data_5WC9
# 
_entry.id   5WC9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5WC9         
WWPDB D_1000228698 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5WC9 
_pdbx_database_status.recvd_initial_deposition_date   2017-06-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Agarwal, S.' 1 0000-0001-9230-9694 
'Cho, T.Y.'   2 0000-0001-8614-3325 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            46 
_citation.language                  ? 
_citation.page_first                929 
_citation.page_last                 941 
_citation.title                     
;Biochemical and structural characterization of a novel cooperative binding mode by Pit-1 with CATT repeats in the macrophage migration inhibitory factor promoter.
;
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkx1183 
_citation.pdbx_database_id_PubMed   29186613 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Agarwal, S.' 1 
primary 'Cho, T.Y.'   2 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   93.65 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5WC9 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     66.415 
_cell.length_a_esd                 ? 
_cell.length_b                     97.518 
_cell.length_b_esd                 ? 
_cell.length_c                     85.093 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5WC9 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Pituitary-specific positive transcription factor 1'                            17759.363 4 ? ? ? ? 
2 polymer syn 
;DNA (5'-D(*CP*CP*AP*TP*TP*CP*AP*TP*TP*CP*AP*TP*TP*CP*AP*TP*TP*CP*GP*GP*A)-3')
;
6348.121  2 ? ? ? ? 
3 polymer syn 
;DNA (5'-D(*CP*CP*GP*AP*AP*TP*GP*AP*AP*TP*GP*AP*AP*TP*GP*AP*AP*TP*GP*GP*T)-3')
;
6535.260  2 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PIT-1,Growth hormone factor 1,GHF-1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GHMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVG
ALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVK
;
;GHMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVG
ALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVK
;
B,A,E,F ? 
2 polydeoxyribonucleotide no no 
;(DC)(DC)(DA)(DT)(DT)(DC)(DA)(DT)(DT)(DC)(DA)(DT)(DT)(DC)(DA)(DT)(DT)(DC)(DG)(DG)
(DA)
;
CCATTCATTCATTCATTCGGA C,G     ? 
3 polydeoxyribonucleotide no no 
;(DC)(DC)(DG)(DA)(DA)(DT)(DG)(DA)(DA)(DT)(DG)(DA)(DA)(DT)(DG)(DA)(DA)(DT)(DG)(DG)
(DT)
;
CCGAATGAATGAATGAATGGT D,H     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   HIS n 
1 3   MET n 
1 4   ASP n 
1 5   SER n 
1 6   PRO n 
1 7   GLU n 
1 8   ILE n 
1 9   ARG n 
1 10  GLU n 
1 11  LEU n 
1 12  GLU n 
1 13  LYS n 
1 14  PHE n 
1 15  ALA n 
1 16  ASN n 
1 17  GLU n 
1 18  PHE n 
1 19  LYS n 
1 20  VAL n 
1 21  ARG n 
1 22  ARG n 
1 23  ILE n 
1 24  LYS n 
1 25  LEU n 
1 26  GLY n 
1 27  TYR n 
1 28  THR n 
1 29  GLN n 
1 30  THR n 
1 31  ASN n 
1 32  VAL n 
1 33  GLY n 
1 34  GLU n 
1 35  ALA n 
1 36  LEU n 
1 37  ALA n 
1 38  ALA n 
1 39  VAL n 
1 40  HIS n 
1 41  GLY n 
1 42  SER n 
1 43  GLU n 
1 44  PHE n 
1 45  SER n 
1 46  GLN n 
1 47  THR n 
1 48  THR n 
1 49  ILE n 
1 50  CYS n 
1 51  ARG n 
1 52  PHE n 
1 53  GLU n 
1 54  ASN n 
1 55  LEU n 
1 56  GLN n 
1 57  LEU n 
1 58  SER n 
1 59  PHE n 
1 60  LYS n 
1 61  ASN n 
1 62  ALA n 
1 63  CYS n 
1 64  LYS n 
1 65  LEU n 
1 66  LYS n 
1 67  ALA n 
1 68  ILE n 
1 69  LEU n 
1 70  SER n 
1 71  LYS n 
1 72  TRP n 
1 73  LEU n 
1 74  GLU n 
1 75  GLU n 
1 76  ALA n 
1 77  GLU n 
1 78  GLN n 
1 79  VAL n 
1 80  GLY n 
1 81  ALA n 
1 82  LEU n 
1 83  TYR n 
1 84  ASN n 
1 85  GLU n 
1 86  LYS n 
1 87  VAL n 
1 88  GLY n 
1 89  ALA n 
1 90  ASN n 
1 91  GLU n 
1 92  ARG n 
1 93  LYS n 
1 94  ARG n 
1 95  LYS n 
1 96  ARG n 
1 97  ARG n 
1 98  THR n 
1 99  THR n 
1 100 ILE n 
1 101 SER n 
1 102 ILE n 
1 103 ALA n 
1 104 ALA n 
1 105 LYS n 
1 106 ASP n 
1 107 ALA n 
1 108 LEU n 
1 109 GLU n 
1 110 ARG n 
1 111 HIS n 
1 112 PHE n 
1 113 GLY n 
1 114 GLU n 
1 115 GLN n 
1 116 ASN n 
1 117 LYS n 
1 118 PRO n 
1 119 SER n 
1 120 SER n 
1 121 GLN n 
1 122 GLU n 
1 123 ILE n 
1 124 MET n 
1 125 ARG n 
1 126 MET n 
1 127 ALA n 
1 128 GLU n 
1 129 GLU n 
1 130 LEU n 
1 131 ASN n 
1 132 LEU n 
1 133 GLU n 
1 134 LYS n 
1 135 GLU n 
1 136 VAL n 
1 137 VAL n 
1 138 ARG n 
1 139 VAL n 
1 140 TRP n 
1 141 PHE n 
1 142 CYS n 
1 143 ASN n 
1 144 ARG n 
1 145 ARG n 
1 146 GLN n 
1 147 ARG n 
1 148 GLU n 
1 149 LYS n 
1 150 ARG n 
1 151 VAL n 
1 152 LYS n 
2 1   DC  n 
2 2   DC  n 
2 3   DA  n 
2 4   DT  n 
2 5   DT  n 
2 6   DC  n 
2 7   DA  n 
2 8   DT  n 
2 9   DT  n 
2 10  DC  n 
2 11  DA  n 
2 12  DT  n 
2 13  DT  n 
2 14  DC  n 
2 15  DA  n 
2 16  DT  n 
2 17  DT  n 
2 18  DC  n 
2 19  DG  n 
2 20  DG  n 
2 21  DA  n 
3 1   DC  n 
3 2   DC  n 
3 3   DG  n 
3 4   DA  n 
3 5   DA  n 
3 6   DT  n 
3 7   DG  n 
3 8   DA  n 
3 9   DA  n 
3 10  DT  n 
3 11  DG  n 
3 12  DA  n 
3 13  DA  n 
3 14  DT  n 
3 15  DG  n 
3 16  DA  n 
3 17  DA  n 
3 18  DT  n 
3 19  DG  n 
3 20  DG  n 
3 21  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   152 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POU1F1, GHF1, PIT1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 21 'Homo sapiens' human 9606 ? 
3 1 sample 1 21 'Homo sapiens' human 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PIT1_HUMAN P28069 ? 1 
;MDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGAL
YNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVK
;
124 
2 PDB 5WC9       5WC9   ? 2 ? 1   
3 PDB 5WC9       5WC9   ? 3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5WC9 B 3 ? 152 ? P28069 124 ? 273 ? 1   150 
2 1 5WC9 A 3 ? 152 ? P28069 124 ? 273 ? 1   150 
3 2 5WC9 C 1 ? 21  ? 5WC9   170 ? 190 ? 170 190 
4 3 5WC9 D 1 ? 21  ? 5WC9   170 ? 190 ? 170 190 
5 1 5WC9 E 3 ? 152 ? P28069 124 ? 273 ? 1   150 
6 1 5WC9 F 3 ? 152 ? P28069 124 ? 273 ? 1   150 
7 2 5WC9 G 1 ? 21  ? 5WC9   170 ? 190 ? 170 190 
8 3 5WC9 H 1 ? 21  ? 5WC9   170 ? 190 ? 170 190 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5WC9 GLY B 1 ? UNP P28069 ? ? 'expression tag' -1 1 
1 5WC9 HIS B 2 ? UNP P28069 ? ? 'expression tag' 0  2 
2 5WC9 GLY A 1 ? UNP P28069 ? ? 'expression tag' -1 3 
2 5WC9 HIS A 2 ? UNP P28069 ? ? 'expression tag' 0  4 
5 5WC9 GLY E 1 ? UNP P28069 ? ? 'expression tag' -1 5 
5 5WC9 HIS E 2 ? UNP P28069 ? ? 'expression tag' 0  6 
6 5WC9 GLY F 1 ? UNP P28069 ? ? 'expression tag' -1 7 
6 5WC9 HIS F 2 ? UNP P28069 ? ? 'expression tag' 0  8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5WC9 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.84 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.70 
_exptl_crystal.description                 'Long rods' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M MES pH 6.5, 17.5% (w/v) PEG 6000, 5%(v/v) MPD' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           93.15 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU RAXIS IV++' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-04-28 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.541870 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.541870 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5WC9 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.15 
_reflns.d_resolution_low                 47.2 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       18198 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.92 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  9.2 
_reflns.pdbx_Rmerge_I_obs                0.2242 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.57 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.07616 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.99 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.15 
_reflns_shell.d_res_low                   3.263 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.24 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1681 
_reflns_shell.percent_possible_all        87.13 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.5317 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.9 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.2808 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.989 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5WC9 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.150 
_refine.ls_d_res_low                             47.2 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     18100 
_refine.ls_number_reflns_R_free                  852 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    95.96 
_refine.ls_percent_reflns_R_free                 4.71 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2327 
_refine.ls_R_factor_R_free                       0.2772 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2305 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1AU7 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            '5% were flagged by Ctruncate' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 28.72 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.38 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4194 
_refine_hist.pdbx_number_atoms_nucleic_acid   1640 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               5834 
_refine_hist.d_res_high                       3.150 
_refine_hist.d_res_low                        47.2 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005  ? 6114 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.587  ? 8581 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 15.234 ? 4207 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.035  ? 960  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 833  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.1500 3.3473 . . 131 2618 88.00 . . . 0.3247 . 0.3042 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3473 3.6057 . . 133 2834 95.00 . . . 0.3361 . 0.2757 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6057 3.9684 . . 158 2890 98.00 . . . 0.2907 . 0.2408 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9684 4.5422 . . 155 2927 98.00 . . . 0.2640 . 0.2096 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5422 5.7212 . . 128 2975 99.00 . . . 0.2598 . 0.2171 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.7212 47.2   . . 147 3004 98.00 . . . 0.2450 . 0.2018 . . . . . . . . . . 
# 
_struct.entry_id                     5WC9 
_struct.title                        'Human Pit-1 and 4xCATT DNA complex' 
_struct.pdbx_descriptor              'Pituitary-specific positive transcription factor 1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5WC9 
_struct_keywords.text            'Transcription regulation, DNA-protein Complex, DNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 5   ? LEU A 25  ? SER B 3   LEU B 23  1 ? 21 
HELX_P HELX_P2  AA2 THR A 28  ? ALA A 35  ? THR B 26  ALA B 33  1 ? 8  
HELX_P HELX_P3  AA3 LEU A 36  ? GLY A 41  ? LEU B 34  GLY B 39  1 ? 6  
HELX_P HELX_P4  AA4 SER A 45  ? ASN A 54  ? SER B 43  ASN B 52  1 ? 10 
HELX_P HELX_P5  AA5 SER A 58  ? ALA A 76  ? SER B 56  ALA B 74  1 ? 19 
HELX_P HELX_P6  AA6 SER A 101 ? GLN A 115 ? SER B 99  GLN B 113 1 ? 15 
HELX_P HELX_P7  AA7 SER A 119 ? ASN A 131 ? SER B 117 ASN B 129 1 ? 13 
HELX_P HELX_P8  AA8 GLU A 133 ? GLU A 148 ? GLU B 131 GLU B 146 1 ? 16 
HELX_P HELX_P9  AA9 SER B 5   ? LEU B 25  ? SER A 3   LEU A 23  1 ? 21 
HELX_P HELX_P10 AB1 THR B 28  ? ALA B 35  ? THR A 26  ALA A 33  1 ? 8  
HELX_P HELX_P11 AB2 LEU B 36  ? GLY B 41  ? LEU A 34  GLY A 39  1 ? 6  
HELX_P HELX_P12 AB3 SER B 45  ? ASN B 54  ? SER A 43  ASN A 52  1 ? 10 
HELX_P HELX_P13 AB4 SER B 58  ? GLN B 78  ? SER A 56  GLN A 76  1 ? 21 
HELX_P HELX_P14 AB5 SER B 101 ? GLU B 114 ? SER A 99  GLU A 112 1 ? 14 
HELX_P HELX_P15 AB6 SER B 119 ? LEU B 130 ? SER A 117 LEU A 128 1 ? 12 
HELX_P HELX_P16 AB7 GLU B 133 ? GLU B 148 ? GLU A 131 GLU A 146 1 ? 16 
HELX_P HELX_P17 AB8 PRO E 6   ? LEU E 25  ? PRO E 4   LEU E 23  1 ? 20 
HELX_P HELX_P18 AB9 THR E 28  ? ALA E 35  ? THR E 26  ALA E 33  1 ? 8  
HELX_P HELX_P19 AC1 LEU E 36  ? GLY E 41  ? LEU E 34  GLY E 39  1 ? 6  
HELX_P HELX_P20 AC2 SER E 45  ? ASN E 54  ? SER E 43  ASN E 52  1 ? 10 
HELX_P HELX_P21 AC3 SER E 58  ? ALA E 76  ? SER E 56  ALA E 74  1 ? 19 
HELX_P HELX_P22 AC4 SER E 101 ? GLN E 115 ? SER E 99  GLN E 113 1 ? 15 
HELX_P HELX_P23 AC5 SER E 119 ? ASN E 131 ? SER E 117 ASN E 129 1 ? 13 
HELX_P HELX_P24 AC6 GLU E 133 ? GLU E 148 ? GLU E 131 GLU E 146 1 ? 16 
HELX_P HELX_P25 AC7 SER F 5   ? LEU F 25  ? SER F 3   LEU F 23  1 ? 21 
HELX_P HELX_P26 AC8 THR F 28  ? ALA F 35  ? THR F 26  ALA F 33  1 ? 8  
HELX_P HELX_P27 AC9 LEU F 36  ? GLY F 41  ? LEU F 34  GLY F 39  1 ? 6  
HELX_P HELX_P28 AD1 SER F 45  ? ASN F 54  ? SER F 43  ASN F 52  1 ? 10 
HELX_P HELX_P29 AD2 SER F 58  ? ALA F 76  ? SER F 56  ALA F 74  1 ? 19 
HELX_P HELX_P30 AD3 SER F 101 ? GLU F 114 ? SER F 99  GLU F 112 1 ? 14 
HELX_P HELX_P31 AD4 SER F 119 ? ASN F 131 ? SER F 117 ASN F 129 1 ? 13 
HELX_P HELX_P32 AD5 GLU F 133 ? GLU F 148 ? GLU F 131 GLU F 146 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? C DC 1  N4 ? ? ? 1_555 D DG 19 O6 ? ? C DC 170 D DG 188 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog2  hydrog ? ? C DC 2  N3 ? ? ? 1_555 D DG 19 N2 ? ? C DC 171 D DG 188 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog3  hydrog ? ? C DA 3  N1 ? ? ? 1_555 D DT 18 N3 ? ? C DA 172 D DT 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4  hydrog ? ? C DA 3  N6 ? ? ? 1_555 D DT 18 O4 ? ? C DA 172 D DT 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5  hydrog ? ? C DT 4  N3 ? ? ? 1_555 D DA 17 N1 ? ? C DT 173 D DA 186 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6  hydrog ? ? C DT 4  O4 ? ? ? 1_555 D DA 17 N6 ? ? C DT 173 D DA 186 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7  hydrog ? ? C DT 5  N3 ? ? ? 1_555 D DA 16 N1 ? ? C DT 174 D DA 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8  hydrog ? ? C DT 5  O4 ? ? ? 1_555 D DA 16 N6 ? ? C DT 174 D DA 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9  hydrog ? ? C DC 6  N3 ? ? ? 1_555 D DG 15 N1 ? ? C DC 175 D DG 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10 hydrog ? ? C DC 6  N4 ? ? ? 1_555 D DG 15 O6 ? ? C DC 175 D DG 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11 hydrog ? ? C DC 6  O2 ? ? ? 1_555 D DG 15 N2 ? ? C DC 175 D DG 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12 hydrog ? ? C DA 7  N1 ? ? ? 1_555 D DA 13 N6 ? ? C DA 176 D DA 182 1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ? ? 
hydrog13 hydrog ? ? C DA 7  N1 ? ? ? 1_555 D DT 14 N3 ? ? C DA 176 D DT 183 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog14 hydrog ? ? C DT 8  O4 ? ? ? 1_555 D DA 12 N6 ? ? C DT 177 D DA 181 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog15 hydrog ? ? C DT 8  N3 ? ? ? 1_555 D DA 13 N1 ? ? C DT 177 D DA 182 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog16 hydrog ? ? C DT 9  N3 ? ? ? 1_555 D DA 12 N1 ? ? C DT 178 D DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17 hydrog ? ? C DT 9  O4 ? ? ? 1_555 D DA 12 N6 ? ? C DT 178 D DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog18 hydrog ? ? C DC 10 N3 ? ? ? 1_555 D DG 11 N1 ? ? C DC 179 D DG 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog19 hydrog ? ? C DC 10 N4 ? ? ? 1_555 D DG 11 O6 ? ? C DC 179 D DG 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20 hydrog ? ? C DC 10 O2 ? ? ? 1_555 D DG 11 N2 ? ? C DC 179 D DG 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog21 hydrog ? ? C DA 11 N1 ? ? ? 1_555 D DT 10 N3 ? ? C DA 180 D DT 179 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22 hydrog ? ? C DA 11 N6 ? ? ? 1_555 D DT 10 O4 ? ? C DA 180 D DT 179 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23 hydrog ? ? C DT 12 N3 ? ? ? 1_555 D DA 9  N1 ? ? C DT 181 D DA 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24 hydrog ? ? C DT 12 O4 ? ? ? 1_555 D DA 9  N6 ? ? C DT 181 D DA 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25 hydrog ? ? C DT 13 N3 ? ? ? 1_555 D DA 8  N1 ? ? C DT 182 D DA 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26 hydrog ? ? C DT 13 O4 ? ? ? 1_555 D DA 8  N6 ? ? C DT 182 D DA 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27 hydrog ? ? C DC 14 N3 ? ? ? 1_555 D DG 7  N1 ? ? C DC 183 D DG 176 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog28 hydrog ? ? C DC 14 N4 ? ? ? 1_555 D DG 7  O6 ? ? C DC 183 D DG 176 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29 hydrog ? ? C DC 14 O2 ? ? ? 1_555 D DG 7  N2 ? ? C DC 183 D DG 176 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30 hydrog ? ? C DA 15 N1 ? ? ? 1_555 D DT 6  N3 ? ? C DA 184 D DT 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog31 hydrog ? ? C DA 15 N6 ? ? ? 1_555 D DT 6  O4 ? ? C DA 184 D DT 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog32 hydrog ? ? C DT 16 N3 ? ? ? 1_555 D DA 5  N1 ? ? C DT 185 D DA 174 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog33 hydrog ? ? C DT 16 O4 ? ? ? 1_555 D DA 5  N6 ? ? C DT 185 D DA 174 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34 hydrog ? ? C DT 17 N3 ? ? ? 1_555 D DA 4  N1 ? ? C DT 186 D DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog35 hydrog ? ? C DT 17 O4 ? ? ? 1_555 D DA 4  N6 ? ? C DT 186 D DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog36 hydrog ? ? C DC 18 N3 ? ? ? 1_555 D DG 3  N1 ? ? C DC 187 D DG 172 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37 hydrog ? ? C DC 18 N4 ? ? ? 1_555 D DG 3  O6 ? ? C DC 187 D DG 172 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog38 hydrog ? ? C DC 18 O2 ? ? ? 1_555 D DG 3  N2 ? ? C DC 187 D DG 172 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39 hydrog ? ? C DG 19 N1 ? ? ? 1_555 D DC 2  N3 ? ? C DG 188 D DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog40 hydrog ? ? C DG 19 N2 ? ? ? 1_555 D DC 2  O2 ? ? C DG 188 D DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog41 hydrog ? ? C DG 19 O6 ? ? ? 1_555 D DC 2  N4 ? ? C DG 188 D DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog42 hydrog ? ? C DG 20 N1 ? ? ? 1_555 D DC 1  N3 ? ? C DG 189 D DC 170 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog43 hydrog ? ? C DG 20 N2 ? ? ? 1_555 D DC 1  O2 ? ? C DG 189 D DC 170 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog44 hydrog ? ? C DG 20 O6 ? ? ? 1_555 D DC 1  N4 ? ? C DG 189 D DC 170 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog45 hydrog ? ? G DC 1  N4 ? ? ? 1_555 H DG 19 O6 ? ? G DC 170 H DG 188 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog46 hydrog ? ? G DC 2  O2 ? ? ? 1_555 H DG 19 N2 ? ? G DC 171 H DG 188 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog47 hydrog ? ? G DA 3  N1 ? ? ? 1_555 H DT 18 N3 ? ? G DA 172 H DT 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48 hydrog ? ? G DA 3  N6 ? ? ? 1_555 H DT 18 O4 ? ? G DA 172 H DT 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog49 hydrog ? ? G DT 4  N3 ? ? ? 1_555 H DA 17 N1 ? ? G DT 173 H DA 186 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog50 hydrog ? ? G DT 5  N3 ? ? ? 1_555 H DA 16 N1 ? ? G DT 174 H DA 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog51 hydrog ? ? G DT 5  O4 ? ? ? 1_555 H DA 16 N6 ? ? G DT 174 H DA 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog52 hydrog ? ? G DC 6  N3 ? ? ? 1_555 H DG 15 N1 ? ? G DC 175 H DG 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53 hydrog ? ? G DC 6  N4 ? ? ? 1_555 H DG 15 O6 ? ? G DC 175 H DG 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog54 hydrog ? ? G DC 6  O2 ? ? ? 1_555 H DG 15 N2 ? ? G DC 175 H DG 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog55 hydrog ? ? G DA 7  N1 ? ? ? 1_555 H DT 14 N3 ? ? G DA 176 H DT 183 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog56 hydrog ? ? G DA 7  N6 ? ? ? 1_555 H DT 14 O4 ? ? G DA 176 H DT 183 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog57 hydrog ? ? G DT 8  N3 ? ? ? 1_555 H DA 13 N1 ? ? G DT 177 H DA 182 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog58 hydrog ? ? G DT 8  O4 ? ? ? 1_555 H DA 13 N6 ? ? G DT 177 H DA 182 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog59 hydrog ? ? G DT 9  N3 ? ? ? 1_555 H DA 12 N1 ? ? G DT 178 H DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog60 hydrog ? ? G DT 9  O4 ? ? ? 1_555 H DA 12 N6 ? ? G DT 178 H DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog61 hydrog ? ? G DC 10 N3 ? ? ? 1_555 H DG 11 N1 ? ? G DC 179 H DG 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog62 hydrog ? ? G DC 10 N4 ? ? ? 1_555 H DG 11 O6 ? ? G DC 179 H DG 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog63 hydrog ? ? G DC 10 O2 ? ? ? 1_555 H DG 11 N2 ? ? G DC 179 H DG 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog64 hydrog ? ? G DA 11 N1 ? ? ? 1_555 H DA 9  N6 ? ? G DA 180 H DA 178 1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ? ? 
hydrog65 hydrog ? ? G DA 11 N1 ? ? ? 1_555 H DT 10 N3 ? ? G DA 180 H DT 179 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog66 hydrog ? ? G DT 12 N3 ? ? ? 1_555 H DA 9  N1 ? ? G DT 181 H DA 178 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog67 hydrog ? ? G DT 13 N3 ? ? ? 1_555 H DA 8  N1 ? ? G DT 182 H DA 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog68 hydrog ? ? G DT 13 O4 ? ? ? 1_555 H DA 8  N6 ? ? G DT 182 H DA 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69 hydrog ? ? G DC 14 N3 ? ? ? 1_555 H DG 7  N1 ? ? G DC 183 H DG 176 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog70 hydrog ? ? G DC 14 N4 ? ? ? 1_555 H DG 7  O6 ? ? G DC 183 H DG 176 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog71 hydrog ? ? G DC 14 O2 ? ? ? 1_555 H DG 7  N2 ? ? G DC 183 H DG 176 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog72 hydrog ? ? G DA 15 N1 ? ? ? 1_555 H DT 6  N3 ? ? G DA 184 H DT 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog73 hydrog ? ? G DA 15 N6 ? ? ? 1_555 H DT 6  O4 ? ? G DA 184 H DT 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog74 hydrog ? ? G DT 16 N3 ? ? ? 1_555 H DA 5  N1 ? ? G DT 185 H DA 174 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog75 hydrog ? ? G DT 16 O4 ? ? ? 1_555 H DA 5  N6 ? ? G DT 185 H DA 174 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog76 hydrog ? ? G DT 17 N3 ? ? ? 1_555 H DA 4  N1 ? ? G DT 186 H DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog77 hydrog ? ? G DT 17 O4 ? ? ? 1_555 H DA 4  N6 ? ? G DT 186 H DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog78 hydrog ? ? G DC 18 O2 ? ? ? 1_555 H DG 3  N2 ? ? G DC 187 H DG 172 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog79 hydrog ? ? G DG 19 O6 ? ? ? 1_555 H DC 1  N4 ? ? G DG 188 H DC 170 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog80 hydrog ? ? G DG 19 N2 ? ? ? 1_555 H DC 2  N3 ? ? G DG 188 H DC 171 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog81 hydrog ? ? G DG 20 N2 ? ? ? 1_555 H DC 1  O2 ? ? G DG 189 H DC 170 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_atom_sites.entry_id                    5WC9 
_atom_sites.fract_transf_matrix[1][1]   0.015057 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000961 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010255 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011776 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N     . ASP A 1 4   ? -11.203 -24.856 1.707   1.00 70.58  ?  2   ASP B N     1 
ATOM 2    C CA    . ASP A 1 4   ? -11.957 -25.298 2.872   1.00 71.15  ?  2   ASP B CA    1 
ATOM 3    C C     . ASP A 1 4   ? -11.006 -25.764 3.968   1.00 71.23  ?  2   ASP B C     1 
ATOM 4    O O     . ASP A 1 4   ? -10.010 -26.432 3.694   1.00 73.64  ?  2   ASP B O     1 
ATOM 5    C CB    . ASP A 1 4   ? -12.925 -26.418 2.492   1.00 75.30  ?  2   ASP B CB    1 
ATOM 6    C CG    . ASP A 1 4   ? -14.009 -26.629 3.527   1.00 75.99  ?  2   ASP B CG    1 
ATOM 7    O OD1   . ASP A 1 4   ? -13.693 -26.654 4.733   1.00 75.07  ?  2   ASP B OD1   1 
ATOM 8    O OD2   . ASP A 1 4   ? -15.183 -26.771 3.131   1.00 78.04  ?  2   ASP B OD2   1 
ATOM 9    N N     . SER A 1 5   ? -11.324 -25.411 5.209   1.00 68.13  ?  3   SER B N     1 
ATOM 10   C CA    . SER A 1 5   ? -10.475 -25.741 6.344   1.00 66.31  ?  3   SER B CA    1 
ATOM 11   C C     . SER A 1 5   ? -11.272 -25.623 7.635   1.00 63.77  ?  3   SER B C     1 
ATOM 12   O O     . SER A 1 5   ? -12.260 -24.881 7.682   1.00 61.47  ?  3   SER B O     1 
ATOM 13   C CB    . SER A 1 5   ? -9.252  -24.825 6.383   1.00 64.93  ?  3   SER B CB    1 
ATOM 14   O OG    . SER A 1 5   ? -9.637  -23.466 6.460   1.00 62.33  ?  3   SER B OG    1 
ATOM 15   N N     . PRO A 1 6   ? -10.881 -26.331 8.697   1.00 68.83  ?  4   PRO B N     1 
ATOM 16   C CA    . PRO A 1 6   ? -11.645 -26.256 9.952   1.00 71.61  ?  4   PRO B CA    1 
ATOM 17   C C     . PRO A 1 6   ? -11.748 -24.855 10.520  1.00 68.05  ?  4   PRO B C     1 
ATOM 18   O O     . PRO A 1 6   ? -12.668 -24.584 11.299  1.00 69.96  ?  4   PRO B O     1 
ATOM 19   C CB    . PRO A 1 6   ? -10.861 -27.179 10.892  1.00 78.63  ?  4   PRO B CB    1 
ATOM 20   C CG    . PRO A 1 6   ? -10.153 -28.116 9.994   1.00 81.47  ?  4   PRO B CG    1 
ATOM 21   C CD    . PRO A 1 6   ? -9.810  -27.338 8.764   1.00 75.54  ?  4   PRO B CD    1 
ATOM 22   N N     . GLU A 1 7   ? -10.830 -23.959 10.165  1.00 65.34  ?  5   GLU B N     1 
ATOM 23   C CA    . GLU A 1 7   ? -10.913 -22.586 10.641  1.00 63.05  ?  5   GLU B CA    1 
ATOM 24   C C     . GLU A 1 7   ? -11.944 -21.782 9.860   1.00 59.21  ?  5   GLU B C     1 
ATOM 25   O O     . GLU A 1 7   ? -12.648 -20.948 10.437  1.00 58.20  ?  5   GLU B O     1 
ATOM 26   C CB    . GLU A 1 7   ? -9.541  -21.924 10.544  1.00 65.09  ?  5   GLU B CB    1 
ATOM 27   C CG    . GLU A 1 7   ? -8.422  -22.767 11.122  1.00 68.81  ?  5   GLU B CG    1 
ATOM 28   C CD    . GLU A 1 7   ? -7.754  -23.633 10.075  1.00 71.84  ?  5   GLU B CD    1 
ATOM 29   O OE1   . GLU A 1 7   ? -7.861  -23.309 8.876   1.00 71.79  ?  5   GLU B OE1   1 
ATOM 30   O OE2   . GLU A 1 7   ? -7.130  -24.646 10.452  1.00 75.03  -1 5   GLU B OE2   1 
ATOM 31   N N     . ILE A 1 8   ? -12.053 -22.023 8.553   1.00 56.49  ?  6   ILE B N     1 
ATOM 32   C CA    . ILE A 1 8   ? -13.057 -21.330 7.753   1.00 54.69  ?  6   ILE B CA    1 
ATOM 33   C C     . ILE A 1 8   ? -14.458 -21.771 8.152   1.00 56.18  ?  6   ILE B C     1 
ATOM 34   O O     . ILE A 1 8   ? -15.390 -20.959 8.194   1.00 56.13  ?  6   ILE B O     1 
ATOM 35   C CB    . ILE A 1 8   ? -12.788 -21.559 6.255   1.00 55.72  ?  6   ILE B CB    1 
ATOM 36   C CG1   . ILE A 1 8   ? -11.480 -20.889 5.842   1.00 54.44  ?  6   ILE B CG1   1 
ATOM 37   C CG2   . ILE A 1 8   ? -13.921 -21.017 5.414   1.00 56.67  ?  6   ILE B CG2   1 
ATOM 38   C CD1   . ILE A 1 8   ? -11.202 -20.964 4.366   1.00 55.23  ?  6   ILE B CD1   1 
ATOM 39   N N     . ARG A 1 9   ? -14.633 -23.059 8.454   1.00 54.09  ?  7   ARG B N     1 
ATOM 40   C CA    . ARG A 1 9   ? -15.941 -23.548 8.877   1.00 51.99  ?  7   ARG B CA    1 
ATOM 41   C C     . ARG A 1 9   ? -16.361 -22.910 10.194  1.00 50.37  ?  7   ARG B C     1 
ATOM 42   O O     . ARG A 1 9   ? -17.496 -22.444 10.337  1.00 51.92  ?  7   ARG B O     1 
ATOM 43   C CB    . ARG A 1 9   ? -15.920 -25.070 8.989   1.00 54.35  ?  7   ARG B CB    1 
ATOM 44   C CG    . ARG A 1 9   ? -15.333 -25.763 7.781   1.00 42.39  ?  7   ARG B CG    1 
ATOM 45   C CD    . ARG A 1 9   ? -15.300 -27.260 7.982   1.00 46.02  ?  7   ARG B CD    1 
ATOM 46   N NE    . ARG A 1 9   ? -14.283 -27.894 7.153   1.00 55.99  ?  7   ARG B NE    1 
ATOM 47   C CZ    . ARG A 1 9   ? -13.591 -28.965 7.521   1.00 60.07  ?  7   ARG B CZ    1 
ATOM 48   N NH1   . ARG A 1 9   ? -13.807 -29.517 8.705   1.00 62.40  1  7   ARG B NH1   1 
ATOM 49   N NH2   . ARG A 1 9   ? -12.681 -29.481 6.708   1.00 61.94  ?  7   ARG B NH2   1 
ATOM 50   N N     . GLU A 1 10  ? -15.458 -22.889 11.176  1.00 48.60  ?  8   GLU B N     1 
ATOM 51   C CA    . GLU A 1 10  ? -15.745 -22.200 12.427  1.00 49.21  ?  8   GLU B CA    1 
ATOM 52   C C     . GLU A 1 10  ? -15.911 -20.704 12.211  1.00 47.68  ?  8   GLU B C     1 
ATOM 53   O O     . GLU A 1 10  ? -16.533 -20.029 13.037  1.00 47.19  ?  8   GLU B O     1 
ATOM 54   C CB    . GLU A 1 10  ? -14.635 -22.467 13.443  1.00 50.94  ?  8   GLU B CB    1 
ATOM 55   N N     . LEU A 1 11  ? -15.359 -20.177 11.121  1.00 47.55  ?  9   LEU B N     1 
ATOM 56   C CA    . LEU A 1 11  ? -15.494 -18.764 10.801  1.00 44.37  ?  9   LEU B CA    1 
ATOM 57   C C     . LEU A 1 11  ? -16.871 -18.472 10.223  1.00 47.30  ?  9   LEU B C     1 
ATOM 58   O O     . LEU A 1 11  ? -17.502 -17.473 10.582  1.00 44.97  ?  9   LEU B O     1 
ATOM 59   C CB    . LEU A 1 11  ? -14.401 -18.358 9.816   1.00 40.00  ?  9   LEU B CB    1 
ATOM 60   C CG    . LEU A 1 11  ? -13.650 -17.053 10.027  1.00 36.94  ?  9   LEU B CG    1 
ATOM 61   C CD1   . LEU A 1 11  ? -13.105 -17.003 11.428  1.00 37.70  ?  9   LEU B CD1   1 
ATOM 62   C CD2   . LEU A 1 11  ? -12.523 -16.978 9.025   1.00 36.44  ?  9   LEU B CD2   1 
ATOM 63   N N     . GLU A 1 12  ? -17.343 -19.336 9.322   1.00 52.62  ?  10  GLU B N     1 
ATOM 64   C CA    . GLU A 1 12  ? -18.691 -19.196 8.784   1.00 55.64  ?  10  GLU B CA    1 
ATOM 65   C C     . GLU A 1 12  ? -19.733 -19.319 9.887   1.00 58.04  ?  10  GLU B C     1 
ATOM 66   O O     . GLU A 1 12  ? -20.681 -18.529 9.952   1.00 57.97  ?  10  GLU B O     1 
ATOM 67   C CB    . GLU A 1 12  ? -18.932 -20.240 7.694   1.00 59.40  ?  10  GLU B CB    1 
ATOM 68   C CG    . GLU A 1 12  ? -18.051 -20.077 6.471   1.00 62.44  ?  10  GLU B CG    1 
ATOM 69   C CD    . GLU A 1 12  ? -18.479 -20.966 5.321   1.00 70.00  ?  10  GLU B CD    1 
ATOM 70   O OE1   . GLU A 1 12  ? -17.836 -22.013 5.100   1.00 72.89  ?  10  GLU B OE1   1 
ATOM 71   O OE2   . GLU A 1 12  ? -19.463 -20.616 4.637   1.00 73.00  -1 10  GLU B OE2   1 
ATOM 72   N N     . LYS A 1 13  ? -19.585 -20.324 10.751  1.00 56.77  ?  11  LYS B N     1 
ATOM 73   C CA    . LYS A 1 13  ? -20.557 -20.542 11.817  1.00 60.98  ?  11  LYS B CA    1 
ATOM 74   C C     . LYS A 1 13  ? -20.692 -19.308 12.700  1.00 58.31  ?  11  LYS B C     1 
ATOM 75   O O     . LYS A 1 13  ? -21.805 -18.889 13.034  1.00 60.51  ?  11  LYS B O     1 
ATOM 76   C CB    . LYS A 1 13  ? -20.154 -21.759 12.647  1.00 67.25  ?  11  LYS B CB    1 
ATOM 77   C CG    . LYS A 1 13  ? -21.274 -22.336 13.490  1.00 40.46  ?  11  LYS B CG    1 
ATOM 78   C CD    . LYS A 1 13  ? -20.745 -23.368 14.462  1.00 43.34  ?  11  LYS B CD    1 
ATOM 79   C CE    . LYS A 1 13  ? -21.789 -23.724 15.499  1.00 46.37  ?  11  LYS B CE    1 
ATOM 80   N NZ    . LYS A 1 13  ? -22.472 -22.516 16.022  1.00 44.93  1  11  LYS B NZ    1 
ATOM 81   N N     . PHE A 1 14  ? -19.563 -18.707 13.085  1.00 53.19  ?  12  PHE B N     1 
ATOM 82   C CA    . PHE A 1 14  ? -19.613 -17.512 13.921  1.00 45.85  ?  12  PHE B CA    1 
ATOM 83   C C     . PHE A 1 14  ? -20.252 -16.341 13.187  1.00 42.31  ?  12  PHE B C     1 
ATOM 84   O O     . PHE A 1 14  ? -21.069 -15.615 13.763  1.00 39.22  ?  12  PHE B O     1 
ATOM 85   C CB    . PHE A 1 14  ? -18.212 -17.133 14.392  1.00 40.71  ?  12  PHE B CB    1 
ATOM 86   C CG    . PHE A 1 14  ? -18.186 -15.922 15.274  1.00 39.41  ?  12  PHE B CG    1 
ATOM 87   C CD1   . PHE A 1 14  ? -18.616 -15.995 16.584  1.00 42.56  ?  12  PHE B CD1   1 
ATOM 88   C CD2   . PHE A 1 14  ? -17.753 -14.706 14.787  1.00 37.39  ?  12  PHE B CD2   1 
ATOM 89   C CE1   . PHE A 1 14  ? -18.603 -14.882 17.393  1.00 43.13  ?  12  PHE B CE1   1 
ATOM 90   C CE2   . PHE A 1 14  ? -17.740 -13.591 15.593  1.00 39.51  ?  12  PHE B CE2   1 
ATOM 91   C CZ    . PHE A 1 14  ? -18.165 -13.681 16.897  1.00 42.00  ?  12  PHE B CZ    1 
ATOM 92   N N     . ALA A 1 15  ? -19.883 -16.134 11.920  1.00 41.32  ?  13  ALA B N     1 
ATOM 93   C CA    . ALA A 1 15  ? -20.451 -15.029 11.156  1.00 39.69  ?  13  ALA B CA    1 
ATOM 94   C C     . ALA A 1 15  ? -21.960 -15.171 11.027  1.00 43.49  ?  13  ALA B C     1 
ATOM 95   O O     . ALA A 1 15  ? -22.694 -14.180 11.106  1.00 45.38  ?  13  ALA B O     1 
ATOM 96   C CB    . ALA A 1 15  ? -19.798 -14.954 9.779   1.00 37.70  ?  13  ALA B CB    1 
ATOM 97   N N     . ASN A 1 16  ? -22.439 -16.397 10.815  1.00 44.35  ?  14  ASN B N     1 
ATOM 98   C CA    . ASN A 1 16  ? -23.877 -16.627 10.754  1.00 44.28  ?  14  ASN B CA    1 
ATOM 99   C C     . ASN A 1 16  ? -24.522 -16.432 12.120  1.00 41.19  ?  14  ASN B C     1 
ATOM 100  O O     . ASN A 1 16  ? -25.582 -15.808 12.227  1.00 41.45  ?  14  ASN B O     1 
ATOM 101  C CB    . ASN A 1 16  ? -24.157 -18.030 10.221  1.00 49.35  ?  14  ASN B CB    1 
ATOM 102  C CG    . ASN A 1 16  ? -23.572 -18.253 8.842   1.00 52.32  ?  14  ASN B CG    1 
ATOM 103  O OD1   . ASN A 1 16  ? -23.085 -17.322 8.203   1.00 51.88  ?  14  ASN B OD1   1 
ATOM 104  N ND2   . ASN A 1 16  ? -23.610 -19.495 8.378   1.00 55.51  ?  14  ASN B ND2   1 
ATOM 105  N N     . GLU A 1 17  ? -23.896 -16.958 13.174  1.00 41.05  ?  15  GLU B N     1 
ATOM 106  C CA    . GLU A 1 17  ? -24.441 -16.792 14.516  1.00 43.12  ?  15  GLU B CA    1 
ATOM 107  C C     . GLU A 1 17  ? -24.387 -15.338 14.963  1.00 40.90  ?  15  GLU B C     1 
ATOM 108  O O     . GLU A 1 17  ? -25.273 -14.871 15.685  1.00 40.51  ?  15  GLU B O     1 
ATOM 109  C CB    . GLU A 1 17  ? -23.679 -17.666 15.509  1.00 47.99  ?  15  GLU B CB    1 
ATOM 110  C CG    . GLU A 1 17  ? -24.032 -19.134 15.482  1.00 55.59  ?  15  GLU B CG    1 
ATOM 111  C CD    . GLU A 1 17  ? -23.392 -19.887 16.628  1.00 63.02  ?  15  GLU B CD    1 
ATOM 112  O OE1   . GLU A 1 17  ? -22.161 -19.779 16.797  1.00 63.35  ?  15  GLU B OE1   1 
ATOM 113  O OE2   . GLU A 1 17  ? -24.120 -20.578 17.368  1.00 68.23  -1 15  GLU B OE2   1 
ATOM 114  N N     . PHE A 1 18  ? -23.341 -14.614 14.564  1.00 39.31  ?  16  PHE B N     1 
ATOM 115  C CA    . PHE A 1 18  ? -23.256 -13.203 14.912  1.00 37.78  ?  16  PHE B CA    1 
ATOM 116  C C     . PHE A 1 18  ? -24.363 -12.395 14.251  1.00 39.42  ?  16  PHE B C     1 
ATOM 117  O O     . PHE A 1 18  ? -24.853 -11.427 14.838  1.00 42.37  ?  16  PHE B O     1 
ATOM 118  C CB    . PHE A 1 18  ? -21.881 -12.653 14.539  1.00 35.78  ?  16  PHE B CB    1 
ATOM 119  C CG    . PHE A 1 18  ? -21.751 -11.173 14.723  1.00 36.94  ?  16  PHE B CG    1 
ATOM 120  C CD1   . PHE A 1 18  ? -21.704 -10.624 15.988  1.00 39.49  ?  16  PHE B CD1   1 
ATOM 121  C CD2   . PHE A 1 18  ? -21.648 -10.331 13.634  1.00 36.12  ?  16  PHE B CD2   1 
ATOM 122  C CE1   . PHE A 1 18  ? -21.583 -9.268  16.162  1.00 39.83  ?  16  PHE B CE1   1 
ATOM 123  C CE2   . PHE A 1 18  ? -21.522 -8.974  13.806  1.00 36.21  ?  16  PHE B CE2   1 
ATOM 124  C CZ    . PHE A 1 18  ? -21.490 -8.442  15.071  1.00 37.61  ?  16  PHE B CZ    1 
ATOM 125  N N     . LYS A 1 19  ? -24.773 -12.774 13.040  1.00 38.37  ?  17  LYS B N     1 
ATOM 126  C CA    . LYS A 1 19  ? -25.810 -12.020 12.342  1.00 37.76  ?  17  LYS B CA    1 
ATOM 127  C C     . LYS A 1 19  ? -27.164 -12.170 13.022  1.00 39.22  ?  17  LYS B C     1 
ATOM 128  O O     . LYS A 1 19  ? -27.862 -11.178 13.253  1.00 42.07  ?  17  LYS B O     1 
ATOM 129  C CB    . LYS A 1 19  ? -25.894 -12.466 10.884  1.00 37.18  ?  17  LYS B CB    1 
ATOM 130  C CG    . LYS A 1 19  ? -27.037 -11.830 10.112  1.00 35.31  ?  17  LYS B CG    1 
ATOM 131  C CD    . LYS A 1 19  ? -26.851 -11.991 8.616   1.00 29.46  ?  17  LYS B CD    1 
ATOM 132  N N     . VAL A 1 20  ? -27.553 -13.401 13.357  1.00 39.05  ?  18  VAL B N     1 
ATOM 133  C CA    . VAL A 1 20  ? -28.858 -13.619 13.977  1.00 42.17  ?  18  VAL B CA    1 
ATOM 134  C C     . VAL A 1 20  ? -28.914 -12.967 15.353  1.00 43.87  ?  18  VAL B C     1 
ATOM 135  O O     . VAL A 1 20  ? -29.868 -12.252 15.678  1.00 46.13  ?  18  VAL B O     1 
ATOM 136  C CB    . VAL A 1 20  ? -29.187 -15.122 14.045  1.00 43.58  ?  18  VAL B CB    1 
ATOM 137  C CG1   . VAL A 1 20  ? -29.752 -15.597 12.720  1.00 43.97  ?  18  VAL B CG1   1 
ATOM 138  C CG2   . VAL A 1 20  ? -27.965 -15.926 14.408  1.00 44.20  ?  18  VAL B CG2   1 
ATOM 139  N N     . ARG A 1 21  ? -27.906 -13.219 16.189  1.00 43.87  ?  19  ARG B N     1 
ATOM 140  C CA    . ARG A 1 21  ? -27.904 -12.640 17.527  1.00 45.54  ?  19  ARG B CA    1 
ATOM 141  C C     . ARG A 1 21  ? -27.811 -11.121 17.484  1.00 44.08  ?  19  ARG B C     1 
ATOM 142  O O     . ARG A 1 21  ? -28.306 -10.447 18.393  1.00 43.84  ?  19  ARG B O     1 
ATOM 143  C CB    . ARG A 1 21  ? -26.762 -13.231 18.348  1.00 47.25  ?  19  ARG B CB    1 
ATOM 144  C CG    . ARG A 1 21  ? -26.917 -14.718 18.603  1.00 53.40  ?  19  ARG B CG    1 
ATOM 145  C CD    . ARG A 1 21  ? -25.791 -15.258 19.457  1.00 60.47  ?  19  ARG B CD    1 
ATOM 146  N NE    . ARG A 1 21  ? -25.712 -14.591 20.751  1.00 67.20  ?  19  ARG B NE    1 
ATOM 147  C CZ    . ARG A 1 21  ? -24.810 -14.881 21.681  1.00 74.42  ?  19  ARG B CZ    1 
ATOM 148  N NH1   . ARG A 1 21  ? -23.907 -15.824 21.457  1.00 75.87  1  19  ARG B NH1   1 
ATOM 149  N NH2   . ARG A 1 21  ? -24.807 -14.228 22.833  1.00 79.21  ?  19  ARG B NH2   1 
ATOM 150  N N     . ARG A 1 22  ? -27.188 -10.564 16.443  1.00 43.10  ?  20  ARG B N     1 
ATOM 151  C CA    . ARG A 1 22  ? -27.152 -9.113  16.296  1.00 43.03  ?  20  ARG B CA    1 
ATOM 152  C C     . ARG A 1 22  ? -28.536 -8.564  15.985  1.00 40.72  ?  20  ARG B C     1 
ATOM 153  O O     . ARG A 1 22  ? -28.936 -7.524  16.519  1.00 40.47  ?  20  ARG B O     1 
ATOM 154  C CB    . ARG A 1 22  ? -26.176 -8.716  15.191  1.00 42.38  ?  20  ARG B CB    1 
ATOM 155  C CG    . ARG A 1 22  ? -26.073 -7.226  14.968  1.00 46.80  ?  20  ARG B CG    1 
ATOM 156  C CD    . ARG A 1 22  ? -25.620 -6.909  13.559  1.00 49.58  ?  20  ARG B CD    1 
ATOM 157  N NE    . ARG A 1 22  ? -26.758 -6.762  12.660  1.00 52.96  ?  20  ARG B NE    1 
ATOM 158  C CZ    . ARG A 1 22  ? -26.729 -7.041  11.364  1.00 55.53  ?  20  ARG B CZ    1 
ATOM 159  N NH1   . ARG A 1 22  ? -25.616 -7.481  10.806  1.00 59.69  1  20  ARG B NH1   1 
ATOM 160  N NH2   . ARG A 1 22  ? -27.814 -6.875  10.626  1.00 56.72  ?  20  ARG B NH2   1 
ATOM 161  N N     . ILE A 1 23  ? -29.283 -9.254  15.126  1.00 41.16  ?  21  ILE B N     1 
ATOM 162  C CA    . ILE A 1 23  ? -30.609 -8.783  14.753  1.00 42.63  ?  21  ILE B CA    1 
ATOM 163  C C     . ILE A 1 23  ? -31.581 -8.975  15.907  1.00 46.54  ?  21  ILE B C     1 
ATOM 164  O O     . ILE A 1 23  ? -32.397 -8.094  16.202  1.00 48.86  ?  21  ILE B O     1 
ATOM 165  C CB    . ILE A 1 23  ? -31.080 -9.506  13.480  1.00 40.80  ?  21  ILE B CB    1 
ATOM 166  C CG1   . ILE A 1 23  ? -30.133 -9.199  12.324  1.00 31.72  ?  21  ILE B CG1   1 
ATOM 167  C CG2   . ILE A 1 23  ? -32.497 -9.101  13.131  1.00 42.65  ?  21  ILE B CG2   1 
ATOM 168  C CD1   . ILE A 1 23  ? -30.460 -9.933  11.056  1.00 31.99  ?  21  ILE B CD1   1 
ATOM 169  N N     . LYS A 1 24  ? -31.519 -10.133 16.569  1.00 45.36  ?  22  LYS B N     1 
ATOM 170  C CA    . LYS A 1 24  ? -32.365 -10.375 17.732  1.00 44.53  ?  22  LYS B CA    1 
ATOM 171  C C     . LYS A 1 24  ? -32.121 -9.343  18.827  1.00 41.55  ?  22  LYS B C     1 
ATOM 172  O O     . LYS A 1 24  ? -33.036 -9.019  19.590  1.00 56.20  ?  22  LYS B O     1 
ATOM 173  C CB    . LYS A 1 24  ? -32.120 -11.790 18.259  1.00 45.91  ?  22  LYS B CB    1 
ATOM 174  C CG    . LYS A 1 24  ? -33.023 -12.216 19.405  1.00 53.09  ?  22  LYS B CG    1 
ATOM 175  C CD    . LYS A 1 24  ? -32.211 -12.716 20.591  1.00 56.57  ?  22  LYS B CD    1 
ATOM 176  C CE    . LYS A 1 24  ? -31.254 -13.821 20.180  1.00 55.66  ?  22  LYS B CE    1 
ATOM 177  N NZ    . LYS A 1 24  ? -30.205 -14.056 21.207  1.00 55.86  ?  22  LYS B NZ    1 
ATOM 178  N N     . LEU A 1 25  ? -30.904 -8.815  18.915  1.00 39.72  ?  23  LEU B N     1 
ATOM 179  C CA    . LEU A 1 25  ? -30.562 -7.767  19.864  1.00 41.47  ?  23  LEU B CA    1 
ATOM 180  C C     . LEU A 1 25  ? -30.847 -6.365  19.342  1.00 41.47  ?  23  LEU B C     1 
ATOM 181  O O     . LEU A 1 25  ? -30.638 -5.394  20.075  1.00 42.55  ?  23  LEU B O     1 
ATOM 182  C CB    . LEU A 1 25  ? -29.086 -7.882  20.244  1.00 42.39  ?  23  LEU B CB    1 
ATOM 183  C CG    . LEU A 1 25  ? -28.744 -8.985  21.243  1.00 47.26  ?  23  LEU B CG    1 
ATOM 184  C CD1   . LEU A 1 25  ? -27.247 -9.117  21.380  1.00 47.61  ?  23  LEU B CD1   1 
ATOM 185  C CD2   . LEU A 1 25  ? -29.376 -8.694  22.587  1.00 51.36  ?  23  LEU B CD2   1 
ATOM 186  N N     . GLY A 1 26  ? -31.319 -6.234  18.108  1.00 42.08  ?  24  GLY B N     1 
ATOM 187  C CA    . GLY A 1 26  ? -31.699 -4.937  17.583  1.00 40.68  ?  24  GLY B CA    1 
ATOM 188  C C     . GLY A 1 26  ? -30.559 -4.016  17.213  1.00 38.73  ?  24  GLY B C     1 
ATOM 189  O O     . GLY A 1 26  ? -30.727 -2.794  17.241  1.00 39.58  ?  24  GLY B O     1 
ATOM 190  N N     . TYR A 1 27  ? -29.404 -4.563  16.856  1.00 34.19  ?  25  TYR B N     1 
ATOM 191  C CA    . TYR A 1 27  ? -28.266 -3.768  16.423  1.00 33.68  ?  25  TYR B CA    1 
ATOM 192  C C     . TYR A 1 27  ? -28.173 -3.759  14.902  1.00 33.50  ?  25  TYR B C     1 
ATOM 193  O O     . TYR A 1 27  ? -28.346 -4.793  14.254  1.00 33.98  ?  25  TYR B O     1 
ATOM 194  C CB    . TYR A 1 27  ? -26.968 -4.313  17.019  1.00 34.69  ?  25  TYR B CB    1 
ATOM 195  C CG    . TYR A 1 27  ? -26.755 -3.978  18.477  1.00 38.35  ?  25  TYR B CG    1 
ATOM 196  C CD1   . TYR A 1 27  ? -26.142 -2.793  18.854  1.00 38.60  ?  25  TYR B CD1   1 
ATOM 197  C CD2   . TYR A 1 27  ? -27.163 -4.849  19.476  1.00 41.69  ?  25  TYR B CD2   1 
ATOM 198  C CE1   . TYR A 1 27  ? -25.941 -2.485  20.183  1.00 41.13  ?  25  TYR B CE1   1 
ATOM 199  C CE2   . TYR A 1 27  ? -26.969 -4.549  20.808  1.00 43.43  ?  25  TYR B CE2   1 
ATOM 200  C CZ    . TYR A 1 27  ? -26.358 -3.367  21.156  1.00 43.30  ?  25  TYR B CZ    1 
ATOM 201  O OH    . TYR A 1 27  ? -26.163 -3.066  22.482  1.00 45.96  ?  25  TYR B OH    1 
ATOM 202  N N     . THR A 1 28  ? -27.898 -2.588  14.339  1.00 32.55  ?  26  THR B N     1 
ATOM 203  C CA    . THR A 1 28  ? -27.574 -2.473  12.927  1.00 29.84  ?  26  THR B CA    1 
ATOM 204  C C     . THR A 1 28  ? -26.070 -2.587  12.725  1.00 31.56  ?  26  THR B C     1 
ATOM 205  O O     . THR A 1 28  ? -25.282 -2.445  13.662  1.00 31.76  ?  26  THR B O     1 
ATOM 206  C CB    . THR A 1 28  ? -28.073 -1.149  12.349  1.00 26.23  ?  26  THR B CB    1 
ATOM 207  O OG1   . THR A 1 28  ? -27.326 -0.069  12.913  1.00 24.96  ?  26  THR B OG1   1 
ATOM 208  C CG2   . THR A 1 28  ? -29.537 -0.955  12.661  1.00 30.30  ?  26  THR B CG2   1 
ATOM 209  N N     . GLN A 1 29  ? -25.679 -2.866  11.480  1.00 32.05  ?  27  GLN B N     1 
ATOM 210  C CA    . GLN A 1 29  ? -24.260 -2.974  11.158  1.00 34.21  ?  27  GLN B CA    1 
ATOM 211  C C     . GLN A 1 29  ? -23.510 -1.711  11.554  1.00 35.38  ?  27  GLN B C     1 
ATOM 212  O O     . GLN A 1 29  ? -22.368 -1.777  12.021  1.00 35.76  ?  27  GLN B O     1 
ATOM 213  C CB    . GLN A 1 29  ? -24.076 -3.264  9.670   1.00 32.92  ?  27  GLN B CB    1 
ATOM 214  C CG    . GLN A 1 29  ? -24.261 -4.722  9.298   1.00 31.73  ?  27  GLN B CG    1 
ATOM 215  C CD    . GLN A 1 29  ? -24.159 -4.958  7.812   1.00 30.55  ?  27  GLN B CD    1 
ATOM 216  O OE1   . GLN A 1 29  ? -24.013 -4.021  7.035   1.00 31.34  ?  27  GLN B OE1   1 
ATOM 217  N NE2   . GLN A 1 29  ? -24.237 -6.217  7.407   1.00 29.60  ?  27  GLN B NE2   1 
ATOM 218  N N     . THR A 1 30  ? -24.134 -0.550  11.371  1.00 34.91  ?  28  THR B N     1 
ATOM 219  C CA    . THR A 1 30  ? -23.512 0.692   11.807  1.00 39.32  ?  28  THR B CA    1 
ATOM 220  C C     . THR A 1 30  ? -23.388 0.754   13.322  1.00 42.70  ?  28  THR B C     1 
ATOM 221  O O     . THR A 1 30  ? -22.413 1.309   13.839  1.00 48.68  ?  28  THR B O     1 
ATOM 222  C CB    . THR A 1 30  ? -24.326 1.881   11.300  1.00 41.26  ?  28  THR B CB    1 
ATOM 223  O OG1   . THR A 1 30  ? -24.565 1.731   9.897   1.00 41.90  ?  28  THR B OG1   1 
ATOM 224  C CG2   . THR A 1 30  ? -23.583 3.177   11.539  1.00 17.06  ?  28  THR B CG2   1 
ATOM 225  N N     . ASN A 1 31  ? -24.350 0.179   14.044  1.00 39.90  ?  29  ASN B N     1 
ATOM 226  C CA    . ASN A 1 31  ? -24.329 0.248   15.501  1.00 44.06  ?  29  ASN B CA    1 
ATOM 227  C C     . ASN A 1 31  ? -23.239 -0.634  16.098  1.00 46.22  ?  29  ASN B C     1 
ATOM 228  O O     . ASN A 1 31  ? -22.527 -0.212  17.016  1.00 48.69  ?  29  ASN B O     1 
ATOM 229  C CB    . ASN A 1 31  ? -25.700 -0.128  16.056  1.00 44.80  ?  29  ASN B CB    1 
ATOM 230  C CG    . ASN A 1 31  ? -26.742 0.929   15.776  1.00 45.87  ?  29  ASN B CG    1 
ATOM 231  O OD1   . ASN A 1 31  ? -26.413 2.045   15.380  1.00 45.04  ?  29  ASN B OD1   1 
ATOM 232  N ND2   . ASN A 1 31  ? -28.005 0.587   15.985  1.00 48.32  ?  29  ASN B ND2   1 
ATOM 233  N N     . VAL A 1 32  ? -23.097 -1.867  15.606  1.00 45.52  ?  30  VAL B N     1 
ATOM 234  C CA    . VAL A 1 32  ? -22.043 -2.730  16.135  1.00 46.86  ?  30  VAL B CA    1 
ATOM 235  C C     . VAL A 1 32  ? -20.673 -2.140  15.827  1.00 48.49  ?  30  VAL B C     1 
ATOM 236  O O     . VAL A 1 32  ? -19.772 -2.164  16.671  1.00 52.63  ?  30  VAL B O     1 
ATOM 237  C CB    . VAL A 1 32  ? -22.197 -4.177  15.624  1.00 45.64  ?  30  VAL B CB    1 
ATOM 238  C CG1   . VAL A 1 32  ? -23.648 -4.599  15.682  1.00 46.21  ?  30  VAL B CG1   1 
ATOM 239  C CG2   . VAL A 1 32  ? -21.660 -4.347  14.229  1.00 43.85  ?  30  VAL B CG2   1 
ATOM 240  N N     . GLY A 1 33  ? -20.495 -1.585  14.627  1.00 47.05  ?  31  GLY B N     1 
ATOM 241  C CA    . GLY A 1 33  ? -19.239 -0.932  14.309  1.00 48.45  ?  31  GLY B CA    1 
ATOM 242  C C     . GLY A 1 33  ? -18.943 0.229   15.233  1.00 50.79  ?  31  GLY B C     1 
ATOM 243  O O     . GLY A 1 33  ? -17.785 0.489   15.562  1.00 53.23  ?  31  GLY B O     1 
ATOM 244  N N     . GLU A 1 34  ? -19.984 0.935   15.670  1.00 51.25  ?  32  GLU B N     1 
ATOM 245  C CA    . GLU A 1 34  ? -19.821 2.059   16.581  1.00 54.83  ?  32  GLU B CA    1 
ATOM 246  C C     . GLU A 1 34  ? -19.615 1.593   18.016  1.00 57.25  ?  32  GLU B C     1 
ATOM 247  O O     . GLU A 1 34  ? -18.772 2.141   18.734  1.00 59.64  ?  32  GLU B O     1 
ATOM 248  C CB    . GLU A 1 34  ? -21.044 2.972   16.484  1.00 58.75  ?  32  GLU B CB    1 
ATOM 249  C CG    . GLU A 1 34  ? -20.853 4.367   17.038  1.00 65.74  ?  32  GLU B CG    1 
ATOM 250  C CD    . GLU A 1 34  ? -22.125 5.194   16.973  1.00 69.68  ?  32  GLU B CD    1 
ATOM 251  O OE1   . GLU A 1 34  ? -23.223 4.600   16.950  1.00 69.49  ?  32  GLU B OE1   1 
ATOM 252  O OE2   . GLU A 1 34  ? -22.026 6.438   16.947  1.00 72.26  -1 32  GLU B OE2   1 
ATOM 253  N N     . ALA A 1 35  ? -20.372 0.586   18.451  1.00 57.26  ?  33  ALA B N     1 
ATOM 254  C CA    . ALA A 1 35  ? -20.356 0.145   19.840  1.00 59.34  ?  33  ALA B CA    1 
ATOM 255  C C     . ALA A 1 35  ? -19.196 -0.792  20.148  1.00 60.91  ?  33  ALA B C     1 
ATOM 256  O O     . ALA A 1 35  ? -19.271 -1.587  21.088  1.00 63.93  ?  33  ALA B O     1 
ATOM 257  C CB    . ALA A 1 35  ? -21.677 -0.539  20.190  1.00 58.40  ?  33  ALA B CB    1 
ATOM 258  N N     . LEU A 1 36  ? -18.113 -0.697  19.382  1.00 59.36  ?  34  LEU B N     1 
ATOM 259  C CA    . LEU A 1 36  ? -16.938 -1.526  19.598  1.00 59.17  ?  34  LEU B CA    1 
ATOM 260  C C     . LEU A 1 36  ? -15.770 -0.786  20.230  1.00 62.31  ?  34  LEU B C     1 
ATOM 261  O O     . LEU A 1 36  ? -14.798 -1.435  20.626  1.00 63.57  ?  34  LEU B O     1 
ATOM 262  C CB    . LEU A 1 36  ? -16.480 -2.151  18.274  1.00 55.57  ?  34  LEU B CB    1 
ATOM 263  C CG    . LEU A 1 36  ? -16.696 -3.652  18.097  1.00 55.54  ?  34  LEU B CG    1 
ATOM 264  C CD1   . LEU A 1 36  ? -18.124 -4.045  18.361  1.00 55.69  ?  34  LEU B CD1   1 
ATOM 265  C CD2   . LEU A 1 36  ? -16.306 -4.040  16.685  1.00 53.42  ?  34  LEU B CD2   1 
ATOM 266  N N     . ALA A 1 37  ? -15.832 0.542   20.337  1.00 63.81  ?  35  ALA B N     1 
ATOM 267  C CA    . ALA A 1 37  ? -14.772 1.267   21.026  1.00 66.78  ?  35  ALA B CA    1 
ATOM 268  C C     . ALA A 1 37  ? -14.643 0.842   22.480  1.00 66.61  ?  35  ALA B C     1 
ATOM 269  O O     . ALA A 1 37  ? -13.589 1.056   23.086  1.00 69.41  ?  35  ALA B O     1 
ATOM 270  C CB    . ALA A 1 37  ? -15.020 2.771   20.944  1.00 71.05  ?  35  ALA B CB    1 
ATOM 271  N N     . ALA A 1 38  ? -15.687 0.238   23.049  1.00 63.05  ?  36  ALA B N     1 
ATOM 272  C CA    . ALA A 1 38  ? -15.615 -0.215  24.431  1.00 63.12  ?  36  ALA B CA    1 
ATOM 273  C C     . ALA A 1 38  ? -14.720 -1.436  24.567  1.00 64.00  ?  36  ALA B C     1 
ATOM 274  O O     . ALA A 1 38  ? -14.078 -1.621  25.606  1.00 68.17  ?  36  ALA B O     1 
ATOM 275  C CB    . ALA A 1 38  ? -17.015 -0.523  24.956  1.00 60.92  ?  36  ALA B CB    1 
ATOM 276  N N     . VAL A 1 39  ? -14.668 -2.277  23.537  1.00 61.42  ?  37  VAL B N     1 
ATOM 277  C CA    . VAL A 1 39  ? -13.854 -3.486  23.558  1.00 63.71  ?  37  VAL B CA    1 
ATOM 278  C C     . VAL A 1 39  ? -12.648 -3.389  22.638  1.00 63.94  ?  37  VAL B C     1 
ATOM 279  O O     . VAL A 1 39  ? -11.799 -4.296  22.653  1.00 65.82  ?  37  VAL B O     1 
ATOM 280  C CB    . VAL A 1 39  ? -14.699 -4.728  23.198  1.00 62.84  ?  37  VAL B CB    1 
ATOM 281  C CG1   . VAL A 1 39  ? -14.027 -6.013  23.659  1.00 65.41  ?  37  VAL B CG1   1 
ATOM 282  C CG2   . VAL A 1 39  ? -16.088 -4.608  23.794  1.00 63.74  ?  37  VAL B CG2   1 
ATOM 283  N N     . HIS A 1 40  ? -12.522 -2.317  21.860  1.00 62.96  ?  38  HIS B N     1 
ATOM 284  C CA    . HIS A 1 40  ? -11.436 -2.218  20.894  1.00 64.15  ?  38  HIS B CA    1 
ATOM 285  C C     . HIS A 1 40  ? -10.642 -0.932  21.073  1.00 69.34  ?  38  HIS B C     1 
ATOM 286  O O     . HIS A 1 40  ? -9.433  -0.905  20.826  1.00 72.18  ?  38  HIS B O     1 
ATOM 287  C CB    . HIS A 1 40  ? -11.985 -2.320  19.471  1.00 59.29  ?  38  HIS B CB    1 
ATOM 288  C CG    . HIS A 1 40  ? -10.933 -2.277  18.410  1.00 57.21  ?  38  HIS B CG    1 
ATOM 289  N ND1   . HIS A 1 40  ? -10.155 -3.367  18.092  1.00 56.83  ?  38  HIS B ND1   1 
ATOM 290  C CD2   . HIS A 1 40  ? -10.558 -1.289  17.566  1.00 55.93  ?  38  HIS B CD2   1 
ATOM 291  C CE1   . HIS A 1 40  ? -9.328  -3.046  17.114  1.00 56.03  ?  38  HIS B CE1   1 
ATOM 292  N NE2   . HIS A 1 40  ? -9.554  -1.790  16.775  1.00 55.67  ?  38  HIS B NE2   1 
ATOM 293  N N     . GLY A 1 41  ? -11.309 0.138   21.494  1.00 70.60  ?  39  GLY B N     1 
ATOM 294  C CA    . GLY A 1 41  ? -10.666 1.424   21.646  1.00 73.49  ?  39  GLY B CA    1 
ATOM 295  C C     . GLY A 1 41  ? -10.839 2.346   20.463  1.00 72.22  ?  39  GLY B C     1 
ATOM 296  O O     . GLY A 1 41  ? -10.302 3.460   20.480  1.00 74.57  ?  39  GLY B O     1 
ATOM 297  N N     . SER A 1 42  ? -11.568 1.912   19.441  1.00 68.91  ?  40  SER B N     1 
ATOM 298  C CA    . SER A 1 42  ? -11.807 2.639   18.204  1.00 65.41  ?  40  SER B CA    1 
ATOM 299  C C     . SER A 1 42  ? -12.942 1.931   17.486  1.00 60.62  ?  40  SER B C     1 
ATOM 300  O O     . SER A 1 42  ? -13.087 0.712   17.598  1.00 59.91  ?  40  SER B O     1 
ATOM 301  C CB    . SER A 1 42  ? -10.559 2.688   17.312  1.00 65.36  ?  40  SER B CB    1 
ATOM 302  O OG    . SER A 1 42  ? -9.366  2.803   18.067  1.00 68.27  ?  40  SER B OG    1 
ATOM 303  N N     . GLU A 1 43  ? -13.740 2.694   16.751  1.00 57.79  ?  41  GLU B N     1 
ATOM 304  C CA    . GLU A 1 43  ? -14.930 2.131   16.135  1.00 55.97  ?  41  GLU B CA    1 
ATOM 305  C C     . GLU A 1 43  ? -14.639 1.701   14.705  1.00 53.82  ?  41  GLU B C     1 
ATOM 306  O O     . GLU A 1 43  ? -13.642 2.097   14.098  1.00 55.26  ?  41  GLU B O     1 
ATOM 307  C CB    . GLU A 1 43  ? -16.092 3.130   16.140  1.00 58.49  ?  41  GLU B CB    1 
ATOM 308  C CG    . GLU A 1 43  ? -15.764 4.506   15.594  1.00 63.01  ?  41  GLU B CG    1 
ATOM 309  C CD    . GLU A 1 43  ? -16.895 5.497   15.798  1.00 65.57  ?  41  GLU B CD    1 
