LEU C  3  250 ? -14.611 0.628   15.005  1.00 29.75  ? 250 LEU C N   1 
ATOM   7852  C  CA  . LEU C  3  250 ? -13.980 -0.331  14.090  1.00 31.83  ? 250 LEU C CA  1 
ATOM   7853  C  C   . LEU C  3  250 ? -12.944 0.356   13.217  1.00 30.90  ? 250 LEU C C   1 
ATOM   7854  O  O   . LEU C  3  250 ? -11.851 -0.158  13.042  1.00 33.09  ? 250 LEU C O   1 
ATOM   7855  C  CB  . LEU C  3  250 ? -15.007 -1.039  13.210  1.00 32.07  ? 250 LEU C CB  1 
ATOM   7856  C  CG  . LEU C  3  250 ? -15.880 -1.970  14.021  1.00 35.94  ? 250 LEU C CG  1 
ATOM   7857  C  CD1 . LEU C  3  250 ? -16.999 -2.527  13.157  1.00 38.43  ? 250 LEU C CD1 1 
ATOM   7858  C  CD2 . LEU C  3  250 ? -15.041 -3.093  14.601  1.00 38.30  ? 250 LEU C CD2 1 
ATOM   7859  N  N   . PHE C  3  251 ? -13.278 1.519   12.685  1.00 31.28  ? 251 PHE C N   1 
ATOM   7860  C  CA  . PHE C  3  251 ? -12.339 2.258   11.859  1.00 34.04  ? 251 PHE C CA  1 
ATOM   7861  C  C   . PHE C  3  251 ? -11.096 2.733   12.617  1.00 31.81  ? 251 PHE C C   1 
ATOM   7862  O  O   . PHE C  3  251 ? -9.982  2.625   12.107  1.00 33.63  ? 251 PHE C O   1 
ATOM   7863  C  CB  . PHE C  3  251 ? -13.035 3.430   11.190  1.00 38.24  ? 251 PHE C CB  1 
ATOM   7864  C  CG  . PHE C  3  251 ? -13.714 3.047   9.928   1.00 45.55  ? 251 PHE C CG  1 
ATOM   7865  C  CD1 . PHE C  3  251 ? -12.978 2.934   8.746   1.00 53.56  ? 251 PHE C CD1 1 
ATOM   7866  C  CD2 . PHE C  3  251 ? -15.089 2.772   9.902   1.00 51.44  ? 251 PHE C CD2 1 
ATOM   7867  C  CE1 . PHE C  3  251 ? -13.606 2.562   7.560   1.00 61.08  ? 251 PHE C CE1 1 
ATOM   7868  C  CE2 . PHE C  3  251 ? -15.723 2.420   8.719   1.00 53.76  ? 251 PHE C CE2 1 
ATOM   7869  C  CZ  . PHE C  3  251 ? -14.984 2.301   7.548   1.00 57.85  ? 251 PHE C CZ  1 
ATOM   7870  N  N   . LEU C  3  252 ? -11.299 3.289   13.806  1.00 29.09  ? 252 LEU C N   1 
ATOM   7871  C  CA  . LEU C  3  252 ? -10.203 3.605   14.724  1.00 30.04  ? 252 LEU C CA  1 
ATOM   7872  C  C   . LEU C  3  252 ? -9.321  2.401   15.028  1.00 31.26  ? 252 LEU C C   1 
ATOM   7873  O  O   . LEU C  3  252 ? -8.086  2.488   14.948  1.00 30.85  ? 252 LEU C O   1 
ATOM   7874  C  CB  . LEU C  3  252 ? -10.718 4.185   16.036  1.00 29.09  ? 252 LEU C CB  1 
ATOM   7875  C  CG  . LEU C  3  252 ? -11.263 5.604   15.945  1.00 29.86  ? 252 LEU C CG  1 
ATOM   7876  C  CD1 . LEU C  3  252 ? -11.840 5.992   17.288  1.00 30.97  ? 252 LEU C CD1 1 
ATOM   7877  C  CD2 . LEU C  3  252 ? -10.190 6.607   15.581  1.00 30.99  ? 252 LEU C CD2 1 
ATOM   7878  N  N   . TYR C  3  253 ? -9.962  1.288   15.352  1.00 32.65  ? 253 TYR C N   1 
ATOM   7879  C  CA  . TYR C  3  253 ? -9.260  0.080   15.745  1.00 35.09  ? 253 TYR C CA  1 
ATOM   7880  C  C   . TYR C  3  253 ? -8.330  -0.356  14.620  1.00 34.43  ? 253 TYR C C   1 
ATOM   7881  O  O   . TYR C  3  253 ? -7.113  -0.512  14.819  1.00 31.84  ? 253 TYR C O   1 
ATOM   7882  C  CB  . TYR C  3  253 ? -10.244 -1.048  16.152  1.00 35.57  ? 253 TYR C CB  1 
ATOM   7883  C  CG  . TYR C  3  253 ? -9.514  -2.314  16.550  1.00 35.69  ? 253 TYR C CG  1 
ATOM   7884  C  CD1 . TYR C  3  253 ? -8.714  -2.356  17.703  1.00 35.89  ? 253 TYR C CD1 1 
ATOM   7885  C  CD2 . TYR C  3  253 ? -9.589  -3.453  15.759  1.00 38.06  ? 253 TYR C CD2 1 
ATOM   7886  C  CE1 . TYR C  3  253 ? -8.020  -3.497  18.049  1.00 35.28  ? 253 TYR C CE1 1 
ATOM   7887  C  CE2 . TYR C  3  253 ? -8.899  -4.605  16.100  1.00 41.50  ? 253 TYR C CE2 1 
ATOM   7888  C  CZ  . TYR C  3  253 ? -8.114  -4.619  17.239  1.00 40.70  ? 253 TYR C CZ  1 
ATOM   7889  O  OH  . TYR C  3  253 ? -7.434  -5.769  17.544  1.00 43.25  ? 253 TYR C OH  1 
ATOM   7890  N  N   . VAL C  3  254 ? -8.902  -0.477  13.435  1.00 33.00  ? 254 VAL C N   1 
ATOM   7891  C  CA  . VAL C  3  254 ? -8.136  -0.894  12.286  1.00 36.15  ? 254 VAL C CA  1 
ATOM   7892  C  C   . VAL C  3  254 ? -7.026  0.129   11.935  1.00 36.95  ? 254 VAL C C   1 
ATOM   7893  O  O   . VAL C  3  254 ? -5.903  -0.272  11.665  1.00 33.78  ? 254 VAL C O   1 
ATOM   7894  C  CB  . VAL C  3  254 ? -9.043  -1.186  11.066  1.00 37.12  ? 254 VAL C CB  1 
ATOM   7895  C  CG1 . VAL C  3  254 ? -8.196  -1.524  9.856   1.00 39.87  ? 254 VAL C CG1 1 
ATOM   7896  C  CG2 . VAL C  3  254 ? -9.953  -2.373  11.345  1.00 39.06  ? 254 VAL C CG2 1 
ATOM   7897  N  N   . SER C  3  255 ? -7.344  1.426   11.975  1.00 36.56  ? 255 SER C N   1 
ATOM   7898  C  CA  . SER C  3  255 ? -6.449  2.471   11.488  1.00 35.85  ? 255 SER C CA  1 
ATOM   7899  C  C   . SER C  3  255 ? -5.353  2.815   12.465  1.00 37.15  ? 255 SER C C   1 
ATOM   7900  O  O   . SER C  3  255 ? -4.183  2.839   12.122  1.00 37.04  ? 255 SER C O   1 
ATOM   7901  C  CB  . SER C  3  255 ? -7.238  3.751   11.215  1.00 35.17  ? 255 SER C CB  1 
ATOM   7902  O  OG  . SER C  3  255 ? -8.196  3.536   10.197  1.00 36.11  ? 255 SER C OG  1 
ATOM   7903  N  N   . ILE C  3  256 ? -5.744  3.168   13.675  1.00 39.65  ? 256 ILE C N   1 
ATOM   7904  C  CA  . ILE C  3  256 ? -4.807  3.737   14.623  1.00 38.42  ? 256 ILE C CA  1 
ATOM   7905  C  C   . ILE C  3  256 ? -4.157  2.654   15.469  1.00 38.91  ? 256 ILE C C   1 
ATOM   7906  O  O   . ILE C  3  256 ? -2.947  2.711   15.700  1.00 40.92  ? 256 ILE C O   1 
ATOM   7907  C  CB  . ILE C  3  256 ? -5.493  4.793   15.511  1.00 38.42  ? 256 ILE C CB  1 
ATOM   7908  C  CG1 . ILE C  3  256 ? -5.908  5.974   14.613  1.00 40.47  ? 256 ILE C CG1 1 
ATOM   7909  C  CG2 . ILE C  3  256 ? -4.588  5.203   16.683  1.00 35.51  ? 256 ILE C CG2 1 
ATOM   7910  C  CD1 . ILE C  3  256 ? -6.469  7.192   15.320  1.00 39.65  ? 256 ILE C CD1 1 
ATOM   7911  N  N   . TYR C  3  257 ? -4.938  1.688   15.948  1.00 37.12  ? 257 TYR C N   1 
ATOM   7912  C  CA  . TYR C  3  257 ? -4.381  0.694   16.867  1.00 38.61  ? 257 TYR C CA  1 
ATOM   7913  C  C   . TYR C  3  257 ? -3.572  -0.384  16.149  1.00 40.21  ? 257 TYR C C   1 
ATOM   7914  O  O   . TYR C  3  257 ? -2.465  -0.687  16.553  1.00 40.39  ? 257 TYR C O   1 
ATOM   7915  C  CB  . TYR C  3  257 ? -5.452  0.051   17.734  1.00 34.88  ? 257 TYR C CB  1 
ATOM   7916  C  CG  . TYR C  3  257 ? -5.989  0.944   18.815  1.00 33.34  ? 257 TYR C CG  1 
ATOM   7917  C  CD1 . TYR C  3  257 ? -7.015  1.837   18.540  1.00 34.78  ? 257 TYR C CD1 1 
ATOM   7918  C  CD2 . TYR C  3  257 ? -5.534  0.863   20.122  1.00 33.13  ? 257 TYR C CD2 1 
ATOM   7919  C  CE1 . TYR C  3  257 ? -7.563  2.636   19.530  1.00 34.88  ? 257 TYR C CE1 1 
ATOM   7920  C  CE2 . TYR C  3  257 ? -6.067  1.688   21.121  1.00 33.13  ? 257 TYR C CE2 1 
ATOM   7921  C  CZ  . TYR C  3  257 ? -7.092  2.566   20.806  1.00 33.66  ? 257 TYR C CZ  1 
ATOM   7922  O  OH  . TYR C  3  257 ? -7.662  3.417   21.722  1.00 35.64  ? 257 TYR C OH  1 
ATOM   7923  N  N   . TRP C  3  258 ? -4.126  -0.918  15.073  1.00 44.70  ? 258 TRP C N   1 
ATOM   7924  C  CA  . TRP C  3  258 ? -3.620  -2.111  14.443  1.00 48.47  ? 258 TRP C CA  1 
ATOM   7925  C  C   . TRP C  3  258 ? -2.579  -1.759  13.394  1.00 49.40  ? 258 TRP C C   1 
ATOM   7926  O  O   . TRP C  3  258 ? -1.403  -2.056  13.574  1.00 52.94  ? 258 TRP C O   1 
ATOM   7927  C  CB  . TRP C  3  258 ? -4.812  -2.918  13.886  1.00 53.94  ? 258 TRP C CB  1 
ATOM   7928  C  CG  . TRP C  3  258 ? -4.517  -4.308  13.472  1.00 65.64  ? 258 TRP C CG  1 
ATOM   7929  C  CD1 . TRP C  3  258 ? -3.367  -5.007  13.682  1.00 71.13  ? 258 TRP C CD1 1 
ATOM   7930  C  CD2 . TRP C  3  258 ? -5.398  -5.191  12.770  1.00 81.10  ? 258 TRP C CD2 1 
ATOM   7931  N  NE1 . TRP C  3  258 ? -3.467  -6.257  13.145  1.00 80.93  ? 258 TRP C NE1 1 
ATOM   7932  C  CE2 . TRP C  3  258 ? -4.706  -6.404  12.580  1.00 85.54  ? 258 TRP C CE2 1 
ATOM   7933  C  CE3 . TRP C  3  258 ? -6.705  -5.069  12.264  1.00 86.92  ? 258 TRP C CE3 1 
ATOM   7934  C  CZ2 . TRP C  3  258 ? -5.278  -7.504  11.912  1.00 86.10  ? 258 TRP C CZ2 1 
ATOM   7935  C  CZ3 . TRP C  3  258 ? -7.277  -6.164  11.596  1.00 86.23  ? 258 TRP C CZ3 1 
ATOM   7936  C  CH2 . TRP C  3  258 ? -6.560  -7.364  11.432  1.00 88.52  ? 258 TRP C CH2 1 
ATOM   7937  N  N   . TRP C  3  259 ? -2.992  -1.099  12.319  1.00 57.02  ? 259 TRP C N   1 
ATOM   7938  C  CA  . TRP C  3  259 ? -2.095  -0.795  11.191  1.00 62.58  ? 259 TRP C CA  1 
ATOM   7939  C  C   . TRP C  3  259 ? -1.040  0.259   11.574  1.00 60.83  ? 259 TRP C C   1 
ATOM   7940  O  O   . TRP C  3  259 ? 0.099   0.206   11.113  1.00 66.88  ? 259 TRP C O   1 
ATOM   7941  C  CB  . TRP C  3  259 ? -2.900  -0.379  9.932   1.00 71.30  ? 259 TRP C CB  1 
ATOM   7942  C  CG  . TRP C  3  259 ? -2.053  0.207   8.813   1.00 85.39  ? 259 TRP C CG  1 
ATOM   7943  C  CD1 . TRP C  3  259 ? -1.514  -0.456  7.734   1.00 87.37  ? 259 TRP C CD1 1 
ATOM   7944  C  CD2 . TRP C  3  259 ? -1.640  1.578   8.686   1.00 90.39  ? 259 TRP C CD2 1 
ATOM   7945  N  NE1 . TRP C  3  259 ? -0.794  0.429   6.949   1.00 89.25  ? 259 TRP C NE1 1 
ATOM   7946  C  CE2 . TRP C  3  259 ? -0.855  1.677   7.516   1.00 89.61  ? 259 TRP C CE2 1 
ATOM   7947  C  CE3 . TRP C  3  259 ? -1.847  2.730   9.462   1.00 87.55  ? 259 TRP C CE3 1 
ATOM   7948  C  CZ2 . TRP C  3  259 ? -0.291  2.881   7.104   1.00 89.88  ? 259 TRP C CZ2 1 
ATOM   7949  C  CZ3 . TRP C  3  259 ? -1.283  3.918   9.054   1.00 85.40  ? 259 TRP C CZ3 1 
ATOM   7950  C  CH2 . TRP C  3  259 ? -0.522  3.991   7.885   1.00 88.66  ? 259 TRP C CH2 1 
ATOM   7951  N  N   . GLY C  3  260 ? -1.411  1.201   12.427  1.00 58.27  ? 260 GLY C N   1 
ATOM   7952  C  CA  . GLY C  3  260 ? -0.487  2.228   12.898  1.00 62.52  ? 260 GLY C CA  1 
ATOM   7953  C  C   . GLY C  3  260 ? 0.244   1.874   14.177  1.00 65.44  ? 260 GLY C C   1 
ATOM   7954  O  O   . GLY C  3  260 ? 0.648   2.777   14.912  1.00 71.09  ? 260 GLY C O   1 
ATOM   7955  N  N   . SER C  3  261 ? 0.369   0.575   14.467  1.00 67.73  ? 261 SER C N   1 
ATOM   7956  C  CA  . SER C  3  261 ? 1.332   0.052   15.443  1.00 66.73  ? 261 SER C CA  1 
ATOM   7957  C  C   . SER C  3  261 ? 2.554   -0.455  14.670  1.00 65.70  ? 261 SER C C   1 
ATOM   7958  O  O   . SER C  3  261 ? 3.560   -0.830  15.293  1.00 60.80  ? 261 SER C O   1 
ATOM   7959  C  CB  . SER C  3  261 ? 0.715   -1.087  16.286  1.00 70.08  ? 261 SER C CB  1 
ATOM   7960  O  OG  . SER C  3  261 ? 0.140   -2.135  15.481  1.00 64.69  ? 261 SER C OG  1 
ATOM   7961  O  OXT . SER C  3  261 ? 2.547   -0.506  13.419  1.00 57.22  ? 261 SER C OXT 1 
ATOM   7962  N  N   . SER D  4  4   ? -63.066 50.588  -10.280 1.00 88.86  ? 4   SER D N   1 
ATOM   7963  C  CA  . SER D  4  4   ? -63.205 51.670  -9.257  1.00 94.53  ? 4   SER D CA  1 
ATOM   7964  C  C   . SER D  4  4   ? -62.010 51.644  -8.303  1.00 88.34  ? 4   SER D C   1 
ATOM   7965  O  O   . SER D  4  4   ? -60.964 52.243  -8.616  1.00 92.28  ? 4   SER D O   1 
ATOM   7966  C  CB  . SER D  4  4   ? -64.562 51.565  -8.507  1.00 101.43 ? 4   SER D CB  1 
ATOM   7967  O  OG  . SER D  4  4   ? -64.637 52.311  -7.277  1.00 93.17  ? 4   SER D OG  1 
ATOM   7968  N  N   . VAL D  4  5   ? -62.167 50.939  -7.173  1.00 71.40  ? 5   VAL D N   1 
ATOM   7969  C  CA  . VAL D  4  5   ? -61.251 51.031  -6.045  1.00 60.31  ? 5   VAL D CA  1 
ATOM   7970  C  C   . VAL D  4  5   ? -60.919 49.635  -5.571  1.00 50.93  ? 5   VAL D C   1 
ATOM   7971  O  O   . VAL D  4  5   ? -61.713 48.989  -4.925  1.00 50.04  ? 5   VAL D O   1 
ATOM   7972  C  CB  . VAL D  4  5   ? -61.814 51.906  -4.897  1.00 59.45  ? 5   VAL D CB  1 
ATOM   7973  C  CG1 . VAL D  4  5   ? -60.934 51.829  -3.649  1.00 54.02  ? 5   VAL D CG1 1 
ATOM   7974  C  CG2 . VAL D  4  5   ? -61.947 53.361  -5.361  1.00 59.82  ? 5   VAL D CG2 1 
ATOM   7975  N  N   . VAL D  4  6   ? -59.702 49.220  -5.897  1.00 53.89  ? 6   VAL D N   1 
ATOM   7976  C  CA  . VAL D  4  6   ? -59.159 47.925  -5.546  1.00 53.46  ? 6   VAL D CA  1 
ATOM   7977  C  C   . VAL D  4  6   ? -58.774 48.007  -4.083  1.00 53.70  ? 6   VAL D C   1 
ATOM   7978  O  O   . VAL D  4  6   ? -58.283 49.046  -3.608  1.00 50.71  ? 6   VAL D O   1 
ATOM   7979  C  CB  . VAL D  4  6   ? -57.915 47.568  -6.411  1.00 53.99  ? 6   VAL D CB  1 
ATOM   7980  C  CG1 . VAL D  4  6   ? -57.452 46.128  -6.140  1.00 56.17  ? 6   VAL D CG1 1 
ATOM   7981  C  CG2 . VAL D  4  6   ? -58.226 47.760  -7.893  1.00 53.92  ? 6   VAL D CG2 1 
ATOM   7982  N  N   . LYS D  4  7   ? -59.019 46.910  -3.372  1.00 60.35  ? 7   LYS D N   1 
ATOM   7983  C  CA  . LYS D  4  7   ? -58.678 46.789  -1.954  1.00 63.49  ? 7   LYS D CA  1 
ATOM   7984  C  C   . LYS D  4  7   ? -57.574 45.737  -1.762  1.00 66.55  ? 7   LYS D C   1 
ATOM   7985  O  O   . LYS D  4  7   ? -57.487 44.763  -2.543  1.00 58.93  ? 7   LYS D O   1 
ATOM   7986  C  CB  . LYS D  4  7   ? -59.919 46.425  -1.154  1.00 66.44  ? 7   LYS D CB  1 
ATOM   7987  C  CG  . LYS D  4  7   ? -61.157 47.208  -1.579  1.00 69.46  ? 7   LYS D CG  1 
ATOM   7988  C  CD  . LYS D  4  7   ? -62.065 47.561  -0.408  1.00 69.02  ? 7   LYS D CD  1 
ATOM   7989  C  CE  . LYS D  4  7   ? -63.249 48.374  -0.894  1.00 68.96  ? 7   LYS D CE  1 
ATOM   7990  N  NZ  . LYS D  4  7   ? -64.354 47.506  -1.403  1.00 69.09  ? 7   LYS D NZ  1 
ATOM   7991  N  N   . SER D  4  8   ? -56.722 45.972  -0.751  1.00 63.90  ? 8   SER D N   1 
ATOM   7992  C  CA  . SER D  4  8   ? -55.664 45.021  -0.350  1.00 64.78  ? 8   SER D CA  1 
ATOM   7993  C  C   . SER D  4  8   ? -56.220 43.651  0.049   1.00 59.00  ? 8   SER D C   1 
ATOM   7994  O  O   . SER D  4  8   ? -55.613 42.626  -0.234  1.00 52.99  ? 8   SER D O   1 
ATOM   7995  C  CB  . SER D  4  8   ? -54.844 45.588  0.807   1.00 62.54  ? 8   SER D CB  1 
ATOM   7996  O  OG  . SER D  4  8   ? -54.061 46.647  0.328   1.00 65.84  ? 8   SER D OG  1 
ATOM   7997  N  N   . GLU D  4  9   ? -57.400 43.670  0.666   1.00 57.49  ? 9   GLU D N   1 
ATOM   7998  C  CA  . GLU D  4  9   ? -58.090 42.483  1.167   1.00 58.84  ? 9   GLU D CA  1 
ATOM   7999  C  C   . GLU D  4  9   ? -58.534 41.537  0.041   1.00 53.79  ? 9   GLU D C   1 
ATOM   8000  O  O   . GLU D  4  9   ? -58.918 40.398  0.327   1.00 55.50  ? 9   GLU D O   1 
ATOM   8001  C  CB  . GLU D  4  9   ? -59.349 42.872  1.977   1.00 65.02  ? 9   GLU D CB  1 
ATOM   8002  C  CG  . GLU D  4  9   ? -59.203 43.994  3.017   1.00 75.96  ? 9   GLU D CG  1 
ATOM   8003  C  CD  . GLU D  4  9   ? -59.600 45.407  2.527   1.00 79.60  ? 9   GLU D CD  1 
ATOM   8004  O  OE1 . GLU D  4  9   ? -58.743 46.089  1.909   1.00 72.78  ? 9   GLU D OE1 1 
ATOM   8005  O  OE2 . GLU D  4  9   ? -60.739 45.864  2.821   1.00 83.43  ? 9   GLU D OE2 1 
ATOM   8006  N  N   . ASP D  4  10  ? -58.516 42.012  -1.215  1.00 46.16  ? 10  ASP D N   1 
ATOM   8007  C  CA  . ASP D  4  10  ? -59.038 41.269  -2.368  1.00 44.97  ? 10  ASP D CA  1 
ATOM   8008  C  C   . ASP D  4  10  ? -57.972 40.488  -3.129  1.00 41.86  ? 10  ASP D C   1 
ATOM   8009  O  O   . ASP D  4  10  ? -58.190 40.112  -4.283  1.00 39.46  ? 10  ASP D O   1 
ATOM   8010  C  CB  . ASP D  4  10  ? -59.791 42.231  -3.327  1.00 50.57  ? 10  ASP D CB  1 
ATOM   8011  C  CG  . ASP D  4  10  ? -61.105 42.790  -2.720  1.00 49.94  ? 10  ASP D CG  1 
ATOM   8012  O  OD1 . ASP D  4  10  ? -61.848 42.034  -2.036  1.00 51.00  ? 10  ASP D OD1 1 
ATOM   8013  O  OD2 . ASP D  4  10  ? -61.372 43.989  -2.928  1.00 45.41  ? 10  ASP D OD2 1 
ATOM   8014  N  N   . TYR D  4  11  ? -56.853 40.184  -2.455  1.00 39.24  ? 11  TYR D N   1 
ATOM   8015  C  CA  . TYR D  4  11  ? -55.743 39.471  -3.055  1.00 36.52  ? 11  TYR D CA  1 
ATOM   8016  C  C   . TYR D  4  11  ? -56.144 38.099  -3.602  1.00 35.22  ? 11  TYR D C   1 
ATOM   8017  O  O   . TYR D  4  11  ? -55.548 37.627  -4.593  1.00 38.31  ? 11  TYR D O   1 
ATOM   8018  C  CB  . TYR D  4  11  ? -54.552 39.348  -2.076  1.00 36.84  ? 11  TYR D CB  1 
ATOM   8019  C  CG  . TYR D  4  11  ? -54.791 38.442  -0.890  1.00 39.24  ? 11  TYR D CG  1 
ATOM   8020  C  CD1 . TYR D  4  11  ? -54.704 37.072  -1.028  1.00 36.98  ? 11  TYR D CD1 1 
ATOM   8021  C  CD2 . TYR D  4  11  ? -55.099 38.965  0.382   1.00 39.61  ? 11  TYR D CD2 1 
ATOM   8022  C  CE1 . TYR D  4  11  ? -54.950 36.245  0.034   1.00 41.78  ? 11  TYR D CE1 1 
ATOM   8023  C  CE2 . TYR D  4  11  ? -55.311 38.134  1.460   1.00 38.20  ? 11  TYR D CE2 1 
ATOM   8024  C  CZ  . TYR D  4  11  ? -55.243 36.772  1.272   1.00 42.47  ? 11  TYR D CZ  1 
ATOM   8025  O  OH  . TYR D  4  11  ? -55.461 35.872  2.293   1.00 50.22  ? 11  TYR D OH  1 
ATOM   8026  N  N   . ALA D  4  12  ? -57.113 37.442  -2.961  1.00 31.99  ? 12  ALA D N   1 
ATOM   8027  C  CA  . ALA D  4  12  ? -57.601 36.128  -3.456  1.00 31.53  ? 12  ALA D CA  1 
ATOM   8028  C  C   . ALA D  4  12  ? -58.587 36.193  -4.639  1.00 31.32  ? 12  ALA D C   1 
ATOM   8029  O  O   . ALA D  4  12  ? -58.881 35.160  -5.247  1.00 31.29  ? 12  ALA D O   1 
ATOM   8030  C  CB  . ALA D  4  12  ? -58.175 35.299  -2.324  1.00 30.37  ? 12  ALA D CB  1 
ATOM   8031  N  N   . LEU D  4  13  ? -59.067 37.388  -4.980  1.00 31.80  ? 13  LEU D N   1 
ATOM   8032  C  CA  . LEU D  4  13  ? -60.015 37.545  -6.069  1.00 33.79  ? 13  LEU D CA  1 
ATOM   8033  C  C   . LEU D  4  13  ? -59.245 37.885  -7.335  1.00 35.75  ? 13  LEU D C   1 
ATOM   8034  O  O   . LEU D  4  13  ? -58.154 38.424  -7.260  1.00 38.32  ? 13  LEU D O   1 
ATOM   8035  C  CB  . LEU D  4  13  ? -61.021 38.651  -5.748  1.00 33.64  ? 13  LEU D CB  1 
ATOM   8036  C  CG  . LEU D  4  13  ? -61.909 38.411  -4.521  1.00 34.00  ? 13  LEU D CG  1 
ATOM   8037  C  CD1 . LEU D  4  13  ? -62.740 39.629  -4.168  1.00 34.71  ? 13  LEU D CD1 1 
ATOM   8038  C  CD2 . LEU D  4  13  ? -62.828 37.217  -4.737  1.00 35.84  ? 13  LEU D CD2 1 
ATOM   8039  N  N   . PRO D  4  14  ? -59.810 37.574  -8.503  1.00 36.62  ? 14  PRO D N   1 
ATOM   8040  C  CA  . PRO D  4  14  ? -59.157 37.989  -9.712  1.00 39.78  ? 14  PRO D CA  1 
ATOM   8041  C  C   . PRO D  4  14  ? -59.038 39.499  -9.764  1.00 41.48  ? 14  PRO D C   1 
ATOM   8042  O  O   . PRO D  4  14  ? -59.877 40.208  -9.204  1.00 44.98  ? 14  PRO D O   1 
ATOM   8043  C  CB  . PRO D  4  14  ? -60.107 37.503  -10.821 1.00 41.87  ? 14  PRO D CB  1 
ATOM   8044  C  CG  . PRO D  4  14  ? -60.983 36.482  -10.191 1.00 41.93  ? 14  PRO D CG  1 
ATOM   8045  C  CD  . PRO D  4  14  ? -61.128 36.978  -8.784  1.00 40.97  ? 14  PRO D CD  1 
ATOM   8046  N  N   . SER D  4  15  ? -57.986 39.974  -10.417 1.00 41.01  ? 15  SER D N   1 
ATOM   8047  C  CA  . SER D  4  15  ? -57.675 41.387  -10.430 1.00 41.06  ? 15  SER D CA  1 
ATOM   8048  C  C   . SER D  4  15  ? -57.366 41.838  -11.843 1.00 38.00  ? 15  SER D C   1 
ATOM   8049  O  O   . SER D  4  15  ? -57.099 41.023  -12.730 1.00 37.65  ? 15  SER D O   1 
ATOM   8050  C  CB  . SER D  4  15  ? -56.514 41.702  -9.490  1.00 43.09  ? 15  SER D CB  1 
ATOM   8051  O  OG  . SER D  4  15  ? -55.355 41.086  -9.963  1.00 52.11  ? 15  SER D OG  1 
ATOM   8052  N  N   . TYR D  4  16  ? -57.461 43.151  -12.024 1.00 35.07  ? 16  TYR D N   1 
ATOM   8053  C  CA  . TYR D  4  16  ? -57.305 43.767  -13.300 1.00 34.38  ? 16  TYR D CA  1 
ATOM   8054  C  C   . TYR D  4  16  ? -55.825 44.017  -13.481 1.00 35.38  ? 16  TYR D C   1 
ATOM   8055  O  O   . TYR D  4  16  ? -55.134 44.396  -12.525 1.00 37.06  ? 16  TYR D O   1 
ATOM   8056  C  CB  . TYR D  4  16  ? -58.053 45.109  -13.353 1.00 34.10  ? 16  TYR D CB  1 
ATOM   8057  C  CG  . TYR D  4  16  ? -57.852 45.774  -14.691 1.00 34.47  ? 16  TYR D CG  1 
ATOM   8058  C  CD1 . TYR D  4  16  ? -58.669 45.432  -15.794 1.00 34.59  ? 16  TYR D CD1 1 
ATOM   8059  C  CD2 . TYR D  4  16  ? -56.767 46.649  -14.905 1.00 30.30  ? 16  TYR D CD2 1 
ATOM   8060  C  CE1 . TYR D  4  16  ? -58.430 45.982  -17.051 1.00 33.08  ? 16  TYR D CE1 1 
ATOM   8061  C  CE2 . TYR D  4  16  ? -56.540 47.207  -16.148 1.00 29.88  ? 16  TYR D CE2 1 
ATOM   8062  C  CZ  . TYR D  4  16  ? -57.363 46.863  -17.207 1.00 30.42  ? 16  TYR D CZ  1 
ATOM   8063  O  OH  . TYR D  4  16  ? -57.170 47.436  -18.404 1.00 30.11  ? 16  TYR D OH  1 
ATOM   8064  N  N   . VAL D  4  17  ? -55.337 43.837  -14.706 1.00 35.71  ? 17  VAL D N   1 
ATOM   8065  C  CA  . VAL D  4  17  ? -53.970 44.226  -15.022 1.00 33.72  ? 17  VAL D CA  1 
ATOM   8066  C  C   . VAL D  4  17  ? -53.822 44.641  -16.483 1.00 33.59  ? 17  VAL D C   1 
ATOM   8067  O  O   . VAL D  4  17  ? -54.468 44.096  -17.390 1.00 33.85  ? 17  VAL D O   1 
ATOM   8068  C  CB  . VAL D  4  17  ? -52.983 43.114  -14.614 1.00 35.39  ? 17  VAL D CB  1 
ATOM   8069  C  CG1 . VAL D  4  17  ? -53.054 41.918  -15.546 1.00 35.85  ? 17  VAL D CG1 1 
ATOM   8070  C  CG2 . VAL D  4  17  ? -51.574 43.672  -14.559 1.00 40.25  ? 17  VAL D CG2 1 
ATOM   8071  N  N   . ASP D  4  18  ? -52.991 45.654  -16.699 1.00 33.67  ? 18  ASP D N   1 
ATOM   8072  C  CA  . ASP D  4  18  ? -52.607 46.081  -18.049 1.00 32.98  ? 18  ASP D CA  1 
ATOM   8073  C  C   . ASP D  4  18  ? -51.222 45.522  -18.364 1.00 33.16  ? 18  ASP D C   1 
ATOM   8074  O  O   . ASP D  4  18  ? -50.271 45.874  -17.733 1.00 35.26  ? 18  ASP D O   1 
ATOM   8075  C  CB  . ASP D  4  18  ? -52.648 47.603  -18.128 1.00 32.00  ? 18  ASP D CB  1 
ATOM   8076  C  CG  . ASP D  4  18  ? -54.085 48.154  -18.346 1.00 33.61  ? 18  ASP D CG  1 
ATOM   8077  O  OD1 . ASP D  4  18  ? -54.894 47.496  -19.037 1.00 34.31  ? 18  ASP D OD1 1 
ATOM   8078  O  OD2 . ASP D  4  18  ? -54.408 49.251  -17.849 1.00 31.41  ? 18  ASP D OD2 1 
ATOM   8079  N  N   . ARG D  4  19  ? -51.144 44.602  -19.309 1.00 37.70  ? 19  ARG D N   1 
ATOM   8080  C  CA  . ARG D  4  19  ? -49.904 43.909  -19.703 1.00 38.36  ? 19  ARG D CA  1 
ATOM   8081  C  C   . ARG D  4  19  ? -50.049 43.523  -21.176 1.00 38.83  ? 19  ARG D C   1 
ATOM   8082  O  O   . ARG D  4  19  ? -51.068 42.932  -21.559 1.00 42.49  ? 19  ARG D O   1 
ATOM   8083  C  CB  . ARG D  4  19  ? -49.718 42.571  -18.943 1.00 37.82  ? 19  ARG D CB  1 
ATOM   8084  C  CG  . ARG D  4  19  ? -49.303 42.624  -17.480 1.00 39.07  ? 19  ARG D CG  1 
ATOM   8085  C  CD  . ARG D  4  19  ? -49.022 41.218  -16.947 1.00 38.51  ? 19  ARG D CD  1 
ATOM   8086  N  NE  . ARG D  4  19  ? -47.809 40.695  -17.566 1.00 43.69  ? 19  ARG D NE  1 
ATOM   8087  C  CZ  . ARG D  4  19  ? -46.539 40.834  -17.114 1.00 40.03  ? 19  ARG D CZ  1 
ATOM   8088  N  NH1 . ARG D  4  19  ? -45.530 40.326  -17.828 1.00 41.30  ? 19  ARG D NH1 1 
ATOM   8089  N  NH2 . ARG D  4  19  ? -46.247 41.450  -15.975 1.00 37.49  ? 19  ARG D NH2 1 
ATOM   8090  N  N   . ARG D  4  20  ? -49.003 43.746  -21.963 1.00 37.27  ? 20  ARG D N   1 
ATOM   8091  C  CA  . ARG D  4  20  ? -48.999 43.414  -23.390 1.00 35.48  ? 20  ARG D CA  1 
ATOM   8092  C  C   . ARG D  4  20  ? -49.221 41.937  -23.638 1.00 32.92  ? 20  ARG D C   1 
ATOM   8093  O  O   . ARG D  4  20  ? -49.745 41.559  -24.653 1.00 32.82  ? 20  ARG D O   1 
ATOM   8094  C  CB  . ARG D  4  20  ? -47.648 43.734  -24.014 1.00 37.20  ? 20  ARG D CB  1 
ATOM   8095  C  CG  . ARG D  4  20  ? -47.146 45.161  -23.911 1.00 36.65  ? 20  ARG D CG  1 
ATOM   8096  C  CD  . ARG D  4  20  ? -45.668 45.158  -24.241 1.00 38.24  ? 20  ARG D CD  1 
ATOM   8097  N  NE  . ARG D  4  20  ? -45.442 44.681  -25.599 1.00 38.92  ? 20  ARG D NE  1 
ATOM   8098  C  CZ  . ARG D  4  20  ? -44.324 44.172  -26.107 1.00 40.75  ? 20  ARG D CZ  1 
ATOM   8099  N  NH1 . ARG D  4  20  ? -43.229 43.976  -25.387 1.00 42.22  ? 20  ARG D NH1 1 
ATOM   8100  N  NH2 . ARG D  4  20  ? -44.328 43.808  -27.379 1.00 44.68  ? 20  ARG D NH2 1 
ATOM   8101  N  N   . ASP D  4  21  ? -48.744 41.111  -22.730 1.00 34.46  ? 21  ASP D N   1 
ATOM   8102  C  CA  . ASP D  4  21  ? -48.816 39.642  -22.866 1.00 37.71  ? 21  ASP D CA  1 
ATOM   8103  C  C   . ASP D  4  21  ? -50.031 39.027  -22.153 1.00 33.38  ? 21  ASP D C   1 
ATOM   8104  O  O   . ASP D  4  21  ? -50.140 37.818  -22.023 1.00 34.33  ? 21  ASP D O   1 
ATOM   8105  C  CB  . ASP D  4  21  ? -47.482 38.975  -22.408 1.00 40.78  ? 21  ASP D CB  1 
ATOM   8106  C  CG  . ASP D  4  21  ? -47.043 39.373  -20.981 1.00 45.15  ? 21  ASP D CG  1 
ATOM   8107  O  OD1 . ASP D  4  21  ? -47.387 40.454  -20.500 1.00 48.52  ? 21  ASP D OD1 1 
ATOM   8108  O  OD2 . ASP D  4  21  ? -46.313 38.605  -20.337 1.00 53.55  ? 21  ASP D OD2 1 
ATOM   8109  N  N   . TYR D  4  22  ? -50.945 39.865  -21.701 1.00 30.15  ? 22  TYR D N   1 
ATOM   8110  C  CA  . TYR D  4  22  ? -52.185 39.386  -21.137 1.00 30.90  ? 22  TYR D CA  1 
ATOM   8111  C  C   . TYR D  4  22  ? -53.271 40.408  -21.456 1.00 30.39  ? 22  TYR D C   1 
ATOM   8112  O  O   . TYR D  4  22  ? -53.889 40.993  -20.544 1.00 27.92  ? 22  TYR D O   1 
ATOM   8113  C  CB  . TYR D  4  22  ? -52.024 39.213  -19.649 1.00 30.03  ? 22  TYR D CB  1 
ATOM   8114  C  CG  . TYR D  4  22  ? -52.977 38.246  -19.047 1.00 30.09  ? 22  TYR D CG  1 
ATOM   8115  C  CD1 . TYR D  4  22  ? -52.843 36.902  -19.262 1.00 27.55  ? 22  TYR D CD1 1 
ATOM   8116  C  CD2 . TYR D  4  22  ? -54.016 38.683  -18.243 1.00 33.16  ? 22  TYR D CD2 1 
ATOM   8117  C  CE1 . TYR D  4  22  ? -53.719 36.013  -18.685 1.00 29.95  ? 22  TYR D CE1 1 
ATOM   8118  C  CE2 . TYR D  4  22  ? -54.900 37.796  -17.645 1.00 31.75  ? 22  TYR D CE2 1 
ATOM   8119  C  CZ  . TYR D  4  22  ? -54.754 36.467  -17.874 1.00 30.31  ? 22  TYR D CZ  1 
ATOM   8120  O  OH  . TYR D  4  22  ? -55.615 35.598  -17.240 1.00 31.23  ? 22  TYR D OH  1 
ATOM   8121  N  N   . PRO D  4  23  ? -53.496 40.625  -22.765 1.00 30.50  ? 23  PRO D N   1 
ATOM   8122  C  CA  . PRO D  4  23  ? -54.305 41.741  -23.258 1.00 31.92  ? 23  PRO D CA  1 
ATOM   8123  C  C   . PRO D  4  23  ? -55.781 41.735  -22.801 1.00 31.77  ? 23  PRO D C   1 
ATOM   8124  O  O   . PRO D  4  23  ? -56.360 42.791  -22.688 1.00 32.09  ? 23  PRO D O   1 
ATOM   8125  C  CB  . PRO D  4  23  ? -54.191 41.568  -24.773 1.00 33.53  ? 23  PRO D CB  1 
ATOM   8126  C  CG  . PRO D  4  23  ? -53.965 40.098  -24.970 1.00 31.55  ? 23  PRO D CG  1 
ATOM   8127  C  CD  . PRO D  4  23  ? -52.979 39.827  -23.894 1.00 30.06  ? 23  PRO D CD  1 
ATOM   8128  N  N   . LEU D  4  24  ? -56.352 40.561  -22.538 1.00 29.86  ? 24  LEU D N   1 
ATOM   8129  C  CA  . LEU D  4  24  ? -57.667 40.464  -21.995 1.00 30.49  ? 24  LEU D CA  1 
ATOM   8130  C  C   . LEU D  4  24  ? -57.648 39.965  -20.558 1.00 32.69  ? 24  LEU D C   1 
ATOM   8131  O  O   . LEU D  4  24  ? -57.680 38.755  -20.342 1.00 34.77  ? 24  LEU D O   1 
ATOM   8132  C  CB  . LEU D  4  24  ? -58.486 39.517  -22.845 1.00 31.17  ? 24  LEU D CB  1 
ATOM   8133  C  CG  . LEU D  4  24  ? -58.647 39.929  -24.284 1.00 32.65  ? 24  LEU D CG  1 
ATOM   8134  C  CD1 . LEU D  4  24  ? -59.556 38.943  -24.963 1.00 36.87  ? 24  LEU D CD1 1 
ATOM   8135  C  CD2 . LEU D  4  24  ? -59.249 41.297  -24.398 1.00 34.40  ? 24  LEU D CD2 1 
ATOM   8136  N  N   . PRO D  4  25  ? -57.661 40.886  -19.567 1.00 33.15  ? 25  PRO D N   1 
ATOM   8137  C  CA  . PRO D  4  25  ? -57.642 40.505  -18.160 1.00 33.94  ? 25  PRO D CA  1 
ATOM   8138  C  C   . PRO D  4  25  ? -58.912 39.860  -17.626 1.00 34.87  ? 25  PRO D C   1 
ATOM   8139  O  O   . PRO D  4  25  ? -59.900 39.760  -18.329 1.00 38.01  ? 25  PRO D O   1 
ATOM   8140  C  CB  . PRO D  4  25  ? -57.366 41.818  -17.427 1.00 34.20  ? 25  PRO D CB  1 
ATOM   8141  C  CG  . PRO D  4  25  ? -57.636 42.889  -18.370 1.00 32.84  ? 25  PRO D CG  1 
ATOM   8142  C  CD  . PRO D  4  25  ? -57.482 42.333  -19.743 1.00 34.31  ? 25  PRO D CD  1 
ATOM   8143  N  N   . ASP D  4  26  ? -58.844 39.417  -16.381 1.00 33.81  ? 26  ASP D N   1 
ATOM   8144  C  CA  . ASP D  4  26  ? -59.798 38.472  -15.822 1.00 35.53  ? 26  ASP D CA  1 
ATOM   8145  C  C   . ASP D  4  26  ? -61.059 39.143  -15.349 1.00 36.69  ? 26  ASP D C   1 
ATOM   8146  O  O   . ASP D  4  26  ? -62.064 38.464  -15.106 1.00 39.88  ? 26  ASP D O   1 
ATOM   8147  C  CB  . ASP D  4  26  ? -59.152 37.721  -14.640 1.00 37.09  ? 26  ASP D CB  1 
ATOM   8148  C  CG  . ASP D  4  26  ? -57.990 36.846  -15.063 1.00 38.80  ? 26  ASP D CG  1 
ATOM   8149  O  OD1 . ASP D  4  26  ? -57.872 36.551  -16.249 1.00 41.84  ? 26  ASP D OD1 1 
ATOM   8150  O  OD2 . ASP D  4  26  ? -57.180 36.450  -14.223 1.00 43.01  ? 26  ASP D OD2 1 
ATOM   8151  N  N   . VAL D  4  27  ? -60.993 40.465  -15.176 1.00 35.61  ? 27  VAL D N   1 
ATOM   8152  C  CA  . VAL D  4  27  ? -62.145 41.260  -14.798 1.00 36.15  ? 27  VAL D CA  1 
ATOM   8153  C  C   . VAL D  4  27  ? -62.184 42.599  -15.536 1.00 35.27  ? 27  VAL D C   1 
ATOM   8154  O  O   . VAL D  4  27  ? -61.176 43.061  -16.058 1.00 36.53  ? 27  VAL D O   1 
ATOM   8155  C  CB  . VAL D  4  27  ? -62.177 41.505  -13.271 1.00 36.07  ? 27  VAL D CB  1 
ATOM   8156  C  CG1 . VAL D  4  27  ? -62.238 40.187  -12.527 1.00 34.07  ? 27  VAL D CG1 1 
ATOM   8157  C  CG2 . VAL D  4  27  ? -60.983 42.334  -12.804 1.00 36.82  ? 27  VAL D CG2 1 
ATOM   8158  N  N   . ALA D  4  28  ? -63.364 43.211  -15.577 1.00 35.36  ? 28  ALA D N   1 
ATOM   8159  C  CA  . ALA D  4  28  ? -63.532 44.548  -16.162 1.00 31.37  ? 28  ALA D CA  1 
ATOM   8160  C  C   . ALA D  4  28  ? -62.874 45.608  -15.263 1.00 30.05  ? 28  ALA D C   1 
ATOM   8161  O  O   . ALA D  4  28  ? -62.869 45.467  -14.062 1.00 33.04  ? 28  ALA D O   1 
ATOM   8162  C  CB  . ALA D  4  28  ? -65.011 44.849  -16.319 1.00 30.90  ? 28  ALA D CB  1 
ATOM   8163  N  N   . HIS D  4  29  ? -62.287 46.638  -15.855 1.00 29.97  ? 29  HIS D N   1 
ATOM   8164  C  CA  . HIS D  4  29  ? -61.812 47.831  -15.145 1.00 30.42  ? 29  HIS D CA  1 
ATOM   8165  C  C   . HIS D  4  29  ? -62.895 48.394  -14.276 1.00 31.24  ? 29  HIS D C   1 
ATOM   8166  O  O   . HIS D  4  29  ? -62.648 48.660  -13.113 1.00 32.19  ? 29  HIS D O   1 
ATOM   8167  C  CB  . HIS D  4  29  ? -61.332 48.894  -16.151 1.00 31.71  ? 29  HIS D CB  1 
ATOM   8168  C  CG  . HIS D  4  29  ? -60.965 50.231  -15.550 1.00 33.63  ? 29  HIS D CG  1 
ATOM   8169  N  ND1 . HIS D  4  29  ? -60.234 50.369  -14.390 1.00 34.85  ? 29  HIS D ND1 1 
ATOM   8170  C  CD2 . HIS D  4  29  ? -61.184 51.495  -16.002 1.00 34.29  ? 29  HIS D CD2 1 
ATOM   8171  C  CE1 . HIS D  4  29  ? -60.056 51.653  -14.133 1.00 34.30  ? 29  HIS D CE1 1 
ATOM   8172  N  NE2 . HIS D  4  29  ? -60.615 52.356  -15.101 1.00 33.50  ? 29  HIS D NE2 1 
ATOM   8173  N  N   . VAL D  4  30  ? -64.093 48.570  -14.842 1.00 33.74  ? 30  VAL D N   1 
ATOM   8174  C  CA  . VAL D  4  30  ? -65.254 49.140  -14.120 1.00 34.96  ? 30  VAL D CA  1 
ATOM   8175  C  C   . VAL D  4  30  ? -66.326 48.063  -13.916 1.00 35.11  ? 30  VAL D C   1 
ATOM   8176  O  O   . VAL D  4  30  ? -66.789 47.460  -14.861 1.00 37.76  ? 30  VAL D O   1 
ATOM   8177  C  CB  . VAL D  4  30  ? -65.787 50.391  -14.848 1.00 35.08  ? 30  VAL D CB  1 
ATOM   8178  C  CG1 . VAL D  4  30  ? -66.840 51.127  -14.031 1.00 36.34  ? 30  VAL D CG1 1 
ATOM   8179  C  CG2 . VAL D  4  30  ? -64.642 51.346  -15.078 1.00 36.09  ? 30  VAL D CG2 1 
ATOM   8180  N  N   . LYS D  4  31  ? -66.657 47.785  -12.669 1.00 37.68  ? 31  LYS D N   1 
ATOM   8181  C  CA  . LYS D  4  31  ? -67.654 46.770  -12.339 1.00 45.14  ? 31  LYS D CA  1 
ATOM   8182  C  C   . LYS D  4  31  ? -69.044 47.326  -12.053 1.00 39.88  ? 31  LYS D C   1 
ATOM   8183  O  O   . LYS D  4  31  ? -70.015 46.639  -12.258 1.00 42.63  ? 31  LYS D O   1 
ATOM   8184  C  CB  . LYS D  4  31  ? -67.199 45.957  -11.125 1.00 54.28  ? 31  LYS D CB  1 
ATOM   8185  C  CG  . LYS D  4  31  ? -67.644 44.504  -11.194 1.00 66.21  ? 31  LYS D CG  1 
ATOM   8186  C  CD  . LYS D  4  31  ? -67.894 43.915  -9.809  1.00 79.89  ? 31  LYS D CD  1 
ATOM   8187  C  CE  . LYS D  4  31  ? -66.680 44.037  -8.899  1.00 85.44  ? 31  LYS D CE  1 
ATOM   8188  N  NZ  . LYS D  4  31  ? -66.736 42.994  -7.837  1.00 92.51  ? 31  LYS D NZ  1 
ATOM   8189  N  N   . ASN D  4  32  ? -69.119 48.546  -11.540 1.00 41.23  ? 32  ASN D N   1 
ATOM   8190  C  CA  . ASN D  4  32  ? -70.365 49.203  -11.149 1.00 39.75  ? 32  ASN D CA  1 
ATOM   8191  C  C   . ASN D  4  32  ? -70.729 50.300  -12.112 1.00 38.25  ? 32  ASN D C   1 
ATOM   8192  O  O   . ASN D  4  32  ? -69.961 51.232  -12.344 1.00 38.19  ? 32  ASN D O   1 
ATOM   8193  C  CB  . ASN D  4  32  ? -70.199 49.822  -9.786  1.00 40.86  ? 32  ASN D CB  1 
ATOM   8194  C  CG  . ASN D  4  32  ? -69.951 48.791  -8.733  1.00 40.66  ? 32  ASN D CG  1 
ATOM   8195  O  OD1 . ASN D  4  32  ? -70.486 47.687  -8.796  1.00 41.46  ? 32  ASN D OD1 1 
ATOM   8196  N  ND2 . ASN D  4  32  ? -69.144 49.142  -7.757  1.00 38.36  ? 32  ASN D ND2 1 
ATOM   8197  N  N   . LEU D  4  33  ? -71.927 50.175  -12.651 1.00 38.24  ? 33  LEU D N   1 
ATOM   8198  C  CA  . LEU D  4  33  ? -72.407 51.021  -13.717 1.00 39.40  ? 33  LEU D CA  1 
ATOM   8199  C  C   . LEU D  4  33  ? -73.490 52.018  -13.270 1.00 36.39  ? 33  LEU D C   1 
ATOM   8200  O  O   . LEU D  4  33  ? -74.446 51.651  -12.601 1.00 37.88  ? 33  LEU D O   1 
ATOM   8201  C  CB  . LEU D  4  33  ? -72.945 50.119  -14.827 1.00 39.95  ? 33  LEU D CB  1 
ATOM   8202  C  CG  . LEU D  4  33  ? -71.927 49.137  -15.433 1.00 40.17  ? 33  LEU D CG  1 
ATOM   8203  C  CD1 . LEU D  4  33  ? -72.596 48.371  -16.554 1.00 38.29  ? 33  LEU D CD1 1 
ATOM   8204  C  CD2 . LEU D  4  33  ? -70.662 49.830  -15.924 1.00 39.90  ? 33  LEU D CD2 1 
ATOM   8205  N  N   . SER D  4  34  ? -73.362 53.268  -13.691 1.00 34.78  ? 34  SER D N   1 
ATOM   8206  C  CA  . SER D  4  34  ? -74.435 54.246  -13.529 1.00 33.94  ? 34  SER D CA  1 
ATOM   8207  C  C   . SER D  4  34  ? -75.662 53.835  -14.356 1.00 34.16  ? 34  SER D C   1 
ATOM   8208  O  O   . SER D  4  34  ? -75.645 52.812  -15.059 1.00 36.09  ? 34  SER D O   1 
ATOM   8209  C  CB  . SER D  4  34  ? -73.951 55.668  -13.870 1.00 31.54  ? 34  SER D CB  1 
ATOM   8210  O  OG  . SER D  4  34  ? -73.599 55.787  -15.246 1.00 35.63  ? 34  SER D OG  1 
ATOM   8211  N  N   . ALA D  4  35  ? -76.737 54.608  -14.236 1.00 33.82  ? 35  ALA D N   1 
ATOM   8212  C  CA  . ALA D  4  35  ? -77.887 54.442  -15.092 1.00 31.31  ? 35  ALA D CA  1 
ATOM   8213  C  C   . ALA D  4  35  ? -77.489 54.687  -16.549 1.00 30.35  ? 35  ALA D C   1 
ATOM   8214  O  O   . ALA D  4  35  ? -77.917 53.943  -17.411 1.00 31.70  ? 35  ALA D O   1 
ATOM   8215  C  CB  . ALA D  4  35  ? -79.008 55.379  -14.663 1.00 32.07  ? 35  ALA D CB  1 
ATOM   8216  N  N   . SER D  4  36  ? -76.664 55.688  -16.836 1.00 29.05  ? 36  SER D N   1 
ATOM   8217  C  CA  . SER D  4  36  ? -76.230 55.935  -18.235 1.00 32.23  ? 36  SER D CA  1 
ATOM   8218  C  C   . SER D  4  36  ? -75.376 54.810  -18.796 1.00 34.08  ? 36  SER D C   1 
ATOM   8219  O  O   . SER D  4  36  ? -75.564 54.384  -19.956 1.00 34.54  ? 36  SER D O   1 
ATOM   8220  C  CB  . SER D  4  36  ? -75.408 57.207  -18.381 1.00 32.44  ? 36  SER D CB  1 
ATOM   8221  O  OG  . SER D  4  36  ? -75.630 58.041  -17.271 1.00 38.71  ? 36  SER D OG  1 
ATOM   8222  N  N   . GLN D  4  37  ? -74.433 54.348  -17.974 1.00 33.79  ? 37  GLN D N   1 
ATOM   8223  C  CA  . GLN D  4  37  ? -73.533 53.258  -18.358 1.00 35.34  ? 37  GLN D CA  1 
ATOM   8224  C  C   . GLN D  4  37  ? -74.298 51.933  -18.588 1.00 35.49  ? 37  GLN D C   1 
ATOM   8225  O  O   . GLN D  4  37  ? -74.007 51.209  -19.535 1.00 32.05  ? 37  GLN D O   1 
ATOM   8226  C  CB  . GLN D  4  37  ? -72.408 53.105  -17.316 1.00 36.54  ? 37  GLN D CB  1 
ATOM   8227  C  CG  . GLN D  4  37  ? -71.479 54.314  -17.288 1.00 34.38  ? 37  GLN D CG  1 
ATOM   8228  C  CD  . GLN D  4  37  ? -70.528 54.365  -16.100 1.00 33.66  ? 37  GLN D CD  1 
ATOM   8229  O  OE1 . GLN D  4  37  ? -69.495 54.997  -16.191 1.00 36.74  ? 37  GLN D OE1 1 
ATOM   8230  N  NE2 . GLN D  4  37  ? -70.852 53.708  -15.013 1.00 29.74  ? 37  GLN D NE2 1 
ATOM   8231  N  N   . LYS D  4  38  ? -75.299 51.651  -17.749 1.00 36.49  ? 38  LYS D N   1 
ATOM   8232  C  CA  . LYS D  4  38  ? -76.210 50.525  -17.994 1.00 38.96  ? 38  LYS D CA  1 
ATOM   8233  C  C   . LYS D  4  38  ? -76.977 50.659  -19.327 1.00 37.41  ? 38  LYS D C   1 
ATOM   8234  O  O   . LYS D  4  38  ? -77.205 49.667  -20.010 1.00 37.10  ? 38  LYS D O   1 
ATOM   8235  C  CB  . LYS D  4  38  ? -77.248 50.386  -16.869 1.00 42.86  ? 38  LYS D CB  1 
ATOM   8236  C  CG  . LYS D  4  38  ? -76.780 49.855  -15.527 1.00 46.26  ? 38  LYS D CG  1 
ATOM   8237  C  CD  . LYS D  4  38  ? -77.996 49.671  -14.617 1.00 55.06  ? 38  LYS D CD  1 
ATOM   8238  C  CE  . LYS D  4  38  ? -77.667 49.734  -13.126 1.00 64.40  ? 38  LYS D CE  1 
ATOM   8239  N  NZ  . LYS D  4  38  ? -76.655 48.696  -12.719 1.00 69.27  ? 38  LYS D NZ  1 
ATOM   8240  N  N   . ALA D  4  39  ? -77.411 51.874  -19.662 1.00 35.63  ? 39  ALA D N   1 
ATOM   8241  C  CA  . ALA D  4  39  ? -78.113 52.115  -20.918 1.00 37.39  ? 39  ALA D CA  1 
ATOM   8242  C  C   . ALA D  4  39  ? -77.185 51.912  -22.103 1.00 38.36  ? 39  ALA D C   1 
ATOM   8243  O  O   . ALA D  4  39  ? -77.602 51.375  -23.115 1.00 40.41  ? 39  ALA D O   1 
ATOM   8244  C  CB  . ALA D  4  39  ? -78.732 53.508  -20.942 1.00 36.98  ? 39  ALA D CB  1 
ATOM   8245  N  N   . LEU D  4  40  ? -75.931 52.343  -21.973 1.00 40.17  ? 40  LEU D N   1 
ATOM   8246  C  CA  . LEU D  4  40  ? -74.891 52.048  -22.969 1.00 40.11  ? 40  LEU D CA  1 
ATOM   8247  C  C   . LEU D  4  40  ? -74.600 50.548  -23.106 1.00 39.10  ? 40  LEU D C   1 
ATOM   8248  O  O   . LEU D  4  40  ? -74.373 50.043  -24.210 1.00 38.92  ? 40  LEU D O   1 
ATOM   8249  C  CB  . LEU D  4  40  ? -73.612 52.782  -22.590 1.00 42.18  ? 40  LEU D CB  1 
ATOM   8250  C  CG  . LEU D  4  40  ? -72.402 52.689  -23.513 1.00 44.62  ? 40  LEU D CG  1 
ATOM   8251  C  CD1 . LEU D  4  40  ? -72.652 53.271  -24.882 1.00 45.64  ? 40  LEU D CD1 1 
ATOM   8252  C  CD2 . LEU D  4  40  ? -71.248 53.441  -22.891 1.00 48.58  ? 40  LEU D CD2 1 
ATOM   8253  N  N   . LYS D  4  41  ? -74.607 49.818  -21.997 1.00 40.12  ? 41  LYS D N   1 
ATOM   8254  C  CA  . LYS D  4  41  ? -74.403 48.356  -22.078 1.00 41.81  ? 41  LYS D CA  1 
ATOM   8255  C  C   . LYS D  4  41  ? -75.527 47.659  -22.830 1.00 42.75  ? 41  LYS D C   1 
ATOM   8256  O  O   . LYS D  4  41  ? -75.280 46.630  -23.447 1.00 43.60  ? 41  LYS D O   1 
ATOM   8257  C  CB  . LYS D  4  41  ? -74.224 47.711  -20.690 1.00 41.02  ? 41  LYS D CB  1 
ATOM   8258  C  CG  . LYS D  4  41  ? -72.991 48.127  -19.897 1.00 41.80  ? 41  LYS D CG  1 
ATOM   8259  C  CD  . LYS D  4  41  ? -71.637 47.945  -20.597 1.00 45.02  ? 41  LYS D CD  1 
ATOM   8260  C  CE  . LYS D  4  41  ? -71.297 46.459  -20.747 1.00 46.51  ? 41  LYS D CE  1 
ATOM   8261  N  NZ  . LYS D  4  41  ? -69.914 46.175  -21.213 1.00 42.09  ? 41  LYS D NZ  1 
ATOM   8262  N  N   . GLU D  4  42  ? -76.753 48.203  -22.763 1.00 47.51  ? 42  GLU D N   1 
ATOM   8263  C  CA  . GLU D  4  42  ? -77.930 47.679  -23.525 1.00 48.38  ? 42  GLU D CA  1 
ATOM   8264  C  C   . GLU D  4  42  ? -77.817 47.982  -25.008 1.00 43.93  ? 42  GLU D C   1 
ATOM   8265  O  O   . GLU D  4  42  ? -78.044 47.120  -25.867 1.00 45.65  ? 42  GLU D O   1 
ATOM   8266  C  CB  . GLU D  4  42  ? -79.262 48.277  -23.022 1.00 52.92  ? 42  GLU D CB  1 
ATOM   8267  C  CG  . GLU D  4  42  ? -79.756 47.757  -21.683 1.00 55.82  ? 42  GLU D CG  1 
ATOM   8268  C  CD  . GLU D  4  42  ? -79.984 46.263  -21.673 1.00 60.93  ? 42  GLU D CD  1 
ATOM   8269  O  OE1 . GLU D  4  42  ? -80.549 45.712  -22.662 1.00 67.62  ? 42  GLU D OE1 1 
ATOM   8270  O  OE2 . GLU D  4  42  ? -79.592 45.654  -20.656 1.00 63.02  ? 42  GLU D OE2 1 
ATOM   8271  N  N   . LYS D  4  43  ? -77.454 49.216  -25.295 1.00 41.70  ? 43  LYS D N   1 
ATOM   8272  C  CA  . LYS D  4  43  ? -77.123 49.628  -26.645 1.00 45.37  ? 43  LYS D CA  1 
ATOM   8273  C  C   . LYS D  4  43  ? -75.996 48.768  -27.282 1.00 46.37  ? 43  LYS D C   1 
ATOM   8274  O  O   . LYS D  4  43  ? -75.931 48.633  -28.509 1.00 48.99  ? 43  LYS D O   1 
ATOM   8275  C  CB  . LYS D  4  43  ? -76.771 51.124  -26.637 1.00 48.53  ? 43  LYS D CB  1 
ATOM   8276  C  CG  . LYS D  4  43  ? -77.237 51.870  -27.862 1.00 55.24  ? 43  LYS D CG  1 
ATOM   8277  C  CD  . LYS D  4  43  ? -77.116 53.387  -27.718 1.00 58.57  ? 43  LYS D CD  1 
ATOM   8278  C  CE  . LYS D  4  43  ? -76.746 53.976  -29.073 1.00 61.16  ? 43  LYS D CE  1 
ATOM   8279  N  NZ  . LYS D  4  43  ? -76.637 55.451  -29.081 1.00 65.62  ? 43  LYS D NZ  1 
ATOM   8280  N  N   . GLU D  4  44  ? -75.118 48.190  -26.449 1.00 48.32  ? 44  GLU D N   1 
ATOM   8281  C  CA  . GLU D  4  44  ? -74.052 47.278  -26.913 1.00 46.29  ? 44  GLU D CA  1 
ATOM   8282  C  C   . GLU D  4  44  ? -74.608 45.919  -27.403 1.00 45.61  ? 44  GLU D C   1 
ATOM   8283  O  O   . GLU D  4  44  ? -73.922 45.208  -28.176 1.00 39.96  ? 44  GLU D O   1 
ATOM   8284  C  CB  . GLU D  4  44  ? -72.977 47.080  -25.814 1.00 47.99  ? 44  GLU D CB  1 
ATOM   8285  C  CG  . GLU D  4  44  ? -71.617 46.591  -26.298 1.00 47.94  ? 44  GLU D CG  1 
ATOM   8286  C  CD  . GLU D  4  44  ? -70.665 46.087  -25.190 1.00 49.21  ? 44  GLU D CD  1 
ATOM   8287  O  OE1 . GLU D  4  44  ? -71.097 45.842  -24.035 1.00 42.96  ? 44  GLU D OE1 1 
ATOM   8288  O  OE2 . GLU D  4  44  ? -69.451 45.921  -25.497 1.00 45.57  ? 44  GLU D OE2 1 
ATOM   8289  N  N   . LYS D  4  45  ? -75.840 45.550  -27.021 1.00 43.61  ? 45  LYS D N   1 
ATOM   8290  C  CA  . LYS D  4  45  ? -76.418 44.280  -27.538 1.00 44.24  ? 45  LYS D CA  1 
ATOM   8291  C  C   . LYS D  4  45  ? -76.940 44.437  -28.977 1.00 40.52  ? 45  LYS D C   1 
ATOM   8292  O  O   . LYS D  4  45  ? -77.034 43.478  -29.740 1.00 37.08  ? 45  LYS D O   1 
ATOM   8293  C  CB  . LYS D  4  45  ? -77.471 43.725  -26.601 1.00 47.63  ? 45  LYS D CB  1 
ATOM   8294  C  CG  . LYS D  4  45  ? -77.037 43.796  -25.145 1.00 52.98  ? 45  LYS D CG  1 
ATOM   8295  C  CD  . LYS D  4  45  ? -77.874 42.893  -24.276 1.00 56.54  ? 45  LYS D CD  1 
ATOM   8296  C  CE  . LYS D  4  45  ? -77.655 43.169  -22.805 1.00 62.78  ? 45  LYS D CE  1 
ATOM   8297  N  NZ  . LYS D  4  45  ? -78.868 42.704  -22.070 1.00 72.66  ? 45  LYS D NZ  1 
ATOM   8298  N  N   . ALA D  4  46  ? -77.214 45.673  -29.363 1.00 42.52  ? 46  ALA D N   1 
ATOM   8299  C  CA  . ALA D  4  46  ? -77.662 45.980  -30.709 1.00 44.93  ? 46  ALA D CA  1 
ATOM   8300  C  C   . ALA D  4  46  ? -76.436 46.076  -31.633 1.00 48.32  ? 46  ALA D C   1 
ATOM   8301  O  O   . ALA D  4  46  ? -75.320 45.705  -31.241 1.00 50.29  ? 46  ALA D O   1 
ATOM   8302  C  CB  . ALA D  4  46  ? -78.471 47.276  -30.697 1.00 44.30  ? 46  ALA D CB  1 
ATOM   8303  N  N   . SER D  4  47  ? -76.659 46.523  -32.871 1.00 47.96  ? 47  SER D N   1 
ATOM   8304  C  CA  . SER D  4  47  ? -75.600 46.632  -33.860 1.00 44.66  ? 47  SER D CA  1 
ATOM   8305  C  C   . SER D  4  47  ? -74.655 47.713  -33.424 1.00 43.99  ? 47  SER D C   1 
ATOM   8306  O  O   . SER D  4  47  ? -75.107 48.794  -33.002 1.00 45.71  ? 47  SER D O   1 
ATOM   8307  C  CB  . SER D  4  47  ? -76.157 46.966  -35.245 1.00 46.45  ? 47  SER D CB  1 
ATOM   8308  O  OG  . SER D  4  47  ? -75.322 47.892  -35.947 1.00 50.48  ? 47  SER D OG  1 
ATOM   8309  N  N   . TRP D  4  48  ? -73.353 47.449  -33.553 1.00 40.62  ? 48  TRP D N   1 
ATOM   8310  C  CA  . TRP D  4  48  ? -72.362 48.427  -33.123 1.00 40.91  ? 48  TRP D CA  1 
ATOM   8311  C  C   . TRP D  4  48  ? -72.166 49.597  -34.127 1.00 43.41  ? 48  TRP D C   1 
ATOM   8312  O  O   . TRP D  4  48  ? -71.520 50.615  -33.799 1.00 43.04  ? 48  TRP D O   1 
ATOM   8313  C  CB  . TRP D  4  48  ? -71.030 47.738  -32.815 1.00 42.41  ? 48  TRP D CB  1 
ATOM   8314  C  CG  . TRP D  4  48  ? -71.064 46.637  -31.750 1.00 39.02  ? 48  TRP D CG  1 
ATOM   8315  C  CD1 . TRP D  4  48  ? -71.908 46.549  -30.698 1.00 40.05  ? 48  TRP D CD1 1 
ATOM   8316  C  CD2 . TRP D  4  48  ? -70.161 45.527  -31.632 1.00 38.00  ? 48  TRP D CD2 1 
ATOM   8317  N  NE1 . TRP D  4  48  ? -71.613 45.438  -29.941 1.00 40.95  ? 48  TRP D NE1 1 
ATOM   8318  C  CE2 . TRP D  4  48  ? -70.545 44.792  -30.500 1.00 39.51  ? 48  TRP D CE2 1 
ATOM   8319  C  CE3 . TRP D  4  48  ? -69.068 45.077  -32.386 1.00 39.57  ? 48  TRP D CE3 1 
ATOM   8320  C  CZ2 . TRP D  4  48  ? -69.875 43.632  -30.091 1.00 39.66  ? 48  TRP D CZ2 1 
ATOM   8321  C  CZ3 . TRP D  4  48  ? -68.399 43.911  -31.973 1.00 38.51  ? 48  TRP D CZ3 1 
ATOM   8322  C  CH2 . TRP D  4  48  ? -68.811 43.211  -30.843 1.00 36.79  ? 48  TRP D CH2 1 
ATOM   8323  N  N   . SER D  4  49  ? -72.722 49.480  -35.337 1.00 46.78  ? 49  SER D N   1 
ATOM   8324  C  CA  . SER D  4  49  ? -72.735 50.601  -36.305 1.00 48.31  ? 49  SER D CA  1 
ATOM   8325  C  C   . SER D  4  49  ? -73.566 51.753  -35.763 1.00 45.56  ? 49  SER D C   1 
ATOM   8326  O  O   . SER D  4  49  ? -73.329 52.898  -36.093 1.00 47.51  ? 49  SER D O   1 
ATOM   8327  C  CB  . SER D  4  49  ? -73.309 50.165  -37.656 1.00 52.85  ? 49  SER D CB  1 
ATOM   8328  O  OG  . SER D  4  49  ? -73.042 48.792  -37.923 1.00 55.49  ? 49  SER D OG  1 
ATOM   8329  N  N   . SER D  4  50  ? -74.527 51.432  -34.912 1.00 47.40  ? 50  SER D N   1 
ATOM   8330  C  CA  . SER D  4  50  ? -75.390 52.419  -34.307 1.00 52.89  ? 50  SER D CA  1 
ATOM   8331  C  C   . SER D  4  50  ? -74.706 53.254  -33.222 1.00 54.41  ? 50  SER D C   1 
ATOM   8332  O  O   . SER D  4  50  ? -75.161 54.368  -32.965 1.00 62.60  ? 50  SER D O   1 
ATOM   8333  C  CB  . SER D  4  50  ? -76.685 51.760  -33.796 1.00 58.14  ? 50  SER D CB  1 
ATOM   8334  O  OG  . SER D  4  50  ? -76.923 52.081  -32.439 1.00 71.39  ? 50  SER D OG  1 
ATOM   8335  N  N   . LEU D  4  51  ? -73.630 52.742  -32.601 1.00 50.85  ? 51  LEU D N   1 
ATOM   8336  C  CA  . LEU D  4  51  ? -72.921 53.463  -31.526 1.00 44.46  ? 51  LEU D CA  1 
ATOM   8337  C  C   . LEU D  4  51  ? -72.109 54.633  -32.065 1.00 42.31  ? 51  LEU D C   1 
ATOM   8338  O  O   . LEU D  4  51  ? -71.485 54.514  -33.122 1.00 44.26  ? 51  LEU D O   1 
ATOM   8339  C  CB  . LEU D  4  51  ? -71.968 52.523  -30.821 1.00 45.11  ? 51  LEU D CB  1 
ATOM   8340  C  CG  . LEU D  4  51  ? -72.581 51.324  -30.107 1.00 47.80  ? 51  LEU D CG  1 
ATOM   8341  C  CD1 . LEU D  4  51  ? -71.488 50.294  -29.853 1.00 50.92  ? 51  LEU D CD1 1 
ATOM   8342  C  CD2 . LEU D  4  51  ? -73.231 51.746  -28.799 1.00 47.81  ? 51  LEU D CD2 1 
ATOM   8343  N  N   . SER D  4  52  ? -72.095 55.753  -31.354 1.00 39.09  ? 52  SER D N   1 
ATOM   8344  C  CA  . SER D  4  52  ? -71.165 56.833  -31.708 1.00 43.59  ? 52  SER D CA  1 
ATOM   8345  C  C   . SER D  4  52  ? -69.685 56.497  -31.378 1.00 49.32  ? 52  SER D C   1 
ATOM   8346  O  O   . SER D  4  52  ? -69.375 55.495  -30.717 1.00 48.46  ? 52  SER D O   1 
ATOM   8347  C  CB  . SER D  4  52  ? -71.554 58.152  -31.027 1.00 44.11  ? 52  SER D CB  1 
ATOM   8348  O  OG  . SER D  4  52  ? -71.857 57.974  -29.657 1.00 45.59  ? 52  SER D OG  1 
ATOM   8349  N  N   . ILE D  4  53  ? -68.783 57.352  -31.855 1.00 51.42  ? 53  ILE D N   1 
ATOM   8350  C  CA  . ILE D  4  53  ? -67.382 57.278  -31.497 1.00 50.78  ? 53  ILE D CA  1 
ATOM   8351  C  C   . ILE D  4  53  ? -67.242 57.447  -29.993 1.00 52.75  ? 53  ILE D C   1 
ATOM   8352  O  O   . ILE D  4  53  ? -66.552 56.651  -29.350 1.00 54.25  ? 53  ILE D O   1 
ATOM   8353  C  CB  . ILE D  4  53  ? -66.526 58.315  -32.276 1.00 53.41  ? 53  ILE D CB  1 
ATOM   8354  C  CG1 . ILE D  4  53  ? -66.474 57.965  -33.776 1.00 56.64  ? 53  ILE D CG1 1 
ATOM   8355  C  CG2 . ILE D  4  53  ? -65.096 58.414  -31.742 1.00 56.88  ? 53  ILE D CG2 1 
ATOM   8356  C  CD1 . ILE D  4  53  ? -66.193 56.511  -34.118 1.00 56.14  ? 53  ILE D CD1 1 
ATOM   8357  N  N   . ASP D  4  54  ? -67.909 58.449  -29.424 1.00 53.01  ? 54  ASP D N   1 
ATOM   8358  C  CA  . ASP D  4  54  ? -67.788 58.708  -27.980 1.00 51.61  ? 54  ASP D CA  1 
ATOM   8359  C  C   . ASP D  4  54  ? -68.312 57.553  -27.128 1.00 47.55  ? 54  ASP D C   1 
ATOM   8360  O  O   . ASP D  4  54  ? -67.769 57.275  -26.066 1.00 51.92  ? 54  ASP D O   1 
ATOM   8361  C  CB  . ASP D  4  54  ? -68.446 60.041  -27.582 1.00 51.28  ? 54  ASP D CB  1 
ATOM   8362  C  CG  . ASP D  4  54  ? -67.661 61.253  -28.063 1.00 54.87  ? 54  ASP D CG  1 
ATOM   8363  O  OD1 . ASP D  4  54  ? -66.502 61.105  -28.509 1.00 56.08  ? 54  ASP D OD1 1 
ATOM   8364  O  OD2 . ASP D  4  54  ? -68.204 62.374  -27.991 1.00 60.05  ? 54  ASP D OD2 1 
ATOM   8365  N  N   . GLU D  4  55  ? -69.347 56.873  -27.604 1.00 46.92  ? 55  GLU D N   1 
ATOM   8366  C  CA  . GLU D  4  55  ? -69.926 55.743  -26.875 1.00 44.58  ? 55  GLU D CA  1 