ATOM 310  O OE1   . GLU A 1 43  ? -17.697 5.301   16.731  1.00 67.11  ?  41  GLU B OE1   1 
ATOM 311  O OE2   . GLU A 1 43  ? -16.987 6.469   15.022  1.00 66.37  -1 41  GLU B OE2   1 
ATOM 312  N N     . PHE A 1 44  ? -15.532 0.875   14.175  1.00 49.90  ?  42  PHE B N     1 
ATOM 313  C CA    . PHE A 1 44  ? -15.461 0.397   12.809  1.00 44.21  ?  42  PHE B CA    1 
ATOM 314  C C     . PHE A 1 44  ? -16.596 1.019   12.003  1.00 42.94  ?  42  PHE B C     1 
ATOM 315  O O     . PHE A 1 44  ? -17.225 1.995   12.422  1.00 47.41  ?  42  PHE B O     1 
ATOM 316  C CB    . PHE A 1 44  ? -15.511 -1.129  12.777  1.00 40.20  ?  42  PHE B CB    1 
ATOM 317  C CG    . PHE A 1 44  ? -14.189 -1.784  13.032  1.00 42.06  ?  42  PHE B CG    1 
ATOM 318  C CD1   . PHE A 1 44  ? -13.186 -1.739  12.085  1.00 42.63  ?  42  PHE B CD1   1 
ATOM 319  C CD2   . PHE A 1 44  ? -13.952 -2.456  14.214  1.00 44.58  ?  42  PHE B CD2   1 
ATOM 320  C CE1   . PHE A 1 44  ? -11.968 -2.346  12.318  1.00 43.35  ?  42  PHE B CE1   1 
ATOM 321  C CE2   . PHE A 1 44  ? -12.737 -3.066  14.448  1.00 45.45  ?  42  PHE B CE2   1 
ATOM 322  C CZ    . PHE A 1 44  ? -11.746 -3.010  13.499  1.00 44.33  ?  42  PHE B CZ    1 
ATOM 323  N N     . SER A 1 45  ? -16.864 0.444   10.839  1.00 36.53  ?  43  SER B N     1 
ATOM 324  C CA    . SER A 1 45  ? -17.829 1.000   9.909   1.00 31.63  ?  43  SER B CA    1 
ATOM 325  C C     . SER A 1 45  ? -18.796 -0.084  9.469   1.00 30.15  ?  43  SER B C     1 
ATOM 326  O O     . SER A 1 45  ? -18.500 -1.276  9.545   1.00 31.88  ?  43  SER B O     1 
ATOM 327  C CB    . SER A 1 45  ? -17.138 1.617   8.688   1.00 27.37  ?  43  SER B CB    1 
ATOM 328  O OG    . SER A 1 45  ? -16.217 0.709   8.115   1.00 23.76  ?  43  SER B OG    1 
ATOM 329  N N     . GLN A 1 46  ? -19.975 0.352   9.028   1.00 27.60  ?  44  GLN B N     1 
ATOM 330  C CA    . GLN A 1 46  ? -20.955 -0.587  8.500   1.00 26.66  ?  44  GLN B CA    1 
ATOM 331  C C     . GLN A 1 46  ? -20.388 -1.358  7.319   1.00 28.43  ?  44  GLN B C     1 
ATOM 332  O O     . GLN A 1 46  ? -20.744 -2.521  7.104   1.00 32.25  ?  44  GLN B O     1 
ATOM 333  C CB    . GLN A 1 46  ? -22.236 0.162   8.121   1.00 21.88  ?  44  GLN B CB    1 
ATOM 334  C CG    . GLN A 1 46  ? -23.178 -0.585  7.201   1.00 16.16  ?  44  GLN B CG    1 
ATOM 335  C CD    . GLN A 1 46  ? -22.994 -0.199  5.757   1.00 14.23  ?  44  GLN B CD    1 
ATOM 336  O OE1   . GLN A 1 46  ? -22.680 -1.033  4.917   1.00 14.21  ?  44  GLN B OE1   1 
ATOM 337  N NE2   . GLN A 1 46  ? -23.197 1.072   5.459   1.00 15.19  ?  44  GLN B NE2   1 
ATOM 338  N N     . THR A 1 47  ? -19.500 -0.729  6.549   1.00 24.82  ?  45  THR B N     1 
ATOM 339  C CA    . THR A 1 47  ? -18.814 -1.431  5.471   1.00 24.04  ?  45  THR B CA    1 
ATOM 340  C C     . THR A 1 47  ? -17.986 -2.589  6.005   1.00 21.60  ?  45  THR B C     1 
ATOM 341  O O     . THR A 1 47  ? -18.080 -3.716  5.511   1.00 21.24  ?  45  THR B O     1 
ATOM 342  C CB    . THR A 1 47  ? -17.928 -0.456  4.704   1.00 28.04  ?  45  THR B CB    1 
ATOM 343  O OG1   . THR A 1 47  ? -18.716 0.646   4.241   1.00 30.05  ?  45  THR B OG1   1 
ATOM 344  C CG2   . THR A 1 47  ? -17.279 -1.146  3.531   1.00 12.56  ?  45  THR B CG2   1 
ATOM 345  N N     . THR A 1 48  ? -17.171 -2.328  7.025   1.00 22.66  ?  46  THR B N     1 
ATOM 346  C CA    . THR A 1 48  ? -16.308 -3.365  7.579   1.00 22.88  ?  46  THR B CA    1 
ATOM 347  C C     . THR A 1 48  ? -17.119 -4.513  8.162   1.00 24.61  ?  46  THR B C     1 
ATOM 348  O O     . THR A 1 48  ? -16.786 -5.685  7.956   1.00 25.75  ?  46  THR B O     1 
ATOM 349  C CB    . THR A 1 48  ? -15.393 -2.764  8.641   1.00 21.87  ?  46  THR B CB    1 
ATOM 350  O OG1   . THR A 1 48  ? -14.509 -1.820  8.029   1.00 23.28  ?  46  THR B OG1   1 
ATOM 351  C CG2   . THR A 1 48  ? -14.582 -3.845  9.319   1.00 21.04  ?  46  THR B CG2   1 
ATOM 352  N N     . ILE A 1 49  ? -18.183 -4.195  8.897   1.00 25.27  ?  47  ILE B N     1 
ATOM 353  C CA    . ILE A 1 49  ? -19.026 -5.233  9.484   1.00 25.58  ?  47  ILE B CA    1 
ATOM 354  C C     . ILE A 1 49  ? -19.686 -6.066  8.394   1.00 28.48  ?  47  ILE B C     1 
ATOM 355  O O     . ILE A 1 49  ? -19.731 -7.298  8.473   1.00 30.49  ?  47  ILE B O     1 
ATOM 356  C CB    . ILE A 1 49  ? -20.065 -4.604  10.424  1.00 20.82  ?  47  ILE B CB    1 
ATOM 357  C CG1   . ILE A 1 49  ? -19.361 -3.782  11.500  1.00 18.27  ?  47  ILE B CG1   1 
ATOM 358  C CG2   . ILE A 1 49  ? -20.932 -5.678  11.040  1.00 21.04  ?  47  ILE B CG2   1 
ATOM 359  C CD1   . ILE A 1 49  ? -18.329 -4.558  12.268  1.00 17.41  ?  47  ILE B CD1   1 
ATOM 360  N N     . CYS A 1 50  ? -20.219 -5.403  7.366   1.00 27.61  ?  48  CYS B N     1 
ATOM 361  C CA    . CYS A 1 50  ? -20.815 -6.125  6.247   1.00 28.04  ?  48  CYS B CA    1 
ATOM 362  C C     . CYS A 1 50  ? -19.816 -7.089  5.633   1.00 30.19  ?  48  CYS B C     1 
ATOM 363  O O     . CYS A 1 50  ? -20.169 -8.215  5.266   1.00 34.07  ?  48  CYS B O     1 
ATOM 364  C CB    . CYS A 1 50  ? -21.323 -5.141  5.194   1.00 28.99  ?  48  CYS B CB    1 
ATOM 365  S SG    . CYS A 1 50  ? -21.958 -5.917  3.700   1.00 32.50  ?  48  CYS B SG    1 
ATOM 366  N N     . ARG A 1 51  ? -18.565 -6.656  5.494   1.00 25.39  ?  49  ARG B N     1 
ATOM 367  C CA    . ARG A 1 51  ? -17.531 -7.537  4.972   1.00 23.01  ?  49  ARG B CA    1 
ATOM 368  C C     . ARG A 1 51  ? -17.339 -8.754  5.864   1.00 21.95  ?  49  ARG B C     1 
ATOM 369  O O     . ARG A 1 51  ? -17.113 -9.861  5.370   1.00 22.90  ?  49  ARG B O     1 
ATOM 370  C CB    . ARG A 1 51  ? -16.222 -6.764  4.818   1.00 21.79  ?  49  ARG B CB    1 
ATOM 371  C CG    . ARG A 1 51  ? -16.278 -5.671  3.766   1.00 16.93  ?  49  ARG B CG    1 
ATOM 372  C CD    . ARG A 1 51  ? -14.903 -5.344  3.232   1.00 13.98  ?  49  ARG B CD    1 
ATOM 373  N NE    . ARG A 1 51  ? -14.947 -4.290  2.226   1.00 13.59  ?  49  ARG B NE    1 
ATOM 374  C CZ    . ARG A 1 51  ? -14.606 -3.029  2.452   1.00 13.98  ?  49  ARG B CZ    1 
ATOM 375  N NH1   . ARG A 1 51  ? -14.191 -2.659  3.652   1.00 14.52  1  49  ARG B NH1   1 
ATOM 376  N NH2   . ARG A 1 51  ? -14.679 -2.137  1.478   1.00 14.20  ?  49  ARG B NH2   1 
ATOM 377  N N     . PHE A 1 52  ? -17.425 -8.573  7.182   1.00 23.67  ?  50  PHE B N     1 
ATOM 378  C CA    . PHE A 1 52  ? -17.241 -9.704  8.085   1.00 29.90  ?  50  PHE B CA    1 
ATOM 379  C C     . PHE A 1 52  ? -18.407 -10.680 8.009   1.00 32.73  ?  50  PHE B C     1 
ATOM 380  O O     . PHE A 1 52  ? -18.205 -11.892 7.881   1.00 33.17  ?  50  PHE B O     1 
ATOM 381  C CB    . PHE A 1 52  ? -17.057 -9.222  9.521   1.00 31.47  ?  50  PHE B CB    1 
ATOM 382  C CG    . PHE A 1 52  ? -16.829 -10.336 10.495  1.00 34.58  ?  50  PHE B CG    1 
ATOM 383  C CD1   . PHE A 1 52  ? -15.567 -10.865 10.673  1.00 36.73  ?  50  PHE B CD1   1 
ATOM 384  C CD2   . PHE A 1 52  ? -17.880 -10.877 11.210  1.00 35.82  ?  50  PHE B CD2   1 
ATOM 385  C CE1   . PHE A 1 52  ? -15.358 -11.895 11.554  1.00 40.22  ?  50  PHE B CE1   1 
ATOM 386  C CE2   . PHE A 1 52  ? -17.674 -11.908 12.092  1.00 38.29  ?  50  PHE B CE2   1 
ATOM 387  C CZ    . PHE A 1 52  ? -16.414 -12.418 12.265  1.00 41.08  ?  50  PHE B CZ    1 
ATOM 388  N N     . GLU A 1 53  ? -19.635 -10.173 8.119   1.00 34.44  ?  51  GLU B N     1 
ATOM 389  C CA    . GLU A 1 53  ? -20.800 -11.050 8.072   1.00 35.46  ?  51  GLU B CA    1 
ATOM 390  C C     . GLU A 1 53  ? -20.842 -11.850 6.781   1.00 33.17  ?  51  GLU B C     1 
ATOM 391  O O     . GLU A 1 53  ? -21.196 -13.033 6.788   1.00 35.99  ?  51  GLU B O     1 
ATOM 392  C CB    . GLU A 1 53  ? -22.078 -10.236 8.240   1.00 38.53  ?  51  GLU B CB    1 
ATOM 393  C CG    . GLU A 1 53  ? -22.349 -9.823  9.663   1.00 44.41  ?  51  GLU B CG    1 
ATOM 394  C CD    . GLU A 1 53  ? -23.612 -9.016  9.788   1.00 50.98  ?  51  GLU B CD    1 
ATOM 395  O OE1   . GLU A 1 53  ? -24.267 -8.776  8.754   1.00 52.77  ?  51  GLU B OE1   1 
ATOM 396  O OE2   . GLU A 1 53  ? -23.963 -8.627  10.918  1.00 56.50  -1 51  GLU B OE2   1 
ATOM 397  N N     . ASN A 1 54  ? -20.483 -11.227 5.667   1.00 29.23  ?  52  ASN B N     1 
ATOM 398  C CA    . ASN A 1 54  ? -20.430 -11.912 4.387   1.00 31.05  ?  52  ASN B CA    1 
ATOM 399  C C     . ASN A 1 54  ? -19.060 -12.506 4.103   1.00 33.24  ?  52  ASN B C     1 
ATOM 400  O O     . ASN A 1 54  ? -18.859 -13.067 3.023   1.00 36.03  ?  52  ASN B O     1 
ATOM 401  C CB    . ASN A 1 54  ? -20.817 -10.947 3.266   1.00 31.22  ?  52  ASN B CB    1 
ATOM 402  C CG    . ASN A 1 54  ? -22.205 -10.380 3.442   1.00 30.18  ?  52  ASN B CG    1 
ATOM 403  O OD1   . ASN A 1 54  ? -23.185 -10.942 2.959   1.00 31.59  ?  52  ASN B OD1   1 
ATOM 404  N ND2   . ASN A 1 54  ? -22.297 -9.262  4.145   1.00 27.93  ?  52  ASN B ND2   1 
ATOM 405  N N     . LEU A 1 55  ? -18.133 -12.413 5.058   1.00 31.93  ?  53  LEU B N     1 
ATOM 406  C CA    . LEU A 1 55  ? -16.768 -12.922 4.916   1.00 28.20  ?  53  LEU B CA    1 
ATOM 407  C C     . LEU A 1 55  ? -16.096 -12.382 3.657   1.00 25.05  ?  53  LEU B C     1 
ATOM 408  O O     . LEU A 1 55  ? -15.443 -13.113 2.915   1.00 18.09  ?  53  LEU B O     1 
ATOM 409  C CB    . LEU A 1 55  ? -16.750 -14.448 4.936   1.00 29.59  ?  53  LEU B CB    1 
ATOM 410  C CG    . LEU A 1 55  ? -16.850 -15.074 6.328   1.00 31.01  ?  53  LEU B CG    1 
ATOM 411  C CD1   . LEU A 1 55  ? -16.653 -16.570 6.258   1.00 23.11  ?  53  LEU B CD1   1 
ATOM 412  C CD2   . LEU A 1 55  ? -15.841 -14.448 7.267   1.00 32.11  ?  53  LEU B CD2   1 
ATOM 413  N N     . GLN A 1 56  ? -16.263 -11.087 3.411   1.00 23.22  ?  54  GLN B N     1 
ATOM 414  C CA    . GLN A 1 56  ? -15.582 -10.423 2.301   1.00 22.88  ?  54  GLN B CA    1 
ATOM 415  C C     . GLN A 1 56  ? -14.369 -9.645  2.806   1.00 22.54  ?  54  GLN B C     1 
ATOM 416  O O     . GLN A 1 56  ? -14.243 -8.436  2.634   1.00 22.68  ?  54  GLN B O     1 
ATOM 417  C CB    . GLN A 1 56  ? -16.549 -9.509  1.559   1.00 24.19  ?  54  GLN B CB    1 
ATOM 418  C CG    . GLN A 1 56  ? -17.690 -10.230 0.892   1.00 28.01  ?  54  GLN B CG    1 
ATOM 419  C CD    . GLN A 1 56  ? -18.685 -9.278  0.288   1.00 31.45  ?  54  GLN B CD    1 
ATOM 420  O OE1   . GLN A 1 56  ? -18.650 -8.079  0.555   1.00 30.60  ?  54  GLN B OE1   1 
ATOM 421  N NE2   . GLN A 1 56  ? -19.583 -9.803  -0.533  1.00 33.90  ?  54  GLN B NE2   1 
ATOM 422  N N     . LEU A 1 57  ? -13.468 -10.380 3.444   1.00 24.35  ?  55  LEU B N     1 
ATOM 423  C CA    . LEU A 1 57  ? -12.179 -9.857  3.862   1.00 27.99  ?  55  LEU B CA    1 
ATOM 424  C C     . LEU A 1 57  ? -11.197 -11.016 3.952   1.00 30.71  ?  55  LEU B C     1 
ATOM 425  O O     . LEU A 1 57  ? -11.562 -12.179 3.778   1.00 31.18  ?  55  LEU B O     1 
ATOM 426  C CB    . LEU A 1 57  ? -12.292 -9.050  5.160   1.00 28.36  ?  55  LEU B CB    1 
ATOM 427  C CG    . LEU A 1 57  ? -13.187 -9.537  6.295   1.00 27.78  ?  55  LEU B CG    1 
ATOM 428  C CD1   . LEU A 1 57  ? -12.729 -10.842 6.842   1.00 30.13  ?  55  LEU B CD1   1 
ATOM 429  C CD2   . LEU A 1 57  ? -13.206 -8.494  7.394   1.00 25.67  ?  55  LEU B CD2   1 
ATOM 430  N N     . SER A 1 58  ? -9.939  -10.685 4.218   1.00 30.65  ?  56  SER B N     1 
ATOM 431  C CA    . SER A 1 58  ? -8.898  -11.696 4.285   1.00 31.03  ?  56  SER B CA    1 
ATOM 432  C C     . SER A 1 58  ? -9.082  -12.605 5.495   1.00 31.26  ?  56  SER B C     1 
ATOM 433  O O     . SER A 1 58  ? -9.753  -12.265 6.472   1.00 30.52  ?  56  SER B O     1 
ATOM 434  C CB    . SER A 1 58  ? -7.525  -11.034 4.343   1.00 24.58  ?  56  SER B CB    1 
ATOM 435  O OG    . SER A 1 58  ? -7.377  -10.293 5.538   1.00 24.81  ?  56  SER B OG    1 
ATOM 436  N N     . PHE A 1 59  ? -8.477  -13.792 5.405   1.00 32.32  ?  57  PHE B N     1 
ATOM 437  C CA    . PHE A 1 59  ? -8.538  -14.748 6.505   1.00 33.62  ?  57  PHE B CA    1 
ATOM 438  C C     . PHE A 1 59  ? -7.916  -14.182 7.773   1.00 37.63  ?  57  PHE B C     1 
ATOM 439  O O     . PHE A 1 59  ? -8.457  -14.361 8.869   1.00 42.43  ?  57  PHE B O     1 
ATOM 440  C CB    . PHE A 1 59  ? -7.845  -16.050 6.120   1.00 35.67  ?  57  PHE B CB    1 
ATOM 441  C CG    . PHE A 1 59  ? -7.811  -17.056 7.228   1.00 39.77  ?  57  PHE B CG    1 
ATOM 442  C CD1   . PHE A 1 59  ? -8.953  -17.740 7.593   1.00 41.07  ?  57  PHE B CD1   1 
ATOM 443  C CD2   . PHE A 1 59  ? -6.642  -17.298 7.924   1.00 43.18  ?  57  PHE B CD2   1 
ATOM 444  C CE1   . PHE A 1 59  ? -8.927  -18.657 8.618   1.00 45.05  ?  57  PHE B CE1   1 
ATOM 445  C CE2   . PHE A 1 59  ? -6.611  -18.213 8.951   1.00 46.51  ?  57  PHE B CE2   1 
ATOM 446  C CZ    . PHE A 1 59  ? -7.755  -18.894 9.298   1.00 47.77  ?  57  PHE B CZ    1 
ATOM 447  N N     . LYS A 1 60  ? -6.764  -13.521 7.649   1.00 35.84  ?  58  LYS B N     1 
ATOM 448  C CA    . LYS A 1 60  ? -6.112  -12.950 8.822   1.00 36.94  ?  58  LYS B CA    1 
ATOM 449  C C     . LYS A 1 60  ? -6.971  -11.864 9.453   1.00 35.70  ?  58  LYS B C     1 
ATOM 450  O O     . LYS A 1 60  ? -7.086  -11.787 10.681  1.00 36.15  ?  58  LYS B O     1 
ATOM 451  C CB    . LYS A 1 60  ? -4.740  -12.396 8.440   1.00 39.90  ?  58  LYS B CB    1 
ATOM 452  C CG    . LYS A 1 60  ? -3.944  -11.859 9.619   1.00 42.68  ?  58  LYS B CG    1 
ATOM 453  C CD    . LYS A 1 60  ? -2.762  -11.024 9.166   1.00 43.68  ?  58  LYS B CD    1 
ATOM 454  C CE    . LYS A 1 60  ? -2.190  -10.222 10.320  1.00 45.45  ?  58  LYS B CE    1 
ATOM 455  N NZ    . LYS A 1 60  ? -1.346  -9.097  9.844   1.00 46.42  1  58  LYS B NZ    1 
ATOM 456  N N     . ASN A 1 61  ? -7.570  -11.005 8.628   1.00 35.15  ?  59  ASN B N     1 
ATOM 457  C CA    . ASN A 1 61  ? -8.449  -9.964  9.147   1.00 37.65  ?  59  ASN B CA    1 
ATOM 458  C C     . ASN A 1 61  ? -9.689  -10.563 9.801   1.00 34.25  ?  59  ASN B C     1 
ATOM 459  O O     . ASN A 1 61  ? -10.189 -10.033 10.799  1.00 31.61  ?  59  ASN B O     1 
ATOM 460  C CB    . ASN A 1 61  ? -8.843  -9.010  8.021   1.00 42.09  ?  59  ASN B CB    1 
ATOM 461  C CG    . ASN A 1 61  ? -9.414  -7.708  8.531   1.00 45.82  ?  59  ASN B CG    1 
ATOM 462  O OD1   . ASN A 1 61  ? -9.361  -7.422  9.721   1.00 48.93  ?  59  ASN B OD1   1 
ATOM 463  N ND2   . ASN A 1 61  ? -9.960  -6.906  7.628   1.00 44.84  ?  59  ASN B ND2   1 
ATOM 464  N N     . ALA A 1 62  ? -10.197 -11.669 9.251   1.00 35.47  ?  60  ALA B N     1 
ATOM 465  C CA    . ALA A 1 62  ? -11.392 -12.299 9.802   1.00 40.36  ?  60  ALA B CA    1 
ATOM 466  C C     . ALA A 1 62  ? -11.156 -12.834 11.204  1.00 47.64  ?  60  ALA B C     1 
ATOM 467  O O     . ALA A 1 62  ? -12.003 -12.668 12.089  1.00 50.24  ?  60  ALA B O     1 
ATOM 468  C CB    . ALA A 1 62  ? -11.849 -13.431 8.888   1.00 41.91  ?  60  ALA B CB    1 
ATOM 469  N N     . CYS A 1 63  ? -10.017 -13.488 11.425  1.00 51.62  ?  61  CYS B N     1 
ATOM 470  C CA    . CYS A 1 63  ? -9.716  -14.011 12.752  1.00 57.74  ?  61  CYS B CA    1 
ATOM 471  C C     . CYS A 1 63  ? -9.583  -12.887 13.768  1.00 53.93  ?  61  CYS B C     1 
ATOM 472  O O     . CYS A 1 63  ? -10.019 -13.026 14.917  1.00 54.85  ?  61  CYS B O     1 
ATOM 473  C CB    . CYS A 1 63  ? -8.442  -14.851 12.701  1.00 68.84  ?  61  CYS B CB    1 
ATOM 474  S SG    . CYS A 1 63  ? -8.581  -16.321 11.671  1.00 78.78  ?  61  CYS B SG    1 
ATOM 475  N N     . LYS A 1 64  ? -8.974  -11.770 13.367  1.00 49.82  ?  62  LYS B N     1 
ATOM 476  C CA    . LYS A 1 64  ? -8.872  -10.619 14.257  1.00 52.25  ?  62  LYS B CA    1 
ATOM 477  C C     . LYS A 1 64  ? -10.248 -10.092 14.638  1.00 52.31  ?  62  LYS B C     1 
ATOM 478  O O     . LYS A 1 64  ? -10.561 -9.941  15.823  1.00 57.78  ?  62  LYS B O     1 
ATOM 479  C CB    . LYS A 1 64  ? -8.040  -9.521  13.599  1.00 52.38  ?  62  LYS B CB    1 
ATOM 480  N N     . LEU A 1 65  ? -11.087 -9.809  13.640  1.00 44.32  ?  63  LEU B N     1 
ATOM 481  C CA    . LEU A 1 65  ? -12.390 -9.209  13.913  1.00 39.24  ?  63  LEU B CA    1 
ATOM 482  C C     . LEU A 1 65  ? -13.303 -10.164 14.668  1.00 40.71  ?  63  LEU B C     1 
ATOM 483  O O     . LEU A 1 65  ? -14.085 -9.731  15.521  1.00 43.16  ?  63  LEU B O     1 
ATOM 484  C CB    . LEU A 1 65  ? -13.042 -8.749  12.613  1.00 34.70  ?  63  LEU B CB    1 
ATOM 485  C CG    . LEU A 1 65  ? -12.762 -7.309  12.182  1.00 33.18  ?  63  LEU B CG    1 
ATOM 486  C CD1   . LEU A 1 65  ? -11.281 -7.024  12.097  1.00 33.43  ?  63  LEU B CD1   1 
ATOM 487  C CD2   . LEU A 1 65  ? -13.431 -7.029  10.853  1.00 32.09  ?  63  LEU B CD2   1 
ATOM 488  N N     . LYS A 1 66  ? -13.239 -11.459 14.357  1.00 40.15  ?  64  LYS B N     1 
ATOM 489  C CA    . LYS A 1 66  ? -14.030 -12.428 15.106  1.00 42.98  ?  64  LYS B CA    1 
ATOM 490  C C     . LYS A 1 66  ? -13.693 -12.378 16.589  1.00 48.21  ?  64  LYS B C     1 
ATOM 491  O O     . LYS A 1 66  ? -14.576 -12.524 17.439  1.00 50.05  ?  64  LYS B O     1 
ATOM 492  C CB    . LYS A 1 66  ? -13.808 -13.832 14.547  1.00 29.85  ?  64  LYS B CB    1 
ATOM 493  C CG    . LYS A 1 66  ? -14.203 -14.953 15.489  1.00 32.53  ?  64  LYS B CG    1 
ATOM 494  C CD    . LYS A 1 66  ? -14.236 -16.286 14.772  1.00 33.20  ?  64  LYS B CD    1 
ATOM 495  C CE    . LYS A 1 66  ? -13.651 -17.389 15.628  1.00 46.05  ?  64  LYS B CE    1 
ATOM 496  N NZ    . LYS A 1 66  ? -12.166 -17.417 15.549  1.00 51.35  1  64  LYS B NZ    1 
ATOM 497  N N     . ALA A 1 67  ? -12.420 -12.150 16.918  1.00 33.53  ?  65  ALA B N     1 
ATOM 498  C CA    . ALA A 1 67  ? -12.024 -12.016 18.316  1.00 43.66  ?  65  ALA B CA    1 
ATOM 499  C C     . ALA A 1 67  ? -12.614 -10.755 18.933  1.00 43.56  ?  65  ALA B C     1 
ATOM 500  O O     . ALA A 1 67  ? -13.138 -10.785 20.051  1.00 46.15  ?  65  ALA B O     1 
ATOM 501  C CB    . ALA A 1 67  ? -10.502 -12.011 18.430  1.00 38.66  ?  65  ALA B CB    1 
ATOM 502  N N     . ILE A 1 68  ? -12.521 -9.631  18.222  1.00 41.04  ?  66  ILE B N     1 
ATOM 503  C CA    . ILE A 1 68  ? -13.090 -8.381  18.714  1.00 41.60  ?  66  ILE B CA    1 
ATOM 504  C C     . ILE A 1 68  ? -14.600 -8.496  18.841  1.00 43.00  ?  66  ILE B C     1 
ATOM 505  O O     . ILE A 1 68  ? -15.196 -8.031  19.818  1.00 47.82  ?  66  ILE B O     1 
ATOM 506  C CB    . ILE A 1 68  ? -12.695 -7.219  17.788  1.00 31.73  ?  66  ILE B CB    1 
ATOM 507  C CG1   . ILE A 1 68  ? -11.209 -7.296  17.447  1.00 34.89  ?  66  ILE B CG1   1 
ATOM 508  C CG2   . ILE A 1 68  ? -13.037 -5.891  18.427  1.00 32.31  ?  66  ILE B CG2   1 
ATOM 509  C CD1   . ILE A 1 68  ? -10.750 -6.218  16.515  1.00 31.37  ?  66  ILE B CD1   1 
ATOM 510  N N     . LEU A 1 69  ? -15.244 -9.102  17.847  1.00 39.74  ?  67  LEU B N     1 
ATOM 511  C CA    . LEU A 1 69  ? -16.699 -9.162  17.818  1.00 40.72  ?  67  LEU B CA    1 
ATOM 512  C C     . LEU A 1 69  ? -17.260 -10.171 18.813  1.00 45.54  ?  67  LEU B C     1 
ATOM 513  O O     . LEU A 1 69  ? -18.343 -9.951  19.366  1.00 46.47  ?  67  LEU B O     1 
ATOM 514  C CB    . LEU A 1 69  ? -17.164 -9.488  16.400  1.00 35.96  ?  67  LEU B CB    1 
ATOM 515  C CG    . LEU A 1 69  ? -17.072 -8.299  15.447  1.00 30.66  ?  67  LEU B CG    1 
ATOM 516  C CD1   . LEU A 1 69  ? -17.317 -8.723  14.019  1.00 27.71  ?  67  LEU B CD1   1 
ATOM 517  C CD2   . LEU A 1 69  ? -18.056 -7.227  15.861  1.00 29.18  ?  67  LEU B CD2   1 
ATOM 518  N N     . SER A 1 70  ? -16.557 -11.283 19.039  1.00 47.67  ?  68  SER B N     1 
ATOM 519  C CA    . SER A 1 70  ? -17.040 -12.279 19.990  1.00 51.53  ?  68  SER B CA    1 
ATOM 520  C C     . SER A 1 70  ? -17.052 -11.736 21.412  1.00 57.04  ?  68  SER B C     1 
ATOM 521  O O     . SER A 1 70  ? -18.004 -11.974 22.163  1.00 60.87  ?  68  SER B O     1 
ATOM 522  C CB    . SER A 1 70  ? -16.185 -13.542 19.910  1.00 51.48  ?  68  SER B CB    1 
ATOM 523  O OG    . SER A 1 70  ? -14.877 -13.296 20.388  1.00 53.22  ?  68  SER B OG    1 
ATOM 524  N N     . LYS A 1 71  ? -16.001 -11.015 21.806  1.00 57.43  ?  69  LYS B N     1 
ATOM 525  C CA    . LYS A 1 71  ? -15.976 -10.425 23.140  1.00 62.66  ?  69  LYS B CA    1 
ATOM 526  C C     . LYS A 1 71  ? -17.064 -9.373  23.305  1.00 64.26  ?  69  LYS B C     1 
ATOM 527  O O     . LYS A 1 71  ? -17.641 -9.231  24.389  1.00 70.44  ?  69  LYS B O     1 
ATOM 528  C CB    . LYS A 1 71  ? -14.602 -9.819  23.421  1.00 62.33  ?  69  LYS B CB    1 
ATOM 529  C CG    . LYS A 1 71  ? -13.451 -10.801 23.296  1.00 62.65  ?  69  LYS B CG    1 
ATOM 530  N N     . TRP A 1 72  ? -17.360 -8.625  22.242  1.00 56.67  ?  70  TRP B N     1 
ATOM 531  C CA    . TRP A 1 72  ? -18.401 -7.608  22.332  1.00 53.54  ?  70  TRP B CA    1 
ATOM 532  C C     . TRP A 1 72  ? -19.792 -8.227  22.362  1.00 51.89  ?  70  TRP B C     1 
ATOM 533  O O     . TRP A 1 72  ? -20.652 -7.787  23.133  1.00 53.62  ?  70  TRP B O     1 
ATOM 534  C CB    . TRP A 1 72  ? -18.284 -6.619  21.176  1.00 49.12  ?  70  TRP B CB    1 
ATOM 535  C CG    . TRP A 1 72  ? -19.433 -5.670  21.122  1.00 44.67  ?  70  TRP B CG    1 
ATOM 536  C CD1   . TRP A 1 72  ? -19.534 -4.476  21.762  1.00 45.58  ?  70  TRP B CD1   1 
ATOM 537  C CD2   . TRP A 1 72  ? -20.649 -5.839  20.390  1.00 38.58  ?  70  TRP B CD2   1 
ATOM 538  N NE1   . TRP A 1 72  ? -20.739 -3.887  21.476  1.00 42.59  ?  70  TRP B NE1   1 
ATOM 539  C CE2   . TRP A 1 72  ? -21.442 -4.706  20.634  1.00 38.40  ?  70  TRP B CE2   1 
ATOM 540  C CE3   . TRP A 1 72  ? -21.144 -6.840  19.553  1.00 35.89  ?  70  TRP B CE3   1 
ATOM 541  C CZ2   . TRP A 1 72  ? -22.700 -4.545  20.071  1.00 36.93  ?  70  TRP B CZ2   1 
ATOM 542  C CZ3   . TRP A 1 72  ? -22.391 -6.678  18.997  1.00 35.59  ?  70  TRP B CZ3   1 
ATOM 543  C CH2   . TRP A 1 72  ? -23.156 -5.540  19.257  1.00 36.37  ?  70  TRP B CH2   1 
ATOM 544  N N     . LEU A 1 73  ? -20.039 -9.229  21.516  1.00 49.14  ?  71  LEU B N     1 
ATOM 545  C CA    . LEU A 1 73  ? -21.360 -9.848  21.459  1.00 50.33  ?  71  LEU B CA    1 
ATOM 546  C C     . LEU A 1 73  ? -21.797 -10.329 22.835  1.00 57.57  ?  71  LEU B C     1 
ATOM 547  O O     . LEU A 1 73  ? -22.922 -10.066 23.271  1.00 58.84  ?  71  LEU B O     1 
ATOM 548  C CB    . LEU A 1 73  ? -21.353 -11.002 20.457  1.00 47.05  ?  71  LEU B CB    1 
ATOM 549  C CG    . LEU A 1 73  ? -22.678 -11.736 20.261  1.00 44.84  ?  71  LEU B CG    1 
ATOM 550  C CD1   . LEU A 1 73  ? -23.765 -10.770 19.844  1.00 42.79  ?  71  LEU B CD1   1 
ATOM 551  C CD2   . LEU A 1 73  ? -22.521 -12.838 19.233  1.00 42.70  ?  71  LEU B CD2   1 
ATOM 552  N N     . GLU A 1 74  ? -20.916 -11.053 23.526  1.00 62.62  ?  72  GLU B N     1 
ATOM 553  C CA    . GLU A 1 74  ? -21.173 -11.421 24.913  1.00 69.85  ?  72  GLU B CA    1 
ATOM 554  C C     . GLU A 1 74  ? -21.476 -10.186 25.752  1.00 74.35  ?  72  GLU B C     1 
ATOM 555  O O     . GLU A 1 74  ? -22.448 -10.156 26.514  1.00 77.57  ?  72  GLU B O     1 
ATOM 556  C CB    . GLU A 1 74  ? -19.975 -12.181 25.483  1.00 72.47  ?  72  GLU B CB    1 
ATOM 557  N N     . GLU A 1 75  ? -20.646 -9.150  25.613  1.00 75.40  ?  73  GLU B N     1 
ATOM 558  C CA    . GLU A 1 75  ? -20.805 -7.939  26.407  1.00 80.87  ?  73  GLU B CA    1 
ATOM 559  C C     . GLU A 1 75  ? -22.097 -7.198  26.092  1.00 78.56  ?  73  GLU B C     1 
ATOM 560  O O     . GLU A 1 75  ? -22.585 -6.444  26.939  1.00 79.97  ?  73  GLU B O     1 
ATOM 561  C CB    . GLU A 1 75  ? -19.607 -7.015  26.182  1.00 84.77  ?  73  GLU B CB    1 
ATOM 562  C CG    . GLU A 1 75  ? -19.419 -5.948  27.248  1.00 90.85  ?  73  GLU B CG    1 
ATOM 563  C CD    . GLU A 1 75  ? -18.232 -5.045  26.966  1.00 93.26  ?  73  GLU B CD    1 
ATOM 564  O OE1   . GLU A 1 75  ? -17.094 -5.554  26.910  1.00 94.88  ?  73  GLU B OE1   1 
ATOM 565  O OE2   . GLU A 1 75  ? -18.440 -3.824  26.800  1.00 93.52  -1 73  GLU B OE2   1 
ATOM 566  N N     . ALA A 1 76  ? -22.673 -7.396  24.905  1.00 79.66  ?  74  ALA B N     1 
ATOM 567  C CA    . ALA A 1 76  ? -23.912 -6.729  24.529  1.00 79.64  ?  74  ALA B CA    1 
ATOM 568  C C     . ALA A 1 76  ? -25.130 -7.614  24.756  1.00 79.41  ?  74  ALA B C     1 
ATOM 569  O O     . ALA A 1 76  ? -26.116 -7.523  24.018  1.00 80.64  ?  74  ALA B O     1 
ATOM 570  C CB    . ALA A 1 76  ? -23.851 -6.274  23.072  1.00 79.52  ?  74  ALA B CB    1 
ATOM 571  N N     . GLU A 1 77  ? -25.080 -8.462  25.774  1.00 76.39  ?  75  GLU B N     1 
ATOM 572  C CA    . GLU A 1 77  ? -26.200 -9.296  26.197  1.00 74.95  ?  75  GLU B CA    1 
ATOM 573  C C     . GLU A 1 77  ? -26.734 -8.712  27.500  1.00 74.07  ?  75  GLU B C     1 
ATOM 574  O O     . GLU A 1 77  ? -26.240 -9.034  28.584  1.00 74.75  ?  75  GLU B O     1 
ATOM 575  C CB    . GLU A 1 77  ? -25.775 -10.751 26.349  1.00 75.33  ?  75  GLU B CB    1 
ATOM 576  C CG    . GLU A 1 77  ? -25.280 -11.369 25.055  1.00 75.33  ?  75  GLU B CG    1 
ATOM 577  C CD    . GLU A 1 77  ? -26.405 -11.922 24.202  1.00 76.16  ?  75  GLU B CD    1 
ATOM 578  O OE1   . GLU A 1 77  ? -27.582 -11.657 24.520  1.00 77.57  ?  75  GLU B OE1   1 
ATOM 579  O OE2   . GLU A 1 77  ? -26.111 -12.621 23.211  1.00 75.35  -1 75  GLU B OE2   1 
ATOM 580  N N     . GLN A 1 78  ? -27.744 -7.852  27.392  1.00 71.48  ?  76  GLN B N     1 
ATOM 581  C CA    . GLN A 1 78  ? -28.282 -7.149  28.539  1.00 69.33  ?  76  GLN B CA    1 
ATOM 582  C C     . GLN A 1 78  ? -29.724 -7.587  28.790  1.00 68.52  ?  76  GLN B C     1 
ATOM 583  O O     . GLN A 1 78  ? -30.212 -8.548  28.178  1.00 67.09  ?  76  GLN B O     1 
ATOM 584  C CB    . GLN A 1 78  ? -28.169 -5.640  28.303  1.00 67.73  ?  76  GLN B CB    1 
ATOM 585  C CG    . GLN A 1 78  ? -26.958 -4.991  28.935  1.00 67.40  ?  76  GLN B CG    1 
ATOM 586  C CD    . GLN A 1 78  ? -25.658 -5.500  28.357  1.00 68.10  ?  76  GLN B CD    1 
ATOM 587  O OE1   . GLN A 1 78  ? -25.086 -6.471  28.847  1.00 69.95  ?  76  GLN B OE1   1 
ATOM 588  N NE2   . GLN A 1 78  ? -25.184 -4.846  27.305  1.00 67.20  ?  76  GLN B NE2   1 
ATOM 589  N N     . VAL A 1 79  ? -30.398 -6.889  29.697  1.00 68.90  ?  77  VAL B N     1 
ATOM 590  C CA    . VAL A 1 79  ? -31.703 -7.310  30.177  1.00 66.09  ?  77  VAL B CA    1 
ATOM 591  C C     . VAL A 1 79  ? -32.672 -6.134  30.250  1.00 62.87  ?  77  VAL B C     1 
ATOM 592  O O     . VAL A 1 79  ? -32.331 -5.062  30.747  1.00 59.66  ?  77  VAL B O     1 
ATOM 593  C CB    . VAL A 1 79  ? -31.571 -7.993  31.543  1.00 64.09  ?  77  VAL B CB    1 
ATOM 594  C CG1   . VAL A 1 79  ? -31.163 -9.444  31.365  1.00 61.58  ?  77  VAL B CG1   1 
ATOM 595  C CG2   . VAL A 1 79  ? -30.555 -7.254  32.399  1.00 62.59  ?  77  VAL B CG2   1 
ATOM 596  N N     . ARG A 1 96  ? -17.585 12.726  -5.192  1.00 70.52  ?  94  ARG B N     1 
ATOM 597  C CA    . ARG A 1 96  ? -16.207 12.461  -4.804  1.00 71.97  ?  94  ARG B CA    1 
ATOM 598  C C     . ARG A 1 96  ? -15.683 11.229  -5.534  1.00 76.96  ?  94  ARG B C     1 
ATOM 599  O O     . ARG A 1 96  ? -14.603 11.257  -6.122  1.00 79.98  ?  94  ARG B O     1 
ATOM 600  C CB    . ARG A 1 96  ? -16.102 12.287  -3.290  1.00 68.35  ?  94  ARG B CB    1 
ATOM 601  C CG    . ARG A 1 96  ? -14.741 12.631  -2.718  1.00 67.27  ?  94  ARG B CG    1 
ATOM 602  C CD    . ARG A 1 96  ? -14.871 13.268  -1.346  1.00 68.87  ?  94  ARG B CD    1 
ATOM 603  N NE    . ARG A 1 96  ? -15.799 14.397  -1.367  1.00 73.06  ?  94  ARG B NE    1 
ATOM 604  C CZ    . ARG A 1 96  ? -16.050 15.183  -0.326  1.00 76.81  ?  94  ARG B CZ    1 
ATOM 605  N NH1   . ARG A 1 96  ? -16.910 16.184  -0.442  1.00 77.95  ?  94  ARG B NH1   1 
ATOM 606  N NH2   . ARG A 1 96  ? -15.439 14.972  0.831   1.00 78.27  ?  94  ARG B NH2   1 
ATOM 607  N N     . ARG A 1 97  ? -16.455 10.149  -5.500  1.00 77.13  ?  95  ARG B N     1 
ATOM 608  C CA    . ARG A 1 97  ? -16.084 8.943   -6.220  1.00 75.49  ?  95  ARG B CA    1 
ATOM 609  C C     . ARG A 1 97  ? -16.504 9.063   -7.678  1.00 78.64  ?  95  ARG B C     1 
ATOM 610  O O     . ARG A 1 97  ? -17.505 9.706   -8.006  1.00 83.59  ?  95  ARG B O     1 
ATOM 611  C CB    . ARG A 1 97  ? -16.747 7.722   -5.582  1.00 70.41  ?  95  ARG B CB    1 
ATOM 612  C CG    . ARG A 1 97  ? -16.185 7.350   -4.220  1.00 66.59  ?  95  ARG B CG    1 
ATOM 613  C CD    . ARG A 1 97  ? -16.442 5.892   -3.869  1.00 61.87  ?  95  ARG B CD    1 
ATOM 614  N NE    . ARG A 1 97  ? -17.809 5.487   -4.190  1.00 59.98  ?  95  ARG B NE    1 
ATOM 615  C CZ    . ARG A 1 97  ? -18.133 4.625   -5.145  1.00 58.10  ?  95  ARG B CZ    1 
ATOM 616  N NH1   . ARG A 1 97  ? -17.191 4.066   -5.878  1.00 57.32  1  95  ARG B NH1   1 
ATOM 617  N NH2   . ARG A 1 97  ? -19.401 4.320   -5.368  1.00 58.42  ?  95  ARG B NH2   1 
ATOM 618  N N     . THR A 1 98  ? -15.736 8.429   -8.556  1.00 75.80  ?  96  THR B N     1 
ATOM 619  C CA    . THR A 1 98  ? -16.052 8.369   -9.976  1.00 75.28  ?  96  THR B CA    1 
ATOM 620  C C     . THR A 1 98  ? -16.434 6.941   -10.330 1.00 73.75  ?  96  THR B C     1 
ATOM 621  O O     . THR A 1 98  ? -15.623 6.025   -10.173 1.00 74.62  ?  96  THR B O     1 
ATOM 622  C CB    . THR A 1 98  ? -14.867 8.829   -10.820 1.00 76.12  ?  96  THR B CB    1 
ATOM 623  O OG1   . THR A 1 98  ? -14.554 10.189  -10.500 1.00 78.21  ?  96  THR B OG1   1 
ATOM 624  C CG2   . THR A 1 98  ? -15.203 8.725   -12.294 1.00 76.06  ?  96  THR B CG2   1 
ATOM 625  N N     . THR A 1 99  ? -17.647 6.760   -10.838 1.00 71.02  ?  97  THR B N     1 
ATOM 626  C CA    . THR A 1 99  ? -18.153 5.433   -11.151 1.00 66.50  ?  97  THR B CA    1 
ATOM 627  C C     . THR A 1 99  ? -17.710 5.024   -12.549 1.00 59.52  ?  97  THR B C     1 
ATOM 628  O O     . THR A 1 99  ? -17.789 5.809   -13.498 1.00 57.70  ?  97  THR B O     1 
ATOM 629  C CB    . THR A 1 99  ? -19.678 5.401   -11.031 1.00 70.35  ?  97  THR B CB    1 
ATOM 630  O OG1   . THR A 1 99  ? -20.040 5.272   -9.651  1.00 70.12  ?  97  THR B OG1   1 
ATOM 631  C CG2   . THR A 1 99  ? -20.264 4.230   -11.801 1.00 71.36  ?  97  THR B CG2   1 
ATOM 632  N N     . ILE A 1 100 ? -17.243 3.792   -12.664 1.00 56.65  ?  98  ILE B N     1 
ATOM 633  C CA    . ILE A 1 100 ? -16.726 3.244   -13.910 1.00 56.38  ?  98  ILE B CA    1 
ATOM 634  C C     . ILE A 1 100 ? -17.871 2.616   -14.690 1.00 61.01  ?  98  ILE B C     1 
ATOM 635  O O     . ILE A 1 100 ? -18.732 1.936   -14.122 1.00 60.48  ?  98  ILE B O     1 
ATOM 636  C CB    . ILE A 1 100 ? -15.604 2.231   -13.616 1.00 51.94  ?  98  ILE B CB    1 
ATOM 637  C CG1   . ILE A 1 100 ? -14.378 2.961   -13.065 1.00 50.75  ?  98  ILE B CG1   1 
ATOM 638  C CG2   . ILE A 1 100 ? -15.239 1.445   -14.849 1.00 50.00  ?  98  ILE B CG2   1 
ATOM 639  C CD1   . ILE A 1 100 ? -13.221 2.058   -12.740 1.00 49.08  ?  98  ILE B CD1   1 
ATOM 640  N N     . SER A 1 101 ? -17.885 2.856   -15.999 1.00 66.00  ?  99  SER B N     1 
ATOM 641  C CA    . SER A 1 101 ? -18.963 2.380   -16.855 1.00 71.50  ?  99  SER B CA    1 
ATOM 642  C C     . SER A 1 101 ? -19.065 0.860   -16.834 1.00 73.24  ?  99  SER B C     1 
ATOM 643  O O     . SER A 1 101 ? -18.083 0.150   -16.608 1.00 75.49  ?  99  SER B O     1 
ATOM 644  C CB    . SER A 1 101 ? -18.745 2.861   -18.289 1.00 74.45  ?  99  SER B CB    1 
ATOM 645  O OG    . SER A 1 101 ? -17.576 2.289   -18.842 1.00 75.37  ?  99  SER B OG    1 
ATOM 646  N N     . ILE A 1 102 ? -20.282 0.366   -17.074 1.00 56.82  ?  100 ILE B N     1 
ATOM 647  C CA    . ILE A 1 102 ? -20.519 -1.075  -17.109 1.00 59.66  ?  100 ILE B CA    1 
ATOM 648  C C     . ILE A 1 102 ? -19.701 -1.723  -18.218 1.00 61.77  ?  100 ILE B C     1 
ATOM 649  O O     . ILE A 1 102 ? -19.213 -2.850  -18.075 1.00 60.13  ?  100 ILE B O     1 
ATOM 650  C CB    . ILE A 1 102 ? -22.024 -1.359  -17.273 1.00 61.19  ?  100 ILE B CB    1 
ATOM 651  C CG1   . ILE A 1 102 ? -22.816 -0.756  -16.111 1.00 62.45  ?  100 ILE B CG1   1 
ATOM 652  C CG2   . ILE A 1 102 ? -22.283 -2.852  -17.399 1.00 59.32  ?  100 ILE B CG2   1 
ATOM 653  C CD1   . ILE A 1 102 ? -22.523 -1.395  -14.764 1.00 60.97  ?  100 ILE B CD1   1 
ATOM 654  N N     . ALA A 1 103 ? -19.536 -1.022  -19.339 1.00 61.65  ?  101 ALA B N     1 
ATOM 655  C CA    . ALA A 1 103 ? -18.754 -1.561  -20.444 1.00 61.37  ?  101 ALA B CA    1 
ATOM 656  C C     . ALA A 1 103 ? -17.279 -1.666  -20.090 1.00 59.85  ?  101 ALA B C     1 
ATOM 657  O O     . ALA A 1 103 ? -16.581 -2.547  -20.600 1.00 62.04  ?  101 ALA B O     1 
ATOM 658  C CB    . ALA A 1 103 ? -18.944 -0.702  -21.693 1.00 62.44  ?  101 ALA B CB    1 
ATOM 659  N N     . ALA A 1 104 ? -16.768 -0.744  -19.280 1.00 56.08  ?  102 ALA B N     1 
ATOM 660  C CA    . ALA A 1 104 ? -15.374 -0.840  -18.873 1.00 57.40  ?  102 ALA B CA    1 
ATOM 661  C C     . ALA A 1 104 ? -15.143 -2.005  -17.917 1.00 56.57  ?  102 ALA B C     1 
ATOM 662  O O     . ALA A 1 104 ? -14.134 -2.710  -18.027 1.00 59.42  ?  102 ALA B O     1 
ATOM 663  C CB    . ALA A 1 104 ? -14.925 0.472   -18.239 1.00 58.98  ?  102 ALA B CB    1 
ATOM 664  N N     . LYS A 1 105 ? -16.069 -2.232  -16.980 1.00 53.75  ?  103 LYS B N     1 
ATOM 665  C CA    . LYS A 1 105 ? -15.859 -3.280  -15.983 1.00 50.08  ?  103 LYS B CA    1 
ATOM 666  C C     . LYS A 1 105 ? -15.746 -4.663  -16.609 1.00 51.92  ?  103 LYS B C     1 
ATOM 667  O O     . LYS A 1 105 ? -14.853 -5.435  -16.243 1.00 52.96  ?  103 LYS B O     1 
ATOM 668  C CB    . LYS A 1 105 ? -16.976 -3.271  -14.939 1.00 47.17  ?  103 LYS B CB    1 
ATOM 669  C CG    . LYS A 1 105 ? -17.023 -2.030  -14.071 1.00 45.40  ?  103 LYS B CG    1 
ATOM 670  C CD    . LYS A 1 105 ? -17.959 -2.234  -12.894 1.00 43.59  ?  103 LYS B CD    1 
ATOM 671  C CE    . LYS A 1 105 ? -18.124 -0.964  -12.090 1.00 41.67  ?  103 LYS B CE    1 
ATOM 672  N NZ    . LYS A 1 105 ? -19.544 -0.546  -12.014 1.00 42.48  1  103 LYS B NZ    1 
ATOM 673  N N     . ASP A 1 106 ? -16.634 -5.008  -17.544 1.00 55.50  ?  104 ASP B N     1 
ATOM 674  C CA    . ASP A 1 106 ? -16.505 -6.321  -18.167 1.00 61.19  ?  104 ASP B CA    1 
ATOM 675  C C     . ASP A 1 106 ? -15.227 -6.411  -18.990 1.00 64.92  ?  104 ASP B C     1 
ATOM 676  O O     . ASP A 1 106 ? -14.633 -7.489  -19.098 1.00 72.24  ?  104 ASP B O     1 
ATOM 677  C CB    . ASP A 1 106 ? -17.741 -6.673  -19.005 1.00 64.90  ?  104 ASP B CB    1 
ATOM 678  C CG    . ASP A 1 106 ? -17.711 -6.081  -20.395 1.00 71.60  ?  104 ASP B CG    1 
ATOM 679  O OD1   . ASP A 1 106 ? -17.696 -4.848  -20.520 1.00 73.10  ?  104 ASP B OD1   1 
ATOM 680  O OD2   . ASP A 1 106 ? -17.696 -6.855  -21.371 1.00 77.72  -1 104 ASP B OD2   1 
ATOM 681  N N     . ALA A 1 107 ? -14.780 -5.294  -19.566 1.00 59.36  ?  105 ALA B N     1 
ATOM 682  C CA    . ALA A 1 107 ? -13.508 -5.292  -20.277 1.00 60.01  ?  105 ALA B CA    1 
ATOM 683  C C     . ALA A 1 107 ? -12.343 -5.458  -19.311 1.00 56.26  ?  105 ALA B C     1 
ATOM 684  O O     . ALA A 1 107 ? -11.452 -6.283  -19.536 1.00 58.28  ?  105 ALA B O     1 
ATOM 685  C CB    . ALA A 1 107 ? -13.357 -4.001  -21.078 1.00 63.42  ?  105 ALA B CB    1 
ATOM 686  N N     . LEU A 1 108 ? -12.334 -4.676  -18.229 1.00 50.45  ?  106 LEU B N     1 
ATOM 687  C CA    . LEU A 1 108 ? -11.274 -4.792  -17.232 1.00 44.43  ?  106 LEU B CA    1 
ATOM 688  C C     . LEU A 1 108 ? -11.237 -6.186  -16.624 1.00 44.34  ?  106 LEU B C     1 
ATOM 689  O O     . LEU A 1 108 ? -10.165 -6.784  -16.481 1.00 45.88  ?  106 LEU B O     1 
ATOM 690  C CB    . LEU A 1 108 ? -11.462 -3.738  -16.146 1.00 39.28  ?  106 LEU B CB    1 
ATOM 691  C CG    . LEU A 1 108 ? -11.229 -2.298  -16.579 1.00 38.78  ?  106 LEU B CG    1 
ATOM 692  C CD1   . LEU A 1 108 ? -11.746 -1.336  -15.535 1.00 36.31  ?  106 LEU B CD1   1 
ATOM 693  C CD2   . LEU A 1 108 ? -9.745  -2.093  -16.799 1.00 39.19  ?  106 LEU B CD2   1 
ATOM 694  N N     . GLU A 1 109 ? -12.400 -6.718  -16.247 1.00 44.12  ?  107 GLU B N     1 
ATOM 695  C CA    . GLU A 1 109 ? -12.448 -8.084  -15.739 1.00 45.10  ?  107 GLU B CA    1 
ATOM 696  C C     . GLU A 1 109 ? -12.005 -9.081  -16.798 1.00 49.07  ?  107 GLU B C     1 
ATOM 697  O O     . GLU A 1 109 ? -11.412 -10.115 -16.471 1.00 48.93  ?  107 GLU B O     1 
ATOM 698  C CB    . GLU A 1 109 ? -13.855 -8.413  -15.244 1.00 44.74  ?  107 GLU B CB    1 
ATOM 699  C CG    . GLU A 1 109 ? -14.023 -9.830  -14.727 1.00 47.58  ?  107 GLU B CG    1 
ATOM 700  C CD    . GLU A 1 109 ? -13.169 -10.127 -13.515 1.00 49.10  ?  107 GLU B CD    1 
ATOM 701  O OE1   . GLU A 1 109 ? -12.752 -9.175  -12.824 1.00 49.26  ?  107 GLU B OE1   1 
ATOM 702  O OE2   . GLU A 1 109 ? -12.906 -11.319 -13.255 1.00 50.87  -1 107 GLU B OE2   1 
ATOM 703  N N     . ARG A 1 110 ? -12.272 -8.785  -18.070 1.00 53.06  ?  108 ARG B N     1 
ATOM 704  C CA    . ARG A 1 110 ? -11.776 -9.636  -19.145 1.00 58.41  ?  108 ARG B CA    1 
ATOM 705  C C     . ARG A 1 110 ? -10.263 -9.532  -19.267 1.00 58.48  ?  108 ARG B C     1 
ATOM 706  O O     . ARG A 1 110 ? -9.581  -10.541 -19.469 1.00 62.02  ?  108 ARG B O     1 
ATOM 707  C CB    . ARG A 1 110 ? -12.464 -9.269  -20.457 1.00 64.89  ?  108 ARG B CB    1 
ATOM 708  C CG    . ARG A 1 110 ? -12.437 -10.358 -21.510 1.00 73.03  ?  108 ARG B CG    1 
ATOM 709  C CD    . ARG A 1 110 ? -13.728 -10.338 -22.307 1.00 77.72  ?  108 ARG B CD    1 
ATOM 710  N NE    . ARG A 1 110 ? -14.064 -8.996  -22.770 1.00 78.70  ?  108 ARG B NE    1 
ATOM 711  C CZ    . ARG A 1 110 ? -15.306 -8.544  -22.902 1.00 78.53  ?  108 ARG B CZ    1 
ATOM 712  N NH1   . ARG A 1 110 ? -16.334 -9.325  -22.598 1.00 78.23  1  108 ARG B NH1   1 
ATOM 713  N NH2   . ARG A 1 110 ? -15.520 -7.309  -23.332 1.00 78.66  ?  108 ARG B NH2   1 
ATOM 714  N N     . HIS A 1 111 ? -9.722  -8.318  -19.154 1.00 55.11  ?  109 HIS B N     1 
ATOM 715  C CA    . HIS A 1 111 ? -8.274  -8.162  -19.120 1.00 54.51  ?  109 HIS B CA    1 
ATOM 716  C C     . HIS A 1 111 ? -7.677  -8.788  -17.870 1.00 53.36  ?  109 HIS B C     1 
ATOM 717  O O     . HIS A 1 111 ? -6.524  -9.232  -17.891 1.00 55.69  ?  109 HIS B O     1 
ATOM 718  C CB    . HIS A 1 111 ? -7.891  -6.686  -19.196 1.00 52.22  ?  109 HIS B CB    1 
ATOM 719  C CG    . HIS A 1 111 ? -7.901  -6.128  -20.583 1.00 53.01  ?  109 HIS B CG    1 
ATOM 720  N ND1   . HIS A 1 111 ? -7.705  -4.790  -20.847 1.00 51.96  ?  109 HIS B ND1   1 
ATOM 721  C CD2   . HIS A 1 111 ? -8.067  -6.728  -21.785 1.00 55.32  ?  109 HIS B CD2   1 
ATOM 722  C CE1   . HIS A 1 111 ? -7.757  -4.589  -22.151 1.00 54.24  ?  109 HIS B CE1   1 
ATOM 723  N NE2   . HIS A 1 111 ? -7.976  -5.749  -22.743 1.00 56.47  ?  109 HIS B NE2   1 
ATOM 724  N N     . PHE A 1 112 ? -8.431  -8.820  -16.772 1.00 50.08  ?  110 PHE B N     1 
ATOM 725  C CA    . PHE A 1 112 ? -7.897  -9.399  -15.547 1.00 49.67  ?  110 PHE B CA    1 
ATOM 726  C C     . PHE A 1 112 ? -7.747  -10.908 -15.660 1.00 53.74  ?  110 PHE B C     1 
ATOM 727  O O     . PHE A 1 112 ? -6.852  -11.488 -15.038 1.00 54.41  ?  110 PHE B O     1 
ATOM 728  C CB    . PHE A 1 112 ? -8.780  -9.035  -14.358 1.00 44.61  ?  110 PHE B CB    1 
ATOM 729  C CG    . PHE A 1 112 ? -8.229  -9.489  -13.042 1.00 43.28  ?  110 PHE B CG    1 
ATOM 730  C CD1   . PHE A 1 112 ? -7.265  -8.747  -12.390 1.00 43.68  ?  110 PHE B CD1   1 
ATOM 731  C CD2   . PHE A 1 112 ? -8.686  -10.650 -12.450 1.00 43.69  ?  110 PHE B CD2   1 
ATOM 732  C CE1   . PHE A 1 112 ? -6.756  -9.164  -11.181 1.00 44.93  ?  110 PHE B CE1   1 
ATOM 733  C CE2   . PHE A 1 112 ? -8.184  -11.066 -11.240 1.00 44.39  ?  110 PHE B CE2   1 
ATOM 734  C CZ    . PHE A 1 112 ? -7.218  -10.323 -10.605 1.00 44.98  ?  110 PHE B CZ    1 
ATOM 735  N N     . GLY A 1 113 ? -8.605  -11.560 -16.443 1.00 56.88  ?  111 GLY B N     1 
ATOM 736  C CA    . GLY A 1 113 ? -8.477  -12.993 -16.626 1.00 62.28  ?  111 GLY B CA    1 
ATOM 737  C C     . GLY A 1 113 ? -7.225  -13.413 -17.364 1.00 67.90  ?  111 GLY B C     1 
ATOM 738  O O     . GLY A 1 113 ? -6.764  -14.544 -17.182 1.00 70.75  ?  111 GLY B O     1 
ATOM 739  N N     . GLU A 1 114 ? -6.666  -12.535 -18.195 1.00 69.89  ?  112 GLU B N     1 
ATOM 740  C CA    . GLU A 1 114 ? -5.459  -12.860 -18.944 1.00 72.68  ?  112 GLU B CA    1 
ATOM 741  C C     . GLU A 1 114 ? -4.187  -12.335 -18.299 1.00 71.44  ?  112 GLU B C     1 
ATOM 742  O O     . GLU A 1 114 ? -3.102  -12.837 -18.606 1.00 72.80  ?  112 GLU B O     1 
ATOM 743  C CB    . GLU A 1 114 ? -5.556  -12.319 -20.376 1.00 74.21  ?  112 GLU B CB    1 
ATOM 744  C CG    . GLU A 1 114 ? -5.594  -10.807 -20.477 1.00 73.24  ?  112 GLU B CG    1 
ATOM 745  C CD    . GLU A 1 114 ? -6.100  -10.323 -21.821 1.00 76.94  ?  112 GLU B CD    1 
ATOM 746  O OE1   . GLU A 1 114 ? -6.615  -11.152 -22.598 1.00 79.69  ?  112 GLU B OE1   1 
ATOM 747  O OE2   . GLU A 1 114 ? -5.983  -9.114  -22.101 1.00 77.17  -1 112 GLU B OE2   1 
ATOM 748  N N     . GLN A 1 115 ? -4.287  -11.351 -17.405 1.00 69.89  ?  113 GLN B N     1 
ATOM 749  C CA    . GLN A 1 115 ? -3.103  -10.795 -16.751 1.00 71.47  ?  113 GLN B CA    1 
ATOM 750  C C     . GLN A 1 115 ? -3.541  -10.168 -15.430 1.00 67.37  ?  113 GLN B C     1 
ATOM 751  O O     . GLN A 1 115 ? -4.019  -9.031  -15.408 1.00 63.94  ?  113 GLN B O     1 
ATOM 752  C CB    . GLN A 1 115 ? -2.404  -9.779  -17.642 1.00 74.06  ?  113 GLN B CB    1 
ATOM 753  C CG    . GLN A 1 115 ? -1.133  -9.207  -17.042 1.00 74.74  ?  113 GLN B CG    1 
ATOM 754  C CD    . GLN A 1 115 ? -0.057  -10.254 -16.843 1.00 78.46  ?  113 GLN B CD    1 
ATOM 755  O OE1   . GLN A 1 115 ? -0.086  -11.019 -15.879 1.00 77.67  ?  113 GLN B OE1   1 
ATOM 756  N NE2   . GLN A 1 115 ? 0.903   -10.293 -17.758 1.00 82.54  ?  113 GLN B NE2   1 
ATOM 757  N N     . ASN A 1 116 ? -3.384  -10.925 -14.344 1.00 67.53  ?  114 ASN B N     1 
ATOM 758  C CA    . ASN A 1 116 ? -3.720  -10.419 -13.018 1.00 63.71  ?  114 ASN B CA    1 
ATOM 759  C C     . ASN A 1 116 ? -2.882  -9.195  -12.669 1.00 61.30  ?  114 ASN B C     1 
ATOM 760  O O     . ASN A 1 116 ? -3.411  -8.177  -12.209 1.00 58.71  ?  114 ASN B O     1 
ATOM 761  C CB    . ASN A 1 116 ? -3.532  -11.524 -11.980 1.00 65.57  ?  114 ASN B CB    1 
ATOM 762  C CG    . ASN A 1 116 ? -4.407  -12.729 -12.253 1.00 68.11  ?  114 ASN B CG    1 
ATOM 763  O OD1   . ASN A 1 116 ? -4.998  -12.849 -13.324 1.00 70.61  ?  114 ASN B OD1   1 
ATOM 764  N ND2   . ASN A 1 116 ? -4.491  -13.633 -11.285 1.00 67.38  ?  114 ASN B ND2   1 
ATOM 765  N N     . LYS A 1 117 ? -1.568  -9.289  -12.846 1.00 61.86  ?  115 LYS B N     1 
ATOM 766  C CA    . LYS A 1 117 ? -0.660  -8.181  -12.579 1.00 58.52  ?  115 LYS B CA    1 
ATOM 767  C C     . LYS A 1 117 ? -0.198  -7.534  -13.878 1.00 59.95  ?  115 LYS B C     1 
ATOM 768  O O     . LYS A 1 117 ? 0.831   -7.936  -14.436 1.00 64.51  ?  115 LYS B O     1 
ATOM 769  C CB    . LYS A 1 117 ? 0.553   -8.655  -11.778 1.00 57.13  ?  115 LYS B CB    1 
ATOM 770  C CG    . LYS A 1 117 ? 0.212   -9.374  -10.487 1.00 52.87  ?  115 LYS B CG    1 
ATOM 771  C CD    . LYS A 1 117 ? 1.354   -9.288  -9.494  1.00 50.98  ?  115 LYS B CD    1 
ATOM 772  C CE    . LYS A 1 117 ? 1.781   -7.847  -9.270  1.00 48.91  ?  115 LYS B CE    1 
ATOM 773  N N     . PRO A 1 118 ? -0.913  -6.538  -14.389 1.00 56.14  ?  116 PRO B N     1 
ATOM 774  C CA    . PRO A 1 118 ? -0.491  -5.888  -15.629 1.00 56.66  ?  116 PRO B CA    1 
ATOM 775  C C     . PRO A 1 118 ? 0.636   -4.898  -15.383 1.00 55.83  ?  116 PRO B C     1 
ATOM 776  O O     . PRO A 1 118 ? 0.816   -4.370  -14.286 1.00 53.67  ?  116 PRO B O     1 
ATOM 777  C CB    . PRO A 1 118 ? -1.763  -5.180  -16.097 1.00 55.93  ?  116 PRO B CB    1 
ATOM 778  C CG    . PRO A 1 118 ? -2.446  -4.824  -14.835 1.00 54.11  ?  116 PRO B CG    1 
ATOM 779  C CD    . PRO A 1 118 ? -2.111  -5.898  -13.824 1.00 54.12  ?  116 PRO B CD    1 
ATOM 780  N N     . SER A 1 119 ? 1.407   -4.662  -16.439 1.00 56.60  ?  117 SER B N     1 
ATOM 781  C CA    . SER A 1 119 ? 2.564   -3.791  -16.336 1.00 54.25  ?  117 SER B CA    1 
ATOM 782  C C     . SER A 1 119 ? 2.140   -2.334  -16.193 1.00 53.52  ?  117 SER B C     1 
ATOM 783  O O     . SER A 1 119 ? 0.989   -1.966  -16.435 1.00 54.18  ?  117 SER B O     1 
ATOM 784  C CB    . SER A 1 119 ? 3.457   -3.947  -17.564 1.00 53.88  ?  117 SER B CB    1 
ATOM 785  O OG    . SER A 1 119 ? 2.851   -3.358  -18.699 1.00 51.92  ?  117 SER B OG    1 
ATOM 786  N N     . SER A 1 120 ? 3.097   -1.499  -15.784 1.00 53.61  ?  118 SER B N     1 
ATOM 787  C CA    . SER A 1 120 ? 2.846   -0.066  -15.710 1.00 53.66  ?  118 SER B CA    1 
ATOM 788  C C     . SER A 1 120 ? 2.542   0.524   -17.077 1.00 57.26  ?  118 SER B C     1 
ATOM 789  O O     . SER A 1 120 ? 1.890   1.569   -17.159 1.00 56.52  ?  118 SER B O     1 
ATOM 790  C CB    . SER A 1 120 ? 4.042   0.649   -15.087 1.00 55.77  ?  118 SER B CB    1 
ATOM 791  O OG    . SER A 1 120 ? 3.709   1.979   -14.739 1.00 55.07  ?  118 SER B OG    1 
ATOM 792  N N     . GLN A 1 121 ? 3.004   -0.119  -18.147 1.00 61.37  ?  119 GLN B N     1 
ATOM 793  C CA    . GLN A 1 121 ? 2.718   0.321   -19.505 1.00 64.67  ?  119 GLN B CA    1 
ATOM 794  C C     . GLN A 1 121 ? 1.402   -0.246  -20.017 1.00 65.03  ?  119 GLN B C     1 
ATOM 795  O O     . GLN A 1 121 ? 0.652   0.455   -20.703 1.00 65.13  ?  119 GLN B O     1 
ATOM 796  C CB    . GLN A 1 121 ? 3.858   -0.084  -20.442 1.00 69.91  ?  119 GLN B CB    1 
ATOM 797  N N     . GLU A 1 122 ? 1.113   -1.512  -19.705 1.00 66.33  ?  120 GLU B N     1 
ATOM 798  C CA    . GLU A 1 122 ? -0.182  -2.079  -20.063 1.00 64.89  ?  120 GLU B CA    1 
ATOM 799  C C     . GLU A 1 122 ? -1.322  -1.323  -19.400 1.00 61.13  ?  120 GLU B C     1 
ATOM 800  O O     . GLU A 1 122 ? -2.405  -1.208  -19.979 1.00 59.97  ?  120 GLU B O     1 
ATOM 801  C CB    . GLU A 1 122 ? -0.242  -3.558  -19.682 1.00 65.50  ?  120 GLU B CB    1 
ATOM 802  C CG    . GLU A 1 122 ? 0.450   -4.489  -20.661 1.00 71.03  ?  120 GLU B CG    1 
ATOM 803  C CD    . GLU A 1 122 ? -0.174  -5.871  -20.689 1.00 74.82  ?  120 GLU B CD    1 
ATOM 804  O OE1   . GLU A 1 122 ? -1.416  -5.963  -20.627 1.00 74.74  ?  120 GLU B OE1   1 
ATOM 805  O OE2   . GLU A 1 122 ? 0.575   -6.865  -20.773 1.00 78.24  -1 120 GLU B OE2   1 
ATOM 806  N N     . ILE A 1 123 ? -1.101  -0.800  -18.194 1.00 60.23  ?  121 ILE B N     1 
ATOM 807  C CA    . ILE A 1 123 ? -2.144  -0.040  -17.515 1.00 62.11  ?  121 ILE B CA    1 
ATOM 808  C C     . ILE A 1 123 ? -2.441  1.253   -18.261 1.00 66.68  ?  121 ILE B C     1 
ATOM 809  O O     . ILE A 1 123 ? -3.605  1.636   -18.425 1.00 70.59  ?  121 ILE B O     1 
ATOM 810  C CB    . ILE A 1 123 ? -1.742  0.225   -16.054 1.00 63.40  ?  121 ILE B CB    1 
ATOM 811  C CG1   . ILE A 1 123 ? -1.857  -1.057  -15.231 1.00 64.20  ?  121 ILE B CG1   1 
ATOM 812  C CG2   . ILE A 1 123 ? -2.593  1.326   -15.453 1.00 31.24  ?  121 ILE B CG2   1 
ATOM 813  C CD1   . ILE A 1 123 ? -1.265  -0.946  -13.852 1.00 32.08  ?  121 ILE B CD1   1 
ATOM 814  N N     . MET A 1 124 ? -1.404  1.943   -18.734 1.00 66.70  ?  122 MET B N     1 
ATOM 815  C CA    . MET A 1 124 ? -1.638  3.169   -19.489 1.00 66.94  ?  122 MET B CA    1 
ATOM 816  C C     . MET A 1 124 ? -2.204  2.874   -20.869 1.00 66.15  ?  122 MET B C     1 
ATOM 817  O O     . MET A 1 124 ? -2.971  3.678   -21.409 1.00 64.70  ?  122 MET B O     1 
ATOM 818  C CB    . MET A 1 124 ? -0.352  3.984   -19.589 1.00 70.78  ?  122 MET B CB    1 
ATOM 819  C CG    . MET A 1 124 ? -0.161  4.932   -18.420 1.00 73.11  ?  122 MET B CG    1 
ATOM 820  S SD    . MET A 1 124 ? 1.519   5.554   -18.271 1.00 81.13  ?  122 MET B SD    1 
ATOM 821  C CE    . MET A 1 124 ? 1.502   6.839   -19.515 1.00 82.48  ?  122 MET B CE    1 
ATOM 822  N N     . ARG A 1 125 ? -1.837  1.735   -21.455 1.00 65.98  ?  123 ARG B N     1 
ATOM 823  C CA    . ARG A 1 125 ? -2.367  1.373   -22.763 1.00 64.60  ?  123 ARG B CA    1 
ATOM 824  C C     . ARG A 1 125 ? -3.858  1.077   -22.692 1.00 61.19  ?  123 ARG B C     1 
ATOM 825  O O     . ARG A 1 125 ? -4.608  1.416   -23.612 1.00 63.20  ?  123 ARG B O     1 
ATOM 826  C CB    . ARG A 1 125 ? -1.601  0.168   -23.309 1.00 65.70  ?  123 ARG B CB    1 
ATOM 827  C CG    . ARG A 1 125 ? -2.421  -0.773  -24.167 1.00 65.73  ?  123 ARG B CG    1 
ATOM 828  C CD    . ARG A 1 125 ? -2.304  -0.427  -25.636 1.00 68.20  ?  123 ARG B CD    1 
ATOM 829  N NE    . ARG A 1 125 ? -0.917  -0.222  -26.034 1.00 71.65  ?  123 ARG B NE    1 
ATOM 830  C CZ    . ARG A 1 125 ? -0.527  0.008   -27.281 1.00 75.72  ?  123 ARG B CZ    1 
ATOM 831  N NH1   . ARG A 1 125 ? -1.423  0.061   -28.256 1.00 76.66  ?  123 ARG B NH1   1 
ATOM 832  N NH2   . ARG A 1 125 ? 0.759   0.180   -27.554 1.00 78.33  ?  123 ARG B NH2   1 
ATOM 833  N N     . MET A 1 126 ? -4.314  0.478   -21.592 1.00 57.87  ?  124 MET B N     1 
ATOM 834  C CA    . MET A 1 126 ? -5.735  0.186   -21.442 1.00 56.25  ?  124 MET B CA    1 
ATOM 835  C C     . MET A 1 126 ? -6.499  1.400   -20.933 1.00 53.60  ?  124 MET B C     1 
ATOM 836  O O     . MET A 1 126 ? -7.649  1.617   -21.324 1.00 53.63  ?  124 MET B O     1 
ATOM 837  C CB    . MET A 1 126 ? -5.936  -1.022  -20.527 1.00 55.58  ?  124 MET B CB    1 
ATOM 838  C CG    . MET A 1 126 ? -5.330  -0.892  -19.155 1.00 57.82  ?  124 MET B CG    1 
ATOM 839  S SD    . MET A 1 126 ? -5.687  -2.320  -18.124 1.00 61.37  ?  124 MET B SD    1 
ATOM 840  C CE    . MET A 1 126 ? -4.738  -3.586  -18.956 1.00 62.77  ?  124 MET B CE    1 
ATOM 841  N N     . ALA A 1 127 ? -5.883  2.190   -20.051 1.00 48.96  ?  125 ALA B N     1 
ATOM 842  C CA    . ALA A 1 127 ? -6.514  3.419   -19.583 1.00 49.73  ?  125 ALA B CA    1 
ATOM 843  C C     . ALA A 1 127 ? -6.904  4.322   -20.745 1.00 51.44  ?  125 ALA B C     1 
ATOM 844  O O     . ALA A 1 127 ? -7.924  5.016   -20.686 1.00 31.75  ?  125 ALA B O     1 
ATOM 845  C CB    . ALA A 1 127 ? -5.577  4.156   -18.629 1.00 52.57  ?  125 ALA B CB    1 
ATOM 846  N N     . GLU A 1 128 ? -6.102  4.329   -21.810 1.00 53.16  ?  126 GLU B N     1 
ATOM 847  C CA    . GLU A 1 128 ? -6.434  5.108   -22.997 1.00 51.92  ?  126 GLU B CA    1 
ATOM 848  C C     . GLU A 1 128 ? -7.526  4.434   -23.819 1.00 49.93  ?  126 GLU B C     1 
ATOM 849  O O     . GLU A 1 128 ? -8.368  5.116   -24.413 1.00 37.64  ?  126 GLU B O     1 
ATOM 850  C CB    . GLU A 1 128 ? -5.184  5.332   -23.846 1.00 55.01  ?  126 GLU B CB    1 
ATOM 851  N N     . GLU A 1 129 ? -7.521  3.101   -23.875 1.00 51.15  ?  127 GLU B N     1 
ATOM 852  C CA    . GLU A 1 129 ? -8.561  2.387   -24.607 1.00 54.54  ?  127 GLU B CA    1 
ATOM 853  C C     . GLU A 1 129 ? -9.931  2.607   -23.983 1.00 50.09  ?  127 GLU B C     1 
ATOM 854  O O     . GLU A 1 129 ? -10.947 2.545   -24.681 1.00 48.25  ?  127 GLU B O     1 
ATOM 855  C CB    . GLU A 1 129 ? -8.246  0.893   -24.651 1.00 60.59  ?  127 GLU B CB    1 
ATOM 856  C CG    . GLU A 1 129 ? -6.995  0.522   -25.427 1.00 68.24  ?  127 GLU B CG    1 
ATOM 857  C CD    . GLU A 1 129 ? -6.700  -0.964  -25.367 1.00 72.81  ?  127 GLU B CD    1 
ATOM 858  O OE1   . GLU A 1 129 ? -7.623  -1.739  -25.041 1.00 73.17  ?  127 GLU B OE1   1 
ATOM 859  O OE2   . GLU A 1 129 ? -5.547  -1.358  -25.636 1.00 75.38  ?  127 GLU B OE2   1 
ATOM 860  N N     . LEU A 1 130 ? -9.980  2.855   -22.675 1.00 49.07  ?  128 LEU B N     1 
ATOM 861  C CA    . LEU A 1 130 ? -11.235 3.047   -21.967 1.00 47.30  ?  128 LEU B CA    1 
ATOM 862  C C     . LEU A 1 130 ? -11.515 4.496   -21.605 1.00 47.76  ?  128 LEU B C     1 
ATOM 863  O O     . LEU A 1 130 ? -12.586 4.778   -21.058 1.00 48.73  ?  128 LEU B O     1 
ATOM 864  C CB    . LEU A 1 130 ? -11.257 2.210   -20.681 1.00 44.24  ?  128 LEU B CB    1 
ATOM 865  C CG    . LEU A 1 130 ? -10.662 0.806   -20.723 1.00 46.57  ?  128 LEU B CG    1 
ATOM 866  C CD1   . LEU A 1 130 ? -10.624 0.235   -19.328 1.00 44.62  ?  128 LEU B CD1   1 
ATOM 867  C CD2   . LEU A 1 130 ? -11.457 -0.093  -21.641 1.00 50.35  ?  128 LEU B CD2   1 
ATOM 868  N N     . ASN A 1 131 ? -10.586 5.412   -21.880 1.00 44.81  ?  129 ASN B N     1 
ATOM 869  C CA    . ASN A 1 131 ? -10.758 6.833   -21.576 1.00 44.04  ?  129 ASN B CA    1 