ATOM   8367  C  C   . GLU D  4  55  ? -69.012 54.514  -26.973 1.00 40.18  ? 55  GLU D C   1 
ATOM   8368  O  O   . GLU D  4  55  ? -68.856 53.767  -26.018 1.00 34.79  ? 55  GLU D O   1 
ATOM   8369  C  CB  . GLU D  4  55  ? -71.317 55.407  -27.424 1.00 44.91  ? 55  GLU D CB  1 
ATOM   8370  C  CG  . GLU D  4  55  ? -72.427 56.381  -27.031 1.00 47.29  ? 55  GLU D CG  1 
ATOM   8371  C  CD  . GLU D  4  55  ? -73.771 56.066  -27.702 1.00 45.32  ? 55  GLU D CD  1 
ATOM   8372  O  OE1 . GLU D  4  55  ? -73.821 55.633  -28.878 1.00 43.03  ? 55  GLU D OE1 1 
ATOM   8373  O  OE2 . GLU D  4  55  ? -74.797 56.263  -27.040 1.00 48.57  ? 55  GLU D OE2 1 
ATOM   8374  N  N   . LYS D  4  56  ? -68.466 54.288  -28.164 1.00 38.36  ? 56  LYS D N   1 
ATOM   8375  C  CA  . LYS D  4  56  ? -67.432 53.281  -28.370 1.00 35.93  ? 56  LYS D CA  1 
ATOM   8376  C  C   . LYS D  4  56  ? -66.221 53.485  -27.442 1.00 33.73  ? 56  LYS D C   1 
ATOM   8377  O  O   . LYS D  4  56  ? -65.784 52.530  -26.827 1.00 30.16  ? 56  LYS D O   1 
ATOM   8378  C  CB  . LYS D  4  56  ? -67.002 53.242  -29.828 1.00 33.90  ? 56  LYS D CB  1 
ATOM   8379  C  CG  . LYS D  4  56  ? -68.036 52.510  -30.662 1.00 36.30  ? 56  LYS D CG  1 
ATOM   8380  C  CD  . LYS D  4  56  ? -67.710 52.543  -32.140 1.00 34.90  ? 56  LYS D CD  1 
ATOM   8381  C  CE  . LYS D  4  56  ? -68.770 51.778  -32.902 1.00 36.46  ? 56  LYS D CE  1 
ATOM   8382  N  NZ  . LYS D  4  56  ? -68.306 51.433  -34.275 1.00 38.22  ? 56  LYS D NZ  1 
ATOM   8383  N  N   . VAL D  4  57  ? -65.718 54.717  -27.330 1.00 33.21  ? 57  VAL D N   1 
ATOM   8384  C  CA  . VAL D  4  57  ? -64.583 54.998  -26.465 1.00 34.65  ? 57  VAL D CA  1 
ATOM   8385  C  C   . VAL D  4  57  ? -65.016 54.691  -25.029 1.00 36.26  ? 57  VAL D C   1 
ATOM   8386  O  O   . VAL D  4  57  ? -64.279 54.086  -24.278 1.00 37.36  ? 57  VAL D O   1 
ATOM   8387  C  CB  . VAL D  4  57  ? -64.022 56.449  -26.608 1.00 32.57  ? 57  VAL D CB  1 
ATOM   8388  C  CG1 . VAL D  4  57  ? -62.961 56.750  -25.557 1.00 31.96  ? 57  VAL D CG1 1 
ATOM   8389  C  CG2 . VAL D  4  57  ? -63.380 56.635  -27.960 1.00 33.86  ? 57  VAL D CG2 1 
ATOM   8390  N  N   . GLU D  4  58  ? -66.232 55.049  -24.668 1.00 38.96  ? 58  GLU D N   1 
ATOM   8391  C  CA  . GLU D  4  58  ? -66.672 54.838  -23.305 1.00 40.07  ? 58  GLU D CA  1 
ATOM   8392  C  C   . GLU D  4  58  ? -66.730 53.375  -22.937 1.00 36.04  ? 58  GLU D C   1 
ATOM   8393  O  O   . GLU D  4  58  ? -66.374 53.003  -21.829 1.00 38.76  ? 58  GLU D O   1 
ATOM   8394  C  CB  . GLU D  4  58  ? -68.020 55.496  -23.057 1.00 44.60  ? 58  GLU D CB  1 
ATOM   8395  C  CG  . GLU D  4  58  ? -68.461 55.226  -21.640 1.00 53.62  ? 58  GLU D CG  1 
ATOM   8396  C  CD  . GLU D  4  58  ? -69.273 56.307  -21.012 1.00 60.15  ? 58  GLU D CD  1 
ATOM   8397  O  OE1 . GLU D  4  58  ? -69.030 56.478  -19.771 1.00 54.71  ? 58  GLU D OE1 1 
ATOM   8398  O  OE2 . GLU D  4  58  ? -70.121 56.915  -21.748 1.00 60.86  ? 58  GLU D OE2 1 
ATOM   8399  N  N   . LEU D  4  59  ? -67.197 52.554  -23.861 1.00 36.22  ? 59  LEU D N   1 
ATOM   8400  C  CA  . LEU D  4  59  ? -67.271 51.127  -23.657 1.00 35.67  ? 59  LEU D CA  1 
ATOM   8401  C  C   . LEU D  4  59  ? -65.861 50.583  -23.503 1.00 34.80  ? 59  LEU D C   1 
ATOM   8402  O  O   . LEU D  4  59  ? -65.620 49.758  -22.624 1.00 34.26  ? 59  LEU D O   1 
ATOM   8403  C  CB  . LEU D  4  59  ? -68.015 50.425  -24.806 1.00 38.64  ? 59  LEU D CB  1 
ATOM   8404  C  CG  . LEU D  4  59  ? -69.554 50.541  -24.874 1.00 40.42  ? 59  LEU D CG  1 
ATOM   8405  C  CD1 . LEU D  4  59  ? -70.038 50.100  -26.244 1.00 41.28  ? 59  LEU D CD1 1 
ATOM   8406  C  CD2 . LEU D  4  59  ? -70.242 49.709  -23.787 1.00 41.11  ? 59  LEU D CD2 1 
ATOM   8407  N  N   . TYR D  4  60  ? -64.916 51.076  -24.310 1.00 33.81  ? 60  TYR D N   1 
ATOM   8408  C  CA  . TYR D  4  60  ? -63.524 50.641  -24.166 1.00 32.26  ? 60  TYR D CA  1 
ATOM   8409  C  C   . TYR D  4  60  ? -63.059 50.927  -22.746 1.00 29.98  ? 60  TYR D C   1 
ATOM   8410  O  O   . TYR D  4  60  ? -62.556 50.013  -22.091 1.00 29.15  ? 60  TYR D O   1 
ATOM   8411  C  CB  . TYR D  4  60  ? -62.596 51.243  -25.220 1.00 32.42  ? 60  TYR D CB  1 
ATOM   8412  C  CG  . TYR D  4  60  ? -61.200 50.687  -25.152 1.00 34.71  ? 60  TYR D CG  1 
ATOM   8413  C  CD1 . TYR D  4  60  ? -60.870 49.516  -25.801 1.00 37.21  ? 60  TYR D CD1 1 
ATOM   8414  C  CD2 . TYR D  4  60  ? -60.199 51.329  -24.395 1.00 37.34  ? 60  TYR D CD2 1 
ATOM   8415  C  CE1 . TYR D  4  60  ? -59.569 49.001  -25.732 1.00 39.30  ? 60  TYR D CE1 1 
ATOM   8416  C  CE2 . TYR D  4  60  ? -58.902 50.831  -24.317 1.00 36.26  ? 60  TYR D CE2 1 
ATOM   8417  C  CZ  . TYR D  4  60  ? -58.590 49.666  -24.978 1.00 37.92  ? 60  TYR D CZ  1 
ATOM   8418  O  OH  . TYR D  4  60  ? -57.324 49.171  -24.899 1.00 33.96  ? 60  TYR D OH  1 
ATOM   8419  N  N   . ARG D  4  61  ? -63.363 52.131  -22.236 1.00 29.58  ? 61  ARG D N   1 
ATOM   8420  C  CA  . ARG D  4  61  ? -62.929 52.577  -20.897 1.00 29.34  ? 61  ARG D CA  1 
ATOM   8421  C  C   . ARG D  4  61  ? -63.637 52.000  -19.715 1.00 30.67  ? 61  ARG D C   1 
ATOM   8422  O  O   . ARG D  4  61  ? -63.153 52.147  -18.578 1.00 34.41  ? 61  ARG D O   1 
ATOM   8423  C  CB  . ARG D  4  61  ? -62.997 54.082  -20.765 1.00 30.96  ? 61  ARG D CB  1 
ATOM   8424  C  CG  . ARG D  4  61  ? -62.121 54.828  -21.760 1.00 33.05  ? 61  ARG D CG  1 
ATOM   8425  C  CD  . ARG D  4  61  ? -60.660 54.673  -21.426 1.00 34.47  ? 61  ARG D CD  1 
ATOM   8426  N  NE  . ARG D  4  61  ? -59.806 55.457  -22.314 1.00 34.42  ? 61  ARG D NE  1 
ATOM   8427  C  CZ  . ARG D  4  61  ? -58.489 55.304  -22.403 1.00 36.47  ? 61  ARG D CZ  1 
ATOM   8428  N  NH1 . ARG D  4  61  ? -57.841 54.404  -21.646 1.00 37.38  ? 61  ARG D NH1 1 
ATOM   8429  N  NH2 . ARG D  4  61  ? -57.805 56.070  -23.231 1.00 35.86  ? 61  ARG D NH2 1 
ATOM   8430  N  N   . LEU D  4  62  ? -64.787 51.376  -19.944 1.00 31.63  ? 62  LEU D N   1 
ATOM   8431  C  CA  . LEU D  4  62  ? -65.417 50.576  -18.909 1.00 32.10  ? 62  LEU D CA  1 
ATOM   8432  C  C   . LEU D  4  62  ? -64.672 49.256  -18.725 1.00 31.27  ? 62  LEU D C   1 
ATOM   8433  O  O   . LEU D  4  62  ? -64.516 48.772  -17.610 1.00 31.41  ? 62  LEU D O   1 
ATOM   8434  C  CB  . LEU D  4  62  ? -66.918 50.341  -19.220 1.00 36.03  ? 62  LEU D CB  1 
ATOM   8435  C  CG  . LEU D  4  62  ? -67.808 51.584  -19.020 1.00 35.68  ? 62  LEU D CG  1 
ATOM   8436  C  CD1 . LEU D  4  62  ? -69.195 51.344  -19.572 1.00 37.47  ? 62  LEU D CD1 1 
ATOM   8437  C  CD2 . LEU D  4  62  ? -67.876 51.998  -17.556 1.00 35.42  ? 62  LEU D CD2 1 
ATOM   8438  N  N   . LYS D  4  63  ? -64.201 48.685  -19.823 1.00 31.73  ? 63  LYS D N   1 
ATOM   8439  C  CA  . LYS D  4  63  ? -63.573 47.371  -19.805 1.00 31.97  ? 63  LYS D CA  1 
ATOM   8440  C  C   . LYS D  4  63  ? -62.099 47.413  -19.378 1.00 31.74  ? 63  LYS D C   1 
ATOM   8441  O  O   . LYS D  4  63  ? -61.638 46.526  -18.703 1.00 29.04  ? 63  LYS D O   1 
ATOM   8442  C  CB  . LYS D  4  63  ? -63.672 46.802  -21.200 1.00 33.44  ? 63  LYS D CB  1 
ATOM   8443  C  CG  . LYS D  4  63  ? -63.309 45.354  -21.290 1.00 37.46  ? 63  LYS D CG  1 
ATOM   8444  C  CD  . LYS D  4  63  ? -64.346 44.477  -20.641 1.00 38.90  ? 63  LYS D CD  1 
ATOM   8445  C  CE  . LYS D  4  63  ? -64.985 43.530  -21.627 1.00 43.24  ? 63  LYS D CE  1 
ATOM   8446  N  NZ  . LYS D  4  63  ? -64.812 42.128  -21.155 1.00 49.41  ? 63  LYS D NZ  1 
ATOM   8447  N  N   . PHE D  4  64  ? -61.373 48.449  -19.804 1.00 33.42  ? 64  PHE D N   1 
ATOM   8448  C  CA  . PHE D  4  64  ? -59.908 48.531  -19.691 1.00 32.62  ? 64  PHE D CA  1 
ATOM   8449  C  C   . PHE D  4  64  ? -59.509 49.860  -19.135 1.00 33.78  ? 64  PHE D C   1 
ATOM   8450  O  O   . PHE D  4  64  ? -60.202 50.861  -19.365 1.00 32.59  ? 64  PHE D O   1 
ATOM   8451  C  CB  . PHE D  4  64  ? -59.260 48.434  -21.082 1.00 29.93  ? 64  PHE D CB  1 
ATOM   8452  C  CG  . PHE D  4  64  ? -59.643 47.207  -21.839 1.00 27.45  ? 64  PHE D CG  1 
ATOM   8453  C  CD1 . PHE D  4  64  ? -59.240 45.953  -21.401 1.00 27.11  ? 64  PHE D CD1 1 
ATOM   8454  C  CD2 . PHE D  4  64  ? -60.406 47.292  -22.972 1.00 26.47  ? 64  PHE D CD2 1 
ATOM   8455  C  CE1 . PHE D  4  64  ? -59.587 44.805  -22.106 1.00 26.37  ? 64  PHE D CE1 1 
ATOM   8456  C  CE2 . PHE D  4  64  ? -60.751 46.156  -23.667 1.00 26.30  ? 64  PHE D CE2 1 
ATOM   8457  C  CZ  . PHE D  4  64  ? -60.350 44.902  -23.235 1.00 24.99  ? 64  PHE D CZ  1 
ATOM   8458  N  N   . LYS D  4  65  ? -58.346 49.898  -18.492 1.00 36.06  ? 65  LYS D N   1 
ATOM   8459  C  CA  . LYS D  4  65  ? -57.903 51.120  -17.836 1.00 37.15  ? 65  LYS D CA  1 
ATOM   8460  C  C   . LYS D  4  65  ? -57.095 51.918  -18.806 1.00 35.37  ? 65  LYS D C   1 
ATOM   8461  O  O   . LYS D  4  65  ? -57.465 53.033  -19.141 1.00 39.26  ? 65  LYS D O   1 
ATOM   8462  C  CB  . LYS D  4  65  ? -57.144 50.827  -16.571 1.00 39.89  ? 65  LYS D CB  1 
ATOM   8463  C  CG  . LYS D  4  65  ? -56.722 52.077  -15.833 1.00 45.78  ? 65  LYS D CG  1 
ATOM   8464  C  CD  . LYS D  4  65  ? -56.567 51.835  -14.343 1.00 52.27  ? 65  LYS D CD  1 
ATOM   8465  C  CE  . LYS D  4  65  ? -55.296 51.075  -14.006 1.00 59.21  ? 65  LYS D CE  1 
ATOM   8466  N  NZ  . LYS D  4  65  ? -54.183 52.029  -13.794 1.00 66.54  ? 65  LYS D NZ  1 
ATOM   8467  N  N   . GLU D  4  66  ? -56.030 51.326  -19.306 1.00 35.27  ? 66  GLU D N   1 
ATOM   8468  C  CA  . GLU D  4  66  ? -55.146 51.998  -20.230 1.00 36.38  ? 66  GLU D CA  1 
ATOM   8469  C  C   . GLU D  4  66  ? -55.165 51.262  -21.534 1.00 38.64  ? 66  GLU D C   1 
ATOM   8470  O  O   . GLU D  4  66  ? -55.207 50.007  -21.561 1.00 40.06  ? 66  GLU D O   1 
ATOM   8471  C  CB  . GLU D  4  66  ? -53.722 51.989  -19.711 1.00 39.90  ? 66  GLU D CB  1 
ATOM   8472  C  CG  . GLU D  4  66  ? -53.462 52.899  -18.519 1.00 45.45  ? 66  GLU D CG  1 
ATOM   8473  C  CD  . GLU D  4  66  ? -52.011 52.851  -18.084 1.00 46.50  ? 66  GLU D CD  1 
ATOM   8474  O  OE1 . GLU D  4  66  ? -51.307 53.854  -18.282 1.00 44.32  ? 66  GLU D OE1 1 
ATOM   8475  O  OE2 . GLU D  4  66  ? -51.587 51.789  -17.579 1.00 51.14  ? 66  GLU D OE2 1 
ATOM   8476  N  N   . SER D  4  67  ? -55.078 52.029  -22.621 1.00 35.29  ? 67  SER D N   1 
ATOM   8477  C  CA  . SER D  4  67  ? -54.902 51.433  -23.924 1.00 36.90  ? 67  SER D CA  1 
ATOM   8478  C  C   . SER D  4  67  ? -53.443 50.957  -24.086 1.00 37.63  ? 67  SER D C   1 
ATOM   8479  O  O   . SER D  4  67  ? -52.608 51.226  -23.254 1.00 37.27  ? 67  SER D O   1 
ATOM   8480  C  CB  . SER D  4  67  ? -55.260 52.442  -25.000 1.00 37.15  ? 67  SER D CB  1 
ATOM   8481  O  OG  . SER D  4  67  ? -54.296 53.459  -25.043 1.00 37.20  ? 67  SER D OG  1 
ATOM   8482  N  N   . PHE D  4  68  ? -53.128 50.273  -25.176 1.00 37.89  ? 68  PHE D N   1 
ATOM   8483  C  CA  . PHE D  4  68  ? -51.750 49.848  -25.412 1.00 36.01  ? 68  PHE D CA  1 
ATOM   8484  C  C   . PHE D  4  68  ? -50.802 51.053  -25.556 1.00 36.54  ? 68  PHE D C   1 
ATOM   8485  O  O   . PHE D  4  68  ? -49.698 51.053  -25.028 1.00 38.12  ? 68  PHE D O   1 
ATOM   8486  C  CB  . PHE D  4  68  ? -51.670 48.919  -26.630 1.00 34.39  ? 68  PHE D CB  1 
ATOM   8487  C  CG  . PHE D  4  68  ? -51.853 47.477  -26.292 1.00 31.97  ? 68  PHE D CG  1 
ATOM   8488  C  CD1 . PHE D  4  68  ? -53.079 47.012  -25.884 1.00 32.06  ? 68  PHE D CD1 1 
ATOM   8489  C  CD2 . PHE D  4  68  ? -50.789 46.590  -26.396 1.00 31.77  ? 68  PHE D CD2 1 
ATOM   8490  C  CE1 . PHE D  4  68  ? -53.253 45.678  -25.590 1.00 32.83  ? 68  PHE D CE1 1 
ATOM   8491  C  CE2 . PHE D  4  68  ? -50.937 45.268  -26.084 1.00 31.61  ? 68  PHE D CE2 1 
ATOM   8492  C  CZ  . PHE D  4  68  ? -52.179 44.802  -25.677 1.00 33.38  ? 68  PHE D CZ  1 
ATOM   8493  N  N   . ALA D  4  69  ? -51.232 52.071  -26.280 1.00 35.28  ? 69  ALA D N   1 
ATOM   8494  C  CA  . ALA D  4  69  ? -50.432 53.279  -26.429 1.00 37.55  ? 69  ALA D CA  1 
ATOM   8495  C  C   . ALA D  4  69  ? -50.059 53.854  -25.052 1.00 37.77  ? 69  ALA D C   1 
ATOM   8496  O  O   . ALA D  4  69  ? -48.921 54.261  -24.799 1.00 38.68  ? 69  ALA D O   1 
ATOM   8497  C  CB  . ALA D  4  69  ? -51.194 54.320  -27.245 1.00 34.97  ? 69  ALA D CB  1 
ATOM   8498  N  N   . GLU D  4  70  ? -51.037 53.880  -24.168 1.00 37.09  ? 70  GLU D N   1 
ATOM   8499  C  CA  . GLU D  4  70  ? -50.829 54.440  -22.860 1.00 39.86  ? 70  GLU D CA  1 
ATOM   8500  C  C   . GLU D  4  70  ? -49.897 53.520  -22.060 1.00 42.26  ? 70  GLU D C   1 
ATOM   8501  O  O   . GLU D  4  70  ? -48.951 54.000  -21.447 1.00 46.51  ? 70  GLU D O   1 
ATOM   8502  C  CB  . GLU D  4  70  ? -52.157 54.673  -22.159 1.00 37.33  ? 70  GLU D CB  1 
ATOM   8503  C  CG  . GLU D  4  70  ? -52.987 55.761  -22.826 1.00 39.98  ? 70  GLU D CG  1 
ATOM   8504  C  CD  . GLU D  4  70  ? -54.409 55.865  -22.297 1.00 40.85  ? 70  GLU D CD  1 
ATOM   8505  O  OE1 . GLU D  4  70  ? -55.082 56.889  -22.549 1.00 46.45  ? 70  GLU D OE1 1 
ATOM   8506  O  OE2 . GLU D  4  70  ? -54.865 54.936  -21.623 1.00 40.69  ? 70  GLU D OE2 1 
ATOM   8507  N  N   . MET D  4  71  ? -50.123 52.209  -22.108 1.00 39.00  ? 71  MET D N   1 
ATOM   8508  C  CA  . MET D  4  71  ? -49.329 51.301  -21.305 1.00 39.65  ? 71  MET D CA  1 
ATOM   8509  C  C   . MET D  4  71  ? -47.877 51.202  -21.786 1.00 38.36  ? 71  MET D C   1 
ATOM   8510  O  O   . MET D  4  71  ? -47.001 50.987  -20.982 1.00 40.64  ? 71  MET D O   1 
ATOM   8511  C  CB  . MET D  4  71  ? -50.031 49.927  -21.102 1.00 39.50  ? 71  MET D CB  1 
ATOM   8512  C  CG  . MET D  4  71  ? -49.725 48.798  -22.063 1.00 42.75  ? 71  MET D CG  1 
ATOM   8513  S  SD  . MET D  4  71  ? -50.512 47.233  -21.594 1.00 42.99  ? 71  MET D SD  1 
ATOM   8514  C  CE  . MET D  4  71  ? -52.220 47.719  -21.771 1.00 45.34  ? 71  MET D CE  1 
ATOM   8515  N  N   . ASN D  4  72  ? -47.632 51.419  -23.074 1.00 42.35  ? 72  ASN D N   1 
ATOM   8516  C  CA  . ASN D  4  72  ? -46.285 51.331  -23.682 1.00 42.04  ? 72  ASN D CA  1 
ATOM   8517  C  C   . ASN D  4  72  ? -45.609 52.683  -23.846 1.00 41.08  ? 72  ASN D C   1 
ATOM   8518  O  O   . ASN D  4  72  ? -44.629 52.765  -24.534 1.00 41.80  ? 72  ASN D O   1 
ATOM   8519  C  CB  . ASN D  4  72  ? -46.355 50.651  -25.066 1.00 39.01  ? 72  ASN D CB  1 
ATOM   8520  C  CG  . ASN D  4  72  ? -46.924 49.256  -24.992 1.00 40.91  ? 72  ASN D CG  1 
ATOM   8521  O  OD1 . ASN D  4  72  ? -46.779 48.595  -23.973 1.00 41.23  ? 72  ASN D OD1 1 
ATOM   8522  N  ND2 . ASN D  4  72  ? -47.596 48.811  -26.052 1.00 38.92  ? 72  ASN D ND2 1 
ATOM   8523  N  N   . ARG D  4  73  ? -46.124 53.746  -23.242 1.00 45.78  ? 73  ARG D N   1 
ATOM   8524  C  CA  . ARG D  4  73  ? -45.524 55.059  -23.442 1.00 49.62  ? 73  ARG D CA  1 
ATOM   8525  C  C   . ARG D  4  73  ? -44.113 55.079  -22.849 1.00 50.30  ? 73  ARG D C   1 
ATOM   8526  O  O   . ARG D  4  73  ? -43.855 54.428  -21.852 1.00 47.86  ? 73  ARG D O   1 
ATOM   8527  C  CB  . ARG D  4  73  ? -46.398 56.156  -22.827 1.00 53.78  ? 73  ARG D CB  1 
ATOM   8528  C  CG  . ARG D  4  73  ? -46.421 56.216  -21.303 1.00 65.65  ? 73  ARG D CG  1 
ATOM   8529  C  CD  . ARG D  4  73  ? -47.541 57.125  -20.784 1.00 75.83  ? 73  ARG D CD  1 
ATOM   8530  N  NE  . ARG D  4  73  ? -47.566 57.195  -19.315 1.00 90.90  ? 73  ARG D NE  1 
ATOM   8531  C  CZ  . ARG D  4  73  ? -48.110 56.292  -18.485 1.00 101.52 ? 73  ARG D CZ  1 
ATOM   8532  N  NH1 . ARG D  4  73  ? -48.715 55.188  -18.941 1.00 105.90 ? 73  ARG D NH1 1 
ATOM   8533  N  NH2 . ARG D  4  73  ? -48.046 56.495  -17.163 1.00 97.57  ? 73  ARG D NH2 1 
ATOM   8534  N  N   . SER D  4  74  ? -43.194 55.809  -23.468 1.00 55.75  ? 74  SER D N   1 
ATOM   8535  C  CA  . SER D  4  74  ? -41.879 56.043  -22.847 1.00 56.79  ? 74  SER D CA  1 
ATOM   8536  C  C   . SER D  4  74  ? -42.014 57.209  -21.889 1.00 50.45  ? 74  SER D C   1 
ATOM   8537  O  O   . SER D  4  74  ? -42.993 57.940  -21.925 1.00 51.48  ? 74  SER D O   1 
ATOM   8538  C  CB  . SER D  4  74  ? -40.808 56.324  -23.891 1.00 60.01  ? 74  SER D CB  1 
ATOM   8539  O  OG  . SER D  4  74  ? -41.256 57.338  -24.770 1.00 72.47  ? 74  SER D OG  1 
ATOM   8540  N  N   . THR D  4  75  ? -41.039 57.331  -21.003 1.00 47.51  ? 75  THR D N   1 
ATOM   8541  C  CA  . THR D  4  75  ? -40.999 58.374  -19.996 1.00 49.68  ? 75  THR D CA  1 
ATOM   8542  C  C   . THR D  4  75  ? -39.620 58.977  -19.988 1.00 44.18  ? 75  THR D C   1 
ATOM   8543  O  O   . THR D  4  75  ? -38.703 58.458  -20.620 1.00 40.70  ? 75  THR D O   1 
ATOM   8544  C  CB  . THR D  4  75  ? -41.268 57.806  -18.589 1.00 57.58  ? 75  THR D CB  1 
ATOM   8545  O  OG1 . THR D  4  75  ? -40.320 56.758  -18.293 1.00 56.18  ? 75  THR D OG1 1 
ATOM   8546  C  CG2 . THR D  4  75  ? -42.709 57.285  -18.493 1.00 62.32  ? 75  THR D CG2 1 
ATOM   8547  N  N   . ASN D  4  76  ? -39.489 60.052  -19.234 1.00 41.79  ? 76  ASN D N   1 
ATOM   8548  C  CA  . ASN D  4  76  ? -38.215 60.715  -19.039 1.00 46.32  ? 76  ASN D CA  1 
ATOM   8549  C  C   . ASN D  4  76  ? -37.515 60.363  -17.728 1.00 45.93  ? 76  ASN D C   1 
ATOM   8550  O  O   . ASN D  4  76  ? -36.588 61.084  -17.316 1.00 44.44  ? 76  ASN D O   1 
ATOM   8551  C  CB  . ASN D  4  76  ? -38.442 62.226  -19.111 1.00 50.80  ? 76  ASN D CB  1 
ATOM   8552  C  CG  . ASN D  4  76  ? -38.964 62.636  -20.449 1.00 55.58  ? 76  ASN D CG  1 
ATOM   8553  O  OD1 . ASN D  4  76  ? -38.285 62.419  -21.475 1.00 53.84  ? 76  ASN D OD1 1 
ATOM   8554  N  ND2 . ASN D  4  76  ? -40.200 63.155  -20.475 1.00 52.94  ? 76  ASN D ND2 1 
ATOM   8555  N  N   . GLU D  4  77  ? -37.925 59.270  -17.077 1.00 44.68  ? 77  GLU D N   1 
ATOM   8556  C  CA  . GLU D  4  77  ? -37.295 58.856  -15.810 1.00 41.73  ? 77  GLU D CA  1 
ATOM   8557  C  C   . GLU D  4  77  ? -35.764 58.712  -15.943 1.00 35.75  ? 77  GLU D C   1 
ATOM   8558  O  O   . GLU D  4  77  ? -35.056 59.073  -15.003 1.00 34.36  ? 77  GLU D O   1 
ATOM   8559  C  CB  . GLU D  4  77  ? -37.919 57.570  -15.279 1.00 42.56  ? 77  GLU D CB  1 
ATOM   8560  C  CG  . GLU D  4  77  ? -37.527 57.163  -13.861 1.00 41.75  ? 77  GLU D CG  1 
ATOM   8561  C  CD  . GLU D  4  77  ? -37.907 55.725  -13.525 1.00 44.12  ? 77  GLU D CD  1 
ATOM   8562  O  OE1 . GLU D  4  77  ? -38.068 55.445  -12.313 1.00 44.79  ? 77  GLU D OE1 1 
ATOM   8563  O  OE2 . GLU D  4  77  ? -38.038 54.881  -14.464 1.00 39.35  ? 77  GLU D OE2 1 
ATOM   8564  N  N   . TRP D  4  78  ? -35.268 58.273  -17.098 1.00 31.56  ? 78  TRP D N   1 
ATOM   8565  C  CA  . TRP D  4  78  ? -33.842 58.033  -17.279 1.00 37.25  ? 78  TRP D CA  1 
ATOM   8566  C  C   . TRP D  4  78  ? -32.974 59.245  -16.976 1.00 42.62  ? 78  TRP D C   1 
ATOM   8567  O  O   . TRP D  4  78  ? -31.866 59.101  -16.443 1.00 46.19  ? 78  TRP D O   1 
ATOM   8568  C  CB  . TRP D  4  78  ? -33.518 57.495  -18.687 1.00 41.73  ? 78  TRP D CB  1 
ATOM   8569  C  CG  . TRP D  4  78  ? -33.648 58.484  -19.786 1.00 46.80  ? 78  TRP D CG  1 
ATOM   8570  C  CD1 . TRP D  4  78  ? -34.768 58.765  -20.488 1.00 46.35  ? 78  TRP D CD1 1 
ATOM   8571  C  CD2 . TRP D  4  78  ? -32.614 59.335  -20.307 1.00 53.06  ? 78  TRP D CD2 1 
ATOM   8572  N  NE1 . TRP D  4  78  ? -34.513 59.738  -21.409 1.00 52.90  ? 78  TRP D NE1 1 
ATOM   8573  C  CE2 . TRP D  4  78  ? -33.199 60.114  -21.324 1.00 56.20  ? 78  TRP D CE2 1 
ATOM   8574  C  CE3 . TRP D  4  78  ? -31.248 59.517  -20.006 1.00 55.12  ? 78  TRP D CE3 1 
ATOM   8575  C  CZ2 . TRP D  4  78  ? -32.470 61.074  -22.059 1.00 56.77  ? 78  TRP D CZ2 1 
ATOM   8576  C  CZ3 . TRP D  4  78  ? -30.517 60.471  -20.724 1.00 54.01  ? 78  TRP D CZ3 1 
ATOM   8577  C  CH2 . TRP D  4  78  ? -31.134 61.234  -21.745 1.00 59.11  ? 78  TRP D CH2 1 
ATOM   8578  N  N   . LYS D  4  79  ? -33.492 60.420  -17.325 1.00 44.47  ? 79  LYS D N   1 
ATOM   8579  C  CA  . LYS D  4  79  ? -32.837 61.705  -17.101 1.00 43.61  ? 79  LYS D CA  1 
ATOM   8580  C  C   . LYS D  4  79  ? -32.693 61.966  -15.620 1.00 40.85  ? 79  LYS D C   1 
ATOM   8581  O  O   . LYS D  4  79  ? -31.659 62.438  -15.150 1.00 40.93  ? 79  LYS D O   1 
ATOM   8582  C  CB  . LYS D  4  79  ? -33.683 62.843  -17.681 1.00 45.22  ? 79  LYS D CB  1 
ATOM   8583  C  CG  . LYS D  4  79  ? -33.941 62.785  -19.180 1.00 48.44  ? 79  LYS D CG  1 
ATOM   8584  C  CD  . LYS D  4  79  ? -34.624 64.069  -19.581 1.00 51.37  ? 79  LYS D CD  1 
ATOM   8585  C  CE  . LYS D  4  79  ? -35.062 64.060  -21.028 1.00 54.10  ? 79  LYS D CE  1 
ATOM   8586  N  NZ  . LYS D  4  79  ? -36.199 65.013  -21.121 1.00 58.01  ? 79  LYS D NZ  1 
ATOM   8587  N  N   . THR D  4  80  ? -33.764 61.721  -14.894 1.00 35.68  ? 80  THR D N   1 
ATOM   8588  C  CA  . THR D  4  80  ? -33.733 61.899  -13.463 1.00 35.69  ? 80  THR D CA  1 
ATOM   8589  C  C   . THR D  4  80  ? -32.697 60.886  -12.911 1.00 35.53  ? 80  THR D C   1 
ATOM   8590  O  O   . THR D  4  80  ? -31.843 61.243  -12.101 1.00 35.88  ? 80  THR D O   1 
ATOM   8591  C  CB  . THR D  4  80  ? -35.132 61.675  -12.877 1.00 33.86  ? 80  THR D CB  1 
ATOM   8592  O  OG1 . THR D  4  80  ? -36.052 62.550  -13.530 1.00 35.16  ? 80  THR D OG1 1 
ATOM   8593  C  CG2 . THR D  4  80  ? -35.179 61.909  -11.384 1.00 33.59  ? 80  THR D CG2 1 
ATOM   8594  N  N   . VAL D  4  81  ? -32.736 59.651  -13.392 1.00 31.82  ? 81  VAL D N   1 
ATOM   8595  C  CA  . VAL D  4  81  ? -31.872 58.622  -12.842 1.00 33.14  ? 81  VAL D CA  1 
ATOM   8596  C  C   . VAL D  4  81  ? -30.399 58.949  -13.079 1.00 32.90  ? 81  VAL D C   1 
ATOM   8597  O  O   . VAL D  4  81  ? -29.623 58.903  -12.133 1.00 31.32  ? 81  VAL D O   1 
ATOM   8598  C  CB  . VAL D  4  81  ? -32.148 57.214  -13.413 1.00 32.37  ? 81  VAL D CB  1 
ATOM   8599  C  CG1 . VAL D  4  81  ? -31.120 56.212  -12.864 1.00 33.18  ? 81  VAL D CG1 1 
ATOM   8600  C  CG2 . VAL D  4  81  ? -33.552 56.776  -13.044 1.00 34.12  ? 81  VAL D CG2 1 
ATOM   8601  N  N   . VAL D  4  82  ? -30.024 59.240  -14.331 1.00 32.10  ? 82  VAL D N   1 
ATOM   8602  C  CA  . VAL D  4  82  ? -28.636 59.541  -14.661 1.00 32.02  ? 82  VAL D CA  1 
ATOM   8603  C  C   . VAL D  4  82  ? -28.191 60.846  -13.969 1.00 34.70  ? 82  VAL D C   1 
ATOM   8604  O  O   . VAL D  4  82  ? -27.168 60.881  -13.308 1.00 34.67  ? 82  VAL D O   1 
ATOM   8605  C  CB  . VAL D  4  82  ? -28.417 59.638  -16.158 1.00 31.97  ? 82  VAL D CB  1 
ATOM   8606  C  CG1 . VAL D  4  82  ? -27.010 60.176  -16.429 1.00 32.01  ? 82  VAL D CG1 1 
ATOM   8607  C  CG2 . VAL D  4  82  ? -28.626 58.259  -16.812 1.00 31.47  ? 82  VAL D CG2 1 
ATOM   8608  N  N   . GLY D  4  83  ? -29.006 61.886  -14.078 1.00 34.87  ? 83  GLY D N   1 
ATOM   8609  C  CA  . GLY D  4  83  ? -28.744 63.137  -13.416 1.00 35.18  ? 83  GLY D CA  1 
ATOM   8610  C  C   . GLY D  4  83  ? -28.521 62.999  -11.937 1.00 34.43  ? 83  GLY D C   1 
ATOM   8611  O  O   . GLY D  4  83  ? -27.608 63.605  -11.385 1.00 36.65  ? 83  GLY D O   1 
ATOM   8612  N  N   . ALA D  4  84  ? -29.353 62.200  -11.287 1.00 33.22  ? 84  ALA D N   1 
ATOM   8613  C  CA  . ALA D  4  84  ? -29.267 62.071  -9.857  1.00 30.28  ? 84  ALA D CA  1 
ATOM   8614  C  C   . ALA D  4  84  ? -28.044 61.250  -9.497  1.00 32.49  ? 84  ALA D C   1 
ATOM   8615  O  O   . ALA D  4  84  ? -27.337 61.598  -8.571  1.00 32.33  ? 84  ALA D O   1 
ATOM   8616  C  CB  . ALA D  4  84  ? -30.499 61.428  -9.326  1.00 30.55  ? 84  ALA D CB  1 
ATOM   8617  N  N   . ALA D  4  85  ? -27.784 60.180  -10.243 1.00 32.31  ? 85  ALA D N   1 
ATOM   8618  C  CA  . ALA D  4  85  ? -26.620 59.348  -10.024 1.00 33.16  ? 85  ALA D CA  1 
ATOM   8619  C  C   . ALA D  4  85  ? -25.341 60.185  -10.118 1.00 37.02  ? 85  ALA D C   1 
ATOM   8620  O  O   . ALA D  4  85  ? -24.471 60.105  -9.233  1.00 39.50  ? 85  ALA D O   1 
ATOM   8621  C  CB  . ALA D  4  85  ? -26.581 58.223  -11.053 1.00 34.05  ? 85  ALA D CB  1 
ATOM   8622  N  N   . MET D  4  86  ? -25.245 60.986  -11.180 1.00 36.87  ? 86  MET D N   1 
ATOM   8623  C  CA  . MET D  4  86  ? -24.106 61.894  -11.404 1.00 35.87  ? 86  MET D CA  1 
ATOM   8624  C  C   . MET D  4  86  ? -23.983 62.914  -10.301 1.00 34.64  ? 86  MET D C   1 