ATOM 870  C C     . ASN A 1 131 ? -10.906 7.048   -20.071 1.00 40.64  ?  129 ASN B C     1 
ATOM 871  O O     . ASN A 1 131 ? -11.825 7.718   -19.598 1.00 39.70  ?  129 ASN B O     1 
ATOM 872  C CB    . ASN A 1 131 ? -11.937 7.433   -22.343 1.00 46.89  ?  129 ASN B CB    1 
ATOM 873  C CG    . ASN A 1 131 ? -11.976 8.942   -22.260 1.00 49.37  ?  129 ASN B CG    1 
ATOM 874  O OD1   . ASN A 1 131 ? -10.961 9.585   -21.998 1.00 50.28  ?  129 ASN B OD1   1 
ATOM 875  N ND2   . ASN A 1 131 ? -13.151 9.516   -22.475 1.00 50.02  ?  129 ASN B ND2   1 
ATOM 876  N N     . LEU A 1 132 ? -9.983  6.464   -19.315 1.00 39.49  ?  130 LEU B N     1 
ATOM 877  C CA    . LEU A 1 132 ? -9.946  6.607   -17.870 1.00 35.51  ?  130 LEU B CA    1 
ATOM 878  C C     . LEU A 1 132 ? -8.566  7.084   -17.452 1.00 30.71  ?  130 LEU B C     1 
ATOM 879  O O     . LEU A 1 132 ? -7.594  6.968   -18.199 1.00 30.09  ?  130 LEU B O     1 
ATOM 880  C CB    . LEU A 1 132 ? -10.279 5.287   -17.161 1.00 35.59  ?  130 LEU B CB    1 
ATOM 881  C CG    . LEU A 1 132 ? -11.727 4.804   -17.205 1.00 34.89  ?  130 LEU B CG    1 
ATOM 882  C CD1   . LEU A 1 132 ? -11.810 3.344   -16.813 1.00 33.79  ?  130 LEU B CD1   1 
ATOM 883  C CD2   . LEU A 1 132 ? -12.590 5.648   -16.293 1.00 33.39  ?  130 LEU B CD2   1 
ATOM 884  N N     . GLU A 1 133 ? -8.493  7.636   -16.247 1.00 30.18  ?  131 GLU B N     1 
ATOM 885  C CA    . GLU A 1 133 ? -7.210  8.052   -15.710 1.00 35.55  ?  131 GLU B CA    1 
ATOM 886  C C     . GLU A 1 133 ? -6.341  6.833   -15.419 1.00 40.18  ?  131 GLU B C     1 
ATOM 887  O O     . GLU A 1 133 ? -6.828  5.713   -15.253 1.00 42.29  ?  131 GLU B O     1 
ATOM 888  C CB    . GLU A 1 133 ? -7.400  8.888   -14.446 1.00 34.28  ?  131 GLU B CB    1 
ATOM 889  C CG    . GLU A 1 133 ? -7.914  10.293  -14.704 1.00 27.06  ?  131 GLU B CG    1 
ATOM 890  N N     . LYS A 1 134 ? -5.028  7.058   -15.397 1.00 40.61  ?  132 LYS B N     1 
ATOM 891  C CA    . LYS A 1 134 ? -4.101  5.958   -15.161 1.00 40.99  ?  132 LYS B CA    1 
ATOM 892  C C     . LYS A 1 134 ? -4.271  5.376   -13.765 1.00 37.99  ?  132 LYS B C     1 
ATOM 893  O O     . LYS A 1 134 ? -4.214  4.155   -13.585 1.00 36.82  ?  132 LYS B O     1 
ATOM 894  C CB    . LYS A 1 134 ? -2.664  6.429   -15.375 1.00 44.90  ?  132 LYS B CB    1 
ATOM 895  N N     . GLU A 1 135 ? -4.462  6.233   -12.762 1.00 37.81  ?  133 GLU B N     1 
ATOM 896  C CA    . GLU A 1 135 ? -4.577  5.756   -11.388 1.00 39.27  ?  133 GLU B CA    1 
ATOM 897  C C     . GLU A 1 135 ? -5.828  4.912   -11.174 1.00 36.76  ?  133 GLU B C     1 
ATOM 898  O O     . GLU A 1 135 ? -5.764  3.861   -10.528 1.00 34.90  ?  133 GLU B O     1 
ATOM 899  C CB    . GLU A 1 135 ? -4.551  6.937   -10.420 1.00 42.83  ?  133 GLU B CB    1 
ATOM 900  C CG    . GLU A 1 135 ? -3.155  7.298   -9.942  1.00 48.82  ?  133 GLU B CG    1 
ATOM 901  C CD    . GLU A 1 135 ? -2.669  6.386   -8.833  1.00 52.02  ?  133 GLU B CD    1 
ATOM 902  O OE1   . GLU A 1 135 ? -3.258  6.423   -7.733  1.00 51.61  ?  133 GLU B OE1   1 
ATOM 903  O OE2   . GLU A 1 135 ? -1.707  5.625   -9.063  1.00 54.41  -1 133 GLU B OE2   1 
ATOM 904  N N     . VAL A 1 136 ? -6.977  5.352   -11.692 1.00 37.29  ?  134 VAL B N     1 
ATOM 905  C CA    . VAL A 1 136 ? -8.220  4.622   -11.446 1.00 36.78  ?  134 VAL B CA    1 
ATOM 906  C C     . VAL A 1 136 ? -8.131  3.201   -11.992 1.00 39.25  ?  134 VAL B C     1 
ATOM 907  O O     . VAL A 1 136 ? -8.640  2.256   -11.380 1.00 38.93  ?  134 VAL B O     1 
ATOM 908  C CB    . VAL A 1 136 ? -9.426  5.393   -12.017 1.00 34.27  ?  134 VAL B CB    1 
ATOM 909  C CG1   . VAL A 1 136 ? -9.427  6.820   -11.503 1.00 34.08  ?  134 VAL B CG1   1 
ATOM 910  C CG2   . VAL A 1 136 ? -9.425  5.380   -13.522 1.00 36.10  ?  134 VAL B CG2   1 
ATOM 911  N N     . VAL A 1 137 ? -7.488  3.023   -13.147 1.00 39.35  ?  135 VAL B N     1 
ATOM 912  C CA    . VAL A 1 137 ? -7.318  1.677   -13.679 1.00 41.30  ?  135 VAL B CA    1 
ATOM 913  C C     . VAL A 1 137 ? -6.281  0.922   -12.864 1.00 43.61  ?  135 VAL B C     1 
ATOM 914  O O     . VAL A 1 137 ? -6.400  -0.291  -12.659 1.00 44.69  ?  135 VAL B O     1 
ATOM 915  C CB    . VAL A 1 137 ? -6.937  1.733   -15.167 1.00 25.30  ?  135 VAL B CB    1 
ATOM 916  C CG1   . VAL A 1 137 ? -6.860  0.339   -15.746 1.00 26.20  ?  135 VAL B CG1   1 
ATOM 917  C CG2   . VAL A 1 137 ? -7.930  2.575   -15.929 1.00 38.06  ?  135 VAL B CG2   1 
ATOM 918  N N     . ARG A 1 138 ? -5.251  1.624   -12.390 1.00 43.34  ?  136 ARG B N     1 
ATOM 919  C CA    . ARG A 1 138 ? -4.230  1.000   -11.557 1.00 39.55  ?  136 ARG B CA    1 
ATOM 920  C C     . ARG A 1 138 ? -4.825  0.501   -10.249 1.00 34.08  ?  136 ARG B C     1 
ATOM 921  O O     . ARG A 1 138 ? -4.613  -0.651  -9.856  1.00 23.28  ?  136 ARG B O     1 
ATOM 922  C CB    . ARG A 1 138 ? -3.105  1.999   -11.295 1.00 39.24  ?  136 ARG B CB    1 
ATOM 923  C CG    . ARG A 1 138 ? -1.864  1.407   -10.672 1.00 28.02  ?  136 ARG B CG    1 
ATOM 924  C CD    . ARG A 1 138 ? -0.928  2.505   -10.223 1.00 41.27  ?  136 ARG B CD    1 
ATOM 925  N NE    . ARG A 1 138 ? -1.389  3.138   -8.994  1.00 38.95  ?  136 ARG B NE    1 
ATOM 926  C CZ    . ARG A 1 138 ? -1.364  2.551   -7.805  1.00 27.47  ?  136 ARG B CZ    1 
ATOM 927  N NH1   . ARG A 1 138 ? -0.905  1.315   -7.689  1.00 27.98  1  136 ARG B NH1   1 
ATOM 928  N NH2   . ARG A 1 138 ? -1.800  3.195   -6.735  1.00 26.55  ?  136 ARG B NH2   1 
ATOM 929  N N     . VAL A 1 139 ? -5.561  1.368   -9.552  1.00 30.97  ?  137 VAL B N     1 
ATOM 930  C CA    . VAL A 1 139 ? -6.191  0.983   -8.294  1.00 29.25  ?  137 VAL B CA    1 
ATOM 931  C C     . VAL A 1 139 ? -7.229  -0.108  -8.514  1.00 29.98  ?  137 VAL B C     1 
ATOM 932  O O     . VAL A 1 139 ? -7.442  -0.956  -7.640  1.00 27.88  ?  137 VAL B O     1 
ATOM 933  C CB    . VAL A 1 139 ? -6.809  2.220   -7.618  1.00 26.67  ?  137 VAL B CB    1 
ATOM 934  C CG1   . VAL A 1 139 ? -7.407  1.852   -6.278  1.00 18.22  ?  137 VAL B CG1   1 
ATOM 935  C CG2   . VAL A 1 139 ? -5.764  3.296   -7.447  1.00 27.78  ?  137 VAL B CG2   1 
ATOM 936  N N     . TRP A 1 140 ? -7.888  -0.109  -9.674  1.00 30.37  ?  138 TRP B N     1 
ATOM 937  C CA    . TRP A 1 140 ? -8.878  -1.141  -9.962  1.00 29.09  ?  138 TRP B CA    1 
ATOM 938  C C     . TRP A 1 140 ? -8.261  -2.529  -9.864  1.00 30.90  ?  138 TRP B C     1 
ATOM 939  O O     . TRP A 1 140 ? -8.782  -3.404  -9.166  1.00 32.63  ?  138 TRP B O     1 
ATOM 940  C CB    . TRP A 1 140 ? -9.477  -0.921  -11.350 1.00 29.94  ?  138 TRP B CB    1 
ATOM 941  C CG    . TRP A 1 140 ? -10.696 -1.750  -11.615 1.00 30.98  ?  138 TRP B CG    1 
ATOM 942  C CD1   . TRP A 1 140 ? -11.993 -1.366  -11.455 1.00 30.17  ?  138 TRP B CD1   1 
ATOM 943  C CD2   . TRP A 1 140 ? -10.735 -3.108  -12.067 1.00 32.05  ?  138 TRP B CD2   1 
ATOM 944  N NE1   . TRP A 1 140 ? -12.836 -2.393  -11.790 1.00 31.14  ?  138 TRP B NE1   1 
ATOM 945  C CE2   . TRP A 1 140 ? -12.088 -3.475  -12.167 1.00 32.65  ?  138 TRP B CE2   1 
ATOM 946  C CE3   . TRP A 1 140 ? -9.757  -4.047  -12.399 1.00 32.18  ?  138 TRP B CE3   1 
ATOM 947  C CZ2   . TRP A 1 140 ? -12.487 -4.737  -12.585 1.00 34.42  ?  138 TRP B CZ2   1 
ATOM 948  C CZ3   . TRP A 1 140 ? -10.156 -5.298  -12.812 1.00 32.77  ?  138 TRP B CZ3   1 
ATOM 949  C CH2   . TRP A 1 140 ? -11.506 -5.633  -12.902 1.00 34.55  ?  138 TRP B CH2   1 
ATOM 950  N N     . PHE A 1 141 ? -7.144  -2.746  -10.559 1.00 32.55  ?  139 PHE B N     1 
ATOM 951  C CA    . PHE A 1 141 ? -6.474  -4.039  -10.495 1.00 35.48  ?  139 PHE B CA    1 
ATOM 952  C C     . PHE A 1 141 ? -5.981  -4.350  -9.091  1.00 38.49  ?  139 PHE B C     1 
ATOM 953  O O     . PHE A 1 141 ? -5.968  -5.517  -8.685  1.00 40.55  ?  139 PHE B O     1 
ATOM 954  C CB    . PHE A 1 141 ? -5.317  -4.078  -11.488 1.00 36.71  ?  139 PHE B CB    1 
ATOM 955  C CG    . PHE A 1 141 ? -5.747  -4.347  -12.894 1.00 36.32  ?  139 PHE B CG    1 
ATOM 956  C CD1   . PHE A 1 141 ? -5.904  -5.644  -13.345 1.00 36.63  ?  139 PHE B CD1   1 
ATOM 957  C CD2   . PHE A 1 141 ? -6.002  -3.308  -13.762 1.00 34.75  ?  139 PHE B CD2   1 
ATOM 958  C CE1   . PHE A 1 141 ? -6.303  -5.894  -14.635 1.00 36.82  ?  139 PHE B CE1   1 
ATOM 959  C CE2   . PHE A 1 141 ? -6.402  -3.556  -15.048 1.00 34.89  ?  139 PHE B CE2   1 
ATOM 960  C CZ    . PHE A 1 141 ? -6.550  -4.850  -15.487 1.00 36.31  ?  139 PHE B CZ    1 
ATOM 961  N N     . CYS A 1 142 ? -5.557  -3.331  -8.344  1.00 38.62  ?  140 CYS B N     1 
ATOM 962  C CA    . CYS A 1 142 ? -5.170  -3.542  -6.956  1.00 38.50  ?  140 CYS B CA    1 
ATOM 963  C C     . CYS A 1 142 ? -6.339  -4.094  -6.152  1.00 34.39  ?  140 CYS B C     1 
ATOM 964  O O     . CYS A 1 142 ? -6.241  -5.159  -5.533  1.00 34.37  ?  140 CYS B O     1 
ATOM 965  C CB    . CYS A 1 142 ? -4.662  -2.235  -6.349  1.00 41.08  ?  140 CYS B CB    1 
ATOM 966  S SG    . CYS A 1 142 ? -3.191  -1.563  -7.141  1.00 46.36  ?  140 CYS B SG    1 
ATOM 967  N N     . ASN A 1 143 ? -7.462  -3.373  -6.152  1.00 30.65  ?  141 ASN B N     1 
ATOM 968  C CA    . ASN A 1 143 ? -8.650  -3.842  -5.448  1.00 28.02  ?  141 ASN B CA    1 
ATOM 969  C C     . ASN A 1 143 ? -9.166  -5.152  -6.025  1.00 27.24  ?  141 ASN B C     1 
ATOM 970  O O     . ASN A 1 143 ? -9.714  -5.979  -5.289  1.00 27.59  ?  141 ASN B O     1 
ATOM 971  C CB    . ASN A 1 143 ? -9.737  -2.772  -5.494  1.00 26.46  ?  141 ASN B CB    1 
ATOM 972  C CG    . ASN A 1 143 ? -9.368  -1.538  -4.704  1.00 26.94  ?  141 ASN B CG    1 
ATOM 973  O OD1   . ASN A 1 143 ? -8.634  -1.613  -3.721  1.00 29.05  ?  141 ASN B OD1   1 
ATOM 974  N ND2   . ASN A 1 143 ? -9.864  -0.390  -5.138  1.00 23.40  ?  141 ASN B ND2   1 
ATOM 975  N N     . ARG A 1 144 ? -9.016  -5.352  -7.334  1.00 27.52  ?  142 ARG B N     1 
ATOM 976  C CA    . ARG A 1 144 ? -9.407  -6.621  -7.936  1.00 29.60  ?  142 ARG B CA    1 
ATOM 977  C C     . ARG A 1 144 ? -8.569  -7.771  -7.401  1.00 32.65  ?  142 ARG B C     1 
ATOM 978  O O     . ARG A 1 144 ? -9.090  -8.860  -7.141  1.00 33.06  ?  142 ARG B O     1 
ATOM 979  C CB    . ARG A 1 144 ? -9.289  -6.539  -9.455  1.00 32.90  ?  142 ARG B CB    1 
ATOM 980  C CG    . ARG A 1 144 ? -9.782  -7.774  -10.179 1.00 36.55  ?  142 ARG B CG    1 
ATOM 981  C CD    . ARG A 1 144 ? -11.224 -8.094  -9.872  1.00 37.45  ?  142 ARG B CD    1 
ATOM 982  N NE    . ARG A 1 144 ? -11.663 -9.272  -10.609 1.00 39.82  ?  142 ARG B NE    1 
ATOM 983  C CZ    . ARG A 1 144 ? -11.532 -10.516 -10.166 1.00 38.98  ?  142 ARG B CZ    1 
ATOM 984  N NH1   . ARG A 1 144 ? -10.973 -10.745 -8.988  1.00 37.19  1  142 ARG B NH1   1 
ATOM 985  N NH2   . ARG A 1 144 ? -11.953 -11.533 -10.902 1.00 39.90  ?  142 ARG B NH2   1 
ATOM 986  N N     . ARG A 1 145 ? -7.264  -7.554  -7.243  1.00 34.13  ?  143 ARG B N     1 
ATOM 987  C CA    . ARG A 1 145 ? -6.402  -8.602  -6.711  1.00 33.44  ?  143 ARG B CA    1 
ATOM 988  C C     . ARG A 1 145 ? -6.748  -8.916  -5.262  1.00 31.32  ?  143 ARG B C     1 
ATOM 989  O O     . ARG A 1 145 ? -6.843  -10.086 -4.877  1.00 32.18  ?  143 ARG B O     1 
ATOM 990  C CB    . ARG A 1 145 ? -4.938  -8.182  -6.838  1.00 36.67  ?  143 ARG B CB    1 
ATOM 991  C CG    . ARG A 1 145 ? -4.288  -8.571  -8.153  1.00 40.82  ?  143 ARG B CG    1 
ATOM 992  C CD    . ARG A 1 145 ? -2.872  -8.038  -8.239  1.00 43.10  ?  143 ARG B CD    1 
ATOM 993  N NE    . ARG A 1 145 ? -2.790  -6.815  -9.030  1.00 44.83  ?  143 ARG B NE    1 
ATOM 994  C CZ    . ARG A 1 145 ? -1.795  -5.939  -8.948  1.00 48.32  ?  143 ARG B CZ    1 
ATOM 995  N NH1   . ARG A 1 145 ? -0.803  -6.142  -8.096  1.00 51.74  1  143 ARG B NH1   1 
ATOM 996  N NH2   . ARG A 1 145 ? -1.795  -4.855  -9.709  1.00 47.57  ?  143 ARG B NH2   1 
ATOM 997  N N     . GLN A 1 146 ? -6.942  -7.880  -4.442  1.00 30.18  ?  144 GLN B N     1 
ATOM 998  C CA    . GLN A 1 146 ? -7.305  -8.097  -3.047  1.00 29.96  ?  144 GLN B CA    1 
ATOM 999  C C     . GLN A 1 146 ? -8.638  -8.817  -2.921  1.00 28.50  ?  144 GLN B C     1 
ATOM 1000 O O     . GLN A 1 146 ? -8.850  -9.569  -1.966  1.00 28.79  ?  144 GLN B O     1 
ATOM 1001 C CB    . GLN A 1 146 ? -7.350  -6.764  -2.304  1.00 30.99  ?  144 GLN B CB    1 
ATOM 1002 C CG    . GLN A 1 146 ? -5.990  -6.151  -2.036  1.00 34.56  ?  144 GLN B CG    1 
ATOM 1003 C CD    . GLN A 1 146 ? -5.239  -6.861  -0.931  1.00 38.04  ?  144 GLN B CD    1 
ATOM 1004 O OE1   . GLN A 1 146 ? -5.498  -6.644  0.249   1.00 39.26  ?  144 GLN B OE1   1 
ATOM 1005 N NE2   . GLN A 1 146 ? -4.292  -7.707  -1.312  1.00 40.56  ?  144 GLN B NE2   1 
ATOM 1006 N N     . ARG A 1 147 ? -9.547  -8.589  -3.869  1.00 29.26  ?  145 ARG B N     1 
ATOM 1007 C CA    A ARG A 1 147 ? -10.836 -9.270  -3.851  0.48 26.40  ?  145 ARG B CA    1 
ATOM 1008 C CA    B ARG A 1 147 ? -10.837 -9.272  -3.851  0.52 26.39  ?  145 ARG B CA    1 
ATOM 1009 C C     . ARG A 1 147 ? -10.673 -10.784 -3.871  1.00 31.52  ?  145 ARG B C     1 
ATOM 1010 O O     . ARG A 1 147 ? -11.460 -11.502 -3.246  1.00 31.60  ?  145 ARG B O     1 
ATOM 1011 C CB    A ARG A 1 147 ? -11.674 -8.781  -5.033  0.48 28.19  ?  145 ARG B CB    1 
ATOM 1012 C CB    B ARG A 1 147 ? -11.688 -8.813  -5.037  0.52 28.19  ?  145 ARG B CB    1 
ATOM 1013 C CG    A ARG A 1 147 ? -12.809 -9.682  -5.463  0.48 24.17  ?  145 ARG B CG    1 
ATOM 1014 C CG    B ARG A 1 147 ? -12.795 -9.781  -5.423  0.52 24.19  ?  145 ARG B CG    1 
ATOM 1015 C CD    A ARG A 1 147 ? -13.989 -8.854  -5.951  0.48 25.53  ?  145 ARG B CD    1 
ATOM 1016 C CD    B ARG A 1 147 ? -13.806 -9.165  -6.374  0.52 25.95  ?  145 ARG B CD    1 
ATOM 1017 N NE    A ARG A 1 147 ? -13.682 -8.074  -7.149  0.48 22.00  ?  145 ARG B NE    1 
ATOM 1018 N NE    B ARG A 1 147 ? -15.173 -9.502  -5.987  0.52 23.37  ?  145 ARG B NE    1 
ATOM 1019 C CZ    A ARG A 1 147 ? -13.635 -6.745  -7.185  0.48 17.17  ?  145 ARG B CZ    1 
ATOM 1020 C CZ    B ARG A 1 147 ? -16.254 -9.193  -6.696  0.52 23.60  ?  145 ARG B CZ    1 
ATOM 1021 N NH1   A ARG A 1 147 ? -13.867 -6.039  -6.089  0.48 14.21  1  145 ARG B NH1   1 
ATOM 1022 N NH1   B ARG A 1 147 ? -16.135 -8.539  -7.842  0.52 24.65  1  145 ARG B NH1   1 
ATOM 1023 N NH2   A ARG A 1 147 ? -13.356 -6.117  -8.317  0.48 16.15  ?  145 ARG B NH2   1 
ATOM 1024 N NH2   B ARG A 1 147 ? -17.456 -9.541  -6.259  0.52 21.51  ?  145 ARG B NH2   1 
ATOM 1025 N N     . GLU A 1 148 ? -9.657  -11.285 -4.565  1.00 33.57  ?  146 GLU B N     1 
ATOM 1026 C CA    . GLU A 1 148 ? -9.408  -12.717 -4.638  1.00 35.18  ?  146 GLU B CA    1 
ATOM 1027 C C     . GLU A 1 148 ? -8.750  -13.268 -3.381  1.00 36.21  ?  146 GLU B C     1 
ATOM 1028 O O     . GLU A 1 148 ? -8.520  -14.478 -3.302  1.00 40.33  ?  146 GLU B O     1 
ATOM 1029 C CB    . GLU A 1 148 ? -8.547  -13.034 -5.862  1.00 36.82  ?  146 GLU B CB    1 
ATOM 1030 C CG    . GLU A 1 148 ? -9.034  -14.224 -6.670  1.00 38.55  ?  146 GLU B CG    1 
ATOM 1031 C CD    . GLU A 1 148 ? -10.230 -13.890 -7.536  1.00 37.83  ?  146 GLU B CD    1 
ATOM 1032 O OE1   . GLU A 1 148 ? -10.326 -12.735 -7.994  1.00 36.75  ?  146 GLU B OE1   1 
ATOM 1033 O OE2   . GLU A 1 148 ? -11.077 -14.779 -7.757  1.00 37.88  -1 146 GLU B OE2   1 
ATOM 1034 N N     . LYS A 1 149 ? -8.443  -12.418 -2.402  1.00 35.00  ?  147 LYS B N     1 
ATOM 1035 C CA    . LYS A 1 149 ? -7.843  -12.837 -1.143  1.00 36.35  ?  147 LYS B CA    1 
ATOM 1036 C C     . LYS A 1 149 ? -8.871  -12.975 -0.026  1.00 35.60  ?  147 LYS B C     1 
ATOM 1037 O O     . LYS A 1 149 ? -8.502  -12.967 1.151   1.00 39.82  ?  147 LYS B O     1 
ATOM 1038 C CB    . LYS A 1 149 ? -6.751  -11.849 -0.726  1.00 36.33  ?  147 LYS B CB    1 
ATOM 1039 C CG    . LYS A 1 149 ? -5.412  -12.058 -1.411  1.00 39.40  ?  147 LYS B CG    1 
ATOM 1040 C CD    . LYS A 1 149 ? -4.625  -13.179 -0.756  1.00 43.11  ?  147 LYS B CD    1 
ATOM 1041 C CE    . LYS A 1 149 ? -3.286  -13.400 -1.442  1.00 47.74  ?  147 LYS B CE    1 
ATOM 1042 N NZ    . LYS A 1 149 ? -2.396  -12.213 -1.346  1.00 49.13  1  147 LYS B NZ    1 
ATOM 1043 N N     . ARG A 1 150 ? -10.145 -13.104 -0.368  1.00 31.88  ?  148 ARG B N     1 
ATOM 1044 C CA    . ARG A 1 150 ? -11.205 -13.147 0.624   1.00 31.90  ?  148 ARG B CA    1 
ATOM 1045 C C     . ARG A 1 150 ? -11.449 -14.577 1.093   1.00 36.25  ?  148 ARG B C     1 
ATOM 1046 O O     . ARG A 1 150 ? -10.918 -15.542 0.543   1.00 39.03  ?  148 ARG B O     1 
ATOM 1047 C CB    . ARG A 1 150 ? -12.493 -12.553 0.053   1.00 28.06  ?  148 ARG B CB    1 
ATOM 1048 C CG    . ARG A 1 150 ? -12.445 -11.060 -0.205  1.00 24.20  ?  148 ARG B CG    1 
ATOM 1049 C CD    . ARG A 1 150 ? -13.673 -10.611 -0.969  1.00 25.38  ?  148 ARG B CD    1 
ATOM 1050 N NE    . ARG A 1 150 ? -13.680 -9.175  -1.225  1.00 25.01  ?  148 ARG B NE    1 
ATOM 1051 C CZ    . ARG A 1 150 ? -14.573 -8.563  -1.992  1.00 23.43  ?  148 ARG B CZ    1 
ATOM 1052 N NH1   . ARG A 1 150 ? -15.528 -9.264  -2.580  1.00 23.63  1  148 ARG B NH1   1 
ATOM 1053 N NH2   . ARG A 1 150 ? -14.510 -7.255  -2.174  1.00 22.11  ?  148 ARG B NH2   1 
ATOM 1054 N N     . VAL A 1 151 ? -12.279 -14.704 2.126   1.00 37.30  ?  149 VAL B N     1 
ATOM 1055 C CA    . VAL A 1 151 ? -12.700 -16.006 2.627   1.00 40.70  ?  149 VAL B CA    1 
ATOM 1056 C C     . VAL A 1 151 ? -13.990 -16.384 1.910   1.00 48.72  ?  149 VAL B C     1 
ATOM 1057 O O     . VAL A 1 151 ? -14.863 -17.045 2.483   1.00 56.73  ?  149 VAL B O     1 
ATOM 1058 C CB    . VAL A 1 151 ? -12.894 -15.982 4.154   1.00 36.16  ?  149 VAL B CB    1 
ATOM 1059 C CG1   . VAL A 1 151 ? -12.846 -17.383 4.731   1.00 17.69  ?  149 VAL B CG1   1 
ATOM 1060 C CG2   . VAL A 1 151 ? -11.859 -15.107 4.804   1.00 35.19  ?  149 VAL B CG2   1 
ATOM 1061 N N     . LYS A 1 152 ? -14.116 -15.963 0.655   1.00 48.35  ?  150 LYS B N     1 
ATOM 1062 C CA    . LYS A 1 152 ? -15.325 -16.175 -0.138  1.00 50.54  ?  150 LYS B CA    1 
ATOM 1063 C C     . LYS A 1 152 ? -16.538 -15.556 0.542   1.00 46.72  ?  150 LYS B C     1 
ATOM 1064 O O     . LYS A 1 152 ? -16.857 -14.391 0.310   1.00 44.22  ?  150 LYS B O     1 
ATOM 1065 C CB    . LYS A 1 152 ? -15.559 -17.666 -0.396  1.00 54.74  ?  150 LYS B CB    1 
ATOM 1066 C CG    . LYS A 1 152 ? -15.246 -18.105 -1.817  1.00 55.69  ?  150 LYS B CG    1 
ATOM 1067 C CD    . LYS A 1 152 ? -16.363 -17.708 -2.768  1.00 54.03  ?  150 LYS B CD    1 
ATOM 1068 C CE    . LYS A 1 152 ? -17.719 -18.120 -2.216  1.00 53.99  ?  150 LYS B CE    1 
ATOM 1069 N NZ    . LYS A 1 152 ? -18.851 -17.604 -3.030  1.00 55.76  1  150 LYS B NZ    1 
ATOM 1070 O OXT   . LYS A 1 152 ? -17.229 -16.200 1.328   1.00 46.00  ?  150 LYS B OXT   1 
ATOM 1071 N N     . ASP B 1 4   ? -39.987 -6.675  -23.802 1.00 79.69  ?  2   ASP A N     1 
ATOM 1072 C CA    . ASP B 1 4   ? -38.590 -6.733  -23.390 1.00 78.77  ?  2   ASP A CA    1 
ATOM 1073 C C     . ASP B 1 4   ? -38.034 -8.148  -23.528 1.00 78.42  ?  2   ASP A C     1 
ATOM 1074 O O     . ASP B 1 4   ? -38.646 -9.001  -24.170 1.00 79.98  ?  2   ASP A O     1 
ATOM 1075 C CB    . ASP B 1 4   ? -38.436 -6.236  -21.952 1.00 76.59  ?  2   ASP A CB    1 
ATOM 1076 C CG    . ASP B 1 4   ? -37.785 -4.866  -21.874 1.00 77.15  ?  2   ASP A CG    1 
ATOM 1077 O OD1   . ASP B 1 4   ? -36.939 -4.560  -22.739 1.00 79.36  ?  2   ASP A OD1   1 
ATOM 1078 O OD2   . ASP B 1 4   ? -38.122 -4.093  -20.952 1.00 75.14  ?  2   ASP A OD2   1 
ATOM 1079 N N     . SER B 1 5   ? -36.876 -8.385  -22.911 1.00 75.97  ?  3   SER A N     1 
ATOM 1080 C CA    . SER B 1 5   ? -36.096 -9.608  -23.075 1.00 75.15  ?  3   SER A CA    1 
ATOM 1081 C C     . SER B 1 5   ? -36.903 -10.859 -22.741 1.00 72.97  ?  3   SER A C     1 
ATOM 1082 O O     . SER B 1 5   ? -37.866 -10.791 -21.967 1.00 69.58  ?  3   SER A O     1 
ATOM 1083 C CB    . SER B 1 5   ? -34.834 -9.536  -22.211 1.00 75.04  ?  3   SER A CB    1 
ATOM 1084 O OG    . SER B 1 5   ? -35.151 -9.335  -20.846 1.00 73.02  ?  3   SER A OG    1 
ATOM 1085 N N     . PRO B 1 6   ? -36.540 -12.015 -23.309 1.00 76.16  ?  4   PRO A N     1 
ATOM 1086 C CA    . PRO B 1 6   ? -37.308 -13.245 -23.050 1.00 77.70  ?  4   PRO A CA    1 
ATOM 1087 C C     . PRO B 1 6   ? -37.379 -13.639 -21.589 1.00 78.36  ?  4   PRO A C     1 
ATOM 1088 O O     . PRO B 1 6   ? -38.300 -14.371 -21.209 1.00 80.27  ?  4   PRO A O     1 
ATOM 1089 C CB    . PRO B 1 6   ? -36.562 -14.302 -23.872 1.00 80.24  ?  4   PRO A CB    1 
ATOM 1090 C CG    . PRO B 1 6   ? -35.890 -13.538 -24.945 1.00 83.01  ?  4   PRO A CG    1 
ATOM 1091 C CD    . PRO B 1 6   ? -35.513 -12.219 -24.344 1.00 80.61  ?  4   PRO A CD    1 
ATOM 1092 N N     . GLU B 1 7   ? -36.441 -13.189 -20.757 1.00 78.05  ?  5   GLU A N     1 
ATOM 1093 C CA    . GLU B 1 7   ? -36.505 -13.500 -19.335 1.00 75.56  ?  5   GLU A CA    1 
ATOM 1094 C C     . GLU B 1 7   ? -37.551 -12.659 -18.615 1.00 70.56  ?  5   GLU A C     1 
ATOM 1095 O O     . GLU B 1 7   ? -38.169 -13.135 -17.657 1.00 71.30  ?  5   GLU A O     1 
ATOM 1096 C CB    . GLU B 1 7   ? -35.130 -13.315 -18.695 1.00 77.90  ?  5   GLU A CB    1 
ATOM 1097 C CG    . GLU B 1 7   ? -34.277 -12.232 -19.338 1.00 81.81  ?  5   GLU A CG    1 
ATOM 1098 C CD    . GLU B 1 7   ? -33.171 -12.797 -20.211 1.00 87.03  ?  5   GLU A CD    1 
ATOM 1099 O OE1   . GLU B 1 7   ? -33.481 -13.517 -21.181 1.00 89.25  ?  5   GLU A OE1   1 
ATOM 1100 O OE2   . GLU B 1 7   ? -31.989 -12.524 -19.920 1.00 89.40  -1 5   GLU A OE2   1 
ATOM 1101 N N     . ILE B 1 8   ? -37.756 -11.416 -19.052 1.00 63.64  ?  6   ILE A N     1 
ATOM 1102 C CA    . ILE B 1 8   ? -38.793 -10.577 -18.463 1.00 59.40  ?  6   ILE A CA    1 
ATOM 1103 C C     . ILE B 1 8   ? -40.181 -11.137 -18.754 1.00 60.99  ?  6   ILE A C     1 
ATOM 1104 O O     . ILE B 1 8   ? -41.093 -11.013 -17.929 1.00 59.25  ?  6   ILE A O     1 
ATOM 1105 C CB    . ILE B 1 8   ? -38.643 -9.126  -18.955 1.00 59.03  ?  6   ILE A CB    1 
ATOM 1106 C CG1   . ILE B 1 8   ? -37.354 -8.522  -18.406 1.00 57.17  ?  6   ILE A CG1   1 
ATOM 1107 C CG2   . ILE B 1 8   ? -39.825 -8.281  -18.523 1.00 59.69  ?  6   ILE A CG2   1 
ATOM 1108 C CD1   . ILE B 1 8   ? -37.180 -7.065  -18.725 1.00 57.64  ?  6   ILE A CD1   1 
ATOM 1109 N N     . ARG B 1 9   ? -40.368 -11.761 -19.919 1.00 66.03  ?  7   ARG A N     1 
ATOM 1110 C CA    . ARG B 1 9   ? -41.674 -12.318 -20.262 1.00 67.28  ?  7   ARG A CA    1 
ATOM 1111 C C     . ARG B 1 9   ? -42.100 -13.386 -19.261 1.00 64.41  ?  7   ARG A C     1 
ATOM 1112 O O     . ARG B 1 9   ? -43.243 -13.392 -18.791 1.00 63.05  ?  7   ARG A O     1 
ATOM 1113 C CB    . ARG B 1 9   ? -41.640 -12.888 -21.679 1.00 69.27  ?  7   ARG A CB    1 
ATOM 1114 N N     . GLU B 1 10  ? -41.193 -14.305 -18.928 1.00 62.30  ?  8   GLU A N     1 
ATOM 1115 C CA    . GLU B 1 10  ? -41.483 -15.307 -17.908 1.00 64.99  ?  8   GLU A CA    1 
ATOM 1116 C C     . GLU B 1 10  ? -41.701 -14.675 -16.538 1.00 63.21  ?  8   GLU A C     1 
ATOM 1117 O O     . GLU B 1 10  ? -42.354 -15.278 -15.680 1.00 61.59  ?  8   GLU A O     1 
ATOM 1118 C CB    . GLU B 1 10  ? -40.347 -16.331 -17.852 1.00 69.14  ?  8   GLU A CB    1 
ATOM 1119 C CG    . GLU B 1 10  ? -40.549 -17.456 -16.851 1.00 73.19  ?  8   GLU A CG    1 
ATOM 1120 C CD    . GLU B 1 10  ? -41.740 -18.330 -17.184 1.00 78.33  ?  8   GLU A CD    1 
ATOM 1121 O OE1   . GLU B 1 10  ? -41.896 -18.697 -18.366 1.00 81.94  ?  8   GLU A OE1   1 
ATOM 1122 O OE2   . GLU B 1 10  ? -42.523 -18.647 -16.265 1.00 79.21  -1 8   GLU A OE2   1 
ATOM 1123 N N     . LEU B 1 11  ? -41.196 -13.460 -16.330 1.00 62.98  ?  9   LEU A N     1 
ATOM 1124 C CA    . LEU B 1 11  ? -41.343 -12.784 -15.047 1.00 59.52  ?  9   LEU A CA    1 
ATOM 1125 C C     . LEU B 1 11  ? -42.758 -12.252 -14.871 1.00 58.53  ?  9   LEU A C     1 
ATOM 1126 O O     . LEU B 1 11  ? -43.335 -12.362 -13.784 1.00 58.04  ?  9   LEU A O     1 
ATOM 1127 C CB    . LEU B 1 11  ? -40.325 -11.649 -14.951 1.00 58.75  ?  9   LEU A CB    1 
ATOM 1128 C CG    . LEU B 1 11  ? -39.505 -11.463 -13.682 1.00 57.63  ?  9   LEU A CG    1 
ATOM 1129 C CD1   . LEU B 1 11  ? -38.799 -12.749 -13.339 1.00 58.71  ?  9   LEU A CD1   1 
ATOM 1130 C CD2   . LEU B 1 11  ? -38.496 -10.357 -13.911 1.00 57.49  ?  9   LEU A CD2   1 
ATOM 1131 N N     . GLU B 1 12  ? -43.323 -11.663 -15.926 1.00 57.58  ?  10  GLU A N     1 
ATOM 1132 C CA    . GLU B 1 12  ? -44.714 -11.222 -15.886 1.00 55.01  ?  10  GLU A CA    1 
ATOM 1133 C C     . GLU B 1 12  ? -45.649 -12.402 -15.666 1.00 54.05  ?  10  GLU A C     1 
ATOM 1134 O O     . GLU B 1 12  ? -46.580 -12.333 -14.858 1.00 55.03  ?  10  GLU A O     1 
ATOM 1135 C CB    . GLU B 1 12  ? -45.073 -10.513 -17.188 1.00 56.75  ?  10  GLU A CB    1 
ATOM 1136 C CG    . GLU B 1 12  ? -44.314 -9.242  -17.454 1.00 59.67  ?  10  GLU A CG    1 
ATOM 1137 C CD    . GLU B 1 12  ? -44.855 -8.502  -18.652 1.00 65.53  ?  10  GLU A CD    1 
ATOM 1138 O OE1   . GLU B 1 12  ? -46.037 -8.103  -18.621 1.00 67.77  ?  10  GLU A OE1   1 
ATOM 1139 O OE2   . GLU B 1 12  ? -44.104 -8.336  -19.634 1.00 68.60  -1 10  GLU A OE2   1 
ATOM 1140 N N     . LYS B 1 13  ? -45.422 -13.487 -16.407 1.00 53.82  ?  11  LYS A N     1 
ATOM 1141 C CA    . LYS B 1 13  ? -46.291 -14.656 -16.347 1.00 55.38  ?  11  LYS A CA    1 
ATOM 1142 C C     . LYS B 1 13  ? -46.401 -15.201 -14.929 1.00 52.19  ?  11  LYS A C     1 
ATOM 1143 O O     . LYS B 1 13  ? -47.497 -15.527 -14.461 1.00 55.58  ?  11  LYS A O     1 
ATOM 1144 C CB    . LYS B 1 13  ? -45.760 -15.727 -17.298 1.00 59.91  ?  11  LYS A CB    1 
ATOM 1145 C CG    . LYS B 1 13  ? -46.815 -16.570 -17.974 1.00 62.10  ?  11  LYS A CG    1 
ATOM 1146 C CD    . LYS B 1 13  ? -46.154 -17.626 -18.840 1.00 62.30  ?  11  LYS A CD    1 
ATOM 1147 C CE    . LYS B 1 13  ? -45.106 -18.396 -18.054 1.00 60.36  ?  11  LYS A CE    1 
ATOM 1148 N NZ    . LYS B 1 13  ? -44.233 -19.217 -18.933 1.00 62.41  1  11  LYS A NZ    1 
ATOM 1149 N N     . PHE B 1 14  ? -45.273 -15.310 -14.228 1.00 46.69  ?  12  PHE A N     1 
ATOM 1150 C CA    . PHE B 1 14  ? -45.302 -15.835 -12.868 1.00 42.97  ?  12  PHE A CA    1 
ATOM 1151 C C     . PHE B 1 14  ? -46.076 -14.921 -11.929 1.00 43.23  ?  12  PHE A C     1 
ATOM 1152 O O     . PHE B 1 14  ? -46.842 -15.397 -11.084 1.00 42.93  ?  12  PHE A O     1 
ATOM 1153 C CB    . PHE B 1 14  ? -43.882 -16.050 -12.349 1.00 37.64  ?  12  PHE A CB    1 
ATOM 1154 C CG    . PHE B 1 14  ? -43.830 -16.616 -10.962 1.00 36.78  ?  12  PHE A CG    1 
ATOM 1155 C CD1   . PHE B 1 14  ? -43.811 -15.782 -9.860  1.00 37.16  ?  12  PHE A CD1   1 
ATOM 1156 C CD2   . PHE B 1 14  ? -43.793 -17.980 -10.760 1.00 38.59  ?  12  PHE A CD2   1 
ATOM 1157 C CE1   . PHE B 1 14  ? -43.768 -16.298 -8.587  1.00 39.08  ?  12  PHE A CE1   1 
ATOM 1158 C CE2   . PHE B 1 14  ? -43.752 -18.500 -9.488  1.00 40.48  ?  12  PHE A CE2   1 
ATOM 1159 C CZ    . PHE B 1 14  ? -43.738 -17.657 -8.401  1.00 40.62  ?  12  PHE A CZ    1 
ATOM 1160 N N     . ALA B 1 15  ? -45.874 -13.609 -12.045 1.00 42.73  ?  13  ALA A N     1 
ATOM 1161 C CA    . ALA B 1 15  ? -46.565 -12.675 -11.163 1.00 41.38  ?  13  ALA A CA    1 
ATOM 1162 C C     . ALA B 1 15  ? -48.076 -12.784 -11.305 1.00 45.90  ?  13  ALA A C     1 
ATOM 1163 O O     . ALA B 1 15  ? -48.806 -12.677 -10.314 1.00 48.10  ?  13  ALA A O     1 
ATOM 1164 C CB    . ALA B 1 15  ? -46.109 -11.252 -11.449 1.00 38.78  ?  13  ALA A CB    1 
ATOM 1165 N N     . ASN B 1 16  ? -48.567 -12.978 -12.528 1.00 47.17  ?  14  ASN A N     1 
ATOM 1166 C CA    . ASN B 1 16  ? -50.002 -13.150 -12.714 1.00 49.83  ?  14  ASN A CA    1 
ATOM 1167 C C     . ASN B 1 16  ? -50.476 -14.451 -12.086 1.00 49.11  ?  14  ASN A C     1 
ATOM 1168 O O     . ASN B 1 16  ? -51.499 -14.482 -11.393 1.00 49.90  ?  14  ASN A O     1 
ATOM 1169 C CB    . ASN B 1 16  ? -50.351 -13.111 -14.200 1.00 55.36  ?  14  ASN A CB    1 
ATOM 1170 C CG    . ASN B 1 16  ? -50.005 -11.786 -14.847 1.00 59.13  ?  14  ASN A CG    1 
ATOM 1171 O OD1   . ASN B 1 16  ? -49.660 -10.821 -14.167 1.00 59.93  ?  14  ASN A OD1   1 
ATOM 1172 N ND2   . ASN B 1 16  ? -50.099 -11.732 -16.169 1.00 60.97  ?  14  ASN A ND2   1 
ATOM 1173 N N     . GLU B 1 17  ? -49.736 -15.539 -12.307 1.00 48.80  ?  15  GLU A N     1 
ATOM 1174 C CA    . GLU B 1 17  ? -50.113 -16.814 -11.710 1.00 49.12  ?  15  GLU A CA    1 
ATOM 1175 C C     . GLU B 1 17  ? -49.944 -16.781 -10.198 1.00 47.26  ?  15  GLU A C     1 
ATOM 1176 O O     . GLU B 1 17  ? -50.728 -17.394 -9.467  1.00 47.91  ?  15  GLU A O     1 
ATOM 1177 C CB    . GLU B 1 17  ? -49.292 -17.946 -12.325 1.00 51.37  ?  15  GLU A CB    1 
ATOM 1178 C CG    . GLU B 1 17  ? -49.604 -19.325 -11.764 1.00 56.23  ?  15  GLU A CG    1 
ATOM 1179 C CD    . GLU B 1 17  ? -50.994 -19.817 -12.134 1.00 64.14  ?  15  GLU A CD    1 
ATOM 1180 O OE1   . GLU B 1 17  ? -51.629 -19.223 -13.032 1.00 67.50  ?  15  GLU A OE1   1 
ATOM 1181 O OE2   . GLU B 1 17  ? -51.456 -20.802 -11.522 1.00 66.74  -1 15  GLU A OE2   1 
ATOM 1182 N N     . PHE B 1 18  ? -48.924 -16.076 -9.710  1.00 46.31  ?  16  PHE A N     1 
ATOM 1183 C CA    . PHE B 1 18  ? -48.763 -15.931 -8.269  1.00 46.94  ?  16  PHE A CA    1 
ATOM 1184 C C     . PHE B 1 18  ? -49.909 -15.140 -7.659  1.00 48.47  ?  16  PHE A C     1 
ATOM 1185 O O     . PHE B 1 18  ? -50.341 -15.429 -6.540  1.00 49.21  ?  16  PHE A O     1 
ATOM 1186 C CB    . PHE B 1 18  ? -47.438 -15.247 -7.949  1.00 45.73  ?  16  PHE A CB    1 
ATOM 1187 C CG    . PHE B 1 18  ? -47.262 -14.926 -6.495  1.00 44.08  ?  16  PHE A CG    1 
ATOM 1188 C CD1   . PHE B 1 18  ? -46.920 -15.909 -5.590  1.00 44.44  ?  16  PHE A CD1   1 
ATOM 1189 C CD2   . PHE B 1 18  ? -47.460 -13.640 -6.033  1.00 42.97  ?  16  PHE A CD2   1 
ATOM 1190 C CE1   . PHE B 1 18  ? -46.767 -15.611 -4.256  1.00 44.08  ?  16  PHE A CE1   1 
ATOM 1191 C CE2   . PHE B 1 18  ? -47.310 -13.340 -4.702  1.00 42.65  ?  16  PHE A CE2   1 
ATOM 1192 C CZ    . PHE B 1 18  ? -46.963 -14.326 -3.813  1.00 43.37  ?  16  PHE A CZ    1 
ATOM 1193 N N     . LYS B 1 19  ? -50.414 -14.137 -8.377  1.00 48.48  ?  17  LYS A N     1 
ATOM 1194 C CA    . LYS B 1 19  ? -51.478 -13.310 -7.823  1.00 47.17  ?  17  LYS A CA    1 
ATOM 1195 C C     . LYS B 1 19  ? -52.780 -14.090 -7.707  1.00 46.99  ?  17  LYS A C     1 
ATOM 1196 O O     . LYS B 1 19  ? -53.465 -14.010 -6.682  1.00 47.93  ?  17  LYS A O     1 
ATOM 1197 C CB    . LYS B 1 19  ? -51.665 -12.049 -8.663  1.00 47.26  ?  17  LYS A CB    1 
ATOM 1198 C CG    . LYS B 1 19  ? -52.544 -11.000 -7.999  1.00 46.10  ?  17  LYS A CG    1 
ATOM 1199 C CD    . LYS B 1 19  ? -52.638 -9.742  -8.842  1.00 47.71  ?  17  LYS A CD    1 
ATOM 1200 C CE    . LYS B 1 19  ? -52.749 -8.500  -7.972  1.00 49.22  ?  17  LYS A CE    1 
ATOM 1201 N NZ    . LYS B 1 19  ? -54.152 -8.047  -7.787  1.00 51.45  1  17  LYS A NZ    1 
ATOM 1202 N N     . VAL B 1 20  ? -53.147 -14.839 -8.747  1.00 45.75  ?  18  VAL A N     1 
ATOM 1203 C CA    . VAL B 1 20  ? -54.386 -15.608 -8.698  1.00 48.10  ?  18  VAL A CA    1 
ATOM 1204 C C     . VAL B 1 20  ? -54.303 -16.692 -7.627  1.00 46.08  ?  18  VAL A C     1 
ATOM 1205 O O     . VAL B 1 20  ? -55.213 -16.839 -6.805  1.00 46.05  ?  18  VAL A O     1 
ATOM 1206 C CB    . VAL B 1 20  ? -54.736 -16.175 -10.089 1.00 50.79  ?  18  VAL A CB    1 
ATOM 1207 C CG1   . VAL B 1 20  ? -54.835 -15.046 -11.093 1.00 53.66  ?  18  VAL A CG1   1 
ATOM 1208 C CG2   . VAL B 1 20  ? -53.711 -17.183 -10.570 1.00 49.05  ?  18  VAL A CG2   1 
ATOM 1209 N N     . ARG B 1 21  ? -53.216 -17.469 -7.618  1.00 44.73  ?  19  ARG A N     1 
ATOM 1210 C CA    . ARG B 1 21  ? -53.077 -18.523 -6.619  1.00 45.85  ?  19  ARG A CA    1 
ATOM 1211 C C     . ARG B 1 21  ? -52.976 -17.955 -5.210  1.00 43.46  ?  19  ARG A C     1 
ATOM 1212 O O     . ARG B 1 21  ? -53.377 -18.616 -4.249  1.00 43.10  ?  19  ARG A O     1 
ATOM 1213 C CB    . ARG B 1 21  ? -51.861 -19.392 -6.932  1.00 48.15  ?  19  ARG A CB    1 
ATOM 1214 C CG    . ARG B 1 21  ? -51.968 -20.189 -8.223  1.00 52.93  ?  19  ARG A CG    1 
ATOM 1215 C CD    . ARG B 1 21  ? -50.732 -21.050 -8.426  1.00 56.54  ?  19  ARG A CD    1 
ATOM 1216 N NE    . ARG B 1 21  ? -51.059 -22.440 -8.729  1.00 61.71  ?  19  ARG A NE    1 
ATOM 1217 C CZ    . ARG B 1 21  ? -50.891 -23.007 -9.918  1.00 64.34  ?  19  ARG A CZ    1 
ATOM 1218 N NH1   . ARG B 1 21  ? -50.392 -22.303 -10.922 1.00 65.66  1  19  ARG A NH1   1 
ATOM 1219 N NH2   . ARG B 1 21  ? -51.213 -24.280 -10.102 1.00 65.26  ?  19  ARG A NH2   1 
ATOM 1220 N N     . ARG B 1 22  ? -52.445 -16.742 -5.065  1.00 42.43  ?  20  ARG A N     1 
ATOM 1221 C CA    . ARG B 1 22  ? -52.400 -16.107 -3.753  1.00 41.78  ?  20  ARG A CA    1 
ATOM 1222 C C     . ARG B 1 22  ? -53.792 -15.722 -3.274  1.00 42.24  ?  20  ARG A C     1 
ATOM 1223 O O     . ARG B 1 22  ? -54.125 -15.907 -2.099  1.00 42.19  ?  20  ARG A O     1 
ATOM 1224 C CB    . ARG B 1 22  ? -51.489 -14.883 -3.802  1.00 40.31  ?  20  ARG A CB    1 
ATOM 1225 C CG    . ARG B 1 22  ? -51.494 -14.037 -2.558  1.00 40.57  ?  20  ARG A CG    1 
ATOM 1226 C CD    . ARG B 1 22  ? -50.962 -12.654 -2.856  1.00 41.19  ?  20  ARG A CD    1 
ATOM 1227 N NE    . ARG B 1 22  ? -51.981 -11.752 -3.379  1.00 42.34  ?  20  ARG A NE    1 
ATOM 1228 C CZ    . ARG B 1 22  ? -52.787 -11.021 -2.620  1.00 42.12  ?  20  ARG A CZ    1 
ATOM 1229 N NH1   . ARG B 1 22  ? -52.696 -11.095 -1.302  1.00 41.92  1  20  ARG A NH1   1 
ATOM 1230 N NH2   . ARG B 1 22  ? -53.682 -10.221 -3.177  1.00 43.05  ?  20  ARG A NH2   1 
ATOM 1231 N N     . ILE B 1 23  ? -54.614 -15.176 -4.166  1.00 42.23  ?  21  ILE A N     1 
ATOM 1232 C CA    . ILE B 1 23  ? -55.955 -14.757 -3.782  1.00 42.48  ?  21  ILE A CA    1 
ATOM 1233 C C     . ILE B 1 23  ? -56.883 -15.955 -3.635  1.00 44.46  ?  21  ILE A C     1 
ATOM 1234 O O     . ILE B 1 23  ? -57.654 -16.039 -2.674  1.00 45.72  ?  21  ILE A O     1 
ATOM 1235 C CB    . ILE B 1 23  ? -56.494 -13.744 -4.804  1.00 41.90  ?  21  ILE A CB    1 
ATOM 1236 C CG1   . ILE B 1 23  ? -55.595 -12.510 -4.843  1.00 38.11  ?  21  ILE A CG1   1 
ATOM 1237 C CG2   . ILE B 1 23  ? -57.914 -13.354 -4.458  1.00 44.81  ?  21  ILE A CG2   1 
ATOM 1238 C CD1   . ILE B 1 23  ? -55.988 -11.508 -5.888  1.00 39.15  ?  21  ILE A CD1   1 
ATOM 1239 N N     . LYS B 1 24  ? -56.828 -16.894 -4.584  1.00 44.59  ?  22  LYS A N     1 
ATOM 1240 C CA    . LYS B 1 24  ? -57.672 -18.085 -4.517  1.00 44.90  ?  22  LYS A CA    1 
ATOM 1241 C C     . LYS B 1 24  ? -57.429 -18.890 -3.248  1.00 43.99  ?  22  LYS A C     1 
ATOM 1242 O O     . LYS B 1 24  ? -58.342 -19.563 -2.758  1.00 46.82  ?  22  LYS A O     1 
ATOM 1243 C CB    . LYS B 1 24  ? -57.442 -18.959 -5.749  1.00 44.56  ?  22  LYS A CB    1 
ATOM 1244 N N     . LEU B 1 25  ? -56.217 -18.844 -2.707  1.00 41.43  ?  23  LEU A N     1 
ATOM 1245 C CA    . LEU B 1 25  ? -55.922 -19.500 -1.440  1.00 43.23  ?  23  LEU A CA    1 
ATOM 1246 C C     . LEU B 1 25  ? -56.275 -18.640 -0.238  1.00 42.00  ?  23  LEU A C     1 
ATOM 1247 O O     . LEU B 1 25  ? -56.071 -19.079 0.898   1.00 43.77  ?  23  LEU A O     1 
ATOM 1248 C CB    . LEU B 1 25  ? -54.446 -19.900 -1.371  1.00 44.57  ?  23  LEU A CB    1 
ATOM 1249 C CG    . LEU B 1 25  ? -53.952 -21.186 -2.044  1.00 46.94  ?  23  LEU A CG    1 
ATOM 1250 C CD1   . LEU B 1 25  ? -54.561 -21.425 -3.417  1.00 48.71  ?  23  LEU A CD1   1 
ATOM 1251 C CD2   . LEU B 1 25  ? -52.434 -21.168 -2.131  1.00 44.10  ?  23  LEU A CD2   1 
ATOM 1252 N N     . GLY B 1 26  ? -56.799 -17.439 -0.455  1.00 38.86  ?  24  GLY A N     1 
ATOM 1253 C CA    . GLY B 1 26  ? -57.234 -16.606 0.646   1.00 34.89  ?  24  GLY A CA    1 
ATOM 1254 C C     . GLY B 1 26  ? -56.119 -15.951 1.420   1.00 47.17  ?  24  GLY A C     1 
ATOM 1255 O O     . GLY B 1 26  ? -56.279 -15.678 2.613   1.00 47.37  ?  24  GLY A O     1 
ATOM 1256 N N     . TYR B 1 27  ? -54.989 -15.690 0.777   1.00 45.31  ?  25  TYR A N     1 
ATOM 1257 C CA    . TYR B 1 27  ? -53.876 -15.003 1.410   1.00 42.13  ?  25  TYR A CA    1 
ATOM 1258 C C     . TYR B 1 27  ? -53.907 -13.533 1.024   1.00 42.99  ?  25  TYR A C     1 
ATOM 1259 O O     . TYR B 1 27  ? -54.113 -13.193 -0.143  1.00 43.01  ?  25  TYR A O     1 
ATOM 1260 C CB    . TYR B 1 27  ? -52.543 -15.619 0.986   1.00 38.93  ?  25  TYR A CB    1 
ATOM 1261 C CG    . TYR B 1 27  ? -52.234 -16.955 1.614   1.00 38.06  ?  25  TYR A CG    1 
ATOM 1262 C CD1   . TYR B 1 27  ? -51.641 -17.038 2.862   1.00 35.86  ?  25  TYR A CD1   1 
ATOM 1263 C CD2   . TYR B 1 27  ? -52.525 -18.135 0.950   1.00 39.41  ?  25  TYR A CD2   1 
ATOM 1264 C CE1   . TYR B 1 27  ? -51.353 -18.257 3.432   1.00 36.42  ?  25  TYR A CE1   1 
ATOM 1265 C CE2   . TYR B 1 27  ? -52.244 -19.357 1.513   1.00 39.95  ?  25  TYR A CE2   1 
ATOM 1266 C CZ    . TYR B 1 27  ? -51.658 -19.413 2.753   1.00 39.38  ?  25  TYR A CZ    1 
ATOM 1267 O OH    . TYR B 1 27  ? -51.374 -20.633 3.316   1.00 43.27  ?  25  TYR A OH    1 
ATOM 1268 N N     . THR B 1 28  ? -53.695 -12.667 2.004   1.00 43.85  ?  26  THR A N     1 
ATOM 1269 C CA    . THR B 1 28  ? -53.496 -11.256 1.727   1.00 42.97  ?  26  THR A CA    1 
ATOM 1270 C C     . THR B 1 28  ? -52.012 -10.968 1.554   1.00 42.57  ?  26  THR A C     1 
ATOM 1271 O O     . THR B 1 28  ? -51.154 -11.762 1.944   1.00 44.63  ?  26  THR A O     1 
ATOM 1272 C CB    . THR B 1 28  ? -54.076 -10.392 2.843   1.00 40.90  ?  26  THR A CB    1 
ATOM 1273 O OG1   . THR B 1 28  ? -53.327 -10.594 4.043   1.00 38.92  ?  26  THR A OG1   1 
ATOM 1274 C CG2   . THR B 1 28  ? -55.522 -10.762 3.091   1.00 41.96  ?  26  THR A CG2   1 
ATOM 1275 N N     . GLN B 1 29  ? -51.719 -9.821  0.940   1.00 36.71  ?  27  GLN A N     1 
ATOM 1276 C CA    . GLN B 1 29  ? -50.330 -9.431  0.732   1.00 37.04  ?  27  GLN A CA    1 
ATOM 1277 C C     . GLN B 1 29  ? -49.563 -9.407  2.045   1.00 38.44  ?  27  GLN A C     1 
ATOM 1278 O O     . GLN B 1 29  ? -48.394 -9.805  2.101   1.00 35.23  ?  27  GLN A O     1 
ATOM 1279 C CB    . GLN B 1 29  ? -50.273 -8.071  0.039   1.00 36.70  ?  27  GLN A CB    1 
ATOM 1280 C CG    . GLN B 1 29  ? -50.431 -8.153  -1.464  1.00 35.70  ?  27  GLN A CG    1 
ATOM 1281 C CD    . GLN B 1 29  ? -50.572 -6.801  -2.112  1.00 34.29  ?  27  GLN A CD    1 
ATOM 1282 O OE1   . GLN B 1 29  ? -50.657 -5.783  -1.433  1.00 34.39  ?  27  GLN A OE1   1 
ATOM 1283 N NE2   . GLN B 1 29  ? -50.600 -6.782  -3.437  1.00 33.47  ?  27  GLN A NE2   1 
ATOM 1284 N N     . THR B 1 30  ? -50.207 -8.944  3.116   1.00 39.64  ?  28  THR A N     1 
ATOM 1285 C CA    . THR B 1 30  ? -49.581 -8.985  4.431   1.00 36.84  ?  28  THR A CA    1 
ATOM 1286 C C     . THR B 1 30  ? -49.405 -10.415 4.919   1.00 37.04  ?  28  THR A C     1 
ATOM 1287 O O     . THR B 1 30  ? -48.421 -10.719 5.602   1.00 39.82  ?  28  THR A O     1 
ATOM 1288 C CB    . THR B 1 30  ? -50.416 -8.186  5.428   1.00 36.41  ?  28  THR A CB    1 
ATOM 1289 O OG1   . THR B 1 30  ? -50.674 -6.881  4.899   1.00 36.09  ?  28  THR A OG1   1 
ATOM 1290 C CG2   . THR B 1 30  ? -49.684 -8.049  6.745   1.00 28.44  ?  28  THR A CG2   1 
ATOM 1291 N N     . ASN B 1 31  ? -50.338 -11.305 4.574   1.00 36.45  ?  29  ASN A N     1 
ATOM 1292 C CA    . ASN B 1 31  ? -50.252 -12.692 5.018   1.00 38.60  ?  29  ASN A CA    1 
ATOM 1293 C C     . ASN B 1 31  ? -49.130 -13.438 4.310   1.00 37.25  ?  29  ASN A C     1 
ATOM 1294 O O     . ASN B 1 31  ? -48.406 -14.219 4.938   1.00 37.21  ?  29  ASN A O     1 
ATOM 1295 C CB    . ASN B 1 31  ? -51.586 -13.400 4.788   1.00 42.84  ?  29  ASN A CB    1 
ATOM 1296 C CG    . ASN B 1 31  ? -52.662 -12.939 5.744   1.00 48.10  ?  29  ASN A CG    1 
ATOM 1297 O OD1   . ASN B 1 31  ? -52.383 -12.245 6.718   1.00 53.25  ?  29  ASN A OD1   1 
ATOM 1298 N ND2   . ASN B 1 31  ? -53.900 -13.328 5.473   1.00 48.23  ?  29  ASN A ND2   1 
ATOM 1299 N N     . VAL B 1 32  ? -48.979 -13.222 3.003   1.00 36.54  ?  30  VAL A N     1 
ATOM 1300 C CA    . VAL B 1 32  ? -47.915 -13.888 2.258   1.00 36.50  ?  30  VAL A CA    1 
ATOM 1301 C C     . VAL B 1 32  ? -46.552 -13.485 2.797   1.00 38.83  ?  30  VAL A C     1 
ATOM 1302 O O     . VAL B 1 32  ? -45.662 -14.325 2.960   1.00 41.18  ?  30  VAL A O     1 
ATOM 1303 C CB    . VAL B 1 32  ? -48.041 -13.577 0.756   1.00 32.87  ?  30  VAL A CB    1 
ATOM 1304 C CG1   . VAL B 1 32  ? -46.820 -14.062 0.010   1.00 31.53  ?  30  VAL A CG1   1 
ATOM 1305 C CG2   . VAL B 1 32  ? -49.284 -14.216 0.195   1.00 32.08  ?  30  VAL A CG2   1 
ATOM 1306 N N     . GLY B 1 33  ? -46.369 -12.201 3.098   1.00 38.62  ?  31  GLY A N     1 
ATOM 1307 C CA    . GLY B 1 33  ? -45.103 -11.762 3.659   1.00 38.94  ?  31  GLY A CA    1 
ATOM 1308 C C     . GLY B 1 33  ? -44.783 -12.428 4.982   1.00 39.55  ?  31  GLY A C     1 
ATOM 1309 O O     . GLY B 1 33  ? -43.628 -12.750 5.261   1.00 38.90  ?  31  GLY A O     1 
ATOM 1310 N N     . GLU B 1 34  ? -45.806 -12.670 5.801   1.00 40.54  ?  32  GLU A N     1 
ATOM 1311 C CA    . GLU B 1 34  ? -45.590 -13.326 7.085   1.00 43.06  ?  32  GLU A CA    1 
ATOM 1312 C C     . GLU B 1 34  ? -45.413 -14.827 6.916   1.00 44.18  ?  32  GLU A C     1 
ATOM 1313 O O     . GLU B 1 34  ? -44.576 -15.434 7.590   1.00 46.57  ?  32  GLU A O     1 
ATOM 1314 C CB    . GLU B 1 34  ? -46.742 -13.025 8.043   1.00 44.14  ?  32  GLU A CB    1 
ATOM 1315 C CG    . GLU B 1 34  ? -46.913 -11.553 8.358   1.00 45.01  ?  32  GLU A CG    1 
ATOM 1316 C CD    . GLU B 1 34  ? -47.866 -11.316 9.506   1.00 48.01  ?  32  GLU A CD    1 
ATOM 1317 O OE1   . GLU B 1 34  ? -48.356 -12.307 10.081  1.00 49.99  ?  32  GLU A OE1   1 
ATOM 1318 O OE2   . GLU B 1 34  ? -48.116 -10.140 9.842   1.00 48.26  -1 32  GLU A OE2   1 
ATOM 1319 N N     . ALA B 1 35  ? -46.189 -15.441 6.030   1.00 43.55  ?  33  ALA A N     1 
ATOM 1320 C CA    . ALA B 1 35  ? -46.159 -16.885 5.871   1.00 45.18  ?  33  ALA A CA    1 
ATOM 1321 C C     . ALA B 1 35  ? -44.977 -17.360 5.039   1.00 48.28  ?  33  ALA A C     1 
ATOM 1322 O O     . ALA B 1 35  ? -45.034 -18.451 4.465   1.00 50.72  ?  33  ALA A O     1 
ATOM 1323 C CB    . ALA B 1 35  ? -47.468 -17.371 5.246   1.00 42.47  ?  33  ALA A CB    1 
ATOM 1324 N N     . LEU B 1 36  ? -43.904 -16.575 4.974   1.00 48.24  ?  34  LEU A N     1 
ATOM 1325 C CA    . LEU B 1 36  ? -42.698 -16.963 4.264   1.00 47.98  ?  34  LEU A CA    1 
ATOM 1326 C C     . LEU B 1 36  ? -41.567 -17.347 5.200   1.00 52.18  ?  34  LEU A C     1 
ATOM 1327 O O     . LEU B 1 36  ? -40.581 -17.931 4.745   1.00 55.33  ?  34  LEU A O     1 
ATOM 1328 C CB    . LEU B 1 36  ? -42.212 -15.821 3.363   1.00 44.99  ?  34  LEU A CB    1 
ATOM 1329 C CG    . LEU B 1 36  ? -42.340 -15.937 1.847   1.00 45.02  ?  34  LEU A CG    1 
ATOM 1330 C CD1   . LEU B 1 36  ? -43.752 -16.269 1.444   1.00 46.45  ?  34  LEU A CD1   1 
ATOM 1331 C CD2   . LEU B 1 36  ? -41.884 -14.658 1.179   1.00 43.36  ?  34  LEU A CD2   1 
ATOM 1332 N N     . ALA B 1 37  ? -41.688 -17.042 6.491   1.00 53.07  ?  35  ALA A N     1 
ATOM 1333 C CA    . ALA B 1 37  ? -40.670 -17.451 7.446   1.00 58.44  ?  35  ALA A CA    1 
ATOM 1334 C C     . ALA B 1 37  ? -40.542 -18.962 7.542   1.00 63.32  ?  35  ALA A C     1 
ATOM 1335 O O     . ALA B 1 37  ? -39.499 -19.457 7.980   1.00 69.27  ?  35  ALA A O     1 
ATOM 1336 C CB    . ALA B 1 37  ? -40.983 -16.867 8.823   1.00 60.18  ?  35  ALA A CB    1 
ATOM 1337 N N     . ALA B 1 38  ? -41.570 -19.705 7.135   1.00 61.19  ?  36  ALA A N     1 
ATOM 1338 C CA    . ALA B 1 38  ? -41.498 -21.157 7.222   1.00 63.82  ?  36  ALA A CA    1 
ATOM 1339 C C     . ALA B 1 38  ? -40.575 -21.747 6.168   1.00 67.81  ?  36  ALA A C     1 
ATOM 1340 O O     . ALA B 1 38  ? -39.915 -22.759 6.425   1.00 75.04  ?  36  ALA A O     1 
ATOM 1341 C CB    . ALA B 1 38  ? -42.895 -21.758 7.098   1.00 62.10  ?  36  ALA A CB    1 
ATOM 1342 N N     . VAL B 1 39  ? -40.506 -21.137 4.987   1.00 64.79  ?  37  VAL A N     1 
ATOM 1343 C CA    . VAL B 1 39  ? -39.688 -21.649 3.896   1.00 69.08  ?  37  VAL A CA    1 
ATOM 1344 C C     . VAL B 1 39  ? -38.481 -20.777 3.609   1.00 68.02  ?  37  VAL A C     1 
ATOM 1345 O O     . VAL B 1 39  ? -37.683 -21.119 2.728   1.00 73.00  ?  37  VAL A O     1 
ATOM 1346 C CB    . VAL B 1 39  ? -40.521 -21.849 2.618   1.00 72.16  ?  37  VAL A CB    1 
ATOM 1347 C CG1   . VAL B 1 39  ? -41.775 -22.641 2.931   1.00 39.47  ?  37  VAL A CG1   1 
ATOM 1348 C CG2   . VAL B 1 39  ? -40.869 -20.513 1.998   1.00 72.42  ?  37  VAL A CG2   1 
ATOM 1349 N N     . HIS B 1 40  ? -38.324 -19.656 4.307   1.00 62.03  ?  38  HIS A N     1 
ATOM 1350 C CA    . HIS B 1 40  ? -37.226 -18.742 4.019   1.00 66.06  ?  38  HIS A CA    1 
ATOM 1351 C C     . HIS B 1 40  ? -36.394 -18.473 5.265   1.00 74.54  ?  38  HIS A C     1 
ATOM 1352 O O     . HIS B 1 40  ? -35.183 -18.258 5.172   1.00 76.03  ?  38  HIS A O     1 
ATOM 1353 C CB    . HIS B 1 40  ? -37.754 -17.428 3.444   1.00 63.07  ?  38  HIS A CB    1 
ATOM 1354 C CG    . HIS B 1 40  ? -36.679 -16.463 3.057   1.00 63.78  ?  38  HIS A CG    1 
ATOM 1355 N ND1   . HIS B 1 40  ? -36.435 -15.303 3.757   1.00 64.08  ?  38  HIS A ND1   1 
ATOM 1356 C CD2   . HIS B 1 40  ? -35.781 -16.485 2.044   1.00 64.28  ?  38  HIS A CD2   1 
ATOM 1357 C CE1   . HIS B 1 40  ? -35.437 -14.649 3.191   1.00 64.62  ?  38  HIS A CE1   1 
ATOM 1358 N NE2   . HIS B 1 40  ? -35.022 -15.346 2.150   1.00 64.57  ?  38  HIS A NE2   1 
ATOM 1359 N N     . GLY B 1 41  ? -37.030 -18.482 6.431   1.00 64.88  ?  39  GLY A N     1 
ATOM 1360 C CA    . GLY B 1 41  ? -36.350 -18.192 7.673   1.00 70.85  ?  39  GLY A CA    1 
ATOM 1361 C C     . GLY B 1 41  ? -36.496 -16.766 8.142   1.00 71.69  ?  39  GLY A C     1 
ATOM 1362 O O     . GLY B 1 41  ? -35.938 -16.412 9.188   1.00 75.73  ?  39  GLY A O     1 
ATOM 1363 N N     . SER B 1 42  ? -37.231 -15.944 7.405   1.00 66.75  ?  40  SER A N     1 
ATOM 1364 C CA    . SER B 1 42  ? -37.446 -14.540 7.712   1.00 62.46  ?  40  SER A CA    1 
ATOM 1365 C C     . SER B 1 42  ? -38.577 -14.053 6.826   1.00 57.37  ?  40  SER A C     1 
ATOM 1366 O O     . SER B 1 42  ? -38.729 -14.512 5.692   1.00 59.07  ?  40  SER A O     1 
ATOM 1367 C CB    . SER B 1 42  ? -36.181 -13.705 7.484   1.00 61.04  ?  40  SER A CB    1 
ATOM 1368 O OG    . SER B 1 42  ? -35.557 -14.042 6.259   1.00 60.58  ?  40  SER A OG    1 
ATOM 1369 N N     . GLU B 1 43  ? -39.359 -13.123 7.348   1.00 47.73  ?  41  GLU A N     1 
ATOM 1370 C CA    . GLU B 1 43  ? -40.561 -12.673 6.671   1.00 43.70  ?  41  GLU A CA    1 
ATOM 1371 C C     . GLU B 1 43  ? -40.291 -11.410 5.866   1.00 37.69  ?  41  GLU A C     1 
ATOM 1372 O O     . GLU B 1 43  ? -39.284 -10.724 6.044   1.00 38.56  ?  41  GLU A O     1 
ATOM 1373 C CB    . GLU B 1 43  ? -41.686 -12.441 7.683   1.00 50.45  ?  41  GLU A CB    1 
ATOM 1374 C CG    . GLU B 1 43  ? -41.292 -11.626 8.899   1.00 56.84  ?  41  GLU A CG    1 
ATOM 1375 C CD    . GLU B 1 43  ? -42.356 -11.646 9.981   1.00 62.39  ?  41  GLU A CD    1 
ATOM 1376 O OE1   . GLU B 1 43  ? -43.131 -12.622 10.042  1.00 64.23  ?  41  GLU A OE1   1 
ATOM 1377 O OE2   . GLU B 1 43  ? -42.422 -10.682 10.770  1.00 64.34  -1 41  GLU A OE2   1 
ATOM 1378 N N     . PHE B 1 44  ? -41.212 -11.120 4.953   1.00 32.75  ?  42  PHE A N     1 
ATOM 1379 C CA    . PHE B 1 44  ? -41.182 -9.937  4.121   1.00 31.84  ?  42  PHE A CA    1 
ATOM 1380 C C     . PHE B 1 44  ? -42.324 -9.011  4.534   1.00 32.62  ?  42  PHE A C     1 
ATOM 1381 O O     . PHE B 1 44  ? -42.899 -9.160  5.620   1.00 35.05  ?  42  PHE A O     1 
ATOM 1382 C CB    . PHE B 1 44  ? -41.251 -10.342 2.649   1.00 33.84  ?  42  PHE A CB    1 
ATOM 1383 C CG    . PHE B 1 44  ? -39.932 -10.765 2.075   1.00 35.28  ?  42  PHE A CG    1 
ATOM 1384 C CD1   . PHE B 1 44  ? -39.029 -9.825  1.619   1.00 31.56  ?  42  PHE A CD1   1 
ATOM 1385 C CD2   . PHE B 1 44  ? -39.595 -12.101 1.993   1.00 36.73  ?  42  PHE A CD2   1 
ATOM 1386 C CE1   . PHE B 1 44  ? -37.818 -10.211 1.094   1.00 28.98  ?  42  PHE A CE1   1 
ATOM 1387 C CE2   . PHE B 1 44  ? -38.388 -12.490 1.467   1.00 34.18  ?  42  PHE A CE2   1 
ATOM 1388 C CZ    . PHE B 1 44  ? -37.499 -11.544 1.017   1.00 30.71  ?  42  PHE A CZ    1 
ATOM 1389 N N     . SER B 1 45  ? -42.654 -8.059  3.670   1.00 31.96  ?  43  SER A N     1 
ATOM 1390 C CA    . SER B 1 45  ? -43.642 -7.039  3.971   1.00 31.00  ?  43  SER A CA    1 
ATOM 1391 C C     . SER B 1 45  ? -44.650 -6.964  2.837   1.00 33.12  ?  43  SER A C     1 
ATOM 1392 O O     . SER B 1 45  ? -44.372 -7.367  1.706   1.00 35.92  ?  43  SER A O     1 
ATOM 1393 C CB    . SER B 1 45  ? -42.990 -5.668  4.188   1.00 24.88  ?  43  SER A CB    1 
ATOM 1394 O OG    . SER B 1 45  ? -42.138 -5.336  3.110   1.00 21.07  ?  43  SER A OG    1 
ATOM 1395 N N     . GLN B 1 46  ? -45.840 -6.457  3.162   1.00 31.06  ?  44  GLN A N     1 
ATOM 1396 C CA    . GLN B 1 46  ? -46.864 -6.276  2.141   1.00 29.71  ?  44  GLN A CA    1 
ATOM 1397 C C     . GLN B 1 46  ? -46.375 -5.364  1.028   1.00 29.31  ?  44  GLN A C     1 
ATOM 1398 O O     . GLN B 1 46  ? -46.740 -5.548  -0.137  1.00 30.84  ?  44  GLN A O     1 
ATOM 1399 C CB    . GLN B 1 46  ? -48.135 -5.715  2.777   1.00 28.39  ?  44  GLN A CB    1 
ATOM 1400 C CG    . GLN B 1 46  ? -49.099 -5.081  1.798   1.00 27.12  ?  44  GLN A CG    1 
ATOM 1401 C CD    . GLN B 1 46  ? -49.065 -3.575  1.854   1.00 25.52  ?  44  GLN A CD    1 
ATOM 1402 O OE1   . GLN B 1 46  ? -48.899 -2.988  2.920   1.00 27.10  ?  44  GLN A OE1   1 
ATOM 1403 N NE2   . GLN B 1 46  ? -49.215 -2.937  0.702   1.00 22.81  ?  44  GLN A NE2   1 
ATOM 1404 N N     . THR B 1 47  ? -45.534 -4.389  1.366   1.00 26.64  ?  45  THR A N     1 
ATOM 1405 C CA    . THR B 1 47  ? -44.928 -3.539  0.352   1.00 27.76  ?  45  THR A CA    1 
ATOM 1406 C C     . THR B 1 47  ? -44.082 -4.357  -0.614  1.00 31.14  ?  45  THR A C     1 
ATOM 1407 O O     . THR B 1 47  ? -44.198 -4.216  -1.834  1.00 32.64  ?  45  THR A O     1 
ATOM 1408 C CB    . THR B 1 47  ? -44.089 -2.460  1.025   1.00 27.21  ?  45  THR A CB    1 
ATOM 1409 O OG1   . THR B 1 47  ? -44.711 -2.076  2.256   1.00 29.37  ?  45  THR A OG1   1 
ATOM 1410 C CG2   . THR B 1 47  ? -43.984 -1.257  0.134   1.00 25.17  ?  45  THR A CG2   1 
ATOM 1411 N N     . THR B 1 48  ? -43.220 -5.222  -0.079  1.00 31.75  ?  46  THR A N     1 
ATOM 1412 C CA    . THR B 1 48  ? -42.350 -6.031  -0.925  1.00 28.86  ?  46  THR A CA    1 
ATOM 1413 C C     . THR B 1 48  ? -43.153 -6.962  -1.820  1.00 26.19  ?  46  THR A C     1 
ATOM 1414 O O     . THR B 1 48  ? -42.852 -7.102  -3.010  1.00 17.71  ?  46  THR A O     1 
ATOM 1415 C CB    . THR B 1 48  ? -41.384 -6.830  -0.058  1.00 31.41  ?  46  THR A CB    1 
ATOM 1416 O OG1   . THR B 1 48  ? -40.496 -5.932  0.617   1.00 34.14  ?  46  THR A OG1   1 
ATOM 1417 C CG2   . THR B 1 48  ? -40.576 -7.783  -0.904  1.00 31.14  ?  46  THR A CG2   1 
ATOM 1418 N N     . ILE B 1 49  ? -44.173 -7.613  -1.264  1.00 27.32  ?  47  ILE A N     1 
ATOM 1419 C CA    . ILE B 1 49  ? -45.012 -8.511  -2.052  1.00 26.47  ?  47  ILE A CA    1 
ATOM 1420 C C     . ILE B 1 49  ? -45.759 -7.738  -3.132  1.00 26.59  ?  47  ILE A C     1 
ATOM 1421 O O     . ILE B 1 49  ? -45.832 -8.167  -4.289  1.00 26.44  ?  47  ILE A O     1 
ATOM 1422 C CB    . ILE B 1 49  ? -45.978 -9.279  -1.135  1.00 25.80  ?  47  ILE A CB    1 
ATOM 1423 C CG1   . ILE B 1 49  ? -45.194 -10.053 -0.076  1.00 25.96  ?  47  ILE A CG1   1 
ATOM 1424 C CG2   . ILE B 1 49  ? -46.859 -10.208 -1.945  1.00 26.15  ?  47  ILE A CG2   1 
ATOM 1425 C CD1   . ILE B 1 49  ? -44.150 -10.973 -0.643  1.00 26.55  ?  47  ILE A CD1   1 
ATOM 1426 N N     . CYS B 1 50  ? -46.338 -6.591  -2.766  1.00 25.14  ?  48  CYS A N     1 
ATOM 1427 C CA    . CYS B 1 50  ? -47.043 -5.764  -3.742  1.00 24.28  ?  48  CYS A CA    1 
ATOM 1428 C C     . CYS B 1 50  ? -46.135 -5.371  -4.897  1.00 25.60  ?  48  CYS A C     1 
ATOM 1429 O O     . CYS B 1 50  ? -46.553 -5.392  -6.060  1.00 29.87  ?  48  CYS A O     1 
ATOM 1430 C CB    . CYS B 1 50  ? -47.606 -4.515  -3.065  1.00 22.18  ?  48  CYS A CB    1 