ATOM   8625  O  O   . MET D  4  86  ? -22.879 63.281  -9.929  1.00 32.84  ? 86  MET D O   1 
ATOM   8626  C  CB  . MET D  4  86  ? -24.214 62.619  -12.748 1.00 39.91  ? 86  MET D CB  1 
ATOM   8627  C  CG  . MET D  4  86  ? -24.130 61.696  -13.958 1.00 42.08  ? 86  MET D CG  1 
ATOM   8628  S  SD  . MET D  4  86  ? -23.225 62.422  -15.305 1.00 52.57  ? 86  MET D SD  1 
ATOM   8629  C  CE  . MET D  4  86  ? -24.386 62.246  -16.645 1.00 52.07  ? 86  MET D CE  1 
ATOM   8630  N  N   . PHE D  4  87  ? -25.101 63.368  -9.758  1.00 35.34  ? 87  PHE D N   1 
ATOM   8631  C  CA  . PHE D  4  87  ? -25.043 64.261  -8.610  1.00 37.18  ? 87  PHE D CA  1 
ATOM   8632  C  C   . PHE D  4  87  ? -24.350 63.585  -7.423  1.00 35.95  ? 87  PHE D C   1 
ATOM   8633  O  O   . PHE D  4  87  ? -23.499 64.176  -6.781  1.00 36.04  ? 87  PHE D O   1 
ATOM   8634  C  CB  . PHE D  4  87  ? -26.438 64.767  -8.199  1.00 39.65  ? 87  PHE D CB  1 
ATOM   8635  C  CG  . PHE D  4  87  ? -26.409 65.654  -6.994  1.00 44.70  ? 87  PHE D CG  1 
ATOM   8636  C  CD1 . PHE D  4  87  ? -26.055 67.001  -7.115  1.00 50.44  ? 87  PHE D CD1 1 
ATOM   8637  C  CD2 . PHE D  4  87  ? -26.689 65.148  -5.725  1.00 51.87  ? 87  PHE D CD2 1 
ATOM   8638  C  CE1 . PHE D  4  87  ? -25.999 67.826  -5.999  1.00 50.04  ? 87  PHE D CE1 1 
ATOM   8639  C  CE2 . PHE D  4  87  ? -26.639 65.975  -4.592  1.00 53.26  ? 87  PHE D CE2 1 
ATOM   8640  C  CZ  . PHE D  4  87  ? -26.288 67.312  -4.735  1.00 51.88  ? 87  PHE D CZ  1 
ATOM   8641  N  N   . PHE D  4  88  ? -24.734 62.350  -7.122  1.00 36.36  ? 88  PHE D N   1 
ATOM   8642  C  CA  . PHE D  4  88  ? -24.275 61.692  -5.906  1.00 34.28  ? 88  PHE D CA  1 
ATOM   8643  C  C   . PHE D  4  88  ? -22.821 61.213  -6.055  1.00 30.66  ? 88  PHE D C   1 
ATOM   8644  O  O   . PHE D  4  88  ? -22.073 61.136  -5.063  1.00 27.73  ? 88  PHE D O   1 
ATOM   8645  C  CB  . PHE D  4  88  ? -25.221 60.555  -5.493  1.00 34.39  ? 88  PHE D CB  1 
ATOM   8646  C  CG  . PHE D  4  88  ? -26.457 61.023  -4.788  1.00 36.78  ? 88  PHE D CG  1 
ATOM   8647  C  CD1 . PHE D  4  88  ? -26.400 61.451  -3.467  1.00 40.20  ? 88  PHE D CD1 1 
ATOM   8648  C  CD2 . PHE D  4  88  ? -27.699 60.997  -5.429  1.00 37.79  ? 88  PHE D CD2 1 
ATOM   8649  C  CE1 . PHE D  4  88  ? -27.559 61.874  -2.799  1.00 43.00  ? 88  PHE D CE1 1 
ATOM   8650  C  CE2 . PHE D  4  88  ? -28.849 61.426  -4.783  1.00 38.18  ? 88  PHE D CE2 1 
ATOM   8651  C  CZ  . PHE D  4  88  ? -28.787 61.870  -3.470  1.00 40.36  ? 88  PHE D CZ  1 
ATOM   8652  N  N   . ILE D  4  89  ? -22.449 60.889  -7.284  1.00 28.70  ? 89  ILE D N   1 
ATOM   8653  C  CA  . ILE D  4  89  ? -21.083 60.602  -7.609  1.00 31.23  ? 89  ILE D CA  1 
ATOM   8654  C  C   . ILE D  4  89  ? -20.260 61.884  -7.393  1.00 34.29  ? 89  ILE D C   1 
ATOM   8655  O  O   . ILE D  4  89  ? -19.235 61.855  -6.724  1.00 36.84  ? 89  ILE D O   1 
ATOM   8656  C  CB  . ILE D  4  89  ? -20.932 60.000  -9.031  1.00 31.45  ? 89  ILE D CB  1 
ATOM   8657  C  CG1 . ILE D  4  89  ? -21.519 58.578  -9.071  1.00 34.18  ? 89  ILE D CG1 1 
ATOM   8658  C  CG2 . ILE D  4  89  ? -19.469 59.894  -9.422  1.00 32.44  ? 89  ILE D CG2 1 
ATOM   8659  C  CD1 . ILE D  4  89  ? -21.779 58.050  -10.474 1.00 34.62  ? 89  ILE D CD1 1 
ATOM   8660  N  N   . GLY D  4  90  ? -20.741 63.006  -7.924  1.00 36.80  ? 90  GLY D N   1 
ATOM   8661  C  CA  . GLY D  4  90  ? -20.144 64.307  -7.691  1.00 34.82  ? 90  GLY D CA  1 
ATOM   8662  C  C   . GLY D  4  90  ? -20.008 64.599  -6.215  1.00 32.90  ? 90  GLY D C   1 
ATOM   8663  O  O   . GLY D  4  90  ? -18.951 65.018  -5.727  1.00 38.16  ? 90  GLY D O   1 
ATOM   8664  N  N   . PHE D  4  91  ? -21.063 64.351  -5.489  1.00 30.61  ? 91  PHE D N   1 
ATOM   8665  C  CA  . PHE D  4  91  ? -21.013 64.489  -4.050  1.00 32.85  ? 91  PHE D CA  1 
ATOM   8666  C  C   . PHE D  4  91  ? -19.900 63.628  -3.413  1.00 33.86  ? 91  PHE D C   1 
ATOM   8667  O  O   . PHE D  4  91  ? -19.254 64.065  -2.437  1.00 29.98  ? 91  PHE D O   1 
ATOM   8668  C  CB  . PHE D  4  91  ? -22.377 64.136  -3.446  1.00 34.53  ? 91  PHE D CB  1 
ATOM   8669  C  CG  . PHE D  4  91  ? -22.339 63.934  -1.971  1.00 34.88  ? 91  PHE D CG  1 
ATOM   8670  C  CD1 . PHE D  4  91  ? -22.407 65.010  -1.126  1.00 32.78  ? 91  PHE D CD1 1 
ATOM   8671  C  CD2 . PHE D  4  91  ? -22.178 62.657  -1.442  1.00 38.58  ? 91  PHE D CD2 1 
ATOM   8672  C  CE1 . PHE D  4  91  ? -22.361 64.821  0.228   1.00 37.37  ? 91  PHE D CE1 1 
ATOM   8673  C  CE2 . PHE D  4  91  ? -22.108 62.456  -0.079  1.00 37.56  ? 91  PHE D CE2 1 
ATOM   8674  C  CZ  . PHE D  4  91  ? -22.201 63.544  0.760   1.00 39.13  ? 91  PHE D CZ  1 
ATOM   8675  N  N   . THR D  4  92  ? -19.713 62.409  -3.927  1.00 31.61  ? 92  THR D N   1 
ATOM   8676  C  CA  . THR D  4  92  ? -18.606 61.574  -3.469  1.00 34.70  ? 92  THR D CA  1 
ATOM   8677  C  C   . THR D  4  92  ? -17.219 62.272  -3.567  1.00 34.83  ? 92  THR D C   1 
ATOM   8678  O  O   . THR D  4  92  ? -16.389 62.155  -2.665  1.00 33.94  ? 92  THR D O   1 
ATOM   8679  C  CB  . THR D  4  92  ? -18.578 60.213  -4.204  1.00 35.02  ? 92  THR D CB  1 
ATOM   8680  O  OG1 . THR D  4  92  ? -19.868 59.597  -4.085  1.00 32.95  ? 92  THR D OG1 1 
ATOM   8681  C  CG2 . THR D  4  92  ? -17.508 59.289  -3.608  1.00 32.53  ? 92  THR D CG2 1 
ATOM   8682  N  N   . ALA D  4  93  ? -16.993 63.033  -4.625  1.00 36.04  ? 93  ALA D N   1 
ATOM   8683  C  CA  . ALA D  4  93  ? -15.732 63.752  -4.774  1.00 38.79  ? 93  ALA D CA  1 
ATOM   8684  C  C   . ALA D  4  93  ? -15.426 64.713  -3.633  1.00 36.10  ? 93  ALA D C   1 
ATOM   8685  O  O   . ALA D  4  93  ? -14.256 64.907  -3.311  1.00 41.38  ? 93  ALA D O   1 
ATOM   8686  C  CB  . ALA D  4  93  ? -15.648 64.457  -6.124  1.00 41.18  ? 93  ALA D CB  1 
ATOM   8687  N  N   . LEU D  4  94  ? -16.452 65.257  -3.003  1.00 33.18  ? 94  LEU D N   1 
ATOM   8688  C  CA  . LEU D  4  94  ? -16.263 66.092  -1.812  1.00 35.19  ? 94  LEU D CA  1 
ATOM   8689  C  C   . LEU D  4  94  ? -15.727 65.316  -0.630  1.00 36.02  ? 94  LEU D C   1 
ATOM   8690  O  O   . LEU D  4  94  ? -14.950 65.837  0.181   1.00 32.72  ? 94  LEU D O   1 
ATOM   8691  C  CB  . LEU D  4  94  ? -17.583 66.753  -1.377  1.00 35.59  ? 94  LEU D CB  1 
ATOM   8692  C  CG  . LEU D  4  94  ? -18.247 67.671  -2.411  1.00 38.48  ? 94  LEU D CG  1 
ATOM   8693  C  CD1 . LEU D  4  94  ? -19.466 68.316  -1.784  1.00 38.65  ? 94  LEU D CD1 1 
ATOM   8694  C  CD2 . LEU D  4  94  ? -17.292 68.728  -2.941  1.00 37.66  ? 94  LEU D CD2 1 
ATOM   8695  N  N   . LEU D  4  95  ? -16.210 64.088  -0.483  1.00 36.58  ? 95  LEU D N   1 
ATOM   8696  C  CA  . LEU D  4  95  ? -15.757 63.257  0.607   1.00 36.64  ? 95  LEU D CA  1 
ATOM   8697  C  C   . LEU D  4  95  ? -14.236 62.976  0.447   1.00 33.19  ? 95  LEU D C   1 
ATOM   8698  O  O   . LEU D  4  95  ? -13.493 63.008  1.407   1.00 29.29  ? 95  LEU D O   1 
ATOM   8699  C  CB  . LEU D  4  95  ? -16.576 61.965  0.660   1.00 35.95  ? 95  LEU D CB  1 
ATOM   8700  C  CG  . LEU D  4  95  ? -18.067 62.120  0.959   1.00 37.68  ? 95  LEU D CG  1 
ATOM   8701  C  CD1 . LEU D  4  95  ? -18.710 60.757  1.167   1.00 36.86  ? 95  LEU D CD1 1 
ATOM   8702  C  CD2 . LEU D  4  95  ? -18.335 63.014  2.162   1.00 37.68  ? 95  LEU D CD2 1 
ATOM   8703  N  N   . LEU D  4  96  ? -13.825 62.708  -0.781  1.00 31.39  ? 96  LEU D N   1 
ATOM   8704  C  CA  . LEU D  4  96  ? -12.444 62.487  -1.138  1.00 33.04  ? 96  LEU D CA  1 
ATOM   8705  C  C   . LEU D  4  96  ? -11.555 63.732  -0.981  1.00 33.52  ? 96  LEU D C   1 
ATOM   8706  O  O   . LEU D  4  96  ? -10.394 63.607  -0.619  1.00 35.12  ? 96  LEU D O   1 
ATOM   8707  C  CB  . LEU D  4  96  ? -12.378 61.970  -2.584  1.00 32.73  ? 96  LEU D CB  1 
ATOM   8708  C  CG  . LEU D  4  96  ? -12.935 60.553  -2.737  1.00 30.24  ? 96  LEU D CG  1 
ATOM   8709  C  CD1 . LEU D  4  96  ? -13.266 60.248  -4.193  1.00 30.14  ? 96  LEU D CD1 1 
ATOM   8710  C  CD2 . LEU D  4  96  ? -11.918 59.579  -2.169  1.00 31.04  ? 96  LEU D CD2 1 
ATOM   8711  N  N   . ILE D  4  97  ? -12.101 64.912  -1.266  1.00 36.55  ? 97  ILE D N   1 
ATOM   8712  C  CA  . ILE D  4  97  ? -11.406 66.197  -1.023  1.00 35.96  ? 97  ILE D CA  1 
ATOM   8713  C  C   . ILE D  4  97  ? -11.173 66.357  0.455   1.00 33.40  ? 97  ILE D C   1 
ATOM   8714  O  O   . ILE D  4  97  ? -10.047 66.614  0.901   1.00 35.12  ? 97  ILE D O   1 
ATOM   8715  C  CB  . ILE D  4  97  ? -12.173 67.431  -1.549  1.00 35.58  ? 97  ILE D CB  1 
ATOM   8716  C  CG1 . ILE D  4  97  ? -12.093 67.489  -3.066  1.00 36.76  ? 97  ILE D CG1 1 
ATOM   8717  C  CG2 . ILE D  4  97  ? -11.572 68.721  -0.993  1.00 36.49  ? 97  ILE D CG2 1 
ATOM   8718  C  CD1 . ILE D  4  97  ? -13.165 68.366  -3.682  1.00 38.59  ? 97  ILE D CD1 1 
ATOM   8719  N  N   . TRP D  4  98  ? -12.229 66.202  1.212   1.00 31.00  ? 98  TRP D N   1 
ATOM   8720  C  CA  . TRP D  4  98  ? -12.091 66.200  2.638   1.00 33.39  ? 98  TRP D CA  1 
ATOM   8721  C  C   . TRP D  4  98  ? -11.004 65.193  3.067   1.00 35.25  ? 98  TRP D C   1 
ATOM   8722  O  O   . TRP D  4  98  ? -10.184 65.506  3.950   1.00 34.80  ? 98  TRP D O   1 
ATOM   8723  C  CB  . TRP D  4  98  ? -13.429 65.882  3.285   1.00 32.68  ? 98  TRP D CB  1 
ATOM   8724  C  CG  . TRP D  4  98  ? -13.425 65.969  4.757   1.00 32.21  ? 98  TRP D CG  1 
ATOM   8725  C  CD1 . TRP D  4  98  ? -13.795 67.030  5.514   1.00 33.20  ? 98  TRP D CD1 1 
ATOM   8726  C  CD2 . TRP D  4  98  ? -13.052 64.940  5.655   1.00 32.64  ? 98  TRP D CD2 1 
ATOM   8727  N  NE1 . TRP D  4  98  ? -13.661 66.728  6.849   1.00 34.18  ? 98  TRP D NE1 1 
ATOM   8728  C  CE2 . TRP D  4  98  ? -13.188 65.449  6.956   1.00 33.75  ? 98  TRP D CE2 1 
ATOM   8729  C  CE3 . TRP D  4  98  ? -12.605 63.629  5.490   1.00 35.25  ? 98  TRP D CE3 1 
ATOM   8730  C  CZ2 . TRP D  4  98  ? -12.907 64.691  8.082   1.00 34.83  ? 98  TRP D CZ2 1 
ATOM   8731  C  CZ3 . TRP D  4  98  ? -12.330 62.871  6.622   1.00 34.66  ? 98  TRP D CZ3 1 
ATOM   8732  C  CH2 . TRP D  4  98  ? -12.478 63.405  7.889   1.00 34.36  ? 98  TRP D CH2 1 
ATOM   8733  N  N   . GLU D  4  99  ? -11.005 64.002  2.465   1.00 33.00  ? 99  GLU D N   1 
ATOM   8734  C  CA  . GLU D  4  99  ? -10.096 62.953  2.911   1.00 33.52  ? 99  GLU D CA  1 
ATOM   8735  C  C   . GLU D  4  99  ? -8.634  63.393  2.745   1.00 31.85  ? 99  GLU D C   1 
ATOM   8736  O  O   . GLU D  4  99  ? -7.855  63.284  3.665   1.00 30.34  ? 99  GLU D O   1 
ATOM   8737  C  CB  . GLU D  4  99  ? -10.350 61.613  2.185   1.00 33.52  ? 99  GLU D CB  1 
ATOM   8738  C  CG  . GLU D  4  99  ? -9.734  60.378  2.874   1.00 32.98  ? 99  GLU D CG  1 
ATOM   8739  C  CD  . GLU D  4  99  ? -9.581  59.147  1.977   1.00 35.26  ? 99  GLU D CD  1 
ATOM   8740  O  OE1 . GLU D  4  99  ? -9.498  59.247  0.731   1.00 33.36  ? 99  GLU D OE1 1 
ATOM   8741  O  OE2 . GLU D  4  99  ? -9.540  58.031  2.533   1.00 40.05  ? 99  GLU D OE2 1 
ATOM   8742  N  N   . LYS D  4  100 ? -8.284  63.883  1.573   1.00 34.32  ? 100 LYS D N   1 
ATOM   8743  C  CA  . LYS D  4  100 ? -6.919  64.346  1.291   1.00 40.46  ? 100 LYS D CA  1 
ATOM   8744  C  C   . LYS D  4  100 ? -6.457  65.454  2.224   1.00 39.12  ? 100 LYS D C   1 
ATOM   8745  O  O   . LYS D  4  100 ? -5.323  65.464  2.663   1.00 40.64  ? 100 LYS D O   1 
ATOM   8746  C  CB  . LYS D  4  100 ? -6.822  64.857  -0.143  1.00 42.57  ? 100 LYS D CB  1 
ATOM   8747  C  CG  . LYS D  4  100 ? -5.420  65.230  -0.612  1.00 47.23  ? 100 LYS D CG  1 
ATOM   8748  C  CD  . LYS D  4  100 ? -4.698  64.004  -1.164  1.00 55.44  ? 100 LYS D CD  1 
ATOM   8749  C  CE  . LYS D  4  100 ? -3.338  64.341  -1.741  1.00 58.20  ? 100 LYS D CE  1 
ATOM   8750  N  NZ  . LYS D  4  100 ? -2.476  64.942  -0.695  1.00 64.67  ? 100 LYS D NZ  1 
ATOM   8751  N  N   . HIS D  4  101 ? -7.345  66.383  2.500   1.00 43.62  ? 101 HIS D N   1 
ATOM   8752  C  CA  . HIS D  4  101 ? -7.000  67.576  3.231   1.00 50.54  ? 101 HIS D CA  1 
ATOM   8753  C  C   . HIS D  4  101 ? -6.790  67.235  4.700   1.00 47.37  ? 101 HIS D C   1 
ATOM   8754  O  O   . HIS D  4  101 ? -5.753  67.559  5.250   1.00 57.92  ? 101 HIS D O   1 
ATOM   8755  C  CB  . HIS D  4  101 ? -8.070  68.678  3.029   1.00 57.52  ? 101 HIS D CB  1 
ATOM   8756  C  CG  . HIS D  4  101 ? -7.634  70.050  3.462   1.00 71.72  ? 101 HIS D CG  1 
ATOM   8757  N  ND1 . HIS D  4  101 ? -6.701  70.793  2.765   1.00 81.41  ? 101 HIS D ND1 1 
ATOM   8758  C  CD2 . HIS D  4  101 ? -8.017  70.819  4.513   1.00 77.30  ? 101 HIS D CD2 1 
ATOM   8759  C  CE1 . HIS D  4  101 ? -6.520  71.953  3.377   1.00 85.21  ? 101 HIS D CE1 1 
ATOM   8760  N  NE2 . HIS D  4  101 ? -7.310  71.996  4.438   1.00 81.53  ? 101 HIS D NE2 1 
ATOM   8761  N  N   . TYR D  4  102 ? -7.734  66.538  5.311   1.00 43.34  ? 102 TYR D N   1 
ATOM   8762  C  CA  . TYR D  4  102 ? -7.757  66.362  6.748   1.00 42.99  ? 102 TYR D CA  1 
ATOM   8763  C  C   . TYR D  4  102 ? -7.223  65.028  7.280   1.00 43.45  ? 102 TYR D C   1 
ATOM   8764  O  O   . TYR D  4  102 ? -6.971  64.924  8.475   1.00 50.48  ? 102 TYR D O   1 
ATOM   8765  C  CB  . TYR D  4  102 ? -9.191  66.548  7.239   1.00 50.07  ? 102 TYR D CB  1 
ATOM   8766  C  CG  . TYR D  4  102 ? -9.698  67.968  7.164   1.00 60.73  ? 102 TYR D CG  1 
ATOM   8767  C  CD1 . TYR D  4  102 ? -9.264  68.923  8.083   1.00 61.40  ? 102 TYR D CD1 1 
ATOM   8768  C  CD2 . TYR D  4  102 ? -10.629 68.364  6.189   1.00 67.62  ? 102 TYR D CD2 1 
ATOM   8769  C  CE1 . TYR D  4  102 ? -9.722  70.231  8.036   1.00 70.53  ? 102 TYR D CE1 1 
ATOM   8770  C  CE2 . TYR D  4  102 ? -11.096 69.682  6.132   1.00 74.21  ? 102 TYR D CE2 1 
ATOM   8771  C  CZ  . TYR D  4  102 ? -10.642 70.618  7.065   1.00 77.74  ? 102 TYR D CZ  1 
ATOM   8772  O  OH  . TYR D  4  102 ? -11.078 71.938  7.052   1.00 79.26  ? 102 TYR D OH  1 
ATOM   8773  N  N   . VAL D  4  103 ? -7.079  64.008  6.433   1.00 40.21  ? 103 VAL D N   1 
ATOM   8774  C  CA  . VAL D  4  103 ? -6.742  62.650  6.877   1.00 35.66  ? 103 VAL D CA  1 
ATOM   8775  C  C   . VAL D  4  103 ? -5.378  62.221  6.368   1.00 36.34  ? 103 VAL D C   1 
ATOM   8776  O  O   . VAL D  4  103 ? -4.590  61.620  7.116   1.00 38.44  ? 103 VAL D O   1 
ATOM   8777  C  CB  . VAL D  4  103 ? -7.802  61.602  6.402   1.00 35.38  ? 103 VAL D CB  1 
ATOM   8778  C  CG1 . VAL D  4  103 ? -7.422  60.192  6.809   1.00 33.20  ? 103 VAL D CG1 1 
ATOM   8779  C  CG2 . VAL D  4  103 ? -9.184  61.941  6.956   1.00 37.31  ? 103 VAL D CG2 1 
ATOM   8780  N  N   . TYR D  4  104 ? -5.120  62.435  5.087   1.00 34.20  ? 104 TYR D N   1 
ATOM   8781  C  CA  . TYR D  4  104 ? -3.871  61.967  4.510   1.00 36.28  ? 104 TYR D CA  1 
ATOM   8782  C  C   . TYR D  4  104 ? -2.789  62.976  4.782   1.00 37.83  ? 104 TYR D C   1 
ATOM   8783  O  O   . TYR D  4  104 ? -2.930  64.155  4.460   1.00 39.26  ? 104 TYR D O   1 
ATOM   8784  C  CB  . TYR D  4  104 ? -3.942  61.770  2.985   1.00 36.26  ? 104 TYR D CB  1 
ATOM   8785  C  CG  . TYR D  4  104 ? -4.659  60.538  2.508   1.00 34.96  ? 104 TYR D CG  1 
ATOM   8786  C  CD1 . TYR D  4  104 ? -4.555  59.328  3.194   1.00 36.32  ? 104 TYR D CD1 1 
ATOM   8787  C  CD2 . TYR D  4  104 ? -5.384  60.558  1.344   1.00 32.79  ? 104 TYR D CD2 1 
ATOM   8788  C  CE1 . TYR D  4  104 ? -5.193  58.190  2.749   1.00 36.35  ? 104 TYR D CE1 1 
ATOM   8789  C  CE2 . TYR D  4  104 ? -6.019  59.412  0.885   1.00 35.13  ? 104 TYR D CE2 1 
ATOM   8790  C  CZ  . TYR D  4  104 ? -5.931  58.228  1.604   1.00 34.79  ? 104 TYR D CZ  1 
ATOM   8791  O  OH  . TYR D  4  104 ? -6.530  57.065  1.177   1.00 31.24  ? 104 TYR D OH  1 
ATOM   8792  N  N   . GLY D  4  105 ? -1.699  62.486  5.351   1.00 38.48  ? 105 GLY D N   1 
ATOM   8793  C  CA  . GLY D  4  105 ? -0.488  63.251  5.478   1.00 39.52  ? 105 GLY D CA  1 
ATOM   8794  C  C   . GLY D  4  105 ? 0.313   63.187  4.208   1.00 40.95  ? 105 GLY D C   1 
ATOM   8795  O  O   . GLY D  4  105 ? -0.155  62.704  3.200   1.00 39.93  ? 105 GLY D O   1 
ATOM   8796  N  N   . PRO D  4  106 ? 1.539   63.695  4.253   1.00 47.07  ? 106 PRO D N   1 
ATOM   8797  C  CA  . PRO D  4  106 ? 2.319   63.794  3.034   1.00 46.69  ? 106 PRO D CA  1 
ATOM   8798  C  C   . PRO D  4  106 ? 2.843   62.459  2.563   1.00 42.75  ? 106 PRO D C   1 
ATOM   8799  O  O   . PRO D  4  106 ? 3.108   61.587  3.381   1.00 37.85  ? 106 PRO D O   1 
ATOM   8800  C  CB  . PRO D  4  106 ? 3.482   64.704  3.439   1.00 47.83  ? 106 PRO D CB  1 
ATOM   8801  C  CG  . PRO D  4  106 ? 3.597   64.526  4.893   1.00 47.98  ? 106 PRO D CG  1 
ATOM   8802  C  CD  . PRO D  4  106 ? 2.196   64.378  5.384   1.00 49.41  ? 106 PRO D CD  1 
ATOM   8803  N  N   . ILE D  4  107 ? 2.998   62.343  1.242   1.00 41.15  ? 107 ILE D N   1 
ATOM   8804  C  CA  . ILE D  4  107 ? 3.477   61.128  0.612   1.00 41.82  ? 107 ILE D CA  1 
ATOM   8805  C  C   . ILE D  4  107 ? 5.011   61.064  0.622   1.00 41.04  ? 107 ILE D C   1 
ATOM   8806  O  O   . ILE D  4  107 ? 5.671   62.080  0.789   1.00 36.18  ? 107 ILE D O   1 
ATOM   8807  C  CB  . ILE D  4  107 ? 2.929   60.965  -0.825  1.00 43.69  ? 107 ILE D CB  1 
ATOM   8808  C  CG1 . ILE D  4  107 ? 3.497   61.999  -1.791  1.00 41.16  ? 107 ILE D CG1 1 
ATOM   8809  C  CG2 . ILE D  4  107 ? 1.406   60.999  -0.838  1.00 43.78  ? 107 ILE D CG2 1 
ATOM   8810  C  CD1 . ILE D  4  107 ? 3.014   61.743  -3.192  1.00 42.33  ? 107 ILE D CD1 1 
ATOM   8811  N  N   . PRO D  4  108 ? 5.583   59.860  0.450   1.00 43.72  ? 108 PRO D N   1 
ATOM   8812  C  CA  . PRO D  4  108 ? 7.045   59.739  0.588   1.00 41.88  ? 108 PRO D CA  1 
ATOM   8813  C  C   . PRO D  4  108 ? 7.887   60.603  -0.366  1.00 39.13  ? 108 PRO D C   1 
ATOM   8814  O  O   . PRO D  4  108 ? 7.487   60.935  -1.499  1.00 36.02  ? 108 PRO D O   1 
ATOM   8815  C  CB  . PRO D  4  108 ? 7.303   58.244  0.343   1.00 44.19  ? 108 PRO D CB  1 
ATOM   8816  C  CG  . PRO D  4  108 ? 6.022   57.573  0.691   1.00 44.66  ? 108 PRO D CG  1 
ATOM   8817  C  CD  . PRO D  4  108 ? 4.940   58.541  0.293   1.00 44.30  ? 108 PRO D CD  1 
ATOM   8818  N  N   . HIS D  4  109 ? 9.067   60.950  0.129   1.00 37.19  ? 109 HIS D N   1 
ATOM   8819  C  CA  . HIS D  4  109 ? 9.997   61.820  -0.587  1.00 35.08  ? 109 HIS D CA  1 
ATOM   8820  C  C   . HIS D  4  109 ? 10.462  61.240  -1.921  1.00 34.11  ? 109 HIS D C   1 
ATOM   8821  O  O   . HIS D  4  109 ? 10.948  61.978  -2.773  1.00 35.78  ? 109 HIS D O   1 
ATOM   8822  C  CB  . HIS D  4  109 ? 11.194  62.137  0.293   1.00 34.14  ? 109 HIS D CB  1 
ATOM   8823  C  CG  . HIS D  4  109 ? 12.152  61.002  0.410   1.00 35.09  ? 109 HIS D CG  1 
ATOM   8824  N  ND1 . HIS D  4  109 ? 12.127  60.114  1.464   1.00 35.48  ? 109 HIS D ND1 1 
ATOM   8825  C  CD2 . HIS D  4  109 ? 13.146  60.591  -0.412  1.00 34.22  ? 109 HIS D CD2 1 
ATOM   8826  C  CE1 . HIS D  4  109 ? 13.076  59.215  1.296   1.00 34.97  ? 109 HIS D CE1 1 
ATOM   8827  N  NE2 . HIS D  4  109 ? 13.706  59.479  0.162   1.00 35.20  ? 109 HIS D NE2 1 
ATOM   8828  N  N   . THR D  4  110 ? 10.294  59.928  -2.117  1.00 35.46  ? 110 THR D N   1 
ATOM   8829  C  CA  . THR D  4  110 ? 10.587  59.276  -3.394  1.00 32.14  ? 110 THR D CA  1 
ATOM   8830  C  C   . THR D  4  110 ? 9.679   59.725  -4.539  1.00 31.40  ? 110 THR D C   1 
ATOM   8831  O  O   . THR D  4  110 ? 9.900   59.337  -5.701  1.00 30.32  ? 110 THR D O   1 
ATOM   8832  C  CB  . THR D  4  110 ? 10.484  57.743  -3.257  1.00 34.53  ? 110 THR D CB  1 
ATOM   8833  O  OG1 . THR D  4  110 ? 9.191   57.374  -2.738  1.00 32.34  ? 110 THR D OG1 1 
ATOM   8834  C  CG2 . THR D  4  110 ? 11.544  57.253  -2.338  1.00 34.22  ? 110 THR D CG2 1 
ATOM   8835  N  N   . PHE D  4  111 ? 8.643   60.500  -4.221  1.00 32.46  ? 111 PHE D N   1 
ATOM   8836  C  CA  . PHE D  4  111 ? 7.770   61.105  -5.244  1.00 33.89  ? 111 PHE D CA  1 
ATOM   8837  C  C   . PHE D  4  111 ? 8.163   62.536  -5.660  1.00 32.93  ? 111 PHE D C   1 
ATOM   8838  O  O   . PHE D  4  111 ? 7.634   63.062  -6.642  1.00 31.30  ? 111 PHE D O   1 
ATOM   8839  C  CB  . PHE D  4  111 ? 6.294   61.045  -4.782  1.00 33.15  ? 111 PHE D CB  1 
ATOM   8840  C  CG  . PHE D  4  111 ? 5.750   59.647  -4.692  1.00 32.02  ? 111 PHE D CG  1 
ATOM   8841  C  CD1 . PHE D  4  111 ? 5.230   59.032  -5.807  1.00 30.30  ? 111 PHE D CD1 1 
ATOM   8842  C  CD2 . PHE D  4  111 ? 5.792   58.936  -3.490  1.00 33.54  ? 111 PHE D CD2 1 
ATOM   8843  C  CE1 . PHE D  4  111 ? 4.726   57.745  -5.730  1.00 31.99  ? 111 PHE D CE1 1 
ATOM   8844  C  CE2 . PHE D  4  111 ? 5.331   57.631  -3.415  1.00 32.98  ? 111 PHE D CE2 1 
ATOM   8845  C  CZ  . PHE D  4  111 ? 4.797   57.037  -4.547  1.00 32.51  ? 111 PHE D CZ  1 
ATOM   8846  N  N   . GLU D  4  112 ? 9.108   63.148  -4.951  1.00 36.12  ? 112 GLU D N   1 
ATOM   8847  C  CA  . GLU D  4  112 ? 9.640   64.456  -5.358  1.00 38.90  ? 112 GLU D CA  1 
ATOM   8848  C  C   . GLU D  4  112 ? 10.179  64.380  -6.777  1.00 38.03  ? 112 GLU D C   1 
ATOM   8849  O  O   . GLU D  4  112 ? 10.663  63.354  -7.204  1.00 35.82  ? 112 GLU D O   1 
ATOM   8850  C  CB  . GLU D  4  112 ? 10.682  64.957  -4.366  1.00 44.69  ? 112 GLU D CB  1 
ATOM   8851  C  CG  . GLU D  4  112 ? 10.093  65.413  -3.017  1.00 54.06  ? 112 GLU D CG  1 
ATOM   8852  C  CD  . GLU D  4  112 ? 11.144  65.998  -2.052  1.00 66.97  ? 112 GLU D CD  1 
ATOM   8853  O  OE1 . GLU D  4  112 ? 12.137  66.581  -2.553  1.00 79.94  ? 112 GLU D OE1 1 
ATOM   8854  O  OE2 . GLU D  4  112 ? 10.990  65.892  -0.797  1.00 66.14  ? 112 GLU D OE2 1 
ATOM   8855  N  N   . GLU D  4  113 ? 10.033  65.450  -7.539  1.00 44.30  ? 113 GLU D N   1 
ATOM   8856  C  CA  . GLU D  4  113 ? 10.505  65.455  -8.938  1.00 49.54  ? 113 GLU D CA  1 
ATOM   8857  C  C   . GLU D  4  113 ? 11.980  64.988  -9.153  1.00 45.11  ? 113 GLU D C   1 
ATOM   8858  O  O   . GLU D  4  113 ? 12.276  64.174  -10.044 1.00 40.79  ? 113 GLU D O   1 
ATOM   8859  C  CB  . GLU D  4  113 ? 10.315  66.844  -9.515  1.00 58.35  ? 113 GLU D CB  1 
ATOM   8860  C  CG  . GLU D  4  113 ? 10.342  66.874  -11.027 1.00 68.78  ? 113 GLU D CG  1 
ATOM   8861  C  CD  . GLU D  4  113 ? 10.169  68.275  -11.557 1.00 77.66  ? 113 GLU D CD  1 
ATOM   8862  O  OE1 . GLU D  4  113 ? 9.568   69.121  -10.837 1.00 79.18  ? 113 GLU D OE1 1 
ATOM   8863  O  OE2 . GLU D  4  113 ? 10.648  68.512  -12.689 1.00 77.65  ? 113 GLU D OE2 1 
ATOM   8864  N  N   . GLU D  4  114 ? 12.885  65.482  -8.319  1.00 43.11  ? 114 GLU D N   1 
ATOM   8865  C  CA  . GLU D  4  114 ? 14.295  65.131  -8.453  1.00 48.37  ? 114 GLU D CA  1 
ATOM   8866  C  C   . GLU D  4  114 ? 14.516  63.609  -8.305  1.00 40.45  ? 114 GLU D C   1 
ATOM   8867  O  O   . GLU D  4  114 ? 15.195  62.982  -9.138  1.00 37.27  ? 114 GLU D O   1 
ATOM   8868  C  CB  . GLU D  4  114 ? 15.169  65.924  -7.458  1.00 58.15  ? 114 GLU D CB  1 
ATOM   8869  C  CG  . GLU D  4  114 ? 16.604  66.140  -7.954  1.00 67.86  ? 114 GLU D CG  1 
ATOM   8870  C  CD  . GLU D  4  114 ? 17.621  66.372  -6.839  1.00 78.39  ? 114 GLU D CD  1 
ATOM   8871  O  OE1 . GLU D  4  114 ? 18.398  67.341  -6.946  1.00 81.03  ? 114 GLU D OE1 1 
ATOM   8872  O  OE2 . GLU D  4  114 ? 17.662  65.582  -5.862  1.00 92.85  ? 114 GLU D OE2 1 
ATOM   8873  N  N   . TRP D  4  115 ? 13.909  63.024  -7.283  1.00 34.54  ? 115 TRP D N   1 
ATOM   8874  C  CA  . TRP D  4  115 ? 14.006  61.578  -7.051  1.00 34.49  ? 115 TRP D CA  1 
ATOM   8875  C  C   . TRP D  4  115 ? 13.487  60.784  -8.244  1.00 33.85  ? 115 TRP D C   1 
ATOM   8876  O  O   . TRP D  4  115 ? 14.160  59.878  -8.746  1.00 37.33  ? 115 TRP D O   1 
ATOM   8877  C  CB  . TRP D  4  115 ? 13.244  61.173  -5.787  1.00 35.13  ? 115 TRP D CB  1 
ATOM   8878  C  CG  . TRP D  4  115 ? 13.619  59.851  -5.312  1.00 37.56  ? 115 TRP D CG  1 
ATOM   8879  C  CD1 . TRP D  4  115 ? 13.251  58.649  -5.847  1.00 39.25  ? 115 TRP D CD1 1 
ATOM   8880  C  CD2 . TRP D  4  115 ? 14.471  59.553  -4.217  1.00 37.60  ? 115 TRP D CD2 1 
ATOM   8881  N  NE1 . TRP D  4  115 ? 13.824  57.630  -5.148  1.00 40.23  ? 115 TRP D NE1 1 
ATOM   8882  C  CE2 . TRP D  4  115 ? 14.572  58.158  -4.134  1.00 37.36  ? 115 TRP D CE2 1 