ATOM 1431 S SG    . CYS B 1 50  ? -48.368 -3.330  -4.189  1.00 22.43  ?  48  CYS A SG    1 
ATOM 1432 N N     . ARG B 1 51  ? -44.894 -4.998  -4.595  1.00 22.04  ?  49  ARG A N     1 
ATOM 1433 C CA    . ARG B 1 51  ? -43.953 -4.632  -5.644  1.00 20.21  ?  49  ARG A CA    1 
ATOM 1434 C C     . ARG B 1 51  ? -43.697 -5.790  -6.598  1.00 21.40  ?  49  ARG A C     1 
ATOM 1435 O O     . ARG B 1 51  ? -43.554 -5.584  -7.808  1.00 21.19  ?  49  ARG A O     1 
ATOM 1436 C CB    . ARG B 1 51  ? -42.646 -4.152  -5.018  1.00 18.28  ?  49  ARG A CB    1 
ATOM 1437 C CG    . ARG B 1 51  ? -42.762 -2.852  -4.254  1.00 16.84  ?  49  ARG A CG    1 
ATOM 1438 C CD    . ARG B 1 51  ? -41.416 -2.160  -4.150  1.00 18.09  ?  49  ARG A CD    1 
ATOM 1439 N NE    . ARG B 1 51  ? -41.505 -0.895  -3.429  1.00 19.54  ?  49  ARG A NE    1 
ATOM 1440 C CZ    . ARG B 1 51  ? -41.136 -0.730  -2.165  1.00 19.00  ?  49  ARG A CZ    1 
ATOM 1441 N NH1   . ARG B 1 51  ? -40.647 -1.748  -1.478  1.00 19.42  1  49  ARG A NH1   1 
ATOM 1442 N NH2   . ARG B 1 51  ? -41.254 0.456   -1.591  1.00 17.87  ?  49  ARG A NH2   1 
ATOM 1443 N N     . PHE B 1 52  ? -43.639 -7.017  -6.077  1.00 22.75  ?  50  PHE A N     1 
ATOM 1444 C CA    . PHE B 1 52  ? -43.375 -8.169  -6.933  1.00 25.09  ?  50  PHE A CA    1 
ATOM 1445 C C     . PHE B 1 52  ? -44.539 -8.441  -7.874  1.00 28.19  ?  50  PHE A C     1 
ATOM 1446 O O     . PHE B 1 52  ? -44.340 -8.641  -9.076  1.00 29.52  ?  50  PHE A O     1 
ATOM 1447 C CB    . PHE B 1 52  ? -43.072 -9.404  -6.090  1.00 26.29  ?  50  PHE A CB    1 
ATOM 1448 C CG    . PHE B 1 52  ? -42.818 -10.635 -6.907  1.00 29.43  ?  50  PHE A CG    1 
ATOM 1449 C CD1   . PHE B 1 52  ? -41.579 -10.863 -7.470  1.00 30.57  ?  50  PHE A CD1   1 
ATOM 1450 C CD2   . PHE B 1 52  ? -43.814 -11.571 -7.100  1.00 30.25  ?  50  PHE A CD2   1 
ATOM 1451 C CE1   . PHE B 1 52  ? -41.347 -11.988 -8.224  1.00 30.71  ?  50  PHE A CE1   1 
ATOM 1452 C CE2   . PHE B 1 52  ? -43.584 -12.697 -7.849  1.00 31.13  ?  50  PHE A CE2   1 
ATOM 1453 C CZ    . PHE B 1 52  ? -42.348 -12.907 -8.411  1.00 30.77  ?  50  PHE A CZ    1 
ATOM 1454 N N     . GLU B 1 53  ? -45.760 -8.471  -7.341  1.00 29.12  ?  51  GLU A N     1 
ATOM 1455 C CA    . GLU B 1 53  ? -46.927 -8.719  -8.177  1.00 30.07  ?  51  GLU A CA    1 
ATOM 1456 C C     . GLU B 1 53  ? -47.010 -7.713  -9.313  1.00 32.46  ?  51  GLU A C     1 
ATOM 1457 O O     . GLU B 1 53  ? -47.396 -8.059  -10.434 1.00 36.98  ?  51  GLU A O     1 
ATOM 1458 C CB    . GLU B 1 53  ? -48.195 -8.670  -7.330  1.00 32.28  ?  51  GLU A CB    1 
ATOM 1459 C CG    . GLU B 1 53  ? -48.425 -9.902  -6.481  1.00 37.55  ?  51  GLU A CG    1 
ATOM 1460 C CD    . GLU B 1 53  ? -49.676 -9.796  -5.641  1.00 44.73  ?  51  GLU A CD    1 
ATOM 1461 O OE1   . GLU B 1 53  ? -50.356 -8.754  -5.719  1.00 47.30  ?  51  GLU A OE1   1 
ATOM 1462 O OE2   . GLU B 1 53  ? -49.983 -10.752 -4.906  1.00 48.12  -1 51  GLU A OE2   1 
ATOM 1463 N N     . ASN B 1 54  ? -46.660 -6.462  -9.038  1.00 31.07  ?  52  ASN A N     1 
ATOM 1464 C CA    . ASN B 1 54  ? -46.648 -5.407  -10.039 1.00 33.55  ?  52  ASN A CA    1 
ATOM 1465 C C     . ASN B 1 54  ? -45.301 -5.255  -10.730 1.00 37.19  ?  52  ASN A C     1 
ATOM 1466 O O     . ASN B 1 54  ? -45.144 -4.340  -11.542 1.00 41.11  ?  52  ASN A O     1 
ATOM 1467 C CB    . ASN B 1 54  ? -47.035 -4.078  -9.392  1.00 34.04  ?  52  ASN A CB    1 
ATOM 1468 C CG    . ASN B 1 54  ? -48.391 -4.128  -8.734  1.00 37.67  ?  52  ASN A CG    1 
ATOM 1469 O OD1   . ASN B 1 54  ? -49.408 -3.825  -9.354  1.00 41.13  ?  52  ASN A OD1   1 
ATOM 1470 N ND2   . ASN B 1 54  ? -48.416 -4.528  -7.473  1.00 36.86  ?  52  ASN A ND2   1 
ATOM 1471 N N     . LEU B 1 55  ? -44.338 -6.130  -10.441 1.00 35.70  ?  53  LEU A N     1 
ATOM 1472 C CA    . LEU B 1 55  ? -42.993 -6.050  -11.014 1.00 36.05  ?  53  LEU A CA    1 
ATOM 1473 C C     . LEU B 1 55  ? -42.379 -4.671  -10.803 1.00 34.43  ?  53  LEU A C     1 
ATOM 1474 O O     . LEU B 1 55  ? -41.780 -4.087  -11.706 1.00 34.54  ?  53  LEU A O     1 
ATOM 1475 C CB    . LEU B 1 55  ? -42.985 -6.429  -12.495 1.00 38.33  ?  53  LEU A CB    1 
ATOM 1476 C CG    . LEU B 1 55  ? -42.881 -7.919  -12.823 1.00 40.49  ?  53  LEU A CG    1 
ATOM 1477 C CD1   . LEU B 1 55  ? -44.083 -8.650  -12.330 1.00 41.11  ?  53  LEU A CD1   1 
ATOM 1478 C CD2   . LEU B 1 55  ? -42.723 -8.133  -14.311 1.00 42.81  ?  53  LEU A CD2   1 
ATOM 1479 N N     . GLN B 1 56  ? -42.535 -4.145  -9.596  1.00 31.97  ?  54  GLN A N     1 
ATOM 1480 C CA    . GLN B 1 56  ? -41.892 -2.893  -9.210  1.00 31.05  ?  54  GLN A CA    1 
ATOM 1481 C C     . GLN B 1 56  ? -40.644 -3.190  -8.385  1.00 28.80  ?  54  GLN A C     1 
ATOM 1482 O O     . GLN B 1 56  ? -40.513 -2.814  -7.223  1.00 24.76  ?  54  GLN A O     1 
ATOM 1483 C CB    . GLN B 1 56  ? -42.872 -2.006  -8.453  1.00 33.29  ?  54  GLN A CB    1 
ATOM 1484 C CG    . GLN B 1 56  ? -44.061 -1.564  -9.283  1.00 31.86  ?  54  GLN A CG    1 
ATOM 1485 C CD    . GLN B 1 56  ? -45.072 -0.775  -8.484  1.00 30.32  ?  54  GLN A CD    1 
ATOM 1486 O OE1   . GLN B 1 56  ? -45.025 -0.744  -7.258  1.00 29.54  ?  54  GLN A OE1   1 
ATOM 1487 N NE2   . GLN B 1 56  ? -45.996 -0.129  -9.180  1.00 29.56  ?  54  GLN A NE2   1 
ATOM 1488 N N     . LEU B 1 57  ? -39.721 -3.895  -9.033  1.00 31.42  ?  55  LEU A N     1 
ATOM 1489 C CA    . LEU B 1 57  ? -38.412 -4.200  -8.479  1.00 31.61  ?  55  LEU A CA    1 
ATOM 1490 C C     . LEU B 1 57  ? -37.425 -4.309  -9.628  1.00 31.70  ?  55  LEU A C     1 
ATOM 1491 O O     . LEU B 1 57  ? -37.804 -4.319  -10.799 1.00 32.11  ?  55  LEU A O     1 
ATOM 1492 C CB    . LEU B 1 57  ? -38.414 -5.519  -7.697  1.00 30.55  ?  55  LEU A CB    1 
ATOM 1493 C CG    . LEU B 1 57  ? -39.506 -5.861  -6.691  1.00 30.38  ?  55  LEU A CG    1 
ATOM 1494 C CD1   . LEU B 1 57  ? -39.558 -7.354  -6.493  1.00 27.77  ?  55  LEU A CD1   1 
ATOM 1495 C CD2   . LEU B 1 57  ? -39.236 -5.170  -5.376  1.00 33.02  ?  55  LEU A CD2   1 
ATOM 1496 N N     . SER B 1 58  ? -36.149 -4.410  -9.280  1.00 31.35  ?  56  SER A N     1 
ATOM 1497 C CA    . SER B 1 58  ? -35.132 -4.577  -10.300 1.00 30.76  ?  56  SER A CA    1 
ATOM 1498 C C     . SER B 1 58  ? -35.238 -5.970  -10.909 1.00 33.50  ?  56  SER A C     1 
ATOM 1499 O O     . SER B 1 58  ? -35.834 -6.883  -10.334 1.00 33.77  ?  56  SER A O     1 
ATOM 1500 C CB    . SER B 1 58  ? -33.736 -4.345  -9.725  1.00 27.01  ?  56  SER A CB    1 
ATOM 1501 O OG    . SER B 1 58  ? -33.397 -5.324  -8.765  1.00 24.58  ?  56  SER A OG    1 
ATOM 1502 N N     . PHE B 1 59  ? -34.661 -6.124  -12.100 1.00 34.51  ?  57  PHE A N     1 
ATOM 1503 C CA    . PHE B 1 59  ? -34.692 -7.421  -12.764 1.00 34.27  ?  57  PHE A CA    1 
ATOM 1504 C C     . PHE B 1 59  ? -34.046 -8.493  -11.898 1.00 38.38  ?  57  PHE A C     1 
ATOM 1505 O O     . PHE B 1 59  ? -34.580 -9.599  -11.765 1.00 41.08  ?  57  PHE A O     1 
ATOM 1506 C CB    . PHE B 1 59  ? -33.997 -7.330  -14.119 1.00 33.65  ?  57  PHE A CB    1 
ATOM 1507 C CG    . PHE B 1 59  ? -33.866 -8.646  -14.819 1.00 36.80  ?  57  PHE A CG    1 
ATOM 1508 C CD1   . PHE B 1 59  ? -34.971 -9.260  -15.373 1.00 38.63  ?  57  PHE A CD1   1 
ATOM 1509 C CD2   . PHE B 1 59  ? -32.642 -9.277  -14.912 1.00 37.92  ?  57  PHE A CD2   1 
ATOM 1510 C CE1   . PHE B 1 59  ? -34.854 -10.470 -16.014 1.00 39.50  ?  57  PHE A CE1   1 
ATOM 1511 C CE2   . PHE B 1 59  ? -32.523 -10.489 -15.552 1.00 38.37  ?  57  PHE A CE2   1 
ATOM 1512 C CZ    . PHE B 1 59  ? -33.630 -11.085 -16.101 1.00 38.72  ?  57  PHE A CZ    1 
ATOM 1513 N N     . LYS B 1 60  ? -32.894 -8.186  -11.300 1.00 38.87  ?  58  LYS A N     1 
ATOM 1514 C CA    . LYS B 1 60  ? -32.232 -9.151  -10.429 1.00 37.09  ?  58  LYS A CA    1 
ATOM 1515 C C     . LYS B 1 60  ? -33.061 -9.430  -9.184  1.00 36.58  ?  58  LYS A C     1 
ATOM 1516 O O     . LYS B 1 60  ? -33.179 -10.581 -8.755  1.00 36.76  ?  58  LYS A O     1 
ATOM 1517 C CB    . LYS B 1 60  ? -30.846 -8.649  -10.027 1.00 35.68  ?  58  LYS A CB    1 
ATOM 1518 C CG    . LYS B 1 60  ? -30.194 -7.686  -10.999 1.00 36.42  ?  58  LYS A CG    1 
ATOM 1519 C CD    . LYS B 1 60  ? -30.510 -6.248  -10.624 1.00 37.50  ?  58  LYS A CD    1 
ATOM 1520 C CE    . LYS B 1 60  ? -29.808 -5.263  -11.530 1.00 42.72  ?  58  LYS A CE    1 
ATOM 1521 N NZ    . LYS B 1 60  ? -30.306 -3.877  -11.321 1.00 45.15  1  58  LYS A NZ    1 
ATOM 1522 N N     . ASN B 1 61  ? -33.629 -8.384  -8.581  1.00 35.20  ?  59  ASN A N     1 
ATOM 1523 C CA    . ASN B 1 61  ? -34.439 -8.561  -7.380  1.00 36.70  ?  59  ASN A CA    1 
ATOM 1524 C C     . ASN B 1 61  ? -35.688 -9.383  -7.664  1.00 38.80  ?  59  ASN A C     1 
ATOM 1525 O O     . ASN B 1 61  ? -36.119 -10.179 -6.822  1.00 40.55  ?  59  ASN A O     1 
ATOM 1526 C CB    . ASN B 1 61  ? -34.818 -7.198  -6.807  1.00 17.60  ?  59  ASN A CB    1 
ATOM 1527 C CG    . ASN B 1 61  ? -35.305 -7.280  -5.388  1.00 23.49  ?  59  ASN A CG    1 
ATOM 1528 O OD1   . ASN B 1 61  ? -35.212 -8.323  -4.753  1.00 24.41  ?  59  ASN A OD1   1 
ATOM 1529 N ND2   . ASN B 1 61  ? -35.826 -6.175  -4.878  1.00 16.79  ?  59  ASN A ND2   1 
ATOM 1530 N N     . ALA B 1 62  ? -36.292 -9.197  -8.838  1.00 37.98  ?  60  ALA A N     1 
ATOM 1531 C CA    . ALA B 1 62  ? -37.479 -9.973  -9.178  1.00 34.23  ?  60  ALA A CA    1 
ATOM 1532 C C     . ALA B 1 62  ? -37.144 -11.451 -9.312  1.00 37.22  ?  60  ALA A C     1 
ATOM 1533 O O     . ALA B 1 62  ? -37.904 -12.309 -8.852  1.00 38.98  ?  60  ALA A O     1 
ATOM 1534 C CB    . ALA B 1 62  ? -38.104 -9.439  -10.464 1.00 29.24  ?  60  ALA A CB    1 
ATOM 1535 N N     . CYS B 1 63  ? -36.011 -11.764 -9.942  1.00 38.95  ?  61  CYS A N     1 
ATOM 1536 C CA    . CYS B 1 63  ? -35.594 -13.155 -10.071 1.00 41.39  ?  61  CYS A CA    1 
ATOM 1537 C C     . CYS B 1 63  ? -35.324 -13.780 -8.708  1.00 39.56  ?  61  CYS A C     1 
ATOM 1538 O O     . CYS B 1 63  ? -35.632 -14.956 -8.485  1.00 40.46  ?  61  CYS A O     1 
ATOM 1539 C CB    . CYS B 1 63  ? -34.356 -13.244 -10.962 1.00 43.08  ?  61  CYS A CB    1 
ATOM 1540 S SG    . CYS B 1 63  ? -34.625 -12.712 -12.669 1.00 43.59  ?  61  CYS A SG    1 
ATOM 1541 N N     . LYS B 1 64  ? -34.731 -13.015 -7.791  1.00 37.14  ?  62  LYS A N     1 
ATOM 1542 C CA    . LYS B 1 64  ? -34.511 -13.512 -6.437  1.00 38.95  ?  62  LYS A CA    1 
ATOM 1543 C C     . LYS B 1 64  ? -35.829 -13.849 -5.756  1.00 41.78  ?  62  LYS A C     1 
ATOM 1544 O O     . LYS B 1 64  ? -36.011 -14.958 -5.244  1.00 44.48  ?  62  LYS A O     1 
ATOM 1545 C CB    . LYS B 1 64  ? -33.732 -12.484 -5.619  1.00 38.24  ?  62  LYS A CB    1 
ATOM 1546 N N     . LEU B 1 65  ? -36.762 -12.895 -5.734  1.00 41.15  ?  63  LEU A N     1 
ATOM 1547 C CA    . LEU B 1 65  ? -38.028 -13.115 -5.044  1.00 38.28  ?  63  LEU A CA    1 
ATOM 1548 C C     . LEU B 1 65  ? -38.857 -14.185 -5.737  1.00 35.05  ?  63  LEU A C     1 
ATOM 1549 O O     . LEU B 1 65  ? -39.540 -14.972 -5.075  1.00 32.47  ?  63  LEU A O     1 
ATOM 1550 C CB    . LEU B 1 65  ? -38.815 -11.809 -4.940  1.00 37.91  ?  63  LEU A CB    1 
ATOM 1551 C CG    . LEU B 1 65  ? -38.599 -10.959 -3.684  1.00 38.94  ?  63  LEU A CG    1 
ATOM 1552 C CD1   . LEU B 1 65  ? -37.137 -10.635 -3.465  1.00 39.55  ?  63  LEU A CD1   1 
ATOM 1553 C CD2   . LEU B 1 65  ? -39.420 -9.691  -3.750  1.00 38.68  ?  63  LEU A CD2   1 
ATOM 1554 N N     . LYS B 1 66  ? -38.811 -14.231 -7.068  1.00 35.59  ?  64  LYS A N     1 
ATOM 1555 C CA    . LYS B 1 66  ? -39.529 -15.273 -7.793  1.00 38.19  ?  64  LYS A CA    1 
ATOM 1556 C C     . LYS B 1 66  ? -39.090 -16.659 -7.344  1.00 40.91  ?  64  LYS A C     1 
ATOM 1557 O O     . LYS B 1 66  ? -39.908 -17.581 -7.266  1.00 42.57  ?  64  LYS A O     1 
ATOM 1558 C CB    . LYS B 1 66  ? -39.317 -15.105 -9.296  1.00 38.74  ?  64  LYS A CB    1 
ATOM 1559 C CG    . LYS B 1 66  ? -40.055 -16.115 -10.146 1.00 41.50  ?  64  LYS A CG    1 
ATOM 1560 C CD    . LYS B 1 66  ? -39.874 -15.820 -11.621 1.00 42.82  ?  64  LYS A CD    1 
ATOM 1561 C CE    . LYS B 1 66  ? -40.405 -16.953 -12.477 1.00 44.00  ?  64  LYS A CE    1 
ATOM 1562 N NZ    . LYS B 1 66  ? -39.654 -18.216 -12.239 1.00 45.38  1  64  LYS A NZ    1 
ATOM 1563 N N     . ALA B 1 67  ? -37.805 -16.824 -7.033  1.00 43.82  ?  65  ALA A N     1 
ATOM 1564 C CA    . ALA B 1 67  ? -37.324 -18.109 -6.541  1.00 44.86  ?  65  ALA A CA    1 
ATOM 1565 C C     . ALA B 1 67  ? -37.894 -18.422 -5.164  1.00 47.60  ?  65  ALA A C     1 
ATOM 1566 O O     . ALA B 1 67  ? -38.381 -19.531 -4.922  1.00 49.63  ?  65  ALA A O     1 
ATOM 1567 C CB    . ALA B 1 67  ? -35.798 -18.115 -6.503  1.00 41.31  ?  65  ALA A CB    1 
ATOM 1568 N N     . ILE B 1 68  ? -37.841 -17.454 -4.247  1.00 46.37  ?  66  ILE A N     1 
ATOM 1569 C CA    . ILE B 1 68  ? -38.364 -17.669 -2.901  1.00 41.91  ?  66  ILE A CA    1 
ATOM 1570 C C     . ILE B 1 68  ? -39.866 -17.904 -2.934  1.00 41.47  ?  66  ILE A C     1 
ATOM 1571 O O     . ILE B 1 68  ? -40.385 -18.795 -2.253  1.00 43.89  ?  66  ILE A O     1 
ATOM 1572 C CB    . ILE B 1 68  ? -38.004 -16.482 -1.991  1.00 37.73  ?  66  ILE A CB    1 
ATOM 1573 C CG1   . ILE B 1 68  ? -36.546 -16.081 -2.189  1.00 38.21  ?  66  ILE A CG1   1 
ATOM 1574 C CG2   . ILE B 1 68  ? -38.252 -16.837 -0.544  1.00 34.96  ?  66  ILE A CG2   1 
ATOM 1575 C CD1   . ILE B 1 68  ? -36.125 -14.908 -1.343  1.00 37.44  ?  66  ILE A CD1   1 
ATOM 1576 N N     . LEU B 1 69  ? -40.590 -17.112 -3.722  1.00 38.86  ?  67  LEU A N     1 
ATOM 1577 C CA    . LEU B 1 69  ? -42.043 -17.217 -3.712  1.00 42.12  ?  67  LEU A CA    1 
ATOM 1578 C C     . LEU B 1 69  ? -42.526 -18.477 -4.415  1.00 46.84  ?  67  LEU A C     1 
ATOM 1579 O O     . LEU B 1 69  ? -43.540 -19.054 -4.008  1.00 52.21  ?  67  LEU A O     1 
ATOM 1580 C CB    . LEU B 1 69  ? -42.675 -15.970 -4.332  1.00 41.34  ?  67  LEU A CB    1 
ATOM 1581 C CG    . LEU B 1 69  ? -42.833 -14.719 -3.456  1.00 39.96  ?  67  LEU A CG    1 
ATOM 1582 C CD1   . LEU B 1 69  ? -41.529 -14.208 -2.881  1.00 42.10  ?  67  LEU A CD1   1 
ATOM 1583 C CD2   . LEU B 1 69  ? -43.513 -13.617 -4.242  1.00 36.56  ?  67  LEU A CD2   1 
ATOM 1584 N N     . SER B 1 70  ? -41.829 -18.921 -5.463  1.00 44.40  ?  68  SER A N     1 
ATOM 1585 C CA    . SER B 1 70  ? -42.233 -20.155 -6.129  1.00 45.91  ?  68  SER A CA    1 
ATOM 1586 C C     . SER B 1 70  ? -42.107 -21.337 -5.183  1.00 45.67  ?  68  SER A C     1 
ATOM 1587 O O     . SER B 1 70  ? -42.977 -22.214 -5.149  1.00 45.04  ?  68  SER A O     1 
ATOM 1588 C CB    . SER B 1 70  ? -41.391 -20.388 -7.382  1.00 48.36  ?  68  SER A CB    1 
ATOM 1589 O OG    . SER B 1 70  ? -41.089 -19.170 -8.032  1.00 48.73  ?  68  SER A OG    1 
ATOM 1590 N N     . LYS B 1 71  ? -41.026 -21.372 -4.401  1.00 47.10  ?  69  LYS A N     1 
ATOM 1591 C CA    . LYS B 1 71  ? -40.864 -22.416 -3.399  1.00 51.84  ?  69  LYS A CA    1 
ATOM 1592 C C     . LYS B 1 71  ? -41.959 -22.342 -2.347  1.00 56.13  ?  69  LYS A C     1 
ATOM 1593 O O     . LYS B 1 71  ? -42.394 -23.375 -1.828  1.00 59.13  ?  69  LYS A O     1 
ATOM 1594 C CB    . LYS B 1 71  ? -39.491 -22.298 -2.742  1.00 52.82  ?  69  LYS A CB    1 
ATOM 1595 C CG    . LYS B 1 71  ? -38.321 -22.487 -3.690  1.00 53.60  ?  69  LYS A CG    1 
ATOM 1596 C CD    . LYS B 1 71  ? -37.003 -22.207 -2.986  1.00 53.38  ?  69  LYS A CD    1 
ATOM 1597 C CE    . LYS B 1 71  ? -35.821 -22.406 -3.917  1.00 53.36  ?  69  LYS A CE    1 
ATOM 1598 N NZ    . LYS B 1 71  ? -34.546 -21.973 -3.281  1.00 53.42  1  69  LYS A NZ    1 
ATOM 1599 N N     . TRP B 1 72  ? -42.422 -21.134 -2.024  1.00 57.27  ?  70  TRP A N     1 
ATOM 1600 C CA    . TRP B 1 72  ? -43.504 -20.998 -1.058  1.00 58.24  ?  70  TRP A CA    1 
ATOM 1601 C C     . TRP B 1 72  ? -44.818 -21.478 -1.649  1.00 60.60  ?  70  TRP A C     1 
ATOM 1602 O O     . TRP B 1 72  ? -45.574 -22.202 -0.993  1.00 62.08  ?  70  TRP A O     1 
ATOM 1603 C CB    . TRP B 1 72  ? -43.622 -19.547 -0.598  1.00 55.70  ?  70  TRP A CB    1 
ATOM 1604 C CG    . TRP B 1 72  ? -44.821 -19.287 0.255   1.00 55.13  ?  70  TRP A CG    1 
ATOM 1605 C CD1   . TRP B 1 72  ? -44.903 -19.410 1.607   1.00 55.10  ?  70  TRP A CD1   1 
ATOM 1606 C CD2   . TRP B 1 72  ? -46.107 -18.833 -0.184  1.00 54.05  ?  70  TRP A CD2   1 
ATOM 1607 N NE1   . TRP B 1 72  ? -46.162 -19.073 2.039   1.00 53.77  ?  70  TRP A NE1   1 
ATOM 1608 C CE2   . TRP B 1 72  ? -46.920 -18.715 0.956   1.00 52.47  ?  70  TRP A CE2   1 
ATOM 1609 C CE3   . TRP B 1 72  ? -46.652 -18.524 -1.433  1.00 54.01  ?  70  TRP A CE3   1 
ATOM 1610 C CZ2   . TRP B 1 72  ? -48.243 -18.302 0.887   1.00 51.82  ?  70  TRP A CZ2   1 
ATOM 1611 C CZ3   . TRP B 1 72  ? -47.969 -18.111 -1.498  1.00 52.72  ?  70  TRP A CZ3   1 
ATOM 1612 C CH2   . TRP B 1 72  ? -48.747 -18.005 -0.347  1.00 51.88  ?  70  TRP A CH2   1 
ATOM 1613 N N     . LEU B 1 73  ? -45.102 -21.093 -2.895  1.00 61.56  ?  71  LEU A N     1 
ATOM 1614 C CA    . LEU B 1 73  ? -46.343 -21.514 -3.536  1.00 65.41  ?  71  LEU A CA    1 
ATOM 1615 C C     . LEU B 1 73  ? -46.471 -23.029 -3.527  1.00 69.32  ?  71  LEU A C     1 
ATOM 1616 O O     . LEU B 1 73  ? -47.510 -23.570 -3.139  1.00 70.52  ?  71  LEU A O     1 
ATOM 1617 C CB    . LEU B 1 73  ? -46.411 -20.986 -4.968  1.00 65.64  ?  71  LEU A CB    1 
ATOM 1618 C CG    . LEU B 1 73  ? -47.359 -19.820 -5.242  1.00 65.30  ?  71  LEU A CG    1 
ATOM 1619 C CD1   . LEU B 1 73  ? -47.372 -19.500 -6.725  1.00 65.10  ?  71  LEU A CD1   1 
ATOM 1620 C CD2   . LEU B 1 73  ? -48.755 -20.137 -4.748  1.00 65.43  ?  71  LEU A CD2   1 
ATOM 1621 N N     . GLU B 1 74  ? -45.414 -23.729 -3.942  1.00 72.08  ?  72  GLU A N     1 
ATOM 1622 C CA    . GLU B 1 74  ? -45.412 -25.186 -3.872  1.00 76.14  ?  72  GLU A CA    1 
ATOM 1623 C C     . GLU B 1 74  ? -45.744 -25.668 -2.467  1.00 76.46  ?  72  GLU A C     1 
ATOM 1624 O O     . GLU B 1 74  ? -46.644 -26.492 -2.273  1.00 77.97  ?  72  GLU A O     1 
ATOM 1625 C CB    . GLU B 1 74  ? -44.047 -25.722 -4.307  1.00 78.36  ?  72  GLU A CB    1 
ATOM 1626 C CG    . GLU B 1 74  ? -43.683 -25.430 -5.753  1.00 80.20  ?  72  GLU A CG    1 
ATOM 1627 C CD    . GLU B 1 74  ? -42.301 -25.939 -6.116  1.00 83.70  ?  72  GLU A CD    1 
ATOM 1628 O OE1   . GLU B 1 74  ? -41.663 -26.585 -5.260  1.00 85.72  ?  72  GLU A OE1   1 
ATOM 1629 O OE2   . GLU B 1 74  ? -41.850 -25.690 -7.252  1.00 85.92  -1 72  GLU A OE2   1 
ATOM 1630 N N     . GLU B 1 75  ? -45.022 -25.158 -1.469  1.00 75.34  ?  73  GLU A N     1 
ATOM 1631 C CA    . GLU B 1 75  ? -45.253 -25.584 -0.097  1.00 75.62  ?  73  GLU A CA    1 
ATOM 1632 C C     . GLU B 1 75  ? -46.573 -25.071 0.466   1.00 72.55  ?  73  GLU A C     1 
ATOM 1633 O O     . GLU B 1 75  ? -47.115 -25.685 1.389   1.00 73.24  ?  73  GLU A O     1 
ATOM 1634 C CB    . GLU B 1 75  ? -44.092 -25.138 0.788   1.00 77.20  ?  73  GLU A CB    1 
ATOM 1635 C CG    . GLU B 1 75  ? -43.925 -25.989 2.024   1.00 79.66  ?  73  GLU A CG    1 
ATOM 1636 C CD    . GLU B 1 75  ? -43.042 -27.191 1.770   1.00 81.89  ?  73  GLU A CD    1 
ATOM 1637 O OE1   . GLU B 1 75  ? -42.184 -27.121 0.868   1.00 81.50  ?  73  GLU A OE1   1 
ATOM 1638 O OE2   . GLU B 1 75  ? -43.219 -28.213 2.458   1.00 83.99  -1 73  GLU A OE2   1 
ATOM 1639 N N     . ALA B 1 76  ? -47.099 -23.965 -0.061  1.00 68.96  ?  74  ALA A N     1 
ATOM 1640 C CA    . ALA B 1 76  ? -48.348 -23.391 0.421   1.00 69.17  ?  74  ALA A CA    1 
ATOM 1641 C C     . ALA B 1 76  ? -49.549 -23.759 -0.435  1.00 71.06  ?  74  ALA A C     1 
ATOM 1642 O O     . ALA B 1 76  ? -50.672 -23.381 -0.091  1.00 72.63  ?  74  ALA A O     1 
ATOM 1643 C CB    . ALA B 1 76  ? -48.237 -21.868 0.514   1.00 67.86  ?  74  ALA A CB    1 
ATOM 1644 N N     . GLU B 1 77  ? -49.346 -24.476 -1.539  1.00 71.15  ?  75  GLU A N     1 
ATOM 1645 C CA    . GLU B 1 77  ? -50.457 -24.966 -2.342  1.00 68.91  ?  75  GLU A CA    1 
ATOM 1646 C C     . GLU B 1 77  ? -50.702 -26.452 -2.164  1.00 69.79  ?  75  GLU A C     1 
ATOM 1647 O O     . GLU B 1 77  ? -51.668 -26.976 -2.726  1.00 71.35  ?  75  GLU A O     1 
ATOM 1648 C CB    . GLU B 1 77  ? -50.226 -24.682 -3.827  1.00 66.37  ?  75  GLU A CB    1 
ATOM 1649 C CG    . GLU B 1 77  ? -51.448 -24.165 -4.545  1.00 67.43  ?  75  GLU A CG    1 
ATOM 1650 C CD    . GLU B 1 77  ? -51.098 -23.484 -5.843  1.00 68.85  ?  75  GLU A CD    1 
ATOM 1651 O OE1   . GLU B 1 77  ? -49.940 -23.620 -6.289  1.00 69.00  ?  75  GLU A OE1   1 
ATOM 1652 O OE2   . GLU B 1 77  ? -51.977 -22.811 -6.420  1.00 69.58  -1 75  GLU A OE2   1 
ATOM 1653 N N     . GLN B 1 78  ? -49.909 -27.116 -1.339  1.00 68.32  ?  76  GLN A N     1 
ATOM 1654 C CA    . GLN B 1 78  ? -50.035 -28.546 -1.133  1.00 70.50  ?  76  GLN A CA    1 
ATOM 1655 C C     . GLN B 1 78  ? -50.537 -28.848 0.262   1.00 73.07  ?  76  GLN A C     1 
ATOM 1656 O O     . GLN B 1 78  ? -50.727 -30.018 0.605   1.00 73.17  ?  76  GLN A O     1 
ATOM 1657 C CB    . GLN B 1 78  ? -48.689 -29.242 -1.365  1.00 70.09  ?  76  GLN A CB    1 
ATOM 1658 N N     . VAL B 1 79  ? -50.795 -27.805 1.045   1.00 74.52  ?  77  VAL A N     1 
ATOM 1659 C CA    . VAL B 1 79  ? -51.376 -27.917 2.373   1.00 81.01  ?  77  VAL A CA    1 
ATOM 1660 C C     . VAL B 1 79  ? -51.863 -26.541 2.805   1.00 79.58  ?  77  VAL A C     1 
ATOM 1661 O O     . VAL B 1 79  ? -51.168 -25.829 3.537   1.00 82.21  ?  77  VAL A O     1 
ATOM 1662 C CB    . VAL B 1 79  ? -50.361 -28.486 3.379   1.00 87.86  ?  77  VAL A CB    1 
ATOM 1663 N N     . GLY B 1 80  ? -53.042 -26.155 2.351   1.00 74.61  ?  78  GLY A N     1 
ATOM 1664 C CA    . GLY B 1 80  ? -53.620 -24.881 2.733   1.00 75.72  ?  78  GLY A CA    1 
ATOM 1665 C C     . GLY B 1 80  ? -54.611 -24.383 1.703   1.00 73.69  ?  78  GLY A C     1 
ATOM 1666 O O     . GLY B 1 80  ? -54.482 -24.611 0.503   1.00 71.26  ?  78  GLY A O     1 
ATOM 1667 N N     . ALA B 1 81  ? -55.625 -23.677 2.195   1.00 74.03  ?  79  ALA A N     1 
ATOM 1668 C CA    . ALA B 1 81  ? -56.655 -23.090 1.345   1.00 75.01  ?  79  ALA A CA    1 
ATOM 1669 C C     . ALA B 1 81  ? -57.422 -22.012 2.103   1.00 76.30  ?  79  ALA A C     1 
ATOM 1670 O O     . ALA B 1 81  ? -57.243 -21.841 3.310   1.00 77.16  ?  79  ALA A O     1 
ATOM 1671 C CB    . ALA B 1 81  ? -57.606 -24.159 0.840   1.00 76.55  ?  79  ALA A CB    1 
ATOM 1672 N N     . LYS B 1 95  ? -41.644 6.538   13.797  1.00 71.64  ?  93  LYS A N     1 
ATOM 1673 C CA    . LYS B 1 95  ? -41.552 7.957   13.481  1.00 71.33  ?  93  LYS A CA    1 
ATOM 1674 C C     . LYS B 1 95  ? -42.808 8.398   12.734  1.00 71.71  ?  93  LYS A C     1 
ATOM 1675 O O     . LYS B 1 95  ? -43.905 7.921   13.014  1.00 71.74  ?  93  LYS A O     1 
ATOM 1676 C CB    . LYS B 1 95  ? -40.294 8.242   12.653  1.00 68.19  ?  93  LYS A CB    1 
ATOM 1677 C CG    . LYS B 1 95  ? -39.746 9.660   12.780  1.00 67.59  ?  93  LYS A CG    1 
ATOM 1678 C CD    . LYS B 1 95  ? -39.015 10.077  11.515  1.00 63.83  ?  93  LYS A CD    1 
ATOM 1679 C CE    . LYS B 1 95  ? -39.119 11.574  11.281  1.00 62.17  ?  93  LYS A CE    1 
ATOM 1680 N NZ    . LYS B 1 95  ? -38.766 11.941  9.883   1.00 58.05  ?  93  LYS A NZ    1 
ATOM 1681 N N     . ARG B 1 96  ? -42.639 9.308   11.780  1.00 72.15  ?  94  ARG A N     1 
ATOM 1682 C CA    . ARG B 1 96  ? -43.737 9.809   10.971  1.00 73.23  ?  94  ARG A CA    1 
ATOM 1683 C C     . ARG B 1 96  ? -43.166 10.317  9.659   1.00 74.05  ?  94  ARG A C     1 
ATOM 1684 O O     . ARG B 1 96  ? -42.104 10.943  9.643   1.00 74.81  ?  94  ARG A O     1 
ATOM 1685 C CB    . ARG B 1 96  ? -44.503 10.927  11.687  1.00 73.70  ?  94  ARG A CB    1 
ATOM 1686 N N     . ARG B 1 97  ? -43.869 10.048  8.565   1.00 74.41  ?  95  ARG A N     1 
ATOM 1687 C CA    . ARG B 1 97  ? -43.407 10.509  7.267   1.00 73.41  ?  95  ARG A CA    1 
ATOM 1688 C C     . ARG B 1 97  ? -43.812 11.956  7.036   1.00 77.80  ?  95  ARG A C     1 
ATOM 1689 O O     . ARG B 1 97  ? -44.831 12.430  7.544   1.00 82.40  ?  95  ARG A O     1 
ATOM 1690 C CB    . ARG B 1 97  ? -43.975 9.640   6.148   1.00 69.00  ?  95  ARG A CB    1 
ATOM 1691 C CG    . ARG B 1 97  ? -43.478 8.214   6.146   1.00 67.86  ?  95  ARG A CG    1 
ATOM 1692 C CD    . ARG B 1 97  ? -43.429 7.655   4.735   1.00 65.66  ?  95  ARG A CD    1 
ATOM 1693 N NE    . ARG B 1 97  ? -44.067 8.530   3.757   1.00 64.38  ?  95  ARG A NE    1 
ATOM 1694 C CZ    . ARG B 1 97  ? -45.295 8.354   3.286   1.00 65.43  ?  95  ARG A CZ    1 
ATOM 1695 N NH1   . ARG B 1 97  ? -46.023 7.330   3.703   1.00 66.35  1  95  ARG A NH1   1 
ATOM 1696 N NH2   . ARG B 1 97  ? -45.796 9.198   2.395   1.00 65.72  ?  95  ARG A NH2   1 
ATOM 1697 N N     . THR B 1 98  ? -43.000 12.656  6.251   1.00 74.81  ?  96  THR A N     1 
ATOM 1698 C CA    . THR B 1 98  ? -43.281 14.021  5.834   1.00 72.76  ?  96  THR A CA    1 
ATOM 1699 C C     . THR B 1 98  ? -43.601 14.009  4.348   1.00 71.60  ?  96  THR A C     1 
ATOM 1700 O O     . THR B 1 98  ? -42.764 13.607  3.535   1.00 74.25  ?  96  THR A O     1 
ATOM 1701 C CB    . THR B 1 98  ? -42.094 14.936  6.124   1.00 68.96  ?  96  THR A CB    1 
ATOM 1702 O OG1   . THR B 1 98  ? -41.755 14.850  7.514   1.00 68.77  ?  96  THR A OG1   1 
ATOM 1703 C CG2   . THR B 1 98  ? -42.434 16.372  5.772   1.00 67.35  ?  96  THR A CG2   1 
ATOM 1704 N N     . THR B 1 99  ? -44.796 14.463  3.995   1.00 68.72  ?  97  THR A N     1 
ATOM 1705 C CA    . THR B 1 99  ? -45.247 14.443  2.613   1.00 67.85  ?  97  THR A CA    1 
ATOM 1706 C C     . THR B 1 99  ? -44.783 15.700  1.890   1.00 66.60  ?  97  THR A C     1 
ATOM 1707 O O     . THR B 1 99  ? -44.883 16.809  2.421   1.00 71.01  ?  97  THR A O     1 
ATOM 1708 C CB    . THR B 1 99  ? -46.772 14.322  2.548   1.00 69.77  ?  97  THR A CB    1 
ATOM 1709 O OG1   . THR B 1 99  ? -47.149 12.954  2.744   1.00 69.62  ?  97  THR A OG1   1 
ATOM 1710 C CG2   . THR B 1 99  ? -47.300 14.788  1.199   1.00 68.47  ?  97  THR A CG2   1 
ATOM 1711 N N     . ILE B 1 100 ? -44.279 15.518  0.676   1.00 58.14  ?  98  ILE A N     1 
ATOM 1712 C CA    . ILE B 1 100 ? -43.781 16.615  -0.143  1.00 52.43  ?  98  ILE A CA    1 
ATOM 1713 C C     . ILE B 1 100 ? -44.953 17.182  -0.926  1.00 52.39  ?  98  ILE A C     1 
ATOM 1714 O O     . ILE B 1 100 ? -45.800 16.435  -1.428  1.00 52.37  ?  98  ILE A O     1 
ATOM 1715 C CB    . ILE B 1 100 ? -42.654 16.138  -1.078  1.00 46.75  ?  98  ILE A CB    1 
ATOM 1716 C CG1   . ILE B 1 100 ? -41.422 15.748  -0.268  1.00 47.16  ?  98  ILE A CG1   1 
ATOM 1717 C CG2   . ILE B 1 100 ? -42.289 17.210  -2.082  1.00 42.90  ?  98  ILE A CG2   1 
ATOM 1718 C CD1   . ILE B 1 100 ? -40.260 15.301  -1.116  1.00 45.35  ?  98  ILE A CD1   1 
ATOM 1719 N N     . SER B 1 101 ? -45.015 18.508  -1.014  1.00 49.97  ?  99  SER A N     1 
ATOM 1720 C CA    . SER B 1 101 ? -46.135 19.163  -1.670  1.00 46.98  ?  99  SER A CA    1 
ATOM 1721 C C     . SER B 1 101 ? -46.247 18.727  -3.124  1.00 43.00  ?  99  SER A C     1 
ATOM 1722 O O     . SER B 1 101 ? -45.257 18.387  -3.774  1.00 44.02  ?  99  SER A O     1 
ATOM 1723 C CB    . SER B 1 101 ? -45.972 20.678  -1.586  1.00 48.90  ?  99  SER A CB    1 
ATOM 1724 O OG    . SER B 1 101 ? -44.825 21.103  -2.297  1.00 49.47  ?  99  SER A OG    1 
ATOM 1725 N N     . ILE B 1 102 ? -47.481 18.740  -3.630  1.00 45.20  ?  100 ILE A N     1 
ATOM 1726 C CA    . ILE B 1 102 ? -47.734 18.338  -5.009  1.00 46.89  ?  100 ILE A CA    1 
ATOM 1727 C C     . ILE B 1 102 ? -47.021 19.261  -5.984  1.00 48.30  ?  100 ILE A C     1 
ATOM 1728 O O     . ILE B 1 102 ? -46.559 18.821  -7.043  1.00 48.11  ?  100 ILE A O     1 
ATOM 1729 C CB    . ILE B 1 102 ? -49.250 18.290  -5.273  1.00 49.03  ?  100 ILE A CB    1 
ATOM 1730 C CG1   . ILE B 1 102 ? -49.919 17.311  -4.308  1.00 49.71  ?  100 ILE A CG1   1 
ATOM 1731 C CG2   . ILE B 1 102 ? -49.531 17.874  -6.705  1.00 48.58  ?  100 ILE A CG2   1 
ATOM 1732 C CD1   . ILE B 1 102 ? -51.419 17.236  -4.455  1.00 50.33  ?  100 ILE A CD1   1 
ATOM 1733 N N     . ALA B 1 103 ? -46.918 20.548  -5.652  1.00 50.20  ?  101 ALA A N     1 
ATOM 1734 C CA    . ALA B 1 103 ? -46.243 21.483  -6.544  1.00 51.97  ?  101 ALA A CA    1 
ATOM 1735 C C     . ALA B 1 103 ? -44.749 21.200  -6.621  1.00 51.78  ?  101 ALA A C     1 
ATOM 1736 O O     . ALA B 1 103 ? -44.140 21.343  -7.687  1.00 55.56  ?  101 ALA A O     1 
ATOM 1737 C CB    . ALA B 1 103 ? -46.494 22.918  -6.086  1.00 53.20  ?  101 ALA A CB    1 
ATOM 1738 N N     . ALA B 1 104 ? -44.140 20.803  -5.501  1.00 47.19  ?  102 ALA A N     1 
ATOM 1739 C CA    . ALA B 1 104 ? -42.717 20.480  -5.510  1.00 44.84  ?  102 ALA A CA    1 
ATOM 1740 C C     . ALA B 1 104 ? -42.436 19.198  -6.279  1.00 43.72  ?  102 ALA A C     1 
ATOM 1741 O O     . ALA B 1 104 ? -41.448 19.119  -7.017  1.00 45.10  ?  102 ALA A O     1 
ATOM 1742 C CB    . ALA B 1 104 ? -42.195 20.372  -4.080  1.00 44.18  ?  102 ALA A CB    1 
ATOM 1743 N N     . LYS B 1 105 ? -43.287 18.181  -6.119  1.00 43.03  ?  103 LYS A N     1 
ATOM 1744 C CA    . LYS B 1 105 ? -43.066 16.920  -6.820  1.00 45.44  ?  103 LYS A CA    1 
ATOM 1745 C C     . LYS B 1 105 ? -43.101 17.118  -8.327  1.00 50.64  ?  103 LYS A C     1 
ATOM 1746 O O     . LYS B 1 105 ? -42.268 16.563  -9.053  1.00 52.02  ?  103 LYS A O     1 
ATOM 1747 C CB    . LYS B 1 105 ? -44.099 15.879  -6.392  1.00 45.26  ?  103 LYS A CB    1 
ATOM 1748 C CG    . LYS B 1 105 ? -43.999 15.460  -4.936  1.00 43.00  ?  103 LYS A CG    1 
ATOM 1749 C CD    . LYS B 1 105 ? -44.826 14.214  -4.665  1.00 41.58  ?  103 LYS A CD    1 
ATOM 1750 C CE    . LYS B 1 105 ? -46.189 14.556  -4.098  1.00 42.99  ?  103 LYS A CE    1 
ATOM 1751 N NZ    . LYS B 1 105 ? -46.993 13.334  -3.828  1.00 44.60  1  103 LYS A NZ    1 
ATOM 1752 N N     . ASP B 1 106 ? -44.065 17.897  -8.818  1.00 54.93  ?  104 ASP A N     1 
ATOM 1753 C CA    . ASP B 1 106 ? -44.109 18.194  -10.244 1.00 60.84  ?  104 ASP A CA    1 
ATOM 1754 C C     . ASP B 1 106 ? -42.895 19.004  -10.668 1.00 62.20  ?  104 ASP A C     1 
ATOM 1755 O O     . ASP B 1 106 ? -42.412 18.858  -11.796 1.00 64.84  ?  104 ASP A O     1 
ATOM 1756 C CB    . ASP B 1 106 ? -45.394 18.943  -10.587 1.00 68.15  ?  104 ASP A CB    1 
ATOM 1757 C CG    . ASP B 1 106 ? -46.617 18.051  -10.545 1.00 75.46  ?  104 ASP A CG    1 
ATOM 1758 O OD1   . ASP B 1 106 ? -46.458 16.817  -10.644 1.00 78.44  ?  104 ASP A OD1   1 
ATOM 1759 O OD2   . ASP B 1 106 ? -47.739 18.585  -10.415 1.00 78.82  -1 104 ASP A OD2   1 
ATOM 1760 N N     . ALA B 1 107 ? -42.389 19.859  -9.779  1.00 60.42  ?  105 ALA A N     1 
ATOM 1761 C CA    . ALA B 1 107 ? -41.175 20.612  -10.072 1.00 60.54  ?  105 ALA A CA    1 
ATOM 1762 C C     . ALA B 1 107 ? -39.959 19.698  -10.111 1.00 59.07  ?  105 ALA A C     1 
ATOM 1763 O O     . ALA B 1 107 ? -39.138 19.780  -11.032 1.00 64.11  ?  105 ALA A O     1 
ATOM 1764 C CB    . ALA B 1 107 ? -40.986 21.720  -9.039  1.00 60.38  ?  105 ALA A CB    1 
ATOM 1765 N N     . LEU B 1 108 ? -39.818 18.828  -9.109  1.00 51.45  ?  106 LEU A N     1 
ATOM 1766 C CA    . LEU B 1 108 ? -38.699 17.891  -9.088  1.00 46.38  ?  106 LEU A CA    1 
ATOM 1767 C C     . LEU B 1 108 ? -38.712 16.995  -10.319 1.00 45.07  ?  106 LEU A C     1 
ATOM 1768 O O     . LEU B 1 108 ? -37.673 16.779  -10.952 1.00 46.29  ?  106 LEU A O     1 
ATOM 1769 C CB    . LEU B 1 108 ? -38.739 17.060  -7.807  1.00 43.83  ?  106 LEU A CB    1 
ATOM 1770 C CG    . LEU B 1 108 ? -38.446 17.827  -6.518  1.00 42.57  ?  106 LEU A CG    1 
ATOM 1771 C CD1   . LEU B 1 108 ? -38.828 17.016  -5.300  1.00 40.07  ?  106 LEU A CD1   1 
ATOM 1772 C CD2   . LEU B 1 108 ? -36.984 18.201  -6.459  1.00 42.84  ?  106 LEU A CD2   1 
ATOM 1773 N N     . GLU B 1 109 ? -39.884 16.460  -10.675 1.00 43.77  ?  107 GLU A N     1 
ATOM 1774 C CA    . GLU B 1 109 ? -39.991 15.671  -11.898 1.00 43.55  ?  107 GLU A CA    1 
ATOM 1775 C C     . GLU B 1 109 ? -39.663 16.504  -13.127 1.00 43.33  ?  107 GLU A C     1 
ATOM 1776 O O     . GLU B 1 109 ? -39.135 15.977  -14.112 1.00 37.98  ?  107 GLU A O     1 
ATOM 1777 C CB    . GLU B 1 109 ? -41.389 15.069  -12.022 1.00 44.62  ?  107 GLU A CB    1 
ATOM 1778 C CG    . GLU B 1 109 ? -41.490 13.627  -11.561 1.00 32.66  ?  107 GLU A CG    1 
ATOM 1779 C CD    . GLU B 1 109 ? -41.152 12.645  -12.665 1.00 46.60  ?  107 GLU A CD    1 
ATOM 1780 O OE1   . GLU B 1 109 ? -41.002 13.081  -13.824 1.00 48.47  ?  107 GLU A OE1   1 
ATOM 1781 O OE2   . GLU B 1 109 ? -41.037 11.438  -12.376 1.00 46.57  -1 107 GLU A OE2   1 
ATOM 1782 N N     . ARG B 1 110 ? -39.974 17.799  -13.093 1.00 43.66  ?  108 ARG A N     1 
ATOM 1783 C CA    . ARG B 1 110 ? -39.567 18.682  -14.178 1.00 47.97  ?  108 ARG A CA    1 
ATOM 1784 C C     . ARG B 1 110 ? -38.057 18.870  -14.175 1.00 49.47  ?  108 ARG A C     1 
ATOM 1785 O O     . ARG B 1 110 ? -37.421 18.870  -15.235 1.00 53.57  ?  108 ARG A O     1 
ATOM 1786 C CB    . ARG B 1 110 ? -40.283 20.024  -14.054 1.00 50.53  ?  108 ARG A CB    1 
ATOM 1787 C CG    . ARG B 1 110 ? -40.368 20.815  -15.344 1.00 56.93  ?  108 ARG A CG    1 
ATOM 1788 C CD    . ARG B 1 110 ? -41.597 21.709  -15.352 1.00 61.61  ?  108 ARG A CD    1 
ATOM 1789 N NE    . ARG B 1 110 ? -41.690 22.518  -14.141 1.00 61.72  ?  108 ARG A NE    1 
ATOM 1790 C CZ    . ARG B 1 110 ? -42.699 22.463  -13.280 1.00 59.80  ?  108 ARG A CZ    1 
ATOM 1791 N NH1   . ARG B 1 110 ? -43.708 21.631  -13.489 1.00 58.55  1  108 ARG A NH1   1 
ATOM 1792 N NH2   . ARG B 1 110 ? -42.697 23.237  -12.204 1.00 58.97  ?  108 ARG A NH2   1 
ATOM 1793 N N     . HIS B 1 111 ? -37.468 19.034  -12.988 1.00 46.60  ?  109 HIS A N     1 
ATOM 1794 C CA    . HIS B 1 111 ? -36.016 19.102  -12.867 1.00 47.48  ?  109 HIS A CA    1 
ATOM 1795 C C     . HIS B 1 111 ? -35.354 17.780  -13.225 1.00 46.91  ?  109 HIS A C     1 
ATOM 1796 O O     . HIS B 1 111 ? -34.209 17.768  -13.686 1.00 45.96  ?  109 HIS A O     1 
ATOM 1797 C CB    . HIS B 1 111 ? -35.624 19.499  -11.446 1.00 45.20  ?  109 HIS A CB    1 
ATOM 1798 C CG    . HIS B 1 111 ? -35.712 20.966  -11.178 1.00 47.50  ?  109 HIS A CG    1 
ATOM 1799 N ND1   . HIS B 1 111 ? -35.079 21.904  -11.962 1.00 51.92  ?  109 HIS A ND1   1 
ATOM 1800 C CD2   . HIS B 1 111 ? -36.350 21.657  -10.205 1.00 47.29  ?  109 HIS A CD2   1 
ATOM 1801 C CE1   . HIS B 1 111 ? -35.328 23.111  -11.489 1.00 53.58  ?  109 HIS A CE1   1 
ATOM 1802 N NE2   . HIS B 1 111 ? -36.097 22.989  -10.422 1.00 50.75  ?  109 HIS A NE2   1 
ATOM 1803 N N     . PHE B 1 112 ? -36.051 16.663  -13.012 1.00 47.89  ?  110 PHE A N     1 
ATOM 1804 C CA    . PHE B 1 112 ? -35.459 15.354  -13.263 1.00 49.54  ?  110 PHE A CA    1 
ATOM 1805 C C     . PHE B 1 112 ? -35.240 15.095  -14.747 1.00 57.61  ?  110 PHE A C     1 
ATOM 1806 O O     . PHE B 1 112 ? -34.299 14.386  -15.115 1.00 56.48  ?  110 PHE A O     1 
ATOM 1807 C CB    . PHE B 1 112 ? -36.339 14.263  -12.650 1.00 44.82  ?  110 PHE A CB    1 
ATOM 1808 C CG    . PHE B 1 112 ? -35.755 12.885  -12.746 1.00 44.60  ?  110 PHE A CG    1 
ATOM 1809 C CD1   . PHE B 1 112 ? -34.812 12.453  -11.831 1.00 43.11  ?  110 PHE A CD1   1 
ATOM 1810 C CD2   . PHE B 1 112 ? -36.162 12.012  -13.735 1.00 46.54  ?  110 PHE A CD2   1 
ATOM 1811 C CE1   . PHE B 1 112 ? -34.273 11.187  -11.915 1.00 41.59  ?  110 PHE A CE1   1 
ATOM 1812 C CE2   . PHE B 1 112 ? -35.628 10.744  -13.819 1.00 46.07  ?  110 PHE A CE2   1 
ATOM 1813 C CZ    . PHE B 1 112 ? -34.682 10.332  -12.907 1.00 42.41  ?  110 PHE A CZ    1 
ATOM 1814 N N     . GLY B 1 113 ? -36.086 15.653  -15.612 1.00 65.34  ?  111 GLY A N     1 
ATOM 1815 C CA    . GLY B 1 113 ? -35.897 15.458  -17.037 1.00 75.67  ?  111 GLY A CA    1 
ATOM 1816 C C     . GLY B 1 113 ? -34.650 16.119  -17.588 1.00 83.69  ?  111 GLY A C     1 
ATOM 1817 O O     . GLY B 1 113 ? -34.101 15.666  -18.596 1.00 91.76  ?  111 GLY A O     1 
ATOM 1818 N N     . GLU B 1 114 ? -34.181 17.184  -16.944 1.00 81.17  ?  112 GLU A N     1 
ATOM 1819 C CA    . GLU B 1 114 ? -33.002 17.907  -17.395 1.00 88.21  ?  112 GLU A CA    1 
ATOM 1820 C C     . GLU B 1 114 ? -31.734 17.499  -16.660 1.00 89.85  ?  112 GLU A C     1 
ATOM 1821 O O     . GLU B 1 114 ? -30.688 18.116  -16.882 1.00 92.84  ?  112 GLU A O     1 
ATOM 1822 C CB    . GLU B 1 114 ? -33.218 19.417  -17.258 1.00 90.76  ?  112 GLU A CB    1 
ATOM 1823 C CG    . GLU B 1 114 ? -34.540 19.926  -17.823 1.00 94.01  ?  112 GLU A CG    1 
ATOM 1824 C CD    . GLU B 1 114 ? -34.517 20.094  -19.335 1.00 102.35 ?  112 GLU A CD    1 
ATOM 1825 O OE1   . GLU B 1 114 ? -33.516 19.705  -19.971 1.00 106.06 ?  112 GLU A OE1   1 
ATOM 1826 O OE2   . GLU B 1 114 ? -35.507 20.617  -19.888 1.00 105.95 -1 112 GLU A OE2   1 
ATOM 1827 N N     . GLN B 1 115 ? -31.792 16.440  -15.845 1.00 80.57  ?  113 GLN A N     1 
ATOM 1828 C CA    . GLN B 1 115 ? -30.662 15.964  -15.052 1.00 74.39  ?  113 GLN A CA    1 
ATOM 1829 C C     . GLN B 1 115 ? -31.101 14.909  -14.048 1.00 68.23  ?  113 GLN A C     1 
ATOM 1830 O O     . GLN B 1 115 ? -31.596 15.236  -12.967 1.00 69.05  ?  113 GLN A O     1 
ATOM 1831 C CB    . GLN B 1 115 ? -29.991 17.107  -14.288 1.00 73.77  ?  113 GLN A CB    1 
ATOM 1832 C CG    . GLN B 1 115 ? -28.731 16.701  -13.555 1.00 70.44  ?  113 GLN A CG    1 
ATOM 1833 C CD    . GLN B 1 115 ? -27.650 16.202  -14.488 1.00 67.18  ?  113 GLN A CD    1 
ATOM 1834 O OE1   . GLN B 1 115 ? -27.530 16.663  -15.621 1.00 67.78  ?  113 GLN A OE1   1 
ATOM 1835 N NE2   . GLN B 1 115 ? -26.855 15.253  -14.015 1.00 62.83  ?  113 GLN A NE2   1 
ATOM 1836 N N     . ASN B 1 116 ? -30.936 13.638  -14.416 1.00 61.71  ?  114 ASN A N     1 
ATOM 1837 C CA    . ASN B 1 116 ? -31.263 12.540  -13.513 1.00 57.66  ?  114 ASN A CA    1 
ATOM 1838 C C     . ASN B 1 116 ? -30.397 12.568  -12.260 1.00 56.07  ?  114 ASN A C     1 
ATOM 1839 O O     . ASN B 1 116 ? -30.906 12.475  -11.138 1.00 56.68  ?  114 ASN A O     1 
ATOM 1840 C CB    . ASN B 1 116 ? -31.119 11.209  -14.246 1.00 58.19  ?  114 ASN A CB    1 
ATOM 1841 C CG    . ASN B 1 116 ? -32.064 11.093  -15.419 1.00 62.88  ?  114 ASN A CG    1 
ATOM 1842 O OD1   . ASN B 1 116 ? -32.675 12.076  -15.835 1.00 65.54  ?  114 ASN A OD1   1 
ATOM 1843 N ND2   . ASN B 1 116 ? -32.195 9.888   -15.957 1.00 65.38  ?  114 ASN A ND2   1 
ATOM 1844 N N     . LYS B 1 117 ? -29.080 12.667  -12.433 1.00 52.72  ?  115 LYS A N     1 
ATOM 1845 C CA    . LYS B 1 117 ? -28.146 12.718  -11.314 1.00 47.04  ?  115 LYS A CA    1 
ATOM 1846 C C     . LYS B 1 117 ? -27.643 14.138  -11.095 1.00 45.25  ?  115 LYS A C     1 
ATOM 1847 O O     . LYS B 1 117 ? -26.630 14.533  -11.682 1.00 48.54  ?  115 LYS A O     1 
ATOM 1848 C CB    . LYS B 1 117 ? -26.960 11.782  -11.552 1.00 46.18  ?  115 LYS A CB    1 
ATOM 1849 C CG    . LYS B 1 117 ? -27.317 10.456  -12.199 1.00 45.19  ?  115 LYS A CG    1 
ATOM 1850 C CD    . LYS B 1 117 ? -26.084 9.581   -12.347 1.00 45.47  ?  115 LYS A CD    1 
ATOM 1851 C CE    . LYS B 1 117 ? -26.216 8.619   -13.515 1.00 46.17  ?  115 LYS A CE    1 
ATOM 1852 N NZ    . LYS B 1 117 ? -25.035 7.719   -13.618 1.00 46.10  1  115 LYS A NZ    1 
ATOM 1853 N N     . PRO B 1 118 ? -28.311 14.933  -10.267 1.00 41.75  ?  116 PRO A N     1 
ATOM 1854 C CA    . PRO B 1 118 ? -27.856 16.303  -10.037 1.00 43.10  ?  116 PRO A CA    1 
ATOM 1855 C C     . PRO B 1 118 ? -26.687 16.348  -9.071  1.00 41.23  ?  116 PRO A C     1 
ATOM 1856 O O     . PRO B 1 118 ? -26.504 15.467  -8.230  1.00 39.83  ?  116 PRO A O     1 
ATOM 1857 C CB    . PRO B 1 118 ? -29.091 16.978  -9.437  1.00 42.24  ?  116 PRO A CB    1 
ATOM 1858 C CG    . PRO B 1 118 ? -29.748 15.889  -8.682  1.00 38.01  ?  116 PRO A CG    1 
ATOM 1859 C CD    . PRO B 1 118 ? -29.462 14.596  -9.416  1.00 38.33  ?  116 PRO A CD    1 
ATOM 1860 N N     . SER B 1 119 ? -25.887 17.400  -9.208  1.00 42.64  ?  117 SER A N     1 
ATOM 1861 C CA    . SER B 1 119 ? -24.714 17.548  -8.367  1.00 44.67  ?  117 SER A CA    1 
ATOM 1862 C C     . SER B 1 119 ? -25.131 17.912  -6.946  1.00 43.65  ?  117 SER A C     1 
ATOM 1863 O O     . SER B 1 119 ? -26.287 18.244  -6.667  1.00 41.27  ?  117 SER A O     1 
ATOM 1864 C CB    . SER B 1 119 ? -23.766 18.605  -8.933  1.00 48.48  ?  117 SER A CB    1 
ATOM 1865 O OG    . SER B 1 119 ? -24.283 19.909  -8.764  1.00 50.15  ?  117 SER A OG    1 
ATOM 1866 N N     . SER B 1 120 ? -24.165 17.832  -6.032  1.00 48.09  ?  118 SER A N     1 
ATOM 1867 C CA    . SER B 1 120 ? -24.413 18.228  -4.654  1.00 49.30  ?  118 SER A CA    1 
ATOM 1868 C C     . SER B 1 120 ? -24.818 19.690  -4.539  1.00 52.80  ?  118 SER A C     1 
ATOM 1869 O O     . SER B 1 120 ? -25.450 20.069  -3.548  1.00 53.48  ?  118 SER A O     1 
ATOM 1870 C CB    . SER B 1 120 ? -23.173 17.961  -3.804  1.00 49.15  ?  118 SER A CB    1 
ATOM 1871 O OG    . SER B 1 120 ? -23.472 18.062  -2.425  1.00 49.55  ?  118 SER A OG    1 
ATOM 1872 N N     . GLN B 1 121 ? -24.478 20.517  -5.527  1.00 55.13  ?  119 GLN A N     1 
ATOM 1873 C CA    . GLN B 1 121 ? -24.847 21.926  -5.504  1.00 55.85  ?  119 GLN A CA    1 
ATOM 1874 C C     . GLN B 1 121 ? -26.247 22.175  -6.050  1.00 55.46  ?  119 GLN A C     1 
ATOM 1875 O O     . GLN B 1 121 ? -26.983 22.998  -5.498  1.00 54.98  ?  119 GLN A O     1 
ATOM 1876 C CB    . GLN B 1 121 ? -23.837 22.742  -6.310  1.00 56.71  ?  119 GLN A CB    1 
ATOM 1877 C CG    . GLN B 1 121 ? -22.442 22.764  -5.725  1.00 57.90  ?  119 GLN A CG    1 
ATOM 1878 C CD    . GLN B 1 121 ? -21.449 23.453  -6.635  1.00 61.02  ?  119 GLN A CD    1 
ATOM 1879 O OE1   . GLN B 1 121 ? -21.813 23.968  -7.691  1.00 63.39  ?  119 GLN A OE1   1 
ATOM 1880 N NE2   . GLN B 1 121 ? -20.185 23.460  -6.234  1.00 60.27  ?  119 GLN A NE2   1 
ATOM 1881 N N     . GLU B 1 122 ? -26.630 21.488  -7.128  1.00 56.44  ?  120 GLU A N     1 
ATOM 1882 C CA    . GLU B 1 122 ? -27.997 21.610  -7.622  1.00 59.03  ?  120 GLU A CA    1 
ATOM 1883 C C     . GLU B 1 122 ? -29.010 21.141  -6.590  1.00 60.41  ?  120 GLU A C     1 
ATOM 1884 O O     . GLU B 1 122 ? -30.115 21.687  -6.519  1.00 59.66  ?  120 GLU A O     1 
ATOM 1885 C CB    . GLU B 1 122 ? -28.169 20.832  -8.925  1.00 59.85  ?  120 GLU A CB    1 
ATOM 1886 C CG    . GLU B 1 122 ? -27.002 20.953  -9.880  1.00 62.71  ?  120 GLU A CG    1 
ATOM 1887 C CD    . GLU B 1 122 ? -27.311 20.400  -11.254 1.00 66.37  ?  120 GLU A CD    1 
ATOM 1888 O OE1   . GLU B 1 122 ? -28.505 20.283  -11.593 1.00 68.49  ?  120 GLU A OE1   1 
ATOM 1889 O OE2   . GLU B 1 122 ? -26.360 20.084  -11.997 1.00 67.66  -1 120 GLU A OE2   1 
ATOM 1890 N N     . ILE B 1 123 ? -28.649 20.155  -5.767  1.00 60.11  ?  121 ILE A N     1 
ATOM 1891 C CA    . ILE B 1 123 ? -29.575 19.674  -4.746  1.00 61.11  ?  121 ILE A CA    1 
ATOM 1892 C C     . ILE B 1 123 ? -29.868 20.776  -3.737  1.00 65.45  ?  121 ILE A C     1 
ATOM 1893 O O     . ILE B 1 123 ? -31.010 20.946  -3.296  1.00 68.43  ?  121 ILE A O     1 
ATOM 1894 C CB    . ILE B 1 123 ? -29.021 18.404  -4.076  1.00 58.66  ?  121 ILE A CB    1 
ATOM 1895 C CG1   . ILE B 1 123 ? -29.118 17.219  -5.037  1.00 56.06  ?  121 ILE A CG1   1 
ATOM 1896 C CG2   . ILE B 1 123 ? -29.778 18.092  -2.804  1.00 59.07  ?  121 ILE A CG2   1 
ATOM 1897 C CD1   . ILE B 1 123 ? -28.436 15.971  -4.542  1.00 53.04  ?  121 ILE A CD1   1 
ATOM 1898 N N     . MET B 1 124 ? -28.849 21.551  -3.364  1.00 66.64  ?  122 MET A N     1 
ATOM 1899 C CA    . MET B 1 124 ? -29.085 22.678  -2.470  1.00 67.05  ?  122 MET A CA    1 
ATOM 1900 C C     . MET B 1 124 ? -29.850 23.786  -3.176  1.00 67.07  ?  122 MET A C     1 
ATOM 1901 O O     . MET B 1 124 ? -30.641 24.495  -2.546  1.00 65.17  ?  122 MET A O     1 
ATOM 1902 C CB    . MET B 1 124 ? -27.761 23.217  -1.931  1.00 69.06  ?  122 MET A CB    1 
ATOM 1903 C CG    . MET B 1 124 ? -27.286 22.552  -0.657  1.00 71.51  ?  122 MET A CG    1 
ATOM 1904 S SD    . MET B 1 124 ? -27.541 23.620  0.767   1.00 75.79  ?  122 MET A SD    1 
ATOM 1905 C CE    . MET B 1 124 ? -27.278 22.483  2.120   1.00 73.27  ?  122 MET A CE    1 
ATOM 1906 N N     . ARG B 1 125 ? -29.628 23.942  -4.482  1.00 65.38  ?  123 ARG A N     1 
ATOM 1907 C CA    . ARG B 1 125 ? -30.339 24.952  -5.254  1.00 65.85  ?  123 ARG A CA    1 
ATOM 1908 C C     . ARG B 1 125 ? -31.817 24.618  -5.373  1.00 65.28  ?  123 ARG A C     1 
ATOM 1909 O O     . ARG B 1 125 ? -32.657 25.523  -5.387  1.00 67.61  ?  123 ARG A O     1 
ATOM 1910 C CB    . ARG B 1 125 ? -29.711 25.070  -6.639  1.00 67.16  ?  123 ARG A CB    1 
ATOM 1911 C CG    . ARG B 1 125 ? -30.268 26.165  -7.517  1.00 69.12  ?  123 ARG A CG    1 
ATOM 1912 C CD    . ARG B 1 125 ? -29.624 26.092  -8.891  1.00 70.76  ?  123 ARG A CD    1 
ATOM 1913 N NE    . ARG B 1 125 ? -28.211 25.737  -8.801  1.00 71.00  ?  123 ARG A NE    1 
ATOM 1914 C CZ    . ARG B 1 125 ? -27.507 25.205  -9.795  1.00 70.77  ?  123 ARG A CZ    1 
ATOM 1915 N NH1   . ARG B 1 125 ? -28.082 24.959  -10.962 1.00 71.04  1  123 ARG A NH1   1 
ATOM 1916 N NH2   . ARG B 1 125 ? -26.226 24.915  -9.620  1.00 69.73  ?  123 ARG A NH2   1 
ATOM 1917 N N     . MET B 1 126 ? -32.149 23.328  -5.448  1.00 60.37  ?  124 MET A N     1 
ATOM 1918 C CA    . MET B 1 126 ? -33.541 22.908  -5.536  1.00 57.12  ?  124 MET A CA    1 
ATOM 1919 C C     . MET B 1 126 ? -34.194 22.880  -4.163  1.00 55.23  ?  124 MET A C     1 
ATOM 1920 O O     . MET B 1 126 ? -35.363 23.248  -4.019  1.00 57.07  ?  124 MET A O     1 
ATOM 1921 C CB    . MET B 1 126 ? -33.633 21.524  -6.176  1.00 57.09  ?  124 MET A CB    1 
ATOM 1922 C CG    . MET B 1 126 ? -33.023 21.399  -7.555  1.00 59.89  ?  124 MET A CG    1 
ATOM 1923 S SD    . MET B 1 126 ? -32.995 19.679  -8.092  1.00 60.84  ?  124 MET A SD    1 
ATOM 1924 C CE    . MET B 1 126 ? -32.110 19.812  -9.640  1.00 63.12  ?  124 MET A CE    1 
ATOM 1925 N N     . ALA B 1 127 ? -33.451 22.432  -3.150  1.00 53.04  ?  125 ALA A N     1 
ATOM 1926 C CA    . ALA B 1 127 ? -33.970 22.416  -1.788  1.00 49.64  ?  125 ALA A CA    1 
ATOM 1927 C C     . ALA B 1 127 ? -34.422 23.799  -1.347  1.00 49.61  ?  125 ALA A C     1 
ATOM 1928 O O     . ALA B 1 127 ? -35.421 23.935  -0.632  1.00 50.22  ?  125 ALA A O     1 
ATOM 1929 C CB    . ALA B 1 127 ? -32.903 21.873  -0.840  1.00 48.06  ?  125 ALA A CB    1 
ATOM 1930 N N     . GLU B 1 128 ? -33.697 24.839  -1.759  1.00 49.67  ?  126 GLU A N     1 
ATOM 1931 C CA    . GLU B 1 128 ? -34.104 26.203  -1.446  1.00 51.23  ?  126 GLU A CA    1 
ATOM 1932 C C     . GLU B 1 128 ? -35.227 26.673  -2.360  1.00 52.66  ?  126 GLU A C     1 
ATOM 1933 O O     . GLU B 1 128 ? -36.161 27.344  -1.910  1.00 52.80  ?  126 GLU A O     1 
ATOM 1934 C CB    . GLU B 1 128 ? -32.901 27.139  -1.552  1.00 52.21  ?  126 GLU A CB    1 
ATOM 1935 C CG    . GLU B 1 128 ? -33.264 28.601  -1.691  1.00 54.67  ?  126 GLU A CG    1 
ATOM 1936 C CD    . GLU B 1 128 ? -32.426 29.494  -0.809  1.00 56.51  ?  126 GLU A CD    1 
ATOM 1937 O OE1   . GLU B 1 128 ? -31.440 29.000  -0.226  1.00 56.06  ?  126 GLU A OE1   1 
ATOM 1938 O OE2   . GLU B 1 128 ? -32.761 30.689  -0.694  1.00 58.04  -1 126 GLU A OE2   1 
ATOM 1939 N N     . GLU B 1 129 ? -35.156 26.311  -3.639  1.00 54.65  ?  127 GLU A N     1 
ATOM 1940 C CA    . GLU B 1 129 ? -36.189 26.700  -4.591  1.00 56.93  ?  127 GLU A CA    1 
ATOM 1941 C C     . GLU B 1 129 ? -37.529 26.052  -4.271  1.00 58.81  ?  127 GLU A C     1 
ATOM 1942 O O     . GLU B 1 129 ? -38.581 26.641  -4.543  1.00 60.44  ?  127 GLU A O     1 
ATOM 1943 C CB    . GLU B 1 129 ? -35.724 26.342  -6.004  1.00 56.54  ?  127 GLU A CB    1 
ATOM 1944 C CG    . GLU B 1 129 ? -36.811 26.173  -7.040  1.00 57.00  ?  127 GLU A CG    1 
ATOM 1945 C CD    . GLU B 1 129 ? -36.266 25.650  -8.353  1.00 58.81  ?  127 GLU A CD    1 
ATOM 1946 O OE1   . GLU B 1 129 ? -35.085 25.916  -8.654  1.00 59.12  ?  127 GLU A OE1   1 
ATOM 1947 O OE2   . GLU B 1 129 ? -37.016 24.971  -9.082  1.00 59.99  -1 127 GLU A OE2   1 
ATOM 1948 N N     . LEU B 1 130 ? -37.517 24.866  -3.670  1.00 57.30  ?  128 LEU A N     1 
ATOM 1949 C CA    . LEU B 1 130 ? -38.735 24.135  -3.354  1.00 54.71  ?  128 LEU A CA    1 
ATOM 1950 C C     . LEU B 1 130 ? -39.084 24.178  -1.874  1.00 53.91  ?  128 LEU A C     1 
ATOM 1951 O O     . LEU B 1 130 ? -40.112 23.619  -1.480  1.00 55.82  ?  128 LEU A O     1 
ATOM 1952 C CB    . LEU B 1 130 ? -38.612 22.680  -3.817  1.00 40.86  ?  128 LEU A CB    1 
ATOM 1953 N N     . ASN B 1 131 ? -38.248 24.809  -1.049  1.00 51.96  ?  129 ASN A N     1 
ATOM 1954 C CA    . ASN B 1 131 ? -38.471 24.930  0.392   1.00 49.29  ?  129 ASN A CA    1 
ATOM 1955 C C     . ASN B 1 131 ? -38.469 23.557  1.058   1.00 45.74  ?  129 ASN A C     1 
ATOM 1956 O O     . ASN B 1 131 ? -39.355 23.214  1.841   1.00 43.42  ?  129 ASN A O     1 
ATOM 1957 C CB    . ASN B 1 131 ? -39.765 25.692  0.693   1.00 51.17  ?  129 ASN A CB    1 
ATOM 1958 C CG    . ASN B 1 131 ? -39.880 26.093  2.147   1.00 53.09  ?  129 ASN A CG    1 
ATOM 1959 O OD1   . ASN B 1 131 ? -38.879 26.175  2.857   1.00 56.29  ?  129 ASN A OD1   1 
ATOM 1960 N ND2   . ASN B 1 131 ? -41.102 26.348  2.599   1.00 52.00  ?  129 ASN A ND2   1 
ATOM 1961 N N     . LEU B 1 132 ? -37.450 22.766  0.735   1.00 46.74  ?  130 LEU A N     1 
ATOM 1962 C CA    . LEU B 1 132 ? -37.258 21.447  1.313   1.00 48.08  ?  130 LEU A CA    1 
ATOM 1963 C C     . LEU B 1 132 ? -35.836 21.328  1.839   1.00 47.72  ?  130 LEU A C     1 
ATOM 1964 O O     . LEU B 1 132 ? -34.953 22.102  1.470   1.00 48.70  ?  130 LEU A O     1 
ATOM 1965 C CB    . LEU B 1 132 ? -37.536 20.345  0.282   1.00 49.75  ?  130 LEU A CB    1 
ATOM 1966 C CG    . LEU B 1 132 ? -38.998 20.134  -0.104  1.00 37.86  ?  130 LEU A CG    1 
ATOM 1967 C CD1   . LEU B 1 132 ? -39.087 19.321  -1.369  1.00 37.92  ?  130 LEU A CD1   1 
ATOM 1968 C CD2   . LEU B 1 132 ? -39.747 19.448  1.015   1.00 36.99  ?  130 LEU A CD2   1 
ATOM 1969 N N     . GLU B 1 133 ? -35.628 20.368  2.734   1.00 47.91  ?  131 GLU A N     1 
ATOM 1970 C CA    . GLU B 1 133 ? -34.285 20.092  3.216   1.00 52.49  ?  131 GLU A CA    1 
ATOM 1971 C C     . GLU B 1 133 ? -33.446 19.447  2.115   1.00 54.35  ?  131 GLU A C     1 
ATOM 1972 O O     . GLU B 1 133 ? -33.965 18.826  1.185   1.00 52.18  ?  131 GLU A O     1 
ATOM 1973 C CB    . GLU B 1 133 ? -34.329 19.191  4.448   1.00 56.59  ?  131 GLU A CB    1 
ATOM 1974 C CG    . GLU B 1 133 ? -35.295 19.658  5.522   1.00 61.96  ?  131 GLU A CG    1 
ATOM 1975 C CD    . GLU B 1 133 ? -34.586 20.246  6.725   1.00 67.56  ?  131 GLU A CD    1 
ATOM 1976 O OE1   . GLU B 1 133 ? -33.539 20.901  6.540   1.00 69.80  ?  131 GLU A OE1   1 
ATOM 1977 O OE2   . GLU B 1 133 ? -35.075 20.053  7.858   1.00 68.93  -1 131 GLU A OE2   1 
ATOM 1978 N N     . LYS B 1 134 ? -32.125 19.604  2.230   1.00 57.35  ?  132 LYS A N     1 
ATOM 1979 C CA    . LYS B 1 134 ? -31.227 19.056  1.217   1.00 61.79  ?  132 LYS A CA    1 
ATOM 1980 C C     . LYS B 1 134 ? -31.290 17.537  1.186   1.00 59.72  ?  132 LYS A C     1 
ATOM 1981 O O     . LYS B 1 134 ? -31.289 16.929  0.109   1.00 61.22  ?  132 LYS A O     1 
ATOM 1982 C CB    . LYS B 1 134 ? -29.791 19.514  1.470   1.00 67.62  ?  132 LYS A CB    1 
ATOM 1983 C CG    . LYS B 1 134 ? -28.774 18.842  0.559   1.00 70.66  ?  132 LYS A CG    1 
ATOM 1984 C CD    . LYS B 1 134 ? -27.351 19.029  1.050   1.00 78.74  ?  132 LYS A CD    1 
ATOM 1985 C CE    . LYS B 1 134 ? -26.350 18.470  0.053   1.00 84.56  ?  132 LYS A CE    1 
ATOM 1986 N NZ    . LYS B 1 134 ? -26.379 16.983  0.010   1.00 84.61  1  132 LYS A NZ    1 
ATOM 1987 N N     . GLU B 1 135 ? -31.336 16.906  2.359   1.00 52.96  ?  133 GLU A N     1 
ATOM 1988 C CA    . GLU B 1 135 ? -31.371 15.450  2.413   1.00 47.42  ?  133 GLU A CA    1 
ATOM 1989 C C     . GLU B 1 135 ? -32.641 14.918  1.767   1.00 42.78  ?  133 GLU A C     1 
ATOM 1990 O O     . GLU B 1 135 ? -32.609 13.912  1.050   1.00 40.93  ?  133 GLU A O     1 
ATOM 1991 C CB    . GLU B 1 135 ? -31.248 14.972  3.858   1.00 48.00  ?  133 GLU A CB    1 