ATOM   8883  C  CE3 . TRP D  4  115 ? 15.173  60.329  -3.309  1.00 38.10  ? 115 TRP D CE3 1 
ATOM   8884  C  CZ2 . TRP D  4  115 ? 15.340  57.530  -3.182  1.00 38.67  ? 115 TRP D CZ2 1 
ATOM   8885  C  CZ3 . TRP D  4  115 ? 15.932  59.702  -2.356  1.00 38.53  ? 115 TRP D CZ3 1 
ATOM   8886  C  CH2 . TRP D  4  115 ? 16.010  58.323  -2.294  1.00 39.11  ? 115 TRP D CH2 1 
ATOM   8887  N  N   . VAL D  4  116 ? 12.317  61.150  -8.739  1.00 32.76  ? 116 VAL D N   1 
ATOM   8888  C  CA  . VAL D  4  116 ? 11.740  60.457  -9.902  1.00 32.99  ? 116 VAL D CA  1 
ATOM   8889  C  C   . VAL D  4  116 ? 12.685  60.450  -11.088 1.00 30.56  ? 116 VAL D C   1 
ATOM   8890  O  O   . VAL D  4  116 ? 12.919  59.433  -11.677 1.00 28.21  ? 116 VAL D O   1 
ATOM   8891  C  CB  . VAL D  4  116 ? 10.327  61.026  -10.262 1.00 33.52  ? 116 VAL D CB  1 
ATOM   8892  C  CG1 . VAL D  4  116 ? 9.878   60.592  -11.648 1.00 33.27  ? 116 VAL D CG1 1 
ATOM   8893  C  CG2 . VAL D  4  116 ? 9.328   60.564  -9.216  1.00 33.23  ? 116 VAL D CG2 1 
ATOM   8894  N  N   . ALA D  4  117 ? 13.234  61.607  -11.423 1.00 36.20  ? 117 ALA D N   1 
ATOM   8895  C  CA  . ALA D  4  117 ? 14.198  61.716  -12.540 1.00 36.28  ? 117 ALA D CA  1 
ATOM   8896  C  C   . ALA D  4  117 ? 15.424  60.821  -12.310 1.00 33.54  ? 117 ALA D C   1 
ATOM   8897  O  O   . ALA D  4  117 ? 15.853  60.109  -13.216 1.00 31.59  ? 117 ALA D O   1 
ATOM   8898  C  CB  . ALA D  4  117 ? 14.611  63.174  -12.748 1.00 36.69  ? 117 ALA D CB  1 
ATOM   8899  N  N   . LYS D  4  118 ? 15.944  60.824  -11.091 1.00 31.75  ? 118 LYS D N   1 
ATOM   8900  C  CA  . LYS D  4  118 ? 17.075  59.953  -10.750 1.00 33.88  ? 118 LYS D CA  1 
ATOM   8901  C  C   . LYS D  4  118 ? 16.710  58.483  -10.832 1.00 32.28  ? 118 LYS D C   1 
ATOM   8902  O  O   . LYS D  4  118 ? 17.414  57.693  -11.460 1.00 30.28  ? 118 LYS D O   1 
ATOM   8903  C  CB  . LYS D  4  118 ? 17.655  60.341  -9.381  1.00 36.13  ? 118 LYS D CB  1 
ATOM   8904  C  CG  . LYS D  4  118 ? 18.389  61.680  -9.454  1.00 40.26  ? 118 LYS D CG  1 
ATOM   8905  C  CD  . LYS D  4  118 ? 18.997  62.132  -8.134  1.00 47.14  ? 118 LYS D CD  1 
ATOM   8906  C  CE  . LYS D  4  118 ? 19.908  63.357  -8.294  1.00 51.89  ? 118 LYS D CE  1 
ATOM   8907  N  NZ  . LYS D  4  118 ? 20.992  63.427  -7.268  1.00 54.49  ? 118 LYS D NZ  1 
ATOM   8908  N  N   . GLN D  4  119 ? 15.558  58.151  -10.250 1.00 33.66  ? 119 GLN D N   1 
ATOM   8909  C  CA  . GLN D  4  119 ? 15.005  56.788  -10.240 1.00 30.98  ? 119 GLN D CA  1 
ATOM   8910  C  C   . GLN D  4  119 ? 14.758  56.297  -11.631 1.00 30.15  ? 119 GLN D C   1 
ATOM   8911  O  O   . GLN D  4  119 ? 15.056  55.137  -11.985 1.00 29.33  ? 119 GLN D O   1 
ATOM   8912  C  CB  . GLN D  4  119 ? 13.713  56.808  -9.483  1.00 33.60  ? 119 GLN D CB  1 
ATOM   8913  C  CG  . GLN D  4  119 ? 13.148  55.463  -9.097  1.00 37.11  ? 119 GLN D CG  1 
ATOM   8914  C  CD  . GLN D  4  119 ? 11.963  55.650  -8.161  1.00 37.48  ? 119 GLN D CD  1 
ATOM   8915  O  OE1 . GLN D  4  119 ? 12.120  55.687  -6.930  1.00 37.09  ? 119 GLN D OE1 1 
ATOM   8916  N  NE2 . GLN D  4  119 ? 10.779  55.811  -8.742  1.00 35.94  ? 119 GLN D NE2 1 
ATOM   8917  N  N   . THR D  4  120 ? 14.259  57.200  -12.453 1.00 28.83  ? 120 THR D N   1 
ATOM   8918  C  CA  . THR D  4  120 ? 13.971  56.843  -13.813 1.00 31.17  ? 120 THR D CA  1 
ATOM   8919  C  C   . THR D  4  120 ? 15.240  56.479  -14.587 1.00 32.91  ? 120 THR D C   1 
ATOM   8920  O  O   . THR D  4  120 ? 15.244  55.534  -15.376 1.00 33.85  ? 120 THR D O   1 
ATOM   8921  C  CB  . THR D  4  120 ? 13.233  57.980  -14.507 1.00 31.45  ? 120 THR D CB  1 
ATOM   8922  O  OG1 . THR D  4  120 ? 12.074  58.316  -13.742 1.00 29.59  ? 120 THR D OG1 1 
ATOM   8923  C  CG2 . THR D  4  120 ? 12.839  57.594  -15.920 1.00 32.66  ? 120 THR D CG2 1 
ATOM   8924  N  N   . LYS D  4  121 ? 16.309  57.238  -14.363 1.00 36.76  ? 121 LYS D N   1 
ATOM   8925  C  CA  . LYS D  4  121 ? 17.622  56.951  -14.973 1.00 37.16  ? 121 LYS D CA  1 
ATOM   8926  C  C   . LYS D  4  121 ? 18.164  55.624  -14.461 1.00 34.48  ? 121 LYS D C   1 
ATOM   8927  O  O   . LYS D  4  121 ? 18.593  54.769  -15.260 1.00 33.27  ? 121 LYS D O   1 
ATOM   8928  C  CB  . LYS D  4  121 ? 18.606  58.085  -14.652 1.00 41.10  ? 121 LYS D CB  1 
ATOM   8929  C  CG  . LYS D  4  121 ? 20.049  57.799  -14.993 1.00 46.04  ? 121 LYS D CG  1 
ATOM   8930  C  CD  . LYS D  4  121 ? 20.308  57.637  -16.479 1.00 51.55  ? 121 LYS D CD  1 
ATOM   8931  C  CE  . LYS D  4  121 ? 21.815  57.608  -16.737 1.00 51.55  ? 121 LYS D CE  1 
ATOM   8932  N  NZ  . LYS D  4  121 ? 22.045  57.909  -18.172 1.00 58.00  ? 121 LYS D NZ  1 
ATOM   8933  N  N   . ARG D  4  122 ? 18.137  55.442  -13.137 1.00 31.10  ? 122 ARG D N   1 
ATOM   8934  C  CA  . ARG D  4  122 ? 18.570  54.171  -12.585 1.00 33.03  ? 122 ARG D CA  1 
ATOM   8935  C  C   . ARG D  4  122 ? 17.804  53.005  -13.214 1.00 34.32  ? 122 ARG D C   1 
ATOM   8936  O  O   . ARG D  4  122 ? 18.414  52.023  -13.606 1.00 34.17  ? 122 ARG D O   1 
ATOM   8937  C  CB  . ARG D  4  122 ? 18.452  54.142  -11.076 1.00 32.41  ? 122 ARG D CB  1 
ATOM   8938  C  CG  . ARG D  4  122 ? 18.996  52.855  -10.509 1.00 31.54  ? 122 ARG D CG  1 
ATOM   8939  C  CD  . ARG D  4  122 ? 19.423  53.029  -9.055  1.00 34.68  ? 122 ARG D CD  1 
ATOM   8940  N  NE  . ARG D  4  122 ? 19.742  51.739  -8.435  1.00 37.21  ? 122 ARG D NE  1 
ATOM   8941  C  CZ  . ARG D  4  122 ? 18.863  50.907  -7.840  1.00 38.44  ? 122 ARG D CZ  1 
ATOM   8942  N  NH1 . ARG D  4  122 ? 17.566  51.212  -7.730  1.00 41.14  ? 122 ARG D NH1 1 
ATOM   8943  N  NH2 . ARG D  4  122 ? 19.296  49.757  -7.323  1.00 35.96  ? 122 ARG D NH2 1 
ATOM   8944  N  N   . MET D  4  123 ? 16.484  53.139  -13.353 1.00 34.03  ? 123 MET D N   1 
ATOM   8945  C  CA  . MET D  4  123 ? 15.690  52.087  -13.974 1.00 35.48  ? 123 MET D CA  1 
ATOM   8946  C  C   . MET D  4  123 ? 16.106  51.837  -15.403 1.00 34.39  ? 123 MET D C   1 
ATOM   8947  O  O   . MET D  4  123 ? 16.168  50.666  -15.817 1.00 30.84  ? 123 MET D O   1 
ATOM   8948  C  CB  . MET D  4  123 ? 14.169  52.367  -13.899 1.00 36.91  ? 123 MET D CB  1 
ATOM   8949  C  CG  . MET D  4  123 ? 13.621  52.293  -12.484 1.00 35.65  ? 123 MET D CG  1 
ATOM   8950  S  SD  . MET D  4  123 ? 11.965  52.976  -12.287 1.00 35.59  ? 123 MET D SD  1 
ATOM   8951  C  CE  . MET D  4  123 ? 11.077  51.894  -13.415 1.00 35.26  ? 123 MET D CE  1 
ATOM   8952  N  N   . LEU D  4  124 ? 16.398  52.908  -16.153 1.00 35.85  ? 124 LEU D N   1 
ATOM   8953  C  CA  . LEU D  4  124 ? 16.949  52.750  -17.532 1.00 36.27  ? 124 LEU D CA  1 
ATOM   8954  C  C   . LEU D  4  124 ? 18.341  52.161  -17.506 1.00 35.71  ? 124 LEU D C   1 
ATOM   8955  O  O   . LEU D  4  124 ? 18.683  51.431  -18.423 1.00 36.31  ? 124 LEU D O   1 
ATOM   8956  C  CB  . LEU D  4  124 ? 16.962  54.049  -18.317 1.00 38.42  ? 124 LEU D CB  1 
ATOM   8957  C  CG  . LEU D  4  124 ? 15.573  54.707  -18.578 1.00 42.95  ? 124 LEU D CG  1 
ATOM   8958  C  CD1 . LEU D  4  124 ? 15.754  56.129  -19.097 1.00 45.09  ? 124 LEU D CD1 1 
ATOM   8959  C  CD2 . LEU D  4  124 ? 14.707  53.911  -19.548 1.00 41.93  ? 124 LEU D CD2 1 
ATOM   8960  N  N   . ASP D  4  125 ? 19.126  52.438  -16.454 1.00 35.07  ? 125 ASP D N   1 
ATOM   8961  C  CA  . ASP D  4  125 ? 20.465  51.836  -16.314 1.00 37.16  ? 125 ASP D CA  1 
ATOM   8962  C  C   . ASP D  4  125 ? 20.383  50.349  -16.058 1.00 39.08  ? 125 ASP D C   1 
ATOM   8963  O  O   . ASP D  4  125 ? 21.178  49.574  -16.612 1.00 39.74  ? 125 ASP D O   1 
ATOM   8964  C  CB  . ASP D  4  125 ? 21.292  52.491  -15.208 1.00 36.21  ? 125 ASP D CB  1 
ATOM   8965  C  CG  . ASP D  4  125 ? 21.716  53.898  -15.549 1.00 37.80  ? 125 ASP D CG  1 
ATOM   8966  O  OD1 . ASP D  4  125 ? 21.808  54.206  -16.769 1.00 37.58  ? 125 ASP D OD1 1 
ATOM   8967  O  OD2 . ASP D  4  125 ? 21.961  54.692  -14.594 1.00 36.71  ? 125 ASP D OD2 1 
ATOM   8968  N  N   . MET D  4  126 ? 19.432  49.932  -15.231 1.00 38.49  ? 126 MET D N   1 
ATOM   8969  C  CA  . MET D  4  126 ? 19.247  48.488  -15.022 1.00 40.44  ? 126 MET D CA  1 
ATOM   8970  C  C   . MET D  4  126 ? 18.353  47.827  -16.082 1.00 38.76  ? 126 MET D C   1 
ATOM   8971  O  O   . MET D  4  126 ? 18.104  46.633  -16.004 1.00 38.99  ? 126 MET D O   1 
ATOM   8972  C  CB  . MET D  4  126 ? 18.827  48.185  -13.572 1.00 40.88  ? 126 MET D CB  1 
ATOM   8973  C  CG  . MET D  4  126 ? 17.369  48.248  -13.203 1.00 41.35  ? 126 MET D CG  1 
ATOM   8974  S  SD  . MET D  4  126 ? 17.208  48.220  -11.408 1.00 42.67  ? 126 MET D SD  1 
ATOM   8975  C  CE  . MET D  4  126 ? 16.701  49.879  -11.017 1.00 47.57  ? 126 MET D CE  1 
ATOM   8976  N  N   . LYS D  4  127 ? 17.928  48.590  -17.094 1.00 38.09  ? 127 LYS D N   1 
ATOM   8977  C  CA  . LYS D  4  127 ? 17.186  48.058  -18.238 1.00 39.83  ? 127 LYS D CA  1 
ATOM   8978  C  C   . LYS D  4  127 ? 15.907  47.346  -17.794 1.00 37.62  ? 127 LYS D C   1 
ATOM   8979  O  O   . LYS D  4  127 ? 15.632  46.194  -18.153 1.00 39.93  ? 127 LYS D O   1 
ATOM   8980  C  CB  . LYS D  4  127 ? 18.076  47.152  -19.106 1.00 45.09  ? 127 LYS D CB  1 
ATOM   8981  C  CG  . LYS D  4  127 ? 19.311  47.873  -19.652 1.00 50.17  ? 127 LYS D CG  1 
ATOM   8982  C  CD  . LYS D  4  127 ? 19.562  47.573  -21.126 1.00 52.47  ? 127 LYS D CD  1 
ATOM   8983  C  CE  . LYS D  4  127 ? 20.719  48.409  -21.676 1.00 53.46  ? 127 LYS D CE  1 
ATOM   8984  N  NZ  . LYS D  4  127 ? 22.025  48.017  -21.069 1.00 53.57  ? 127 LYS D NZ  1 
ATOM   8985  N  N   . VAL D  4  128 ? 15.153  48.039  -16.960 1.00 35.51  ? 128 VAL D N   1 
ATOM   8986  C  CA  . VAL D  4  128 ? 13.875  47.554  -16.517 1.00 34.68  ? 128 VAL D CA  1 
ATOM   8987  C  C   . VAL D  4  128 ? 12.973  47.430  -17.746 1.00 36.74  ? 128 VAL D C   1 
ATOM   8988  O  O   . VAL D  4  128 ? 12.736  48.420  -18.492 1.00 34.77  ? 128 VAL D O   1 
ATOM   8989  C  CB  . VAL D  4  128 ? 13.233  48.490  -15.498 1.00 35.74  ? 128 VAL D CB  1 
ATOM   8990  C  CG1 . VAL D  4  128 ? 11.758  48.142  -15.296 1.00 37.83  ? 128 VAL D CG1 1 
ATOM   8991  C  CG2 . VAL D  4  128 ? 13.994  48.449  -14.187 1.00 34.34  ? 128 VAL D CG2 1 
ATOM   8992  N  N   . ALA D  4  129 ? 12.493  46.201  -17.943 1.00 34.46  ? 129 ALA D N   1 
ATOM   8993  C  CA  . ALA D  4  129 ? 11.503  45.888  -18.949 1.00 35.57  ? 129 ALA D CA  1 
ATOM   8994  C  C   . ALA D  4  129 ? 11.978  46.353  -20.330 1.00 34.30  ? 129 ALA D C   1 
ATOM   8995  O  O   . ALA D  4  129 ? 11.436  47.277  -20.897 1.00 29.49  ? 129 ALA D O   1 
ATOM   8996  C  CB  . ALA D  4  129 ? 10.147  46.474  -18.567 1.00 33.90  ? 129 ALA D CB  1 
ATOM   8997  N  N   . PRO D  4  130 ? 13.009  45.684  -20.855 1.00 37.77  ? 130 PRO D N   1 
ATOM   8998  C  CA  . PRO D  4  130 ? 13.678  46.065  -22.096 1.00 38.22  ? 130 PRO D CA  1 
ATOM   8999  C  C   . PRO D  4  130 ? 13.112  45.481  -23.371 1.00 36.93  ? 130 PRO D C   1 
ATOM   9000  O  O   . PRO D  4  130 ? 13.499  45.928  -24.455 1.00 37.47  ? 130 PRO D O   1 
ATOM   9001  C  CB  . PRO D  4  130 ? 15.096  45.530  -21.891 1.00 40.46  ? 130 PRO D CB  1 
ATOM   9002  C  CG  . PRO D  4  130 ? 14.938  44.348  -20.977 1.00 40.34  ? 130 PRO D CG  1 
ATOM   9003  C  CD  . PRO D  4  130 ? 13.642  44.495  -20.239 1.00 39.59  ? 130 PRO D CD  1 
ATOM   9004  N  N   . ILE D  4  131 ? 12.220  44.505  -23.258 1.00 35.23  ? 131 ILE D N   1 
ATOM   9005  C  CA  . ILE D  4  131 ? 11.565  43.947  -24.411 1.00 34.98  ? 131 ILE D CA  1 
ATOM   9006  C  C   . ILE D  4  131 ? 10.391  44.870  -24.856 1.00 33.08  ? 131 ILE D C   1 
ATOM   9007  O  O   . ILE D  4  131 ? 10.281  45.208  -26.025 1.00 33.44  ? 131 ILE D O   1 
ATOM   9008  C  CB  . ILE D  4  131 ? 11.091  42.511  -24.150 1.00 38.82  ? 131 ILE D CB  1 
ATOM   9009  C  CG1 . ILE D  4  131 ? 12.245  41.523  -23.996 1.00 41.46  ? 131 ILE D CG1 1 
ATOM   9010  C  CG2 . ILE D  4  131 ? 10.363  41.983  -25.368 1.00 45.60  ? 131 ILE D CG2 1 
ATOM   9011  C  CD1 . ILE D  4  131 ? 13.253  41.848  -22.946 1.00 46.61  ? 131 ILE D CD1 1 
ATOM   9012  N  N   . GLN D  4  132 ? 9.535   45.280  -23.918 1.00 32.45  ? 132 GLN D N   1 
ATOM   9013  C  CA  . GLN D  4  132 ? 8.331   46.094  -24.190 1.00 32.71  ? 132 GLN D CA  1 
ATOM   9014  C  C   . GLN D  4  132 ? 7.950   47.166  -23.118 1.00 35.09  ? 132 GLN D C   1 
ATOM   9015  O  O   . GLN D  4  132 ? 7.406   48.215  -23.455 1.00 38.60  ? 132 GLN D O   1 
ATOM   9016  C  CB  . GLN D  4  132 ? 7.117   45.180  -24.312 1.00 34.24  ? 132 GLN D CB  1 
ATOM   9017  C  CG  . GLN D  4  132 ? 7.238   43.991  -25.241 1.00 36.74  ? 132 GLN D CG  1 
ATOM   9018  C  CD  . GLN D  4  132 ? 5.909   43.250  -25.395 1.00 39.47  ? 132 GLN D CD  1 
ATOM   9019  O  OE1 . GLN D  4  132 ? 5.477   42.551  -24.462 1.00 41.56  ? 132 GLN D OE1 1 
ATOM   9020  N  NE2 . GLN D  4  132 ? 5.264   43.380  -26.571 1.00 34.70  ? 132 GLN D NE2 1 
ATOM   9021  N  N   . GLY D  4  133 ? 8.196   46.915  -21.841 1.00 32.55  ? 133 GLY D N   1 
ATOM   9022  C  CA  . GLY D  4  133 ? 7.562   47.710  -20.810 1.00 34.14  ? 133 GLY D CA  1 
ATOM   9023  C  C   . GLY D  4  133 ? 8.041   49.139  -20.586 1.00 38.56  ? 133 GLY D C   1 
ATOM   9024  O  O   . GLY D  4  133 ? 7.221   50.067  -20.493 1.00 41.42  ? 133 GLY D O   1 
ATOM   9025  N  N   . PHE D  4  134 ? 9.353   49.333  -20.492 1.00 39.79  ? 134 PHE D N   1 
ATOM   9026  C  CA  . PHE D  4  134 ? 9.905   50.590  -20.000 1.00 41.92  ? 134 PHE D CA  1 
ATOM   9027  C  C   . PHE D  4  134 ? 11.172  51.018  -20.777 1.00 46.35  ? 134 PHE D C   1 
ATOM   9028  O  O   . PHE D  4  134 ? 11.102  51.905  -21.643 1.00 47.87  ? 134 PHE D O   1 
ATOM   9029  C  CB  . PHE D  4  134 ? 10.154  50.439  -18.503 1.00 39.92  ? 134 PHE D CB  1 
ATOM   9030  C  CG  . PHE D  4  134 ? 10.400  51.720  -17.807 1.00 40.98  ? 134 PHE D CG  1 
ATOM   9031  C  CD1 . PHE D  4  134 ? 9.348   52.538  -17.465 1.00 38.99  ? 134 PHE D CD1 1 
ATOM   9032  C  CD2 . PHE D  4  134 ? 11.685  52.103  -17.462 1.00 43.56  ? 134 PHE D CD2 1 
ATOM   9033  C  CE1 . PHE D  4  134 ? 9.573   53.733  -16.801 1.00 41.64  ? 134 PHE D CE1 1 
ATOM   9034  C  CE2 . PHE D  4  134 ? 11.921  53.304  -16.790 1.00 41.99  ? 134 PHE D CE2 1 
ATOM   9035  C  CZ  . PHE D  4  134 ? 10.860  54.129  -16.469 1.00 40.26  ? 134 PHE D CZ  1 
ATOM   9036  N  N   . SER D  4  135 ? 12.305  50.366  -20.507 1.00 40.84  ? 135 SER D N   1 
ATOM   9037  C  CA  . SER D  4  135 ? 13.536  50.628  -21.220 1.00 36.71  ? 135 SER D CA  1 
ATOM   9038  C  C   . SER D  4  135 ? 13.381  50.463  -22.725 1.00 37.75  ? 135 SER D C   1 
ATOM   9039  O  O   . SER D  4  135 ? 13.969  51.209  -23.494 1.00 39.07  ? 135 SER D O   1 
ATOM   9040  C  CB  . SER D  4  135 ? 14.627  49.708  -20.692 1.00 36.12  ? 135 SER D CB  1 
ATOM   9041  O  OG  . SER D  4  135 ? 14.836  49.989  -19.323 1.00 34.61  ? 135 SER D OG  1 
ATOM   9042  N  N   . ALA D  4  136 ? 12.532  49.536  -23.157 1.00 36.97  ? 136 ALA D N   1 
ATOM   9043  C  CA  . ALA D  4  136 ? 12.196  49.408  -24.587 1.00 35.61  ? 136 ALA D CA  1 
ATOM   9044  C  C   . ALA D  4  136 ? 11.716  50.707  -25.216 1.00 36.73  ? 136 ALA D C   1 
ATOM   9045  O  O   . ALA D  4  136 ? 11.705  50.813  -26.436 1.00 37.15  ? 136 ALA D O   1 
ATOM   9046  C  CB  . ALA D  4  136 ? 11.132  48.338  -24.796 1.00 34.76  ? 136 ALA D CB  1 
ATOM   9047  N  N   . LYS D  4  137 ? 11.301  51.669  -24.387 1.00 36.50  ? 137 LYS D N   1 
ATOM   9048  C  CA  . LYS D  4  137 ? 10.696  52.896  -24.847 1.00 38.59  ? 137 LYS D CA  1 
ATOM   9049  C  C   . LYS D  4  137 ? 11.683  54.036  -24.864 1.00 43.40  ? 137 LYS D C   1 
ATOM   9050  O  O   . LYS D  4  137 ? 11.300  55.174  -25.125 1.00 46.15  ? 137 LYS D O   1 
ATOM   9051  C  CB  . LYS D  4  137 ? 9.480   53.221  -23.968 1.00 37.63  ? 137 LYS D CB  1 
ATOM   9052  C  CG  . LYS D  4  137 ? 8.222   52.584  -24.501 1.00 38.40  ? 137 LYS D CG  1 
ATOM   9053  C  CD  . LYS D  4  137 ? 7.259   52.113  -23.457 1.00 39.97  ? 137 LYS D CD  1 
ATOM   9054  C  CE  . LYS D  4  137 ? 6.109   51.415  -24.156 1.00 46.53  ? 137 LYS D CE  1 
ATOM   9055  N  NZ  . LYS D  4  137 ? 5.028   51.081  -23.191 1.00 56.80  ? 137 LYS D NZ  1 
ATOM   9056  N  N   . TRP D  4  138 ? 12.956  53.722  -24.631 1.00 44.85  ? 138 TRP D N   1 
ATOM   9057  C  CA  . TRP D  4  138 ? 13.996  54.712  -24.468 1.00 44.80  ? 138 TRP D CA  1 
ATOM   9058  C  C   . TRP D  4  138 ? 15.062  54.468  -25.513 1.00 46.17  ? 138 TRP D C   1 
ATOM   9059  O  O   . TRP D  4  138 ? 15.369  53.311  -25.805 1.00 41.92  ? 138 TRP D O   1 
ATOM   9060  C  CB  . TRP D  4  138 ? 14.575  54.555  -23.096 1.00 45.14  ? 138 TRP D CB  1 
ATOM   9061  C  CG  . TRP D  4  138 ? 15.749  55.366  -22.853 1.00 45.79  ? 138 TRP D CG  1 
ATOM   9062  C  CD1 . TRP D  4  138 ? 17.040  54.969  -22.942 1.00 42.93  ? 138 TRP D CD1 1 
ATOM   9063  C  CD2 . TRP D  4  138 ? 15.770  56.726  -22.437 1.00 44.70  ? 138 TRP D CD2 1 
ATOM   9064  N  NE1 . TRP D  4  138 ? 17.867  55.997  -22.609 1.00 43.26  ? 138 TRP D NE1 1 
ATOM   9065  C  CE2 . TRP D  4  138 ? 17.118  57.093  -22.295 1.00 43.60  ? 138 TRP D CE2 1 
ATOM   9066  C  CE3 . TRP D  4  138 ? 14.783  57.671  -22.180 1.00 43.95  ? 138 TRP D CE3 1 
ATOM   9067  C  CZ2 . TRP D  4  138 ? 17.511  58.364  -21.895 1.00 43.79  ? 138 TRP D CZ2 1 
ATOM   9068  C  CZ3 . TRP D  4  138 ? 15.165  58.948  -21.798 1.00 45.76  ? 138 TRP D CZ3 1 
ATOM   9069  C  CH2 . TRP D  4  138 ? 16.523  59.281  -21.659 1.00 45.45  ? 138 TRP D CH2 1 
ATOM   9070  N  N   . ASP D  4  139 ? 15.573  55.557  -26.109 1.00 52.79  ? 139 ASP D N   1 
ATOM   9071  C  CA  . ASP D  4  139 ? 16.721  55.499  -27.056 1.00 57.45  ? 139 ASP D CA  1 
ATOM   9072  C  C   . ASP D  4  139 ? 18.038  55.678  -26.299 1.00 57.46  ? 139 ASP D C   1 
ATOM   9073  O  O   . ASP D  4  139 ? 18.341  56.757  -25.768 1.00 57.08  ? 139 ASP D O   1 
ATOM   9074  C  CB  . ASP D  4  139 ? 16.638  56.541  -28.190 1.00 56.53  ? 139 ASP D CB  1 
ATOM   9075  C  CG  . ASP D  4  139 ? 17.232  56.022  -29.517 1.00 60.13  ? 139 ASP D CG  1 
ATOM   9076  O  OD1 . ASP D  4  139 ? 18.331  55.402  -29.527 1.00 59.50  ? 139 ASP D OD1 1 
ATOM   9077  O  OD2 . ASP D  4  139 ? 16.571  56.229  -30.561 1.00 68.74  ? 139 ASP D OD2 1 
ATOM   9078  N  N   . TYR D  4  140 ? 18.810  54.604  -26.256 1.00 54.73  ? 140 TYR D N   1 
ATOM   9079  C  CA  . TYR D  4  140 ? 20.097  54.628  -25.606 1.00 56.35  ? 140 TYR D CA  1 
ATOM   9080  C  C   . TYR D  4  140 ? 21.160  55.410  -26.417 1.00 62.78  ? 140 TYR D C   1 
ATOM   9081  O  O   . TYR D  4  140 ? 22.051  56.034  -25.832 1.00 64.26  ? 140 TYR D O   1 
ATOM   9082  C  CB  . TYR D  4  140 ? 20.513  53.193  -25.285 1.00 54.19  ? 140 TYR D CB  1 
ATOM   9083  C  CG  . TYR D  4  140 ? 19.741  52.652  -24.101 1.00 51.89  ? 140 TYR D CG  1 
ATOM   9084  C  CD1 . TYR D  4  140 ? 20.124  52.971  -22.808 1.00 48.76  ? 140 TYR D CD1 1 
ATOM   9085  C  CD2 . TYR D  4  140 ? 18.610  51.856  -24.277 1.00 53.54  ? 140 TYR D CD2 1 
ATOM   9086  C  CE1 . TYR D  4  140 ? 19.419  52.499  -21.725 1.00 53.19  ? 140 TYR D CE1 1 
ATOM   9087  C  CE2 . TYR D  4  140 ? 17.886  51.394  -23.189 1.00 52.11  ? 140 TYR D CE2 1 
ATOM   9088  C  CZ  . TYR D  4  140 ? 18.298  51.714  -21.924 1.00 51.00  ? 140 TYR D CZ  1 
ATOM   9089  O  OH  . TYR D  4  140 ? 17.605  51.265  -20.847 1.00 48.97  ? 140 TYR D OH  1 
ATOM   9090  N  N   . ASP D  4  141 ? 21.028  55.419  -27.747 1.00 67.83  ? 141 ASP D N   1 
ATOM   9091  C  CA  . ASP D  4  141 ? 21.919  56.188  -28.610 1.00 65.71  ? 141 ASP D CA  1 
ATOM   9092  C  C   . ASP D  4  141 ? 21.636  57.680  -28.469 1.00 69.34  ? 141 ASP D C   1 
ATOM   9093  O  O   . ASP D  4  141 ? 22.508  58.433  -27.996 1.00 70.45  ? 141 ASP D O   1 
ATOM   9094  C  CB  . ASP D  4  141 ? 21.798  55.715  -30.052 1.00 66.95  ? 141 ASP D CB  1 
ATOM   9095  C  CG  . ASP D  4  141 ? 22.209  54.253  -30.208 1.00 74.31  ? 141 ASP D CG  1 
ATOM   9096  O  OD1 . ASP D  4  141 ? 23.157  53.824  -29.506 1.00 73.30  ? 141 ASP D OD1 1 
ATOM   9097  O  OD2 . ASP D  4  141 ? 21.573  53.523  -31.007 1.00 80.26  ? 141 ASP D OD2 1 
ATOM   9098  N  N   . LYS D  4  142 ? 20.406  58.094  -28.785 1.00 65.56  ? 142 LYS D N   1 
ATOM   9099  C  CA  . LYS D  4  142 ? 20.056  59.528  -28.806 1.00 65.25  ? 142 LYS D CA  1 
ATOM   9100  C  C   . LYS D  4  142 ? 19.737  60.121  -27.432 1.00 61.43  ? 142 LYS D C   1 
ATOM   9101  O  O   . LYS D  4  142 ? 19.414  61.316  -27.334 1.00 60.44  ? 142 LYS D O   1 
ATOM   9102  C  CB  . LYS D  4  142 ? 18.902  59.808  -29.791 1.00 74.22  ? 142 LYS D CB  1 
ATOM   9103  C  CG  . LYS D  4  142 ? 19.135  59.250  -31.197 1.00 81.25  ? 142 LYS D CG  1 
ATOM   9104  C  CD  . LYS D  4  142 ? 18.613  60.134  -32.326 1.00 88.37  ? 142 LYS D CD  1 
ATOM   9105  C  CE  . LYS D  4  142 ? 17.126  60.442  -32.204 1.00 97.41  ? 142 LYS D CE  1 
ATOM   9106  N  NZ  . LYS D  4  142 ? 16.277  59.231  -31.985 1.00 106.05 ? 142 LYS D NZ  1 
ATOM   9107  N  N   . ASN D  4  143 ? 19.826  59.297  -26.383 1.00 60.31  ? 143 ASN D N   1 
ATOM   9108  C  CA  . ASN D  4  143 ? 19.501  59.690  -25.007 1.00 60.46  ? 143 ASN D CA  1 
ATOM   9109  C  C   . ASN D  4  143 ? 18.160  60.437  -24.785 1.00 59.01  ? 143 ASN D C   1 
ATOM   9110  O  O   . ASN D  4  143 ? 18.092  61.427  -24.035 1.00 53.50  ? 143 ASN D O   1 
ATOM   9111  C  CB  . ASN D  4  143 ? 20.663  60.454  -24.394 1.00 62.44  ? 143 ASN D CB  1 
ATOM   9112  C  CG  . ASN D  4  143 ? 20.856  60.097  -22.949 1.00 72.22  ? 143 ASN D CG  1 
ATOM   9113  O  OD1 . ASN D  4  143 ? 21.222  58.947  -22.622 1.00 73.09  ? 143 ASN D OD1 1 
ATOM   9114  N  ND2 . ASN D  4  143 ? 20.582  61.057  -22.060 1.00 73.46  ? 143 ASN D ND2 1 
ATOM   9115  N  N   . GLU D  4  144 ? 17.105  59.924  -25.427 1.00 58.40  ? 144 GLU D N   1 
ATOM   9116  C  CA  . GLU D  4  144 ? 15.738  60.430  -25.265 1.00 66.02  ? 144 GLU D CA  1 
ATOM   9117  C  C   . GLU D  4  144 ? 14.681  59.324  -25.418 1.00 60.06  ? 144 GLU D C   1 
ATOM   9118  O  O   . GLU D  4  144 ? 14.966  58.223  -25.900 1.00 60.41  ? 144 GLU D O   1 
ATOM   9119  C  CB  . GLU D  4  144 ? 15.448  61.565  -26.261 1.00 72.70  ? 144 GLU D CB  1 
ATOM   9120  C  CG  . GLU D  4  144 ? 15.474  61.161  -27.733 1.00 76.55  ? 144 GLU D CG  1 
ATOM   9121  C  CD  . GLU D  4  144 ? 15.484  62.347  -28.688 1.00 86.63  ? 144 GLU D CD  1 
ATOM   9122  O  OE1 . GLU D  4  144 ? 15.182  62.111  -29.874 1.00 98.13  ? 144 GLU D OE1 1 
ATOM   9123  O  OE2 . GLU D  4  144 ? 15.791  63.501  -28.280 1.00 87.93  ? 144 GLU D OE2 1 
ATOM   9124  N  N   . TRP D  4  145 ? 13.458  59.648  -25.011 1.00 51.95  ? 145 TRP D N   1 
ATOM   9125  C  CA  . TRP D  4  145 ? 12.329  58.743  -25.165 1.00 49.29  ? 145 TRP D CA  1 
ATOM   9126  C  C   . TRP D  4  145 ? 12.017  58.656  -26.645 1.00 50.77  ? 145 TRP D C   1 
ATOM   9127  O  O   . TRP D  4  145 ? 12.094  59.652  -27.340 1.00 54.17  ? 145 TRP D O   1 
ATOM   9128  C  CB  . TRP D  4  145 ? 11.093  59.246  -24.400 1.00 43.87  ? 145 TRP D CB  1 
ATOM   9129  C  CG  . TRP D  4  145 ? 11.250  59.354  -22.917 1.00 38.04  ? 145 TRP D CG  1 
ATOM   9130  C  CD1 . TRP D  4  145 ? 11.330  60.497  -22.200 1.00 39.84  ? 145 TRP D CD1 1 
ATOM   9131  C  CD2 . TRP D  4  145 ? 11.284  58.282  -21.966 1.00 36.93  ? 145 TRP D CD2 1 
ATOM   9132  N  NE1 . TRP D  4  145 ? 11.452  60.216  -20.856 1.00 40.33  ? 145 TRP D NE1 1 
ATOM   9133  C  CE2 . TRP D  4  145 ? 11.443  58.856  -20.694 1.00 38.43  ? 145 TRP D CE2 1 
ATOM   9134  C  CE3 . TRP D  4  145 ? 11.248  56.897  -22.072 1.00 36.23  ? 145 TRP D CE3 1 
ATOM   9135  C  CZ2 . TRP D  4  145 ? 11.549  58.088  -19.537 1.00 39.07  ? 145 TRP D CZ2 1 
ATOM   9136  C  CZ3 . TRP D  4  145 ? 11.373  56.145  -20.938 1.00 35.85  ? 145 TRP D CZ3 1 
ATOM   9137  C  CH2 . TRP D  4  145 ? 11.514  56.734  -19.685 1.00 37.02  ? 145 TRP D CH2 1 
ATOM   9138  N  N   . LYS D  4  146 ? 11.682  57.465  -27.119 1.00 54.07  ? 146 LYS D N   1 
ATOM   9139  C  CA  . LYS D  4  146 ? 11.284  57.270  -28.503 1.00 60.21  ? 146 LYS D CA  1 
ATOM   9140  C  C   . LYS D  4  146 ? 9.932   57.933  -28.812 1.00 72.08  ? 146 LYS D C   1 