ATOM 1992 C CG    . GLU B 1 135 ? -31.117 13.464  4.013   1.00 48.04  ?  133 GLU A CG    1 
ATOM 1993 C CD    . GLU B 1 135 ? -29.781 12.919  3.537   1.00 49.90  ?  133 GLU A CD    1 
ATOM 1994 O OE1   . GLU B 1 135 ? -28.920 13.707  3.095   1.00 53.19  ?  133 GLU A OE1   1 
ATOM 1995 O OE2   . GLU B 1 135 ? -29.595 11.688  3.595   1.00 48.76  -1 133 GLU A OE2   1 
ATOM 1996 N N     . VAL B 1 136 ? -33.774 15.572  2.026   1.00 41.24  ?  134 VAL A N     1 
ATOM 1997 C CA    . VAL B 1 136 ? -35.047 15.124  1.470   1.00 34.46  ?  134 VAL A CA    1 
ATOM 1998 C C     . VAL B 1 136 ? -34.990 15.125  -0.052  1.00 33.46  ?  134 VAL A C     1 
ATOM 1999 O O     . VAL B 1 136 ? -35.498 14.209  -0.709  1.00 29.80  ?  134 VAL A O     1 
ATOM 2000 C CB    . VAL B 1 136 ? -36.189 16.012  1.998   1.00 30.81  ?  134 VAL A CB    1 
ATOM 2001 C CG1   . VAL B 1 136 ? -37.333 16.072  1.007   1.00 28.59  ?  134 VAL A CG1   1 
ATOM 2002 C CG2   . VAL B 1 136 ? -36.668 15.508  3.342   1.00 30.38  ?  134 VAL A CG2   1 
ATOM 2003 N N     . VAL B 1 137 ? -34.350 16.140  -0.635  1.00 36.45  ?  135 VAL A N     1 
ATOM 2004 C CA    . VAL B 1 137 ? -34.223 16.200  -2.086  1.00 23.83  ?  135 VAL A CA    1 
ATOM 2005 C C     . VAL B 1 137 ? -33.225 15.166  -2.583  1.00 28.35  ?  135 VAL A C     1 
ATOM 2006 O O     . VAL B 1 137 ? -33.398 14.601  -3.668  1.00 22.49  ?  135 VAL A O     1 
ATOM 2007 C CB    . VAL B 1 137 ? -33.831 17.620  -2.526  1.00 34.33  ?  135 VAL A CB    1 
ATOM 2008 C CG1   . VAL B 1 137 ? -33.754 17.703  -4.034  1.00 34.73  ?  135 VAL A CG1   1 
ATOM 2009 C CG2   . VAL B 1 137 ? -34.824 18.631  -1.990  1.00 34.67  ?  135 VAL A CG2   1 
ATOM 2010 N N     . ARG B 1 138 ? -32.169 14.902  -1.810  1.00 32.16  ?  136 ARG A N     1 
ATOM 2011 C CA    . ARG B 1 138 ? -31.196 13.890  -2.207  1.00 30.29  ?  136 ARG A CA    1 
ATOM 2012 C C     . ARG B 1 138 ? -31.840 12.517  -2.289  1.00 23.47  ?  136 ARG A C     1 
ATOM 2013 O O     . ARG B 1 138 ? -31.697 11.809  -3.291  1.00 20.77  ?  136 ARG A O     1 
ATOM 2014 C CB    . ARG B 1 138 ? -30.036 13.844  -1.220  1.00 33.30  ?  136 ARG A CB    1 
ATOM 2015 C CG    . ARG B 1 138 ? -28.906 12.962  -1.709  1.00 38.45  ?  136 ARG A CG    1 
ATOM 2016 C CD    . ARG B 1 138 ? -27.927 12.626  -0.612  1.00 43.65  ?  136 ARG A CD    1 
ATOM 2017 N NE    . ARG B 1 138 ? -27.735 11.181  -0.550  1.00 44.39  ?  136 ARG A NE    1 
ATOM 2018 C CZ    . ARG B 1 138 ? -28.290 10.395  0.364   1.00 44.75  ?  136 ARG A CZ    1 
ATOM 2019 N NH1   . ARG B 1 138 ? -28.070 9.089   0.344   1.00 45.04  1  136 ARG A NH1   1 
ATOM 2020 N NH2   . ARG B 1 138 ? -29.073 10.914  1.296   1.00 43.88  ?  136 ARG A NH2   1 
ATOM 2021 N N     . VAL B 1 139 ? -32.540 12.116  -1.227  1.00 21.32  ?  137 VAL A N     1 
ATOM 2022 C CA    . VAL B 1 139 ? -33.192 10.813  -1.210  1.00 20.80  ?  137 VAL A CA    1 
ATOM 2023 C C     . VAL B 1 139 ? -34.276 10.729  -2.275  1.00 18.26  ?  137 VAL A C     1 
ATOM 2024 O O     . VAL B 1 139 ? -34.532 9.650   -2.821  1.00 16.02  ?  137 VAL A O     1 
ATOM 2025 C CB    . VAL B 1 139 ? -33.748 10.525  0.194   1.00 20.63  ?  137 VAL A CB    1 
ATOM 2026 C CG1   . VAL B 1 139 ? -34.282 9.115   0.271   1.00 19.43  ?  137 VAL A CG1   1 
ATOM 2027 C CG2   . VAL B 1 139 ? -32.668 10.728  1.231   1.00 22.18  ?  137 VAL A CG2   1 
ATOM 2028 N N     . TRP B 1 140 ? -34.939 11.844  -2.582  1.00 18.83  ?  138 TRP A N     1 
ATOM 2029 C CA    . TRP B 1 140 ? -35.945 11.829  -3.638  1.00 18.92  ?  138 TRP A CA    1 
ATOM 2030 C C     . TRP B 1 140 ? -35.336 11.389  -4.962  1.00 20.89  ?  138 TRP A C     1 
ATOM 2031 O O     . TRP B 1 140 ? -35.845 10.475  -5.618  1.00 23.60  ?  138 TRP A O     1 
ATOM 2032 C CB    . TRP B 1 140 ? -36.592 13.207  -3.775  1.00 20.95  ?  138 TRP A CB    1 
ATOM 2033 C CG    . TRP B 1 140 ? -37.817 13.198  -4.632  1.00 22.65  ?  138 TRP A CG    1 
ATOM 2034 C CD1   . TRP B 1 140 ? -39.105 13.078  -4.211  1.00 22.95  ?  138 TRP A CD1   1 
ATOM 2035 C CD2   . TRP B 1 140 ? -37.871 13.301  -6.058  1.00 24.10  ?  138 TRP A CD2   1 
ATOM 2036 N NE1   . TRP B 1 140 ? -39.959 13.104  -5.283  1.00 22.29  ?  138 TRP A NE1   1 
ATOM 2037 C CE2   . TRP B 1 140 ? -39.224 13.239  -6.430  1.00 23.58  ?  138 TRP A CE2   1 
ATOM 2038 C CE3   . TRP B 1 140 ? -36.905 13.440  -7.057  1.00 24.52  ?  138 TRP A CE3   1 
ATOM 2039 C CZ2   . TRP B 1 140 ? -39.635 13.312  -7.752  1.00 25.05  ?  138 TRP A CZ2   1 
ATOM 2040 C CZ3   . TRP B 1 140 ? -37.315 13.509  -8.366  1.00 25.00  ?  138 TRP A CZ3   1 
ATOM 2041 C CH2   . TRP B 1 140 ? -38.666 13.446  -8.704  1.00 25.63  ?  138 TRP A CH2   1 
ATOM 2042 N N     . PHE B 1 141 ? -34.239 12.030  -5.369  1.00 24.28  ?  139 PHE A N     1 
ATOM 2043 C CA    . PHE B 1 141 ? -33.585 11.657  -6.617  1.00 28.72  ?  139 PHE A CA    1 
ATOM 2044 C C     . PHE B 1 141 ? -33.066 10.231  -6.577  1.00 31.54  ?  139 PHE A C     1 
ATOM 2045 O O     . PHE B 1 141 ? -33.056 9.548   -7.606  1.00 32.78  ?  139 PHE A O     1 
ATOM 2046 C CB    . PHE B 1 141 ? -32.446 12.623  -6.927  1.00 32.27  ?  139 PHE A CB    1 
ATOM 2047 C CG    . PHE B 1 141 ? -32.900 13.899  -7.561  1.00 35.43  ?  139 PHE A CG    1 
ATOM 2048 C CD1   . PHE B 1 141 ? -33.331 14.955  -6.786  1.00 35.04  ?  139 PHE A CD1   1 
ATOM 2049 C CD2   . PHE B 1 141 ? -32.900 14.039  -8.937  1.00 38.05  ?  139 PHE A CD2   1 
ATOM 2050 C CE1   . PHE B 1 141 ? -33.750 16.123  -7.366  1.00 38.36  ?  139 PHE A CE1   1 
ATOM 2051 C CE2   . PHE B 1 141 ? -33.320 15.206  -9.522  1.00 41.33  ?  139 PHE A CE2   1 
ATOM 2052 C CZ    . PHE B 1 141 ? -33.745 16.250  -8.736  1.00 42.10  ?  139 PHE A CZ    1 
ATOM 2053 N N     . CYS B 1 142 ? -32.611 9.771   -5.413  1.00 32.54  ?  140 CYS A N     1 
ATOM 2054 C CA    . CYS B 1 142 ? -32.206 8.378   -5.278  1.00 32.41  ?  140 CYS A CA    1 
ATOM 2055 C C     . CYS B 1 142 ? -33.374 7.450   -5.584  1.00 28.86  ?  140 CYS A C     1 
ATOM 2056 O O     . CYS B 1 142 ? -33.286 6.582   -6.459  1.00 25.77  ?  140 CYS A O     1 
ATOM 2057 C CB    . CYS B 1 142 ? -31.657 8.127   -3.873  1.00 32.61  ?  140 CYS A CB    1 
ATOM 2058 S SG    . CYS B 1 142 ? -30.189 9.085   -3.461  1.00 36.42  ?  140 CYS A SG    1 
ATOM 2059 N N     . ASN B 1 143 ? -34.485 7.624   -4.866  1.00 29.10  ?  141 ASN A N     1 
ATOM 2060 C CA    . ASN B 1 143 ? -35.670 6.809   -5.113  1.00 26.61  ?  141 ASN A CA    1 
ATOM 2061 C C     . ASN B 1 143 ? -36.218 7.016   -6.517  1.00 28.76  ?  141 ASN A C     1 
ATOM 2062 O O     . ASN B 1 143 ? -36.746 6.076   -7.120  1.00 28.59  ?  141 ASN A O     1 
ATOM 2063 C CB    . ASN B 1 143 ? -36.746 7.129   -4.081  1.00 21.09  ?  141 ASN A CB    1 
ATOM 2064 C CG    . ASN B 1 143 ? -36.342 6.733   -2.688  1.00 21.13  ?  141 ASN A CG    1 
ATOM 2065 O OD1   . ASN B 1 143 ? -35.568 5.797   -2.495  1.00 20.18  ?  141 ASN A OD1   1 
ATOM 2066 N ND2   . ASN B 1 143 ? -36.858 7.448   -1.701  1.00 21.67  ?  141 ASN A ND2   1 
ATOM 2067 N N     . ARG B 1 144 ? -36.116 8.235   -7.046  1.00 29.40  ?  142 ARG A N     1 
ATOM 2068 C CA    . ARG B 1 144 ? -36.544 8.479   -8.418  1.00 30.62  ?  142 ARG A CA    1 
ATOM 2069 C C     . ARG B 1 144 ? -35.685 7.710   -9.411  1.00 34.04  ?  142 ARG A C     1 
ATOM 2070 O O     . ARG B 1 144 ? -36.197 7.173   -10.399 1.00 37.48  ?  142 ARG A O     1 
ATOM 2071 C CB    . ARG B 1 144 ? -36.515 9.972   -8.724  1.00 32.95  ?  142 ARG A CB    1 
ATOM 2072 C CG    . ARG B 1 144 ? -37.105 10.313  -10.069 1.00 36.62  ?  142 ARG A CG    1 
ATOM 2073 C CD    . ARG B 1 144 ? -38.519 9.791   -10.181 1.00 37.18  ?  142 ARG A CD    1 
ATOM 2074 N NE    . ARG B 1 144 ? -39.137 10.162  -11.448 1.00 39.74  ?  142 ARG A NE    1 
ATOM 2075 C CZ    . ARG B 1 144 ? -39.014 9.462   -12.568 1.00 40.43  ?  142 ARG A CZ    1 
ATOM 2076 N NH1   . ARG B 1 144 ? -38.290 8.354   -12.582 1.00 39.77  1  142 ARG A NH1   1 
ATOM 2077 N NH2   . ARG B 1 144 ? -39.614 9.871   -13.674 1.00 41.49  ?  142 ARG A NH2   1 
ATOM 2078 N N     . ARG B 1 145 ? -34.373 7.656   -9.177  1.00 32.84  ?  143 ARG A N     1 
ATOM 2079 C CA    . ARG B 1 145 ? -33.500 6.912   -10.078 1.00 31.94  ?  143 ARG A CA    1 
ATOM 2080 C C     . ARG B 1 145 ? -33.812 5.422   -10.046 1.00 29.32  ?  143 ARG A C     1 
ATOM 2081 O O     . ARG B 1 145 ? -33.829 4.767   -11.092 1.00 30.02  ?  143 ARG A O     1 
ATOM 2082 C CB    . ARG B 1 145 ? -32.036 7.166   -9.733  1.00 34.89  ?  143 ARG A CB    1 
ATOM 2083 C CG    . ARG B 1 145 ? -31.452 8.385   -10.418 1.00 37.96  ?  143 ARG A CG    1 
ATOM 2084 C CD    . ARG B 1 145 ? -29.985 8.562   -10.086 1.00 42.72  ?  143 ARG A CD    1 
ATOM 2085 N NE    . ARG B 1 145 ? -29.759 9.524   -9.017  1.00 48.72  ?  143 ARG A NE    1 
ATOM 2086 C CZ    . ARG B 1 145 ? -28.961 9.308   -7.978  1.00 56.88  ?  143 ARG A CZ    1 
ATOM 2087 N NH1   . ARG B 1 145 ? -28.321 8.155   -7.860  1.00 60.36  1  143 ARG A NH1   1 
ATOM 2088 N NH2   . ARG B 1 145 ? -28.808 10.244  -7.053  1.00 59.89  ?  143 ARG A NH2   1 
ATOM 2089 N N     . GLN B 1 146 ? -34.031 4.863   -8.854  1.00 28.15  ?  144 GLN A N     1 
ATOM 2090 C CA    . GLN B 1 146 ? -34.407 3.457   -8.753  1.00 29.16  ?  144 GLN A CA    1 
ATOM 2091 C C     . GLN B 1 146 ? -35.721 3.174   -9.463  1.00 27.71  ?  144 GLN A C     1 
ATOM 2092 O O     . GLN B 1 146 ? -35.930 2.066   -9.967  1.00 26.97  ?  144 GLN A O     1 
ATOM 2093 C CB    . GLN B 1 146 ? -34.528 3.045   -7.292  1.00 30.30  ?  144 GLN A CB    1 
ATOM 2094 C CG    . GLN B 1 146 ? -33.231 2.879   -6.557  1.00 34.00  ?  144 GLN A CG    1 
ATOM 2095 C CD    . GLN B 1 146 ? -33.422 2.064   -5.304  1.00 37.46  ?  144 GLN A CD    1 
ATOM 2096 O OE1   . GLN B 1 146 ? -34.374 2.274   -4.556  1.00 36.85  ?  144 GLN A OE1   1 
ATOM 2097 N NE2   . GLN B 1 146 ? -32.533 1.110   -5.077  1.00 41.43  ?  144 GLN A NE2   1 
ATOM 2098 N N     . ARG B 1 147 ? -36.618 4.156   -9.497  1.00 26.64  ?  145 ARG A N     1 
ATOM 2099 C CA    A ARG B 1 147 ? -37.917 3.967   -10.131 0.49 26.80  ?  145 ARG A CA    1 
ATOM 2100 C CA    B ARG B 1 147 ? -37.917 3.954   -10.128 0.51 26.78  ?  145 ARG A CA    1 
ATOM 2101 C C     . ARG B 1 147 ? -37.780 3.718   -11.626 1.00 29.76  ?  145 ARG A C     1 
ATOM 2102 O O     . ARG B 1 147 ? -38.618 3.038   -12.225 1.00 32.18  ?  145 ARG A O     1 
ATOM 2103 C CB    A ARG B 1 147 ? -38.787 5.191   -9.854  0.49 26.83  ?  145 ARG A CB    1 
ATOM 2104 C CB    B ARG B 1 147 ? -38.824 5.153   -9.845  0.51 26.85  ?  145 ARG A CB    1 
ATOM 2105 C CG    A ARG B 1 147 ? -40.125 5.237   -10.541 0.49 26.95  ?  145 ARG A CG    1 
ATOM 2106 C CG    B ARG B 1 147 ? -40.100 5.192   -10.657 0.51 26.96  ?  145 ARG A CG    1 
ATOM 2107 C CD    A ARG B 1 147 ? -40.914 6.388   -9.959  0.49 26.66  ?  145 ARG A CD    1 
ATOM 2108 C CD    B ARG B 1 147 ? -41.098 6.179   -10.086 0.51 26.77  ?  145 ARG A CD    1 
ATOM 2109 N NE    A ARG B 1 147 ? -41.049 6.245   -8.512  0.49 25.42  ?  145 ARG A NE    1 
ATOM 2110 N NE    B ARG B 1 147 ? -42.318 6.221   -10.887 0.51 27.56  ?  145 ARG A NE    1 
ATOM 2111 C CZ    A ARG B 1 147 ? -41.110 7.259   -7.655  0.49 27.11  ?  145 ARG A CZ    1 
ATOM 2112 C CZ    B ARG B 1 147 ? -43.412 6.896   -10.555 0.51 27.39  ?  145 ARG A CZ    1 
ATOM 2113 N NH1   A ARG B 1 147 ? -41.233 7.024   -6.356  0.49 10.87  1  145 ARG A NH1   1 
ATOM 2114 N NH1   B ARG B 1 147 ? -44.469 6.872   -11.352 0.51 26.90  1  145 ARG A NH1   1 
ATOM 2115 N NH2   A ARG B 1 147 ? -41.033 8.508   -8.093  0.49 29.80  ?  145 ARG A NH2   1 
ATOM 2116 N NH2   B ARG B 1 147 ? -43.452 7.592   -9.430  0.51 24.95  ?  145 ARG A NH2   1 
ATOM 2117 N N     . GLU B 1 148 ? -36.737 4.254   -12.243 1.00 32.18  ?  146 GLU A N     1 
ATOM 2118 C CA    . GLU B 1 148 ? -36.494 3.990   -13.652 1.00 35.86  ?  146 GLU A CA    1 
ATOM 2119 C C     . GLU B 1 148 ? -35.740 2.690   -13.881 1.00 37.00  ?  146 GLU A C     1 
ATOM 2120 O O     . GLU B 1 148 ? -35.509 2.321   -15.036 1.00 42.34  ?  146 GLU A O     1 
ATOM 2121 C CB    . GLU B 1 148 ? -35.738 5.160   -14.281 1.00 38.41  ?  146 GLU A CB    1 
ATOM 2122 C CG    . GLU B 1 148 ? -36.580 6.407   -14.420 1.00 40.64  ?  146 GLU A CG    1 
ATOM 2123 C CD    . GLU B 1 148 ? -37.553 6.312   -15.574 1.00 47.65  ?  146 GLU A CD    1 
ATOM 2124 O OE1   . GLU B 1 148 ? -37.378 5.423   -16.430 1.00 50.38  ?  146 GLU A OE1   1 
ATOM 2125 O OE2   . GLU B 1 148 ? -38.502 7.120   -15.621 1.00 50.78  -1 146 GLU A OE2   1 
ATOM 2126 N N     . LYS B 1 149 ? -35.344 1.996   -12.817 1.00 33.02  ?  147 LYS A N     1 
ATOM 2127 C CA    . LYS B 1 149 ? -34.669 0.715   -12.934 1.00 35.09  ?  147 LYS A CA    1 
ATOM 2128 C C     . LYS B 1 149 ? -35.592 -0.473  -12.699 1.00 35.97  ?  147 LYS A C     1 
ATOM 2129 O O     . LYS B 1 149 ? -35.195 -1.607  -12.980 1.00 38.73  ?  147 LYS A O     1 
ATOM 2130 C CB    . LYS B 1 149 ? -33.489 0.648   -11.959 1.00 37.27  ?  147 LYS A CB    1 
ATOM 2131 C CG    . LYS B 1 149 ? -32.460 1.739   -12.180 1.00 40.90  ?  147 LYS A CG    1 
ATOM 2132 C CD    . LYS B 1 149 ? -31.153 1.422   -11.486 1.00 44.43  ?  147 LYS A CD    1 
ATOM 2133 C CE    . LYS B 1 149 ? -29.997 2.141   -12.159 1.00 49.00  ?  147 LYS A CE    1 
ATOM 2134 N NZ    . LYS B 1 149 ? -29.828 1.700   -13.569 1.00 50.93  1  147 LYS A NZ    1 
ATOM 2135 N N     . ARG B 1 150 ? -36.800 -0.249  -12.191 1.00 34.97  ?  148 ARG A N     1 
ATOM 2136 C CA    . ARG B 1 150 ? -37.715 -1.353  -11.965 1.00 33.67  ?  148 ARG A CA    1 
ATOM 2137 C C     . ARG B 1 150 ? -38.245 -1.878  -13.295 1.00 34.30  ?  148 ARG A C     1 
ATOM 2138 O O     . ARG B 1 150 ? -38.253 -1.182  -14.312 1.00 36.70  ?  148 ARG A O     1 
ATOM 2139 C CB    . ARG B 1 150 ? -38.872 -0.927  -11.060 1.00 31.70  ?  148 ARG A CB    1 
ATOM 2140 C CG    . ARG B 1 150 ? -39.617 0.293   -11.532 1.00 30.88  ?  148 ARG A CG    1 
ATOM 2141 C CD    . ARG B 1 150 ? -40.866 0.559   -10.711 1.00 32.30  ?  148 ARG A CD    1 
ATOM 2142 N NE    . ARG B 1 150 ? -40.565 0.892   -9.324  1.00 31.90  ?  148 ARG A NE    1 
ATOM 2143 C CZ    . ARG B 1 150 ? -41.304 1.700   -8.572  1.00 31.93  ?  148 ARG A CZ    1 
ATOM 2144 N NH1   . ARG B 1 150 ? -42.387 2.270   -9.073  1.00 32.63  1  148 ARG A NH1   1 
ATOM 2145 N NH2   . ARG B 1 150 ? -40.957 1.944   -7.319  1.00 33.57  ?  148 ARG A NH2   1 
ATOM 2146 N N     . VAL B 1 151 ? -38.692 -3.134  -13.276 1.00 32.66  ?  149 VAL A N     1 
ATOM 2147 C CA    . VAL B 1 151 ? -39.061 -3.789  -14.523 1.00 35.31  ?  149 VAL A CA    1 
ATOM 2148 C C     . VAL B 1 151 ? -40.367 -3.223  -15.064 1.00 39.07  ?  149 VAL A C     1 
ATOM 2149 O O     . VAL B 1 151 ? -40.575 -3.177  -16.282 1.00 42.20  ?  149 VAL A O     1 
ATOM 2150 C CB    . VAL B 1 151 ? -39.132 -5.312  -14.299 1.00 34.57  ?  149 VAL A CB    1 
ATOM 2151 C CG1   . VAL B 1 151 ? -40.113 -5.966  -15.248 1.00 34.64  ?  149 VAL A CG1   1 
ATOM 2152 C CG2   . VAL B 1 151 ? -37.758 -5.931  -14.443 1.00 35.96  ?  149 VAL A CG2   1 
ATOM 2153 N N     . LYS B 1 152 ? -41.235 -2.728  -14.190 1.00 39.76  ?  150 LYS A N     1 
ATOM 2154 C CA    . LYS B 1 152 ? -42.526 -2.205  -14.617 1.00 40.55  ?  150 LYS A CA    1 
ATOM 2155 C C     . LYS B 1 152 ? -42.894 -0.951  -13.835 1.00 42.65  ?  150 LYS A C     1 
ATOM 2156 O O     . LYS B 1 152 ? -42.563 0.164   -14.232 1.00 44.40  ?  150 LYS A O     1 
ATOM 2157 C CB    . LYS B 1 152 ? -43.615 -3.268  -14.458 1.00 38.53  ?  150 LYS A CB    1 
ATOM 2158 C CG    . LYS B 1 152 ? -44.041 -3.911  -15.768 1.00 39.43  ?  150 LYS A CG    1 
ATOM 2159 C CD    . LYS B 1 152 ? -44.856 -5.172  -15.544 1.00 41.10  ?  150 LYS A CD    1 
ATOM 2160 C CE    . LYS B 1 152 ? -46.326 -4.857  -15.331 1.00 43.88  ?  150 LYS A CE    1 
ATOM 2161 N NZ    . LYS B 1 152 ? -47.121 -6.075  -15.007 1.00 45.05  1  150 LYS A NZ    1 
ATOM 2162 O OXT   . LYS B 1 152 ? -43.536 -1.019  -12.791 1.00 43.15  ?  150 LYS A OXT   1 
ATOM 2163 C "C5'" . DC  C 2 1   ? -57.422 -7.745  3.750   1.00 33.07  ?  170 DC  C "C5'" 1 
ATOM 2164 C "C4'" . DC  C 2 1   ? -57.336 -6.813  2.558   1.00 33.49  ?  170 DC  C "C4'" 1 
ATOM 2165 O "O4'" . DC  C 2 1   ? -57.452 -5.459  3.014   1.00 35.42  ?  170 DC  C "O4'" 1 
ATOM 2166 C "C3'" . DC  C 2 1   ? -56.020 -6.878  1.795   1.00 32.10  ?  170 DC  C "C3'" 1 
ATOM 2167 O "O3'" . DC  C 2 1   ? -56.182 -7.640  0.601   1.00 31.83  ?  170 DC  C "O3'" 1 
ATOM 2168 C "C2'" . DC  C 2 1   ? -55.666 -5.413  1.495   1.00 32.22  ?  170 DC  C "C2'" 1 
ATOM 2169 C "C1'" . DC  C 2 1   ? -56.814 -4.615  2.100   1.00 36.10  ?  170 DC  C "C1'" 1 
ATOM 2170 N N1    . DC  C 2 1   ? -56.361 -3.403  2.826   1.00 40.93  ?  170 DC  C N1    1 
ATOM 2171 C C2    . DC  C 2 1   ? -56.007 -2.259  2.111   1.00 41.63  ?  170 DC  C C2    1 
ATOM 2172 O O2    . DC  C 2 1   ? -56.086 -2.270  0.879   1.00 39.72  ?  170 DC  C O2    1 
ATOM 2173 N N3    . DC  C 2 1   ? -55.596 -1.163  2.793   1.00 43.44  ?  170 DC  C N3    1 
ATOM 2174 C C4    . DC  C 2 1   ? -55.528 -1.191  4.124   1.00 43.57  ?  170 DC  C C4    1 
ATOM 2175 N N4    . DC  C 2 1   ? -55.113 -0.088  4.754   1.00 44.86  ?  170 DC  C N4    1 
ATOM 2176 C C5    . DC  C 2 1   ? -55.877 -2.351  4.867   1.00 43.12  ?  170 DC  C C5    1 
ATOM 2177 C C6    . DC  C 2 1   ? -56.281 -3.423  4.184   1.00 42.86  ?  170 DC  C C6    1 
ATOM 2178 P P     . DC  C 2 2   ? -54.984 -7.744  -0.461  1.00 27.98  ?  171 DC  C P     1 
ATOM 2179 O OP1   . DC  C 2 2   ? -55.315 -8.794  -1.438  1.00 28.32  ?  171 DC  C OP1   1 
ATOM 2180 O OP2   . DC  C 2 2   ? -53.715 -7.804  0.286   1.00 29.93  -1 171 DC  C OP2   1 
ATOM 2181 O "O5'" . DC  C 2 2   ? -55.048 -6.361  -1.235  1.00 24.73  ?  171 DC  C "O5'" 1 
ATOM 2182 C "C5'" . DC  C 2 2   ? -54.446 -6.226  -2.487  1.00 23.91  ?  171 DC  C "C5'" 1 
ATOM 2183 C "C4'" . DC  C 2 2   ? -54.408 -4.770  -2.884  1.00 27.52  ?  171 DC  C "C4'" 1 
ATOM 2184 O "O4'" . DC  C 2 2   ? -54.505 -3.954  -1.703  1.00 30.40  ?  171 DC  C "O4'" 1 
ATOM 2185 C "C3'" . DC  C 2 2   ? -53.126 -4.340  -3.593  1.00 28.12  ?  171 DC  C "C3'" 1 
ATOM 2186 O "O3'" . DC  C 2 2   ? -53.409 -3.988  -4.923  1.00 28.76  ?  171 DC  C "O3'" 1 
ATOM 2187 C "C2'" . DC  C 2 2   ? -52.613 -3.141  -2.789  1.00 30.22  ?  171 DC  C "C2'" 1 
ATOM 2188 C "C1'" . DC  C 2 2   ? -53.797 -2.767  -1.914  1.00 33.06  ?  171 DC  C "C1'" 1 
ATOM 2189 N N1    . DC  C 2 2   ? -53.384 -2.227  -0.600  1.00 37.34  ?  171 DC  C N1    1 
ATOM 2190 C C2    . DC  C 2 2   ? -53.618 -0.886  -0.300  1.00 40.83  ?  171 DC  C C2    1 
ATOM 2191 O O2    . DC  C 2 2   ? -54.197 -0.174  -1.129  1.00 44.71  ?  171 DC  C O2    1 
ATOM 2192 N N3    . DC  C 2 2   ? -53.223 -0.407  0.903   1.00 38.69  ?  171 DC  C N3    1 
ATOM 2193 C C4    . DC  C 2 2   ? -52.607 -1.208  1.770   1.00 34.03  ?  171 DC  C C4    1 
ATOM 2194 N N4    . DC  C 2 2   ? -52.233 -0.690  2.941   1.00 29.21  ?  171 DC  C N4    1 
ATOM 2195 C C5    . DC  C 2 2   ? -52.349 -2.574  1.476   1.00 36.35  ?  171 DC  C C5    1 
ATOM 2196 C C6    . DC  C 2 2   ? -52.745 -3.035  0.288   1.00 37.14  ?  171 DC  C C6    1 
ATOM 2197 P P     . DA  C 2 3   ? -52.216 -3.817  -5.975  1.00 25.49  ?  172 DA  C P     1 
ATOM 2198 O OP1   . DA  C 2 3   ? -52.814 -3.922  -7.318  1.00 31.68  -1 172 DA  C OP1   1 
ATOM 2199 O OP2   . DA  C 2 3   ? -51.116 -4.715  -5.581  1.00 24.71  ?  172 DA  C OP2   1 
ATOM 2200 O "O5'" . DA  C 2 3   ? -51.741 -2.318  -5.752  1.00 21.91  ?  172 DA  C "O5'" 1 
ATOM 2201 C "C5'" . DA  C 2 3   ? -52.637 -1.271  -6.024  1.00 26.65  ?  172 DA  C "C5'" 1 
ATOM 2202 C "C4'" . DA  C 2 3   ? -52.044 0.074   -5.656  1.00 30.24  ?  172 DA  C "C4'" 1 
ATOM 2203 O "O4'" . DA  C 2 3   ? -51.909 0.173   -4.227  1.00 32.87  ?  172 DA  C "O4'" 1 
ATOM 2204 C "C3'" . DA  C 2 3   ? -50.658 0.362   -6.238  1.00 28.87  ?  172 DA  C "C3'" 1 
ATOM 2205 O "O3'" . DA  C 2 3   ? -50.723 1.509   -7.054  1.00 30.60  ?  172 DA  C "O3'" 1 
ATOM 2206 C "C2'" . DA  C 2 3   ? -49.774 0.594   -5.008  1.00 28.91  ?  172 DA  C "C2'" 1 
ATOM 2207 C "C1'" . DA  C 2 3   ? -50.791 0.959   -3.947  1.00 34.66  ?  172 DA  C "C1'" 1 
ATOM 2208 N N9    . DA  C 2 3   ? -50.357 0.668   -2.593  1.00 41.26  ?  172 DA  C N9    1 
ATOM 2209 C C8    . DA  C 2 3   ? -49.749 -0.466  -2.149  1.00 41.71  ?  172 DA  C C8    1 
ATOM 2210 N N7    . DA  C 2 3   ? -49.484 -0.456  -0.866  1.00 42.66  ?  172 DA  C N7    1 
ATOM 2211 C C5    . DA  C 2 3   ? -49.970 0.766   -0.440  1.00 43.58  ?  172 DA  C C5    1 
ATOM 2212 C C6    . DA  C 2 3   ? -50.002 1.384   0.819   1.00 43.94  ?  172 DA  C C6    1 
ATOM 2213 N N6    . DA  C 2 3   ? -49.512 0.823   1.923   1.00 41.92  ?  172 DA  C N6    1 
ATOM 2214 N N1    . DA  C 2 3   ? -50.560 2.607   0.902   1.00 47.94  ?  172 DA  C N1    1 
ATOM 2215 C C2    . DA  C 2 3   ? -51.051 3.167   -0.207  1.00 48.83  ?  172 DA  C C2    1 
ATOM 2216 N N3    . DA  C 2 3   ? -51.078 2.684   -1.443  1.00 48.63  ?  172 DA  C N3    1 
ATOM 2217 C C4    . DA  C 2 3   ? -50.516 1.467   -1.491  1.00 45.40  ?  172 DA  C C4    1 
ATOM 2218 P P     . DT  C 2 4   ? -49.415 2.053   -7.798  1.00 29.52  ?  173 DT  C P     1 
ATOM 2219 O OP1   . DT  C 2 4   ? -49.860 2.844   -8.957  1.00 31.27  -1 173 DT  C OP1   1 
ATOM 2220 O OP2   . DT  C 2 4   ? -48.483 0.926   -7.971  1.00 21.56  ?  173 DT  C OP2   1 
ATOM 2221 O "O5'" . DT  C 2 4   ? -48.777 3.060   -6.752  1.00 24.15  ?  173 DT  C "O5'" 1 
ATOM 2222 C "C5'" . DT  C 2 4   ? -49.472 4.233   -6.404  1.00 28.18  ?  173 DT  C "C5'" 1 
ATOM 2223 C "C4'" . DT  C 2 4   ? -48.709 5.013   -5.358  1.00 30.37  ?  173 DT  C "C4'" 1 
ATOM 2224 O "O4'" . DT  C 2 4   ? -48.685 4.284   -4.118  1.00 31.77  ?  173 DT  C "O4'" 1 
ATOM 2225 C "C3'" . DT  C 2 4   ? -47.244 5.291   -5.709  1.00 29.94  ?  173 DT  C "C3'" 1 
ATOM 2226 O "O3'" . DT  C 2 4   ? -47.047 6.674   -5.883  1.00 32.06  ?  173 DT  C "O3'" 1 
ATOM 2227 C "C2'" . DT  C 2 4   ? -46.457 4.762   -4.505  1.00 29.79  ?  173 DT  C "C2'" 1 
ATOM 2228 C "C1'" . DT  C 2 4   ? -47.523 4.650   -3.435  1.00 31.02  ?  173 DT  C "C1'" 1 
ATOM 2229 N N1    . DT  C 2 4   ? -47.218 3.628   -2.425  1.00 28.65  ?  173 DT  C N1    1 
ATOM 2230 C C2    . DT  C 2 4   ? -47.344 3.939   -1.100  1.00 30.44  ?  173 DT  C C2    1 
ATOM 2231 O O2    . DT  C 2 4   ? -47.720 5.024   -0.704  1.00 33.59  ?  173 DT  C O2    1 
ATOM 2232 N N3    . DT  C 2 4   ? -47.029 2.925   -0.245  1.00 30.70  ?  173 DT  C N3    1 
ATOM 2233 C C4    . DT  C 2 4   ? -46.596 1.660   -0.578  1.00 29.56  ?  173 DT  C C4    1 
ATOM 2234 O O4    . DT  C 2 4   ? -46.335 0.815   0.265   1.00 29.49  ?  173 DT  C O4    1 
ATOM 2235 C C5    . DT  C 2 4   ? -46.476 1.403   -1.986  1.00 27.32  ?  173 DT  C C5    1 
ATOM 2236 C C7    . DT  C 2 4   ? -46.017 0.064   -2.471  1.00 23.79  ?  173 DT  C C7    1 
ATOM 2237 C C6    . DT  C 2 4   ? -46.787 2.389   -2.832  1.00 27.67  ?  173 DT  C C6    1 
ATOM 2238 P P     . DT  C 2 5   ? -45.577 7.261   -6.132  1.00 34.30  ?  174 DT  C P     1 
ATOM 2239 O OP1   . DT  C 2 5   ? -45.726 8.442   -6.999  1.00 37.58  -1 174 DT  C OP1   1 
ATOM 2240 O OP2   . DT  C 2 5   ? -44.675 6.171   -6.549  1.00 35.48  ?  174 DT  C OP2   1 
ATOM 2241 O "O5'" . DT  C 2 5   ? -45.138 7.760   -4.685  1.00 33.75  ?  174 DT  C "O5'" 1 
ATOM 2242 C "C5'" . DT  C 2 5   ? -45.911 8.739   -4.024  1.00 35.90  ?  174 DT  C "C5'" 1 
ATOM 2243 C "C4'" . DT  C 2 5   ? -45.554 8.816   -2.555  1.00 30.82  ?  174 DT  C "C4'" 1 
ATOM 2244 O "O4'" . DT  C 2 5   ? -45.447 7.487   -2.010  1.00 29.30  ?  174 DT  C "O4'" 1 
ATOM 2245 C "C3'" . DT  C 2 5   ? -44.220 9.506   -2.263  1.00 37.93  ?  174 DT  C "C3'" 1 
ATOM 2246 O "O3'" . DT  C 2 5   ? -44.429 10.666  -1.479  1.00 40.05  ?  174 DT  C "O3'" 1 
ATOM 2247 C "C2'" . DT  C 2 5   ? -43.402 8.455   -1.503  1.00 36.60  ?  174 DT  C "C2'" 1 
ATOM 2248 C "C1'" . DT  C 2 5   ? -44.467 7.495   -1.013  1.00 32.30  ?  174 DT  C "C1'" 1 
ATOM 2249 N N1    . DT  C 2 5   ? -43.967 6.116   -0.813  1.00 27.90  ?  174 DT  C N1    1 
ATOM 2250 C C2    . DT  C 2 5   ? -43.898 5.612   0.457   1.00 27.75  ?  174 DT  C C2    1 
ATOM 2251 O O2    . DT  C 2 5   ? -44.245 6.235   1.437   1.00 29.27  ?  174 DT  C O2    1 
ATOM 2252 N N3    . DT  C 2 5   ? -43.419 4.338   0.542   1.00 26.15  ?  174 DT  C N3    1 
ATOM 2253 C C4    . DT  C 2 5   ? -42.999 3.537   -0.496  1.00 26.22  ?  174 DT  C C4    1 
ATOM 2254 O O4    . DT  C 2 5   ? -42.581 2.401   -0.319  1.00 26.95  ?  174 DT  C O4    1 
ATOM 2255 C C5    . DT  C 2 5   ? -43.088 4.128   -1.804  1.00 25.77  ?  174 DT  C C5    1 
ATOM 2256 C C7    . DT  C 2 5   ? -42.661 3.351   -3.009  1.00 22.92  ?  174 DT  C C7    1 
ATOM 2257 C C6    . DT  C 2 5   ? -43.558 5.378   -1.898  1.00 26.37  ?  174 DT  C C6    1 
ATOM 2258 P P     . DC  C 2 6   ? -43.260 11.755  -1.342  1.00 38.78  ?  175 DC  C P     1 
ATOM 2259 O OP1   . DC  C 2 6   ? -43.862 13.003  -0.845  1.00 42.25  -1 175 DC  C OP1   1 
ATOM 2260 O OP2   . DC  C 2 6   ? -42.498 11.756  -2.603  1.00 37.26  ?  175 DC  C OP2   1 
ATOM 2261 O "O5'" . DC  C 2 6   ? -42.321 11.167  -0.199  1.00 37.54  ?  175 DC  C "O5'" 1 
ATOM 2262 C "C5'" . DC  C 2 6   ? -42.271 11.802  1.056   1.00 35.82  ?  175 DC  C "C5'" 1 
ATOM 2263 C "C4'" . DC  C 2 6   ? -41.749 10.859  2.120   1.00 39.28  ?  175 DC  C "C4'" 1 
ATOM 2264 O "O4'" . DC  C 2 6   ? -41.782 9.503   1.618   1.00 39.81  ?  175 DC  C "O4'" 1 
ATOM 2265 C "C3'" . DC  C 2 6   ? -40.304 11.113  2.561   1.00 40.59  ?  175 DC  C "C3'" 1 
ATOM 2266 O "O3'" . DC  C 2 6   ? -40.237 11.217  3.969   1.00 44.44  ?  175 DC  C "O3'" 1 
ATOM 2267 C "C2'" . DC  C 2 6   ? -39.552 9.884   2.058   1.00 39.29  ?  175 DC  C "C2'" 1 
ATOM 2268 C "C1'" . DC  C 2 6   ? -40.644 8.834   2.072   1.00 39.62  ?  175 DC  C "C1'" 1 
ATOM 2269 N N1    . DC  C 2 6   ? -40.366 7.703   1.163   1.00 39.68  ?  175 DC  C N1    1 
ATOM 2270 C C2    . DC  C 2 6   ? -40.218 6.419   1.684   1.00 42.17  ?  175 DC  C C2    1 
ATOM 2271 O O2    . DC  C 2 6   ? -40.343 6.245   2.901   1.00 43.69  ?  175 DC  C O2    1 
ATOM 2272 N N3    . DC  C 2 6   ? -39.953 5.396   0.839   1.00 41.18  ?  175 DC  C N3    1 
ATOM 2273 C C4    . DC  C 2 6   ? -39.828 5.626   -0.466  1.00 38.71  ?  175 DC  C C4    1 
ATOM 2274 N N4    . DC  C 2 6   ? -39.565 4.587   -1.261  1.00 24.40  ?  175 DC  C N4    1 
ATOM 2275 C C5    . DC  C 2 6   ? -39.968 6.930   -1.013  1.00 38.58  ?  175 DC  C C5    1 
ATOM 2276 C C6    . DC  C 2 6   ? -40.230 7.929   -0.169  1.00 39.06  ?  175 DC  C C6    1 
ATOM 2277 P P     . DA  C 2 7   ? -38.944 11.857  4.673   1.00 50.13  ?  176 DA  C P     1 
ATOM 2278 O OP1   . DA  C 2 7   ? -39.412 12.657  5.820   1.00 55.89  ?  176 DA  C OP1   1 
ATOM 2279 O OP2   . DA  C 2 7   ? -38.116 12.476  3.622   1.00 52.50  ?  176 DA  C OP2   1 
ATOM 2280 O "O5'" . DA  C 2 7   ? -38.155 10.594  5.231   1.00 46.51  ?  176 DA  C "O5'" 1 
ATOM 2281 C "C5'" . DA  C 2 7   ? -38.863 9.609   5.947   1.00 45.14  ?  176 DA  C "C5'" 1 
ATOM 2282 C "C4'" . DA  C 2 7   ? -38.023 8.364   6.151   1.00 43.09  ?  176 DA  C "C4'" 1 
ATOM 2283 O "O4'" . DA  C 2 7   ? -38.085 7.552   4.959   1.00 39.82  ?  176 DA  C "O4'" 1 
ATOM 2284 C "C3'" . DA  C 2 7   ? -36.536 8.617   6.410   1.00 43.22  ?  176 DA  C "C3'" 1 
ATOM 2285 O "O3'" . DA  C 2 7   ? -36.198 8.189   7.714   1.00 44.75  ?  176 DA  C "O3'" 1 
ATOM 2286 C "C2'" . DA  C 2 7   ? -35.811 7.786   5.345   1.00 40.51  ?  176 DA  C "C2'" 1 
ATOM 2287 C "C1'" . DA  C 2 7   ? -36.889 6.845   4.841   1.00 36.46  ?  176 DA  C "C1'" 1 
ATOM 2288 N N9    . DA  C 2 7   ? -36.700 6.481   3.446   1.00 30.95  ?  176 DA  C N9    1 
ATOM 2289 C C8    . DA  C 2 7   ? -36.694 7.320   2.376   1.00 30.98  ?  176 DA  C C8    1 
ATOM 2290 N N7    . DA  C 2 7   ? -36.487 6.718   1.234   1.00 28.17  ?  176 DA  C N7    1 
ATOM 2291 C C5    . DA  C 2 7   ? -36.352 5.390   1.581   1.00 27.20  ?  176 DA  C C5    1 
ATOM 2292 C C6    . DA  C 2 7   ? -36.120 4.234   0.821   1.00 25.54  ?  176 DA  C C6    1 
ATOM 2293 N N6    . DA  C 2 7   ? -35.977 4.243   -0.505  1.00 25.42  ?  176 DA  C N6    1 
ATOM 2294 N N1    . DA  C 2 7   ? -36.039 3.064   1.475   1.00 23.91  ?  176 DA  C N1    1 
ATOM 2295 C C2    . DA  C 2 7   ? -36.180 3.059   2.801   1.00 24.88  ?  176 DA  C C2    1 
ATOM 2296 N N3    . DA  C 2 7   ? -36.404 4.078   3.622   1.00 30.36  ?  176 DA  C N3    1 
ATOM 2297 C C4    . DA  C 2 7   ? -36.479 5.226   2.941   1.00 28.88  ?  176 DA  C C4    1 
ATOM 2298 P P     . DT  C 2 8   ? -34.688 8.303   8.243   1.00 49.43  ?  177 DT  C P     1 
ATOM 2299 O OP1   . DT  C 2 8   ? -34.757 8.639   9.676   1.00 55.25  -1 177 DT  C OP1   1 
ATOM 2300 O OP2   . DT  C 2 8   ? -33.906 9.157   7.327   1.00 51.08  ?  177 DT  C OP2   1 
ATOM 2301 O "O5'" . DT  C 2 8   ? -34.153 6.810   8.118   1.00 44.82  ?  177 DT  C "O5'" 1 
ATOM 2302 C "C5'" . DT  C 2 8   ? -34.929 5.749   8.643   1.00 42.63  ?  177 DT  C "C5'" 1 
ATOM 2303 C "C4'" . DT  C 2 8   ? -34.397 4.409   8.180   1.00 41.26  ?  177 DT  C "C4'" 1 
ATOM 2304 O "O4'" . DT  C 2 8   ? -34.455 4.344   6.746   1.00 39.63  ?  177 DT  C "O4'" 1 
ATOM 2305 C "C3'" . DT  C 2 8   ? -32.940 4.126   8.551   1.00 42.86  ?  177 DT  C "C3'" 1 
ATOM 2306 O "O3'" . DT  C 2 8   ? -32.882 3.121   9.548   1.00 46.74  ?  177 DT  C "O3'" 1 
ATOM 2307 C "C2'" . DT  C 2 8   ? -32.287 3.662   7.242   1.00 38.22  ?  177 DT  C "C2'" 1 
ATOM 2308 C "C1'" . DT  C 2 8   ? -33.472 3.455   6.311   1.00 35.41  ?  177 DT  C "C1'" 1 
ATOM 2309 N N1    . DT  C 2 8   ? -33.157 3.756   4.903   1.00 30.56  ?  177 DT  C N1    1 
ATOM 2310 C C2    . DT  C 2 8   ? -33.170 2.742   3.986   1.00 28.51  ?  177 DT  C C2    1 
ATOM 2311 O O2    . DT  C 2 8   ? -33.444 1.594   4.270   1.00 28.77  ?  177 DT  C O2    1 
ATOM 2312 N N3    . DT  C 2 8   ? -32.859 3.121   2.711   1.00 24.95  ?  177 DT  C N3    1 
ATOM 2313 C C4    . DT  C 2 8   ? -32.536 4.387   2.274   1.00 26.16  ?  177 DT  C C4    1 
ATOM 2314 O O4    . DT  C 2 8   ? -32.269 4.629   1.105   1.00 25.67  ?  177 DT  C O4    1 
ATOM 2315 C C5    . DT  C 2 8   ? -32.537 5.405   3.291   1.00 29.04  ?  177 DT  C C5    1 
ATOM 2316 C C7    . DT  C 2 8   ? -32.201 6.820   2.939   1.00 33.25  ?  177 DT  C C7    1 
ATOM 2317 C C6    . DT  C 2 8   ? -32.841 5.044   4.543   1.00 29.60  ?  177 DT  C C6    1 
ATOM 2318 P P     . DT  C 2 9   ? -31.476 2.696   10.192  1.00 47.40  ?  178 DT  C P     1 
ATOM 2319 O OP1   . DT  C 2 9   ? -31.733 2.272   11.581  1.00 51.01  -1 178 DT  C OP1   1 
ATOM 2320 O OP2   . DT  C 2 9   ? -30.497 3.764   9.910   1.00 50.12  ?  178 DT  C OP2   1 
ATOM 2321 O "O5'" . DT  C 2 9   ? -31.049 1.411   9.358   1.00 39.19  ?  178 DT  C "O5'" 1 
ATOM 2322 C "C5'" . DT  C 2 9   ? -31.802 0.221   9.473   1.00 35.74  ?  178 DT  C "C5'" 1 
ATOM 2323 C "C4'" . DT  C 2 9   ? -31.467 -0.734  8.347   1.00 32.47  ?  178 DT  C "C4'" 1 
ATOM 2324 O "O4'" . DT  C 2 9   ? -31.523 -0.026  7.095   1.00 32.55  ?  178 DT  C "O4'" 1 
ATOM 2325 C "C3'" . DT  C 2 9   ? -30.067 -1.343  8.424   1.00 29.82  ?  178 DT  C "C3'" 1 
ATOM 2326 O "O3'" . DT  C 2 9   ? -30.143 -2.736  8.667   1.00 28.54  ?  178 DT  C "O3'" 1 
ATOM 2327 C "C2'" . DT  C 2 9   ? -29.436 -1.043  7.063   1.00 26.72  ?  178 DT  C "C2'" 1 
ATOM 2328 C "C1'" . DT  C 2 9   ? -30.616 -0.611  6.212   1.00 28.17  ?  178 DT  C "C1'" 1 
ATOM 2329 N N1    . DT  C 2 9   ? -30.241 0.389   5.185   1.00 28.99  ?  178 DT  C N1    1 
ATOM 2330 C C2    . DT  C 2 9   ? -30.298 0.044   3.860   1.00 29.50  ?  178 DT  C C2    1 
ATOM 2331 O O2    . DT  C 2 9   ? -30.663 -1.047  3.471   1.00 30.48  ?  178 DT  C O2    1 
ATOM 2332 N N3    . DT  C 2 9   ? -29.916 1.031   2.996   1.00 27.77  ?  178 DT  C N3    1 
ATOM 2333 C C4    . DT  C 2 9   ? -29.486 2.301   3.320   1.00 28.72  ?  178 DT  C C4    1 
ATOM 2334 O O4    . DT  C 2 9   ? -29.162 3.121   2.472   1.00 31.45  ?  178 DT  C O4    1 
ATOM 2335 C C5    . DT  C 2 9   ? -29.443 2.595   4.726   1.00 28.83  ?  178 DT  C C5    1 
ATOM 2336 C C7    . DT  C 2 9   ? -28.993 3.942   5.196   1.00 30.03  ?  178 DT  C C7    1 
ATOM 2337 C C6    . DT  C 2 9   ? -29.815 1.635   5.581   1.00 29.28  ?  178 DT  C C6    1 
ATOM 2338 P P     . DC  C 2 10  ? -28.800 -3.587  8.869   1.00 25.79  ?  179 DC  C P     1 
ATOM 2339 O OP1   . DC  C 2 10  ? -29.139 -4.809  9.617   1.00 25.33  ?  179 DC  C OP1   1 
ATOM 2340 O OP2   . DC  C 2 10  ? -27.764 -2.672  9.373   1.00 28.75  ?  179 DC  C OP2   1 
ATOM 2341 O "O5'" . DC  C 2 10  ? -28.389 -3.999  7.389   1.00 22.72  ?  179 DC  C "O5'" 1 
ATOM 2342 C "C5'" . DC  C 2 10  ? -29.142 -4.970  6.696   1.00 20.98  ?  179 DC  C "C5'" 1 
ATOM 2343 C "C4'" . DC  C 2 10  ? -28.690 -5.081  5.254   1.00 21.53  ?  179 DC  C "C4'" 1 
ATOM 2344 O "O4'" . DC  C 2 10  ? -28.681 -3.769  4.647   1.00 24.41  ?  179 DC  C "O4'" 1 
ATOM 2345 C "C3'" . DC  C 2 10  ? -27.283 -5.647  5.067   1.00 19.26  ?  179 DC  C "C3'" 1 
ATOM 2346 O "O3'" . DC  C 2 10  ? -27.298 -6.679  4.104   1.00 34.24  ?  179 DC  C "O3'" 1 
ATOM 2347 C "C2'" . DC  C 2 10  ? -26.479 -4.446  4.582   1.00 20.09  ?  179 DC  C "C2'" 1 
ATOM 2348 C "C1'" . DC  C 2 10  ? -27.538 -3.651  3.852   1.00 19.86  ?  179 DC  C "C1'" 1 
ATOM 2349 N N1    . DC  C 2 10  ? -27.199 -2.220  3.719   1.00 21.19  ?  179 DC  C N1    1 
ATOM 2350 C C2    . DC  C 2 10  ? -27.151 -1.634  2.456   1.00 20.78  ?  179 DC  C C2    1 
ATOM 2351 O O2    . DC  C 2 10  ? -27.408 -2.321  1.463   1.00 19.31  ?  179 DC  C O2    1 
ATOM 2352 N N3    . DC  C 2 10  ? -26.829 -0.325  2.354   1.00 33.94  ?  179 DC  C N3    1 
ATOM 2353 C C4    . DC  C 2 10  ? -26.560 0.381   3.449   1.00 36.31  ?  179 DC  C C4    1 
ATOM 2354 N N4    . DC  C 2 10  ? -26.246 1.670   3.301   1.00 25.26  ?  179 DC  C N4    1 
ATOM 2355 C C5    . DC  C 2 10  ? -26.600 -0.202  4.744   1.00 24.31  ?  179 DC  C C5    1 
ATOM 2356 C C6    . DC  C 2 10  ? -26.914 -1.494  4.829   1.00 22.96  ?  179 DC  C C6    1 
ATOM 2357 P P     . DA  C 2 11  ? -25.975 -7.543  3.839   1.00 26.33  ?  180 DA  C P     1 
ATOM 2358 O OP1   . DA  C 2 11  ? -26.398 -8.934  3.603   1.00 50.81  ?  180 DA  C OP1   1 
ATOM 2359 O OP2   . DA  C 2 11  ? -25.001 -7.238  4.902   1.00 26.40  ?  180 DA  C OP2   1 
ATOM 2360 O "O5'" . DA  C 2 11  ? -25.410 -6.964  2.472   1.00 24.68  ?  180 DA  C "O5'" 1 
ATOM 2361 C "C5'" . DA  C 2 11  ? -26.008 -7.347  1.253   1.00 24.55  ?  180 DA  C "C5'" 1 
ATOM 2362 C "C4'" . DA  C 2 11  ? -25.504 -6.489  0.115   1.00 23.59  ?  180 DA  C "C4'" 1 
ATOM 2363 O "O4'" . DA  C 2 11  ? -25.540 -5.112  0.516   1.00 28.97  ?  180 DA  C "O4'" 1 
ATOM 2364 C "C3'" . DA  C 2 11  ? -24.070 -6.779  -0.320  1.00 22.54  ?  180 DA  C "C3'" 1 
ATOM 2365 O "O3'" . DA  C 2 11  ? -24.050 -7.201  -1.672  1.00 27.79  ?  180 DA  C "O3'" 1 
ATOM 2366 C "C2'" . DA  C 2 11  ? -23.335 -5.446  -0.125  1.00 22.08  ?  180 DA  C "C2'" 1 
ATOM 2367 C "C1'" . DA  C 2 11  ? -24.469 -4.437  -0.064  1.00 22.99  ?  180 DA  C "C1'" 1 
ATOM 2368 N N9    . DA  C 2 11  ? -24.177 -3.291  0.778   1.00 25.85  ?  180 DA  C N9    1 
ATOM 2369 C C8    . DA  C 2 11  ? -24.284 -3.231  2.134   1.00 27.73  ?  180 DA  C C8    1 
ATOM 2370 N N7    . DA  C 2 11  ? -23.961 -2.071  2.639   1.00 29.64  ?  180 DA  C N7    1 
ATOM 2371 C C5    . DA  C 2 11  ? -23.620 -1.313  1.536   1.00 28.65  ?  180 DA  C C5    1 
ATOM 2372 C C6    . DA  C 2 11  ? -23.183 0.016   1.400   1.00 30.58  ?  180 DA  C C6    1 
ATOM 2373 N N6    . DA  C 2 11  ? -23.013 0.842   2.433   1.00 31.89  ?  180 DA  C N6    1 
ATOM 2374 N N1    . DA  C 2 11  ? -22.928 0.465   0.161   1.00 25.13  ?  180 DA  C N1    1 
ATOM 2375 C C2    . DA  C 2 11  ? -23.102 -0.365  -0.868  1.00 26.44  ?  180 DA  C C2    1 
ATOM 2376 N N3    . DA  C 2 11  ? -23.503 -1.634  -0.866  1.00 23.52  ?  180 DA  C N3    1 
ATOM 2377 C C4    . DA  C 2 11  ? -23.748 -2.050  0.380   1.00 26.54  ?  180 DA  C C4    1 
ATOM 2378 P P     . DT  C 2 12  ? -22.729 -7.869  -2.289  1.00 28.33  ?  181 DT  C P     1 
ATOM 2379 O OP1   . DT  C 2 12  ? -23.156 -8.775  -3.371  1.00 30.32  -1 181 DT  C OP1   1 
ATOM 2380 O OP2   . DT  C 2 12  ? -21.908 -8.385  -1.181  1.00 30.53  ?  181 DT  C OP2   1 
ATOM 2381 O "O5'" . DT  C 2 12  ? -21.950 -6.643  -2.937  1.00 24.24  ?  181 DT  C "O5'" 1 
ATOM 2382 C "C5'" . DT  C 2 12  ? -22.519 -5.969  -4.035  1.00 25.52  ?  181 DT  C "C5'" 1 
ATOM 2383 C "C4'" . DT  C 2 12  ? -21.732 -4.721  -4.379  1.00 27.97  ?  181 DT  C "C4'" 1 
ATOM 2384 O "O4'" . DT  C 2 12  ? -21.792 -3.803  -3.282  1.00 29.17  ?  181 DT  C "O4'" 1 
ATOM 2385 C "C3'" . DT  C 2 12  ? -20.245 -4.941  -4.638  1.00 29.00  ?  181 DT  C "C3'" 1 
ATOM 2386 O "O3'" . DT  C 2 12  ? -19.991 -4.930  -6.029  1.00 32.51  ?  181 DT  C "O3'" 1 
ATOM 2387 C "C2'" . DT  C 2 12  ? -19.552 -3.769  -3.926  1.00 29.70  ?  181 DT  C "C2'" 1 
ATOM 2388 C "C1'" . DT  C 2 12  ? -20.708 -2.933  -3.393  1.00 29.23  ?  181 DT  C "C1'" 1 
ATOM 2389 N N1    . DT  C 2 12  ? -20.436 -2.351  -2.064  1.00 27.83  ?  181 DT  C N1    1 
ATOM 2390 C C2    . DT  C 2 12  ? -20.243 -1.001  -1.955  1.00 28.75  ?  181 DT  C C2    1 
ATOM 2391 O O2    . DT  C 2 12  ? -20.312 -0.241  -2.899  1.00 29.77  ?  181 DT  C O2    1 
ATOM 2392 N N3    . DT  C 2 12  ? -19.995 -0.561  -0.688  1.00 28.80  ?  181 DT  C N3    1 
ATOM 2393 C C4    . DT  C 2 12  ? -19.905 -1.324  0.455   1.00 26.92  ?  181 DT  C C4    1 
ATOM 2394 O O4    . DT  C 2 12  ? -19.674 -0.835  1.551   1.00 25.76  ?  181 DT  C O4    1 
ATOM 2395 C C5    . DT  C 2 12  ? -20.100 -2.736  0.270   1.00 25.12  ?  181 DT  C C5    1 
ATOM 2396 C C7    . DT  C 2 12  ? -20.025 -3.664  1.440   1.00 23.18  ?  181 DT  C C7    1 
ATOM 2397 C C6    . DT  C 2 12  ? -20.352 -3.178  -0.968  1.00 26.10  ?  181 DT  C C6    1 
ATOM 2398 P P     . DT  C 2 13  ? -18.485 -4.957  -6.582  1.00 38.97  ?  182 DT  C P     1 
ATOM 2399 O OP1   . DT  C 2 13  ? -18.521 -5.491  -7.956  1.00 42.82  -1 182 DT  C OP1   1 
ATOM 2400 O OP2   . DT  C 2 13  ? -17.617 -5.594  -5.572  1.00 41.80  ?  182 DT  C OP2   1 
ATOM 2401 O "O5'" . DT  C 2 13  ? -18.088 -3.419  -6.653  1.00 33.05  ?  182 DT  C "O5'" 1 
ATOM 2402 C "C5'" . DT  C 2 13  ? -18.664 -2.592  -7.637  1.00 29.82  ?  182 DT  C "C5'" 1 
ATOM 2403 C "C4'" . DT  C 2 13  ? -18.454 -1.137  -7.289  1.00 29.37  ?  182 DT  C "C4'" 1 
ATOM 2404 O "O4'" . DT  C 2 13  ? -18.445 -0.993  -5.858  1.00 24.34  ?  182 DT  C "O4'" 1 
ATOM 2405 C "C3'" . DT  C 2 13  ? -17.131 -0.549  -7.782  1.00 32.05  ?  182 DT  C "C3'" 1 
ATOM 2406 O "O3'" . DT  C 2 13  ? -17.376 0.533   -8.650  1.00 34.16  ?  182 DT  C "O3'" 1 
ATOM 2407 C "C2'" . DT  C 2 13  ? -16.420 -0.093  -6.505  1.00 25.92  ?  182 DT  C "C2'" 1 
ATOM 2408 C "C1'" . DT  C 2 13  ? -17.565 0.034   -5.520  1.00 24.83  ?  182 DT  C "C1'" 1 
ATOM 2409 N N1    . DT  C 2 13  ? -17.142 -0.169  -4.128  1.00 23.69  ?  182 DT  C N1    1 
ATOM 2410 C C2    . DT  C 2 13  ? -17.164 0.886   -3.264  1.00 29.29  ?  182 DT  C C2    1 
ATOM 2411 O O2    . DT  C 2 13  ? -17.543 1.995   -3.580  1.00 31.21  ?  182 DT  C O2    1 
ATOM 2412 N N3    . DT  C 2 13  ? -16.743 0.595   -1.996  1.00 26.06  ?  182 DT  C N3    1 
ATOM 2413 C C4    . DT  C 2 13  ? -16.298 -0.623  -1.525  1.00 22.61  ?  182 DT  C C4    1 
ATOM 2414 O O4    . DT  C 2 13  ? -15.939 -0.786  -0.366  1.00 22.00  ?  182 DT  C O4    1 
ATOM 2415 C C5    . DT  C 2 13  ? -16.288 -1.687  -2.492  1.00 22.26  ?  182 DT  C C5    1 
ATOM 2416 C C7    . DT  C 2 13  ? -15.828 -3.056  -2.101  1.00 23.02  ?  182 DT  C C7    1 
ATOM 2417 C C6    . DT  C 2 13  ? -16.702 -1.410  -3.733  1.00 22.78  ?  182 DT  C C6    1 
ATOM 2418 P P     . DC  C 2 14  ? -16.264 0.968   -9.716  1.00 34.53  ?  183 DC  C P     1 
ATOM 2419 O OP1   . DC  C 2 14  ? -16.951 1.725   -10.777 1.00 38.82  -1 183 DC  C OP1   1 
ATOM 2420 O OP2   . DC  C 2 14  ? -15.471 -0.227  -10.049 1.00 35.70  ?  183 DC  C OP2   1 
ATOM 2421 O "O5'" . DC  C 2 14  ? -15.327 1.959   -8.900  1.00 31.02  ?  183 DC  C "O5'" 1 
ATOM 2422 C "C5'" . DC  C 2 14  ? -15.691 3.308   -8.777  1.00 32.18  ?  183 DC  C "C5'" 1 
ATOM 2423 C "C4'" . DC  C 2 14  ? -14.951 3.977   -7.635  1.00 45.86  ?  183 DC  C "C4'" 1 
ATOM 2424 O "O4'" . DC  C 2 14  ? -14.947 3.109   -6.483  1.00 43.42  ?  183 DC  C "O4'" 1 
ATOM 2425 C "C3'" . DC  C 2 14  ? -13.481 4.335   -7.895  1.00 44.97  ?  183 DC  C "C3'" 1 
ATOM 2426 O "O3'" . DC  C 2 14  ? -13.293 5.722   -7.662  1.00 43.67  ?  183 DC  C "O3'" 1 
ATOM 2427 C "C2'" . DC  C 2 14  ? -12.721 3.488   -6.869  1.00 31.32  ?  183 DC  C "C2'" 1 
ATOM 2428 C "C1'" . DC  C 2 14  ? -13.765 3.346   -5.784  1.00 40.24  ?  183 DC  C "C1'" 1 
ATOM 2429 N N1    . DC  C 2 14  ? -13.523 2.222   -4.860  1.00 35.97  ?  183 DC  C N1    1 
ATOM 2430 C C2    . DC  C 2 14  ? -13.643 2.428   -3.489  1.00 34.57  ?  183 DC  C C2    1 
ATOM 2431 O O2    . DC  C 2 14  ? -13.959 3.547   -3.077  1.00 37.67  ?  183 DC  C O2    1 
ATOM 2432 N N3    . DC  C 2 14  ? -13.416 1.395   -2.649  1.00 29.80  ?  183 DC  C N3    1 
ATOM 2433 C C4    . DC  C 2 14  ? -13.079 0.205   -3.135  1.00 26.78  ?  183 DC  C C4    1 
ATOM 2434 N N4    . DC  C 2 14  ? -12.864 -0.785  -2.266  1.00 24.74  ?  183 DC  C N4    1 
ATOM 2435 C C5    . DC  C 2 14  ? -12.949 -0.024  -4.532  1.00 25.67  ?  183 DC  C C5    1 
ATOM 2436 C C6    . DC  C 2 14  ? -13.175 1.004   -5.350  1.00 34.73  ?  183 DC  C C6    1 
ATOM 2437 P P     . DA  C 2 15  ? -11.885 6.425   -7.968  1.00 46.45  ?  184 DA  C P     1 
ATOM 2438 O OP1   . DA  C 2 15  ? -12.193 7.672   -8.691  1.00 49.12  -1 184 DA  C OP1   1 
ATOM 2439 O OP2   . DA  C 2 15  ? -10.972 5.430   -8.562  1.00 48.95  ?  184 DA  C OP2   1 
ATOM 2440 O "O5'" . DA  C 2 15  ? -11.326 6.815   -6.526  1.00 44.82  ?  184 DA  C "O5'" 1 
ATOM 2441 C "C5'" . DA  C 2 15  ? -12.222 6.977   -5.447  1.00 43.30  ?  184 DA  C "C5'" 1 
ATOM 2442 C "C4'" . DA  C 2 15  ? -11.491 6.957   -4.115  1.00 42.42  ?  184 DA  C "C4'" 1 
ATOM 2443 O "O4'" . DA  C 2 15  ? -11.555 5.630   -3.559  1.00 38.22  ?  184 DA  C "O4'" 1 
ATOM 2444 C "C3'" . DA  C 2 15  ? -10.004 7.316   -4.182  1.00 44.69  ?  184 DA  C "C3'" 1 
ATOM 2445 O "O3'" . DA  C 2 15  ? -9.773  8.563   -3.535  1.00 49.57  ?  184 DA  C "O3'" 1 
ATOM 2446 C "C2'" . DA  C 2 15  ? -9.293  6.168   -3.458  1.00 40.37  ?  184 DA  C "C2'" 1 
ATOM 2447 C "C1'" . DA  C 2 15  ? -10.424 5.416   -2.772  1.00 36.55  ?  184 DA  C "C1'" 1 
ATOM 2448 N N9    . DA  C 2 15  ? -10.175 3.983   -2.701  1.00 33.66  ?  184 DA  C N9    1 
ATOM 2449 C C8    . DA  C 2 15  ? -10.256 3.086   -3.723  1.00 32.43  ?  184 DA  C C8    1 
ATOM 2450 N N7    . DA  C 2 15  ? -9.967  1.858   -3.371  1.00 30.74  ?  184 DA  C N7    1 
ATOM 2451 C C5    . DA  C 2 15  ? -9.681  1.957   -2.022  1.00 30.18  ?  184 DA  C C5    1 
ATOM 2452 C C6    . DA  C 2 15  ? -9.309  1.003   -1.060  1.00 28.61  ?  184 DA  C C6    1 
ATOM 2453 N N6    . DA  C 2 15  ? -9.151  -0.294  -1.333  1.00 26.24  ?  184 DA  C N6    1 
ATOM 2454 N N1    . DA  C 2 15  ? -9.098  1.434   0.195   1.00 27.28  ?  184 DA  C N1    1 
ATOM 2455 C C2    . DA  C 2 15  ? -9.256  2.730   0.465   1.00 28.49  ?  184 DA  C C2    1 
ATOM 2456 N N3    . DA  C 2 15  ? -9.605  3.718   -0.352  1.00 30.81  ?  184 DA  C N3    1 
ATOM 2457 C C4    . DA  C 2 15  ? -9.805  3.259   -1.593  1.00 31.41  ?  184 DA  C C4    1 
ATOM 2458 P P     . DT  C 2 16  ? -8.280  9.121   -3.340  1.00 50.62  ?  185 DT  C P     1 
ATOM 2459 O OP1   . DT  C 2 16  ? -8.363  10.591  -3.247  1.00 42.62  -1 185 DT  C OP1   1 
ATOM 2460 O OP2   . DT  C 2 16  ? -7.405  8.500   -4.351  1.00 53.52  ?  185 DT  C OP2   1 
ATOM 2461 O "O5'" . DT  C 2 16  ? -7.849  8.552   -1.918  1.00 47.67  ?  185 DT  C "O5'" 1 
ATOM 2462 C "C5'" . DT  C 2 16  ? -8.670  8.792   -0.792  1.00 46.48  ?  185 DT  C "C5'" 1 
ATOM 2463 C "C4'" . DT  C 2 16  ? -7.995  8.321   0.482   1.00 43.58  ?  185 DT  C "C4'" 1 
ATOM 2464 O "O4'" . DT  C 2 16  ? -7.954  6.872   0.505   1.00 40.94  ?  185 DT  C "O4'" 1 
ATOM 2465 C "C3'" . DT  C 2 16  ? -6.548  8.789   0.659   1.00 43.24  ?  185 DT  C "C3'" 1 
ATOM 2466 O "O3'" . DT  C 2 16  ? -6.372  9.307   1.959   1.00 46.71  ?  185 DT  C "O3'" 1 
ATOM 2467 C "C2'" . DT  C 2 16  ? -5.736  7.516   0.451   1.00 39.77  ?  185 DT  C "C2'" 1 
ATOM 2468 C "C1'" . DT  C 2 16  ? -6.695  6.469   0.971   1.00 39.20  ?  185 DT  C "C1'" 1 
ATOM 2469 N N1    . DT  C 2 16  ? -6.408  5.109   0.461   1.00 37.33  ?  185 DT  C N1    1 
ATOM 2470 C C2    . DT  C 2 16  ? -6.108  4.109   1.349   1.00 36.90  ?  185 DT  C C2    1 
ATOM 2471 O O2    . DT  C 2 16  ? -6.073  4.274   2.550   1.00 37.50  ?  185 DT  C O2    1 
ATOM 2472 N N3    . DT  C 2 16  ? -5.852  2.896   0.777   1.00 36.38  ?  185 DT  C N3    1 
ATOM 2473 C C4    . DT  C 2 16  ? -5.861  2.592   -0.567  1.00 38.31  ?  185 DT  C C4    1 
ATOM 2474 O O4    . DT  C 2 16  ? -5.616  1.468   -0.986  1.00 39.40  ?  185 DT  C O4    1 
ATOM 2475 C C5    . DT  C 2 16  ? -6.177  3.687   -1.444  1.00 32.22  ?  185 DT  C C5    1 
ATOM 2476 C C7    . DT  C 2 16  ? -6.217  3.477   -2.924  1.00 33.10  ?  185 DT  C C7    1 
ATOM 2477 C C6    . DT  C 2 16  ? -6.431  4.880   -0.894  1.00 35.60  ?  185 DT  C C6    1 
ATOM 2478 P P     . DT  C 2 17  ? -5.017  10.066  2.359   1.00 52.34  ?  186 DT  C P     1 
ATOM 2479 O OP1   . DT  C 2 17  ? -5.406  11.328  3.016   1.00 55.64  -1 186 DT  C OP1   1 
ATOM 2480 O OP2   . DT  C 2 17  ? -4.110  10.085  1.194   1.00 54.24  ?  186 DT  C OP2   1 
ATOM 2481 O "O5'" . DT  C 2 17  ? -4.378  9.115   3.464   1.00 48.24  ?  186 DT  C "O5'" 1 
ATOM 2482 C "C5'" . DT  C 2 17  ? -5.102  8.856   4.642   1.00 45.20  ?  186 DT  C "C5'" 1 
ATOM 2483 C "C4'" . DT  C 2 17  ? -4.637  7.578   5.307   1.00 42.90  ?  186 DT  C "C4'" 1 
ATOM 2484 O "O4'" . DT  C 2 17  ? -4.626  6.499   4.352   1.00 41.93  ?  186 DT  C "O4'" 1 
ATOM 2485 C "C3'" . DT  C 2 17  ? -3.223  7.625   5.893   1.00 39.66  ?  186 DT  C "C3'" 1 
ATOM 2486 O "O3'" . DT  C 2 17  ? -3.284  7.506   7.296   1.00 44.54  ?  186 DT  C "O3'" 1 
ATOM 2487 C "C2'" . DT  C 2 17  ? -2.510  6.422   5.265   1.00 47.04  ?  186 DT  C "C2'" 1 
ATOM 2488 C "C1'" . DT  C 2 17  ? -3.668  5.576   4.778   1.00 43.03  ?  186 DT  C "C1'" 1 
ATOM 2489 N N1    . DT  C 2 17  ? -3.305  4.682   3.658   1.00 43.97  ?  186 DT  C N1    1 
ATOM 2490 C C2    . DT  C 2 17  ? -3.269  3.330   3.876   1.00 43.61  ?  186 DT  C C2    1 
ATOM 2491 O O2    . DT  C 2 17  ? -3.555  2.821   4.942   1.00 40.78  ?  186 DT  C O2    1 
ATOM 2492 N N3    . DT  C 2 17  ? -2.910  2.586   2.790   1.00 46.66  ?  186 DT  C N3    1 
ATOM 2493 C C4    . DT  C 2 17  ? -2.568  3.051   1.538   1.00 49.51  ?  186 DT  C C4    1 
ATOM 2494 O O4    . DT  C 2 17  ? -2.258  2.302   0.624   1.00 54.60  ?  186 DT  C O4    1 
ATOM 2495 C C5    . DT  C 2 17  ? -2.607  4.480   1.379   1.00 46.46  ?  186 DT  C C5    1 
ATOM 2496 C C7    . DT  C 2 17  ? -2.258  5.099   0.060   1.00 43.91  ?  186 DT  C C7    1 
ATOM 2497 C C6    . DT  C 2 17  ? -2.964  5.221   2.438   1.00 46.23  ?  186 DT  C C6    1 
ATOM 2498 P P     . DC  C 2 18  ? -1.973  7.755   8.187   1.00 48.51  ?  187 DC  C P     1 
ATOM 2499 O OP1   . DC  C 2 18  ? -2.410  7.945   9.584   1.00 48.94  -1 187 DC  C OP1   1 
ATOM 2500 O OP2   . DC  C 2 18  ? -1.149  8.774   7.509   1.00 50.22  ?  187 DC  C OP2   1 
ATOM 2501 O "O5'" . DC  C 2 18  ? -1.180  6.375   8.091   1.00 49.26  ?  187 DC  C "O5'" 1 
ATOM 2502 C "C5'" . DC  C 2 18  ? -1.810  5.173   8.496   1.00 49.32  ?  187 DC  C "C5'" 1 
ATOM 2503 C "C4'" . DC  C 2 18  ? -0.912  3.981   8.240   1.00 50.58  ?  187 DC  C "C4'" 1 
ATOM 2504 O "O4'" . DC  C 2 18  ? -0.889  3.671   6.825   1.00 49.86  ?  187 DC  C "O4'" 1 
ATOM 2505 C "C3'" . DC  C 2 18  ? 0.544   4.194   8.653   1.00 55.07  ?  187 DC  C "C3'" 1 
ATOM 2506 O "O3'" . DC  C 2 18  ? 0.938   3.206   9.582   1.00 57.78  ?  187 DC  C "O3'" 1 
ATOM 2507 C "C2'" . DC  C 2 18  ? 1.329   4.078   7.345   1.00 54.59  ?  187 DC  C "C2'" 1 
ATOM 2508 C "C1'" . DC  C 2 18  ? 0.400   3.244   6.487   1.00 51.98  ?  187 DC  C "C1'" 1 
ATOM 2509 N N1    . DC  C 2 18  ? 0.622   3.428   5.026   1.00 53.63  ?  187 DC  C N1    1 
ATOM 2510 C C2    . DC  C 2 18  ? 0.527   2.331   4.169   1.00 54.70  ?  187 DC  C C2    1 
ATOM 2511 O O2    . DC  C 2 18  ? 0.225   1.228   4.635   1.00 56.66  ?  187 DC  C O2    1 
ATOM 2512 N N3    . DC  C 2 18  ? 0.751   2.510   2.846   1.00 52.40  ?  187 DC  C N3    1 
ATOM 2513 C C4    . DC  C 2 18  ? 1.074   3.715   2.383   1.00 51.80  ?  187 DC  C C4    1 
ATOM 2514 N N4    . DC  C 2 18  ? 1.287   3.844   1.071   1.00 49.39  ?  187 DC  C N4    1 
ATOM 2515 C C5    . DC  C 2 18  ? 1.190   4.843   3.243   1.00 54.52  ?  187 DC  C C5    1 
ATOM 2516 C C6    . DC  C 2 18  ? 0.965   4.654   4.545   1.00 54.65  ?  187 DC  C C6    1 
ATOM 2517 P P     . DG  C 2 19  ? 2.073   3.541   10.663  1.00 61.68  ?  188 DG  C P     1 
ATOM 2518 O OP1   . DG  C 2 19  ? 1.536   3.205   11.996  1.00 63.39  -1 188 DG  C OP1   1 
ATOM 2519 O OP2   . DG  C 2 19  ? 2.569   4.903   10.387  1.00 63.24  ?  188 DG  C OP2   1 
ATOM 2520 O "O5'" . DG  C 2 19  ? 3.238   2.516   10.319  1.00 63.95  ?  188 DG  C "O5'" 1 
ATOM 2521 C "C5'" . DG  C 2 19  ? 3.481   1.420   11.171  1.00 64.98  ?  188 DG  C "C5'" 1 
ATOM 2522 C "C4'" . DG  C 2 19  ? 2.931   0.140   10.577  1.00 61.66  ?  188 DG  C "C4'" 1 
ATOM 2523 O "O4'" . DG  C 2 19  ? 2.325   0.424   9.299   1.00 59.90  ?  188 DG  C "O4'" 1 
ATOM 2524 C "C3'" . DG  C 2 19  ? 3.971   -0.951  10.364  1.00 64.36  ?  188 DG  C "C3'" 1 
ATOM 2525 O "O3'" . DG  C 2 19  ? 3.631   -2.107  11.123  1.00 68.11  ?  188 DG  C "O3'" 1 
ATOM 2526 C "C2'" . DG  C 2 19  ? 3.983   -1.232  8.858   1.00 62.00  ?  188 DG  C "C2'" 1 
ATOM 2527 C "C1'" . DG  C 2 19  ? 2.914   -0.330  8.265   1.00 60.66  ?  188 DG  C "C1'" 1 
ATOM 2528 N N9    . DG  C 2 19  ? 3.424   0.584   7.249   1.00 62.65  ?  188 DG  C N9    1 
ATOM 2529 C C8    . DG  C 2 19  ? 3.838   1.876   7.434   1.00 64.76  ?  188 DG  C C8    1 
ATOM 2530 N N7    . DG  C 2 19  ? 4.241   2.455   6.339   1.00 67.37  ?  188 DG  C N7    1 
ATOM 2531 C C5    . DG  C 2 19  ? 4.091   1.479   5.365   1.00 64.23  ?  188 DG  C C5    1 
ATOM 2532 C C6    . DG  C 2 19  ? 4.368   1.526   3.983   1.00 61.64  ?  188 DG  C C6    1 
ATOM 2533 O O6    . DG  C 2 19  ? 4.821   2.470   3.323   1.00 63.95  ?  188 DG  C O6    1 
ATOM 2534 N N1    . DG  C 2 19  ? 4.076   0.320   3.359   1.00 56.37  ?  188 DG  C N1    1 
ATOM 2535 C C2    . DG  C 2 19  ? 3.574   -0.789  3.991   1.00 52.20  ?  188 DG  C C2    1 
ATOM 2536 N N2    . DG  C 2 19  ? 3.354   -1.861  3.220   1.00 48.30  ?  188 DG  C N2    1 
ATOM 2537 N N3    . DG  C 2 19  ? 3.308   -0.846  5.286   1.00 55.55  ?  188 DG  C N3    1 
ATOM 2538 C C4    . DG  C 2 19  ? 3.590   0.321   5.909   1.00 61.58  ?  188 DG  C C4    1 
ATOM 2539 P P     . DG  C 2 20  ? 4.735   -3.238  11.411  1.00 75.34  ?  189 DG  C P     1 
ATOM 2540 O OP1   . DG  C 2 20  ? 4.046   -4.433  11.938  1.00 77.99  -1 189 DG  C OP1   1 
ATOM 2541 O OP2   . DG  C 2 20  ? 5.823   -2.607  12.187  1.00 77.20  ?  189 DG  C OP2   1 
ATOM 2542 O "O5'" . DG  C 2 20  ? 5.316   -3.568  9.966   1.00 74.54  ?  189 DG  C "O5'" 1 
ATOM 2543 C "C5'" . DG  C 2 20  ? 6.414   -4.418  9.808   1.00 78.51  ?  189 DG  C "C5'" 1 
ATOM 2544 C "C4'" . DG  C 2 20  ? 6.397   -5.019  8.417   1.00 80.26  ?  189 DG  C "C4'" 1 
ATOM 2545 O "O4'" . DG  C 2 20  ? 5.976   -4.006  7.467   1.00 78.21  ?  189 DG  C "O4'" 1 
ATOM 2546 C "C3'" . DG  C 2 20  ? 7.743   -5.535  7.925   1.00 86.10  ?  189 DG  C "C3'" 1 
ATOM 2547 O "O3'" . DG  C 2 20  ? 7.575   -6.749  7.222   1.00 89.38  ?  189 DG  C "O3'" 1 
ATOM 2548 C "C2'" . DG  C 2 20  ? 8.238   -4.421  7.012   1.00 85.89  ?  189 DG  C "C2'" 1 
ATOM 2549 C "C1'" . DG  C 2 20  ? 6.939   -3.862  6.450   1.00 80.38  ?  189 DG  C "C1'" 1 
ATOM 2550 N N9    . DG  C 2 20  ? 7.039   -2.449  6.105   1.00 75.94  ?  189 DG  C N9    1 
ATOM 2551 C C8    . DG  C 2 20  ? 7.073   -1.392  6.976   1.00 74.35  ?  189 DG  C C8    1 
ATOM 2552 N N7    . DG  C 2 20  ? 7.180   -0.236  6.385   1.00 73.57  ?  189 DG  C N7    1 
ATOM 2553 C C5    . DG  C 2 20  ? 7.222   -0.545  5.035   1.00 73.40  ?  189 DG  C C5    1 
ATOM 2554 C C6    . DG  C 2 20  ? 7.333   0.303   3.912   1.00 69.52  ?  189 DG  C C6    1 
ATOM 2555 O O6    . DG  C 2 20  ? 7.419   1.535   3.890   1.00 67.80  ?  189 DG  C O6    1 
ATOM 2556 N N1    . DG  C 2 20  ? 7.338   -0.414  2.723   1.00 69.40  ?  189 DG  C N1    1 
ATOM 2557 C C2    . DG  C 2 20  ? 7.250   -1.778  2.630   1.00 70.60  ?  189 DG  C C2    1 
ATOM 2558 N N2    . DG  C 2 20  ? 7.274   -2.289  1.392   1.00 69.73  ?  189 DG  C N2    1 
ATOM 2559 N N3    . DG  C 2 20  ? 7.146   -2.588  3.675   1.00 73.64  ?  189 DG  C N3    1 
ATOM 2560 C C4    . DG  C 2 20  ? 7.138   -1.903  4.843   1.00 74.61  ?  189 DG  C C4    1 
ATOM 2561 P P     . DA  C 2 21  ? 8.590   -7.962  7.486   1.00 99.32  ?  190 DA  C P     1 
ATOM 2562 O OP1   . DA  C 2 21  ? 8.476   -8.330  8.912   1.00 99.12  ?  190 DA  C OP1   1 
ATOM 2563 O OP2   . DA  C 2 21  ? 9.904   -7.558  6.943   1.00 102.18 ?  190 DA  C OP2   1 
ATOM 2564 O "O5'" . DA  C 2 21  ? 8.012   -9.156  6.592   1.00 101.13 ?  190 DA  C "O5'" 1 
ATOM 2565 C "C4'" . DC  D 3 1   ? 7.821   1.759   -5.551  1.00 56.98  ?  170 DC  D "C4'" 1 
ATOM 2566 O "O4'" . DC  D 3 1   ? 7.901   2.147   -4.171  1.00 57.05  ?  170 DC  D "O4'" 1 
ATOM 2567 C "C3'" . DC  D 3 1   ? 6.450   1.108   -5.712  1.00 54.21  ?  170 DC  D "C3'" 1 
ATOM 2568 O "O3'" . DC  D 3 1   ? 6.553   -0.060  -6.507  1.00 54.92  ?  170 DC  D "O3'" 1 
ATOM 2569 C "C2'" . DC  D 3 1   ? 6.008   0.777   -4.277  1.00 52.30  ?  170 DC  D "C2'" 1 
ATOM 2570 C "C1'" . DC  D 3 1   ? 7.189   1.213   -3.413  1.00 54.82  ?  170 DC  D "C1'" 1 
ATOM 2571 N N1    . DC  D 3 1   ? 6.766   1.857   -2.148  1.00 55.15  ?  170 DC  D N1    1 
ATOM 2572 C C2    . DC  D 3 1   ? 6.880   1.159   -0.948  1.00 54.80  ?  170 DC  D C2    1 
ATOM 2573 O O2    . DC  D 3 1   ? 7.361   0.021   -0.956  1.00 55.22  ?  170 DC  D O2    1 
ATOM 2574 N N3    . DC  D 3 1   ? 6.477   1.757   0.197   1.00 54.05  ?  170 DC  D N3    1 
ATOM 2575 C C4    . DC  D 3 1   ? 5.968   2.987   0.164   1.00 54.55  ?  170 DC  D C4    1 
ATOM 2576 N N4    . DC  D 3 1   ? 5.581   3.534   1.319   1.00 55.36  ?  170 DC  D N4    1 
ATOM 2577 C C5    . DC  D 3 1   ? 5.832   3.709   -1.052  1.00 55.24  ?  170 DC  D C5    1 
ATOM 2578 C C6    . DC  D 3 1   ? 6.234   3.109   -2.174  1.00 56.01  ?  170 DC  D C6    1 
ATOM 2579 P P     . DC  D 3 2   ? 5.229   -0.845  -6.955  1.00 51.40  ?  171 DC  D P     1 
ATOM 2580 O OP1   . DC  D 3 2   ? 5.584   -1.737  -8.075  1.00 55.07  ?  171 DC  D OP1   1 
ATOM 2581 O OP2   . DC  D 3 2   ? 4.160   0.156   -7.115  1.00 51.24  -1 171 DC  D OP2   1 
ATOM 2582 O "O5'" . DC  D 3 2   ? 4.877   -1.774  -5.711  1.00 46.22  ?  171 DC  D "O5'" 1 
ATOM 2583 C "C5'" . DC  D 3 2   ? 5.024   -3.177  -5.823  1.00 48.48  ?  171 DC  D "C5'" 1 
ATOM 2584 C "C4'" . DC  D 3 2   ? 4.658   -3.865  -4.524  1.00 50.99  ?  171 DC  D "C4'" 1 
ATOM 2585 O "O4'" . DC  D 3 2   ? 4.859   -2.955  -3.421  1.00 49.71  ?  171 DC  D "O4'" 1 
ATOM 2586 C "C3'" . DC  D 3 2   ? 3.197   -4.322  -4.435  1.00 55.32  ?  171 DC  D "C3'" 1 
ATOM 2587 O "O3'" . DC  D 3 2   ? 3.127   -5.702  -4.136  1.00 60.16  ?  171 DC  D "O3'" 1 
ATOM 2588 C "C2'" . DC  D 3 2   ? 2.611   -3.473  -3.306  1.00 52.33  ?  171 DC  D "C2'" 1 
ATOM 2589 C "C1'" . DC  D 3 2   ? 3.844   -3.168  -2.482  1.00 50.86  ?  171 DC  D "C1'" 1 
ATOM 2590 N N1    . DC  D 3 2   ? 3.707   -1.952  -1.660  1.00 53.11  ?  171 DC  D N1    1 
ATOM 2591 C C2    . DC  D 3 2   ? 3.794   -2.044  -0.271  1.00 56.70  ?  171 DC  D C2    1 
ATOM 2592 O O2    . DC  D 3 2   ? 3.991   -3.147  0.250   1.00 57.87  ?  171 DC  D O2    1 
ATOM 2593 N N3    . DC  D 3 2   ? 3.664   -0.917  0.467   1.00 56.59  ?  171 DC  D N3    1 
ATOM 2594 C C4    . DC  D 3 2   ? 3.453   0.254   -0.135  1.00 53.61  ?  171 DC  D C4    1 
ATOM 2595 N N4    . DC  D 3 2   ? 3.329   1.339   0.633   1.00 51.78  ?  171 DC  D N4    1 
ATOM 2596 C C5    . DC  D 3 2   ? 3.357   0.363   -1.549  1.00 52.50  ?  171 DC  D C5    1 
ATOM 2597 C C6    . DC  D 3 2   ? 3.489   -0.754  -2.264  1.00 52.65  ?  171 DC  D C6    1 
ATOM 2598 P P     . DG  D 3 3   ? 1.804   -6.531  -4.504  1.00 67.32  ?  172 DG  D P     1 
ATOM 2599 O OP1   . DG  D 3 3   ? 2.214   -7.907  -4.845  1.00 72.76  -1 172 DG  D OP1   1 
ATOM 2600 O OP2   . DG  D 3 3   ? 1.019   -5.722  -5.459  1.00 70.04  ?  172 DG  D OP2   1 
ATOM 2601 O "O5'" . DG  D 3 3   ? 0.992   -6.580  -3.136  1.00 61.51  ?  172 DG  D "O5'" 1 
ATOM 2602 C "C5'" . DG  D 3 3   ? 1.501   -7.324  -2.052  1.00 56.28  ?  172 DG  D "C5'" 1 
ATOM 2603 C "C4'" . DG  D 3 3   ? 0.926   -6.824  -0.743  1.00 49.70  ?  172 DG  D "C4'" 1 
ATOM 2604 O "O4'" . DG  D 3 3   ? 1.048   -5.388  -0.687  1.00 47.79  ?  172 DG  D "O4'" 1 
ATOM 2605 C "C3'" . DG  D 3 3   ? -0.556  -7.129  -0.522  1.00 45.43  ?  172 DG  D "C3'" 1 
ATOM 2606 O "O3'" . DG  D 3 3   ? -0.729  -7.696  0.747   1.00 43.88  ?  172 DG  D "O3'" 1 
ATOM 2607 C "C2'" . DG  D 3 3   ? -1.220  -5.758  -0.605  1.00 43.54  ?  172 DG  D "C2'" 1 
ATOM 2608 C "C1'" . DG  D 3 3   ? -0.111  -4.862  -0.108  1.00 44.41  ?  172 DG  D "C1'" 1 
ATOM 2609 N N9    . DG  D 3 3   ? -0.244  -3.491  -0.560  1.00 44.63  ?  172 DG  D N9    1 
ATOM 2610 C C8    . DG  D 3 3   ? -0.497  -3.072  -1.837  1.00 45.43  ?  172 DG  D C8    1 
ATOM 2611 N N7    . DG  D 3 3   ? -0.550  -1.780  -1.956  1.00 45.05  ?  172 DG  D N7    1 
ATOM 2612 C C5    . DG  D 3 3   ? -0.302  -1.313  -0.677  1.00 45.44  ?  172 DG  D C5    1 
ATOM 2613 C C6    . DG  D 3 3   ? -0.231  0.007   -0.194  1.00 50.69  ?  172 DG  D C6    1 
ATOM 2614 O O6    . DG  D 3 3   ? -0.377  1.058   -0.827  1.00 55.97  ?  172 DG  D O6    1 
ATOM 2615 N N1    . DG  D 3 3   ? 0.040   0.044   1.168   1.00 50.13  ?  172 DG  D N1    1 
ATOM 2616 C C2    . DG  D 3 3   ? 0.220   -1.061  1.962   1.00 48.71  ?  172 DG  D C2    1 
ATOM 2617 N N2    . DG  D 3 3   ? 0.474   -0.827  3.256   1.00 48.48  ?  172 DG  D N2    1 
ATOM 2618 N N3    . DG  D 3 3   ? 0.156   -2.307  1.520   1.00 47.00  ?  172 DG  D N3    1 
ATOM 2619 C C4    . DG  D 3 3   ? -0.107  -2.355  0.194   1.00 44.95  ?  172 DG  D C4    1 
ATOM 2620 P P     . DA  D 3 4   ? -1.712  -8.942  0.955   1.00 49.02  ?  173 DA  D P     1 
ATOM 2621 O OP1   . DA  D 3 4   ? -0.882  -10.159 1.005   1.00 56.25  -1 173 DA  D OP1   1 
ATOM 2622 O OP2   . DA  D 3 4   ? -2.807  -8.832  -0.026  1.00 48.62  ?  173 DA  D OP2   1 
ATOM 2623 O "O5'" . DA  D 3 4   ? -2.312  -8.678  2.401   1.00 44.60  ?  173 DA  D "O5'" 1 
ATOM 2624 C "C5'" . DA  D 3 4   ? -1.435  -8.476  3.483   1.00 40.70  ?  173 DA  D "C5'" 1 
ATOM 2625 C "C4'" . DA  D 3 4   ? -1.894  -7.303  4.313   1.00 39.82  ?  173 DA  D "C4'" 1 
ATOM 2626 O "O4'" . DA  D 3 4   ? -1.836  -6.118  3.504   1.00 40.01  ?  173 DA  D "O4'" 1 
ATOM 2627 C "C3'" . DA  D 3 4   ? -3.339  -7.399  4.790   1.00 43.35  ?  173 DA  D "C3'" 1 
ATOM 2628 O "O3'" . DA  D 3 4   ? -3.383  -7.680  6.172   1.00 45.25  ?  173 DA  D "O3'" 1 
ATOM 2629 C "C2'" . DA  D 3 4   ? -3.948  -6.026  4.480   1.00 42.91  ?  173 DA  D "C2'" 1 
ATOM 2630 C "C1'" . DA  D 3 4   ? -2.769  -5.201  3.990   1.00 41.85  ?  173 DA  D "C1'" 1 
ATOM 2631 N N9    . DA  D 3 4   ? -3.136  -4.304  2.904   1.00 42.64  ?  173 DA  D N9    1 
ATOM 2632 C C8    . DA  D 3 4   ? -3.612  -4.658  1.677   1.00 43.24  ?  173 DA  D C8    1 
ATOM 2633 N N7    . DA  D 3 4   ? -3.867  -3.641  0.896   1.00 44.31  ?  173 DA  D N7    1 
ATOM 2634 C C5    . DA  D 3 4   ? -3.534  -2.541  1.665   1.00 42.81  ?  173 DA  D C5    1 
ATOM 2635 C C6    . DA  D 3 4   ? -3.575  -1.161  1.410   1.00 40.76  ?  173 DA  D C6    1 
ATOM 2636 N N6    . DA  D 3 4   ? -3.990  -0.640  0.253   1.00 41.59  ?  173 DA  D N6    1 
ATOM 2637 N N1    . DA  D 3 4   ? -3.172  -0.333  2.392   1.00 39.56  ?  173 DA  D N1    1 
ATOM 2638 C C2    . DA  D 3 4   ? -2.761  -0.858  3.548   1.00 41.16  ?  173 DA  D C2    1 
ATOM 2639 N N3    . DA  D 3 4   ? -2.678  -2.136  3.903   1.00 41.38  ?  173 DA  D N3    1 
ATOM 2640 C C4    . DA  D 3 4   ? -3.083  -2.933  2.907   1.00 41.92  ?  173 DA  D C4    1 
ATOM 2641 P P     . DA  D 3 5   ? -4.795  -7.915  6.892   1.00 45.23  ?  174 DA  D P     1 
ATOM 2642 O OP1   . DA  D 3 5   ? -4.534  -8.605  8.166   1.00 50.99  -1 174 DA  D OP1   1 
ATOM 2643 O OP2   . DA  D 3 5   ? -5.709  -8.508  5.896   1.00 45.68  ?  174 DA  D OP2   1 
ATOM 2644 O "O5'" . DA  D 3 5   ? -5.307  -6.442  7.210   1.00 36.27  ?  174 DA  D "O5'" 1 
ATOM 2645 C "C5'" . DA  D 3 5   ? -4.665  -5.674  8.203   1.00 32.39  ?  174 DA  D "C5'" 1 
ATOM 2646 C "C4'" . DA  D 3 5   ? -5.259  -4.283  8.269   1.00 30.49  ?  174 DA  D "C4'" 1 
ATOM 2647 O "O4'" . DA  D 3 5   ? -5.179  -3.663  6.961   1.00 27.93  ?  174 DA  D "O4'" 1 
ATOM 2648 C "C3'" . DA  D 3 5   ? -6.735  -4.228  8.665   1.00 31.87  ?  174 DA  D "C3'" 1 
ATOM 2649 O "O3'" . DA  D 3 5   ? -6.947  -3.160  9.579   1.00 32.07  ?  174 DA  D "O3'" 1 
ATOM 2650 C "C2'" . DA  D 3 5   ? -7.424  -3.972  7.331   1.00 30.41  ?  174 DA  D "C2'" 1 
ATOM 2651 C "C1'" . DA  D 3 5   ? -6.413  -3.064  6.678   1.00 28.49  ?  174 DA  D "C1'" 1 
ATOM 2652 N N9    . DA  D 3 5   ? -6.567  -2.963  5.236   1.00 29.52  ?  174 DA  D N9    1 
ATOM 2653 C C8    . DA  D 3 5   ? -6.716  -3.988  4.352   1.00 31.04  ?  174 DA  D C8    1 
ATOM 2654 N N7    . DA  D 3 5   ? -6.831  -3.598  3.107   1.00 31.76  ?  174 DA  D N7    1 
ATOM 2655 C C5    . DA  D 3 5   ? -6.751  -2.222  3.183   1.00 25.60  ?  174 DA  D C5    1 
ATOM 2656 C C6    . DA  D 3 5   ? -6.805  -1.216  2.205   1.00 26.06  ?  174 DA  D C6    1 
ATOM 2657 N N6    . DA  D 3 5   ? -6.959  -1.465  0.905   1.00 26.63  ?  174 DA  D N6    1 
ATOM 2658 N N1    . DA  D 3 5   ? -6.694  0.059   2.615   1.00 26.32  ?  174 DA  D N1    1 
ATOM 2659 C C2    . DA  D 3 5   ? -6.540  0.305   3.917   1.00 26.18  ?  174 DA  D C2    1 
ATOM 2660 N N3    . DA  D 3 5   ? -6.474  -0.555  4.927   1.00 31.27  ?  174 DA  D N3    1 
ATOM 2661 C C4    . DA  D 3 5   ? -6.588  -1.814  4.487   1.00 30.51  ?  174 DA  D C4    1 
ATOM 2662 P P     . DT  D 3 6   ? -8.286  -3.092  10.460  1.00 30.84  ?  175 DT  D P     1 
ATOM 2663 O OP1   . DT  D 3 6   ? -7.897  -3.036  11.880  1.00 36.48  -1 175 DT  D OP1   1 
ATOM 2664 O OP2   . DT  D 3 6   ? -9.193  -4.151  9.983   1.00 28.32  ?  175 DT  D OP2   1 
ATOM 2665 O "O5'" . DT  D 3 6   ? -8.931  -1.697  10.049  1.00 27.75  ?  175 DT  D "O5'" 1 
ATOM 2666 C "C5'" . DT  D 3 6   ? -9.069  -1.390  8.689   1.00 26.41  ?  175 DT  D "C5'" 1 
ATOM 2667 C "C4'" . DT  D 3 6   ? -9.744  -0.062  8.475   1.00 26.87  ?  175 DT  D "C4'" 1 
ATOM 2668 O "O4'" . DT  D 3 6   ? -9.513  0.349   7.110   1.00 38.23  ?  175 DT  D "O4'" 1 
ATOM 2669 C "C3'" . DT  D 3 6   ? -11.252 -0.071  8.651   1.00 27.20  ?  175 DT  D "C3'" 1 
ATOM 2670 O "O3'" . DT  D 3 6   ? -11.689 1.191   9.111   1.00 28.35  ?  175 DT  D "O3'" 1 
ATOM 2671 C "C2'" . DT  D 3 6   ? -11.744 -0.364  7.241   1.00 41.43  ?  175 DT  D "C2'" 1 
ATOM 2672 C "C1'" . DT  D 3 6   ? -10.721 0.367   6.388   1.00 26.31  ?  175 DT  D "C1'" 1 
ATOM 2673 N N1    . DT  D 3 6   ? -10.482 -0.294  5.087   1.00 25.74  ?  175 DT  D N1    1 
ATOM 2674 C C2    . DT  D 3 6   ? -10.164 0.469   3.998   1.00 26.46  ?  175 DT  D C2    1 
ATOM 2675 O O2    . DT  D 3 6   ? -10.039 1.676   4.045   1.00 27.88  ?  175 DT  D O2    1 
ATOM 2676 N N3    . DT  D 3 6   ? -9.967  -0.237  2.844   1.00 25.91  ?  175 DT  D N3    1 
ATOM 2677 C C4    . DT  D 3 6   ? -10.074 -1.603  2.673   1.00 29.69  ?  175 DT  D C4    1 
ATOM 2678 O O4    . DT  D 3 6   ? -9.882  -2.148  1.593   1.00 29.92  ?  175 DT  D O4    1 
ATOM 2679 C C5    . DT  D 3 6   ? -10.424 -2.343  3.851   1.00 29.18  ?  175 DT  D C5    1 
ATOM 2680 C C7    . DT  D 3 6   ? -10.566 -3.831  3.786   1.00 25.49  ?  175 DT  D C7    1 
ATOM 2681 C C6    . DT  D 3 6   ? -10.613 -1.661  4.990   1.00 29.95  ?  175 DT  D C6    1 
ATOM 2682 P P     . DG  D 3 7   ? -13.227 1.436   9.489   1.00 30.10  ?  176 DG  D P     1 
ATOM 2683 O OP1   . DG  D 3 7   ? -13.252 2.133   10.787  1.00 31.00  -1 176 DG  D OP1   1 
ATOM 2684 O OP2   . DG  D 3 7   ? -13.966 0.172   9.323   1.00 28.66  ?  176 DG  D OP2   1 
ATOM 2685 O "O5'" . DG  D 3 7   ? -13.719 2.455   8.372   1.00 34.77  ?  176 DG  D "O5'" 1 
ATOM 2686 C "C5'" . DG  D 3 7   ? -13.164 3.752   8.335   1.00 41.07  ?  176 DG  D "C5'" 1 
ATOM 2687 C "C4'" . DG  D 3 7   ? -13.567 4.494   7.077   1.00 45.18  ?  176 DG  D "C4'" 1 
ATOM 2688 O "O4'" . DG  D 3 7   ? -13.093 3.774   5.913   1.00 46.11  ?  176 DG  D "O4'" 1 
ATOM 2689 C "C3'" . DG  D 3 7   ? -15.065 4.672   6.872   1.00 31.37  ?  176 DG  D "C3'" 1 
ATOM 2690 O "O3'" . DG  D 3 7   ? -15.305 5.951   6.358   1.00 32.81  ?  176 DG  D "O3'" 1 
ATOM 2691 C "C2'" . DG  D 3 7   ? -15.385 3.604   5.837   1.00 41.49  ?  176 DG  D "C2'" 1 
ATOM 2692 C "C1'" . DG  D 3 7   ? -14.141 3.666   4.987   1.00 29.28  ?  176 DG  D "C1'" 1 
ATOM 2693 N N9    . DG  D 3 7   ? -13.923 2.470   4.192   1.00 28.08  ?  176 DG  D N9    1 
ATOM 2694 C C8    . DG  D 3 7   ? -14.098 1.174   4.590   1.00 27.32  ?  176 DG  D C8    1 
ATOM 2695 N N7    . DG  D 3 7   ? -13.809 0.305   3.665   1.00 26.79  ?  176 DG  D N7    1 
ATOM 2696 C C5    . DG  D 3 7   ? -13.404 1.077   2.590   1.00 27.17  ?  176 DG  D C5    1 
ATOM 2697 C C6    . DG  D 3 7   ? -12.970 0.689   1.306   1.00 27.29  ?  176 DG  D C6    1 
ATOM 2698 O O6    . DG  D 3 7   ? -12.852 -0.453  0.849   1.00 27.09  ?  176 DG  D O6    1 
ATOM 2699 N N1    . DG  D 3 7   ? -12.654 1.787   0.517   1.00 28.13  ?  176 DG  D N1    1 
ATOM 2700 C C2    . DG  D 3 7   ? -12.746 3.094   0.919   1.00 31.71  ?  176 DG  D C2    1 
ATOM 2701 N N2    . DG  D 3 7   ? -12.396 4.019   0.016   1.00 30.00  ?  176 DG  D N2    1 
ATOM 2702 N N3    . DG  D 3 7   ? -13.152 3.471   2.120   1.00 31.36  ?  176 DG  D N3    1 
ATOM 2703 C C4    . DG  D 3 7   ? -13.464 2.411   2.900   1.00 28.87  ?  176 DG  D C4    1 
ATOM 2704 P P     . DA  D 3 8   ? -16.202 6.998   7.170   1.00 42.47  ?  177 DA  D P     1 
ATOM 2705 O OP1   . DA  D 3 8   ? -15.362 7.571   8.237   1.00 45.39  -1 177 DA  D OP1   1 
ATOM 2706 O OP2   . DA  D 3 8   ? -17.474 6.336   7.514   1.00 45.32  ?  177 DA  D OP2   1 
ATOM 2707 O "O5'" . DA  D 3 8   ? -16.497 8.129   6.091   1.00 41.46  ?  177 DA  D "O5'" 1 
ATOM 2708 C "C5'" . DA  D 3 8   ? -15.411 8.750   5.436   1.00 41.27  ?  177 DA  D "C5'" 1 
ATOM 2709 C "C4'" . DA  D 3 8   ? -15.688 8.929   3.957   1.00 41.95  ?  177 DA  D "C4'" 1 
ATOM 2710 O "O4'" . DA  D 3 8   ? -15.564 7.650   3.289   1.00 41.14  ?  177 DA  D "O4'" 1 
ATOM 2711 C "C3'" . DA  D 3 8   ? -17.078 9.453   3.617   1.00 38.33  ?  177 DA  D "C3'" 1 
ATOM 2712 O "O3'" . DA  D 3 8   ? -16.991 10.384  2.560   1.00 42.95  ?  177 DA  D "O3'" 1 
ATOM 2713 C "C2'" . DA  D 3 8   ? -17.822 8.194   3.190   1.00 36.61  ?  177 DA  D "C2'" 1 
ATOM 2714 C "C1'" . DA  D 3 8   ? -16.716 7.402   2.525   1.00 34.77  ?  177 DA  D "C1'" 1 
ATOM 2715 N N9    . DA  D 3 8   ? -16.961 5.968   2.528   1.00 32.99  ?  177 DA  D N9    1 
ATOM 2716 C C8    . DA  D 3 8   ? -17.605 5.247   3.491   1.00 41.78  ?  177 DA  D C8    1 
ATOM 2717 N N7    . DA  D 3 8   ? -17.673 3.966   3.233   1.00 40.68  ?  177 DA  D N7    1 
ATOM 2718 C C5    . DA  D 3 8   ? -17.015 3.837   2.024   1.00 38.94  ?  177 DA  D C5    1 
ATOM 2719 C C6    . DA  D 3 8   ? -16.739 2.725   1.210   1.00 36.75  ?  177 DA  D C6    1 
ATOM 2720 N N6    . DA  D 3 8   ? -17.112 1.480   1.513   1.00 29.37  ?  177 DA  D N6    1 
ATOM 2721 N N1    . DA  D 3 8   ? -16.061 2.943   0.067   1.00 30.34  ?  177 DA  D N1    1 
ATOM 2722 C C2    . DA  D 3 8   ? -15.690 4.189   -0.233  1.00 31.34  ?  177 DA  D C2    1 
ATOM 2723 N N3    . DA  D 3 8   ? -15.893 5.310   0.451   1.00 41.38  ?  177 DA  D N3    1 
ATOM 2724 C C4    . DA  D 3 8   ? -16.566 5.062   1.579   1.00 41.12  ?  177 DA  D C4    1 
ATOM 2725 P P     . DA  D 3 9   ? -18.284 11.218  2.111   1.00 47.81  ?  178 DA  D P     1 
ATOM 2726 O OP1   . DA  D 3 9   ? -17.857 12.612  1.889   1.00 51.62  -1 178 DA  D OP1   1 
ATOM 2727 O OP2   . DA  D 3 9   ? -19.365 10.940  3.075   1.00 48.28  ?  178 DA  D OP2   1 
ATOM 2728 O "O5'" . DA  D 3 9   ? -18.679 10.572  0.709   1.00 47.37  ?  178 DA  D "O5'" 1 
ATOM 2729 C "C5'" . DA  D 3 9   ? -17.680 10.342  -0.265  1.00 45.06  ?  178 DA  D "C5'" 1 
ATOM 2730 C "C4'" . DA  D 3 9   ? -18.223 9.519   -1.417  1.00 43.68  ?  178 DA  D "C4'" 1 
ATOM 2731 O "O4'" . DA  D 3 9   ? -18.317 8.130   -1.018  1.00 37.84  ?  178 DA  D "O4'" 1 
ATOM 2732 C "C3'" . DA  D 3 9   ? -19.619 9.921   -1.893  1.00 46.46  ?  178 DA  D "C3'" 1 
ATOM 2733 O "O3'" . DA  D 3 9   ? -19.674 9.933   -3.302  1.00 49.32  ?  178 DA  D "O3'" 1 
ATOM 2734 C "C2'" . DA  D 3 9   ? -20.514 8.837   -1.315  1.00 43.54  ?  178 DA  D "C2'" 1 
ATOM 2735 C "C1'" . DA  D 3 9   ? -19.592 7.637   -1.342  1.00 40.24  ?  178 DA  D "C1'" 1 
ATOM 2736 N N9    . DA  D 3 9   ? -19.965 6.620   -0.373  1.00 38.01  ?  178 DA  D N9    1 
ATOM 2737 C C8    . DA  D 3 9   ? -20.604 6.816   0.814   1.00 37.80  ?  178 DA  D C8    1 
ATOM 2738 N N7    . DA  D 3 9   ? -20.820 5.714   1.483   1.00 35.76  ?  178 DA  D N7    1 
ATOM 2739 C C5    . DA  D 3 9   ? -20.279 4.729   0.681   1.00 34.75  ?  178 DA  D C5    1 
ATOM 2740 C C6    . DA  D 3 9   ? -20.183 3.338   0.830   1.00 34.58  ?  178 DA  D C6    1 
ATOM 2741 N N6    . DA  D 3 9   ? -20.654 2.680   1.891   1.00 35.95  ?  178 DA  D N6    1 
ATOM 2742 N N1    . DA  D 3 9   ? -19.583 2.645   -0.155  1.00 33.36  ?  178 DA  D N1    1 
ATOM 2743 C C2    . DA  D 3 9   ? -19.114 3.308   -1.215  1.00 33.20  ?  178 DA  D C2    1 
ATOM 2744 N N3    . DA  D 3 9   ? -19.146 4.611   -1.465  1.00 34.46  ?  178 DA  D N3    1 
ATOM 2745 C C4    . DA  D 3 9   ? -19.749 5.270   -0.468  1.00 35.88  ?  178 DA  D C4    1 
ATOM 2746 P P     . DT  D 3 10  ? -21.037 10.342  -4.043  1.00 52.56  ?  179 DT  D P     1 
ATOM 2747 O OP1   . DT  D 3 10  ? -20.673 10.991  -5.314  1.00 56.28  -1 179 DT  D OP1   1 
ATOM 2748 O OP2   . DT  D 3 10  ? -21.906 11.040  -3.077  1.00 55.51  ?  179 DT  D OP2   1 
ATOM 2749 O "O5'" . DT  D 3 10  ? -21.713 8.945   -4.384  1.00 49.59  ?  179 DT  D "O5'" 1 
ATOM 2750 C "C5'" . DT  D 3 10  ? -21.243 8.208   -5.488  1.00 49.70  ?  179 DT  D "C5'" 1 
ATOM 2751 C "C4'" . DT  D 3 10  ? -21.772 6.792   -5.464  1.00 49.51  ?  179 DT  D "C4'" 1 
ATOM 2752 O "O4'" . DT  D 3 10  ? -21.674 6.250   -4.145  1.00 46.63  ?  179 DT  D "O4'" 1 
ATOM 2753 C "C3'" . DT  D 3 10  ? -23.244 6.649   -5.816  1.00 54.69  ?  179 DT  D "C3'" 1 
ATOM 2754 O "O3'" . DT  D 3 10  ? -23.386 6.390   -7.196  1.00 63.14  ?  179 DT  D "O3'" 1 
ATOM 2755 C "C2'" . DT  D 3 10  ? -23.701 5.448   -4.971  1.00 51.07  ?  179 DT  D "C2'" 1 
ATOM 2756 C "C1'" . DT  D 3 10  ? -22.469 5.105   -4.131  1.00 47.62  ?  179 DT  D "C1'" 1 
ATOM 2757 N N1    . DT  D 3 10  ? -22.795 4.750   -2.737  1.00 47.65  ?  179 DT  D N1    1 
ATOM 2758 C C2    . DT  D 3 10  ? -22.598 3.463   -2.317  1.00 48.73  ?  179 DT  D C2    1 
ATOM 2759 O O2    . DT  D 3 10  ? -22.132 2.594   -3.029  1.00 49.79  ?  179 DT  D O2    1 
ATOM 2760 N N3    . DT  D 3 10  ? -22.942 3.229   -1.017  1.00 47.33  ?  179 DT  D N3    1 
ATOM 2761 C C4    . DT  D 3 10  ? -23.473 4.132   -0.121  1.00 45.33  ?  179 DT  D C4    1 
ATOM 2762 O O4    . DT  D 3 10  ? -23.755 3.828   1.030   1.00 43.65  ?  179 DT  D O4    1 
ATOM 2763 C C5    . DT  D 3 10  ? -23.668 5.460   -0.631  1.00 47.14  ?  179 DT  D C5    1 
ATOM 2764 C C7    . DT  D 3 10  ? -24.238 6.525   0.253   1.00 49.62  ?  179 DT  D C7    1 
ATOM 2765 C C6    . DT  D 3 10  ? -23.330 5.702   -1.904  1.00 48.25  ?  179 DT  D C6    1 
ATOM 2766 P P     . DG  D 3 11  ? -24.841 6.170   -7.832  1.00 48.07  ?  180 DG  D P     1 
ATOM 2767 O OP1   . DG  D 3 11  ? -24.720 6.391   -9.286  1.00 51.68  -1 180 DG  D OP1   1 
ATOM 2768 O OP2   . DG  D 3 11  ? -25.810 6.953   -7.040  1.00 50.33  ?  180 DG  D OP2   1 
ATOM 2769 O "O5'" . DG  D 3 11  ? -25.138 4.627   -7.578  1.00 42.45  ?  180 DG  D "O5'" 1 
ATOM 2770 C "C5'" . DG  D 3 11  ? -24.342 3.648   -8.202  1.00 37.70  ?  180 DG  D "C5'" 1 
ATOM 2771 C "C4'" . DG  D 3 11  ? -24.718 2.265   -7.717  1.00 34.07  ?  180 DG  D "C4'" 1 
ATOM 2772 O "O4'" . DG  D 3 11  ? -24.636 2.224   -6.269  1.00 32.57  ?  180 DG  D "O4'" 1 
ATOM 2773 C "C3'" . DG  D 3 11  ? -26.143 1.826   -8.063  1.00 35.51  ?  180 DG  D "C3'" 1 
ATOM 2774 O "O3'" . DG  D 3 11  ? -26.150 0.460   -8.421  1.00 37.26  ?  180 DG  D "O3'" 1 
ATOM 2775 C "C2'" . DG  D 3 11  ? -26.887 2.047   -6.755  1.00 34.46  ?  180 DG  D "C2'" 1 
ATOM 2776 C "C1'" . DG  D 3 11  ? -25.815 1.653   -5.768  1.00 31.51  ?  180 DG  D "C1'" 1 
ATOM 2777 N N9    . DG  D 3 11  ? -26.053 2.143   -4.421  1.00 30.18  ?  180 DG  D N9    1 
ATOM 2778 C C8    . DG  D 3 11  ? -26.265 3.437   -4.033  1.00 31.84  ?  180 DG  D C8    1 
ATOM 2779 N N7    . DG  D 3 11  ? -26.453 3.570   -2.752  1.00 31.98  ?  180 DG  D N7    1 
ATOM 2780 C C5    . DG  D 3 11  ? -26.359 2.277   -2.264  1.00 30.92  ?  180 DG  D C5    1 
ATOM 2781 C C6    . DG  D 3 11  ? -26.476 1.792   -0.945  1.00 30.64  ?  180 DG  D C6    1 
ATOM 2782 O O6    . DG  D 3 11  ? -26.694 2.430   0.090   1.00 31.26  ?  180 DG  D O6    1 
ATOM 2783 N N1    . DG  D 3 11  ? -26.313 0.413   -0.890  1.00 30.05  ?  180 DG  D N1    1 
ATOM 2784 C C2    . DG  D 3 11  ? -26.073 -0.392  -1.974  1.00 31.27  ?  180 DG  D C2    1 
ATOM 2785 N N2    . DG  D 3 11  ? -25.941 -1.701  -1.727  1.00 32.84  ?  180 DG  D N2    1 
ATOM 2786 N N3    . DG  D 3 11  ? -25.956 0.052   -3.211  1.00 30.37  ?  180 DG  D N3    1 
ATOM 2787 C C4    . DG  D 3 11  ? -26.115 1.391   -3.280  1.00 30.02  ?  180 DG  D C4    1 
ATOM 2788 P P     . DA  D 3 12  ? -27.504 -0.233  -8.924  1.00 38.91  ?  181 DA  D P     1 
ATOM 2789 O OP1   . DA  D 3 12  ? -27.147 -1.254  -9.927  1.00 40.09  ?  181 DA  D OP1   1 
ATOM 2790 O OP2   . DA  D 3 12  ? -28.465 0.833   -9.261  1.00 41.67  ?  181 DA  D OP2   1 
ATOM 2791 O "O5'" . DA  D 3 12  ? -28.039 -0.982  -7.627  1.00 32.87  ?  181 DA  D "O5'" 1 
ATOM 2792 C "C5'" . DA  D 3 12  ? -27.482 -2.221  -7.254  1.00 28.56  ?  181 DA  D "C5'" 1 
ATOM 2793 C "C4'" . DA  D 3 12  ? -28.088 -2.705  -5.957  1.00 29.26  ?  181 DA  D "C4'" 1 
ATOM 2794 O "O4'" . DA  D 3 12  ? -28.071 -1.631  -5.005  1.00 29.50  ?  181 DA  D "O4'" 1 
ATOM 2795 C "C3'" . DA  D 3 12  ? -29.550 -3.146  -6.058  1.00 34.72  ?  181 DA  D "C3'" 1 
ATOM 2796 O "O3'" . DA  D 3 12  ? -29.651 -4.553  -5.925  1.00 36.67  ?  181 DA  D "O3'" 1 
ATOM 2797 C "C2'" . DA  D 3 12  ? -30.255 -2.435  -4.898  1.00 35.50  ?  181 DA  D "C2'" 1 
ATOM 2798 C "C1'" . DA  D 3 12  ? -29.110 -1.832  -4.097  1.00 33.72  ?  181 DA  D "C1'" 1 
ATOM 2799 N N9    . DA  D 3 12  ? -29.462 -0.560  -3.491  1.00 35.48  ?  181 DA  D N9    1 
ATOM 2800 C C8    . DA  D 3 12  ? -29.664 0.626   -4.129  1.00 36.88  ?  181 DA  D C8    1 
ATOM 2801 N N7    . DA  D 3 12  ? -29.989 1.607   -3.326  1.00 38.65  ?  181 DA  D N7    1 
ATOM 2802 C C5    . DA  D 3 12  ? -29.996 1.021   -2.074  1.00 37.83  ?  181 DA  D C5    1 
ATOM 2803 C C6    . DA  D 3 12  ? -30.260 1.530   -0.792  1.00 38.92  ?  181 DA  D C6    1 
ATOM 2804 N N6    . DA  D 3 12  ? -30.583 2.803   -0.561  1.00 41.23  ?  181 DA  D N6    1 
ATOM 2805 N N1    . DA  D 3 12  ? -30.181 0.678   0.246   1.00 38.10  ?  181 DA  D N1    1 
ATOM 2806 C C2    . DA  D 3 12  ? -29.857 -0.596  0.010   1.00 36.83  ?  181 DA  D C2    1 
ATOM 2807 N N3    . DA  D 3 12  ? -29.587 -1.188  -1.148  1.00 35.36  ?  181 DA  D N3    1 
ATOM 2808 C C4    . DA  D 3 12  ? -29.675 -0.315  -2.159  1.00 36.07  ?  181 DA  D C4    1 
ATOM 2809 P P     . DA  D 3 13  ? -31.057 -5.287  -6.165  1.00 38.28  ?  182 DA  D P     1 
ATOM 2810 O OP1   . DA  D 3 13  ? -30.747 -6.678  -6.538  1.00 42.19  -1 182 DA  D OP1   1 
ATOM 2811 O OP2   . DA  D 3 13  ? -31.892 -4.442  -7.039  1.00 40.77  ?  182 DA  D OP2   1 
ATOM 2812 O "O5'" . DA  D 3 13  ? -31.730 -5.318  -4.722  1.00 33.58  ?  182 DA  D "O5'" 1 
ATOM 2813 C "C5'" . DA  D 3 13  ? -31.160 -6.103  -3.701  1.00 30.19  ?  182 DA  D "C5'" 1 
ATOM 2814 C "C4'" . DA  D 3 13  ? -31.737 -5.741  -2.348  1.00 29.11  ?  182 DA  D "C4'" 1 
ATOM 2815 O "O4'" . DA  D 3 13  ? -31.729 -4.310  -2.192  1.00 30.02  ?  182 DA  D "O4'" 1 
ATOM 2816 C "C3'" . DA  D 3 13  ? -33.187 -6.178  -2.123  1.00 29.11  ?  182 DA  D "C3'" 1 
ATOM 2817 O "O3'" . DA  D 3 13  ? -33.250 -7.126  -1.079  1.00 27.95  ?  182 DA  D "O3'" 1 
ATOM 2818 C "C2'" . DA  D 3 13  ? -33.931 -4.893  -1.754  1.00 31.40  ?  182 DA  D "C2'" 1 
ATOM 2819 C "C1'" . DA  D 3 13  ? -32.806 -3.949  -1.379  1.00 33.21  ?  182 DA  D "C1'" 1 
ATOM 2820 N N9    . DA  D 3 13  ? -33.131 -2.558  -1.629  1.00 38.99  ?  182 DA  D N9    1 
ATOM 2821 C C8    . DA  D 3 13  ? -33.275 -1.954  -2.842  1.00 41.83  ?  182 DA  D C8    1 
ATOM 2822 N N7    . DA  D 3 13  ? -33.585 -0.685  -2.765  1.00 43.81  ?  182 DA  D N7    1 
ATOM 2823 C C5    . DA  D 3 13  ? -33.651 -0.444  -1.406  1.00 43.65  ?  182 DA  D C5    1 
ATOM 2824 C C6    . DA  D 3 13  ? -33.933 0.713   -0.664  1.00 48.31  ?  182 DA  D C6    1 
ATOM 2825 N N6    . DA  D 3 13  ? -34.217 1.889   -1.221  1.00 52.62  ?  182 DA  D N6    1 
ATOM 2826 N N1    . DA  D 3 13  ? -33.917 0.613   0.676   1.00 48.09  ?  182 DA  D N1    1 
ATOM 2827 C C2    . DA  D 3 13  ? -33.633 -0.568  1.230   1.00 44.85  ?  182 DA  D C2    1 
ATOM 2828 N N3    . DA  D 3 13  ? -33.350 -1.722  0.637   1.00 42.72  ?  182 DA  D N3    1 
ATOM 2829 C C4    . DA  D 3 13  ? -33.376 -1.589  -0.693  1.00 41.97  ?  182 DA  D C4    1 
ATOM 2830 P P     . DT  D 3 14  ? -34.604 -7.938  -0.804  1.00 28.32  ?  183 DT  D P     1 
ATOM 2831 O OP1   . DT  D 3 14  ? -34.246 -9.212  -0.156  1.00 30.99  -1 183 DT  D OP1   1 
ATOM 2832 O OP2   . DT  D 3 14  ? -35.404 -7.929  -2.040  1.00 29.88  ?  183 DT  D OP2   1 
ATOM 2833 O "O5'" . DT  D 3 14  ? -35.379 -7.033  0.247   1.00 23.46  ?  183 DT  D "O5'" 1 
ATOM 2834 C "C5'" . DT  D 3 14  ? -34.707 -6.588  1.399   1.00 22.02  ?  183 DT  D "C5'" 1 
ATOM 2835 C "C4'" . DT  D 3 14  ? -35.565 -5.631  2.193   1.00 24.19  ?  183 DT  D "C4'" 1 
ATOM 2836 O "O4'" . DT  D 3 14  ? -35.472 -4.302  1.639   1.00 23.35  ?  183 DT  D "O4'" 1 
ATOM 2837 C "C3'" . DT  D 3 14  ? -37.061 -5.969  2.235   1.00 28.37  ?  183 DT  D "C3'" 1 
ATOM 2838 O "O3'" . DT  D 3 14  ? -37.446 -6.190  3.593   1.00 30.34  ?  183 DT  D "O3'" 1 
ATOM 2839 C "C2'" . DT  D 3 14  ? -37.735 -4.732  1.624   1.00 27.67  ?  183 DT  D "C2'" 1 
ATOM 2840 C "C1'" . DT  D 3 14  ? -36.694 -3.666  1.868   1.00 26.23  ?  183 DT  D "C1'" 1 
ATOM 2841 N N1    . DT  D 3 14  ? -36.805 -2.501  0.966   1.00 31.36  ?  183 DT  D N1    1 
ATOM 2842 C C2    . DT  D 3 14  ? -36.891 -1.250  1.509   1.00 37.21  ?  183 DT  D C2    1 
ATOM 2843 O O2    . DT  D 3 14  ? -36.906 -1.046  2.705   1.00 39.53  ?  183 DT  D O2    1 
ATOM 2844 N N3    . DT  D 3 14  ? -36.983 -0.237  0.599   1.00 41.24  ?  183 DT  D N3    1 
ATOM 2845 C C4    . DT  D 3 14  ? -36.981 -0.348  -0.775  1.00 42.37  ?  183 DT  D C4    1 
ATOM 2846 O O4    . DT  D 3 14  ? -37.064 0.627   -1.512  1.00 46.36  ?  183 DT  D O4    1 
ATOM 2847 C C5    . DT  D 3 14  ? -36.873 -1.689  -1.282  1.00 37.24  ?  183 DT  D C5    1 
ATOM 2848 C C7    . DT  D 3 14  ? -36.861 -1.935  -2.759  1.00 34.99  ?  183 DT  D C7    1 
ATOM 2849 C C6    . DT  D 3 14  ? -36.787 -2.691  -0.397  1.00 34.71  ?  183 DT  D C6    1 
ATOM 2850 P P     . DG  D 3 15  ? -38.946 -6.586  4.000   1.00 26.84  ?  184 DG  D P     1 
ATOM 2851 O OP1   . DG  D 3 15  ? -38.857 -7.871  4.713   1.00 27.74  -1 184 DG  D OP1   1 
ATOM 2852 O OP2   . DG  D 3 15  ? -39.850 -6.452  2.845   1.00 28.84  ?  184 DG  D OP2   1 
ATOM 2853 O "O5'" . DG  D 3 15  ? -39.330 -5.468  5.062   1.00 27.44  ?  184 DG  D "O5'" 1 
ATOM 2854 C "C5'" . DG  D 3 15  ? -38.851 -4.155  4.876   1.00 29.83  ?  184 DG  D "C5'" 1 
ATOM 2855 C "C4'" . DG  D 3 15  ? -39.085 -3.300  6.101   1.00 31.72  ?  184 DG  D "C4'" 1 
ATOM 2856 O "O4'" . DG  D 3 15  ? -38.824 -1.926  5.774   1.00 33.71  ?  184 DG  D "O4'" 1 
ATOM 2857 C "C3'" . DG  D 3 15  ? -40.501 -3.314  6.632   1.00 31.04  ?  184 DG  D "C3'" 1 
ATOM 2858 O "O3'" . DG  D 3 15  ? -40.502 -2.987  8.011   1.00 31.82  ?  184 DG  D "O3'" 1 
ATOM 2859 C "C2'" . DG  D 3 15  ? -41.175 -2.233  5.790   1.00 23.29  ?  184 DG  D "C2'" 1 
ATOM 2860 C "C1'" . DG  D 3 15  ? -40.034 -1.260  5.488   1.00 34.44  ?  184 DG  D "C1'" 1 
ATOM 2861 N N9    . DG  D 3 15  ? -39.999 -0.835  4.096   1.00 23.74  ?  184 DG  D N9    1 
ATOM 2862 C C8    . DG  D 3 15  ? -40.176 -1.620  2.991   1.00 23.11  ?  184 DG  D C8    1 
ATOM 2863 N N7    . DG  D 3 15  ? -40.075 -0.969  1.870   1.00 23.80  ?  184 DG  D N7    1 
ATOM 2864 C C5    . DG  D 3 15  ? -39.795 0.329   2.256   1.00 24.94  ?  184 DG  D C5    1 
ATOM 2865 C C6    . DG  D 3 15  ? -39.576 1.482   1.473   1.00 35.63  ?  184 DG  D C6    1 
ATOM 2866 O O6    . DG  D 3 15  ? -39.586 1.587   0.241   1.00 34.34  ?  184 DG  D O6    1 
ATOM 2867 N N1    . DG  D 3 15  ? -39.323 2.597   2.261   1.00 39.70  ?  184 DG  D N1    1 
ATOM 2868 C C2    . DG  D 3 15  ? -39.287 2.597   3.631   1.00 43.08  ?  184 DG  D C2    1 
ATOM 2869 N N2    . DG  D 3 15  ? -39.025 3.772   4.217   1.00 46.84  ?  184 DG  D N2    1 
ATOM 2870 N N3    . DG  D 3 15  ? -39.488 1.522   4.378   1.00 42.45  ?  184 DG  D N3    1 
ATOM 2871 C C4    . DG  D 3 15  ? -39.737 0.428   3.624   1.00 24.96  ?  184 DG  D C4    1 
ATOM 2872 P P     . DA  D 3 16  ? -41.881 -2.910  8.827   1.00 35.06  ?  185 DA  D P     1 
ATOM 2873 O OP1   . DA  D 3 16  ? -41.617 -3.449  10.172  1.00 40.31  -1 185 DA  D OP1   1 
ATOM 2874 O OP2   . DA  D 3 16  ? -42.961 -3.494  8.012   1.00 39.87  ?  185 DA  D OP2   1 
ATOM 2875 O "O5'" . DA  D 3 16  ? -42.141 -1.348  8.975   1.00 31.28  ?  185 DA  D "O5'" 1 
ATOM 2876 C "C5'" . DA  D 3 16  ? -41.349 -0.596  9.866   1.00 29.78  ?  185 DA  D "C5'" 1 
ATOM 2877 C "C4'" . DA  D 3 16  ? -41.746 0.866   9.854   1.00 32.10  ?  185 DA  D "C4'" 1 
ATOM 2878 O "O4'" . DA  D 3 16  ? -41.706 1.372   8.496   1.00 31.79  ?  185 DA  D "O4'" 1 
ATOM 2879 C "C3'" . DA  D 3 16  ? -43.149 1.162   10.368  1.00 35.75  ?  185 DA  D "C3'" 1 
ATOM 2880 O "O3'" . DA  D 3 16  ? -43.159 2.414   11.023  1.00 38.29  ?  185 DA  D "O3'" 1 
ATOM 2881 C "C2'" . DA  D 3 16  ? -43.968 1.204   9.087   1.00 35.64  ?  185 DA  D "C2'" 1 
ATOM 2882 C "C1'" . DA  D 3 16  ? -42.982 1.843   8.126   1.00 34.14  ?  185 DA  D "C1'" 1 
ATOM 2883 N N9    . DA  D 3 16  ? -43.225 1.507   6.730   1.00 35.53  ?  185 DA  D N9    1 
ATOM 2884 C C8    . DA  D 3 16  ? -43.787 0.363   6.243   1.00 36.53  ?  185 DA  D C8    1 
ATOM 2885 N N7    . DA  D 3 16  ? -43.883 0.336   4.938   1.00 36.76  ?  185 DA  D N7    1 
ATOM 2886 C C5    . DA  D 3 16  ? -43.345 1.546   4.542   1.00 36.42  ?  185 DA  D C5    1 
ATOM 2887 C C6    . DA  D 3 16  ? -43.155 2.129   3.278   1.00 37.19  ?  185 DA  D C6    1 
ATOM 2888 N N6    . DA  D 3 16  ? -43.506 1.535   2.135   1.00 39.32  ?  185 DA  D N6    1 
ATOM 2889 N N1    . DA  D 3 16  ? -42.589 3.350   3.231   1.00 35.27  ?  185 DA  D N1    1 
ATOM 2890 C C2    . DA  D 3 16  ? -42.243 3.943   4.376   1.00 34.13  ?  185 DA  D C2    1 
ATOM 2891 N N3    . DA  D 3 16  ? -42.372 3.495   5.621   1.00 33.80  ?  185 DA  D N3    1 
ATOM 2892 C C4    . DA  D 3 16  ? -42.936 2.280   5.633   1.00 35.09  ?  185 DA  D C4    1 
ATOM 2893 P P     . DA  D 3 17  ? -44.501 2.972   11.701  1.00 40.20  ?  186 DA  D P     1 
ATOM 2894 O OP1   . DA  D 3 17  ? -44.123 3.697   12.927  1.00 42.40  -1 186 DA  D OP1   1 
ATOM 2895 O OP2   . DA  D 3 17  ? -45.487 1.878   11.775  1.00 46.45  ?  186 DA  D OP2   1 
ATOM 2896 O "O5'" . DA  D 3 17  ? -45.021 4.041   10.649  1.00 35.77  ?  186 DA  D "O5'" 1 
ATOM 2897 C "C5'" . DA  D 3 17  ? -44.253 5.194   10.400  1.00 25.37  ?  186 DA  D "C5'" 1 
ATOM 2898 C "C4'" . DA  D 3 17  ? -44.792 5.947   9.206   1.00 34.48  ?  186 DA  D "C4'" 1 
ATOM 2899 O "O4'" . DA  D 3 17  ? -44.795 5.076   8.061   1.00 33.64  ?  186 DA  D "O4'" 1 
ATOM 2900 C "C3'" . DA  D 3 17  ? -46.222 6.449   9.372   1.00 38.86  ?  186 DA  D "C3'" 1 
ATOM 2901 O "O3'" . DA  D 3 17  ? -46.258 7.857   9.260   1.00 42.27  ?  186 DA  D "O3'" 1 
ATOM 2902 C "C2'" . DA  D 3 17  ? -47.012 5.769   8.253   1.00 38.06  ?  186 DA  D "C2'" 1 
ATOM 2903 C "C1'" . DA  D 3 17  ? -45.934 5.317   7.287   1.00 35.45  ?  186 DA  D "C1'" 1 
ATOM 2904 N N9    . DA  D 3 17  ? -46.279 4.081   6.607   1.00 35.35  ?  186 DA  D N9    1 
ATOM 2905 C C8    . DA  D 3 17  ? -46.609 2.894   7.188   1.00 34.57  ?  186 DA  D C8    1 
ATOM 2906 N N7    . DA  D 3 17  ? -46.868 1.942   6.332   1.00 34.42  ?  186 DA  D N7    1 
ATOM 2907 C C5    . DA  D 3 17  ? -46.684 2.544   5.104   1.00 30.88  ?  186 DA  D C5    1 
ATOM 2908 C C6    . DA  D 3 17  ? -46.800 2.064   3.793   1.00 32.06  ?  186 DA  D C6    1 
ATOM 2909 N N6    . DA  D 3 17  ? -47.147 0.811   3.502   1.00 38.89  ?  186 DA  D N6    1 
ATOM 2910 N N1    . DA  D 3 17  ? -46.547 2.921   2.791   1.00 32.61  ?  186 DA  D N1    1 
ATOM 2911 C C2    . DA  D 3 17  ? -46.200 4.174   3.090   1.00 38.56  ?  186 DA  D C2    1 
ATOM 2912 N N3    . DA  D 3 17  ? -46.058 4.739   4.282   1.00 37.62  ?  186 DA  D N3    1 
ATOM 2913 C C4    . DA  D 3 17  ? -46.316 3.861   5.255   1.00 30.35  ?  186 DA  D C4    1 
ATOM 2914 P P     . DT  D 3 18  ? -47.625 8.644   9.537   1.00 45.65  ?  187 DT  D P     1 
ATOM 2915 O OP1   . DT  D 3 18  ? -47.279 10.033  9.889   1.00 46.94  -1 187 DT  D OP1   1 
ATOM 2916 O OP2   . DT  D 3 18  ? -48.430 7.821   10.458  1.00 48.48  ?  187 DT  D OP2   1 
ATOM 2917 O "O5'" . DT  D 3 18  ? -48.360 8.644   8.128   1.00 47.00  ?  187 DT  D "O5'" 1 
ATOM 2918 C "C5'" . DT  D 3 18  ? -47.906 9.496   7.100   1.00 36.54  ?  187 DT  D "C5'" 1 
ATOM 2919 C "C4'" . DT  D 3 18  ? -48.610 9.177   5.800   1.00 45.48  ?  187 DT  D "C4'" 1 
ATOM 2920 O "O4'" . DT  D 3 18  ? -48.470 7.780   5.490   1.00 37.08  ?  187 DT  D "O4'" 1 
ATOM 2921 C "C3'" . DT  D 3 18  ? -50.119 9.437   5.810   1.00 52.71  ?  187 DT  D "C3'" 1 
ATOM 2922 O "O3'" . DT  D 3 18  ? -50.433 10.586  5.039   1.00 56.24  ?  187 DT  D "O3'" 1 
ATOM 2923 C "C2'" . DT  D 3 18  ? -50.720 8.167   5.193   1.00 52.16  ?  187 DT  D "C2'" 1 
ATOM 2924 C "C1'" . DT  D 3 18  ? -49.507 7.462   4.616   1.00 39.77  ?  187 DT  D "C1'" 1 
ATOM 2925 N N1    . DT  D 3 18  ? -49.675 5.993   4.550   1.00 41.84  ?  187 DT  D N1    1 
ATOM 2926 C C2    . DT  D 3 18  ? -49.741 5.388   3.324   1.00 42.09  ?  187 DT  D C2    1 
ATOM 2927 O O2    . DT  D 3 18  ? -49.625 5.994   2.278   1.00 43.24  ?  187 DT  D O2    1 
ATOM 2928 N N3    . DT  D 3 18  ? -49.919 4.037   3.363   1.00 39.90  ?  187 DT  D N3    1 
ATOM 2929 C C4    . DT  D 3 18  ? -50.057 3.249   4.483   1.00 38.97  ?  187 DT  D C4    1 
ATOM 2930 O O4    . DT  D 3 18  ? -50.217 2.038   4.417   1.00 39.30  ?  187 DT  D O4    1 
ATOM 2931 C C5    . DT  D 3 18  ? -49.999 3.947   5.737   1.00 38.02  ?  187 DT  D C5    1 
ATOM 2932 C C7    . DT  D 3 18  ? -50.136 3.192   7.021   1.00 37.46  ?  187 DT  D C7    1 
ATOM 2933 C C6    . DT  D 3 18  ? -49.823 5.273   5.712   1.00 38.12  ?  187 DT  D C6    1 
ATOM 2934 P P     . DG  D 3 19  ? -51.963 10.925  4.685   1.00 59.65  ?  188 DG  D P     1 
ATOM 2935 O OP1   . DG  D 3 19  ? -52.044 12.363  4.369   1.00 64.14  ?  188 DG  D OP1   1 
ATOM 2936 O OP2   . DG  D 3 19  ? -52.820 10.362  5.747   1.00 58.63  ?  188 DG  D OP2   1 
ATOM 2937 O "O5'" . DG  D 3 19  ? -52.233 10.105  3.346   1.00 60.17  ?  188 DG  D "O5'" 1 
ATOM 2938 C "C5'" . DG  D 3 19  ? -51.347 10.228  2.248   1.00 62.12  ?  188 DG  D "C5'" 1 
ATOM 2939 C "C4'" . DG  D 3 19  ? -51.904 9.544   1.011   1.00 67.46  ?  188 DG  D "C4'" 1 
ATOM 2940 O "O4'" . DG  D 3 19  ? -51.920 8.106   1.223   1.00 66.63  ?  188 DG  D "O4'" 1 
ATOM 2941 C "C3'" . DG  D 3 19  ? -53.336 9.917   0.656   1.00 75.23  ?  188 DG  D "C3'" 1 
ATOM 2942 O "O3'" . DG  D 3 19  ? -53.527 9.861   -0.746  1.00 81.38  ?  188 DG  D "O3'" 1 
ATOM 2943 C "C2'" . DG  D 3 19  ? -54.151 8.847   1.365   1.00 74.28  ?  188 DG  D "C2'" 1 
ATOM 2944 C "C1'" . DG  D 3 19  ? -53.251 7.627   1.241   1.00 69.97  ?  188 DG  D "C1'" 1 
ATOM 2945 N N9    . DG  D 3 19  ? -53.413 6.707   2.360   1.00 68.45  ?  188 DG  D N9    1 
ATOM 2946 C C8    . DG  D 3 19  ? -53.383 7.024   3.692   1.00 67.41  ?  188 DG  D C8    1 
ATOM 2947 N N7    . DG  D 3 19  ? -53.570 6.003   4.476   1.00 66.77  ?  188 DG  D N7    1 
ATOM 2948 C C5    . DG  D 3 19  ? -53.742 4.937   3.607   1.00 67.28  ?  188 DG  D C5    1 
ATOM 2949 C C6    . DG  D 3 19  ? -53.982 3.574   3.881   1.00 68.22  ?  188 DG  D C6    1 
ATOM 2950 O O6    . DG  D 3 19  ? -54.093 3.020   4.983   1.00 67.53  ?  188 DG  D O6    1 
ATOM 2951 N N1    . DG  D 3 19  ? -54.094 2.829   2.713   1.00 69.71  ?  188 DG  D N1    1 
ATOM 2952 C C2    . DG  D 3 19  ? -53.988 3.338   1.445   1.00 70.02  ?  188 DG  D C2    1 
ATOM 2953 N N2    . DG  D 3 19  ? -54.130 2.464   0.441   1.00 72.01  ?  188 DG  D N2    1 
ATOM 2954 N N3    . DG  D 3 19  ? -53.765 4.615   1.174   1.00 69.02  ?  188 DG  D N3    1 
ATOM 2955 C C4    . DG  D 3 19  ? -53.651 5.354   2.300   1.00 68.15  ?  188 DG  D C4    1 
ATOM 2956 P P     . DG  D 3 20  ? -54.839 10.518  -1.399  1.00 88.39  ?  189 DG  D P     1 
ATOM 2957 O OP1   . DG  D 3 20  ? -54.681 10.454  -2.868  1.00 91.88  ?  189 DG  D OP1   1 
ATOM 2958 O OP2   . DG  D 3 20  ? -55.087 11.818  -0.742  1.00 89.62  ?  189 DG  D OP2   1 
ATOM 2959 O "O5'" . DG  D 3 20  ? -56.014 9.535   -0.941  1.00 88.27  ?  189 DG  D "O5'" 1 
ATOM 2960 C "C5'" . DG  D 3 20  ? -57.017 9.150   -1.854  1.00 92.81  ?  189 DG  D "C5'" 1 
ATOM 2961 C "C4'" . DG  D 3 20  ? -56.693 7.808   -2.488  1.00 92.14  ?  189 DG  D "C4'" 1 
ATOM 2962 O "O4'" . DG  D 3 20  ? -55.876 7.033   -1.583  1.00 87.73  ?  189 DG  D "O4'" 1 
ATOM 2963 C "C3'" . DG  D 3 20  ? -57.918 6.969   -2.832  1.00 96.20  ?  189 DG  D "C3'" 1 
ATOM 2964 O "O3'" . DG  D 3 20  ? -58.076 6.915   -4.237  1.00 101.82 ?  189 DG  D "O3'" 1 
ATOM 2965 C "C2'" . DG  D 3 20  ? -57.639 5.579   -2.258  1.00 93.36  ?  189 DG  D "C2'" 1 
ATOM 2966 C "C1'" . DG  D 3 20  ? -56.449 5.771   -1.328  1.00 88.94  ?  189 DG  D "C1'" 1 
ATOM 2967 N N9    . DG  D 3 20  ? -56.789 5.692   0.087   1.00 89.61  ?  189 DG  D N9    1 
ATOM 2968 C C8    . DG  D 3 20  ? -56.995 6.739   0.945   1.00 90.54  ?  189 DG  D C8    1 
ATOM 2969 N N7    . DG  D 3 20  ? -57.290 6.367   2.158   1.00 90.08  ?  189 DG  D N7    1 
ATOM 2970 C C5    . DG  D 3 20  ? -57.292 4.983   2.096   1.00 88.41  ?  189 DG  D C5    1 
ATOM 2971 C C6    . DG  D 3 20  ? -57.549 4.029   3.105   1.00 86.84  ?  189 DG  D C6    1 
ATOM 2972 O O6    . DG  D 3 20  ? -57.836 4.227   4.293   1.00 87.32  ?  189 DG  D O6    1 
ATOM 2973 N N1    . DG  D 3 20  ? -57.450 2.730   2.620   1.00 84.83  ?  189 DG  D N1    1 
ATOM 2974 C C2    . DG  D 3 20  ? -57.139 2.398   1.325   1.00 84.45  ?  189 DG  D C2    1 
ATOM 2975 N N2    . DG  D 3 20  ? -57.088 1.091   1.044   1.00 83.92  ?  189 DG  D N2    1 
ATOM 2976 N N3    . DG  D 3 20  ? -56.895 3.283   0.370   1.00 86.48  ?  189 DG  D N3    1 
ATOM 2977 C C4    . DG  D 3 20  ? -56.989 4.551   0.827   1.00 88.48  ?  189 DG  D C4    1 
ATOM 2978 P P     . DT  D 3 21  ? -59.361 7.580   -4.930  1.00 111.85 ?  190 DT  D P     1 
ATOM 2979 O OP1   . DT  D 3 21  ? -59.050 9.000   -5.200  1.00 113.55 ?  190 DT  D OP1   1 
ATOM 2980 O OP2   . DT  D 3 21  ? -60.538 7.229   -4.109  1.00 112.96 ?  190 DT  D OP2   1 
ATOM 2981 O "O5'" . DT  D 3 21  ? -59.471 6.811   -6.323  1.00 117.83 ?  190 DT  D "O5'" 1 
ATOM 2982 C "C5'" . DT  D 3 21  ? -58.427 5.939   -6.730  1.00 116.81 ?  190 DT  D "C5'" 1 
ATOM 2983 C "C4'" . DT  D 3 21  ? -57.454 6.650   -7.653  1.00 117.99 ?  190 DT  D "C4'" 1 
ATOM 2984 O "O4'" . DT  D 3 21  ? -57.048 7.905   -7.054  1.00 116.17 ?  190 DT  D "O4'" 1 
ATOM 2985 C "C3'" . DT  D 3 21  ? -56.163 5.894   -7.926  1.00 114.61 ?  190 DT  D "C3'" 1 
ATOM 2986 O "O3'" . DT  D 3 21  ? -56.318 5.059   -9.066  1.00 118.59 ?  190 DT  D "O3'" 1 
ATOM 2987 C "C2'" . DT  D 3 21  ? -55.179 7.024   -8.193  1.00 112.76 ?  190 DT  D "C2'" 1 
ATOM 2988 C "C1'" . DT  D 3 21  ? -55.650 8.077   -7.196  1.00 112.44 ?  190 DT  D "C1'" 1 
ATOM 2989 N N     . SER E 1 5   ? -21.603 2.657   -61.506 1.00 50.07  ?  3   SER E N     1 
ATOM 2990 C CA    . SER E 1 5   ? -22.466 3.364   -62.443 1.00 50.02  ?  3   SER E CA    1 
ATOM 2991 C C     . SER E 1 5   ? -21.662 4.330   -63.309 1.00 51.61  ?  3   SER E C     1 
ATOM 2992 O O     . SER E 1 5   ? -20.606 4.804   -62.897 1.00 50.37  ?  3   SER E O     1 
ATOM 2993 C CB    . SER E 1 5   ? -23.560 4.115   -61.682 1.00 48.80  ?  3   SER E CB    1 
ATOM 2994 O OG    . SER E 1 5   ? -23.933 5.303   -62.354 1.00 49.68  ?  3   SER E OG    1 
ATOM 2995 N N     . PRO E 1 6   ? -22.155 4.607   -64.518 1.00 54.10  ?  4   PRO E N     1 
ATOM 2996 C CA    . PRO E 1 6   ? -21.424 5.522   -65.408 1.00 56.00  ?  4   PRO E CA    1 
ATOM 2997 C C     . PRO E 1 6   ? -21.257 6.919   -64.845 1.00 58.78  ?  4   PRO E C     1 
ATOM 2998 O O     . PRO E 1 6   ? -20.314 7.621   -65.228 1.00 60.12  ?  4   PRO E O     1 
ATOM 2999 C CB    . PRO E 1 6   ? -22.278 5.531   -66.685 1.00 54.74  ?  4   PRO E CB    1 
ATOM 3000 C CG    . PRO E 1 6   ? -23.580 4.905   -66.306 1.00 54.14  ?  4   PRO E CG    1 
ATOM 3001 C CD    . PRO E 1 6   ? -23.275 3.952   -65.208 1.00 53.86  ?  4   PRO E CD    1 
ATOM 3002 N N     . GLU E 1 7   ? -22.148 7.351   -63.951 1.00 60.00  ?  5   GLU E N     1 
ATOM 3003 C CA    . GLU E 1 7   ? -22.002 8.667   -63.340 1.00 60.30  ?  5   GLU E CA    1 
ATOM 3004 C C     . GLU E 1 7   ? -20.983 8.665   -62.210 1.00 55.32  ?  5   GLU E C     1 
ATOM 3005 O O     . GLU E 1 7   ? -20.270 9.656   -62.027 1.00 55.88  ?  5   GLU E O     1 
ATOM 3006 C CB    . GLU E 1 7   ? -23.353 9.169   -62.835 1.00 65.81  ?  5   GLU E CB    1 
ATOM 3007 C CG    . GLU E 1 7   ? -23.314 10.590  -62.306 1.00 74.21  ?  5   GLU E CG    1 
ATOM 3008 C CD    . GLU E 1 7   ? -23.291 11.626  -63.412 1.00 79.36  ?  5   GLU E CD    1 
ATOM 3009 O OE1   . GLU E 1 7   ? -23.791 11.329  -64.517 1.00 80.34  ?  5   GLU E OE1   1 
ATOM 3010 O OE2   . GLU E 1 7   ? -22.771 12.738  -63.177 1.00 80.43  -1 5   GLU E OE2   1 
ATOM 3011 N N     . ILE E 1 8   ? -20.899 7.574   -61.447 1.00 50.18  ?  6   ILE E N     1 
ATOM 3012 C CA    . ILE E 1 8   ? -19.903 7.493   -60.385 1.00 49.23  ?  6   ILE E CA    1 
ATOM 3013 C C     . ILE E 1 8   ? -18.500 7.477   -60.974 1.00 49.29  ?  6   ILE E C     1 
ATOM 3014 O O     . ILE E 1 8   ? -17.575 8.087   -60.426 1.00 49.19  ?  6   ILE E O     1 
ATOM 3015 C CB    . ILE E 1 8   ? -20.165 6.258   -59.507 1.00 48.85  ?  6   ILE E CB    1 
ATOM 3016 C CG1   . ILE E 1 8   ? -21.463 6.433   -58.722 1.00 48.22  ?  6   ILE E CG1   1 
ATOM 3017 C CG2   . ILE E 1 8   ? -18.998 6.007   -58.569 1.00 49.47  ?  6   ILE E CG2   1 
ATOM 3018 C CD1   . ILE E 1 8   ? -21.746 5.311   -57.761 1.00 47.37  ?  6   ILE E CD1   1 
ATOM 3019 N N     . ARG E 1 9   ? -18.321 6.793   -62.104 1.00 48.98  ?  7   ARG E N     1 
ATOM 3020 C CA    . ARG E 1 9   ? -17.019 6.782   -62.759 1.00 48.75  ?  7   ARG E CA    1 
ATOM 3021 C C     . ARG E 1 9   ? -16.638 8.185   -63.210 1.00 51.60  ?  7   ARG E C     1 
ATOM 3022 O O     . ARG E 1 9   ? -15.511 8.637   -62.989 1.00 53.04  ?  7   ARG E O     1 
ATOM 3023 C CB    . ARG E 1 9   ? -17.031 5.811   -63.938 1.00 46.42  ?  7   ARG E CB    1 
ATOM 3024 N N     . GLU E 1 10  ? -17.575 8.890   -63.847 1.00 52.15  ?  8   GLU E N     1 
ATOM 3025 C CA    . GLU E 1 10  ? -17.331 10.276  -64.221 1.00 54.45  ?  8   GLU E CA    1 
ATOM 3026 C C     . GLU E 1 10  ? -17.136 11.158  -62.999 1.00 56.26  ?  8   GLU E C     1 
ATOM 3027 O O     . GLU E 1 10  ? -16.529 12.228  -63.107 1.00 57.91  ?  8   GLU E O     1 
ATOM 3028 C CB    . GLU E 1 10  ? -18.489 10.804  -65.070 1.00 54.70  ?  8   GLU E CB    1 
ATOM 3029 N N     . LEU E 1 11  ? -17.643 10.731  -61.843 1.00 55.41  ?  9   LEU E N     1 
ATOM 3030 C CA    . LEU E 1 11  ? -17.474 11.489  -60.611 1.00 54.81  ?  9   LEU E CA    1 
ATOM 3031 C C     . LEU E 1 11  ? -16.082 11.282  -60.027 1.00 55.70  ?  9   LEU E C     1 
ATOM 3032 O O     . LEU E 1 11  ? -15.451 12.239  -59.565 1.00 56.93  ?  9   LEU E O     1 
ATOM 3033 C CB    . LEU E 1 11  ? -18.549 11.083  -59.605 1.00 54.08  ?  9   LEU E CB    1 
ATOM 3034 C CG    . LEU E 1 11  ? -19.218 12.191  -58.796 1.00 53.45  ?  9   LEU E CG    1 
ATOM 3035 C CD1   . LEU E 1 11  ? -19.762 13.263  -59.713 1.00 53.96  ?  9   LEU E CD1   1 
ATOM 3036 C CD2   . LEU E 1 11  ? -20.332 11.594  -57.968 1.00 51.58  ?  9   LEU E CD2   1 
ATOM 3037 N N     . GLU E 1 12  ? -15.595 10.039  -60.038 1.00 55.78  ?  10  GLU E N     1 
ATOM 3038 C CA    . GLU E 1 12  ? -14.240 9.755   -59.576 1.00 55.87  ?  10  GLU E CA    1 
ATOM 3039 C C     . GLU E 1 12  ? -13.207 10.494  -60.414 1.00 54.64  ?  10  GLU E C     1 
ATOM 3040 O O     . GLU E 1 12  ? -12.273 11.098  -59.877 1.00 55.26  ?  10  GLU E O     1 
ATOM 3041 C CB    . GLU E 1 12  ? -13.971 8.252   -59.623 1.00 58.67  ?  10  GLU E CB    1 
ATOM 3042 C CG    . GLU E 1 12  ? -14.811 7.422   -58.682 1.00 61.73  ?  10  GLU E CG    1 
ATOM 3043 C CD    . GLU E 1 12  ? -14.384 5.969   -58.660 1.00 64.64  ?  10  GLU E CD    1 
ATOM 3044 O OE1   . GLU E 1 12  ? -14.521 5.291   -59.699 1.00 65.21  ?  10  GLU E OE1   1 
ATOM 3045 O OE2   . GLU E 1 12  ? -13.905 5.505   -57.605 1.00 65.65  -1 10  GLU E OE2   1 
ATOM 3046 N N     . LYS E 1 13  ? -13.352 10.439  -61.740 1.00 52.95  ?  11  LYS E N     1 
ATOM 3047 C CA    . LYS E 1 13  ? -12.372 11.058  -62.626 1.00 54.44  ?  11  LYS E CA    1 
ATOM 3048 C C     . LYS E 1 13  ? -12.203 12.540  -62.324 1.00 57.05  ?  11  LYS E C     1 
ATOM 3049 O O     . LYS E 1 13  ? -11.075 13.041  -62.267 1.00 60.99  ?  11  LYS E O     1 
ATOM 3050 C CB    . LYS E 1 13  ? -12.778 10.850  -64.083 1.00 53.94  ?  11  LYS E CB    1 
ATOM 3051 C CG    . LYS E 1 13  ? -12.525 9.445   -64.600 1.00 50.49  ?  11  LYS E CG    1 
ATOM 3052 N N     . PHE E 1 14  ? -13.308 13.262  -62.132 1.00 55.02  ?  12  PHE E N     1 
ATOM 3053 C CA    . PHE E 1 14  ? -13.196 14.680  -61.810 1.00 53.41  ?  12  PHE E CA    1 
ATOM 3054 C C     . PHE E 1 14  ? -12.538 14.883  -60.455 1.00 53.80  ?  12  PHE E C     1 
ATOM 3055 O O     . PHE E 1 14  ? -11.691 15.770  -60.296 1.00 53.76  ?  12  PHE E O     1 
ATOM 3056 C CB    . PHE E 1 14  ? -14.565 15.353  -61.835 1.00 50.65  ?  12  PHE E CB    1 
ATOM 3057 C CG    . PHE E 1 14  ? -14.510 16.825  -61.560 1.00 51.40  ?  12  PHE E CG    1 
ATOM 3058 C CD1   . PHE E 1 14  ? -14.334 17.727  -62.590 1.00 53.74  ?  12  PHE E CD1   1 
ATOM 3059 C CD2   . PHE E 1 14  ? -14.627 17.309  -60.270 1.00 50.99  ?  12  PHE E CD2   1 
ATOM 3060 C CE1   . PHE E 1 14  ? -14.278 19.080  -62.339 1.00 55.23  ?  12  PHE E CE1   1 
ATOM 3061 C CE2   . PHE E 1 14  ? -14.570 18.659  -60.015 1.00 52.15  ?  12  PHE E CE2   1 
ATOM 3062 C CZ    . PHE E 1 14  ? -14.396 19.545  -61.049 1.00 54.07  ?  12  PHE E CZ    1 
ATOM 3063 N N     . ALA E 1 15  ? -12.921 14.078  -59.463 1.00 53.58  ?  13  ALA E N     1 
ATOM 3064 C CA    . ALA E 1 15  ? -12.339 14.223  -58.134 1.00 54.44  ?  13  ALA E CA    1 
ATOM 3065 C C     . ALA E 1 15  ? -10.831 14.033  -58.180 1.00 55.07  ?  13  ALA E C     1 
ATOM 3066 O O     . ALA E 1 15  ? -10.085 14.752  -57.507 1.00 53.82  ?  13  ALA E O     1 
ATOM 3067 C CB    . ALA E 1 15  ? -12.981 13.226  -57.172 1.00 53.14  ?  13  ALA E CB    1 
ATOM 3068 N N     . ASN E 1 16  ? -10.364 13.067  -58.970 1.00 57.28  ?  14  ASN E N     1 
ATOM 3069 C CA    . ASN E 1 16  ? -8.929  12.880  -59.135 1.00 60.45  ?  14  ASN E CA    1 
ATOM 3070 C C     . ASN E 1 16  ? -8.312  14.034  -59.914 1.00 61.69  ?  14  ASN E C     1 
ATOM 3071 O O     . ASN E 1 16  ? -7.250  14.544  -59.542 1.00 59.97  ?  14  ASN E O     1 
ATOM 3072 C CB    . ASN E 1 16  ? -8.654  11.549  -59.828 1.00 63.27  ?  14  ASN E CB    1 
ATOM 3073 C CG    . ASN E 1 16  ? -9.218  10.371  -59.062 1.00 65.81  ?  14  ASN E CG    1 
ATOM 3074 O OD1   . ASN E 1 16  ? -9.674  10.517  -57.930 1.00 66.80  ?  14  ASN E OD1   1 
ATOM 3075 N ND2   . ASN E 1 16  ? -9.191  9.196   -59.677 1.00 66.79  ?  14  ASN E ND2   1 
ATOM 3076 N N     . GLU E 1 17  ? -8.964  14.460  -60.997 1.00 66.13  ?  15  GLU E N     1 
ATOM 3077 C CA    . GLU E 1 17  ? -8.432  15.565  -61.786 1.00 72.77  ?  15  GLU E CA    1 
ATOM 3078 C C     . GLU E 1 17  ? -8.484  16.878  -61.018 1.00 75.49  ?  15  GLU E C     1 
ATOM 3079 O O     . GLU E 1 17  ? -7.579  17.710  -61.147 1.00 84.45  ?  15  GLU E O     1 
ATOM 3080 C CB    . GLU E 1 17  ? -9.197  15.686  -63.102 1.00 75.73  ?  15  GLU E CB    1 
ATOM 3081 C CG    . GLU E 1 17  ? -8.901  14.582  -64.097 1.00 78.57  ?  15  GLU E CG    1 
ATOM 3082 C CD    . GLU E 1 17  ? -9.230  14.986  -65.518 1.00 84.07  ?  15  GLU E CD    1 
ATOM 3083 O OE1   . GLU E 1 17  ? -9.049  16.176  -65.854 1.00 86.55  ?  15  GLU E OE1   1 
ATOM 3084 O OE2   . GLU E 1 17  ? -9.668  14.116  -66.300 1.00 85.84  ?  15  GLU E OE2   1 
ATOM 3085 N N     . PHE E 1 18  ? -9.530  17.088  -60.216 1.00 67.59  ?  16  PHE E N     1 
ATOM 3086 C CA    . PHE E 1 18  ? -9.587  18.298  -59.404 1.00 63.82  ?  16  PHE E CA    1 
ATOM 3087 C C     . PHE E 1 18  ? -8.485  18.326  -58.356 1.00 65.44  ?  16  PHE E C     1 
ATOM 3088 O O     . PHE E 1 18  ? -7.970  19.400  -58.032 1.00 67.78  ?  16  PHE E O     1 
ATOM 3089 C CB    . PHE E 1 18  ? -10.949 18.429  -58.730 1.00 57.95  ?  16  PHE E CB    1 
ATOM 3090 C CG    . PHE E 1 18  ? -11.037 19.581  -57.776 1.00 53.31  ?  16  PHE E CG    1 
ATOM 3091 C CD1   . PHE E 1 18  ? -11.124 20.878  -58.241 1.00 52.53  ?  16  PHE E CD1   1 
ATOM 3092 C CD2   . PHE E 1 18  ? -11.031 19.366  -56.412 1.00 50.17  ?  16  PHE E CD2   1 
ATOM 3093 C CE1   . PHE E 1 18  ? -11.200 21.936  -57.364 1.00 51.40  ?  16  PHE E CE1   1 
ATOM 3094 C CE2   . PHE E 1 18  ? -11.108 20.420  -55.534 1.00 49.28  ?  16  PHE E CE2   1 
ATOM 3095 C CZ    . PHE E 1 18  ? -11.193 21.706  -56.011 1.00 50.04  ?  16  PHE E CZ    1 
ATOM 3096 N N     . LYS E 1 19  ? -8.113  17.166  -57.819 1.00 63.23  ?  17  LYS E N     1 
ATOM 3097 C CA    . LYS E 1 19  ? -7.084  17.124  -56.787 1.00 59.26  ?  17  LYS E CA    1 
ATOM 3098 C C     . LYS E 1 19  ? -5.727  17.509  -57.360 1.00 59.83  ?  17  LYS E C     1 
ATOM 3099 O O     . LYS E 1 19  ? -4.997  18.312  -56.771 1.00 59.66  ?  17  LYS E O     1 
ATOM 3100 C CB    . LYS E 1 19  ? -7.036  15.730  -56.163 1.00 55.14  ?  17  LYS E CB    1 
ATOM 3101 C CG    . LYS E 1 19  ? -6.159  15.608  -54.933 1.00 52.44  ?  17  LYS E CG    1 
ATOM 3102 C CD    . LYS E 1 19  ? -6.214  14.193  -54.387 1.00 52.30  ?  17  LYS E CD    1 
ATOM 3103 C CE    . LYS E 1 19  ? -5.758  14.131  -52.942 1.00 52.55  ?  17  LYS E CE    1 
ATOM 3104 N NZ    . LYS E 1 19  ? -6.916  14.167  -52.008 1.00 51.69  1  17  LYS E NZ    1 
ATOM 3105 N N     . VAL E 1 20  ? -5.376  16.943  -58.515 1.00 65.32  ?  18  VAL E N     1 
ATOM 3106 C CA    . VAL E 1 20  ? -4.091  17.245  -59.136 1.00 71.70  ?  18  VAL E CA    1 
ATOM 3107 C C     . VAL E 1 20  ? -4.035  18.703  -59.571 1.00 75.53  ?  18  VAL E C     1 
ATOM 3108 O O     . VAL E 1 20  ? -3.073  19.419  -59.275 1.00 83.63  ?  18  VAL E O     1 
ATOM 3109 C CB    . VAL E 1 20  ? -3.832  16.295  -60.316 1.00 45.49  ?  18  VAL E CB    1 
ATOM 3110 C CG1   . VAL E 1 20  ? -2.448  16.529  -60.875 1.00 46.80  ?  18  VAL E CG1   1 
ATOM 3111 C CG2   . VAL E 1 20  ? -3.995  14.854  -59.872 1.00 44.43  ?  18  VAL E CG2   1 
ATOM 3112 N N     . ARG E 1 21  ? -5.065  19.163  -60.285 1.00 67.85  ?  19  ARG E N     1 
ATOM 3113 C CA    . ARG E 1 21  ? -5.078  20.540  -60.769 1.00 67.97  ?  19  ARG E CA    1 