ATOM   9141  O  O   . LYS D  4  146 ? 9.055   57.995  -27.945 1.00 72.10  ? 146 LYS D O   1 
ATOM   9142  C  CB  . LYS D  4  146 ? 11.181  55.776  -28.805 1.00 56.36  ? 146 LYS D CB  1 
ATOM   9143  C  CG  . LYS D  4  146 ? 12.475  55.006  -28.603 1.00 55.39  ? 146 LYS D CG  1 
ATOM   9144  C  CD  . LYS D  4  146 ? 12.434  53.648  -29.266 1.00 55.18  ? 146 LYS D CD  1 
ATOM   9145  C  CE  . LYS D  4  146 ? 13.495  52.736  -28.679 1.00 60.74  ? 146 LYS D CE  1 
ATOM   9146  N  NZ  . LYS D  4  146 ? 13.452  51.402  -29.336 1.00 64.81  ? 146 LYS D NZ  1 
ATOM   9147  N  N   . LYS D  4  147 ? 9.801   58.465  -30.034 1.00 90.48  ? 147 LYS D N   1 
ATOM   9148  C  CA  . LYS D  4  147 ? 8.494   58.631  -30.717 1.00 103.98 ? 147 LYS D CA  1 
ATOM   9149  C  C   . LYS D  4  147 ? 8.626   58.003  -32.104 1.00 106.45 ? 147 LYS D C   1 
ATOM   9150  O  O   . LYS D  4  147 ? 9.650   58.174  -32.772 1.00 102.87 ? 147 LYS D O   1 
ATOM   9151  C  CB  . LYS D  4  147 ? 8.057   60.097  -30.889 1.00 110.74 ? 147 LYS D CB  1 
ATOM   9152  C  CG  . LYS D  4  147 ? 8.053   60.958  -29.629 1.00 116.33 ? 147 LYS D CG  1 
ATOM   9153  C  CD  . LYS D  4  147 ? 9.234   61.925  -29.598 1.00 118.30 ? 147 LYS D CD  1 
ATOM   9154  C  CE  . LYS D  4  147 ? 9.012   63.134  -30.498 1.00 115.32 ? 147 LYS D CE  1 
ATOM   9155  N  NZ  . LYS D  4  147 ? 10.279  63.876  -30.729 1.00 114.44 ? 147 LYS D NZ  1 
ATOM   9156  O  OXT . LYS D  4  147 ? 7.730   57.312  -32.587 1.00 105.79 ? 147 LYS D OXT 1 
ATOM   9157  N  N   . HIS E  5  5   ? -45.008 17.526  -33.882 1.00 118.13 ? 5   HIS E N   1 
ATOM   9158  C  CA  . HIS E  5  5   ? -45.420 18.941  -34.129 1.00 118.17 ? 5   HIS E CA  1 
ATOM   9159  C  C   . HIS E  5  5   ? -46.499 19.033  -35.202 1.00 114.70 ? 5   HIS E C   1 
ATOM   9160  O  O   . HIS E  5  5   ? -46.663 18.124  -36.028 1.00 109.50 ? 5   HIS E O   1 
ATOM   9161  C  CB  . HIS E  5  5   ? -44.220 19.802  -34.534 1.00 120.27 ? 5   HIS E CB  1 
ATOM   9162  C  CG  . HIS E  5  5   ? -43.123 19.814  -33.517 1.00 130.89 ? 5   HIS E CG  1 
ATOM   9163  N  ND1 . HIS E  5  5   ? -41.804 19.578  -33.839 1.00 131.94 ? 5   HIS E ND1 1 
ATOM   9164  C  CD2 . HIS E  5  5   ? -43.153 20.006  -32.176 1.00 136.13 ? 5   HIS E CD2 1 
ATOM   9165  C  CE1 . HIS E  5  5   ? -41.066 19.640  -32.744 1.00 130.36 ? 5   HIS E CE1 1 
ATOM   9166  N  NE2 . HIS E  5  5   ? -41.860 19.898  -31.721 1.00 132.39 ? 5   HIS E NE2 1 
ATOM   9167  N  N   . GLU E  5  6   ? -47.229 20.146  -35.170 1.00 105.72 ? 6   GLU E N   1 
ATOM   9168  C  CA  . GLU E  5  6   ? -48.324 20.413  -36.109 1.00 96.08  ? 6   GLU E CA  1 
ATOM   9169  C  C   . GLU E  5  6   ? -47.893 21.454  -37.136 1.00 84.49  ? 6   GLU E C   1 
ATOM   9170  O  O   . GLU E  5  6   ? -47.071 22.319  -36.840 1.00 79.91  ? 6   GLU E O   1 
ATOM   9171  C  CB  . GLU E  5  6   ? -49.594 20.864  -35.360 1.00 97.70  ? 6   GLU E CB  1 
ATOM   9172  C  CG  . GLU E  5  6   ? -49.609 22.307  -34.859 1.00 96.27  ? 6   GLU E CG  1 
ATOM   9173  C  CD  . GLU E  5  6   ? -50.625 22.540  -33.751 1.00 93.48  ? 6   GLU E CD  1 
ATOM   9174  O  OE1 . GLU E  5  6   ? -51.806 22.143  -33.896 1.00 86.26  ? 6   GLU E OE1 1 
ATOM   9175  O  OE2 . GLU E  5  6   ? -50.232 23.132  -32.728 1.00 90.85  ? 6   GLU E OE2 1 
ATOM   9176  N  N   . THR E  5  7   ? -48.472 21.376  -38.332 1.00 76.56  ? 7   THR E N   1 
ATOM   9177  C  CA  . THR E  5  7   ? -48.077 22.243  -39.439 1.00 77.95  ? 7   THR E CA  1 
ATOM   9178  C  C   . THR E  5  7   ? -48.710 23.623  -39.199 1.00 76.90  ? 7   THR E C   1 
ATOM   9179  O  O   . THR E  5  7   ? -49.559 23.786  -38.324 1.00 72.00  ? 7   THR E O   1 
ATOM   9180  C  CB  . THR E  5  7   ? -48.469 21.671  -40.838 1.00 85.61  ? 7   THR E CB  1 
ATOM   9181  O  OG1 . THR E  5  7   ? -49.798 22.073  -41.195 1.00 93.37  ? 7   THR E OG1 1 
ATOM   9182  C  CG2 . THR E  5  7   ? -48.372 20.130  -40.907 1.00 89.27  ? 7   THR E CG2 1 
ATOM   9183  N  N   . ASP E  5  8   ? -48.290 24.621  -39.961 1.00 76.81  ? 8   ASP E N   1 
ATOM   9184  C  CA  . ASP E  5  8   ? -48.827 25.969  -39.786 1.00 69.32  ? 8   ASP E CA  1 
ATOM   9185  C  C   . ASP E  5  8   ? -50.315 26.008  -40.136 1.00 70.58  ? 8   ASP E C   1 
ATOM   9186  O  O   . ASP E  5  8   ? -51.084 26.685  -39.458 1.00 69.07  ? 8   ASP E O   1 
ATOM   9187  C  CB  . ASP E  5  8   ? -48.036 26.995  -40.616 1.00 63.97  ? 8   ASP E CB  1 
ATOM   9188  C  CG  . ASP E  5  8   ? -46.612 27.207  -40.097 1.00 61.55  ? 8   ASP E CG  1 
ATOM   9189  O  OD1 . ASP E  5  8   ? -46.316 26.868  -38.918 1.00 57.36  ? 8   ASP E OD1 1 
ATOM   9190  O  OD2 . ASP E  5  8   ? -45.790 27.736  -40.879 1.00 59.29  ? 8   ASP E OD2 1 
ATOM   9191  N  N   . GLU E  5  9   ? -50.722 25.277  -41.173 1.00 70.16  ? 9   GLU E N   1 
ATOM   9192  C  CA  . GLU E  5  9   ? -52.126 25.249  -41.554 1.00 69.10  ? 9   GLU E CA  1 
ATOM   9193  C  C   . GLU E  5  9   ? -52.964 24.510  -40.520 1.00 63.81  ? 9   GLU E C   1 
ATOM   9194  O  O   . GLU E  5  9   ? -54.085 24.912  -40.276 1.00 59.50  ? 9   GLU E O   1 
ATOM   9195  C  CB  . GLU E  5  9   ? -52.334 24.678  -42.959 1.00 78.86  ? 9   GLU E CB  1 
ATOM   9196  C  CG  . GLU E  5  9   ? -52.092 25.683  -44.091 1.00 87.51  ? 9   GLU E CG  1 
ATOM   9197  C  CD  . GLU E  5  9   ? -50.694 25.598  -44.700 1.00 96.68  ? 9   GLU E CD  1 
ATOM   9198  O  OE1 . GLU E  5  9   ? -50.562 25.040  -45.817 1.00 103.00 ? 9   GLU E OE1 1 
ATOM   9199  O  OE2 . GLU E  5  9   ? -49.726 26.083  -44.068 1.00 98.52  ? 9   GLU E OE2 1 
ATOM   9200  N  N   . GLU E  5  10  ? -52.435 23.458  -39.895 1.00 65.44  ? 10  GLU E N   1 
ATOM   9201  C  CA  . GLU E  5  10  ? -53.164 22.780  -38.795 1.00 71.52  ? 10  GLU E CA  1 
ATOM   9202  C  C   . GLU E  5  10  ? -53.403 23.761  -37.616 1.00 70.31  ? 10  GLU E C   1 
ATOM   9203  O  O   . GLU E  5  10  ? -54.480 23.758  -36.998 1.00 74.77  ? 10  GLU E O   1 
ATOM   9204  C  CB  . GLU E  5  10  ? -52.457 21.474  -38.315 1.00 75.82  ? 10  GLU E CB  1 
ATOM   9205  C  CG  . GLU E  5  10  ? -52.612 20.249  -39.243 1.00 82.47  ? 10  GLU E CG  1 
ATOM   9206  C  CD  . GLU E  5  10  ? -51.853 18.988  -38.781 1.00 83.82  ? 10  GLU E CD  1 
ATOM   9207  O  OE1 . GLU E  5  10  ? -52.441 17.888  -38.803 1.00 82.86  ? 10  GLU E OE1 1 
ATOM   9208  O  OE2 . GLU E  5  10  ? -50.667 19.073  -38.403 1.00 82.84  ? 10  GLU E OE2 1 
ATOM   9209  N  N   . PHE E  5  11  ? -52.398 24.602  -37.344 1.00 61.72  ? 11  PHE E N   1 
ATOM   9210  C  CA  . PHE E  5  11  ? -52.417 25.614  -36.266 1.00 52.87  ? 11  PHE E CA  1 
ATOM   9211  C  C   . PHE E  5  11  ? -53.516 26.670  -36.487 1.00 49.24  ? 11  PHE E C   1 
ATOM   9212  O  O   . PHE E  5  11  ? -54.356 26.912  -35.618 1.00 50.28  ? 11  PHE E O   1 
ATOM   9213  C  CB  . PHE E  5  11  ? -51.008 26.271  -36.159 1.00 49.52  ? 11  PHE E CB  1 
ATOM   9214  C  CG  . PHE E  5  11  ? -50.888 27.329  -35.102 1.00 47.43  ? 11  PHE E CG  1 
ATOM   9215  C  CD1 . PHE E  5  11  ? -51.192 28.657  -35.384 1.00 47.49  ? 11  PHE E CD1 1 
ATOM   9216  C  CD2 . PHE E  5  11  ? -50.472 27.006  -33.827 1.00 48.73  ? 11  PHE E CD2 1 
ATOM   9217  C  CE1 . PHE E  5  11  ? -51.085 29.642  -34.414 1.00 47.21  ? 11  PHE E CE1 1 
ATOM   9218  C  CE2 . PHE E  5  11  ? -50.370 27.984  -32.850 1.00 49.34  ? 11  PHE E CE2 1 
ATOM   9219  C  CZ  . PHE E  5  11  ? -50.670 29.306  -33.149 1.00 47.22  ? 11  PHE E CZ  1 
ATOM   9220  N  N   . ASP E  5  12  ? -53.498 27.287  -37.656 1.00 44.60  ? 12  ASP E N   1 
ATOM   9221  C  CA  . ASP E  5  12  ? -54.460 28.295  -37.991 1.00 46.63  ? 12  ASP E CA  1 
ATOM   9222  C  C   . ASP E  5  12  ? -55.864 27.726  -37.931 1.00 50.34  ? 12  ASP E C   1 
ATOM   9223  O  O   . ASP E  5  12  ? -56.786 28.406  -37.484 1.00 57.26  ? 12  ASP E O   1 
ATOM   9224  C  CB  . ASP E  5  12  ? -54.170 28.879  -39.370 1.00 49.85  ? 12  ASP E CB  1 
ATOM   9225  C  CG  . ASP E  5  12  ? -52.855 29.644  -39.423 1.00 53.75  ? 12  ASP E CG  1 
ATOM   9226  O  OD1 . ASP E  5  12  ? -52.200 29.759  -38.379 1.00 57.53  ? 12  ASP E OD1 1 
ATOM   9227  O  OD2 . ASP E  5  12  ? -52.464 30.139  -40.501 1.00 61.09  ? 12  ASP E OD2 1 
ATOM   9228  N  N   . ALA E  5  13  ? -56.018 26.468  -38.333 1.00 52.39  ? 13  ALA E N   1 
ATOM   9229  C  CA  . ALA E  5  13  ? -57.328 25.813  -38.343 1.00 50.49  ? 13  ALA E CA  1 
ATOM   9230  C  C   . ALA E  5  13  ? -57.831 25.541  -36.931 1.00 49.64  ? 13  ALA E C   1 
ATOM   9231  O  O   . ALA E  5  13  ? -58.973 25.821  -36.615 1.00 51.83  ? 13  ALA E O   1 
ATOM   9232  C  CB  . ALA E  5  13  ? -57.263 24.521  -39.140 1.00 50.28  ? 13  ALA E CB  1 
ATOM   9233  N  N   . ARG E  5  14  ? -56.976 24.986  -36.082 1.00 52.44  ? 14  ARG E N   1 
ATOM   9234  C  CA  . ARG E  5  14  ? -57.324 24.779  -34.671 1.00 53.00  ? 14  ARG E CA  1 
ATOM   9235  C  C   . ARG E  5  14  ? -57.838 26.072  -34.006 1.00 51.43  ? 14  ARG E C   1 
ATOM   9236  O  O   . ARG E  5  14  ? -58.779 26.003  -33.206 1.00 49.14  ? 14  ARG E O   1 
ATOM   9237  C  CB  . ARG E  5  14  ? -56.119 24.255  -33.890 1.00 55.59  ? 14  ARG E CB  1 
ATOM   9238  C  CG  . ARG E  5  14  ? -56.477 23.431  -32.669 1.00 59.59  ? 14  ARG E CG  1 
ATOM   9239  C  CD  . ARG E  5  14  ? -55.466 23.561  -31.534 1.00 65.27  ? 14  ARG E CD  1 
ATOM   9240  N  NE  . ARG E  5  14  ? -54.140 24.005  -31.974 1.00 67.97  ? 14  ARG E NE  1 
ATOM   9241  C  CZ  . ARG E  5  14  ? -53.290 24.732  -31.242 1.00 72.67  ? 14  ARG E CZ  1 
ATOM   9242  N  NH1 . ARG E  5  14  ? -53.574 25.121  -29.993 1.00 73.15  ? 14  ARG E NH1 1 
ATOM   9243  N  NH2 . ARG E  5  14  ? -52.128 25.089  -31.773 1.00 74.39  ? 14  ARG E NH2 1 
ATOM   9244  N  N   . TRP E  5  15  ? -57.237 27.230  -34.340 1.00 44.58  ? 15  TRP E N   1 
ATOM   9245  C  CA  . TRP E  5  15  ? -57.626 28.492  -33.695 1.00 45.95  ? 15  TRP E CA  1 
ATOM   9246  C  C   . TRP E  5  15  ? -58.872 29.106  -34.289 1.00 46.65  ? 15  TRP E C   1 
ATOM   9247  O  O   . TRP E  5  15  ? -59.709 29.617  -33.532 1.00 46.61  ? 15  TRP E O   1 
ATOM   9248  C  CB  . TRP E  5  15  ? -56.489 29.516  -33.648 1.00 43.64  ? 15  TRP E CB  1 
ATOM   9249  C  CG  . TRP E  5  15  ? -55.498 29.144  -32.613 1.00 41.68  ? 15  TRP E CG  1 
ATOM   9250  C  CD1 . TRP E  5  15  ? -54.248 28.652  -32.815 1.00 40.11  ? 15  TRP E CD1 1 
ATOM   9251  C  CD2 . TRP E  5  15  ? -55.700 29.159  -31.204 1.00 39.75  ? 15  TRP E CD2 1 
ATOM   9252  N  NE1 . TRP E  5  15  ? -53.649 28.399  -31.610 1.00 39.15  ? 15  TRP E NE1 1 
ATOM   9253  C  CE2 . TRP E  5  15  ? -54.522 28.702  -30.608 1.00 36.60  ? 15  TRP E CE2 1 
ATOM   9254  C  CE3 . TRP E  5  15  ? -56.761 29.537  -30.386 1.00 42.19  ? 15  TRP E CE3 1 
ATOM   9255  C  CZ2 . TRP E  5  15  ? -54.369 28.613  -29.243 1.00 39.05  ? 15  TRP E CZ2 1 
ATOM   9256  C  CZ3 . TRP E  5  15  ? -56.606 29.439  -29.016 1.00 42.68  ? 15  TRP E CZ3 1 
ATOM   9257  C  CH2 . TRP E  5  15  ? -55.414 28.992  -28.461 1.00 41.03  ? 15  TRP E CH2 1 
ATOM   9258  N  N   . VAL E  5  16  ? -58.999 29.049  -35.615 1.00 46.25  ? 16  VAL E N   1 
ATOM   9259  C  CA  . VAL E  5  16  ? -60.219 29.501  -36.284 1.00 49.55  ? 16  VAL E CA  1 
ATOM   9260  C  C   . VAL E  5  16  ? -61.441 28.745  -35.726 1.00 53.91  ? 16  VAL E C   1 
ATOM   9261  O  O   . VAL E  5  16  ? -62.495 29.347  -35.490 1.00 57.60  ? 16  VAL E O   1 
ATOM   9262  C  CB  . VAL E  5  16  ? -60.106 29.385  -37.819 1.00 50.47  ? 16  VAL E CB  1 
ATOM   9263  C  CG1 . VAL E  5  16  ? -61.454 29.548  -38.512 1.00 53.62  ? 16  VAL E CG1 1 
ATOM   9264  C  CG2 . VAL E  5  16  ? -59.141 30.437  -38.360 1.00 51.66  ? 16  VAL E CG2 1 
ATOM   9265  N  N   . THR E  5  17  ? -61.271 27.446  -35.483 1.00 53.28  ? 17  THR E N   1 
ATOM   9266  C  CA  . THR E  5  17  ? -62.304 26.584  -34.893 1.00 54.68  ? 17  THR E CA  1 
ATOM   9267  C  C   . THR E  5  17  ? -62.617 26.945  -33.451 1.00 55.57  ? 17  THR E C   1 
ATOM   9268  O  O   . THR E  5  17  ? -63.789 26.965  -33.049 1.00 59.23  ? 17  THR E O   1 
ATOM   9269  C  CB  . THR E  5  17  ? -61.832 25.114  -34.909 1.00 52.99  ? 17  THR E CB  1 
ATOM   9270  O  OG1 . THR E  5  17  ? -61.631 24.721  -36.263 1.00 47.48  ? 17  THR E OG1 1 
ATOM   9271  C  CG2 . THR E  5  17  ? -62.831 24.165  -34.207 1.00 53.83  ? 17  THR E CG2 1 
ATOM   9272  N  N   . TYR E  5  18  ? -61.550 27.168  -32.679 1.00 49.24  ? 18  TYR E N   1 
ATOM   9273  C  CA  . TYR E  5  18  ? -61.663 27.492  -31.265 1.00 43.15  ? 18  TYR E CA  1 
ATOM   9274  C  C   . TYR E  5  18  ? -62.628 28.658  -31.037 1.00 44.23  ? 18  TYR E C   1 
ATOM   9275  O  O   . TYR E  5  18  ? -63.535 28.578  -30.185 1.00 41.05  ? 18  TYR E O   1 
ATOM   9276  C  CB  . TYR E  5  18  ? -60.286 27.823  -30.699 1.00 38.40  ? 18  TYR E CB  1 
ATOM   9277  C  CG  . TYR E  5  18  ? -60.297 28.130  -29.220 1.00 37.09  ? 18  TYR E CG  1 
ATOM   9278  C  CD1 . TYR E  5  18  ? -60.181 27.141  -28.261 1.00 34.56  ? 18  TYR E CD1 1 
ATOM   9279  C  CD2 . TYR E  5  18  ? -60.437 29.434  -28.783 1.00 36.82  ? 18  TYR E CD2 1 
ATOM   9280  C  CE1 . TYR E  5  18  ? -60.201 27.459  -26.907 1.00 35.34  ? 18  TYR E CE1 1 
ATOM   9281  C  CE2 . TYR E  5  18  ? -60.460 29.760  -27.441 1.00 33.95  ? 18  TYR E CE2 1 
ATOM   9282  C  CZ  . TYR E  5  18  ? -60.342 28.790  -26.501 1.00 34.00  ? 18  TYR E CZ  1 
ATOM   9283  O  OH  . TYR E  5  18  ? -60.364 29.199  -25.180 1.00 34.00  ? 18  TYR E OH  1 
ATOM   9284  N  N   . PHE E  5  19  ? -62.418 29.725  -31.807 1.00 42.36  ? 19  PHE E N   1 
ATOM   9285  C  CA  . PHE E  5  19  ? -63.222 30.939  -31.713 1.00 42.37  ? 19  PHE E CA  1 
ATOM   9286  C  C   . PHE E  5  19  ? -64.600 30.812  -32.319 1.00 42.75  ? 19  PHE E C   1 
ATOM   9287  O  O   . PHE E  5  19  ? -65.531 31.423  -31.812 1.00 43.61  ? 19  PHE E O   1 
ATOM   9288  C  CB  . PHE E  5  19  ? -62.479 32.126  -32.348 1.00 41.65  ? 19  PHE E CB  1 
ATOM   9289  C  CG  . PHE E  5  19  ? -61.258 32.527  -31.582 1.00 40.87  ? 19  PHE E CG  1 
ATOM   9290  C  CD1 . PHE E  5  19  ? -61.357 32.907  -30.234 1.00 40.93  ? 19  PHE E CD1 1 
ATOM   9291  C  CD2 . PHE E  5  19  ? -60.011 32.499  -32.170 1.00 40.89  ? 19  PHE E CD2 1 
ATOM   9292  C  CE1 . PHE E  5  19  ? -60.235 33.248  -29.499 1.00 39.73  ? 19  PHE E CE1 1 
ATOM   9293  C  CE2 . PHE E  5  19  ? -58.886 32.844  -31.437 1.00 40.86  ? 19  PHE E CE2 1 
ATOM   9294  C  CZ  . PHE E  5  19  ? -58.994 33.225  -30.107 1.00 38.82  ? 19  PHE E CZ  1 
ATOM   9295  N  N   . ASN E  5  20  ? -64.731 30.025  -33.389 1.00 48.12  ? 20  ASN E N   1 
ATOM   9296  C  CA  . ASN E  5  20  ? -66.045 29.836  -34.063 1.00 49.26  ? 20  ASN E CA  1 
ATOM   9297  C  C   . ASN E  5  20  ? -67.043 29.031  -33.236 1.00 52.52  ? 20  ASN E C   1 
ATOM   9298  O  O   . ASN E  5  20  ? -68.233 29.116  -33.479 1.00 58.59  ? 20  ASN E O   1 
ATOM   9299  C  CB  . ASN E  5  20  ? -65.900 29.236  -35.471 1.00 43.79  ? 20  ASN E CB  1 
ATOM   9300  C  CG  . ASN E  5  20  ? -65.425 30.261  -36.519 1.00 43.99  ? 20  ASN E CG  1 
ATOM   9301  O  OD1 . ASN E  5  20  ? -65.599 31.489  -36.387 1.00 40.60  ? 20  ASN E OD1 1 
ATOM   9302  N  ND2 . ASN E  5  20  ? -64.827 29.747  -37.580 1.00 46.71  ? 20  ASN E ND2 1 
ATOM   9303  N  N   . LYS E  5  21  ? -66.566 28.287  -32.242 1.00 55.34  ? 21  LYS E N   1 
ATOM   9304  C  CA  . LYS E  5  21  ? -67.446 27.602  -31.306 1.00 55.26  ? 21  LYS E CA  1 
ATOM   9305  C  C   . LYS E  5  21  ? -68.625 28.521  -30.978 1.00 55.66  ? 21  LYS E C   1 
ATOM   9306  O  O   . LYS E  5  21  ? -68.413 29.617  -30.462 1.00 51.94  ? 21  LYS E O   1 
ATOM   9307  C  CB  . LYS E  5  21  ? -66.684 27.215  -30.047 1.00 55.64  ? 21  LYS E CB  1 
ATOM   9308  C  CG  . LYS E  5  21  ? -67.397 26.262  -29.109 1.00 58.59  ? 21  LYS E CG  1 
ATOM   9309  C  CD  . LYS E  5  21  ? -66.698 26.260  -27.756 1.00 59.90  ? 21  LYS E CD  1 
ATOM   9310  C  CE  . LYS E  5  21  ? -67.454 25.419  -26.754 1.00 61.49  ? 21  LYS E CE  1 
ATOM   9311  N  NZ  . LYS E  5  21  ? -67.047 25.761  -25.369 1.00 63.98  ? 21  LYS E NZ  1 
ATOM   9312  N  N   . PRO E  5  22  ? -69.868 28.100  -31.320 1.00 59.85  ? 22  PRO E N   1 
ATOM   9313  C  CA  . PRO E  5  22  ? -71.016 29.030  -31.221 1.00 55.06  ? 22  PRO E CA  1 
ATOM   9314  C  C   . PRO E  5  22  ? -71.344 29.465  -29.801 1.00 47.86  ? 22  PRO E C   1 
ATOM   9315  O  O   . PRO E  5  22  ? -71.627 30.638  -29.586 1.00 50.97  ? 22  PRO E O   1 
ATOM   9316  C  CB  . PRO E  5  22  ? -72.177 28.218  -31.807 1.00 55.99  ? 22  PRO E CB  1 
ATOM   9317  C  CG  . PRO E  5  22  ? -71.538 27.139  -32.594 1.00 55.67  ? 22  PRO E CG  1 
ATOM   9318  C  CD  . PRO E  5  22  ? -70.311 26.783  -31.815 1.00 56.88  ? 22  PRO E CD  1 
ATOM   9319  N  N   . ASP E  5  23  ? -71.278 28.522  -28.863 1.00 45.23  ? 23  ASP E N   1 
ATOM   9320  C  CA  . ASP E  5  23  ? -71.508 28.768  -27.427 1.00 49.33  ? 23  ASP E CA  1 
ATOM   9321  C  C   . ASP E  5  23  ? -70.195 28.955  -26.604 1.00 53.24  ? 23  ASP E C   1 
ATOM   9322  O  O   . ASP E  5  23  ? -70.026 28.394  -25.498 1.00 49.41  ? 23  ASP E O   1 
ATOM   9323  C  CB  . ASP E  5  23  ? -72.328 27.623  -26.848 1.00 51.29  ? 23  ASP E CB  1 
ATOM   9324  C  CG  . ASP E  5  23  ? -71.590 26.300  -26.881 1.00 55.09  ? 23  ASP E CG  1 
ATOM   9325  O  OD1 . ASP E  5  23  ? -70.854 26.018  -27.856 1.00 61.78  ? 23  ASP E OD1 1 
ATOM   9326  O  OD2 . ASP E  5  23  ? -71.741 25.539  -25.916 1.00 65.24  ? 23  ASP E OD2 1 
ATOM   9327  N  N   . ILE E  5  24  ? -69.276 29.750  -27.165 1.00 51.02  ? 24  ILE E N   1 
ATOM   9328  C  CA  . ILE E  5  24  ? -68.058 30.163  -26.483 1.00 44.57  ? 24  ILE E CA  1 
ATOM   9329  C  C   . ILE E  5  24  ? -68.403 31.141  -25.412 1.00 43.18  ? 24  ILE E C   1 
ATOM   9330  O  O   . ILE E  5  24  ? -69.130 32.105  -25.669 1.00 45.55  ? 24  ILE E O   1 
ATOM   9331  C  CB  . ILE E  5  24  ? -67.076 30.833  -27.458 1.00 46.43  ? 24  ILE E CB  1 
ATOM   9332  C  CG1 . ILE E  5  24  ? -65.686 30.945  -26.831 1.00 49.07  ? 24  ILE E CG1 1 
ATOM   9333  C  CG2 . ILE E  5  24  ? -67.577 32.204  -27.962 1.00 46.40  ? 24  ILE E CG2 1 
ATOM   9334  C  CD1 . ILE E  5  24  ? -64.601 31.214  -27.864 1.00 51.05  ? 24  ILE E CD1 1 
ATOM   9335  N  N   . ASP E  5  25  ? -67.898 30.914  -24.207 1.00 43.50  ? 25  ASP E N   1 
ATOM   9336  C  CA  . ASP E  5  25  ? -68.066 31.931  -23.145 1.00 43.51  ? 25  ASP E CA  1 
ATOM   9337  C  C   . ASP E  5  25  ? -66.886 32.943  -23.125 1.00 41.22  ? 25  ASP E C   1 
ATOM   9338  O  O   . ASP E  5  25  ? -65.905 32.800  -23.863 1.00 39.20  ? 25  ASP E O   1 
ATOM   9339  C  CB  . ASP E  5  25  ? -68.348 31.306  -21.764 1.00 43.06  ? 25  ASP E CB  1 
ATOM   9340  C  CG  . ASP E  5  25  ? -67.267 30.380  -21.293 1.00 42.21  ? 25  ASP E CG  1 
ATOM   9341  O  OD1 . ASP E  5  25  ? -66.139 30.465  -21.784 1.00 44.06  ? 25  ASP E OD1 1 
ATOM   9342  O  OD2 . ASP E  5  25  ? -67.568 29.550  -20.425 1.00 43.03  ? 25  ASP E OD2 1 
ATOM   9343  N  N   . ALA E  5  26  ? -67.025 33.974  -22.302 1.00 39.01  ? 26  ALA E N   1 
ATOM   9344  C  CA  . ALA E  5  26  ? -66.025 35.020  -22.180 1.00 40.17  ? 26  ALA E CA  1 
ATOM   9345  C  C   . ALA E  5  26  ? -64.695 34.450  -21.675 1.00 41.27  ? 26  ALA E C   1 
ATOM   9346  O  O   . ALA E  5  26  ? -63.611 34.908  -22.066 1.00 40.15  ? 26  ALA E O   1 
ATOM   9347  C  CB  . ALA E  5  26  ? -66.520 36.127  -21.254 1.00 38.40  ? 26  ALA E CB  1 
ATOM   9348  N  N   . TRP E  5  27  ? -64.785 33.436  -20.821 1.00 41.21  ? 27  TRP E N   1 
ATOM   9349  C  CA  . TRP E  5  27  ? -63.591 32.842  -20.264 1.00 39.50  ? 27  TRP E CA  1 
ATOM   9350  C  C   . TRP E  5  27  ? -62.763 32.262  -21.401 1.00 38.29  ? 27  TRP E C   1 
ATOM   9351  O  O   . TRP E  5  27  ? -61.557 32.472  -21.479 1.00 40.53  ? 27  TRP E O   1 
ATOM   9352  C  CB  . TRP E  5  27  ? -63.939 31.793  -19.202 1.00 35.90  ? 27  TRP E CB  1 
ATOM   9353  C  CG  . TRP E  5  27  ? -62.717 31.220  -18.475 1.00 36.89  ? 27  TRP E CG  1 
ATOM   9354  C  CD1 . TRP E  5  27  ? -62.181 31.665  -17.302 1.00 35.44  ? 27  TRP E CD1 1 
ATOM   9355  C  CD2 . TRP E  5  27  ? -61.894 30.112  -18.902 1.00 34.52  ? 27  TRP E CD2 1 
ATOM   9356  N  NE1 . TRP E  5  27  ? -61.093 30.905  -16.972 1.00 36.71  ? 27  TRP E NE1 1 
ATOM   9357  C  CE2 . TRP E  5  27  ? -60.893 29.946  -17.930 1.00 35.28  ? 27  TRP E CE2 1 
ATOM   9358  C  CE3 . TRP E  5  27  ? -61.914 29.245  -20.017 1.00 35.59  ? 27  TRP E CE3 1 
ATOM   9359  C  CZ2 . TRP E  5  27  ? -59.913 28.934  -18.014 1.00 37.53  ? 27  TRP E CZ2 1 
ATOM   9360  C  CZ3 . TRP E  5  27  ? -60.934 28.225  -20.110 1.00 36.90  ? 27  TRP E CZ3 1 
ATOM   9361  C  CH2 . TRP E  5  27  ? -59.946 28.086  -19.110 1.00 38.71  ? 27  TRP E CH2 1 
ATOM   9362  N  N   . GLU E  5  28  ? -63.422 31.554  -22.295 1.00 40.77  ? 28  GLU E N   1 
ATOM   9363  C  CA  . GLU E  5  28  ? -62.725 30.876  -23.384 1.00 42.54  ? 28  GLU E CA  1 
ATOM   9364  C  C   . GLU E  5  28  ? -62.189 31.851  -24.444 1.00 40.18  ? 28  GLU E C   1 
ATOM   9365  O  O   . GLU E  5  28  ? -61.139 31.596  -25.025 1.00 38.95  ? 28  GLU E O   1 
ATOM   9366  C  CB  . GLU E  5  28  ? -63.649 29.851  -24.016 1.00 43.12  ? 28  GLU E CB  1 
ATOM   9367  C  CG  . GLU E  5  28  ? -63.966 28.683  -23.112 1.00 44.24  ? 28  GLU E CG  1 
ATOM   9368  C  CD  . GLU E  5  28  ? -65.055 27.818  -23.700 1.00 48.04  ? 28  GLU E CD  1 
ATOM   9369  O  OE1 . GLU E  5  28  ? -65.042 26.580  -23.433 1.00 47.91  ? 28  GLU E OE1 1 
ATOM   9370  O  OE2 . GLU E  5  28  ? -65.915 28.395  -24.421 1.00 43.51  ? 28  GLU E OE2 1 
ATOM   9371  N  N   . LEU E  5  29  ? -62.896 32.956  -24.675 1.00 36.03  ? 29  LEU E N   1 
ATOM   9372  C  CA  . LEU E  5  29  ? -62.389 34.016  -25.556 1.00 37.12  ? 29  LEU E CA  1 
ATOM   9373  C  C   . LEU E  5  29  ? -61.085 34.584  -25.040 1.00 36.20  ? 29  LEU E C   1 
ATOM   9374  O  O   . LEU E  5  29  ? -60.198 34.824  -25.836 1.00 36.16  ? 29  LEU E O   1 
ATOM   9375  C  CB  . LEU E  5  29  ? -63.378 35.175  -25.685 1.00 35.60  ? 29  LEU E CB  1 
ATOM   9376  C  CG  . LEU E  5  29  ? -62.953 36.374  -26.507 1.00 37.91  ? 29  LEU E CG  1 
ATOM   9377  C  CD1 . LEU E  5  29  ? -63.224 36.135  -27.968 1.00 39.39  ? 29  LEU E CD1 1 
ATOM   9378  C  CD2 . LEU E  5  29  ? -63.694 37.609  -26.043 1.00 41.59  ? 29  LEU E CD2 1 
ATOM   9379  N  N   . ARG E  5  30  ? -61.010 34.842  -23.730 1.00 37.81  ? 30  ARG E N   1 
ATOM   9380  C  CA  . ARG E  5  30  ? -59.833 35.476  -23.110 1.00 37.30  ? 30  ARG E CA  1 
ATOM   9381  C  C   . ARG E  5  30  ? -58.670 34.512  -23.098 1.00 36.80  ? 30  ARG E C   1 
ATOM   9382  O  O   . ARG E  5  30  ? -57.584 34.814  -23.580 1.00 38.11  ? 30  ARG E O   1 
ATOM   9383  C  CB  . ARG E  5  30  ? -60.144 35.929  -21.690 1.00 37.40  ? 30  ARG E CB  1 
ATOM   9384  C  CG  . ARG E  5  30  ? -61.157 37.072  -21.647 1.00 40.11  ? 30  ARG E CG  1 
ATOM   9385  C  CD  . ARG E  5  30  ? -61.106 37.823  -20.324 1.00 38.69  ? 30  ARG E CD  1 
ATOM   9386  N  NE  . ARG E  5  30  ? -61.376 36.925  -19.210 1.00 40.38  ? 30  ARG E NE  1 
ATOM   9387  C  CZ  . ARG E  5  30  ? -62.588 36.561  -18.790 1.00 42.78  ? 30  ARG E CZ  1 
ATOM   9388  N  NH1 . ARG E  5  30  ? -63.700 37.001  -19.391 1.00 46.43  ? 30  ARG E NH1 1 
ATOM   9389  N  NH2 . ARG E  5  30  ? -62.694 35.737  -17.765 1.00 41.46  ? 30  ARG E NH2 1 
ATOM   9390  N  N   . LYS E  5  31  ? -58.922 33.340  -22.555 1.00 37.59  ? 31  LYS E N   1 
ATOM   9391  C  CA  . LYS E  5  31  ? -57.963 32.261  -22.570 1.00 39.51  ? 31  LYS E CA  1 
ATOM   9392  C  C   . LYS E  5  31  ? -57.369 32.099  -23.948 1.00 36.36  ? 31  LYS E C   1 
ATOM   9393  O  O   . LYS E  5  31  ? -56.161 32.019  -24.090 1.00 37.42  ? 31  LYS E O   1 
ATOM   9394  C  CB  . LYS E  5  31  ? -58.658 30.984  -22.106 1.00 44.84  ? 31  LYS E CB  1 
ATOM   9395  C  CG  . LYS E  5  31  ? -57.862 29.707  -22.224 1.00 50.39  ? 31  LYS E CG  1 
ATOM   9396  C  CD  . LYS E  5  31  ? -56.594 29.691  -21.388 1.00 58.45  ? 31  LYS E CD  1 
ATOM   9397  C  CE  . LYS E  5  31  ? -55.687 28.529  -21.792 1.00 66.00  ? 31  LYS E CE  1 
ATOM   9398  N  NZ  . LYS E  5  31  ? -56.436 27.230  -21.919 1.00 68.55  ? 31  LYS E NZ  1 
ATOM   9399  N  N   . GLY E  5  32  ? -58.210 32.073  -24.975 1.00 34.76  ? 32  GLY E N   1 