ATOM 3114 C C     . ARG E 1 21  ? -5.076  21.543  -59.624 1.00 67.55  ?  19  ARG E C     1 
ATOM 3115 O O     . ARG E 1 21  ? -4.569  22.659  -59.779 1.00 67.73  ?  19  ARG E O     1 
ATOM 3116 C CB    . ARG E 1 21  ? -6.299  20.764  -61.662 1.00 66.19  ?  19  ARG E CB    1 
ATOM 3117 C CG    . ARG E 1 21  ? -6.307  19.976  -62.965 1.00 65.43  ?  19  ARG E CG    1 
ATOM 3118 C CD    . ARG E 1 21  ? -5.639  20.729  -64.115 1.00 68.21  ?  19  ARG E CD    1 
ATOM 3119 N NE    . ARG E 1 21  ? -4.287  21.189  -63.820 1.00 69.74  ?  19  ARG E NE    1 
ATOM 3120 C CZ    . ARG E 1 21  ? -3.186  20.492  -64.075 1.00 69.29  ?  19  ARG E CZ    1 
ATOM 3121 N NH1   . ARG E 1 21  ? -3.268  19.294  -64.636 1.00 68.23  ?  19  ARG E NH1   1 
ATOM 3122 N NH2   . ARG E 1 21  ? -2.003  20.999  -63.774 1.00 70.01  ?  19  ARG E NH2   1 
ATOM 3123 N N     . ARG E 1 22  ? -5.635  21.171  -58.472 1.00 62.60  ?  20  ARG E N     1 
ATOM 3124 C CA    . ARG E 1 22  ? -5.604  22.062  -57.318 1.00 60.05  ?  20  ARG E CA    1 
ATOM 3125 C C     . ARG E 1 22  ? -4.195  22.194  -56.756 1.00 56.49  ?  20  ARG E C     1 
ATOM 3126 O O     . ARG E 1 22  ? -3.760  23.296  -56.409 1.00 45.88  ?  20  ARG E O     1 
ATOM 3127 C CB    . ARG E 1 22  ? -6.557  21.552  -56.240 1.00 60.80  ?  20  ARG E CB    1 
ATOM 3128 C CG    . ARG E 1 22  ? -6.590  22.398  -54.982 1.00 59.91  ?  20  ARG E CG    1 
ATOM 3129 C CD    . ARG E 1 22  ? -7.048  21.583  -53.791 1.00 56.74  ?  20  ARG E CD    1 
ATOM 3130 N NE    . ARG E 1 22  ? -5.921  20.930  -53.137 1.00 57.76  ?  20  ARG E NE    1 
ATOM 3131 C CZ    . ARG E 1 22  ? -5.990  19.760  -52.516 1.00 58.75  ?  20  ARG E CZ    1 
ATOM 3132 N NH1   . ARG E 1 22  ? -7.136  19.107  -52.459 1.00 59.43  1  20  ARG E NH1   1 
ATOM 3133 N NH2   . ARG E 1 22  ? -4.911  19.245  -51.948 1.00 60.03  ?  20  ARG E NH2   1 
ATOM 3134 N N     . ILE E 1 23  ? -3.463  21.083  -56.674 1.00 55.60  ?  21  ILE E N     1 
ATOM 3135 C CA    . ILE E 1 23  ? -2.130  21.111  -56.080 1.00 57.71  ?  21  ILE E CA    1 
ATOM 3136 C C     . ILE E 1 23  ? -1.133  21.774  -57.020 1.00 60.02  ?  21  ILE E C     1 
ATOM 3137 O O     . ILE E 1 23  ? -0.326  22.614  -56.602 1.00 58.80  ?  21  ILE E O     1 
ATOM 3138 C CB    . ILE E 1 23  ? -1.688  19.686  -55.707 1.00 56.68  ?  21  ILE E CB    1 
ATOM 3139 C CG1   . ILE E 1 23  ? -2.594  19.118  -54.616 1.00 43.21  ?  21  ILE E CG1   1 
ATOM 3140 C CG2   . ILE E 1 23  ? -0.235  19.671  -55.274 1.00 56.39  ?  21  ILE E CG2   1 
ATOM 3141 C CD1   . ILE E 1 23  ? -2.273  17.695  -54.242 1.00 42.46  ?  21  ILE E CD1   1 
ATOM 3142 N N     . LYS E 1 24  ? -1.167  21.405  -58.302 1.00 62.22  ?  22  LYS E N     1 
ATOM 3143 C CA    . LYS E 1 24  ? -0.270  22.021  -59.273 1.00 64.19  ?  22  LYS E CA    1 
ATOM 3144 C C     . LYS E 1 24  ? -0.476  23.527  -59.353 1.00 64.63  ?  22  LYS E C     1 
ATOM 3145 O O     . LYS E 1 24  ? 0.456   24.265  -59.690 1.00 68.29  ?  22  LYS E O     1 
ATOM 3146 C CB    . LYS E 1 24  ? -0.444  21.362  -60.639 1.00 65.28  ?  22  LYS E CB    1 
ATOM 3147 C CG    . LYS E 1 24  ? 0.166   19.969  -60.697 1.00 49.80  ?  22  LYS E CG    1 
ATOM 3148 C CD    . LYS E 1 24  ? 0.226   19.427  -62.111 1.00 50.78  ?  22  LYS E CD    1 
ATOM 3149 N N     . LEU E 1 25  ? -1.680  24.001  -59.053 1.00 70.17  ?  23  LEU E N     1 
ATOM 3150 C CA    . LEU E 1 25  ? -1.951  25.429  -58.991 1.00 71.11  ?  23  LEU E CA    1 
ATOM 3151 C C     . LEU E 1 25  ? -1.593  26.039  -57.644 1.00 71.01  ?  23  LEU E C     1 
ATOM 3152 O O     . LEU E 1 25  ? -1.756  27.250  -57.468 1.00 71.22  ?  23  LEU E O     1 
ATOM 3153 C CB    . LEU E 1 25  ? -3.427  25.690  -59.295 1.00 68.19  ?  23  LEU E CB    1 
ATOM 3154 C CG    . LEU E 1 25  ? -3.854  25.649  -60.760 1.00 70.78  ?  23  LEU E CG    1 
ATOM 3155 C CD1   . LEU E 1 25  ? -5.361  25.729  -60.862 1.00 67.46  ?  23  LEU E CD1   1 
ATOM 3156 C CD2   . LEU E 1 25  ? -3.209  26.788  -61.526 1.00 75.30  ?  23  LEU E CD2   1 
ATOM 3157 N N     . GLY E 1 26  ? -1.110  25.239  -56.697 1.00 67.96  ?  24  GLY E N     1 
ATOM 3158 C CA    . GLY E 1 26  ? -0.675  25.768  -55.419 1.00 67.73  ?  24  GLY E CA    1 
ATOM 3159 C C     . GLY E 1 26  ? -1.793  26.171  -54.487 1.00 64.53  ?  24  GLY E C     1 
ATOM 3160 O O     . GLY E 1 26  ? -1.604  27.058  -53.649 1.00 66.79  ?  24  GLY E O     1 
ATOM 3161 N N     . TYR E 1 27  ? -2.958  25.543  -54.608 1.00 59.46  ?  25  TYR E N     1 
ATOM 3162 C CA    . TYR E 1 27  ? -4.087  25.794  -53.726 1.00 53.22  ?  25  TYR E CA    1 
ATOM 3163 C C     . TYR E 1 27  ? -4.161  24.718  -52.653 1.00 48.48  ?  25  TYR E C     1 
ATOM 3164 O O     . TYR E 1 27  ? -3.962  23.534  -52.934 1.00 46.47  ?  25  TYR E O     1 
ATOM 3165 C CB    . TYR E 1 27  ? -5.401  25.823  -54.509 1.00 50.92  ?  25  TYR E CB    1 
ATOM 3166 C CG    . TYR E 1 27  ? -5.660  27.094  -55.284 1.00 52.31  ?  25  TYR E CG    1 
ATOM 3167 C CD1   . TYR E 1 27  ? -6.258  28.185  -54.677 1.00 51.40  ?  25  TYR E CD1   1 
ATOM 3168 C CD2   . TYR E 1 27  ? -5.297  27.205  -56.617 1.00 55.76  ?  25  TYR E CD2   1 
ATOM 3169 C CE1   . TYR E 1 27  ? -6.501  29.347  -55.375 1.00 53.52  ?  25  TYR E CE1   1 
ATOM 3170 C CE2   . TYR E 1 27  ? -5.533  28.365  -57.324 1.00 57.87  ?  25  TYR E CE2   1 
ATOM 3171 C CZ    . TYR E 1 27  ? -6.135  29.433  -56.697 1.00 56.95  ?  25  TYR E CZ    1 
ATOM 3172 O OH    . TYR E 1 27  ? -6.374  30.593  -57.393 1.00 59.39  ?  25  TYR E OH    1 
ATOM 3173 N N     . THR E 1 28  ? -4.431  25.135  -51.424 1.00 48.73  ?  26  THR E N     1 
ATOM 3174 C CA    . THR E 1 28  ? -4.754  24.196  -50.363 1.00 48.66  ?  26  THR E CA    1 
ATOM 3175 C C     . THR E 1 28  ? -6.263  23.988  -50.297 1.00 47.61  ?  26  THR E C     1 
ATOM 3176 O O     . THR E 1 28  ? -7.046  24.782  -50.822 1.00 47.75  ?  26  THR E O     1 
ATOM 3177 C CB    . THR E 1 28  ? -4.237  24.688  -49.012 1.00 49.47  ?  26  THR E CB    1 
ATOM 3178 O OG1   . THR E 1 28  ? -4.950  25.866  -48.625 1.00 50.05  ?  26  THR E OG1   1 
ATOM 3179 C CG2   . THR E 1 28  ? -2.760  25.004  -49.096 1.00 53.26  ?  26  THR E CG2   1 
ATOM 3180 N N     . GLN E 1 29  ? -6.663  22.892  -49.651 1.00 45.67  ?  27  GLN E N     1 
ATOM 3181 C CA    . GLN E 1 29  ? -8.085  22.601  -49.503 1.00 42.85  ?  27  GLN E CA    1 
ATOM 3182 C C     . GLN E 1 29  ? -8.815  23.753  -48.828 1.00 40.71  ?  27  GLN E C     1 
ATOM 3183 O O     . GLN E 1 29  ? -9.951  24.076  -49.190 1.00 38.57  ?  27  GLN E O     1 
ATOM 3184 C CB    . GLN E 1 29  ? -8.277  21.308  -48.716 1.00 44.59  ?  27  GLN E CB    1 
ATOM 3185 C CG    . GLN E 1 29  ? -8.092  20.053  -49.543 1.00 45.44  ?  27  GLN E CG    1 
ATOM 3186 C CD    . GLN E 1 29  ? -8.193  18.794  -48.717 1.00 44.58  ?  27  GLN E CD    1 
ATOM 3187 O OE1   . GLN E 1 29  ? -8.350  18.850  -47.501 1.00 44.91  ?  27  GLN E OE1   1 
ATOM 3188 N NE2   . GLN E 1 29  ? -8.095  17.648  -49.373 1.00 44.49  ?  27  GLN E NE2   1 
ATOM 3189 N N     . THR E 1 30  ? -8.177  24.385  -47.843 1.00 42.76  ?  28  THR E N     1 
ATOM 3190 C CA    . THR E 1 30  ? -8.777  25.547  -47.199 1.00 43.65  ?  28  THR E CA    1 
ATOM 3191 C C     . THR E 1 30  ? -8.891  26.725  -48.158 1.00 49.61  ?  28  THR E C     1 
ATOM 3192 O O     . THR E 1 30  ? -9.848  27.502  -48.068 1.00 50.90  ?  28  THR E O     1 
ATOM 3193 C CB    . THR E 1 30  ? -7.962  25.936  -45.967 1.00 40.56  ?  28  THR E CB    1 
ATOM 3194 O OG1   . THR E 1 30  ? -7.803  24.793  -45.121 1.00 38.21  ?  28  THR E OG1   1 
ATOM 3195 C CG2   . THR E 1 30  ? -8.664  27.028  -45.187 1.00 40.09  ?  28  THR E CG2   1 
ATOM 3196 N N     . ASN E 1 31  ? -7.944  26.868  -49.087 1.00 53.58  ?  29  ASN E N     1 
ATOM 3197 C CA    . ASN E 1 31  ? -7.999  27.982  -50.027 1.00 57.76  ?  29  ASN E CA    1 
ATOM 3198 C C     . ASN E 1 31  ? -9.146  27.814  -51.014 1.00 59.63  ?  29  ASN E C     1 
ATOM 3199 O O     . ASN E 1 31  ? -9.830  28.787  -51.350 1.00 61.06  ?  29  ASN E O     1 
ATOM 3200 C CB    . ASN E 1 31  ? -6.672  28.121  -50.770 1.00 58.15  ?  29  ASN E CB    1 
ATOM 3201 C CG    . ASN E 1 31  ? -5.564  28.646  -49.889 1.00 58.03  ?  29  ASN E CG    1 
ATOM 3202 O OD1   . ASN E 1 31  ? -4.736  27.886  -49.394 1.00 55.72  ?  29  ASN E OD1   1 
ATOM 3203 N ND2   . ASN E 1 31  ? -5.548  29.955  -49.680 1.00 60.84  ?  29  ASN E ND2   1 
ATOM 3204 N N     . VAL E 1 32  ? -9.354  26.593  -51.506 1.00 60.54  ?  30  VAL E N     1 
ATOM 3205 C CA    . VAL E 1 32  ? -10.464 26.340  -52.419 1.00 61.00  ?  30  VAL E CA    1 
ATOM 3206 C C     . VAL E 1 32  ? -11.793 26.612  -51.729 1.00 59.38  ?  30  VAL E C     1 
ATOM 3207 O O     . VAL E 1 32  ? -12.696 27.223  -52.311 1.00 60.43  ?  30  VAL E O     1 
ATOM 3208 C CB    . VAL E 1 32  ? -10.390 24.900  -52.955 1.00 61.94  ?  30  VAL E CB    1 
ATOM 3209 C CG1   . VAL E 1 32  ? -11.552 24.618  -53.887 1.00 60.21  ?  30  VAL E CG1   1 
ATOM 3210 C CG2   . VAL E 1 32  ? -9.069  24.673  -53.657 1.00 67.06  ?  30  VAL E CG2   1 
ATOM 3211 N N     . GLY E 1 33  ? -11.929 26.181  -50.475 1.00 57.24  ?  31  GLY E N     1 
ATOM 3212 C CA    . GLY E 1 33  ? -13.156 26.446  -49.743 1.00 56.60  ?  31  GLY E CA    1 
ATOM 3213 C C     . GLY E 1 33  ? -13.439 27.926  -49.579 1.00 59.18  ?  31  GLY E C     1 
ATOM 3214 O O     . GLY E 1 33  ? -14.593 28.354  -49.619 1.00 61.90  ?  31  GLY E O     1 
ATOM 3215 N N     . GLU E 1 34  ? -12.389 28.730  -49.405 1.00 58.99  ?  32  GLU E N     1 
ATOM 3216 C CA    . GLU E 1 34  ? -12.568 30.169  -49.247 1.00 60.02  ?  32  GLU E CA    1 
ATOM 3217 C C     . GLU E 1 34  ? -12.794 30.861  -50.585 1.00 58.68  ?  32  GLU E C     1 
ATOM 3218 O O     . GLU E 1 34  ? -13.648 31.747  -50.692 1.00 59.00  ?  32  GLU E O     1 
ATOM 3219 C CB    . GLU E 1 34  ? -11.356 30.777  -48.542 1.00 63.60  ?  32  GLU E CB    1 
ATOM 3220 C CG    . GLU E 1 34  ? -11.091 30.217  -47.162 1.00 64.83  ?  32  GLU E CG    1 
ATOM 3221 C CD    . GLU E 1 34  ? -10.061 31.019  -46.401 1.00 69.21  ?  32  GLU E CD    1 
ATOM 3222 O OE1   . GLU E 1 34  ? -9.604  32.053  -46.929 1.00 71.80  ?  32  GLU E OE1   1 
ATOM 3223 O OE2   . GLU E 1 34  ? -9.701  30.614  -45.277 1.00 70.34  -1 32  GLU E OE2   1 
ATOM 3224 N N     . ALA E 1 35  ? -12.042 30.473  -51.612 1.00 57.75  ?  33  ALA E N     1 
ATOM 3225 C CA    . ALA E 1 35  ? -12.076 31.146  -52.900 1.00 58.27  ?  33  ALA E CA    1 
ATOM 3226 C C     . ALA E 1 35  ? -13.251 30.720  -53.761 1.00 56.87  ?  33  ALA E C     1 
ATOM 3227 O O     . ALA E 1 35  ? -13.181 30.846  -54.987 1.00 58.43  ?  33  ALA E O     1 
ATOM 3228 C CB    . ALA E 1 35  ? -10.768 30.904  -53.653 1.00 58.81  ?  33  ALA E CB    1 
ATOM 3229 N N     . LEU E 1 36  ? -14.332 30.240  -53.151 1.00 53.69  ?  34  LEU E N     1 
ATOM 3230 C CA    . LEU E 1 36  ? -15.522 29.838  -53.881 1.00 51.81  ?  34  LEU E CA    1 
ATOM 3231 C C     . LEU E 1 36  ? -16.664 30.829  -53.742 1.00 55.65  ?  34  LEU E C     1 
ATOM 3232 O O     . LEU E 1 36  ? -17.657 30.708  -54.466 1.00 57.98  ?  34  LEU E O     1 
ATOM 3233 C CB    . LEU E 1 36  ? -15.993 28.460  -53.409 1.00 46.68  ?  34  LEU E CB    1 
ATOM 3234 C CG    . LEU E 1 36  ? -15.829 27.300  -54.385 1.00 42.97  ?  34  LEU E CG    1 
ATOM 3235 C CD1   . LEU E 1 36  ? -14.406 27.214  -54.875 1.00 43.53  ?  34  LEU E CD1   1 
ATOM 3236 C CD2   . LEU E 1 36  ? -16.244 26.004  -53.722 1.00 39.73  ?  34  LEU E CD2   1 
ATOM 3237 N N     . ALA E 1 37  ? -16.552 31.799  -52.833 1.00 56.90  ?  35  ALA E N     1 
ATOM 3238 C CA    . ALA E 1 37  ? -17.578 32.826  -52.712 1.00 60.66  ?  35  ALA E CA    1 
ATOM 3239 C C     . ALA E 1 37  ? -17.729 33.646  -53.985 1.00 65.39  ?  35  ALA E C     1 
ATOM 3240 O O     . ALA E 1 37  ? -18.774 34.274  -54.183 1.00 69.18  ?  35  ALA E O     1 
ATOM 3241 C CB    . ALA E 1 37  ? -17.259 33.746  -51.536 1.00 62.39  ?  35  ALA E CB    1 
ATOM 3242 N N     . ALA E 1 38  ? -16.716 33.652  -54.851 1.00 65.34  ?  36  ALA E N     1 
ATOM 3243 C CA    . ALA E 1 38  ? -16.804 34.416  -56.089 1.00 66.53  ?  36  ALA E CA    1 
ATOM 3244 C C     . ALA E 1 38  ? -17.746 33.767  -57.091 1.00 65.71  ?  36  ALA E C     1 
ATOM 3245 O O     . ALA E 1 38  ? -18.400 34.469  -57.869 1.00 67.64  ?  36  ALA E O     1 
ATOM 3246 C CB    . ALA E 1 38  ? -15.415 34.577  -56.702 1.00 66.59  ?  36  ALA E CB    1 
ATOM 3247 N N     . VAL E 1 39  ? -17.834 32.440  -57.084 1.00 64.02  ?  37  VAL E N     1 
ATOM 3248 C CA    . VAL E 1 39  ? -18.664 31.702  -58.026 1.00 67.06  ?  37  VAL E CA    1 
ATOM 3249 C C     . VAL E 1 39  ? -19.895 31.108  -57.370 1.00 69.12  ?  37  VAL E C     1 
ATOM 3250 O O     . VAL E 1 39  ? -20.747 30.541  -58.070 1.00 69.44  ?  37  VAL E O     1 
ATOM 3251 C CB    . VAL E 1 39  ? -17.847 30.604  -58.734 1.00 65.60  ?  37  VAL E CB    1 
ATOM 3252 C CG1   . VAL E 1 39  ? -17.830 29.333  -57.904 1.00 61.91  ?  37  VAL E CG1   1 
ATOM 3253 C CG2   . VAL E 1 39  ? -18.388 30.341  -60.127 1.00 68.35  ?  37  VAL E CG2   1 
ATOM 3254 N N     . HIS E 1 40  ? -20.034 31.239  -56.054 1.00 71.20  ?  38  HIS E N     1 
ATOM 3255 C CA    . HIS E 1 40  ? -21.135 30.611  -55.340 1.00 72.71  ?  38  HIS E CA    1 
ATOM 3256 C C     . HIS E 1 40  ? -21.912 31.638  -54.528 1.00 76.29  ?  38  HIS E C     1 
ATOM 3257 O O     . HIS E 1 40  ? -23.128 31.510  -54.352 1.00 81.30  ?  38  HIS E O     1 
ATOM 3258 C CB    . HIS E 1 40  ? -20.605 29.495  -54.435 1.00 71.21  ?  38  HIS E CB    1 
ATOM 3259 C CG    . HIS E 1 40  ? -21.672 28.742  -53.706 1.00 72.92  ?  38  HIS E CG    1 
ATOM 3260 N ND1   . HIS E 1 40  ? -21.876 28.867  -52.350 1.00 74.22  ?  38  HIS E ND1   1 
ATOM 3261 C CD2   . HIS E 1 40  ? -22.589 27.848  -54.143 1.00 73.05  ?  38  HIS E CD2   1 
ATOM 3262 C CE1   . HIS E 1 40  ? -22.875 28.085  -51.983 1.00 73.73  ?  38  HIS E CE1   1 
ATOM 3263 N NE2   . HIS E 1 40  ? -23.325 27.455  -53.053 1.00 73.17  ?  38  HIS E NE2   1 
ATOM 3264 N N     . GLY E 1 41  ? -21.222 32.661  -54.034 1.00 75.89  ?  39  GLY E N     1 
ATOM 3265 C CA    . GLY E 1 41  ? -21.826 33.666  -53.188 1.00 79.25  ?  39  GLY E CA    1 
ATOM 3266 C C     . GLY E 1 41  ? -21.625 33.418  -51.714 1.00 78.02  ?  39  GLY E C     1 
ATOM 3267 O O     . GLY E 1 41  ? -22.099 34.213  -50.894 1.00 82.15  ?  39  GLY E O     1 
ATOM 3268 N N     . SER E 1 42  ? -20.924 32.347  -51.361 1.00 72.27  ?  40  SER E N     1 
ATOM 3269 C CA    . SER E 1 42  ? -20.662 31.930  -49.995 1.00 65.75  ?  40  SER E CA    1 
ATOM 3270 C C     . SER E 1 42  ? -19.590 30.858  -50.049 1.00 60.79  ?  40  SER E C     1 
ATOM 3271 O O     . SER E 1 42  ? -19.515 30.095  -51.014 1.00 57.45  ?  40  SER E O     1 
ATOM 3272 C CB    . SER E 1 42  ? -21.925 31.392  -49.313 1.00 62.38  ?  40  SER E CB    1 
ATOM 3273 N N     . GLU E 1 43  ? -18.769 30.805  -49.012 1.00 62.04  ?  41  GLU E N     1 
ATOM 3274 C CA    . GLU E 1 43  ? -17.625 29.912  -49.003 1.00 60.73  ?  41  GLU E CA    1 
ATOM 3275 C C     . GLU E 1 43  ? -17.969 28.600  -48.312 1.00 60.21  ?  41  GLU E C     1 
ATOM 3276 O O     . GLU E 1 43  ? -18.957 28.490  -47.585 1.00 61.94  ?  41  GLU E O     1 
ATOM 3277 C CB    . GLU E 1 43  ? -16.429 30.572  -48.315 1.00 62.92  ?  41  GLU E CB    1 
ATOM 3278 C CG    . GLU E 1 43  ? -16.759 31.263  -47.011 1.00 68.48  ?  41  GLU E CG    1 
ATOM 3279 C CD    . GLU E 1 43  ? -15.603 32.095  -46.493 1.00 74.27  ?  41  GLU E CD    1 
ATOM 3280 O OE1   . GLU E 1 43  ? -14.742 32.487  -47.307 1.00 75.49  ?  41  GLU E OE1   1 
ATOM 3281 O OE2   . GLU E 1 43  ? -15.559 32.366  -45.276 1.00 77.35  -1 41  GLU E OE2   1 
ATOM 3282 N N     . PHE E 1 44  ? -17.129 27.599  -48.556 1.00 59.09  ?  42  PHE E N     1 
ATOM 3283 C CA    . PHE E 1 44  ? -17.258 26.282  -47.970 1.00 58.12  ?  42  PHE E CA    1 
ATOM 3284 C C     . PHE E 1 44  ? -16.122 26.068  -46.973 1.00 56.86  ?  42  PHE E C     1 
ATOM 3285 O O     . PHE E 1 44  ? -15.477 27.028  -46.532 1.00 58.91  ?  42  PHE E O     1 
ATOM 3286 C CB    . PHE E 1 44  ? -17.282 25.226  -49.077 1.00 59.57  ?  42  PHE E CB    1 
ATOM 3287 C CG    . PHE E 1 44  ? -18.631 25.040  -49.702 1.00 62.93  ?  42  PHE E CG    1 
ATOM 3288 C CD1   . PHE E 1 44  ? -19.167 26.011  -50.523 1.00 66.46  ?  42  PHE E CD1   1 
ATOM 3289 C CD2   . PHE E 1 44  ? -19.362 23.894  -49.469 1.00 62.99  ?  42  PHE E CD2   1 
ATOM 3290 C CE1   . PHE E 1 44  ? -20.408 25.841  -51.098 1.00 67.64  ?  42  PHE E CE1   1 
ATOM 3291 C CE2   . PHE E 1 44  ? -20.603 23.722  -50.040 1.00 64.14  ?  42  PHE E CE2   1 
ATOM 3292 C CZ    . PHE E 1 44  ? -21.125 24.696  -50.856 1.00 66.08  ?  42  PHE E CZ    1 
ATOM 3293 N N     . SER E 1 45  ? -15.877 24.816  -46.618 1.00 48.31  ?  43  SER E N     1 
ATOM 3294 C CA    . SER E 1 45  ? -14.908 24.488  -45.590 1.00 43.71  ?  43  SER E CA    1 
ATOM 3295 C C     . SER E 1 45  ? -13.947 23.439  -46.114 1.00 40.55  ?  43  SER E C     1 
ATOM 3296 O O     . SER E 1 45  ? -14.268 22.682  -47.033 1.00 38.69  ?  43  SER E O     1 
ATOM 3297 C CB    . SER E 1 45  ? -15.594 23.972  -44.325 1.00 44.70  ?  43  SER E CB    1 
ATOM 3298 O OG    . SER E 1 45  ? -16.496 22.926  -44.636 1.00 45.65  ?  43  SER E OG    1 
ATOM 3299 N N     . GLN E 1 46  ? -12.753 23.413  -45.523 1.00 39.52  ?  44  GLN E N     1 
ATOM 3300 C CA    . GLN E 1 46  ? -11.773 22.402  -45.890 1.00 37.46  ?  44  GLN E CA    1 
ATOM 3301 C C     . GLN E 1 46  ? -12.322 21.003  -45.653 1.00 37.78  ?  44  GLN E C     1 
ATOM 3302 O O     . GLN E 1 46  ? -11.972 20.065  -46.378 1.00 37.36  ?  44  GLN E O     1 
ATOM 3303 C CB    . GLN E 1 46  ? -10.477 22.646  -45.116 1.00 35.58  ?  44  GLN E CB    1 
ATOM 3304 C CG    . GLN E 1 46  ? -9.510  21.487  -45.066 1.00 32.16  ?  44  GLN E CG    1 
ATOM 3305 C CD    . GLN E 1 46  ? -9.652  20.690  -43.801 1.00 28.46  ?  44  GLN E CD    1 
ATOM 3306 O OE1   . GLN E 1 46  ? -9.943  19.501  -43.833 1.00 29.42  ?  44  GLN E OE1   1 
ATOM 3307 N NE2   . GLN E 1 46  ? -9.453  21.346  -42.671 1.00 30.15  ?  44  GLN E NE2   1 
ATOM 3308 N N     . THR E 1 47  ? -13.193 20.850  -44.655 1.00 37.13  ?  45  THR E N     1 
ATOM 3309 C CA    . THR E 1 47  ? -13.867 19.577  -44.435 1.00 23.31  ?  45  THR E CA    1 
ATOM 3310 C C     . THR E 1 47  ? -14.689 19.173  -45.649 1.00 30.35  ?  45  THR E C     1 
ATOM 3311 O O     . THR E 1 47  ? -14.588 18.042  -46.135 1.00 29.73  ?  45  THR E O     1 
ATOM 3312 C CB    . THR E 1 47  ? -14.763 19.676  -43.205 1.00 23.90  ?  45  THR E CB    1 
ATOM 3313 O OG1   . THR E 1 47  ? -13.985 20.079  -42.074 1.00 60.66  ?  45  THR E OG1   1 
ATOM 3314 C CG2   . THR E 1 47  ? -15.433 18.356  -42.931 1.00 23.18  ?  45  THR E CG2   1 
ATOM 3315 N N     . THR E 1 48  ? -15.512 20.092  -46.153 1.00 30.02  ?  46  THR E N     1 
ATOM 3316 C CA    . THR E 1 48  ? -16.368 19.787  -47.293 1.00 28.07  ?  46  THR E CA    1 
ATOM 3317 C C     . THR E 1 48  ? -15.552 19.466  -48.538 1.00 28.60  ?  46  THR E C     1 
ATOM 3318 O O     . THR E 1 48  ? -15.863 18.515  -49.265 1.00 28.00  ?  46  THR E O     1 
ATOM 3319 C CB    . THR E 1 48  ? -17.310 20.955  -47.554 1.00 27.55  ?  46  THR E CB    1 
ATOM 3320 O OG1   . THR E 1 48  ? -18.181 21.116  -46.431 1.00 26.95  ?  46  THR E OG1   1 
ATOM 3321 C CG2   . THR E 1 48  ? -18.137 20.699  -48.790 1.00 27.75  ?  46  THR E CG2   1 
ATOM 3322 N N     . ILE E 1 49  ? -14.507 20.250  -48.805 1.00 28.47  ?  47  ILE E N     1 
ATOM 3323 C CA    . ILE E 1 49  ? -13.661 19.995  -49.968 1.00 28.72  ?  47  ILE E CA    1 
ATOM 3324 C C     . ILE E 1 49  ? -12.975 18.641  -49.837 1.00 30.77  ?  47  ILE E C     1 
ATOM 3325 O O     . ILE E 1 49  ? -12.925 17.856  -50.790 1.00 31.04  ?  47  ILE E O     1 
ATOM 3326 C CB    . ILE E 1 49  ? -12.639 21.130  -50.145 1.00 30.53  ?  47  ILE E CB    1 
ATOM 3327 C CG1   . ILE E 1 49  ? -13.348 22.477  -50.267 1.00 30.76  ?  47  ILE E CG1   1 
ATOM 3328 C CG2   . ILE E 1 49  ? -11.774 20.880  -51.362 1.00 32.53  ?  47  ILE E CG2   1 
ATOM 3329 C CD1   . ILE E 1 49  ? -14.384 22.520  -51.354 1.00 32.14  ?  47  ILE E CD1   1 
ATOM 3330 N N     . CYS E 1 50  ? -12.431 18.352  -48.652 1.00 31.55  ?  48  CYS E N     1 
ATOM 3331 C CA    . CYS E 1 50  ? -11.794 17.060  -48.418 1.00 33.39  ?  48  CYS E CA    1 
ATOM 3332 C C     . CYS E 1 50  ? -12.758 15.912  -48.677 1.00 33.53  ?  48  CYS E C     1 
ATOM 3333 O O     . CYS E 1 50  ? -12.380 14.894  -49.266 1.00 33.55  ?  48  CYS E O     1 
ATOM 3334 C CB    . CYS E 1 50  ? -11.252 16.996  -46.990 1.00 33.91  ?  48  CYS E CB    1 
ATOM 3335 S SG    . CYS E 1 50  ? -10.546 15.407  -46.530 1.00 35.18  ?  48  CYS E SG    1 
ATOM 3336 N N     . ARG E 1 51  ? -14.007 16.054  -48.235 1.00 33.45  ?  49  ARG E N     1 
ATOM 3337 C CA    . ARG E 1 51  ? -15.006 15.021  -48.481 1.00 34.49  ?  49  ARG E CA    1 
ATOM 3338 C C     . ARG E 1 51  ? -15.223 14.803  -49.972 1.00 38.27  ?  49  ARG E C     1 
ATOM 3339 O O     . ARG E 1 51  ? -15.448 13.671  -50.413 1.00 39.85  ?  49  ARG E O     1 
ATOM 3340 C CB    . ARG E 1 51  ? -16.323 15.393  -47.805 1.00 34.92  ?  49  ARG E CB    1 
ATOM 3341 C CG    . ARG E 1 51  ? -16.292 15.394  -46.288 1.00 38.64  ?  49  ARG E CG    1 
ATOM 3342 C CD    . ARG E 1 51  ? -17.689 15.177  -45.736 1.00 41.27  ?  49  ARG E CD    1 
ATOM 3343 N NE    . ARG E 1 51  ? -17.736 15.200  -44.279 1.00 43.25  ?  49  ARG E NE    1 
ATOM 3344 C CZ    . ARG E 1 51  ? -18.160 16.238  -43.569 1.00 44.21  ?  49  ARG E CZ    1 
ATOM 3345 N NH1   . ARG E 1 51  ? -18.576 17.334  -44.184 1.00 44.28  1  49  ARG E NH1   1 
ATOM 3346 N NH2   . ARG E 1 51  ? -18.174 16.181  -42.247 1.00 45.29  ?  49  ARG E NH2   1 
ATOM 3347 N N     . PHE E 1 52  ? -15.167 15.873  -50.764 1.00 42.07  ?  50  PHE E N     1 
ATOM 3348 C CA    . PHE E 1 52  ? -15.395 15.745  -52.200 1.00 41.66  ?  50  PHE E CA    1 
ATOM 3349 C C     . PHE E 1 52  ? -14.273 14.974  -52.880 1.00 42.29  ?  50  PHE E C     1 
ATOM 3350 O O     . PHE E 1 52  ? -14.527 14.033  -53.639 1.00 43.85  ?  50  PHE E O     1 
ATOM 3351 C CB    . PHE E 1 52  ? -15.539 17.130  -52.827 1.00 43.05  ?  50  PHE E CB    1 
ATOM 3352 C CG    . PHE E 1 52  ? -15.777 17.101  -54.305 1.00 47.78  ?  50  PHE E CG    1 
ATOM 3353 C CD1   . PHE E 1 52  ? -17.048 16.913  -54.811 1.00 49.96  ?  50  PHE E CD1   1 
ATOM 3354 C CD2   . PHE E 1 52  ? -14.727 17.261  -55.189 1.00 50.03  ?  50  PHE E CD2   1 
ATOM 3355 C CE1   . PHE E 1 52  ? -17.264 16.886  -56.169 1.00 52.40  ?  50  PHE E CE1   1 
ATOM 3356 C CE2   . PHE E 1 52  ? -14.938 17.235  -56.547 1.00 52.64  ?  50  PHE E CE2   1 
ATOM 3357 C CZ    . PHE E 1 52  ? -16.207 17.047  -57.038 1.00 53.88  ?  50  PHE E CZ    1 
ATOM 3358 N N     . GLU E 1 53  ? -13.024 15.366  -52.626 1.00 41.86  ?  51  GLU E N     1 
ATOM 3359 C CA    . GLU E 1 53  ? -11.889 14.692  -53.250 1.00 41.61  ?  51  GLU E CA    1 
ATOM 3360 C C     . GLU E 1 53  ? -11.872 13.207  -52.922 1.00 40.44  ?  51  GLU E C     1 
ATOM 3361 O O     . GLU E 1 53  ? -11.524 12.382  -53.773 1.00 44.76  ?  51  GLU E O     1 
ATOM 3362 C CB    . GLU E 1 53  ? -10.589 15.363  -52.824 1.00 44.98  ?  51  GLU E CB    1 
ATOM 3363 C CG    . GLU E 1 53  ? -10.371 16.699  -53.495 1.00 47.69  ?  51  GLU E CG    1 
ATOM 3364 C CD    . GLU E 1 53  ? -9.102  17.369  -53.049 1.00 51.55  ?  51  GLU E CD    1 
ATOM 3365 O OE1   . GLU E 1 53  ? -8.376  16.781  -52.224 1.00 53.81  ?  51  GLU E OE1   1 
ATOM 3366 O OE2   . GLU E 1 53  ? -8.826  18.489  -53.521 1.00 52.94  -1 51  GLU E OE2   1 
ATOM 3367 N N     . ASN E 1 54  ? -12.228 12.846  -51.695 1.00 28.86  ?  52  ASN E N     1 
ATOM 3368 C CA    . ASN E 1 54  ? -12.322 11.450  -51.298 1.00 32.83  ?  52  ASN E CA    1 
ATOM 3369 C C     . ASN E 1 54  ? -13.710 10.875  -51.529 1.00 33.66  ?  52  ASN E C     1 
ATOM 3370 O O     . ASN E 1 54  ? -13.961 9.727   -51.151 1.00 34.26  ?  52  ASN E O     1 
ATOM 3371 C CB    . ASN E 1 54  ? -11.929 11.288  -49.831 1.00 33.41  ?  52  ASN E CB    1 
ATOM 3372 C CG    . ASN E 1 54  ? -10.516 11.723  -49.561 1.00 32.94  ?  52  ASN E CG    1 
ATOM 3373 O OD1   . ASN E 1 54  ? -10.227 12.913  -49.489 1.00 33.78  ?  52  ASN E OD1   1 
ATOM 3374 N ND2   . ASN E 1 54  ? -9.621  10.760  -49.406 1.00 32.81  ?  52  ASN E ND2   1 
ATOM 3375 N N     . LEU E 1 55  ? -14.603 11.648  -52.147 1.00 32.97  ?  53  LEU E N     1 
ATOM 3376 C CA    . LEU E 1 55  ? -15.972 11.225  -52.437 1.00 32.59  ?  53  LEU E CA    1 
ATOM 3377 C C     . LEU E 1 55  ? -16.682 10.719  -51.186 1.00 33.08  ?  53  LEU E C     1 
ATOM 3378 O O     . LEU E 1 55  ? -17.367 9.696   -51.204 1.00 34.51  ?  53  LEU E O     1 
ATOM 3379 C CB    . LEU E 1 55  ? -15.994 10.170  -53.542 1.00 32.98  ?  53  LEU E CB    1 
ATOM 3380 C CG    . LEU E 1 55  ? -15.841 10.706  -54.967 1.00 35.38  ?  53  LEU E CG    1 
ATOM 3381 C CD1   . LEU E 1 55  ? -16.097 9.608   -55.977 1.00 38.94  ?  53  LEU E CD1   1 
ATOM 3382 C CD2   . LEU E 1 55  ? -16.762 11.884  -55.208 1.00 36.16  ?  53  LEU E CD2   1 
ATOM 3383 N N     . GLN E 1 56  ? -16.520 11.448  -50.089 1.00 31.77  ?  54  GLN E N     1 
ATOM 3384 C CA    . GLN E 1 56  ? -17.224 11.149  -48.843 1.00 32.47  ?  54  GLN E CA    1 
ATOM 3385 C C     . GLN E 1 56  ? -18.427 12.072  -48.683 1.00 31.59  ?  54  GLN E C     1 
ATOM 3386 O O     . GLN E 1 56  ? -18.527 12.863  -47.751 1.00 30.02  ?  54  GLN E O     1 
ATOM 3387 C CB    . GLN E 1 56  ? -16.274 11.266  -47.657 1.00 36.22  ?  54  GLN E CB    1 
ATOM 3388 C CG    . GLN E 1 56  ? -15.135 10.270  -47.679 1.00 39.32  ?  54  GLN E CG    1 
ATOM 3389 C CD    . GLN E 1 56  ? -14.155 10.493  -46.555 1.00 41.38  ?  54  GLN E CD    1 
ATOM 3390 O OE1   . GLN E 1 56  ? -14.191 11.521  -45.882 1.00 40.54  ?  54  GLN E OE1   1 
ATOM 3391 N NE2   . GLN E 1 56  ? -13.269 9.530   -46.343 1.00 43.89  ?  54  GLN E NE2   1 
ATOM 3392 N N     . LEU E 1 57  ? -19.350 11.949  -49.631 1.00 35.23  ?  55  LEU E N     1 
ATOM 3393 C CA    . LEU E 1 57  ? -20.620 12.658  -49.594 1.00 34.42  ?  55  LEU E CA    1 
ATOM 3394 C C     . LEU E 1 57  ? -21.670 11.812  -50.288 1.00 35.50  ?  55  LEU E C     1 
ATOM 3395 O O     . LEU E 1 57  ? -21.373 10.773  -50.880 1.00 32.80  ?  55  LEU E O     1 
ATOM 3396 C CB    . LEU E 1 57  ? -20.548 14.023  -50.285 1.00 31.27  ?  55  LEU E CB    1 
ATOM 3397 C CG    . LEU E 1 57  ? -19.444 15.023  -49.977 1.00 27.79  ?  55  LEU E CG    1 
ATOM 3398 C CD1   . LEU E 1 57  ? -19.302 15.988  -51.128 1.00 26.18  ?  55  LEU E CD1   1 
ATOM 3399 C CD2   . LEU E 1 57  ? -19.794 15.768  -48.710 1.00 28.03  ?  55  LEU E CD2   1 
ATOM 3400 N N     . SER E 1 58  ? -22.912 12.269  -50.200 1.00 39.78  ?  56  SER E N     1 
ATOM 3401 C CA    . SER E 1 58  ? -23.992 11.580  -50.876 1.00 45.82  ?  56  SER E CA    1 
ATOM 3402 C C     . SER E 1 58  ? -23.850 11.766  -52.380 1.00 48.50  ?  56  SER E C     1 
ATOM 3403 O O     . SER E 1 58  ? -23.165 12.673  -52.859 1.00 46.76  ?  56  SER E O     1 
ATOM 3404 C CB    . SER E 1 58  ? -25.347 12.097  -50.398 1.00 50.21  ?  56  SER E CB    1 
ATOM 3405 O OG    . SER E 1 58  ? -25.528 13.452  -50.760 1.00 52.11  ?  56  SER E OG    1 
ATOM 3406 N N     . PHE E 1 59  ? -24.496 10.877  -53.131 1.00 53.27  ?  57  PHE E N     1 
ATOM 3407 C CA    . PHE E 1 59  ? -24.439 10.970  -54.584 1.00 53.45  ?  57  PHE E CA    1 
ATOM 3408 C C     . PHE E 1 59  ? -24.981 12.307  -55.071 1.00 52.01  ?  57  PHE E C     1 
ATOM 3409 O O     . PHE E 1 59  ? -24.397 12.938  -55.958 1.00 54.19  ?  57  PHE E O     1 
ATOM 3410 C CB    . PHE E 1 59  ? -25.210 9.811   -55.209 1.00 55.58  ?  57  PHE E CB    1 
ATOM 3411 C CG    . PHE E 1 59  ? -25.223 9.832   -56.704 1.00 56.31  ?  57  PHE E CG    1 
ATOM 3412 C CD1   . PHE E 1 59  ? -24.079 9.529   -57.418 1.00 55.41  ?  57  PHE E CD1   1 
ATOM 3413 C CD2   . PHE E 1 59  ? -26.375 10.151  -57.395 1.00 58.88  ?  57  PHE E CD2   1 
ATOM 3414 C CE1   . PHE E 1 59  ? -24.082 9.545   -58.790 1.00 58.30  ?  57  PHE E CE1   1 
ATOM 3415 C CE2   . PHE E 1 59  ? -26.384 10.169  -58.769 1.00 61.99  ?  57  PHE E CE2   1 
ATOM 3416 C CZ    . PHE E 1 59  ? -25.234 9.865   -59.468 1.00 61.81  ?  57  PHE E CZ    1 
ATOM 3417 N N     . LYS E 1 60  ? -26.102 12.752  -54.501 1.00 47.39  ?  58  LYS E N     1 
ATOM 3418 C CA    . LYS E 1 60  ? -26.690 14.027  -54.898 1.00 47.41  ?  58  LYS E CA    1 
ATOM 3419 C C     . LYS E 1 60  ? -25.784 15.201  -54.544 1.00 45.33  ?  58  LYS E C     1 
ATOM 3420 O O     . LYS E 1 60  ? -25.605 16.118  -55.353 1.00 47.55  ?  58  LYS E O     1 
ATOM 3421 C CB    . LYS E 1 60  ? -28.057 14.186  -54.238 1.00 50.92  ?  58  LYS E CB    1 
ATOM 3422 C CG    . LYS E 1 60  ? -28.791 15.460  -54.599 1.00 53.60  ?  58  LYS E CG    1 
ATOM 3423 C CD    . LYS E 1 60  ? -29.944 15.703  -53.641 1.00 55.94  ?  58  LYS E CD    1 
ATOM 3424 C CE    . LYS E 1 60  ? -30.453 17.128  -53.740 1.00 59.87  ?  58  LYS E CE    1 
ATOM 3425 N NZ    . LYS E 1 60  ? -31.233 17.518  -52.534 1.00 62.43  1  58  LYS E NZ    1 
ATOM 3426 N N     . ASN E 1 61  ? -25.208 15.196  -53.339 1.00 42.63  ?  59  ASN E N     1 
ATOM 3427 C CA    . ASN E 1 61  ? -24.326 16.289  -52.933 1.00 41.11  ?  59  ASN E CA    1 
ATOM 3428 C C     . ASN E 1 61  ? -23.065 16.340  -53.783 1.00 39.64  ?  59  ASN E C     1 
ATOM 3429 O O     . ASN E 1 61  ? -22.556 17.426  -54.080 1.00 38.68  ?  59  ASN E O     1 
ATOM 3430 C CB    . ASN E 1 61  ? -23.962 16.158  -51.455 1.00 38.08  ?  59  ASN E CB    1 
ATOM 3431 C CG    . ASN E 1 61  ? -23.361 17.430  -50.887 1.00 33.51  ?  59  ASN E CG    1 
ATOM 3432 O OD1   . ASN E 1 61  ? -23.369 18.477  -51.530 1.00 34.47  ?  59  ASN E OD1   1 
ATOM 3433 N ND2   . ASN E 1 61  ? -22.833 17.342  -49.673 1.00 28.76  ?  59  ASN E ND2   1 
ATOM 3434 N N     . ALA E 1 62  ? -22.538 15.179  -54.171 1.00 39.65  ?  60  ALA E N     1 
ATOM 3435 C CA    . ALA E 1 62  ? -21.329 15.158  -54.985 1.00 42.02  ?  60  ALA E CA    1 
ATOM 3436 C C     . ALA E 1 62  ? -21.572 15.789  -56.348 1.00 45.09  ?  60  ALA E C     1 
ATOM 3437 O O     . ALA E 1 62  ? -20.726 16.531  -56.857 1.00 46.45  ?  60  ALA E O     1 
ATOM 3438 C CB    . ALA E 1 62  ? -20.824 13.727  -55.134 1.00 43.44  ?  60  ALA E CB    1 
ATOM 3439 N N     . CYS E 1 63  ? -22.722 15.500  -56.958 1.00 46.98  ?  61  CYS E N     1 
ATOM 3440 C CA    . CYS E 1 63  ? -23.046 16.096  -58.248 1.00 49.62  ?  61  CYS E CA    1 
ATOM 3441 C C     . CYS E 1 63  ? -23.168 17.610  -58.142 1.00 50.89  ?  61  CYS E C     1 
ATOM 3442 O O     . CYS E 1 63  ? -22.753 18.338  -59.049 1.00 51.70  ?  61  CYS E O     1 
ATOM 3443 C CB    . CYS E 1 63  ? -24.337 15.489  -58.792 1.00 49.59  ?  61  CYS E CB    1 
ATOM 3444 S SG    . CYS E 1 63  ? -24.232 13.727  -59.163 1.00 49.01  ?  61  CYS E SG    1 
ATOM 3445 N N     . LYS E 1 64  ? -23.748 18.100  -57.047 1.00 48.09  ?  62  LYS E N     1 
ATOM 3446 C CA    . LYS E 1 64  ? -23.840 19.539  -56.834 1.00 48.98  ?  62  LYS E CA    1 
ATOM 3447 C C     . LYS E 1 64  ? -22.462 20.180  -56.761 1.00 49.78  ?  62  LYS E C     1 
ATOM 3448 O O     . LYS E 1 64  ? -22.171 21.141  -57.481 1.00 52.19  ?  62  LYS E O     1 
ATOM 3449 C CB    . LYS E 1 64  ? -24.623 19.830  -55.556 1.00 45.49  ?  62  LYS E CB    1 
ATOM 3450 C CG    . LYS E 1 64  ? -24.504 21.266  -55.089 1.00 44.21  ?  62  LYS E CG    1 
ATOM 3451 C CD    . LYS E 1 64  ? -25.286 21.498  -53.812 1.00 41.04  ?  62  LYS E CD    1 
ATOM 3452 C CE    . LYS E 1 64  ? -24.990 22.866  -53.229 1.00 37.89  ?  62  LYS E CE    1 
ATOM 3453 N NZ    . LYS E 1 64  ? -25.721 23.100  -51.955 1.00 34.65  1  62  LYS E NZ    1 
ATOM 3454 N N     . LEU E 1 65  ? -21.595 19.655  -55.894 1.00 46.92  ?  63  LEU E N     1 
ATOM 3455 C CA    . LEU E 1 65  ? -20.298 20.283  -55.665 1.00 44.92  ?  63  LEU E CA    1 
ATOM 3456 C C     . LEU E 1 65  ? -19.408 20.210  -56.897 1.00 44.61  ?  63  LEU E C     1 
ATOM 3457 O O     . LEU E 1 65  ? -18.660 21.151  -57.178 1.00 45.80  ?  63  LEU E O     1 
ATOM 3458 C CB    . LEU E 1 65  ? -19.612 19.637  -54.466 1.00 41.51  ?  63  LEU E CB    1 
ATOM 3459 C CG    . LEU E 1 65  ? -19.987 20.297  -53.143 1.00 42.54  ?  63  LEU E CG    1 
ATOM 3460 C CD1   . LEU E 1 65  ? -19.452 19.499  -51.979 1.00 42.45  ?  63  LEU E CD1   1 
ATOM 3461 C CD2   . LEU E 1 65  ? -19.460 21.716  -53.110 1.00 44.07  ?  63  LEU E CD2   1 
ATOM 3462 N N     . LYS E 1 66  ? -19.462 19.102  -57.637 1.00 44.37  ?  64  LYS E N     1 
ATOM 3463 C CA    . LYS E 1 66  ? -18.680 19.013  -58.865 1.00 45.95  ?  64  LYS E CA    1 
ATOM 3464 C C     . LYS E 1 66  ? -19.049 20.133  -59.827 1.00 50.94  ?  64  LYS E C     1 
ATOM 3465 O O     . LYS E 1 66  ? -18.180 20.688  -60.506 1.00 55.51  ?  64  LYS E O     1 
ATOM 3466 C CB    . LYS E 1 66  ? -18.880 17.648  -59.522 1.00 31.28  ?  64  LYS E CB    1 
ATOM 3467 C CG    . LYS E 1 66  ? -18.373 17.570  -60.948 1.00 34.12  ?  64  LYS E CG    1 
ATOM 3468 C CD    . LYS E 1 66  ? -18.943 16.368  -61.671 1.00 38.76  ?  64  LYS E CD    1 
ATOM 3469 C CE    . LYS E 1 66  ? -18.872 16.546  -63.176 1.00 39.37  ?  64  LYS E CE    1 
ATOM 3470 N NZ    . LYS E 1 66  ? -19.634 15.489  -63.896 1.00 41.96  1  64  LYS E NZ    1 
ATOM 3471 N N     . ALA E 1 67  ? -20.330 20.499  -59.875 1.00 50.79  ?  65  ALA E N     1 
ATOM 3472 C CA    . ALA E 1 67  ? -20.752 21.606  -60.725 1.00 52.09  ?  65  ALA E CA    1 
ATOM 3473 C C     . ALA E 1 67  ? -20.181 22.923  -60.224 1.00 49.70  ?  65  ALA E C     1 
ATOM 3474 O O     . ALA E 1 67  ? -19.678 23.734  -61.009 1.00 52.65  ?  65  ALA E O     1 
ATOM 3475 C CB    . ALA E 1 67  ? -22.276 21.666  -60.789 1.00 40.33  ?  65  ALA E CB    1 
ATOM 3476 N N     . ILE E 1 68  ? -20.270 23.163  -58.916 1.00 45.52  ?  66  ILE E N     1 
ATOM 3477 C CA    . ILE E 1 68  ? -19.720 24.388  -58.345 1.00 48.09  ?  66  ILE E CA    1 
ATOM 3478 C C     . ILE E 1 68  ? -18.209 24.426  -58.520 1.00 51.14  ?  66  ILE E C     1 
ATOM 3479 O O     . ILE E 1 68  ? -17.633 25.464  -58.865 1.00 55.21  ?  66  ILE E O     1 
ATOM 3480 C CB    . ILE E 1 68  ? -20.115 24.514  -56.864 1.00 45.38  ?  66  ILE E CB    1 
ATOM 3481 C CG1   . ILE E 1 68  ? -21.585 24.153  -56.662 1.00 46.03  ?  66  ILE E CG1   1 
ATOM 3482 C CG2   . ILE E 1 68  ? -19.853 25.920  -56.374 1.00 46.70  ?  66  ILE E CG2   1 
ATOM 3483 C CD1   . ILE E 1 68  ? -22.543 25.069  -57.376 1.00 51.72  ?  66  ILE E CD1   1 
ATOM 3484 N N     . LEU E 1 69  ? -17.541 23.299  -58.276 1.00 49.48  ?  67  LEU E N     1 
ATOM 3485 C CA    . LEU E 1 69  ? -16.083 23.280  -58.302 1.00 50.14  ?  67  LEU E CA    1 
ATOM 3486 C C     . LEU E 1 69  ? -15.534 23.329  -59.723 1.00 56.89  ?  67  LEU E C     1 
ATOM 3487 O O     . LEU E 1 69  ? -14.491 23.946  -59.961 1.00 59.52  ?  67  LEU E O     1 
ATOM 3488 C CB    . LEU E 1 69  ? -15.566 22.043  -57.570 1.00 44.86  ?  67  LEU E CB    1 
ATOM 3489 C CG    . LEU E 1 69  ? -15.599 22.118  -56.043 1.00 40.36  ?  67  LEU E CG    1 
ATOM 3490 C CD1   . LEU E 1 69  ? -15.251 20.780  -55.425 1.00 35.63  ?  67  LEU E CD1   1 
ATOM 3491 C CD2   . LEU E 1 69  ? -14.658 23.194  -55.545 1.00 41.89  ?  67  LEU E CD2   1 
ATOM 3492 N N     . SER E 1 70  ? -16.217 22.695  -60.681 1.00 60.37  ?  68  SER E N     1 
ATOM 3493 C CA    . SER E 1 70  ? -15.735 22.715  -62.059 1.00 66.33  ?  68  SER E CA    1 
ATOM 3494 C C     . SER E 1 70  ? -15.752 24.126  -62.627 1.00 72.03  ?  68  SER E C     1 
ATOM 3495 O O     . SER E 1 70  ? -14.816 24.533  -63.324 1.00 78.85  ?  68  SER E O     1 
ATOM 3496 C CB    . SER E 1 70  ? -16.573 21.785  -62.932 1.00 43.10  ?  68  SER E CB    1 
ATOM 3497 O OG    . SER E 1 70  ? -17.873 22.309  -63.112 1.00 69.64  ?  68  SER E OG    1 
ATOM 3498 N N     . LYS E 1 71  ? -16.813 24.886  -62.346 1.00 68.11  ?  69  LYS E N     1 
ATOM 3499 C CA    . LYS E 1 71  ? -16.861 26.274  -62.790 1.00 71.17  ?  69  LYS E CA    1 
ATOM 3500 C C     . LYS E 1 71  ? -15.764 27.103  -62.140 1.00 70.99  ?  69  LYS E C     1 
ATOM 3501 O O     . LYS E 1 71  ? -15.236 28.031  -62.762 1.00 75.97  ?  69  LYS E O     1 
ATOM 3502 C CB    . LYS E 1 71  ? -18.233 26.874  -62.487 1.00 70.81  ?  69  LYS E CB    1 
ATOM 3503 N N     . TRP E 1 72  ? -15.412 26.795  -60.892 1.00 66.32  ?  70  TRP E N     1 
ATOM 3504 C CA    . TRP E 1 72  ? -14.335 27.524  -60.234 1.00 66.48  ?  70  TRP E CA    1 
ATOM 3505 C C     . TRP E 1 72  ? -12.976 27.127  -60.792 1.00 67.46  ?  70  TRP E C     1 
ATOM 3506 O O     . TRP E 1 72  ? -12.118 27.988  -61.018 1.00 70.29  ?  70  TRP E O     1 
ATOM 3507 C CB    . TRP E 1 72  ? -14.377 27.292  -58.726 1.00 62.86  ?  70  TRP E CB    1 
ATOM 3508 C CG    . TRP E 1 72  ? -13.201 27.876  -58.016 1.00 64.36  ?  70  TRP E CG    1 
ATOM 3509 C CD1   . TRP E 1 72  ? -13.089 29.139  -57.523 1.00 67.58  ?  70  TRP E CD1   1 
ATOM 3510 C CD2   . TRP E 1 72  ? -11.964 27.217  -57.719 1.00 63.10  ?  70  TRP E CD2   1 
ATOM 3511 N NE1   . TRP E 1 72  ? -11.860 29.310  -56.936 1.00 67.75  ?  70  TRP E NE1   1 
ATOM 3512 C CE2   . TRP E 1 72  ? -11.151 28.144  -57.044 1.00 64.33  ?  70  TRP E CE2   1 
ATOM 3513 C CE3   . TRP E 1 72  ? -11.467 25.934  -57.959 1.00 60.83  ?  70  TRP E CE3   1 
ATOM 3514 C CZ2   . TRP E 1 72  ? -9.871  27.830  -56.607 1.00 62.76  ?  70  TRP E CZ2   1 
ATOM 3515 C CZ3   . TRP E 1 72  ? -10.197 25.625  -57.525 1.00 58.88  ?  70  TRP E CZ3   1 
ATOM 3516 C CH2   . TRP E 1 72  ? -9.413  26.568  -56.857 1.00 60.39  ?  70  TRP E CH2   1 
ATOM 3517 N N     . LEU E 1 73  ? -12.750 25.826  -60.991 1.00 68.15  ?  71  LEU E N     1 
ATOM 3518 C CA    . LEU E 1 73  ? -11.467 25.365  -61.509 1.00 71.61  ?  71  LEU E CA    1 
ATOM 3519 C C     . LEU E 1 73  ? -11.140 26.042  -62.832 1.00 78.00  ?  71  LEU E C     1 
ATOM 3520 O O     . LEU E 1 73  ? -10.034 26.558  -63.021 1.00 85.73  ?  71  LEU E O     1 
ATOM 3521 C CB    . LEU E 1 73  ? -11.480 23.848  -61.670 1.00 43.08  ?  71  LEU E CB    1 
ATOM 3522 C CG    . LEU E 1 73  ? -10.163 23.237  -62.142 1.00 43.80  ?  71  LEU E CG    1 
ATOM 3523 C CD1   . LEU E 1 73  ? -9.048  23.600  -61.186 1.00 43.40  ?  71  LEU E CD1   1 
ATOM 3524 C CD2   . LEU E 1 73  ? -10.289 21.735  -62.269 1.00 41.99  ?  71  LEU E CD2   1 
ATOM 3525 N N     . GLU E 1 74  ? -12.097 26.044  -63.762 1.00 73.56  ?  72  GLU E N     1 
ATOM 3526 C CA    . GLU E 1 74  ? -11.933 26.784  -65.008 1.00 80.02  ?  72  GLU E CA    1 
ATOM 3527 C C     . GLU E 1 74  ? -11.580 28.239  -64.730 1.00 80.87  ?  72  GLU E C     1 
ATOM 3528 O O     . GLU E 1 74  ? -10.632 28.785  -65.303 1.00 85.03  ?  72  GLU E O     1 
ATOM 3529 C CB    . GLU E 1 74  ? -13.209 26.689  -65.846 1.00 84.71  ?  72  GLU E CB    1 
ATOM 3530 C CG    . GLU E 1 74  ? -13.540 25.283  -66.319 1.00 86.35  ?  72  GLU E CG    1 
ATOM 3531 C CD    . GLU E 1 74  ? -14.864 25.208  -67.057 1.00 90.98  ?  72  GLU E CD    1 
ATOM 3532 O OE1   . GLU E 1 74  ? -15.496 26.265  -67.258 1.00 94.74  ?  72  GLU E OE1   1 
ATOM 3533 O OE2   . GLU E 1 74  ? -15.274 24.090  -67.433 1.00 90.69  -1 72  GLU E OE2   1 
ATOM 3534 N N     . GLU E 1 75  ? -12.336 28.880  -63.839 1.00 77.49  ?  73  GLU E N     1 
ATOM 3535 C CA    . GLU E 1 75  ? -12.098 30.284  -63.538 1.00 82.65  ?  73  GLU E CA    1 
ATOM 3536 C C     . GLU E 1 75  ? -10.759 30.502  -62.850 1.00 83.28  ?  73  GLU E C     1 
ATOM 3537 O O     . GLU E 1 75  ? -10.193 31.596  -62.938 1.00 88.14  ?  73  GLU E O     1 
ATOM 3538 C CB    . GLU E 1 75  ? -13.224 30.824  -62.656 1.00 83.30  ?  73  GLU E CB    1 
ATOM 3539 C CG    . GLU E 1 75  ? -13.311 32.336  -62.605 1.00 88.76  ?  73  GLU E CG    1 
ATOM 3540 C CD    . GLU E 1 75  ? -14.392 32.823  -61.667 1.00 85.84  ?  73  GLU E CD    1 
ATOM 3541 O OE1   . GLU E 1 75  ? -15.576 32.516  -61.907 1.00 84.58  ?  73  GLU E OE1   1 
ATOM 3542 O OE2   . GLU E 1 75  ? -14.053 33.512  -60.683 1.00 84.63  -1 73  GLU E OE2   1 
ATOM 3543 N N     . ALA E 1 76  ? -10.227 29.483  -62.174 1.00 60.19  ?  74  ALA E N     1 
ATOM 3544 C CA    . ALA E 1 76  ? -8.966  29.616  -61.457 1.00 63.86  ?  74  ALA E CA    1 
ATOM 3545 C C     . ALA E 1 76  ? -7.780  29.061  -62.237 1.00 64.28  ?  74  ALA E C     1 
ATOM 3546 O O     . ALA E 1 76  ? -6.822  28.571  -61.633 1.00 63.11  ?  74  ALA E O     1 
ATOM 3547 C CB    . ALA E 1 76  ? -9.058  28.939  -60.091 1.00 64.37  ?  74  ALA E CB    1 
ATOM 3548 N N     . GLU E 1 77  ? -7.811  29.141  -63.566 1.00 65.57  ?  75  GLU E N     1 
ATOM 3549 C CA    . GLU E 1 77  ? -6.654  28.777  -64.379 1.00 66.05  ?  75  GLU E CA    1 
ATOM 3550 C C     . GLU E 1 77  ? -6.049  30.067  -64.919 1.00 66.54  ?  75  GLU E C     1 
ATOM 3551 O O     . GLU E 1 77  ? -6.336  30.512  -66.028 1.00 66.38  ?  75  GLU E O     1 
ATOM 3552 C CB    . GLU E 1 77  ? -7.049  27.818  -65.495 1.00 66.14  ?  75  GLU E CB    1 
ATOM 3553 C CG    . GLU E 1 77  ? -7.613  26.497  -65.012 1.00 65.24  ?  75  GLU E CG    1 
ATOM 3554 C CD    . GLU E 1 77  ? -6.539  25.471  -64.724 1.00 65.43  ?  75  GLU E CD    1 
ATOM 3555 O OE1   . GLU E 1 77  ? -5.348  25.839  -64.706 1.00 65.97  ?  75  GLU E OE1   1 
ATOM 3556 O OE2   . GLU E 1 77  ? -6.886  24.290  -64.519 1.00 65.37  -1 75  GLU E OE2   1 
ATOM 3557 N N     . GLN E 1 78  ? -5.183  30.664  -64.110 1.00 66.80  ?  76  GLN E N     1 
ATOM 3558 C CA    . GLN E 1 78  ? -4.541  31.921  -64.460 1.00 66.03  ?  76  GLN E CA    1 
ATOM 3559 C C     . GLN E 1 78  ? -3.028  31.771  -64.445 1.00 63.19  ?  76  GLN E C     1 
ATOM 3560 O O     . GLN E 1 78  ? -2.455  31.315  -63.458 1.00 60.55  ?  76  GLN E O     1 
ATOM 3561 C CB    . GLN E 1 78  ? -4.981  33.031  -63.509 1.00 66.54  ?  76  GLN E CB    1 
ATOM 3562 C CG    . GLN E 1 78  ? -6.484  33.256  -63.484 1.00 67.61  ?  76  GLN E CG    1 
ATOM 3563 C CD    . GLN E 1 78  ? -7.079  33.386  -64.876 1.00 69.12  ?  76  GLN E CD    1 
ATOM 3564 O OE1   . GLN E 1 78  ? -7.939  32.601  -65.272 1.00 68.16  ?  76  GLN E OE1   1 
ATOM 3565 N NE2   . GLN E 1 78  ? -6.624  34.383  -65.624 1.00 70.79  ?  76  GLN E NE2   1 
ATOM 3566 N N     . LYS E 1 95  ? -18.014 25.261  -29.447 1.00 72.23  ?  93  LYS E N     1 
ATOM 3567 C CA    . LYS E 1 95  ? -17.789 24.792  -28.086 1.00 74.36  ?  93  LYS E CA    1 
ATOM 3568 C C     . LYS E 1 95  ? -16.631 23.805  -28.036 1.00 75.34  ?  93  LYS E C     1 
ATOM 3569 O O     . LYS E 1 95  ? -15.495 24.155  -28.346 1.00 77.17  ?  93  LYS E O     1 
ATOM 3570 C CB    . LYS E 1 95  ? -19.056 24.147  -27.523 1.00 73.96  ?  93  LYS E CB    1 
ATOM 3571 N N     . ARG E 1 96  ? -16.924 22.571  -27.638 1.00 74.54  ?  94  ARG E N     1 
ATOM 3572 C CA    . ARG E 1 96  ? -15.907 21.533  -27.554 1.00 75.34  ?  94  ARG E CA    1 
ATOM 3573 C C     . ARG E 1 96  ? -16.570 20.178  -27.736 1.00 79.49  ?  94  ARG E C     1 
ATOM 3574 O O     . ARG E 1 96  ? -17.711 19.965  -27.320 1.00 81.44  ?  94  ARG E O     1 
ATOM 3575 C CB    . ARG E 1 96  ? -15.153 21.580  -26.221 1.00 73.94  ?  94  ARG E CB    1 
ATOM 3576 C CG    . ARG E 1 96  ? -13.831 22.326  -26.279 1.00 73.36  ?  94  ARG E CG    1 
ATOM 3577 N N     . ARG E 1 97  ? -15.836 19.268  -28.368 1.00 78.98  ?  95  ARG E N     1 
ATOM 3578 C CA    . ARG E 1 97  ? -16.308 17.915  -28.596 1.00 74.12  ?  95  ARG E CA    1 
ATOM 3579 C C     . ARG E 1 97  ? -16.065 17.051  -27.362 1.00 74.17  ?  95  ARG E C     1 
ATOM 3580 O O     . ARG E 1 97  ? -15.193 17.329  -26.537 1.00 73.74  ?  95  ARG E O     1 
ATOM 3581 C CB    . ARG E 1 97  ? -15.620 17.298  -29.815 1.00 70.85  ?  95  ARG E CB    1 
ATOM 3582 C CG    . ARG E 1 97  ? -15.963 17.976  -31.130 1.00 69.51  ?  95  ARG E CG    1 
ATOM 3583 C CD    . ARG E 1 97  ? -15.842 17.023  -32.311 1.00 69.72  ?  95  ARG E CD    1 
ATOM 3584 N NE    . ARG E 1 97  ? -14.467 16.770  -32.733 1.00 70.55  ?  95  ARG E NE    1 
ATOM 3585 C CZ    . ARG E 1 97  ? -13.849 15.601  -32.595 1.00 71.09  ?  95  ARG E CZ    1 
ATOM 3586 N NH1   . ARG E 1 97  ? -14.479 14.578  -32.042 1.00 72.84  1  95  ARG E NH1   1 
ATOM 3587 N NH2   . ARG E 1 97  ? -12.602 15.450  -33.012 1.00 69.89  ?  95  ARG E NH2   1 
ATOM 3588 N N     . THR E 1 98  ? -16.859 15.994  -27.242 1.00 73.56  ?  96  THR E N     1 
ATOM 3589 C CA    . THR E 1 98  ? -16.703 15.007  -26.184 1.00 77.86  ?  96  THR E CA    1 
ATOM 3590 C C     . THR E 1 98  ? -16.098 13.756  -26.799 1.00 82.56  ?  96  THR E C     1 
ATOM 3591 O O     . THR E 1 98  ? -16.648 13.201  -27.755 1.00 87.90  ?  96  THR E O     1 
ATOM 3592 C CB    . THR E 1 98  ? -18.039 14.677  -25.519 1.00 76.67  ?  96  THR E CB    1 
ATOM 3593 O OG1   . THR E 1 98  ? -18.674 13.608  -26.228 1.00 73.56  ?  96  THR E OG1   1 
ATOM 3594 C CG2   . THR E 1 98  ? -18.943 15.893  -25.526 1.00 78.19  ?  96  THR E CG2   1 
ATOM 3595 N N     . THR E 1 99  ? -14.970 13.313  -26.251 1.00 81.11  ?  97  THR E N     1 
ATOM 3596 C CA    . THR E 1 99  ? -14.240 12.206  -26.846 1.00 82.94  ?  97  THR E CA    1 
ATOM 3597 C C     . THR E 1 99  ? -14.826 10.873  -26.406 1.00 82.78  ?  97  THR E C     1 
ATOM 3598 O O     . THR E 1 99  ? -15.060 10.645  -25.215 1.00 82.40  ?  97  THR E O     1 
ATOM 3599 C CB    . THR E 1 99  ? -12.766 12.280  -26.444 1.00 85.17  ?  97  THR E CB    1 
ATOM 3600 O OG1   . THR E 1 99  ? -12.362 13.652  -26.346 1.00 84.96  ?  97  THR E OG1   1 
ATOM 3601 C CG2   . THR E 1 99  ? -11.893 11.576  -27.473 1.00 85.95  ?  97  THR E CG2   1 
ATOM 3602 N N     . ILE E 1 100 ? -15.072 9.999   -27.375 1.00 74.19  ?  98  ILE E N     1 
ATOM 3603 C CA    . ILE E 1 100 ? -15.607 8.668   -27.130 1.00 68.63  ?  98  ILE E CA    1 
ATOM 3604 C C     . ILE E 1 100 ? -14.441 7.698   -27.015 1.00 65.45  ?  98  ILE E C     1 
ATOM 3605 O O     . ILE E 1 100 ? -13.505 7.748   -27.822 1.00 73.04  ?  98  ILE E O     1 
ATOM 3606 C CB    . ILE E 1 100 ? -16.577 8.250   -28.249 1.00 67.95  ?  98  ILE E CB    1 
ATOM 3607 C CG1   . ILE E 1 100 ? -17.854 9.087   -28.182 1.00 69.46  ?  98  ILE E CG1   1 
ATOM 3608 C CG2   . ILE E 1 100 ? -16.900 6.777   -28.167 1.00 67.17  ?  98  ILE E CG2   1 
ATOM 3609 C CD1   . ILE E 1 100 ? -18.875 8.731   -29.229 1.00 31.52  ?  98  ILE E CD1   1 
ATOM 3610 N N     . SER E 1 101 ? -14.485 6.826   -26.013 1.00 54.12  ?  99  SER E N     1 
ATOM 3611 C CA    . SER E 1 101 ? -13.413 5.860   -25.825 1.00 53.03  ?  99  SER E CA    1 
ATOM 3612 C C     . SER E 1 101 ? -13.338 4.917   -27.017 1.00 52.18  ?  99  SER E C     1 
ATOM 3613 O O     . SER E 1 101 ? -14.328 4.683   -27.713 1.00 53.69  ?  99  SER E O     1 
ATOM 3614 C CB    . SER E 1 101 ? -13.626 5.062   -24.540 1.00 53.99  ?  99  SER E CB    1 
ATOM 3615 O OG    . SER E 1 101 ? -14.771 4.238   -24.632 1.00 54.05  ?  99  SER E OG    1 
ATOM 3616 N N     . ILE E 1 102 ? -12.140 4.385   -27.263 1.00 46.90  ?  100 ILE E N     1 
ATOM 3617 C CA    . ILE E 1 102 ? -11.967 3.433   -28.356 1.00 46.30  ?  100 ILE E CA    1 
ATOM 3618 C C     . ILE E 1 102 ? -12.829 2.202   -28.121 1.00 50.59  ?  100 ILE E C     1 
ATOM 3619 O O     . ILE E 1 102 ? -13.380 1.619   -29.062 1.00 52.79  ?  100 ILE E O     1 
ATOM 3620 C CB    . ILE E 1 102 ? -10.482 3.063   -28.507 1.00 48.80  ?  100 ILE E CB    1 
ATOM 3621 C CG1   . ILE E 1 102 ? -9.644  4.309   -28.792 1.00 46.63  ?  100 ILE E CG1   1 
ATOM 3622 C CG2   . ILE E 1 102 ? -10.298 2.040   -29.610 1.00 51.51  ?  100 ILE E CG2   1 
ATOM 3623 C CD1   . ILE E 1 102 ? -9.938  4.953   -30.127 1.00 43.20  ?  100 ILE E CD1   1 
ATOM 3624 N N     . ALA E 1 103 ? -12.974 1.799   -26.856 1.00 53.57  ?  101 ALA E N     1 
ATOM 3625 C CA    . ALA E 1 103 ? -13.788 0.634   -26.530 1.00 55.75  ?  101 ALA E CA    1 
ATOM 3626 C C     . ALA E 1 103 ? -15.262 0.899   -26.798 1.00 54.15  ?  101 ALA E C     1 
ATOM 3627 O O     . ALA E 1 103 ? -15.991 -0.004  -27.222 1.00 56.06  ?  101 ALA E O     1 
ATOM 3628 C CB    . ALA E 1 103 ? -13.570 0.234   -25.073 1.00 58.89  ?  101 ALA E CB    1 
ATOM 3629 N N     . ALA E 1 104 ? -15.720 2.128   -26.555 1.00 50.09  ?  102 ALA E N     1 
ATOM 3630 C CA    . ALA E 1 104 ? -17.109 2.460   -26.849 1.00 53.06  ?  102 ALA E CA    1 
ATOM 3631 C C     . ALA E 1 104 ? -17.363 2.441   -28.349 1.00 53.33  ?  102 ALA E C     1 
ATOM 3632 O O     . ALA E 1 104 ? -18.428 2.003   -28.797 1.00 55.40  ?  102 ALA E O     1 
ATOM 3633 C CB    . ALA E 1 104 ? -17.467 3.818   -26.256 1.00 52.62  ?  102 ALA E CB    1 
ATOM 3634 N N     . LYS E 1 105 ? -16.399 2.923   -29.137 1.00 50.64  ?  103 LYS E N     1 
ATOM 3635 C CA    . LYS E 1 105 ? -16.549 2.897   -30.587 1.00 48.63  ?  103 LYS E CA    1 
ATOM 3636 C C     . LYS E 1 105 ? -16.693 1.467   -31.083 1.00 54.21  ?  103 LYS E C     1 
ATOM 3637 O O     . LYS E 1 105 ? -17.538 1.178   -31.937 1.00 54.23  ?  103 LYS E O     1 
ATOM 3638 C CB    . LYS E 1 105 ? -15.348 3.565   -31.253 1.00 44.01  ?  103 LYS E CB    1 
ATOM 3639 C CG    . LYS E 1 105 ? -15.157 5.033   -30.923 1.00 39.86  ?  103 LYS E CG    1 
ATOM 3640 C CD    . LYS E 1 105 ? -14.082 5.635   -31.810 1.00 37.39  ?  103 LYS E CD    1 
ATOM 3641 C CE    . LYS E 1 105 ? -13.740 7.054   -31.406 1.00 33.89  ?  103 LYS E CE    1 
ATOM 3642 N NZ    . LYS E 1 105 ? -12.809 7.685   -32.380 1.00 32.43  1  103 LYS E NZ    1 
ATOM 3643 N N     . ASP E 1 106 ? -15.869 0.556   -30.559 1.00 60.06  ?  104 ASP E N     1 
ATOM 3644 C CA    . ASP E 1 106 ? -15.987 -0.848  -30.932 1.00 66.78  ?  104 ASP E CA    1 
ATOM 3645 C C     . ASP E 1 106 ? -17.304 -1.442  -30.457 1.00 69.64  ?  104 ASP E C     1 
ATOM 3646 O O     . ASP E 1 106 ? -17.866 -2.314  -31.126 1.00 72.89  ?  104 ASP E O     1 
ATOM 3647 C CB    . ASP E 1 106 ? -14.820 -1.649  -30.355 1.00 73.78  ?  104 ASP E CB    1 
ATOM 3648 C CG    . ASP E 1 106 ? -13.516 -1.383  -31.072 1.00 80.84  ?  104 ASP E CG    1 
ATOM 3649 O OD1   . ASP E 1 106 ? -13.552 -0.897  -32.220 1.00 83.15  ?  104 ASP E OD1   1 
ATOM 3650 O OD2   . ASP E 1 106 ? -12.451 -1.668  -30.489 1.00 86.15  -1 104 ASP E OD2   1 
ATOM 3651 N N     . ALA E 1 107 ? -17.805 -0.993  -29.306 1.00 67.09  ?  105 ALA E N     1 
ATOM 3652 C CA    . ALA E 1 107 ? -19.099 -1.466  -28.829 1.00 68.92  ?  105 ALA E CA    1 
ATOM 3653 C C     . ALA E 1 107 ? -20.238 -0.918  -29.679 1.00 65.10  ?  105 ALA E C     1 
ATOM 3654 O O     . ALA E 1 107 ? -21.110 -1.673  -30.126 1.00 67.00  ?  105 ALA E O     1 
ATOM 3655 C CB    . ALA E 1 107 ? -19.288 -1.083  -27.362 1.00 70.83  ?  105 ALA E CB    1 
ATOM 3656 N N     . LEU E 1 108 ? -20.244 0.396   -29.917 1.00 59.47  ?  106 LEU E N     1 
ATOM 3657 C CA    . LEU E 1 108 ? -21.295 1.004   -30.729 1.00 55.63  ?  106 LEU E CA    1 
ATOM 3658 C C     . LEU E 1 108 ? -21.321 0.427   -32.137 1.00 55.89  ?  106 LEU E C     1 
ATOM 3659 O O     . LEU E 1 108 ? -22.388 0.090   -32.661 1.00 60.44  ?  106 LEU E O     1 
ATOM 3660 C CB    . LEU E 1 108 ? -21.114 2.520   -30.773 1.00 48.63  ?  106 LEU E CB    1 
ATOM 3661 C CG    . LEU E 1 108 ? -21.396 3.261   -29.471 1.00 46.66  ?  106 LEU E CG    1 
ATOM 3662 C CD1   . LEU E 1 108 ? -20.899 4.687   -29.541 1.00 42.29  ?  106 LEU E CD1   1 
ATOM 3663 C CD2   . LEU E 1 108 ? -22.883 3.239   -29.203 1.00 48.71  ?  106 LEU E CD2   1 
ATOM 3664 N N     . GLU E 1 109 ? -20.154 0.306   -32.769 1.00 50.63  ?  107 GLU E N     1 
ATOM 3665 C CA    . GLU E 1 109 ? -20.109 -0.294  -34.097 1.00 48.94  ?  107 GLU E CA    1 
ATOM 3666 C C     . GLU E 1 109 ? -20.574 -1.743  -34.069 1.00 51.49  ?  107 GLU E C     1 
ATOM 3667 O O     . GLU E 1 109 ? -21.156 -2.227  -35.045 1.00 51.74  ?  107 GLU E O     1 
ATOM 3668 C CB    . GLU E 1 109 ? -18.699 -0.187  -34.676 1.00 47.75  ?  107 GLU E CB    1 
ATOM 3669 C CG    . GLU E 1 109 ? -18.561 -0.749  -36.080 1.00 50.43  ?  107 GLU E CG    1 
ATOM 3670 C CD    . GLU E 1 109 ? -19.381 0.012   -37.102 1.00 51.50  ?  107 GLU E CD    1 
ATOM 3671 O OE1   . GLU E 1 109 ? -19.739 1.179   -36.841 1.00 49.83  ?  107 GLU E OE1   1 
ATOM 3672 O OE2   . GLU E 1 109 ? -19.678 -0.560  -38.172 1.00 52.63  -1 107 GLU E OE2   1 
ATOM 3673 N N     . ARG E 1 110 ? -20.335 -2.449  -32.963 1.00 55.27  ?  108 ARG E N     1 
ATOM 3674 C CA    . ARG E 1 110 ? -20.847 -3.808  -32.835 1.00 62.31  ?  108 ARG E CA    1 