ATOM   9400  C  CA  . GLY E  5  32  ? -57.721 31.931  -26.346 1.00 32.14  ? 32  GLY E CA  1 
ATOM   9401  C  C   . GLY E  5  32  ? -56.807 33.065  -26.763 1.00 31.91  ? 32  GLY E C   1 
ATOM   9402  O  O   . GLY E  5  32  ? -55.686 32.839  -27.160 1.00 33.44  ? 32  GLY E O   1 
ATOM   9403  N  N   . MET E  5  33  ? -57.273 34.300  -26.686 1.00 32.00  ? 33  MET E N   1 
ATOM   9404  C  CA  . MET E  5  33  ? -56.414 35.435  -27.029 1.00 34.47  ? 33  MET E CA  1 
ATOM   9405  C  C   . MET E  5  33  ? -55.118 35.542  -26.199 1.00 35.24  ? 33  MET E C   1 
ATOM   9406  O  O   . MET E  5  33  ? -54.055 35.837  -26.751 1.00 33.17  ? 33  MET E O   1 
ATOM   9407  C  CB  . MET E  5  33  ? -57.174 36.764  -26.900 1.00 35.75  ? 33  MET E CB  1 
ATOM   9408  C  CG  . MET E  5  33  ? -58.020 37.066  -28.119 1.00 39.80  ? 33  MET E CG  1 
ATOM   9409  S  SD  . MET E  5  33  ? -57.136 36.882  -29.684 1.00 40.01  ? 33  MET E SD  1 
ATOM   9410  C  CE  . MET E  5  33  ? -55.913 38.161  -29.442 1.00 36.60  ? 33  MET E CE  1 
ATOM   9411  N  N   . ASN E  5  34  ? -55.244 35.370  -24.884 1.00 32.02  ? 34  ASN E N   1 
ATOM   9412  C  CA  . ASN E  5  34  ? -54.115 35.439  -23.985 1.00 31.93  ? 34  ASN E CA  1 
ATOM   9413  C  C   . ASN E  5  34  ? -53.123 34.312  -24.260 1.00 32.26  ? 34  ASN E C   1 
ATOM   9414  O  O   . ASN E  5  34  ? -51.944 34.535  -24.078 1.00 33.67  ? 34  ASN E O   1 
ATOM   9415  C  CB  . ASN E  5  34  ? -54.559 35.417  -22.516 1.00 32.10  ? 34  ASN E CB  1 
ATOM   9416  C  CG  . ASN E  5  34  ? -55.278 36.700  -22.089 1.00 33.36  ? 34  ASN E CG  1 
ATOM   9417  O  OD1 . ASN E  5  34  ? -55.093 37.776  -22.686 1.00 37.90  ? 34  ASN E OD1 1 
ATOM   9418  N  ND2 . ASN E  5  34  ? -56.100 36.594  -21.049 1.00 30.01  ? 34  ASN E ND2 1 
ATOM   9419  N  N   . THR E  5  35  ? -53.571 33.134  -24.698 1.00 30.84  ? 35  THR E N   1 
ATOM   9420  C  CA  . THR E  5  35  ? -52.657 32.082  -25.156 1.00 31.07  ? 35  THR E CA  1 
ATOM   9421  C  C   . THR E  5  35  ? -51.957 32.446  -26.471 1.00 34.49  ? 35  THR E C   1 
ATOM   9422  O  O   . THR E  5  35  ? -50.737 32.320  -26.606 1.00 41.80  ? 35  THR E O   1 
ATOM   9423  C  CB  . THR E  5  35  ? -53.385 30.728  -25.289 1.00 30.94  ? 35  THR E CB  1 
ATOM   9424  O  OG1 . THR E  5  35  ? -53.850 30.338  -23.993 1.00 33.20  ? 35  THR E OG1 1 
ATOM   9425  C  CG2 . THR E  5  35  ? -52.476 29.628  -25.819 1.00 29.68  ? 35  THR E CG2 1 
ATOM   9426  N  N   . LEU E  5  36  ? -52.717 32.922  -27.437 1.00 39.52  ? 36  LEU E N   1 
ATOM   9427  C  CA  . LEU E  5  36  ? -52.209 33.162  -28.800 1.00 39.17  ? 36  LEU E CA  1 
ATOM   9428  C  C   . LEU E  5  36  ? -51.082 34.190  -28.862 1.00 37.96  ? 36  LEU E C   1 
ATOM   9429  O  O   . LEU E  5  36  ? -50.226 34.105  -29.752 1.00 36.54  ? 36  LEU E O   1 
ATOM   9430  C  CB  . LEU E  5  36  ? -53.375 33.613  -29.700 1.00 44.42  ? 36  LEU E CB  1 
ATOM   9431  C  CG  . LEU E  5  36  ? -53.384 33.393  -31.215 1.00 45.70  ? 36  LEU E CG  1 
ATOM   9432  C  CD1 . LEU E  5  36  ? -53.201 31.931  -31.550 1.00 45.23  ? 36  LEU E CD1 1 
ATOM   9433  C  CD2 . LEU E  5  36  ? -54.720 33.878  -31.769 1.00 45.95  ? 36  LEU E CD2 1 
ATOM   9434  N  N   . VAL E  5  37  ? -51.111 35.168  -27.942 1.00 36.47  ? 37  VAL E N   1 
ATOM   9435  C  CA  . VAL E  5  37  ? -50.093 36.222  -27.884 1.00 37.33  ? 37  VAL E CA  1 
ATOM   9436  C  C   . VAL E  5  37  ? -48.764 35.767  -27.297 1.00 35.01  ? 37  VAL E C   1 
ATOM   9437  O  O   . VAL E  5  37  ? -47.804 36.533  -27.342 1.00 39.45  ? 37  VAL E O   1 
ATOM   9438  C  CB  . VAL E  5  37  ? -50.538 37.480  -27.117 1.00 37.39  ? 37  VAL E CB  1 
ATOM   9439  C  CG1 . VAL E  5  37  ? -51.649 38.148  -27.867 1.00 42.81  ? 37  VAL E CG1 1 
ATOM   9440  C  CG2 . VAL E  5  37  ? -50.952 37.155  -25.695 1.00 39.10  ? 37  VAL E CG2 1 
ATOM   9441  N  N   . GLY E  5  38  ? -48.710 34.559  -26.738 1.00 32.14  ? 38  GLY E N   1 
ATOM   9442  C  CA  . GLY E  5  38  ? -47.461 33.969  -26.307 1.00 31.91  ? 38  GLY E CA  1 
ATOM   9443  C  C   . GLY E  5  38  ? -46.593 33.414  -27.403 1.00 33.25  ? 38  GLY E C   1 
ATOM   9444  O  O   . GLY E  5  38  ? -45.440 33.109  -27.166 1.00 37.11  ? 38  GLY E O   1 
ATOM   9445  N  N   . TYR E  5  39  ? -47.150 33.222  -28.594 1.00 37.47  ? 39  TYR E N   1 
ATOM   9446  C  CA  . TYR E  5  39  ? -46.425 32.570  -29.691 1.00 37.57  ? 39  TYR E CA  1 
ATOM   9447  C  C   . TYR E  5  39  ? -45.663 33.601  -30.515 1.00 35.17  ? 39  TYR E C   1 
ATOM   9448  O  O   . TYR E  5  39  ? -45.975 34.781  -30.497 1.00 36.18  ? 39  TYR E O   1 
ATOM   9449  C  CB  . TYR E  5  39  ? -47.387 31.749  -30.567 1.00 40.78  ? 39  TYR E CB  1 
ATOM   9450  C  CG  . TYR E  5  39  ? -48.036 30.590  -29.843 1.00 45.28  ? 39  TYR E CG  1 
ATOM   9451  C  CD1 . TYR E  5  39  ? -47.279 29.514  -29.362 1.00 52.86  ? 39  TYR E CD1 1 
ATOM   9452  C  CD2 . TYR E  5  39  ? -49.404 30.553  -29.636 1.00 47.94  ? 39  TYR E CD2 1 
ATOM   9453  C  CE1 . TYR E  5  39  ? -47.884 28.442  -28.698 1.00 52.97  ? 39  TYR E CE1 1 
ATOM   9454  C  CE2 . TYR E  5  39  ? -50.014 29.492  -28.975 1.00 48.78  ? 39  TYR E CE2 1 
ATOM   9455  C  CZ  . TYR E  5  39  ? -49.257 28.444  -28.507 1.00 51.89  ? 39  TYR E CZ  1 
ATOM   9456  O  OH  . TYR E  5  39  ? -49.892 27.419  -27.848 1.00 55.54  ? 39  TYR E OH  1 
ATOM   9457  N  N   . ASP E  5  40  ? -44.641 33.134  -31.212 1.00 36.11  ? 40  ASP E N   1 
ATOM   9458  C  CA  . ASP E  5  40  ? -43.801 33.961  -32.063 1.00 35.43  ? 40  ASP E CA  1 
ATOM   9459  C  C   . ASP E  5  40  ? -44.501 34.047  -33.418 1.00 36.72  ? 40  ASP E C   1 
ATOM   9460  O  O   . ASP E  5  40  ? -44.149 33.343  -34.354 1.00 35.45  ? 40  ASP E O   1 
ATOM   9461  C  CB  . ASP E  5  40  ? -42.404 33.333  -32.165 1.00 33.36  ? 40  ASP E CB  1 
ATOM   9462  C  CG  . ASP E  5  40  ? -41.462 34.118  -33.028 1.00 34.54  ? 40  ASP E CG  1 
ATOM   9463  O  OD1 . ASP E  5  40  ? -41.681 35.328  -33.254 1.00 32.64  ? 40  ASP E OD1 1 
ATOM   9464  O  OD2 . ASP E  5  40  ? -40.464 33.523  -33.465 1.00 35.84  ? 40  ASP E OD2 1 
ATOM   9465  N  N   . LEU E  5  41  ? -45.511 34.910  -33.474 1.00 39.24  ? 41  LEU E N   1 
ATOM   9466  C  CA  . LEU E  5  41  ? -46.383 35.081  -34.634 1.00 39.65  ? 41  LEU E CA  1 
ATOM   9467  C  C   . LEU E  5  41  ? -47.430 36.149  -34.405 1.00 36.95  ? 41  LEU E C   1 
ATOM   9468  O  O   . LEU E  5  41  ? -47.945 36.301  -33.299 1.00 38.62  ? 41  LEU E O   1 
ATOM   9469  C  CB  . LEU E  5  41  ? -47.114 33.781  -34.988 1.00 41.52  ? 41  LEU E CB  1 
ATOM   9470  C  CG  . LEU E  5  41  ? -48.082 33.171  -33.976 1.00 42.49  ? 41  LEU E CG  1 
ATOM   9471  C  CD1 . LEU E  5  41  ? -49.473 33.770  -34.089 1.00 43.32  ? 41  LEU E CD1 1 
ATOM   9472  C  CD2 . LEU E  5  41  ? -48.160 31.654  -34.165 1.00 43.10  ? 41  LEU E CD2 1 
ATOM   9473  N  N   . VAL E  5  42  ? -47.728 36.901  -35.455 1.00 37.94  ? 42  VAL E N   1 
ATOM   9474  C  CA  . VAL E  5  42  ? -48.940 37.728  -35.495 1.00 39.06  ? 42  VAL E CA  1 
ATOM   9475  C  C   . VAL E  5  42  ? -49.980 36.813  -36.100 1.00 37.47  ? 42  VAL E C   1 
ATOM   9476  O  O   . VAL E  5  42  ? -49.766 36.268  -37.174 1.00 36.87  ? 42  VAL E O   1 
ATOM   9477  C  CB  . VAL E  5  42  ? -48.780 39.001  -36.332 1.00 40.22  ? 42  VAL E CB  1 
ATOM   9478  C  CG1 . VAL E  5  42  ? -50.065 39.815  -36.323 1.00 39.99  ? 42  VAL E CG1 1 
ATOM   9479  C  CG2 . VAL E  5  42  ? -47.628 39.831  -35.791 1.00 40.30  ? 42  VAL E CG2 1 
ATOM   9480  N  N   . PRO E  5  43  ? -51.091 36.590  -35.396 1.00 39.16  ? 43  PRO E N   1 
ATOM   9481  C  CA  . PRO E  5  43  ? -52.041 35.611  -35.933 1.00 39.03  ? 43  PRO E CA  1 
ATOM   9482  C  C   . PRO E  5  43  ? -52.630 36.027  -37.277 1.00 39.28  ? 43  PRO E C   1 
ATOM   9483  O  O   . PRO E  5  43  ? -52.763 37.226  -37.570 1.00 36.72  ? 43  PRO E O   1 
ATOM   9484  C  CB  . PRO E  5  43  ? -53.142 35.549  -34.881 1.00 38.97  ? 43  PRO E CB  1 
ATOM   9485  C  CG  . PRO E  5  43  ? -52.716 36.429  -33.761 1.00 38.49  ? 43  PRO E CG  1 
ATOM   9486  C  CD  . PRO E  5  43  ? -51.615 37.308  -34.230 1.00 37.95  ? 43  PRO E CD  1 
ATOM   9487  N  N   . GLU E  5  44  ? -52.969 35.022  -38.078 1.00 43.70  ? 44  GLU E N   1 
ATOM   9488  C  CA  . GLU E  5  44  ? -53.549 35.228  -39.416 1.00 42.54  ? 44  GLU E CA  1 
ATOM   9489  C  C   . GLU E  5  44  ? -54.923 35.931  -39.352 1.00 38.14  ? 44  GLU E C   1 
ATOM   9490  O  O   . GLU E  5  44  ? -55.703 35.701  -38.408 1.00 31.98  ? 44  GLU E O   1 
ATOM   9491  C  CB  . GLU E  5  44  ? -53.682 33.894  -40.153 1.00 46.56  ? 44  GLU E CB  1 
ATOM   9492  C  CG  . GLU E  5  44  ? -52.368 33.371  -40.714 1.00 51.60  ? 44  GLU E CG  1 
ATOM   9493  C  CD  . GLU E  5  44  ? -52.100 33.728  -42.163 1.00 54.29  ? 44  GLU E CD  1 
ATOM   9494  O  OE1 . GLU E  5  44  ? -50.981 33.391  -42.611 1.00 55.78  ? 44  GLU E OE1 1 
ATOM   9495  O  OE2 . GLU E  5  44  ? -52.988 34.284  -42.858 1.00 51.91  ? 44  GLU E OE2 1 
ATOM   9496  N  N   . PRO E  5  45  ? -55.210 36.788  -40.357 1.00 36.67  ? 45  PRO E N   1 
ATOM   9497  C  CA  . PRO E  5  45  ? -56.464 37.496  -40.390 1.00 38.07  ? 45  PRO E CA  1 
ATOM   9498  C  C   . PRO E  5  45  ? -57.668 36.607  -40.140 1.00 38.28  ? 45  PRO E C   1 
ATOM   9499  O  O   . PRO E  5  45  ? -58.567 37.040  -39.441 1.00 38.43  ? 45  PRO E O   1 
ATOM   9500  C  CB  . PRO E  5  45  ? -56.480 38.087  -41.789 1.00 39.43  ? 45  PRO E CB  1 
ATOM   9501  C  CG  . PRO E  5  45  ? -55.032 38.347  -42.097 1.00 38.20  ? 45  PRO E CG  1 
ATOM   9502  C  CD  . PRO E  5  45  ? -54.253 37.327  -41.350 1.00 36.53  ? 45  PRO E CD  1 
ATOM   9503  N  N   . LYS E  5  46  ? -57.670 35.376  -40.654 1.00 41.78  ? 46  LYS E N   1 
ATOM   9504  C  CA  . LYS E  5  46  ? -58.810 34.463  -40.446 1.00 46.88  ? 46  LYS E CA  1 
ATOM   9505  C  C   . LYS E  5  46  ? -59.016 34.007  -38.993 1.00 46.96  ? 46  LYS E C   1 
ATOM   9506  O  O   . LYS E  5  46  ? -60.137 33.630  -38.622 1.00 48.96  ? 46  LYS E O   1 
ATOM   9507  C  CB  . LYS E  5  46  ? -58.783 33.262  -41.419 1.00 52.91  ? 46  LYS E CB  1 
ATOM   9508  C  CG  . LYS E  5  46  ? -57.639 32.273  -41.221 1.00 62.67  ? 46  LYS E CG  1 
ATOM   9509  C  CD  . LYS E  5  46  ? -57.169 31.614  -42.521 1.00 67.76  ? 46  LYS E CD  1 
ATOM   9510  C  CE  . LYS E  5  46  ? -57.886 30.310  -42.864 1.00 73.11  ? 46  LYS E CE  1 
ATOM   9511  N  NZ  . LYS E  5  46  ? -57.055 29.114  -42.520 1.00 73.26  ? 46  LYS E NZ  1 
ATOM   9512  N  N   . ILE E  5  47  ? -57.971 34.055  -38.161 1.00 45.23  ? 47  ILE E N   1 
ATOM   9513  C  CA  . ILE E  5  47  ? -58.128 33.740  -36.730 1.00 40.43  ? 47  ILE E CA  1 
ATOM   9514  C  C   . ILE E  5  47  ? -58.775 34.933  -36.048 1.00 37.91  ? 47  ILE E C   1 
ATOM   9515  O  O   . ILE E  5  47  ? -59.704 34.765  -35.246 1.00 35.39  ? 47  ILE E O   1 
ATOM   9516  C  CB  . ILE E  5  47  ? -56.785 33.418  -36.039 1.00 41.06  ? 47  ILE E CB  1 
ATOM   9517  C  CG1 . ILE E  5  47  ? -56.201 32.104  -36.565 1.00 42.57  ? 47  ILE E CG1 1 
ATOM   9518  C  CG2 . ILE E  5  47  ? -56.978 33.266  -34.527 1.00 43.29  ? 47  ILE E CG2 1 
ATOM   9519  C  CD1 . ILE E  5  47  ? -54.724 31.933  -36.269 1.00 43.50  ? 47  ILE E CD1 1 
ATOM   9520  N  N   . ILE E  5  48  ? -58.259 36.122  -36.368 1.00 34.69  ? 48  ILE E N   1 
ATOM   9521  C  CA  . ILE E  5  48  ? -58.684 37.377  -35.736 1.00 36.75  ? 48  ILE E CA  1 
ATOM   9522  C  C   . ILE E  5  48  ? -60.149 37.601  -36.043 1.00 38.94  ? 48  ILE E C   1 
ATOM   9523  O  O   . ILE E  5  48  ? -60.908 37.950  -35.165 1.00 40.93  ? 48  ILE E O   1 
ATOM   9524  C  CB  . ILE E  5  48  ? -57.888 38.613  -36.266 1.00 34.39  ? 48  ILE E CB  1 
ATOM   9525  C  CG1 . ILE E  5  48  ? -56.377 38.522  -35.967 1.00 34.80  ? 48  ILE E CG1 1 
ATOM   9526  C  CG2 . ILE E  5  48  ? -58.454 39.900  -35.712 1.00 33.54  ? 48  ILE E CG2 1 
ATOM   9527  C  CD1 . ILE E  5  48  ? -56.067 38.192  -34.529 1.00 35.14  ? 48  ILE E CD1 1 
ATOM   9528  N  N   . ASP E  5  49  ? -60.513 37.418  -37.309 1.00 42.63  ? 49  ASP E N   1 
ATOM   9529  C  CA  . ASP E  5  49  ? -61.902 37.460  -37.774 1.00 44.02  ? 49  ASP E CA  1 
ATOM   9530  C  C   . ASP E  5  49  ? -62.791 36.541  -36.927 1.00 41.24  ? 49  ASP E C   1 
ATOM   9531  O  O   . ASP E  5  49  ? -63.788 36.996  -36.378 1.00 41.78  ? 49  ASP E O   1 
ATOM   9532  C  CB  . ASP E  5  49  ? -61.957 37.056  -39.263 1.00 50.56  ? 49  ASP E CB  1 
ATOM   9533  C  CG  . ASP E  5  49  ? -63.363 37.123  -39.865 1.00 50.22  ? 49  ASP E CG  1 
ATOM   9534  O  OD1 . ASP E  5  49  ? -64.137 36.139  -39.732 1.00 49.57  ? 49  ASP E OD1 1 
ATOM   9535  O  OD2 . ASP E  5  49  ? -63.656 38.149  -40.496 1.00 46.91  ? 49  ASP E OD2 1 
ATOM   9536  N  N   . ALA E  5  50  ? -62.429 35.268  -36.786 1.00 36.19  ? 50  ALA E N   1 
ATOM   9537  C  CA  . ALA E  5  50  ? -63.200 34.402  -35.910 1.00 35.69  ? 50  ALA E CA  1 
ATOM   9538  C  C   . ALA E  5  50  ? -63.279 35.007  -34.535 1.00 38.09  ? 50  ALA E C   1 
ATOM   9539  O  O   . ALA E  5  50  ? -64.347 35.046  -33.928 1.00 40.88  ? 50  ALA E O   1 
ATOM   9540  C  CB  . ALA E  5  50  ? -62.619 33.010  -35.832 1.00 35.58  ? 50  ALA E CB  1 
ATOM   9541  N  N   . ALA E  5  51  ? -62.157 35.518  -34.041 1.00 39.21  ? 51  ALA E N   1 
ATOM   9542  C  CA  . ALA E  5  51  ? -62.148 36.062  -32.680 1.00 37.56  ? 51  ALA E CA  1 
ATOM   9543  C  C   . ALA E  5  51  ? -63.061 37.285  -32.547 1.00 34.21  ? 51  ALA E C   1 
ATOM   9544  O  O   . ALA E  5  51  ? -63.778 37.403  -31.564 1.00 35.86  ? 51  ALA E O   1 
ATOM   9545  C  CB  . ALA E  5  51  ? -60.741 36.375  -32.238 1.00 36.87  ? 51  ALA E CB  1 
ATOM   9546  N  N   . LEU E  5  52  ? -63.047 38.162  -33.538 1.00 33.00  ? 52  LEU E N   1 
ATOM   9547  C  CA  . LEU E  5  52  ? -63.894 39.338  -33.546 1.00 35.34  ? 52  LEU E CA  1 
ATOM   9548  C  C   . LEU E  5  52  ? -65.363 38.964  -33.615 1.00 37.52  ? 52  LEU E C   1 
ATOM   9549  O  O   . LEU E  5  52  ? -66.175 39.629  -32.985 1.00 37.89  ? 52  LEU E O   1 
ATOM   9550  C  CB  . LEU E  5  52  ? -63.573 40.249  -34.727 1.00 36.92  ? 52  LEU E CB  1 
ATOM   9551  C  CG  . LEU E  5  52  ? -62.200 40.932  -34.788 1.00 38.90  ? 52  LEU E CG  1 
ATOM   9552  C  CD1 . LEU E  5  52  ? -62.060 41.734  -36.063 1.00 39.95  ? 52  LEU E CD1 1 
ATOM   9553  C  CD2 . LEU E  5  52  ? -61.983 41.847  -33.612 1.00 39.93  ? 52  LEU E CD2 1 
ATOM   9554  N  N   . ARG E  5  53  ? -65.705 37.910  -34.363 1.00 39.07  ? 53  ARG E N   1 
ATOM   9555  C  CA  . ARG E  5  53  ? -67.103 37.410  -34.441 1.00 39.66  ? 53  ARG E CA  1 
ATOM   9556  C  C   . ARG E  5  53  ? -67.541 36.877  -33.117 1.00 38.98  ? 53  ARG E C   1 
ATOM   9557  O  O   . ARG E  5  53  ? -68.631 37.182  -32.670 1.00 43.67  ? 53  ARG E O   1 
ATOM   9558  C  CB  . ARG E  5  53  ? -67.300 36.354  -35.550 1.00 40.39  ? 53  ARG E CB  1 
ATOM   9559  C  CG  . ARG E  5  53  ? -67.403 37.081  -36.890 1.00 44.13  ? 53  ARG E CG  1 
ATOM   9560  C  CD  . ARG E  5  53  ? -67.227 36.244  -38.161 1.00 45.47  ? 53  ARG E CD  1 
ATOM   9561  N  NE  . ARG E  5  53  ? -67.010 37.186  -39.272 1.00 47.65  ? 53  ARG E NE  1 
ATOM   9562  C  CZ  . ARG E  5  53  ? -67.953 37.916  -39.879 1.00 44.99  ? 53  ARG E CZ  1 
ATOM   9563  N  NH1 . ARG E  5  53  ? -69.235 37.783  -39.555 1.00 47.12  ? 53  ARG E NH1 1 
ATOM   9564  N  NH2 . ARG E  5  53  ? -67.606 38.786  -40.828 1.00 40.40  ? 53  ARG E NH2 1 
ATOM   9565  N  N   . ALA E  5  54  ? -66.672 36.123  -32.464 1.00 38.72  ? 54  ALA E N   1 
ATOM   9566  C  CA  . ALA E  5  54  ? -66.941 35.693  -31.103 1.00 40.12  ? 54  ALA E CA  1 
ATOM   9567  C  C   . ALA E  5  54  ? -67.281 36.877  -30.187 1.00 38.38  ? 54  ALA E C   1 
ATOM   9568  O  O   . ALA E  5  54  ? -68.199 36.778  -29.366 1.00 41.84  ? 54  ALA E O   1 
ATOM   9569  C  CB  . ALA E  5  54  ? -65.771 34.879  -30.548 1.00 41.06  ? 54  ALA E CB  1 
ATOM   9570  N  N   . CYS E  5  55  ? -66.569 37.994  -30.333 1.00 36.45  ? 55  CYS E N   1 
ATOM   9571  C  CA  . CYS E  5  55  ? -66.850 39.174  -29.506 1.00 36.65  ? 55  CYS E CA  1 
ATOM   9572  C  C   . CYS E  5  55  ? -68.278 39.690  -29.712 1.00 36.57  ? 55  CYS E C   1 
ATOM   9573  O  O   . CYS E  5  55  ? -68.928 40.141  -28.747 1.00 32.00  ? 55  CYS E O   1 
ATOM   9574  C  CB  . CYS E  5  55  ? -65.861 40.321  -29.770 1.00 36.44  ? 55  CYS E CB  1 
ATOM   9575  S  SG  . CYS E  5  55  ? -64.179 39.972  -29.283 1.00 38.82  ? 55  CYS E SG  1 
ATOM   9576  N  N   . ARG E  5  56  ? -68.737 39.640  -30.971 1.00 37.34  ? 56  ARG E N   1 
ATOM   9577  C  CA  . ARG E  5  56  ? -70.099 40.010  -31.321 1.00 38.03  ? 56  ARG E CA  1 
ATOM   9578  C  C   . ARG E  5  56  ? -71.083 39.067  -30.670 1.00 38.58  ? 56  ARG E C   1 
ATOM   9579  O  O   . ARG E  5  56  ? -72.057 39.539  -30.069 1.00 44.85  ? 56  ARG E O   1 
ATOM   9580  C  CB  . ARG E  5  56  ? -70.322 40.017  -32.824 1.00 39.11  ? 56  ARG E CB  1 
ATOM   9581  C  CG  . ARG E  5  56  ? -71.764 40.268  -33.250 1.00 37.18  ? 56  ARG E CG  1 
ATOM   9582  C  CD  . ARG E  5  56  ? -72.187 41.689  -32.989 1.00 35.32  ? 56  ARG E CD  1 
ATOM   9583  N  NE  . ARG E  5  56  ? -72.750 41.882  -31.666 1.00 34.44  ? 56  ARG E NE  1 
ATOM   9584  C  CZ  . ARG E  5  56  ? -73.262 43.039  -31.270 1.00 34.37  ? 56  ARG E CZ  1 
ATOM   9585  N  NH1 . ARG E  5  56  ? -73.286 44.078  -32.099 1.00 33.92  ? 56  ARG E NH1 1 
ATOM   9586  N  NH2 . ARG E  5  56  ? -73.725 43.170  -30.038 1.00 33.31  ? 56  ARG E NH2 1 
ATOM   9587  N  N   . ARG E  5  57  ? -70.824 37.765  -30.733 1.00 36.19  ? 57  ARG E N   1 
ATOM   9588  C  CA  . ARG E  5  57  ? -71.706 36.797  -30.081 1.00 36.07  ? 57  ARG E CA  1 
ATOM   9589  C  C   . ARG E  5  57  ? -71.791 37.014  -28.588 1.00 38.89  ? 57  ARG E C   1 
ATOM   9590  O  O   . ARG E  5  57  ? -72.803 36.662  -27.989 1.00 42.57  ? 57  ARG E O   1 
ATOM   9591  C  CB  . ARG E  5  57  ? -71.287 35.360  -30.361 1.00 36.61  ? 57  ARG E CB  1 
ATOM   9592  C  CG  . ARG E  5  57  ? -71.447 34.970  -31.810 1.00 37.67  ? 57  ARG E CG  1 
ATOM   9593  C  CD  . ARG E  5  57  ? -71.559 33.461  -32.006 1.00 39.93  ? 57  ARG E CD  1 
ATOM   9594  N  NE  . ARG E  5  57  ? -70.388 32.680  -31.596 1.00 43.67  ? 57  ARG E NE  1 
ATOM   9595  C  CZ  . ARG E  5  57  ? -69.196 32.666  -32.226 1.00 42.18  ? 57  ARG E CZ  1 
ATOM   9596  N  NH1 . ARG E  5  57  ? -68.952 33.450  -33.272 1.00 39.20  ? 57  ARG E NH1 1 
ATOM   9597  N  NH2 . ARG E  5  57  ? -68.209 31.895  -31.762 1.00 40.87  ? 57  ARG E NH2 1 
ATOM   9598  N  N   . LEU E  5  58  ? -70.741 37.586  -27.986 1.00 41.53  ? 58  LEU E N   1 
ATOM   9599  C  CA  . LEU E  5  58  ? -70.708 37.866  -26.530 1.00 40.16  ? 58  LEU E CA  1 
ATOM   9600  C  C   . LEU E  5  58  ? -71.030 39.293  -26.161 1.00 36.58  ? 58  LEU E C   1 
ATOM   9601  O  O   . LEU E  5  58  ? -70.949 39.654  -24.994 1.00 38.26  ? 58  LEU E O   1 
ATOM   9602  C  CB  . LEU E  5  58  ? -69.348 37.491  -25.959 1.00 43.66  ? 58  LEU E CB  1 
ATOM   9603  C  CG  . LEU E  5  58  ? -69.102 36.003  -25.801 1.00 42.92  ? 58  LEU E CG  1 
ATOM   9604  C  CD1 . LEU E  5  58  ? -67.602 35.738  -25.899 1.00 45.53  ? 58  LEU E CD1 1 
ATOM   9605  C  CD2 . LEU E  5  58  ? -69.687 35.531  -24.475 1.00 42.29  ? 58  LEU E CD2 1 
ATOM   9606  N  N   . ASN E  5  59  ? -71.425 40.080  -27.154 1.00 37.08  ? 59  ASN E N   1 
ATOM   9607  C  CA  . ASN E  5  59  ? -71.826 41.483  -27.000 1.00 37.37  ? 59  ASN E CA  1 
ATOM   9608  C  C   . ASN E  5  59  ? -70.751 42.295  -26.321 1.00 38.43  ? 59  ASN E C   1 
ATOM   9609  O  O   . ASN E  5  59  ? -71.048 43.106  -25.444 1.00 44.51  ? 59  ASN E O   1 
ATOM   9610  C  CB  . ASN E  5  59  ? -73.170 41.610  -26.259 1.00 36.44  ? 59  ASN E CB  1 
ATOM   9611  C  CG  . ASN E  5  59  ? -74.264 40.817  -26.928 1.00 35.28  ? 59  ASN E CG  1 
ATOM   9612  O  OD1 . ASN E  5  59  ? -74.811 39.918  -26.337 1.00 38.40  ? 59  ASN E OD1 1 
ATOM   9613  N  ND2 . ASN E  5  59  ? -74.532 41.098  -28.186 1.00 34.03  ? 59  ASN E ND2 1 
ATOM   9614  N  N   . ASP E  5  60  ? -69.507 42.079  -26.753 1.00 34.64  ? 60  ASP E N   1 
ATOM   9615  C  CA  . ASP E  5  60  ? -68.365 42.696  -26.134 1.00 32.25  ? 60  ASP E CA  1 
ATOM   9616  C  C   . ASP E  5  60  ? -67.561 43.437  -27.180 1.00 31.01  ? 60  ASP E C   1 
ATOM   9617  O  O   . ASP E  5  60  ? -66.668 42.889  -27.780 1.00 30.35  ? 60  ASP E O   1 
ATOM   9618  C  CB  . ASP E  5  60  ? -67.525 41.643  -25.414 1.00 32.09  ? 60  ASP E CB  1 
ATOM   9619  C  CG  . ASP E  5  60  ? -66.317 42.241  -24.691 1.00 31.84  ? 60  ASP E CG  1 
ATOM   9620  O  OD1 . ASP E  5  60  ? -66.037 43.467  -24.760 1.00 31.01  ? 60  ASP E OD1 1 
ATOM   9621  O  OD2 . ASP E  5  60  ? -65.634 41.447  -24.061 1.00 29.80  ? 60  ASP E OD2 1 
ATOM   9622  N  N   . PHE E  5  61  ? -67.887 44.714  -27.358 1.00 33.73  ? 61  PHE E N   1 
ATOM   9623  C  CA  . PHE E  5  61  ? -67.229 45.576  -28.336 1.00 31.25  ? 61  PHE E CA  1 
ATOM   9624  C  C   . PHE E  5  61  ? -65.785 45.907  -27.932 1.00 32.30  ? 61  PHE E C   1 
ATOM   9625  O  O   . PHE E  5  61  ? -64.899 45.943  -28.776 1.00 30.41  ? 61  PHE E O   1 
ATOM   9626  C  CB  . PHE E  5  61  ? -68.048 46.865  -28.547 1.00 29.31  ? 61  PHE E CB  1 
ATOM   9627  C  CG  . PHE E  5  61  ? -67.303 47.935  -29.304 1.00 29.80  ? 61  PHE E CG  1 
ATOM   9628  C  CD1 . PHE E  5  61  ? -67.227 47.894  -30.663 1.00 29.54  ? 61  PHE E CD1 1 
ATOM   9629  C  CD2 . PHE E  5  61  ? -66.653 48.962  -28.633 1.00 28.60  ? 61  PHE E CD2 1 
ATOM   9630  C  CE1 . PHE E  5  61  ? -66.497 48.857  -31.355 1.00 31.30  ? 61  PHE E CE1 1 
ATOM   9631  C  CE2 . PHE E  5  61  ? -65.950 49.936  -29.323 1.00 31.23  ? 61  PHE E CE2 1 
ATOM   9632  C  CZ  . PHE E  5  61  ? -65.856 49.881  -30.693 1.00 28.94  ? 61  PHE E CZ  1 
ATOM   9633  N  N   . ALA E  5  62  ? -65.582 46.156  -26.638 1.00 33.71  ? 62  ALA E N   1 
ATOM   9634  C  CA  . ALA E  5  62  ? -64.323 46.649  -26.130 1.00 32.32  ? 62  ALA E CA  1 
ATOM   9635  C  C   . ALA E  5  62  ? -63.217 45.624  -26.324 1.00 31.17  ? 62  ALA E C   1 
ATOM   9636  O  O   . ALA E  5  62  ? -62.133 45.979  -26.766 1.00 30.61  ? 62  ALA E O   1 
ATOM   9637  C  CB  . ALA E  5  62  ? -64.457 47.004  -24.667 1.00 33.09  ? 62  ALA E CB  1 
ATOM   9638  N  N   . SER E  5  63  ? -63.487 44.361  -26.007 1.00 29.82  ? 63  SER E N   1 
ATOM   9639  C  CA  . SER E  5  63  ? -62.533 43.282  -26.325 1.00 30.09  ? 63  SER E CA  1 
ATOM   9640  C  C   . SER E  5  63  ? -62.166 43.161  -27.822 1.00 33.51  ? 63  SER E C   1 
ATOM   9641  O  O   . SER E  5  63  ? -61.048 42.703  -28.167 1.00 34.63  ? 63  SER E O   1 
ATOM   9642  C  CB  . SER E  5  63  ? -63.032 41.942  -25.817 1.00 29.35  ? 63  SER E CB  1 
ATOM   9643  O  OG  . SER E  5  63  ? -63.145 41.966  -24.405 1.00 29.54  ? 63  SER E OG  1 
ATOM   9644  N  N   . ALA E  5  64  ? -63.082 43.569  -28.706 1.00 32.19  ? 64  ALA E N   1 
ATOM   9645  C  CA  . ALA E  5  64  ? -62.783 43.585  -30.147 1.00 33.58  ? 64  ALA E CA  1 
ATOM   9646  C  C   . ALA E  5  64  ? -61.706 44.620  -30.496 1.00 32.29  ? 64  ALA E C   1 
ATOM   9647  O  O   . ALA E  5  64  ? -60.816 44.328  -31.289 1.00 29.77  ? 64  ALA E O   1 
ATOM   9648  C  CB  . ALA E  5  64  ? -64.045 43.825  -30.981 1.00 33.40  ? 64  ALA E CB  1 
ATOM   9649  N  N   . VAL E  5  65  ? -61.795 45.810  -29.897 1.00 31.48  ? 65  VAL E N   1 
ATOM   9650  C  CA  . VAL E  5  65  ? -60.804 46.866  -30.122 1.00 33.62  ? 65  VAL E CA  1 
ATOM   9651  C  C   . VAL E  5  65  ? -59.432 46.449  -29.522 1.00 34.83  ? 65  VAL E C   1 
ATOM   9652  O  O   . VAL E  5  65  ? -58.377 46.671  -30.143 1.00 35.91  ? 65  VAL E O   1 
ATOM   9653  C  CB  . VAL E  5  65  ? -61.264 48.213  -29.526 1.00 35.22  ? 65  VAL E CB  1 
ATOM   9654  C  CG1 . VAL E  5  65  ? -60.218 49.315  -29.751 1.00 34.34  ? 65  VAL E CG1 1 
ATOM   9655  C  CG2 . VAL E  5  65  ? -62.619 48.617  -30.116 1.00 36.17  ? 65  VAL E CG2 1 
ATOM   9656  N  N   . ARG E  5  66  ? -59.472 45.806  -28.350 1.00 32.35  ? 66  ARG E N   1 
ATOM   9657  C  CA  . ARG E  5  66  ? -58.282 45.311  -27.670 1.00 31.38  ? 66  ARG E CA  1 
ATOM   9658  C  C   . ARG E  5  66  ? -57.602 44.270  -28.510 1.00 30.63  ? 66  ARG E C   1 
ATOM   9659  O  O   . ARG E  5  66  ? -56.382 44.264  -28.594 1.00 30.31  ? 66  ARG E O   1 
ATOM   9660  C  CB  . ARG E  5  66  ? -58.643 44.672  -26.311 1.00 32.66  ? 66  ARG E CB  1 
ATOM   9661  C  CG  . ARG E  5  66  ? -57.489 44.396  -25.338 1.00 28.54  ? 66  ARG E CG  1 
ATOM   9662  C  CD  . ARG E  5  66  ? -57.063 45.670  -24.662 1.00 27.65  ? 66  ARG E CD  1 
ATOM   9663  N  NE  . ARG E  5  66  ? -56.384 45.398  -23.416 1.00 25.50  ? 66  ARG E NE  1 
ATOM   9664  C  CZ  . ARG E  5  66  ? -55.888 46.339  -22.640 1.00 25.96  ? 66  ARG E CZ  1 
ATOM   9665  N  NH1 . ARG E  5  66  ? -55.967 47.603  -22.999 1.00 26.74  ? 66  ARG E NH1 1 
ATOM   9666  N  NH2 . ARG E  5  66  ? -55.301 46.018  -21.493 1.00 28.39  ? 66  ARG E NH2 1 
ATOM   9667  N  N   . ILE E  5  67  ? -58.372 43.366  -29.110 1.00 31.78  ? 67  ILE E N   1 
ATOM   9668  C  CA  . ILE E  5  67  ? -57.756 42.354  -29.988 1.00 32.13  ? 67  ILE E CA  1 
ATOM   9669  C  C   . ILE E  5  67  ? -56.974 43.019  -31.116 1.00 32.74  ? 67  ILE E C   1 
ATOM   9670  O  O   . ILE E  5  67  ? -55.899 42.537  -31.464 1.00 30.52  ? 67  ILE E O   1 
ATOM   9671  C  CB  . ILE E  5  67  ? -58.777 41.358  -30.531 1.00 30.60  ? 67  ILE E CB  1 
ATOM   9672  C  CG1 . ILE E  5  67  ? -59.052 40.331  -29.474 1.00 29.78  ? 67  ILE E CG1 1 
ATOM   9673  C  CG2 . ILE E  5  67  ? -58.241 40.604  -31.750 1.00 32.73  ? 67  ILE E CG2 1 
ATOM   9674  C  CD1 . ILE E  5  67  ? -60.402 39.704  -29.607 1.00 32.20  ? 67  ILE E CD1 1 
ATOM   9675  N  N   . LEU E  5  68  ? -57.488 44.132  -31.660 1.00 32.63  ? 68  LEU E N   1 
ATOM   9676  C  CA  . LEU E  5  68  ? -56.779 44.826  -32.746 1.00 34.22  ? 68  LEU E CA  1 
ATOM   9677  C  C   . LEU E  5  68  ? -55.520 45.533  -32.260 1.00 31.74  ? 68  LEU E C   1 
ATOM   9678  O  O   . LEU E  5  68  ? -54.555 45.603  -32.994 1.00 31.78  ? 68  LEU E O   1 
ATOM   9679  C  CB  . LEU E  5  68  ? -57.683 45.831  -33.463 1.00 35.42  ? 68  LEU E CB  1 
ATOM   9680  C  CG  . LEU E  5  68  ? -58.904 45.214  -34.154 1.00 37.56  ? 68  LEU E CG  1 
ATOM   9681  C  CD1 . LEU E  5  68  ? -59.792 46.326  -34.710 1.00 38.20  ? 68  LEU E CD1 1 
ATOM   9682  C  CD2 . LEU E  5  68  ? -58.490 44.238  -35.240 1.00 37.27  ? 68  LEU E CD2 1 
ATOM   9683  N  N   . GLU E  5  69  ? -55.561 46.106  -31.057 1.00 30.58  ? 69  GLU E N   1 
ATOM   9684  C  CA  . GLU E  5  69  ? -54.369 46.656  -30.420 1.00 29.74  ? 69  GLU E CA  1 
ATOM   9685  C  C   . GLU E  5  69  ? -53.249 45.606  -30.245 1.00 30.32  ? 69  GLU E C   1 
ATOM   9686  O  O   . GLU E  5  69  ? -52.084 45.887  -30.523 1.00 25.48  ? 69  GLU E O   1 
ATOM   9687  C  CB  . GLU E  5  69  ? -54.724 47.191  -29.075 1.00 29.90  ? 69  GLU E CB  1 
ATOM   9688  C  CG  . GLU E  5  69  ? -55.534 48.455  -29.114 1.00 29.75  ? 69  GLU E CG  1 
ATOM   9689  C  CD  . GLU E  5  69  ? -55.760 48.940  -27.714 1.00 29.31  ? 69  GLU E CD  1 
ATOM   9690  O  OE1 . GLU E  5  69  ? -55.156 49.975  -27.308 1.00 29.83  ? 69  GLU E OE1 1 
ATOM   9691  O  OE2 . GLU E  5  69  ? -56.508 48.220  -27.023 1.00 28.18  ? 69  GLU E OE2 1 
ATOM   9692  N  N   . VAL E  5  70  ? -53.643 44.392  -29.857 1.00 31.62  ? 70  VAL E N   1 
ATOM   9693  C  CA  . VAL E  5  70  ? -52.718 43.300  -29.681 1.00 35.00  ? 70  VAL E CA  1 
ATOM   9694  C  C   . VAL E  5  70  ? -52.064 42.853  -30.987 1.00 35.60  ? 70  VAL E C   1 
ATOM   9695  O  O   . VAL E  5  70  ? -50.885 42.506  -30.983 1.00 36.69  ? 70  VAL E O   1 
ATOM   9696  C  CB  . VAL E  5  70  ? -53.347 42.113  -28.890 1.00 38.27  ? 70  VAL E CB  1 
ATOM   9697  C  CG1 . VAL E  5  70  ? -53.548 40.869  -29.740 1.00 41.70  ? 70  VAL E CG1 1 
ATOM   9698  C  CG2 . VAL E  5  70  ? -52.396 41.727  -27.784 1.00 42.83  ? 70  VAL E CG2 1 
ATOM   9699  N  N   . VAL E  5  71  ? -52.818 42.869  -32.082 1.00 34.82  ? 71  VAL E N   1 
ATOM   9700  C  CA  . VAL E  5  71  ? -52.274 42.537  -33.385 1.00 34.66  ? 71  VAL E CA  1 
ATOM   9701  C  C   . VAL E  5  71  ? -51.160 43.528  -33.705 1.00 34.67  ? 71  VAL E C   1 
ATOM   9702  O  O   . VAL E  5  71  ? -50.062 43.121  -34.127 1.00 30.11  ? 71  VAL E O   1 
ATOM   9703  C  CB  . VAL E  5  71  ? -53.346 42.558  -34.507 1.00 35.49  ? 71  VAL E CB  1 
ATOM   9704  C  CG1 . VAL E  5  71  ? -52.714 42.424  -35.887 1.00 36.94  ? 71  VAL E CG1 1 
ATOM   9705  C  CG2 . VAL E  5  71  ? -54.348 41.438  -34.329 1.00 36.38  ? 71  VAL E CG2 1 
ATOM   9706  N  N   . LYS E  5  72  ? -51.432 44.820  -33.523 1.00 33.77  ? 72  LYS E N   1 
ATOM   9707  C  CA  . LYS E  5  72  ? -50.429 45.827  -33.876 1.00 34.79  ? 72  LYS E CA  1 
ATOM   9708  C  C   . LYS E  5  72  ? -49.176 45.635  -33.010 1.00 32.63  ? 72  LYS E C   1 
ATOM   9709  O  O   . LYS E  5  72  ? -48.041 45.736  -33.468 1.00 31.53  ? 72  LYS E O   1 
ATOM   9710  C  CB  . LYS E  5  72  ? -50.982 47.249  -33.712 1.00 37.46  ? 72  LYS E CB  1 
ATOM   9711  C  CG  . LYS E  5  72  ? -50.114 48.318  -34.355 1.00 41.04  ? 72  LYS E CG  1 
ATOM   9712  C  CD  . LYS E  5  72  ? -50.115 49.611  -33.578 1.00 47.20  ? 72  LYS E CD  1 
ATOM   9713  C  CE  . LYS E  5  72  ? -51.330 50.439  -33.912 1.00 55.33  ? 72  LYS E CE  1 
ATOM   9714  N  NZ  . LYS E  5  72  ? -51.028 51.299  -35.098 1.00 60.73  ? 72  LYS E NZ  1 
ATOM   9715  N  N   . ASP E  5  73  ? -49.407 45.345  -31.741 1.00 31.90  ? 73  ASP E N   1 
ATOM   9716  C  CA  . ASP E  5  73  ? -48.342 45.233  -30.782 1.00 29.82  ? 73  ASP E CA  1 
ATOM   9717  C  C   . ASP E  5  73  ? -47.430 44.041  -31.071 1.00 28.41  ? 73  ASP E C   1 
ATOM   9718  O  O   . ASP E  5  73  ? -46.217 44.179  -30.979 1.00 27.08  ? 73  ASP E O   1 
ATOM   9719  C  CB  . ASP E  5  73  ? -48.925 45.133  -29.376 1.00 31.45  ? 73  ASP E CB  1 
ATOM   9720  C  CG  . ASP E  5  73  ? -47.858 45.235  -28.301 1.00 30.64  ? 73  ASP E CG  1 
ATOM   9721  O  OD1 . ASP E  5  73  ? -47.448 46.378  -28.001 1.00 28.25  ? 73  ASP E OD1 1 
ATOM   9722  O  OD2 . ASP E  5  73  ? -47.438 44.158  -27.795 1.00 28.95  ? 73  ASP E OD2 1 
ATOM   9723  N  N   . LYS E  5  74  ? -48.017 42.882  -31.383 1.00 28.51  ? 74  LYS E N   1 
ATOM   9724  C  CA  . LYS E  5  74  ? -47.259 41.671  -31.735 1.00 29.09  ? 74  LYS E CA  1 
ATOM   9725  C  C   . LYS E  5  74  ? -46.381 41.851  -32.951 1.00 30.30  ? 74  LYS E C   1 
ATOM   9726  O  O   . LYS E  5  74  ? -45.376 41.191  -33.077 1.00 32.70  ? 74  LYS E O   1 
ATOM   9727  C  CB  . LYS E  5  74  ? -48.186 40.494  -31.996 1.00 29.60  ? 74  LYS E CB  1 
ATOM   9728  C  CG  . LYS E  5  74  ? -48.773 39.856  -30.754 1.00 30.95  ? 74  LYS E CG  1 
ATOM   9729  C  CD  . LYS E  5  74  ? -47.753 39.273  -29.765 1.00 31.05  ? 74  LYS E CD  1 
ATOM   9730  C  CE  . LYS E  5  74  ? -47.028 38.078  -30.339 1.00 31.96  ? 74  LYS E CE  1 
ATOM   9731  N  NZ  . LYS E  5  74  ? -46.066 37.505  -29.356 1.00 32.19  ? 74  LYS E NZ  1 
ATOM   9732  N  N   . ALA E  5  75  ? -46.775 42.753  -33.836 1.00 33.10  ? 75  ALA E N   1 
ATOM   9733  C  CA  . ALA E  5  75  ? -46.000 43.096  -35.015 1.00 35.24  ? 75  ALA E CA  1 
ATOM   9734  C  C   . ALA E  5  75  ? -44.660 43.785  -34.702 1.00 38.44  ? 75  ALA E C   1 
ATOM   9735  O  O   . ALA E  5  75  ? -43.701 43.695  -35.483 1.00 36.12  ? 75  ALA E O   1 
ATOM   9736  C  CB  . ALA E  5  75  ? -46.834 43.991  -35.910 1.00 37.07  ? 75  ALA E CB  1 
ATOM   9737  N  N   . GLY E  5  76  ? -44.616 44.506  -33.582 1.00 40.73  ? 76  GLY E N   1 
ATOM   9738  C  CA  . GLY E  5  76  ? -43.386 45.088  -33.101 1.00 38.55  ? 76  GLY E CA  1 
ATOM   9739  C  C   . GLY E  5  76  ? -42.945 46.103  -34.109 1.00 35.96  ? 76  GLY E C   1 
ATOM   9740  O  O   . GLY E  5  76  ? -43.765 46.891  -34.532 1.00 38.44  ? 76  GLY E O   1 
ATOM   9741  N  N   . PRO E  5  77  ? -41.670 46.057  -34.532 1.00 35.24  ? 77  PRO E N   1 
ATOM   9742  C  CA  . PRO E  5  77  ? -41.143 47.028  -35.465 1.00 35.92  ? 77  PRO E CA  1 
ATOM   9743  C  C   . PRO E  5  77  ? -41.590 46.772  -36.917 1.00 37.34  ? 77  PRO E C   1 
ATOM   9744  O  O   . PRO E  5  77  ? -41.319 47.615  -37.770 1.00 38.07  ? 77  PRO E O   1 
ATOM   9745  C  CB  . PRO E  5  77  ? -39.630 46.810  -35.357 1.00 33.49  ? 77  PRO E CB  1 
ATOM   9746  C  CG  . PRO E  5  77  ? -39.509 45.359  -35.222 1.00 33.75  ? 77  PRO E CG  1 
ATOM   9747  C  CD  . PRO E  5  77  ? -40.708 44.944  -34.366 1.00 36.58  ? 77  PRO E CD  1 
ATOM   9748  N  N   . HIS E  5  78  ? -42.228 45.632  -37.201 1.00 35.47  ? 78  HIS E N   1 
ATOM   9749  C  CA  . HIS E  5  78  ? -42.641 45.339  -38.552 1.00 39.25  ? 78  HIS E CA  1 
ATOM   9750  C  C   . HIS E  5  78  ? -43.945 46.077  -38.844 1.00 38.78  ? 78  HIS E C   1 
ATOM   9751  O  O   . HIS E  5  78  ? -45.014 45.499  -38.782 1.00 36.17  ? 78  HIS E O   1 
ATOM   9752  C  CB  . HIS E  5  78  ? -42.760 43.838  -38.774 1.00 40.47  ? 78  HIS E CB  1 
ATOM   9753  C  CG  . HIS E  5  78  ? -41.484 43.106  -38.518 1.00 43.54  ? 78  HIS E CG  1 
ATOM   9754  N  ND1 . HIS E  5  78  ? -40.440 43.098  -39.412 1.00 43.67  ? 78  HIS E ND1 1 
ATOM   9755  C  CD2 . HIS E  5  78  ? -41.078 42.369  -37.457 1.00 45.72  ? 78  HIS E CD2 1 
ATOM   9756  C  CE1 . HIS E  5  78  ? -39.448 42.385  -38.913 1.00 45.12  ? 78  HIS E CE1 1 
ATOM   9757  N  NE2 . HIS E  5  78  ? -39.812 41.925  -37.731 1.00 45.15  ? 78  HIS E NE2 1 
ATOM   9758  N  N   . LYS E  5  79  ? -43.795 47.351  -39.205 1.00 41.73  ? 79  LYS E N   1 
ATOM   9759  C  CA  . LYS E  5  79  ? -44.882 48.293  -39.451 1.00 47.16  ? 79  LYS E CA  1 
ATOM   9760  C  C   . LYS E  5  79  ? -45.852 47.874  -40.575 1.00 43.23  ? 79  LYS E C   1 
ATOM   9761  O  O   . LYS E  5  79  ? -47.001 48.279  -40.594 1.00 44.06  ? 79  LYS E O   1 
ATOM   9762  C  CB  . LYS E  5  79  ? -44.294 49.665  -39.789 1.00 55.08  ? 79  LYS E CB  1 
ATOM   9763  C  CG  . LYS E  5  79  ? -43.465 50.308  -38.674 1.00 70.64  ? 79  LYS E CG  1 
ATOM   9764  C  CD  . LYS E  5  79  ? -44.219 51.320  -37.790 1.00 84.21  ? 79  LYS E CD  1 
ATOM   9765  C  CE  . LYS E  5  79  ? -45.010 50.683  -36.640 1.00 94.22  ? 79  LYS E CE  1 
ATOM   9766  N  NZ  . LYS E  5  79  ? -44.160 50.016  -35.602 1.00 95.42  ? 79  LYS E NZ  1 
ATOM   9767  N  N   . GLU E  5  80  ? -45.384 47.065  -41.504 1.00 40.95  ? 80  GLU E N   1 
ATOM   9768  C  CA  . GLU E  5  80  ? -46.219 46.609  -42.599 1.00 42.59  ? 80  GLU E CA  1 
ATOM   9769  C  C   . GLU E  5  80  ? -47.358 45.624  -42.248 1.00 43.17  ? 80  GLU E C   1 
ATOM   9770  O  O   . GLU E  5  80  ? -48.289 45.457  -43.057 1.00 48.82  ? 80  GLU E O   1 
ATOM   9771  C  CB  . GLU E  5  80  ? -45.350 46.096  -43.779 1.00 45.41  ? 80  GLU E CB  1 
ATOM   9772  C  CG  . GLU E  5  80  ? -44.677 44.737  -43.635 1.00 50.67  ? 80  GLU E CG  1 
ATOM   9773  C  CD  . GLU E  5  80  ? -43.488 44.698  -42.665 1.00 53.64  ? 80  GLU E CD  1 
ATOM   9774  O  OE1 . GLU E  5  80  ? -42.978 43.558  -42.480 1.00 55.44  ? 80  GLU E OE1 1 
ATOM   9775  O  OE2 . GLU E  5  80  ? -43.075 45.762  -42.096 1.00 47.18  ? 80  GLU E OE2 1 
ATOM   9776  N  N   . ILE E  5  81  ? -47.323 44.993  -41.077 1.00 38.45  ? 81  ILE E N   1 
ATOM   9777  C  CA  . ILE E  5  81  ? -48.213 43.857  -40.808 1.00 37.44  ? 81  ILE E CA  1 
ATOM   9778  C  C   . ILE E  5  81  ? -49.604 44.311  -40.405 1.00 36.25  ? 81  ILE E C   1 
ATOM   9779  O  O   . ILE E  5  81  ? -50.570 43.682  -40.769 1.00 35.05  ? 81  ILE E O   1 
ATOM   9780  C  CB  . ILE E  5  81  ? -47.652 42.927  -39.719 1.00 38.17  ? 81  ILE E CB  1 
ATOM   9781  C  CG1 . ILE E  5  81  ? -46.285 42.370  -40.156 1.00 38.77  ? 81  ILE E CG1 1 
ATOM   9782  C  CG2 . ILE E  5  81  ? -48.620 41.785  -39.422 1.00 38.99  ? 81  ILE E CG2 1 
ATOM   9783  C  CD1 . ILE E  5  81  ? -45.553 41.602  -39.091 1.00 38.59  ? 81  ILE E CD1 1 
ATOM   9784  N  N   . TYR E  5  82  ? -49.691 45.386  -39.635 1.00 35.50  ? 82  TYR E N   1 
ATOM   9785  C  CA  . TYR E  5  82  ? -50.964 45.829  -39.092 1.00 36.42  ? 82  TYR E CA  1 
ATOM   9786  C  C   . TYR E  5  82  ? -51.890 46.350  -40.211 1.00 37.38  ? 82  TYR E C   1 
ATOM   9787  O  O   . TYR E  5  82  ? -53.015 45.859  -40.337 1.00 38.23  ? 82  TYR E O   1 
ATOM   9788  C  CB  . TYR E  5  82  ? -50.772 46.832  -37.923 1.00 33.18  ? 82  TYR E CB  1 
ATOM   9789  C  CG  . TYR E  5  82  ? -52.070 47.333  -37.294 1.00 32.54  ? 82  TYR E CG  1 
ATOM   9790  C  CD1 . TYR E  5  82  ? -52.941 46.472  -36.651 1.00 32.54  ? 82  TYR E CD1 1 
ATOM   9791  C  CD2 . TYR E  5  82  ? -52.408 48.672  -37.334 1.00 33.58  ? 82  TYR E CD2 1 
ATOM   9792  C  CE1 . TYR E  5  82  ? -54.109 46.935  -36.092 1.00 32.04  ? 82  TYR E CE1 1 
ATOM   9793  C  CE2 . TYR E  5  82  ? -53.565 49.144  -36.766 1.00 31.69  ? 82  TYR E CE2 1 
ATOM   9794  C  CZ  . TYR E  5  82  ? -54.407 48.270  -36.157 1.00 32.49  ? 82  TYR E CZ  1 
ATOM   9795  O  OH  . TYR E  5  82  ? -55.541 48.748  -35.585 1.00 37.60  ? 82  TYR E OH  1 
ATOM   9796  N  N   . PRO E  5  83  ? -51.408 47.280  -41.054 1.00 37.16  ? 83  PRO E N   1 
ATOM   9797  C  CA  . PRO E  5  83  ? -52.214 47.681  -42.213 1.00 37.96  ? 83  PRO E CA  1 
ATOM   9798  C  C   . PRO E  5  83  ? -52.595 46.534  -43.148 1.00 38.98  ? 83  PRO E C   1 
ATOM   9799  O  O   . PRO E  5  83  ? -53.673 46.588  -43.748 1.00 45.12  ? 83  PRO E O   1 
ATOM   9800  C  CB  . PRO E  5  83  ? -51.317 48.679  -42.949 1.00 35.65  ? 83  PRO E CB  1 
ATOM   9801  C  CG  . PRO E  5  83  ? -50.331 49.133  -41.938 1.00 36.65  ? 83  PRO E CG  1 
ATOM   9802  C  CD  . PRO E  5  83  ? -50.083 47.919  -41.103 1.00 38.08  ? 83  PRO E CD  1 
ATOM   9803  N  N   . TYR E  5  84  ? -51.745 45.516  -43.279 1.00 36.53  ? 84  TYR E N   1 
ATOM   9804  C  CA  . TYR E  5  84  ? -52.181 44.296  -43.973 1.00 38.13  ? 84  TYR E CA  1 
ATOM   9805  C  C   . TYR E  5  84  ? -53.324 43.634  -43.246 1.00 36.62  ? 84  TYR E C   1 
ATOM   9806  O  O   . TYR E  5  84  ? -54.279 43.264  -43.866 1.00 38.31  ? 84  TYR E O   1 
ATOM   9807  C  CB  . TYR E  5  84  ? -51.083 43.254  -44.145 1.00 36.49  ? 84  TYR E CB  1 
ATOM   9808  C  CG  . TYR E  5  84  ? -51.587 42.002  -44.816 1.00 36.61  ? 84  TYR E CG  1 
ATOM   9809  C  CD1 . TYR E  5  84  ? -51.836 41.979  -46.194 1.00 40.18  ? 84  TYR E CD1 1 
ATOM   9810  C  CD2 . TYR E  5  84  ? -51.820 40.845  -44.098 1.00 37.48  ? 84  TYR E CD2 1 
ATOM   9811  C  CE1 . TYR E  5  84  ? -52.293 40.834  -46.835 1.00 37.94  ? 84  TYR E CE1 1 
ATOM   9812  C  CE2 . TYR E  5  84  ? -52.272 39.685  -44.732 1.00 37.87  ? 84  TYR E CE2 1 
ATOM   9813  C  CZ  . TYR E  5  84  ? -52.512 39.696  -46.097 1.00 38.43  ? 84  TYR E CZ  1 
ATOM   9814  O  OH  . TYR E  5  84  ? -52.977 38.571  -46.722 1.00 44.85  ? 84  TYR E OH  1 
ATOM   9815  N  N   . VAL E  5  85  ? -53.205 43.453  -41.940 1.00 37.49  ? 85  VAL E N   1 
ATOM   9816  C  CA  . VAL E  5  85  ? -54.239 42.755  -41.208 1.00 39.71  ? 85  VAL E CA  1 
ATOM   9817  C  C   . VAL E  5  85  ? -55.584 43.515  -41.277 1.00 40.26  ? 85  VAL E C   1 
ATOM   9818  O  O   . VAL E  5  85  ? -56.618 42.892  -41.447 1.00 41.38  ? 85  VAL E O   1 
ATOM   9819  C  CB  . VAL E  5  85  ? -53.829 42.460  -39.754 1.00 40.34  ? 85  VAL E CB  1 
ATOM   9820  C  CG1 . VAL E  5  85  ? -54.989 41.788  -38.997 1.00 40.46  ? 85  VAL E CG1 1 
ATOM   9821  C  CG2 . VAL E  5  85  ? -52.572 41.577  -39.715 1.00 40.34  ? 85  VAL E CG2 1 
ATOM   9822  N  N   . ILE E  5  86  ? -55.555 44.836  -41.170 1.00 37.07  ? 86  ILE E N   1 
ATOM   9823  C  CA  . ILE E  5  86  ? -56.743 45.649  -41.298 1.00 41.11  ? 86  ILE E CA  1 
ATOM   9824  C  C   . ILE E  5  86  ? -57.366 45.590  -42.692 1.00 43.75  ? 86  ILE E C   1 
ATOM   9825  O  O   . ILE E  5  86  ? -58.593 45.606  -42.837 1.00 44.56  ? 86  ILE E O   1 
ATOM   9826  C  CB  . ILE E  5  86  ? -56.477 47.136  -40.920 1.00 42.51  ? 86  ILE E CB  1 
ATOM   9827  C  CG1 . ILE E  5  86  ? -56.107 47.227  -39.437 1.00 42.44  ? 86  ILE E CG1 1 
ATOM   9828  C  CG2 . ILE E  5  86  ? -57.709 47.998  -41.176 1.00 41.31  ? 86  ILE E CG2 1 
ATOM   9829  C  CD1 . ILE E  5  86  ? -57.001 46.433  -38.495 1.00 39.44  ? 86  ILE E CD1 1 
ATOM   9830  N  N   . GLN E  5  87  ? -56.538 45.520  -43.714 1.00 45.48  ? 87  GLN E N   1 
ATOM   9831  C  CA  . GLN E  5  87  ? -57.059 45.385  -45.069 1.00 43.18  ? 87  GLN E CA  1 
ATOM   9832  C  C   . GLN E  5  87  ? -57.909 44.142  -45.215 1.00 41.58  ? 87  GLN E C   1 
ATOM   9833  O  O   . GLN E  5  87  ? -59.000 44.195  -45.762 1.00 46.97  ? 87  GLN E O   1 
ATOM   9834  C  CB  . GLN E  5  87  ? -55.913 45.410  -46.066 1.00 43.96  ? 87  GLN E CB  1 
ATOM   9835  C  CG  . GLN E  5  87  ? -56.164 44.740  -47.401 1.00 42.69  ? 87  GLN E CG  1 
ATOM   9836  C  CD  . GLN E  5  87  ? -54.914 44.777  -48.184 1.00 39.38  ? 87  GLN E CD  1 
ATOM   9837  O  OE1 . GLN E  5  87  ? -54.394 45.867  -48.438 1.00 42.21  ? 87  GLN E OE1 1 
ATOM   9838  N  NE2 . GLN E  5  87  ? -54.362 43.613  -48.491 1.00 33.49  ? 87  GLN E NE2 1 
ATOM   9839  N  N   . GLU E  5  88  ? -57.403 43.040  -44.706 1.00 41.54  ? 88  GLU E N   1 
ATOM   9840  C  CA  . GLU E  5  88  ? -58.077 41.750  -44.788 1.00 44.69  ? 88  GLU E CA  1 
ATOM   9841  C  C   . GLU E  5  88  ? -59.311 41.604  -43.852 1.00 45.62  ? 88  GLU E C   1 
ATOM   9842  O  O   . GLU E  5  88  ? -60.164 40.736  -44.069 1.00 49.50  ? 88  GLU E O   1 
ATOM   9843  C  CB  . GLU E  5  88  ? -57.055 40.629  -44.502 1.00 46.22  ? 88  GLU E CB  1 
ATOM   9844  C  CG  . GLU E  5  88  ? -55.850 40.593  -45.445 1.00 48.31  ? 88  GLU E CG  1 
ATOM   9845  C  CD  . GLU E  5  88  ? -56.267 40.474  -46.907 1.00 49.04  ? 88  GLU E CD  1 
ATOM   9846  O  OE1 . GLU E  5  88  ? -56.976 39.470  -47.216 1.00 47.54  ? 88  GLU E OE1 1 
ATOM   9847  O  OE2 . GLU E  5  88  ? -55.915 41.393  -47.701 1.00 40.29  ? 88  GLU E OE2 1 
ATOM   9848  N  N   . LEU E  5  89  ? -59.393 42.423  -42.809 1.00 45.36  ? 89  LEU E N   1 
ATOM   9849  C  CA  . LEU E  5  89  ? -60.505 42.358  -41.861 1.00 49.51  ? 89  LEU E CA  1 
ATOM   9850  C  C   . LEU E  5  89  ? -61.588 43.389  -42.178 1.00 47.21  ? 89  LEU E C   1 
ATOM   9851  O  O   . LEU E  5  89  ? -62.666 43.373  -41.587 1.00 46.45  ? 89  LEU E O   1 
ATOM   9852  C  CB  . LEU E  5  89  ? -59.989 42.568  -40.429 1.00 50.12  ? 89  LEU E CB  1 
ATOM   9853  C  CG  . LEU E  5  89  ? -59.068 41.491  -39.843 1.00 49.82  ? 89  LEU E CG  1 
ATOM   9854  C  CD1 . LEU E  5  89  ? -58.613 41.920  -38.441 1.00 50.55  ? 89  LEU E CD1 1 
ATOM   9855  C  CD2 . LEU E  5  89  ? -59.744 40.118  -39.833 1.00 50.58  ? 89  LEU E CD2 1 
ATOM   9856  N  N   . ARG E  5  90  ? -61.307 44.261  -43.134 1.00 48.67  ? 90  ARG E N   1 
ATOM   9857  C  CA  . ARG E  5  90  ? -62.160 45.395  -43.407 1.00 49.92  ? 90  ARG E CA  1 
ATOM   9858  C  C   . ARG E  5  90  ? -63.648 45.079  -43.704 1.00 50.10  ? 90  ARG E C   1 
ATOM   9859  O  O   . ARG E  5  90  ? -64.506 45.827  -43.291 1.00 55.56  ? 90  ARG E O   1 
ATOM   9860  C  CB  . ARG E  5  90  ? -61.538 46.259  -44.506 1.00 51.71  ? 90  ARG E CB  1 
ATOM   9861  C  CG  . ARG E  5  90  ? -62.288 47.552  -44.788 1.00 58.00  ? 90  ARG E CG  1 
ATOM   9862  C  CD  . ARG E  5  90  ? -62.545 48.410  -43.546 1.00 60.71  ? 90  ARG E CD  1 
ATOM   9863  N  NE  . ARG E  5  90  ? -61.323 49.046  -43.065 1.00 61.58  ? 90  ARG E NE  1 
ATOM   9864  C  CZ  . ARG E  5  90  ? -61.275 49.907  -42.054 1.00 64.47  ? 90  ARG E CZ  1 
ATOM   9865  N  NH1 . ARG E  5  90  ? -62.379 50.230  -41.363 1.00 59.91  ? 90  ARG E NH1 1 
ATOM   9866  N  NH2 . ARG E  5  90  ? -60.104 50.447  -41.726 1.00 67.05  ? 90  ARG E NH2 1 
ATOM   9867  N  N   . PRO E  5  91  ? -63.952 43.982  -44.411 1.00 48.27  ? 91  PRO E N   1 
ATOM   9868  C  CA  . PRO E  5  91  ? -65.324 43.486  -44.506 1.00 46.62  ? 91  PRO E CA  1 
ATOM   9869  C  C   . PRO E  5  91  ? -66.014 43.219  -43.173 1.00 47.03  ? 91  PRO E C   1 
ATOM   9870  O  O   . PRO E  5  91  ? -67.122 43.731  -42.942 1.00 49.21  ? 91  PRO E O   1 
ATOM   9871  C  CB  . PRO E  5  91  ? -65.157 42.172  -45.257 1.00 47.27  ? 91  PRO E CB  1 
ATOM   9872  C  CG  . PRO E  5  91  ? -64.012 42.443  -46.144 1.00 47.17  ? 91  PRO E CG  1 
ATOM   9873  C  CD  . PRO E  5  91  ? -63.067 43.278  -45.351 1.00 48.55  ? 91  PRO E CD  1 
ATOM   9874  N  N   . THR E  5  92  ? -65.377 42.417  -42.317 1.00 43.72  ? 92  THR E N   1 
ATOM   9875  C  CA  . THR E  5  92  ? -65.910 42.107  -40.977 1.00 39.66  ? 92  THR E CA  1 
ATOM   9876  C  C   . THR E  5  92  ? -66.050 43.371  -40.118 1.00 39.42  ? 92  THR E C   1 
ATOM   9877  O  O   . THR E  5  92  ? -67.019 43.514  -39.389 1.00 43.18  ? 92  THR E O   1 
ATOM   9878  C  CB  . THR E  5  92  ? -64.975 41.118  -40.276 1.00 40.44  ? 92  THR E CB  1 
ATOM   9879  O  OG1 . THR E  5  92  ? -64.868 39.953  -41.080 1.00 41.65  ? 92  THR E OG1 1 
ATOM   9880  C  CG2 . THR E  5  92  ? -65.468 40.726  -38.902 1.00 41.38  ? 92  THR E CG2 1 
ATOM   9881  N  N   . LEU E  5  93  ? -65.086 44.284  -40.218 1.00 37.58  ? 93  LEU E N   1 
ATOM   9882  C  CA  . LEU E  5  93  ? -65.119 45.491  -39.441 1.00 38.53  ? 93  LEU E CA  1 
ATOM   9883  C  C   . LEU E  5  93  ? -66.299 46.347  -39.839 1.00 39.53  ? 93  LEU E C   1 
ATOM   9884  O  O   . LEU E  5  93  ? -67.016 46.811  -38.968 1.00 39.47  ? 93  LEU E O   1 
ATOM   9885  C  CB  . LEU E  5  93  ? -63.824 46.301  -39.572 1.00 40.01  ? 93  LEU E CB  1 
ATOM   9886  C  CG  . LEU E  5  93  ? -62.498 45.662  -39.164 1.00 41.36  ? 93  LEU E CG  1 
ATOM   9887  C  CD1 . LEU E  5  93  ? -61.390 46.691  -39.260 1.00 40.33  ? 93  LEU E CD1 1 
ATOM   9888  C  CD2 . LEU E  5  93  ? -62.571 45.108  -37.757 1.00 43.79  ? 93  LEU E CD2 1 
ATOM   9889  N  N   . ASN E  5  94  ? -66.488 46.574  -41.145 1.00 45.64  ? 94  ASN E N   1 
ATOM   9890  C  CA  . ASN E  5  94  ? -67.671 47.297  -41.672 1.00 44.41  ? 94  ASN E CA  1 
ATOM   9891  C  C   . ASN E  5  94  ? -68.955 46.538  -41.330 1.00 43.84  ? 94  ASN E C   1 
ATOM   9892  O  O   . ASN E  5  94  ? -69.914 47.133  -40.842 1.00 44.93  ? 94  ASN E O   1 
ATOM   9893  C  CB  . ASN E  5  94  ? -67.602 47.462  -43.180 1.00 46.50  ? 94  ASN E CB  1 
ATOM   9894  C  CG  . ASN E  5  94  ? -66.481 48.376  -43.630 1.00 50.79  ? 94  ASN E CG  1 
ATOM   9895  O  OD1 . ASN E  5  94  ? -65.889 49.113  -42.836 1.00 60.87  ? 94  ASN E OD1 1 
ATOM   9896  N  ND2 . ASN E  5  94  ? -66.176 48.325  -44.927 1.00 51.89  ? 94  ASN E ND2 1 
ATOM   9897  N  N   . GLU E  5  95  ? -68.954 45.224  -41.526 1.00 40.82  ? 95  GLU E N   1 
ATOM   9898  C  CA  . GLU E  5  95  ? -70.135 44.429  -41.216 1.00 43.27  ? 95  GLU E CA  1 
ATOM   9899  C  C   . GLU E  5  95  ? -70.546 44.544  -39.745 1.00 46.80  ? 95  GLU E C   1 
ATOM   9900  O  O   . GLU E  5  95  ? -71.724 44.744  -39.486 1.00 50.63  ? 95  GLU E O   1 
ATOM   9901  C  CB  . GLU E  5  95  ? -69.944 42.961  -41.589 1.00 42.90  ? 95  GLU E CB  1 
ATOM   9902  C  CG  . GLU E  5  95  ? -71.206 42.119  -41.468 1.00 44.45  ? 95  GLU E CG  1 
ATOM   9903  C  CD  . GLU E  5  95  ? -70.934 40.623  -41.413 1.00 48.18  ? 95  GLU E CD  1 
ATOM   9904  O  OE1 . GLU E  5  95  ? -71.804 39.885  -40.910 1.00 56.22  ? 95  GLU E OE1 1 
ATOM   9905  O  OE2 . GLU E  5  95  ? -69.859 40.168  -41.848 1.00 47.65  ? 95  GLU E OE2 1 
ATOM   9906  N  N   . LEU E  5  96  ? -69.596 44.426  -38.795 1.00 45.55  ? 96  LEU E N   1 
ATOM   9907  C  CA  . LEU E  5  96  ? -69.924 44.410  -37.338 1.00 38.65  ? 96  LEU E CA  1 
ATOM   9908  C  C   . LEU E  5  96  ? -69.907 45.784  -36.702 1.00 36.21  ? 96  LEU E C   1 
ATOM   9909  O  O   . LEU E  5  96  ? -70.209 45.911  -35.528 1.00 38.22  ? 96  LEU E O   1 
ATOM   9910  C  CB  . LEU E  5  96  ? -68.997 43.477  -36.568 1.00 36.30  ? 96  LEU E CB  1 
ATOM   9911  C  CG  . LEU E  5  96  ? -68.964 42.031  -37.066 1.00 39.17  ? 96  LEU E CG  1 
ATOM   9912  C  CD1 . LEU E  5  96  ? -67.956 41.189  -36.297 1.00 41.51  ? 96  LEU E CD1 1 
ATOM   9913  C  CD2 . LEU E  5  96  ? -70.339 41.392  -36.973 1.00 38.85  ? 96  LEU E CD2 1 
ATOM   9914  N  N   . GLY E  5  97  ? -69.578 46.818  -37.463 1.00 33.85  ? 97  GLY E N   1 
ATOM   9915  C  CA  . GLY E  5  97  ? -69.416 48.142  -36