ATOM 3675 C C     . ARG E 1 110 ? -22.365 -3.809  -32.718 1.00 65.71  ?  108 ARG E C     1 
ATOM 3676 O O     . ARG E 1 110 ? -23.040 -4.652  -33.317 1.00 69.98  ?  108 ARG E O     1 
ATOM 3677 C CB    . ARG E 1 110 ? -20.208 -4.500  -31.632 1.00 66.34  ?  108 ARG E CB    1 
ATOM 3678 C CG    . ARG E 1 110 ? -20.216 -6.019  -31.713 1.00 73.82  ?  108 ARG E CG    1 
ATOM 3679 C CD    . ARG E 1 110 ? -21.065 -6.641  -30.617 1.00 80.15  ?  108 ARG E CD    1 
ATOM 3680 N NE    . ARG E 1 110 ? -20.856 -5.991  -29.329 1.00 81.03  ?  108 ARG E NE    1 
ATOM 3681 C CZ    . ARG E 1 110 ? -21.608 -6.204  -28.256 1.00 84.78  ?  108 ARG E CZ    1 
ATOM 3682 N NH1   . ARG E 1 110 ? -22.617 -7.059  -28.313 1.00 88.79  1  108 ARG E NH1   1 
ATOM 3683 N NH2   . ARG E 1 110 ? -21.347 -5.566  -27.125 1.00 84.22  ?  108 ARG E NH2   1 
ATOM 3684 N N     . HIS E 1 111 ? -22.917 -2.872  -31.945 1.00 63.74  ?  109 HIS E N     1 
ATOM 3685 C CA    . HIS E 1 111 ? -24.366 -2.733  -31.865 1.00 64.36  ?  109 HIS E CA    1 
ATOM 3686 C C     . HIS E 1 111 ? -24.969 -2.275  -33.186 1.00 64.99  ?  109 HIS E C     1 
ATOM 3687 O O     . HIS E 1 111 ? -26.119 -2.614  -33.486 1.00 68.02  ?  109 HIS E O     1 
ATOM 3688 C CB    . HIS E 1 111 ? -24.735 -1.763  -30.747 1.00 60.09  ?  109 HIS E CB    1 
ATOM 3689 C CG    . HIS E 1 111 ? -24.693 -2.375  -29.384 1.00 60.16  ?  109 HIS E CG    1 
ATOM 3690 N ND1   . HIS E 1 111 ? -24.841 -1.637  -28.231 1.00 58.40  ?  109 HIS E ND1   1 
ATOM 3691 C CD2   . HIS E 1 111 ? -24.539 -3.661  -28.992 1.00 63.21  ?  109 HIS E CD2   1 
ATOM 3692 C CE1   . HIS E 1 111 ? -24.767 -2.440  -27.185 1.00 61.36  ?  109 HIS E CE1   1 
ATOM 3693 N NE2   . HIS E 1 111 ? -24.586 -3.674  -27.620 1.00 64.81  ?  109 HIS E NE2   1 
ATOM 3694 N N     . PHE E 1 112 ? -24.223 -1.509  -33.986 1.00 62.86  ?  110 PHE E N     1 
ATOM 3695 C CA    . PHE E 1 112 ? -24.772 -1.043  -35.254 1.00 64.15  ?  110 PHE E CA    1 
ATOM 3696 C C     . PHE E 1 112 ? -24.946 -2.190  -36.235 1.00 68.86  ?  110 PHE E C     1 
ATOM 3697 O O     . PHE E 1 112 ? -25.854 -2.157  -37.072 1.00 70.71  ?  110 PHE E O     1 
ATOM 3698 C CB    . PHE E 1 112 ? -23.885 0.039   -35.862 1.00 59.38  ?  110 PHE E CB    1 
ATOM 3699 C CG    . PHE E 1 112 ? -24.452 0.646   -37.108 1.00 60.38  ?  110 PHE E CG    1 
ATOM 3700 C CD1   . PHE E 1 112 ? -25.362 1.681   -37.034 1.00 61.74  ?  110 PHE E CD1   1 
ATOM 3701 C CD2   . PHE E 1 112 ? -24.086 0.174   -38.354 1.00 61.84  ?  110 PHE E CD2   1 
ATOM 3702 C CE1   . PHE E 1 112 ? -25.890 2.238   -38.179 1.00 63.18  ?  110 PHE E CE1   1 
ATOM 3703 C CE2   . PHE E 1 112 ? -24.612 0.728   -39.500 1.00 62.88  ?  110 PHE E CE2   1 
ATOM 3704 C CZ    . PHE E 1 112 ? -25.513 1.760   -39.413 1.00 63.55  ?  110 PHE E CZ    1 
ATOM 3705 N N     . GLY E 1 113 ? -24.091 -3.208  -36.152 1.00 71.05  ?  111 GLY E N     1 
ATOM 3706 C CA    . GLY E 1 113 ? -24.264 -4.380  -36.986 1.00 76.91  ?  111 GLY E CA    1 
ATOM 3707 C C     . GLY E 1 113 ? -25.521 -5.155  -36.661 1.00 82.60  ?  111 GLY E C     1 
ATOM 3708 O O     . GLY E 1 113 ? -26.028 -5.889  -37.516 1.00 86.23  ?  111 GLY E O     1 
ATOM 3709 N N     . GLU E 1 114 ? -26.036 -5.001  -35.442 1.00 82.93  ?  112 GLU E N     1 
ATOM 3710 C CA    . GLU E 1 114 ? -27.236 -5.698  -35.008 1.00 86.72  ?  112 GLU E CA    1 
ATOM 3711 C C     . GLU E 1 114 ? -28.497 -4.866  -35.177 1.00 85.22  ?  112 GLU E C     1 
ATOM 3712 O O     . GLU E 1 114 ? -29.589 -5.432  -35.294 1.00 89.00  ?  112 GLU E O     1 
ATOM 3713 C CB    . GLU E 1 114 ? -27.102 -6.099  -33.537 1.00 88.78  ?  112 GLU E CB    1 
ATOM 3714 C CG    . GLU E 1 114 ? -25.900 -6.970  -33.231 1.00 90.84  ?  112 GLU E CG    1 
ATOM 3715 C CD    . GLU E 1 114 ? -25.713 -7.194  -31.744 1.00 93.85  ?  112 GLU E CD    1 
ATOM 3716 O OE1   . GLU E 1 114 ? -26.239 -6.387  -30.950 1.00 92.99  ?  112 GLU E OE1   1 
ATOM 3717 O OE2   . GLU E 1 114 ? -25.039 -8.175  -31.369 1.00 97.44  -1 112 GLU E OE2   1 
ATOM 3718 N N     . GLN E 1 115 ? -28.379 -3.539  -35.202 1.00 80.53  ?  113 GLN E N     1 
ATOM 3719 C CA    . GLN E 1 115 ? -29.556 -2.683  -35.334 1.00 83.81  ?  113 GLN E CA    1 
ATOM 3720 C C     . GLN E 1 115 ? -29.114 -1.326  -35.873 1.00 80.11  ?  113 GLN E C     1 
ATOM 3721 O O     . GLN E 1 115 ? -28.643 -0.478  -35.112 1.00 79.23  ?  113 GLN E O     1 
ATOM 3722 C CB    . GLN E 1 115 ? -30.279 -2.542  -34.003 1.00 86.77  ?  113 GLN E CB    1 
ATOM 3723 N N     . ASN E 1 116 ? -29.256 -1.140  -37.187 1.00 77.92  ?  114 ASN E N     1 
ATOM 3724 C CA    . ASN E 1 116 ? -28.952 0.152   -37.793 1.00 73.01  ?  114 ASN E CA    1 
ATOM 3725 C C     . ASN E 1 116 ? -29.829 1.245   -37.199 1.00 71.61  ?  114 ASN E C     1 
ATOM 3726 O O     . ASN E 1 116 ? -29.344 2.324   -36.843 1.00 67.05  ?  114 ASN E O     1 
ATOM 3727 C CB    . ASN E 1 116 ? -29.123 0.081   -39.310 1.00 73.77  ?  114 ASN E CB    1 
ATOM 3728 C CG    . ASN E 1 116 ? -28.203 -0.935  -39.953 1.00 74.92  ?  114 ASN E CG    1 
ATOM 3729 O OD1   . ASN E 1 116 ? -27.600 -1.760  -39.271 1.00 76.84  ?  114 ASN E OD1   1 
ATOM 3730 N ND2   . ASN E 1 116 ? -28.086 -0.876  -41.273 1.00 74.70  ?  114 ASN E ND2   1 
ATOM 3731 N N     . LYS E 1 117 ? -31.134 0.990   -37.112 1.00 73.76  ?  115 LYS E N     1 
ATOM 3732 C CA    . LYS E 1 117 ? -32.103 1.919   -36.546 1.00 73.86  ?  115 LYS E CA    1 
ATOM 3733 C C     . LYS E 1 117 ? -32.486 1.481   -35.137 1.00 77.99  ?  115 LYS E C     1 
ATOM 3734 O O     . LYS E 1 117 ? -33.456 0.732   -34.965 1.00 85.31  ?  115 LYS E O     1 
ATOM 3735 C CB    . LYS E 1 117 ? -33.352 1.988   -37.425 1.00 73.98  ?  115 LYS E CB    1 
ATOM 3736 C CG    . LYS E 1 117 ? -33.743 3.381   -37.877 1.00 68.22  ?  115 LYS E CG    1 
ATOM 3737 C CD    . LYS E 1 117 ? -33.124 3.706   -39.225 1.00 62.21  ?  115 LYS E CD    1 
ATOM 3738 C CE    . LYS E 1 117 ? -33.843 4.857   -39.901 1.00 59.14  ?  115 LYS E CE    1 
ATOM 3739 N NZ    . LYS E 1 117 ? -33.295 5.148   -41.254 1.00 55.63  ?  115 LYS E NZ    1 
ATOM 3740 N N     . PRO E 1 118 ? -31.765 1.922   -34.109 1.00 72.63  ?  116 PRO E N     1 
ATOM 3741 C CA    . PRO E 1 118 ? -32.100 1.514   -32.744 1.00 71.24  ?  116 PRO E CA    1 
ATOM 3742 C C     . PRO E 1 118 ? -33.266 2.309   -32.184 1.00 68.75  ?  116 PRO E C     1 
ATOM 3743 O O     . PRO E 1 118 ? -33.532 3.443   -32.587 1.00 65.32  ?  116 PRO E O     1 
ATOM 3744 C CB    . PRO E 1 118 ? -30.810 1.812   -31.974 1.00 66.90  ?  116 PRO E CB    1 
ATOM 3745 C CG    . PRO E 1 118 ? -30.264 3.011   -32.669 1.00 61.70  ?  116 PRO E CG    1 
ATOM 3746 C CD    . PRO E 1 118 ? -30.665 2.902   -34.127 1.00 64.98  ?  116 PRO E CD    1 
ATOM 3747 N N     . SER E 1 119 ? -33.963 1.695   -31.233 1.00 70.50  ?  117 SER E N     1 
ATOM 3748 C CA    . SER E 1 119 ? -35.125 2.337   -30.644 1.00 73.82  ?  117 SER E CA    1 
ATOM 3749 C C     . SER E 1 119 ? -34.697 3.484   -29.738 1.00 72.07  ?  117 SER E C     1 
ATOM 3750 O O     . SER E 1 119 ? -33.533 3.604   -29.351 1.00 69.76  ?  117 SER E O     1 
ATOM 3751 C CB    . SER E 1 119 ? -35.947 1.336   -29.837 1.00 78.52  ?  117 SER E CB    1 
ATOM 3752 O OG    . SER E 1 119 ? -35.298 1.026   -28.618 1.00 77.21  ?  117 SER E OG    1 
ATOM 3753 N N     . SER E 1 120 ? -35.664 4.338   -29.400 1.00 72.43  ?  118 SER E N     1 
ATOM 3754 C CA    . SER E 1 120 ? -35.391 5.412   -28.456 1.00 72.86  ?  118 SER E CA    1 
ATOM 3755 C C     . SER E 1 120 ? -35.014 4.869   -27.088 1.00 74.67  ?  118 SER E C     1 
ATOM 3756 O O     . SER E 1 120 ? -34.320 5.552   -26.329 1.00 74.02  ?  118 SER E O     1 
ATOM 3757 C CB    . SER E 1 120 ? -36.604 6.333   -28.346 1.00 77.38  ?  118 SER E CB    1 
ATOM 3758 O OG    . SER E 1 120 ? -37.203 6.530   -29.614 1.00 76.98  ?  118 SER E OG    1 
ATOM 3759 N N     . GLN E 1 121 ? -35.454 3.654   -26.763 1.00 77.18  ?  119 GLN E N     1 
ATOM 3760 C CA    . GLN E 1 121 ? -35.101 3.002   -25.510 1.00 78.33  ?  119 GLN E CA    1 
ATOM 3761 C C     . GLN E 1 121 ? -33.795 2.230   -25.623 1.00 73.21  ?  119 GLN E C     1 
ATOM 3762 O O     . GLN E 1 121 ? -32.996 2.231   -24.681 1.00 72.48  ?  119 GLN E O     1 
ATOM 3763 C CB    . GLN E 1 121 ? -36.231 2.071   -25.064 1.00 82.76  ?  119 GLN E CB    1 
ATOM 3764 C CG    . GLN E 1 121 ? -37.594 2.744   -25.001 1.00 87.41  ?  119 GLN E CG    1 
ATOM 3765 C CD    . GLN E 1 121 ? -37.584 4.028   -24.190 1.00 89.63  ?  119 GLN E CD    1 
ATOM 3766 O OE1   . GLN E 1 121 ? -36.897 4.133   -23.175 1.00 90.29  ?  119 GLN E OE1   1 
ATOM 3767 N NE2   . GLN E 1 121 ? -38.348 5.015   -24.641 1.00 91.02  ?  119 GLN E NE2   1 
ATOM 3768 N N     . GLU E 1 122 ? -33.565 1.565   -26.758 1.00 69.72  ?  120 GLU E N     1 
ATOM 3769 C CA    . GLU E 1 122 ? -32.280 0.911   -26.973 1.00 65.69  ?  120 GLU E CA    1 
ATOM 3770 C C     . GLU E 1 122 ? -31.142 1.918   -26.928 1.00 64.92  ?  120 GLU E C     1 
ATOM 3771 O O     . GLU E 1 122 ? -30.035 1.584   -26.496 1.00 64.70  ?  120 GLU E O     1 
ATOM 3772 C CB    . GLU E 1 122 ? -32.278 0.163   -28.305 1.00 60.50  ?  120 GLU E CB    1 
ATOM 3773 N N     . ILE E 1 123 ? -31.394 3.151   -27.367 1.00 65.79  ?  121 ILE E N     1 
ATOM 3774 C CA    . ILE E 1 123 ? -30.377 4.191   -27.273 1.00 66.98  ?  121 ILE E CA    1 
ATOM 3775 C C     . ILE E 1 123 ? -30.088 4.510   -25.813 1.00 75.86  ?  121 ILE E C     1 
ATOM 3776 O O     . ILE E 1 123 ? -28.933 4.706   -25.420 1.00 79.50  ?  121 ILE E O     1 
ATOM 3777 C CB    . ILE E 1 123 ? -30.819 5.445   -28.051 1.00 64.60  ?  121 ILE E CB    1 
ATOM 3778 C CG1   . ILE E 1 123 ? -30.723 5.211   -29.556 1.00 60.93  ?  121 ILE E CG1   1 
ATOM 3779 C CG2   . ILE E 1 123 ? -29.982 6.644   -27.660 1.00 63.72  ?  121 ILE E CG2   1 
ATOM 3780 C CD1   . ILE E 1 123 ? -31.321 6.324   -30.373 1.00 43.67  ?  121 ILE E CD1   1 
ATOM 3781 N N     . MET E 1 124 ? -31.132 4.546   -24.982 1.00 80.43  ?  122 MET E N     1 
ATOM 3782 C CA    . MET E 1 124 ? -30.940 4.821   -23.563 1.00 85.65  ?  122 MET E CA    1 
ATOM 3783 C C     . MET E 1 124 ? -30.263 3.658   -22.851 1.00 86.30  ?  122 MET E C     1 
ATOM 3784 O O     . MET E 1 124 ? -29.508 3.873   -21.897 1.00 89.27  ?  122 MET E O     1 
ATOM 3785 C CB    . MET E 1 124 ? -32.283 5.138   -22.908 1.00 92.10  ?  122 MET E CB    1 
ATOM 3786 C CG    . MET E 1 124 ? -32.155 5.859   -21.586 1.00 98.30  ?  122 MET E CG    1 
ATOM 3787 S SD    . MET E 1 124 ? -30.979 7.217   -21.688 1.00 97.92  ?  122 MET E SD    1 
ATOM 3788 C CE    . MET E 1 124 ? -30.173 7.079   -20.097 1.00 101.05 ?  122 MET E CE    1 
ATOM 3789 N N     . ARG E 1 125 ? -30.517 2.426   -23.293 1.00 84.14  ?  123 ARG E N     1 
ATOM 3790 C CA    . ARG E 1 125 ? -29.872 1.274   -22.674 1.00 85.62  ?  123 ARG E CA    1 
ATOM 3791 C C     . ARG E 1 125 ? -28.377 1.257   -22.949 1.00 78.55  ?  123 ARG E C     1 
ATOM 3792 O O     . ARG E 1 125 ? -27.599 0.799   -22.105 1.00 80.56  ?  123 ARG E O     1 
ATOM 3793 C CB    . ARG E 1 125 ? -30.516 -0.021  -23.170 1.00 89.96  ?  123 ARG E CB    1 
ATOM 3794 N N     . MET E 1 126 ? -27.958 1.747   -24.115 1.00 71.76  ?  124 MET E N     1 
ATOM 3795 C CA    . MET E 1 126 ? -26.540 1.773   -24.448 1.00 65.34  ?  124 MET E CA    1 
ATOM 3796 C C     . MET E 1 126 ? -25.842 2.968   -23.817 1.00 62.35  ?  124 MET E C     1 
ATOM 3797 O O     . MET E 1 126 ? -24.712 2.845   -23.336 1.00 60.01  ?  124 MET E O     1 
ATOM 3798 C CB    . MET E 1 126 ? -26.362 1.811   -25.965 1.00 62.24  ?  124 MET E CB    1 
ATOM 3799 C CG    . MET E 1 126 ? -26.995 0.654   -26.699 1.00 66.74  ?  124 MET E CG    1 
ATOM 3800 S SD    . MET E 1 126 ? -26.910 0.857   -28.484 1.00 68.20  ?  124 MET E SD    1 
ATOM 3801 C CE    . MET E 1 126 ? -27.856 -0.563  -29.027 1.00 71.38  ?  124 MET E CE    1 
ATOM 3802 N N     . ALA E 1 127 ? -26.501 4.128   -23.808 1.00 63.63  ?  125 ALA E N     1 
ATOM 3803 C CA    . ALA E 1 127 ? -25.925 5.305   -23.165 1.00 64.57  ?  125 ALA E CA    1 
ATOM 3804 C C     . ALA E 1 127 ? -25.587 5.030   -21.708 1.00 69.76  ?  125 ALA E C     1 
ATOM 3805 O O     . ALA E 1 127 ? -24.579 5.525   -21.193 1.00 71.20  ?  125 ALA E O     1 
ATOM 3806 C CB    . ALA E 1 127 ? -26.885 6.487   -23.279 1.00 65.39  ?  125 ALA E CB    1 
ATOM 3807 N N     . GLU E 1 128 ? -26.413 4.235   -21.029 1.00 73.66  ?  126 GLU E N     1 
ATOM 3808 C CA    . GLU E 1 128 ? -26.119 3.860   -19.652 1.00 79.66  ?  126 GLU E CA    1 
ATOM 3809 C C     . GLU E 1 128 ? -25.040 2.790   -19.592 1.00 81.39  ?  126 GLU E C     1 
ATOM 3810 O O     . GLU E 1 128 ? -24.187 2.813   -18.699 1.00 85.19  ?  126 GLU E O     1 
ATOM 3811 C CB    . GLU E 1 128 ? -27.390 3.374   -18.955 1.00 86.08  ?  126 GLU E CB    1 
ATOM 3812 C CG    . GLU E 1 128 ? -27.335 3.444   -17.440 1.00 91.60  ?  126 GLU E CG    1 
ATOM 3813 C CD    . GLU E 1 128 ? -28.161 4.582   -16.876 1.00 94.36  ?  126 GLU E CD    1 
ATOM 3814 O OE1   . GLU E 1 128 ? -28.925 5.204   -17.643 1.00 92.55  ?  126 GLU E OE1   1 
ATOM 3815 O OE2   . GLU E 1 128 ? -28.040 4.857   -15.665 1.00 98.18  ?  126 GLU E OE2   1 
ATOM 3816 N N     . GLU E 1 129 ? -25.063 1.846   -20.533 1.00 80.41  ?  127 GLU E N     1 
ATOM 3817 C CA    . GLU E 1 129 ? -24.043 0.804   -20.562 1.00 82.28  ?  127 GLU E CA    1 
ATOM 3818 C C     . GLU E 1 129 ? -22.664 1.381   -20.855 1.00 79.50  ?  127 GLU E C     1 
ATOM 3819 O O     . GLU E 1 129 ? -21.655 0.847   -20.383 1.00 80.65  ?  127 GLU E O     1 
ATOM 3820 C CB    . GLU E 1 129 ? -24.429 -0.258  -21.596 1.00 82.96  ?  127 GLU E CB    1 
ATOM 3821 C CG    . GLU E 1 129 ? -23.281 -1.090  -22.144 1.00 84.41  ?  127 GLU E CG    1 
ATOM 3822 C CD    . GLU E 1 129 ? -23.718 -2.013  -23.268 1.00 85.41  ?  127 GLU E CD    1 
ATOM 3823 O OE1   . GLU E 1 129 ? -22.898 -2.293  -24.167 1.00 83.54  ?  127 GLU E OE1   1 
ATOM 3824 O OE2   . GLU E 1 129 ? -24.892 -2.438  -23.264 1.00 87.90  -1 127 GLU E OE2   1 
ATOM 3825 N N     . LEU E 1 130 ? -22.601 2.484   -21.598 1.00 77.49  ?  128 LEU E N     1 
ATOM 3826 C CA    . LEU E 1 130 ? -21.334 3.092   -21.972 1.00 74.38  ?  128 LEU E CA    1 
ATOM 3827 C C     . LEU E 1 130 ? -21.016 4.362   -21.201 1.00 71.99  ?  128 LEU E C     1 
ATOM 3828 O O     . LEU E 1 130 ? -19.931 4.920   -21.391 1.00 76.36  ?  128 LEU E O     1 
ATOM 3829 C CB    . LEU E 1 130 ? -21.324 3.411   -23.471 1.00 42.52  ?  128 LEU E CB    1 
ATOM 3830 C CG    . LEU E 1 130 ? -21.539 2.241   -24.422 1.00 41.77  ?  128 LEU E CG    1 
ATOM 3831 C CD1   . LEU E 1 130 ? -21.800 2.769   -25.808 1.00 38.32  ?  128 LEU E CD1   1 
ATOM 3832 C CD2   . LEU E 1 130 ? -20.338 1.323   -24.421 1.00 42.44  ?  128 LEU E CD2   1 
ATOM 3833 N N     . ASN E 1 131 ? -21.929 4.837   -20.354 1.00 64.05  ?  129 ASN E N     1 
ATOM 3834 C CA    . ASN E 1 131 ? -21.724 6.049   -19.561 1.00 62.46  ?  129 ASN E CA    1 
ATOM 3835 C C     . ASN E 1 131 ? -21.538 7.261   -20.471 1.00 57.20  ?  129 ASN E C     1 
ATOM 3836 O O     . ASN E 1 131 ? -20.587 8.033   -20.338 1.00 55.63  ?  129 ASN E O     1 
ATOM 3837 C CB    . ASN E 1 131 ? -20.552 5.900   -18.588 1.00 64.60  ?  129 ASN E CB    1 
ATOM 3838 C CG    . ASN E 1 131 ? -20.506 7.010   -17.558 1.00 66.14  ?  129 ASN E CG    1 
ATOM 3839 O OD1   . ASN E 1 131 ? -21.519 7.645   -17.267 1.00 67.94  ?  129 ASN E OD1   1 
ATOM 3840 N ND2   . ASN E 1 131 ? -19.324 7.258   -17.007 1.00 66.01  ?  129 ASN E ND2   1 
ATOM 3841 N N     . LEU E 1 132 ? -22.452 7.409   -21.422 1.00 55.38  ?  130 LEU E N     1 
ATOM 3842 C CA    . LEU E 1 132 ? -22.467 8.545   -22.327 1.00 55.76  ?  130 LEU E CA    1 
ATOM 3843 C C     . LEU E 1 132 ? -23.846 9.182   -22.285 1.00 57.32  ?  130 LEU E C     1 
ATOM 3844 O O     . LEU E 1 132 ? -24.825 8.558   -21.872 1.00 64.92  ?  130 LEU E O     1 
ATOM 3845 C CB    . LEU E 1 132 ? -22.119 8.138   -23.768 1.00 54.99  ?  130 LEU E CB    1 
ATOM 3846 C CG    . LEU E 1 132 ? -20.669 7.772   -24.089 1.00 53.38  ?  130 LEU E CG    1 
ATOM 3847 C CD1   . LEU E 1 132 ? -20.585 7.054   -25.419 1.00 34.52  ?  130 LEU E CD1   1 
ATOM 3848 C CD2   . LEU E 1 132 ? -19.804 9.011   -24.110 1.00 35.17  ?  130 LEU E CD2   1 
ATOM 3849 N N     . GLU E 1 133 ? -23.916 10.435  -22.715 1.00 51.30  ?  131 GLU E N     1 
ATOM 3850 C CA    . GLU E 1 133 ? -25.200 11.107  -22.779 1.00 56.60  ?  131 GLU E CA    1 
ATOM 3851 C C     . GLU E 1 133 ? -26.073 10.482  -23.861 1.00 57.80  ?  131 GLU E C     1 
ATOM 3852 O O     . GLU E 1 133 ? -25.592 9.837   -24.793 1.00 56.19  ?  131 GLU E O     1 
ATOM 3853 C CB    . GLU E 1 133 ? -25.022 12.600  -23.047 1.00 57.87  ?  131 GLU E CB    1 
ATOM 3854 C CG    . GLU E 1 133 ? -24.673 13.415  -21.816 1.00 62.89  ?  131 GLU E CG    1 
ATOM 3855 C CD    . GLU E 1 133 ? -24.560 14.897  -22.109 1.00 67.08  ?  131 GLU E CD    1 
ATOM 3856 O OE1   . GLU E 1 133 ? -24.449 15.265  -23.298 1.00 66.07  ?  131 GLU E OE1   1 
ATOM 3857 O OE2   . GLU E 1 133 ? -24.584 15.697  -21.151 1.00 71.14  -1 131 GLU E OE2   1 
ATOM 3858 N N     . LYS E 1 134 ? -27.385 10.653  -23.702 1.00 63.11  ?  132 LYS E N     1 
ATOM 3859 C CA    . LYS E 1 134 ? -28.323 10.091  -24.666 1.00 61.78  ?  132 LYS E CA    1 
ATOM 3860 C C     . LYS E 1 134 ? -28.159 10.739  -26.033 1.00 58.95  ?  132 LYS E C     1 
ATOM 3861 O O     . LYS E 1 134 ? -28.267 10.066  -27.065 1.00 43.38  ?  132 LYS E O     1 
ATOM 3862 C CB    . LYS E 1 134 ? -29.755 10.255  -24.159 1.00 52.69  ?  132 LYS E CB    1 
ATOM 3863 N N     . GLU E 1 135 ? -27.922 12.051  -26.060 1.00 59.31  ?  133 GLU E N     1 
ATOM 3864 C CA    . GLU E 1 135 ? -27.818 12.766  -27.327 1.00 55.19  ?  133 GLU E CA    1 
ATOM 3865 C C     . GLU E 1 135 ? -26.622 12.295  -28.146 1.00 48.51  ?  133 GLU E C     1 
ATOM 3866 O O     . GLU E 1 135 ? -26.753 12.010  -29.339 1.00 43.73  ?  133 GLU E O     1 
ATOM 3867 C CB    . GLU E 1 135 ? -27.726 14.269  -27.060 1.00 58.79  ?  133 GLU E CB    1 
ATOM 3868 C CG    . GLU E 1 135 ? -27.740 15.144  -28.305 1.00 60.19  ?  133 GLU E CG    1 
ATOM 3869 C CD    . GLU E 1 135 ? -29.093 15.184  -28.991 1.00 63.40  ?  133 GLU E CD    1 
ATOM 3870 O OE1   . GLU E 1 135 ? -29.215 15.876  -30.022 1.00 62.34  ?  133 GLU E OE1   1 
ATOM 3871 O OE2   . GLU E 1 135 ? -30.036 14.536  -28.494 1.00 66.25  -1 133 GLU E OE2   1 
ATOM 3872 N N     . VAL E 1 136 ? -25.450 12.176  -27.513 1.00 49.51  ?  134 VAL E N     1 
ATOM 3873 C CA    . VAL E 1 136 ? -24.238 11.820  -28.252 1.00 47.34  ?  134 VAL E CA    1 
ATOM 3874 C C     . VAL E 1 136 ? -24.379 10.450  -28.903 1.00 48.13  ?  134 VAL E C     1 
ATOM 3875 O O     . VAL E 1 136 ? -23.898 10.228  -30.020 1.00 47.55  ?  134 VAL E O     1 
ATOM 3876 C CB    . VAL E 1 136 ? -22.995 11.904  -27.344 1.00 45.58  ?  134 VAL E CB    1 
ATOM 3877 C CG1   . VAL E 1 136 ? -22.856 13.299  -26.770 1.00 47.69  ?  134 VAL E CG1   1 
ATOM 3878 C CG2   . VAL E 1 136 ? -23.046 10.880  -26.237 1.00 47.66  ?  134 VAL E CG2   1 
ATOM 3879 N N     . VAL E 1 137 ? -25.026 9.506   -28.219 1.00 45.79  ?  135 VAL E N     1 
ATOM 3880 C CA    . VAL E 1 137 ? -25.224 8.192   -28.815 1.00 36.00  ?  135 VAL E CA    1 
ATOM 3881 C C     . VAL E 1 137 ? -26.269 8.262   -29.916 1.00 44.95  ?  135 VAL E C     1 
ATOM 3882 O O     . VAL E 1 137 ? -26.170 7.552   -30.923 1.00 44.73  ?  135 VAL E O     1 
ATOM 3883 C CB    . VAL E 1 137 ? -25.606 7.164   -27.739 1.00 38.71  ?  135 VAL E CB    1 
ATOM 3884 C CG1   . VAL E 1 137 ? -25.747 5.786   -28.352 1.00 38.58  ?  135 VAL E CG1   1 
ATOM 3885 C CG2   . VAL E 1 137 ? -24.570 7.150   -26.638 1.00 39.82  ?  135 VAL E CG2   1 
ATOM 3886 N N     . ARG E 1 138 ? -27.282 9.113   -29.750 1.00 44.29  ?  136 ARG E N     1 
ATOM 3887 C CA    . ARG E 1 138 ? -28.304 9.255   -30.780 1.00 41.99  ?  136 ARG E CA    1 
ATOM 3888 C C     . ARG E 1 138 ? -27.703 9.787   -32.073 1.00 37.95  ?  136 ARG E C     1 
ATOM 3889 O O     . ARG E 1 138 ? -27.893 9.201   -33.144 1.00 37.44  ?  136 ARG E O     1 
ATOM 3890 C CB    . ARG E 1 138 ? -29.420 10.172  -30.279 1.00 44.11  ?  136 ARG E CB    1 
ATOM 3891 C CG    . ARG E 1 138 ? -30.666 10.192  -31.152 1.00 43.74  ?  136 ARG E CG    1 
ATOM 3892 C CD    . ARG E 1 138 ? -31.628 11.274  -30.702 1.00 46.44  ?  136 ARG E CD    1 
ATOM 3893 N NE    . ARG E 1 138 ? -31.167 12.600  -31.090 1.00 47.82  ?  136 ARG E NE    1 
ATOM 3894 C CZ    . ARG E 1 138 ? -31.172 13.054  -32.336 1.00 49.75  ?  136 ARG E CZ    1 
ATOM 3895 N NH1   . ARG E 1 138 ? -31.621 12.289  -33.319 1.00 49.46  1  136 ARG E NH1   1 
ATOM 3896 N NH2   . ARG E 1 138 ? -30.730 14.273  -32.600 1.00 51.23  ?  136 ARG E NH2   1 
ATOM 3897 N N     . VAL E 1 139 ? -26.967 10.897  -31.992 1.00 35.87  ?  137 VAL E N     1 
ATOM 3898 C CA    . VAL E 1 139 ? -26.340 11.467  -33.181 1.00 34.73  ?  137 VAL E CA    1 
ATOM 3899 C C     . VAL E 1 139 ? -25.297 10.524  -33.758 1.00 32.80  ?  137 VAL E C     1 
ATOM 3900 O O     . VAL E 1 139 ? -25.068 10.512  -34.973 1.00 32.69  ?  137 VAL E O     1 
ATOM 3901 C CB    . VAL E 1 139 ? -25.728 12.843  -32.865 1.00 37.42  ?  137 VAL E CB    1 
ATOM 3902 C CG1   . VAL E 1 139 ? -25.532 13.626  -34.141 1.00 37.69  ?  137 VAL E CG1   1 
ATOM 3903 C CG2   . VAL E 1 139 ? -26.629 13.614  -31.933 1.00 42.06  ?  137 VAL E CG2   1 
ATOM 3904 N N     . TRP E 1 140 ? -24.634 9.739   -32.910 1.00 32.70  ?  138 TRP E N     1 
ATOM 3905 C CA    . TRP E 1 140 ? -23.645 8.791   -33.407 1.00 32.34  ?  138 TRP E CA    1 
ATOM 3906 C C     . TRP E 1 140 ? -24.265 7.829   -34.410 1.00 33.89  ?  138 TRP E C     1 
ATOM 3907 O O     . TRP E 1 140 ? -23.758 7.665   -35.524 1.00 32.60  ?  138 TRP E O     1 
ATOM 3908 C CB    . TRP E 1 140 ? -23.015 8.028   -32.246 1.00 34.57  ?  138 TRP E CB    1 
ATOM 3909 C CG    . TRP E 1 140 ? -21.810 7.262   -32.656 1.00 36.08  ?  138 TRP E CG    1 
ATOM 3910 C CD1   . TRP E 1 140 ? -20.518 7.686   -32.612 1.00 37.27  ?  138 TRP E CD1   1 
ATOM 3911 C CD2   . TRP E 1 140 ? -21.779 5.933   -33.181 1.00 37.02  ?  138 TRP E CD2   1 
ATOM 3912 N NE1   . TRP E 1 140 ? -19.681 6.704   -33.077 1.00 38.28  ?  138 TRP E NE1   1 
ATOM 3913 C CE2   . TRP E 1 140 ? -20.433 5.616   -33.432 1.00 38.82  ?  138 TRP E CE2   1 
ATOM 3914 C CE3   . TRP E 1 140 ? -22.758 4.979   -33.460 1.00 36.16  ?  138 TRP E CE3   1 
ATOM 3915 C CZ2   . TRP E 1 140 ? -20.043 4.390   -33.950 1.00 39.93  ?  138 TRP E CZ2   1 
ATOM 3916 C CZ3   . TRP E 1 140 ? -22.369 3.765   -33.973 1.00 37.28  ?  138 TRP E CZ3   1 
ATOM 3917 C CH2   . TRP E 1 140 ? -21.026 3.479   -34.212 1.00 39.51  ?  138 TRP E CH2   1 
ATOM 3918 N N     . PHE E 1 141 ? -25.372 7.188   -34.034 1.00 39.69  ?  139 PHE E N     1 
ATOM 3919 C CA    . PHE E 1 141 ? -26.037 6.272   -34.953 1.00 43.31  ?  139 PHE E CA    1 
ATOM 3920 C C     . PHE E 1 141 ? -26.535 7.002   -36.191 1.00 45.13  ?  139 PHE E C     1 
ATOM 3921 O O     . PHE E 1 141 ? -26.517 6.448   -37.295 1.00 44.28  ?  139 PHE E O     1 
ATOM 3922 C CB    . PHE E 1 141 ? -27.191 5.565   -34.246 1.00 45.73  ?  139 PHE E CB    1 
ATOM 3923 C CG    . PHE E 1 141 ? -26.759 4.418   -33.384 1.00 48.94  ?  139 PHE E CG    1 
ATOM 3924 C CD1   . PHE E 1 141 ? -26.653 3.144   -33.909 1.00 50.85  ?  139 PHE E CD1   1 
ATOM 3925 C CD2   . PHE E 1 141 ? -26.460 4.610   -32.050 1.00 50.10  ?  139 PHE E CD2   1 
ATOM 3926 C CE1   . PHE E 1 141 ? -26.257 2.087   -33.121 1.00 52.53  ?  139 PHE E CE1   1 
ATOM 3927 C CE2   . PHE E 1 141 ? -26.063 3.556   -31.259 1.00 51.45  ?  139 PHE E CE2   1 
ATOM 3928 C CZ    . PHE E 1 141 ? -25.962 2.293   -31.795 1.00 52.75  ?  139 PHE E CZ    1 
ATOM 3929 N N     . CYS E 1 142 ? -26.983 8.246   -36.029 1.00 48.41  ?  140 CYS E N     1 
ATOM 3930 C CA    . CYS E 1 142 ? -27.384 9.052   -37.177 1.00 48.01  ?  140 CYS E CA    1 
ATOM 3931 C C     . CYS E 1 142 ? -26.217 9.244   -38.136 1.00 43.63  ?  140 CYS E C     1 
ATOM 3932 O O     . CYS E 1 142 ? -26.304 8.899   -39.319 1.00 42.38  ?  140 CYS E O     1 
ATOM 3933 C CB    . CYS E 1 142 ? -27.932 10.400  -36.708 1.00 51.55  ?  140 CYS E CB    1 
ATOM 3934 S SG    . CYS E 1 142 ? -29.408 10.300  -35.677 1.00 56.69  ?  140 CYS E SG    1 
ATOM 3935 N N     . ASN E 1 143 ? -25.106 9.791   -37.635 1.00 38.17  ?  141 ASN E N     1 
ATOM 3936 C CA    . ASN E 1 143 ? -23.926 9.966   -38.474 1.00 33.94  ?  141 ASN E CA    1 
ATOM 3937 C C     . ASN E 1 143 ? -23.400 8.633   -38.982 1.00 33.70  ?  141 ASN E C     1 
ATOM 3938 O O     . ASN E 1 143 ? -22.854 8.562   -40.089 1.00 33.31  ?  141 ASN E O     1 
ATOM 3939 C CB    . ASN E 1 143 ? -22.838 10.713  -37.708 1.00 31.86  ?  141 ASN E CB    1 
ATOM 3940 C CG    . ASN E 1 143 ? -23.219 12.142  -37.410 1.00 32.68  ?  141 ASN E CG    1 
ATOM 3941 O OD1   . ASN E 1 143 ? -23.990 12.756  -38.144 1.00 32.58  ?  141 ASN E OD1   1 
ATOM 3942 N ND2   . ASN E 1 143 ? -22.678 12.684  -36.329 1.00 33.26  ?  141 ASN E ND2   1 
ATOM 3943 N N     . ARG E 1 144 ? -23.535 7.572   -38.186 1.00 33.87  ?  142 ARG E N     1 
ATOM 3944 C CA    . ARG E 1 144 ? -23.164 6.245   -38.660 1.00 34.42  ?  142 ARG E CA    1 
ATOM 3945 C C     . ARG E 1 144 ? -24.047 5.821   -39.823 1.00 36.91  ?  142 ARG E C     1 
ATOM 3946 O O     . ARG E 1 144 ? -23.563 5.240   -40.801 1.00 37.73  ?  142 ARG E O     1 
ATOM 3947 C CB    . ARG E 1 144 ? -23.258 5.241   -37.515 1.00 36.18  ?  142 ARG E CB    1 
ATOM 3948 C CG    . ARG E 1 144 ? -22.749 3.853   -37.844 1.00 38.94  ?  142 ARG E CG    1 
ATOM 3949 C CD    . ARG E 1 144 ? -21.298 3.845   -38.268 1.00 37.53  ?  142 ARG E CD    1 
ATOM 3950 N NE    . ARG E 1 144 ? -20.839 2.483   -38.512 1.00 38.63  ?  142 ARG E NE    1 
ATOM 3951 C CZ    . ARG E 1 144 ? -20.943 1.868   -39.683 1.00 42.20  ?  142 ARG E CZ    1 
ATOM 3952 N NH1   . ARG E 1 144 ? -21.491 2.496   -40.709 1.00 43.22  1  142 ARG E NH1   1 
ATOM 3953 N NH2   . ARG E 1 144 ? -20.507 0.627   -39.827 1.00 46.72  ?  142 ARG E NH2   1 
ATOM 3954 N N     . ARG E 1 145 ? -25.348 6.102   -39.733 1.00 38.17  ?  143 ARG E N     1 
ATOM 3955 C CA    . ARG E 1 145 ? -26.259 5.770   -40.823 1.00 38.56  ?  143 ARG E CA    1 
ATOM 3956 C C     . ARG E 1 145 ? -25.947 6.583   -42.070 1.00 38.27  ?  143 ARG E C     1 
ATOM 3957 O O     . ARG E 1 145 ? -25.917 6.043   -43.181 1.00 37.24  ?  143 ARG E O     1 
ATOM 3958 C CB    . ARG E 1 145 ? -27.701 6.013   -40.385 1.00 29.70  ?  143 ARG E CB    1 
ATOM 3959 C CG    . ARG E 1 145 ? -28.374 4.834   -39.718 1.00 32.59  ?  143 ARG E CG    1 
ATOM 3960 C CD    . ARG E 1 145 ? -29.773 5.208   -39.277 1.00 39.92  ?  143 ARG E CD    1 
ATOM 3961 N NE    . ARG E 1 145 ? -29.837 5.525   -37.855 1.00 43.67  ?  143 ARG E NE    1 
ATOM 3962 C CZ    . ARG E 1 145 ? -30.805 6.240   -37.293 1.00 49.08  ?  143 ARG E CZ    1 
ATOM 3963 N NH1   . ARG E 1 145 ? -31.785 6.732   -38.036 1.00 52.28  1  143 ARG E NH1   1 
ATOM 3964 N NH2   . ARG E 1 145 ? -30.789 6.473   -35.990 1.00 50.12  ?  143 ARG E NH2   1 
ATOM 3965 N N     . GLN E 1 146 ? -25.720 7.887   -41.905 1.00 39.77  ?  144 GLN E N     1 
ATOM 3966 C CA    . GLN E 1 146 ? -25.376 8.747   -43.028 1.00 42.03  ?  144 GLN E CA    1 
ATOM 3967 C C     . GLN E 1 146 ? -24.070 8.333   -43.692 1.00 46.77  ?  144 GLN E C     1 
ATOM 3968 O O     . GLN E 1 146 ? -23.866 8.627   -44.874 1.00 47.11  ?  144 GLN E O     1 
ATOM 3969 C CB    . GLN E 1 146 ? -25.289 10.198  -42.557 1.00 38.41  ?  144 GLN E CB    1 
ATOM 3970 C CG    . GLN E 1 146 ? -26.629 10.824  -42.210 1.00 39.56  ?  144 GLN E CG    1 
ATOM 3971 C CD    . GLN E 1 146 ? -27.426 11.223  -43.429 1.00 42.44  ?  144 GLN E CD    1 
ATOM 3972 O OE1   . GLN E 1 146 ? -27.227 12.297  -43.987 1.00 41.94  ?  144 GLN E OE1   1 
ATOM 3973 N NE2   . GLN E 1 146 ? -28.336 10.356  -43.850 1.00 45.97  ?  144 GLN E NE2   1 
ATOM 3974 N N     . ARG E 1 147 ? -23.179 7.666   -42.959 1.00 51.49  ?  145 ARG E N     1 
ATOM 3975 C CA    . ARG E 1 147 ? -21.895 7.263   -43.518 1.00 52.57  ?  145 ARG E CA    1 
ATOM 3976 C C     . ARG E 1 147 ? -22.047 6.127   -44.518 1.00 55.55  ?  145 ARG E C     1 
ATOM 3977 O O     . ARG E 1 147 ? -21.281 6.049   -45.483 1.00 57.68  ?  145 ARG E O     1 
ATOM 3978 C CB    . ARG E 1 147 ? -20.943 6.872   -42.387 1.00 54.25  ?  145 ARG E CB    1 
ATOM 3979 C CG    . ARG E 1 147 ? -19.729 6.068   -42.802 1.00 56.36  ?  145 ARG E CG    1 
ATOM 3980 C CD    . ARG E 1 147 ? -18.689 6.091   -41.697 1.00 57.32  ?  145 ARG E CD    1 
ATOM 3981 N NE    . ARG E 1 147 ? -17.595 5.158   -41.938 1.00 60.58  ?  145 ARG E NE    1 
ATOM 3982 C CZ    . ARG E 1 147 ? -16.397 5.251   -41.371 1.00 62.46  ?  145 ARG E CZ    1 
ATOM 3983 N NH1   . ARG E 1 147 ? -16.134 6.240   -40.528 1.00 59.95  1  145 ARG E NH1   1 
ATOM 3984 N NH2   . ARG E 1 147 ? -15.461 4.356   -41.648 1.00 66.65  ?  145 ARG E NH2   1 
ATOM 3985 N N     . GLU E 1 148 ? -23.022 5.245   -44.314 1.00 56.79  ?  146 GLU E N     1 
ATOM 3986 C CA    . GLU E 1 148 ? -23.340 4.247   -45.325 1.00 58.25  ?  146 GLU E CA    1 
ATOM 3987 C C     . GLU E 1 148 ? -24.133 4.829   -46.486 1.00 54.87  ?  146 GLU E C     1 
ATOM 3988 O O     . GLU E 1 148 ? -24.444 4.100   -47.433 1.00 56.78  ?  146 GLU E O     1 
ATOM 3989 C CB    . GLU E 1 148 ? -24.098 3.082   -44.691 1.00 63.40  ?  146 GLU E CB    1 
ATOM 3990 C CG    . GLU E 1 148 ? -23.252 2.255   -43.741 1.00 67.39  ?  146 GLU E CG    1 
ATOM 3991 C CD    . GLU E 1 148 ? -22.271 1.356   -44.465 1.00 74.08  ?  146 GLU E CD    1 
ATOM 3992 O OE1   . GLU E 1 148 ? -22.425 1.166   -45.689 1.00 77.06  ?  146 GLU E OE1   1 
ATOM 3993 O OE2   . GLU E 1 148 ? -21.343 0.837   -43.811 1.00 76.59  -1 146 GLU E OE2   1 
ATOM 3994 N N     . LYS E 1 149 ? -24.465 6.117   -46.428 1.00 48.49  ?  147 LYS E N     1 
ATOM 3995 C CA    . LYS E 1 149 ? -25.165 6.817   -47.494 1.00 45.84  ?  147 LYS E CA    1 
ATOM 3996 C C     . LYS E 1 149 ? -24.206 7.596   -48.383 1.00 42.51  ?  147 LYS E C     1 
ATOM 3997 O O     . LYS E 1 149 ? -24.630 8.516   -49.090 1.00 41.44  ?  147 LYS E O     1 
ATOM 3998 C CB    . LYS E 1 149 ? -26.214 7.759   -46.900 1.00 44.28  ?  147 LYS E CB    1 
ATOM 3999 C CG    . LYS E 1 149 ? -27.492 7.886   -47.703 1.00 45.96  ?  147 LYS E CG    1 
ATOM 4000 C CD    . LYS E 1 149 ? -28.610 7.066   -47.094 1.00 48.60  ?  147 LYS E CD    1 
ATOM 4001 C CE    . LYS E 1 149 ? -29.728 6.853   -48.094 1.00 52.74  ?  147 LYS E CE    1 
ATOM 4002 N NZ    . LYS E 1 149 ? -29.245 6.177   -49.326 1.00 54.42  ?  147 LYS E NZ    1 
ATOM 4003 N N     . ARG E 1 150 ? -22.927 7.243   -48.359 1.00 42.21  ?  148 ARG E N     1 
ATOM 4004 C CA    A ARG E 1 150 ? -21.874 7.924   -49.097 0.55 43.07  ?  148 ARG E CA    1 
ATOM 4005 C CA    B ARG E 1 150 ? -21.918 7.958   -49.121 0.45 43.08  ?  148 ARG E CA    1 
ATOM 4006 C C     . ARG E 1 150 ? -21.653 7.256   -50.448 1.00 42.21  ?  148 ARG E C     1 
ATOM 4007 O O     . ARG E 1 150 ? -22.117 6.144   -50.704 1.00 47.83  ?  148 ARG E O     1 
ATOM 4008 C CB    A ARG E 1 150 ? -20.566 7.904   -48.303 0.55 40.54  ?  148 ARG E CB    1 
ATOM 4009 C CB    B ARG E 1 150 ? -20.627 8.084   -48.307 0.45 40.27  ?  148 ARG E CB    1 
ATOM 4010 C CG    A ARG E 1 150 ? -20.524 8.780   -47.072 0.55 41.64  ?  148 ARG E CG    1 
ATOM 4011 C CG    B ARG E 1 150 ? -20.819 8.769   -46.962 0.45 41.73  ?  148 ARG E CG    1 
ATOM 4012 C CD    A ARG E 1 150 ? -19.191 8.603   -46.362 0.55 20.40  ?  148 ARG E CD    1 
ATOM 4013 C CD    B ARG E 1 150 ? -19.530 9.376   -46.436 0.45 40.27  ?  148 ARG E CD    1 
ATOM 4014 N NE    A ARG E 1 150 ? -19.066 9.437   -45.172 0.55 41.58  ?  148 ARG E NE    1 
ATOM 4015 N NE    B ARG E 1 150 ? -19.719 10.103  -45.179 0.45 41.15  ?  148 ARG E NE    1 
ATOM 4016 C CZ    A ARG E 1 150 ? -18.053 9.363   -44.316 0.55 19.04  ?  148 ARG E CZ    1 
ATOM 4017 C CZ    B ARG E 1 150 ? -20.560 11.120  -45.005 0.45 17.48  ?  148 ARG E CZ    1 
ATOM 4018 N NH1   A ARG E 1 150 ? -17.077 8.492   -44.516 0.55 20.47  1  148 ARG E NH1   1 
ATOM 4019 N NH1   B ARG E 1 150 ? -21.318 11.546  -46.004 0.45 17.55  1  148 ARG E NH1   1 
ATOM 4020 N NH2   A ARG E 1 150 ? -18.016 10.158  -43.259 0.55 18.22  ?  148 ARG E NH2   1 
ATOM 4021 N NH2   B ARG E 1 150 ? -20.645 11.712  -43.824 0.45 17.11  ?  148 ARG E NH2   1 
ATOM 4022 N N     . VAL E 1 151 ? -20.902 7.942   -51.310 1.00 39.20  ?  149 VAL E N     1 
ATOM 4023 C CA    . VAL E 1 151 ? -20.530 7.329   -52.577 1.00 41.82  ?  149 VAL E CA    1 
ATOM 4024 C C     . VAL E 1 151 ? -19.302 6.447   -52.398 1.00 45.32  ?  149 VAL E C     1 
ATOM 4025 O O     . VAL E 1 151 ? -19.164 5.421   -53.073 1.00 49.00  ?  149 VAL E O     1 
ATOM 4026 C CB    . VAL E 1 151 ? -20.306 8.417   -53.641 1.00 41.30  ?  149 VAL E CB    1 
ATOM 4027 C CG1   . VAL E 1 151 ? -19.314 7.963   -54.687 1.00 46.03  ?  149 VAL E CG1   1 
ATOM 4028 C CG2   . VAL E 1 151 ? -21.612 8.775   -54.303 1.00 42.76  ?  149 VAL E CG2   1 
ATOM 4029 N N     . LYS E 1 152 ? -18.437 6.782   -51.448 1.00 45.84  ?  150 LYS E N     1 
ATOM 4030 C CA    . LYS E 1 152 ? -17.218 6.023   -51.204 1.00 49.02  ?  150 LYS E CA    1 
ATOM 4031 C C     . LYS E 1 152 ? -16.921 6.003   -49.707 1.00 52.02  ?  150 LYS E C     1 
ATOM 4032 O O     . LYS E 1 152 ? -16.841 7.049   -49.069 1.00 51.16  ?  150 LYS E O     1 
ATOM 4033 C CB    . LYS E 1 152 ? -16.032 6.614   -51.971 1.00 47.17  ?  150 LYS E CB    1 
ATOM 4034 C CG    . LYS E 1 152 ? -16.133 6.519   -53.487 1.00 49.69  ?  150 LYS E CG    1 
ATOM 4035 C CD    . LYS E 1 152 ? -16.148 5.080   -53.974 1.00 55.11  ?  150 LYS E CD    1 
ATOM 4036 C CE    . LYS E 1 152 ? -16.601 5.002   -55.426 1.00 57.09  ?  150 LYS E CE    1 
ATOM 4037 N NZ    . LYS E 1 152 ? -16.949 3.616   -55.844 1.00 60.82  1  150 LYS E NZ    1 
ATOM 4038 O OXT   . LYS E 1 152 ? -16.758 4.949   -49.094 1.00 56.72  ?  150 LYS E OXT   1 
ATOM 4039 N N     . ASP F 1 4   ? 6.273   -5.551  -26.845 1.00 87.31  ?  2   ASP F N     1 
ATOM 4040 C CA    . ASP F 1 4   ? 6.622   -6.216  -28.093 1.00 90.22  ?  2   ASP F CA    1 
ATOM 4041 C C     . ASP F 1 4   ? 5.517   -7.174  -28.525 1.00 92.75  ?  2   ASP F C     1 
ATOM 4042 O O     . ASP F 1 4   ? 5.176   -8.116  -27.810 1.00 93.53  ?  2   ASP F O     1 
ATOM 4043 C CB    . ASP F 1 4   ? 7.950   -6.965  -27.953 1.00 92.26  ?  2   ASP F CB    1 
ATOM 4044 C CG    . ASP F 1 4   ? 8.658   -7.152  -29.282 1.00 93.27  ?  2   ASP F CG    1 
ATOM 4045 O OD1   . ASP F 1 4   ? 9.282   -6.185  -29.766 1.00 92.31  ?  2   ASP F OD1   1 
ATOM 4046 O OD2   . ASP F 1 4   ? 8.594   -8.267  -29.841 1.00 94.75  ?  2   ASP F OD2   1 
ATOM 4047 N N     . SER F 1 5   ? 4.966   -6.916  -29.703 1.00 93.69  ?  3   SER F N     1 
ATOM 4048 C CA    . SER F 1 5   ? 3.883   -7.674  -30.303 1.00 95.36  ?  3   SER F CA    1 
ATOM 4049 C C     . SER F 1 5   ? 4.351   -8.290  -31.614 1.00 100.68 ?  3   SER F C     1 
ATOM 4050 O O     . SER F 1 5   ? 5.307   -7.802  -32.229 1.00 101.84 ?  3   SER F O     1 
ATOM 4051 C CB    . SER F 1 5   ? 2.666   -6.773  -30.554 1.00 90.77  ?  3   SER F CB    1 
ATOM 4052 O OG    . SER F 1 5   ? 2.304   -6.075  -29.376 1.00 87.73  ?  3   SER F OG    1 
ATOM 4053 N N     . PRO F 1 6   ? 3.708   -9.370  -32.069 1.00 104.15 ?  4   PRO F N     1 
ATOM 4054 C CA    . PRO F 1 6   ? 4.157   -10.009 -33.317 1.00 106.65 ?  4   PRO F CA    1 
ATOM 4055 C C     . PRO F 1 6   ? 4.163   -9.073  -34.511 1.00 108.60 ?  4   PRO F C     1 
ATOM 4056 O O     . PRO F 1 6   ? 4.921   -9.306  -35.461 1.00 108.12 ?  4   PRO F O     1 
ATOM 4057 C CB    . PRO F 1 6   ? 3.149   -11.151 -33.504 1.00 106.19 ?  4   PRO F CB    1 
ATOM 4058 C CG    . PRO F 1 6   ? 2.693   -11.470 -32.128 1.00 105.87 ?  4   PRO F CG    1 
ATOM 4059 C CD    . PRO F 1 6   ? 2.683   -10.170 -31.376 1.00 104.24 ?  4   PRO F CD    1 
ATOM 4060 N N     . GLU F 1 7   ? 3.346   -8.021  -34.499 1.00 110.59 ?  5   GLU F N     1 
ATOM 4061 C CA    . GLU F 1 7   ? 3.412   -7.034  -35.569 1.00 109.18 ?  5   GLU F CA    1 
ATOM 4062 C C     . GLU F 1 7   ? 4.579   -6.080  -35.352 1.00 104.12 ?  5   GLU F C     1 
ATOM 4063 O O     . GLU F 1 7   ? 5.218   -5.642  -36.314 1.00 105.53 ?  5   GLU F O     1 
ATOM 4064 C CB    . GLU F 1 7   ? 2.099   -6.258  -35.663 1.00 106.13 ?  5   GLU F CB    1 
ATOM 4065 C CG    . GLU F 1 7   ? 0.856   -7.124  -35.771 1.00 105.99 ?  5   GLU F CG    1 
ATOM 4066 C CD    . GLU F 1 7   ? 0.239   -7.424  -34.423 1.00 106.31 ?  5   GLU F CD    1 
ATOM 4067 O OE1   . GLU F 1 7   ? 0.528   -6.683  -33.460 1.00 105.20 ?  5   GLU F OE1   1 
ATOM 4068 O OE2   . GLU F 1 7   ? -0.538  -8.397  -34.326 1.00 108.31 ?  5   GLU F OE2   1 
ATOM 4069 N N     . ILE F 1 8   ? 4.859   -5.742  -34.092 1.00 93.52  ?  6   ILE F N     1 
ATOM 4070 C CA    . ILE F 1 8   ? 6.007   -4.900  -33.781 1.00 86.68  ?  6   ILE F CA    1 
ATOM 4071 C C     . ILE F 1 8   ? 7.303   -5.641  -34.076 1.00 86.02  ?  6   ILE F C     1 
ATOM 4072 O O     . ILE F 1 8   ? 8.283   -5.048  -34.542 1.00 87.14  ?  6   ILE F O     1 
ATOM 4073 C CB    . ILE F 1 8   ? 5.940   -4.435  -32.315 1.00 82.92  ?  6   ILE F CB    1 
ATOM 4074 C CG1   . ILE F 1 8   ? 4.743   -3.510  -32.103 1.00 76.66  ?  6   ILE F CG1   1 
ATOM 4075 C CG2   . ILE F 1 8   ? 7.223   -3.723  -31.917 1.00 84.02  ?  6   ILE F CG2   1 
ATOM 4076 C CD1   . ILE F 1 8   ? 4.663   -2.930  -30.711 1.00 72.16  ?  6   ILE F CD1   1 
ATOM 4077 N N     . ARG F 1 9   ? 7.326   -6.950  -33.819 1.00 84.07  ?  7   ARG F N     1 
ATOM 4078 C CA    . ARG F 1 9   ? 8.529   -7.737  -34.072 1.00 81.95  ?  7   ARG F CA    1 
ATOM 4079 C C     . ARG F 1 9   ? 8.888   -7.734  -35.551 1.00 82.61  ?  7   ARG F C     1 
ATOM 4080 O O     . ARG F 1 9   ? 10.040  -7.483  -35.923 1.00 82.83  ?  7   ARG F O     1 
ATOM 4081 C CB    . ARG F 1 9   ? 8.329   -9.167  -33.569 1.00 80.83  ?  7   ARG F CB    1 
ATOM 4082 N N     . GLU F 1 10  ? 7.907   -8.001  -36.414 1.00 83.53  ?  8   GLU F N     1 
ATOM 4083 C CA    . GLU F 1 10  ? 8.148   -7.939  -37.850 1.00 87.66  ?  8   GLU F CA    1 
ATOM 4084 C C     . GLU F 1 10  ? 8.493   -6.531  -38.309 1.00 88.71  ?  8   GLU F C     1 
ATOM 4085 O O     . GLU F 1 10  ? 9.099   -6.367  -39.373 1.00 89.46  ?  8   GLU F O     1 
ATOM 4086 C CB    . GLU F 1 10  ? 6.925   -8.452  -38.610 1.00 88.06  ?  8   GLU F CB    1 
ATOM 4087 N N     . LEU F 1 11  ? 8.123   -5.516  -37.529 1.00 88.08  ?  9   LEU F N     1 
ATOM 4088 C CA    . LEU F 1 11  ? 8.387   -4.134  -37.906 1.00 87.17  ?  9   LEU F CA    1 
ATOM 4089 C C     . LEU F 1 11  ? 9.839   -3.740  -37.660 1.00 89.91  ?  9   LEU F C     1 
ATOM 4090 O O     . LEU F 1 11  ? 10.457  -3.094  -38.513 1.00 88.62  ?  9   LEU F O     1 
ATOM 4091 C CB    . LEU F 1 11  ? 7.445   -3.210  -37.137 1.00 82.27  ?  9   LEU F CB    1 
ATOM 4092 C CG    . LEU F 1 11  ? 6.764   -2.076  -37.898 1.00 78.88  ?  9   LEU F CG    1 
ATOM 4093 C CD1   . LEU F 1 11  ? 6.049   -2.610  -39.121 1.00 78.35  ?  9   LEU F CD1   1 
ATOM 4094 C CD2   . LEU F 1 11  ? 5.787   -1.371  -36.980 1.00 76.19  ?  9   LEU F CD2   1 
ATOM 4095 N N     . GLU F 1 12  ? 10.398  -4.109  -36.505 1.00 94.52  ?  10  GLU F N     1 
ATOM 4096 C CA    . GLU F 1 12  ? 11.803  -3.812  -36.237 1.00 97.59  ?  10  GLU F CA    1 
ATOM 4097 C C     . GLU F 1 12  ? 12.719  -4.515  -37.229 1.00 100.48 ?  10  GLU F C     1 
ATOM 4098 O O     . GLU F 1 12  ? 13.626  -3.898  -37.798 1.00 103.19 ?  10  GLU F O     1 
ATOM 4099 C CB    . GLU F 1 12  ? 12.175  -4.212  -34.808 1.00 99.33  ?  10  GLU F CB    1 
ATOM 4100 C CG    . GLU F 1 12  ? 11.511  -3.397  -33.715 1.00 98.39  ?  10  GLU F CG    1 
ATOM 4101 C CD    . GLU F 1 12  ? 12.085  -3.701  -32.344 1.00 101.10 ?  10  GLU F CD    1 
ATOM 4102 O OE1   . GLU F 1 12  ? 12.209  -4.895  -32.000 1.00 103.84 ?  10  GLU F OE1   1 
ATOM 4103 O OE2   . GLU F 1 12  ? 12.417  -2.747  -31.611 1.00 100.79 -1 10  GLU F OE2   1 
ATOM 4104 N N     . LYS F 1 13  ? 12.500  -5.814  -37.442 1.00 99.52  ?  11  LYS F N     1 
ATOM 4105 C CA    . LYS F 1 13  ? 13.379  -6.586  -38.314 1.00 101.65 ?  11  LYS F CA    1 
ATOM 4106 C C     . LYS F 1 13  ? 13.432  -5.992  -39.716 1.00 100.91 ?  11  LYS F C     1 
ATOM 4107 O O     . LYS F 1 13  ? 14.513  -5.824  -40.291 1.00 102.41 ?  11  LYS F O     1 
ATOM 4108 C CB    . LYS F 1 13  ? 12.916  -8.043  -38.362 1.00 104.09 ?  11  LYS F CB    1 
ATOM 4109 N N     . PHE F 1 14  ? 12.272  -5.659  -40.278 1.00 98.06  ?  12  PHE F N     1 
ATOM 4110 C CA    . PHE F 1 14  ? 12.243  -5.090  -41.620 1.00 95.39  ?  12  PHE F CA    1 
ATOM 4111 C C     . PHE F 1 14  ? 12.892  -3.711  -41.644 1.00 91.58  ?  12  PHE F C     1 
ATOM 4112 O O     . PHE F 1 14  ? 13.675  -3.398  -42.547 1.00 91.51  ?  12  PHE F O     1 
ATOM 4113 C CB    . PHE F 1 14  ? 10.798  -5.032  -42.123 1.00 93.54  ?  12  PHE F CB    1 
ATOM 4114 C CG    . PHE F 1 14  ? 10.663  -4.597  -43.554 1.00 93.92  ?  12  PHE F CG    1 
ATOM 4115 C CD1   . PHE F 1 14  ? 10.844  -3.276  -43.921 1.00 93.43  ?  12  PHE F CD1   1 
ATOM 4116 C CD2   . PHE F 1 14  ? 10.324  -5.513  -44.530 1.00 95.62  ?  12  PHE F CD2   1 
ATOM 4117 C CE1   . PHE F 1 14  ? 10.717  -2.885  -45.231 1.00 94.47  ?  12  PHE F CE1   1 
ATOM 4118 C CE2   . PHE F 1 14  ? 10.193  -5.125  -45.843 1.00 96.77  ?  12  PHE F CE2   1 
ATOM 4119 C CZ    . PHE F 1 14  ? 10.390  -3.808  -46.192 1.00 96.02  ?  12  PHE F CZ    1 
ATOM 4120 N N     . ALA F 1 15  ? 12.566  -2.868  -40.663 1.00 88.49  ?  13  ALA F N     1 
ATOM 4121 C CA    . ALA F 1 15  ? 13.130  -1.523  -40.628 1.00 86.49  ?  13  ALA F CA    1 
ATOM 4122 C C     . ALA F 1 15  ? 14.645  -1.552  -40.482 1.00 90.06  ?  13  ALA F C     1 
ATOM 4123 O O     . ALA F 1 15  ? 15.352  -0.765  -41.121 1.00 93.67  ?  13  ALA F O     1 
ATOM 4124 C CB    . ALA F 1 15  ? 12.499  -0.723  -39.495 1.00 80.97  ?  13  ALA F CB    1 
ATOM 4125 N N     . ASN F 1 16  ? 15.164  -2.447  -39.640 1.00 87.36  ?  14  ASN F N     1 
ATOM 4126 C CA    . ASN F 1 16  ? 16.611  -2.568  -39.509 1.00 86.23  ?  14  ASN F CA    1 
ATOM 4127 C C     . ASN F 1 16  ? 17.227  -3.112  -40.789 1.00 86.38  ?  14  ASN F C     1 
ATOM 4128 O O     . ASN F 1 16  ? 18.274  -2.631  -41.235 1.00 86.74  ?  14  ASN F O     1 
ATOM 4129 C CB    . ASN F 1 16  ? 16.968  -3.449  -38.314 1.00 88.07  ?  14  ASN F CB    1 
ATOM 4130 C CG    . ASN F 1 16  ? 16.473  -2.877  -37.001 1.00 87.34  ?  14  ASN F CG    1 
ATOM 4131 O OD1   . ASN F 1 16  ? 15.875  -3.583  -36.190 1.00 87.60  ?  14  ASN F OD1   1 
ATOM 4132 N ND2   . ASN F 1 16  ? 16.718  -1.591  -36.786 1.00 86.32  ?  14  ASN F ND2   1 
ATOM 4133 N N     . GLU F 1 17  ? 16.589  -4.116  -41.394 1.00 86.38  ?  15  GLU F N     1 
ATOM 4134 C CA    . GLU F 1 17  ? 17.095  -4.654  -42.649 1.00 88.22  ?  15  GLU F CA    1 
ATOM 4135 C C     . GLU F 1 17  ? 17.015  -3.614  -43.755 1.00 88.11  ?  15  GLU F C     1 
ATOM 4136 O O     . GLU F 1 17  ? 17.865  -3.589  -44.650 1.00 89.56  ?  15  GLU F O     1 
ATOM 4137 C CB    . GLU F 1 17  ? 16.318  -5.911  -43.036 1.00 88.71  ?  15  GLU F CB    1 
ATOM 4138 N N     . PHE F 1 18  ? 15.993  -2.760  -43.718 1.00 86.64  ?  16  PHE F N     1 
ATOM 4139 C CA    . PHE F 1 18  ? 15.907  -1.668  -44.678 1.00 85.46  ?  16  PHE F CA    1 
ATOM 4140 C C     . PHE F 1 18  ? 17.055  -0.683  -44.495 1.00 87.09  ?  16  PHE F C     1 
ATOM 4141 O O     . PHE F 1 18  ? 17.529  -0.092  -45.470 1.00 88.68  ?  16  PHE F O     1 
ATOM 4142 C CB    . PHE F 1 18  ? 14.561  -0.959  -44.534 1.00 80.16  ?  16  PHE F CB    1 
ATOM 4143 C CG    . PHE F 1 18  ? 14.385  0.205   -45.461 1.00 77.38  ?  16  PHE F CG    1 
ATOM 4144 C CD1   . PHE F 1 18  ? 14.081  -0.001  -46.792 1.00 76.97  ?  16  PHE F CD1   1 
ATOM 4145 C CD2   . PHE F 1 18  ? 14.578  1.499   -45.019 1.00 75.94  ?  16  PHE F CD2   1 
ATOM 4146 C CE1   . PHE F 1 18  ? 13.927  1.062   -47.652 1.00 76.24  ?  16  PHE F CE1   1 
ATOM 4147 C CE2   . PHE F 1 18  ? 14.429  2.567   -45.878 1.00 75.00  ?  16  PHE F CE2   1 
ATOM 4148 C CZ    . PHE F 1 18  ? 14.105  2.347   -47.197 1.00 74.98  ?  16  PHE F CZ    1 
ATOM 4149 N N     . LYS F 1 19  ? 17.514  -0.498  -43.256 1.00 86.70  ?  17  LYS F N     1 
ATOM 4150 C CA    . LYS F 1 19  ? 18.577  0.463   -42.979 1.00 86.77  ?  17  LYS F CA    1 
ATOM 4151 C C     . LYS F 1 19  ? 19.902  0.028   -43.592 1.00 91.38  ?  17  LYS F C     1 
ATOM 4152 O O     . LYS F 1 19  ? 20.588  0.828   -44.239 1.00 94.04  ?  17  LYS F O     1 
ATOM 4153 C CB    . LYS F 1 19  ? 18.724  0.641   -41.468 1.00 84.77  ?  17  LYS F CB    1 
ATOM 4154 C CG    . LYS F 1 19  ? 19.684  1.734   -41.039 1.00 84.31  ?  17  LYS F CG    1 
ATOM 4155 C CD    . LYS F 1 19  ? 19.209  3.111   -41.449 1.00 82.70  ?  17  LYS F CD    1 
ATOM 4156 C CE    . LYS F 1 19  ? 19.561  4.133   -40.382 1.00 81.07  ?  17  LYS F CE    1 
ATOM 4157 N NZ    . LYS F 1 19  ? 20.943  3.954   -39.865 1.00 81.87  1  17  LYS F NZ    1 
ATOM 4158 N N     . VAL F 1 20  ? 20.284  -1.235  -43.397 1.00 91.86  ?  18  VAL F N     1 
ATOM 4159 C CA    . VAL F 1 20  ? 21.553  -1.719  -43.935 1.00 91.98  ?  18  VAL F CA    1 
ATOM 4160 C C     . VAL F 1 20  ? 21.524  -1.720  -45.459 1.00 92.93  ?  18  VAL F C     1 
ATOM 4161 O O     . VAL F 1 20  ? 22.448  -1.223  -46.113 1.00 94.71  ?  18  VAL F O     1 
ATOM 4162 C CB    . VAL F 1 20  ? 21.890  -3.112  -43.371 1.00 90.70  ?  18  VAL F CB    1 
ATOM 4163 C CG1   . VAL F 1 20  ? 22.525  -2.984  -41.998 1.00 88.48  ?  18  VAL F CG1   1 
ATOM 4164 C CG2   . VAL F 1 20  ? 20.649  -3.979  -43.296 1.00 89.37  ?  18  VAL F CG2   1 
ATOM 4165 N N     . ARG F 1 21  ? 20.468  -2.285  -46.046 1.00 91.47  ?  19  ARG F N     1 
ATOM 4166 C CA    . ARG F 1 21  ? 20.380  -2.355  -47.499 1.00 93.52  ?  19  ARG F CA    1 
ATOM 4167 C C     . ARG F 1 21  ? 20.311  -0.967  -48.124 1.00 92.33  ?  19  ARG F C     1 
ATOM 4168 O O     . ARG F 1 21  ? 20.727  -0.782  -49.271 1.00 95.05  ?  19  ARG F O     1 
ATOM 4169 C CB    . ARG F 1 21  ? 19.167  -3.187  -47.912 1.00 94.43  ?  19  ARG F CB    1 
ATOM 4170 C CG    . ARG F 1 21  ? 19.202  -4.623  -47.404 1.00 95.86  ?  19  ARG F CG    1 
ATOM 4171 C CD    . ARG F 1 21  ? 20.034  -5.553  -48.276 1.00 87.34  ?  19  ARG F CD    1 
ATOM 4172 N NE    . ARG F 1 21  ? 19.994  -5.211  -49.693 1.00 88.67  ?  19  ARG F NE    1 
ATOM 4173 C CZ    . ARG F 1 21  ? 20.896  -5.622  -50.580 1.00 91.55  ?  19  ARG F CZ    1 
ATOM 4174 N NH1   . ARG F 1 21  ? 21.902  -6.393  -50.194 1.00 92.27  ?  19  ARG F NH1   1 
ATOM 4175 N NH2   . ARG F 1 21  ? 20.789  -5.272  -51.852 1.00 92.27  ?  19  ARG F NH2   1 
ATOM 4176 N N     . ARG F 1 22  ? 19.793  0.019   -47.390 1.00 87.84  ?  20  ARG F N     1 
ATOM 4177 C CA    . ARG F 1 22  ? 19.766  1.384   -47.906 1.00 85.06  ?  20  ARG F CA    1 
ATOM 4178 C C     . ARG F 1 22  ? 21.171  1.957   -48.025 1.00 85.41  ?  20  ARG F C     1 
ATOM 4179 O O     . ARG F 1 22  ? 21.493  2.630   -49.011 1.00 85.75  ?  20  ARG F O     1 
ATOM 4180 C CB    . ARG F 1 22  ? 18.892  2.260   -47.007 1.00 80.86  ?  20  ARG F CB    1 
ATOM 4181 C CG    . ARG F 1 22  ? 18.825  3.727   -47.395 1.00 79.63  ?  20  ARG F CG    1 
ATOM 4182 C CD    . ARG F 1 22  ? 18.366  4.568   -46.214 1.00 77.72  ?  20  ARG F CD    1 
ATOM 4183 N NE    . ARG F 1 22  ? 19.456  5.006   -45.349 1.00 77.60  ?  20  ARG F NE    1 
ATOM 4184 C CZ    . ARG F 1 22  ? 20.141  6.129   -45.526 1.00 78.46  ?  20  ARG F CZ    1 
ATOM 4185 N NH1   . ARG F 1 22  ? 19.852  6.926   -46.541 1.00 79.69  1  20  ARG F NH1   1 
ATOM 4186 N NH2   . ARG F 1 22  ? 21.114  6.456   -44.689 1.00 78.07  ?  20  ARG F NH2   1 
ATOM 4187 N N     . ILE F 1 23  ? 22.020  1.708   -47.031 1.00 84.58  ?  21  ILE F N     1 
ATOM 4188 C CA    . ILE F 1 23  ? 23.383  2.220   -47.081 1.00 87.02  ?  21  ILE F CA    1 
ATOM 4189 C C     . ILE F 1 23  ? 24.225  1.414   -48.061 1.00 90.83  ?  21  ILE F C     1 
ATOM 4190 O O     . ILE F 1 23  ? 25.002  1.980   -48.838 1.00 92.21  ?  21  ILE F O     1 
ATOM 4191 C CB    . ILE F 1 23  ? 23.999  2.225   -45.672 1.00 81.21  ?  21  ILE F CB    1 
ATOM 4192 C CG1   . ILE F 1 23  ? 23.210  3.159   -44.756 1.00 78.67  ?  21  ILE F CG1   1 
ATOM 4193 C CG2   . ILE F 1 23  ? 25.457  2.643   -45.734 1.00 82.67  ?  21  ILE F CG2   1 
ATOM 4194 C CD1   . ILE F 1 23  ? 23.693  3.169   -43.329 1.00 77.82  ?  21  ILE F CD1   1 
ATOM 4195 N N     . LYS F 1 24  ? 24.084  0.086   -48.039 1.00 91.83  ?  22  LYS F N     1 
ATOM 4196 C CA    . LYS F 1 24  ? 24.850  -0.766  -48.944 1.00 93.74  ?  22  LYS F CA    1 
ATOM 4197 C C     . LYS F 1 24  ? 24.613  -0.416  -50.407 1.00 94.91  ?  22  LYS F C     1 
ATOM 4198 O O     . LYS F 1 24  ? 25.512  -0.591  -51.236 1.00 98.02  ?  22  LYS F O     1 
ATOM 4199 C CB    . LYS F 1 24  ? 24.505  -2.234  -48.693 1.00 88.74  ?  22  LYS F CB    1 
ATOM 4200 N N     . LEU F 1 25  ? 23.428  0.080   -50.746 1.00 92.84  ?  23  LEU F N     1 
ATOM 4201 C CA    . LEU F 1 25  ? 23.152  0.524   -52.106 1.00 93.17  ?  23  LEU F CA    1 
ATOM 4202 C C     . LEU F 1 25  ? 23.573  1.964   -52.359 1.00 92.13  ?  23  LEU F C     1 
ATOM 4203 O O     . LEU F 1 25  ? 23.383  2.461   -53.473 1.00 92.30  ?  23  LEU F O     1 
ATOM 4204 C CB    . LEU F 1 25  ? 21.667  0.355   -52.438 1.00 92.38  ?  23  LEU F CB    1 
ATOM 4205 C CG    . LEU F 1 25  ? 21.163  -1.024  -52.877 1.00 94.09  ?  23  LEU F CG    1 
ATOM 4206 C CD1   . LEU F 1 25  ? 21.620  -2.147  -51.961 1.00 94.37  ?  23  LEU F CD1   1 
ATOM 4207 C CD2   . LEU F 1 25  ? 19.646  -1.011  -53.007 1.00 93.41  ?  23  LEU F CD2   1 
ATOM 4208 N N     . GLY F 1 26  ? 24.122  2.646   -51.360 1.00 91.18  ?  24  GLY F N     1 
ATOM 4209 C CA    . GLY F 1 26  ? 24.625  3.987   -51.576 1.00 92.23  ?  24  GLY F CA    1 
ATOM 4210 C C     . GLY F 1 26  ? 23.550  5.036   -51.726 1.00 91.81  ?  24  GLY F C     1 
ATOM 4211 O O     . GLY F 1 26  ? 23.776  6.056   -52.386 1.00 92.75  ?  24  GLY F O     1 
ATOM 4212 N N     . TYR F 1 27  ? 22.386  4.821   -51.123 1.00 89.97  ?  25  TYR F N     1 
ATOM 4213 C CA    . TYR F 1 27  ? 21.297  5.784   -51.159 1.00 87.63  ?  25  TYR F CA    1 
ATOM 4214 C C     . TYR F 1 27  ? 21.293  6.616   -49.886 1.00 84.52  ?  25  TYR F C     1 
ATOM 4215 O O     . TYR F 1 27  ? 21.494  6.091   -48.788 1.00 82.16  ?  25  TYR F O     1 
ATOM 4216 C CB    . TYR F 1 27  ? 19.943  5.086   -51.312 1.00 86.52  ?  25  TYR F CB    1 
ATOM 4217 C CG    . TYR F 1 27  ? 19.631  4.588   -52.704 1.00 87.65  ?  25  TYR F CG    1 
ATOM 4218 C CD1   . TYR F 1 27  ? 19.127  5.447   -53.672 1.00 87.34  ?  25  TYR F CD1   1 
ATOM 4219 C CD2   . TYR F 1 27  ? 19.803  3.255   -53.040 1.00 88.73  ?  25  TYR F CD2   1 
ATOM 4220 C CE1   . TYR F 1 27  ? 18.830  4.997   -54.942 1.00 88.30  ?  25  TYR F CE1   1 
ATOM 4221 C CE2   . TYR F 1 27  ? 19.506  2.794   -54.308 1.00 90.10  ?  25  TYR F CE2   1 
ATOM 4222 C CZ    . TYR F 1 27  ? 19.019  3.670   -55.253 1.00 89.70  ?  25  TYR F CZ    1 
ATOM 4223 O OH    . TYR F 1 27  ? 18.719  3.218   -56.516 1.00 89.88  ?  25  TYR F OH    1 
ATOM 4224 N N     . THR F 1 28  ? 21.071  7.915   -50.041 1.00 84.36  ?  26  THR F N     1 
ATOM 4225 C CA    . THR F 1 28  ? 20.827  8.779   -48.900 1.00 82.77  ?  26  THR F CA    1 
ATOM 4226 C C     . THR F 1 28  ? 19.333  8.835   -48.613 1.00 83.43  ?  26  THR F C     1 
ATOM 4227 O O     . THR F 1 28  ? 18.503  8.489   -49.455 1.00 84.55  ?  26  THR F O     1 
ATOM 4228 C CB    . THR F 1 28  ? 21.368  10.188  -49.145 1.00 82.13  ?  26  THR F CB    1 
ATOM 4229 O OG1   . THR F 1 28  ? 20.615  10.819  -50.187 1.00 77.93  ?  26  THR F OG1   1 
ATOM 4230 C CG2   . THR F 1 28  ? 22.832  10.137  -49.539 1.00 85.61  ?  26  THR F CG2   1 
ATOM 4231 N N     . GLN F 1 29  ? 18.999  9.265   -47.394 1.00 82.82  ?  27  GLN F N     1 
ATOM 4232 C CA    . GLN F 1 29  ? 17.596  9.365   -47.009 1.00 70.88  ?  27  GLN F CA    1 
ATOM 4233 C C     . GLN F 1 29  ? 16.818  10.244  -47.977 1.00 86.46  ?  27  GLN F C     1 
ATOM 4234 O O     . GLN F 1 29  ? 15.666  9.946   -48.310 1.00 85.61  ?  27  GLN F O     1 
ATOM 4235 C CB    . GLN F 1 29  ? 17.475  9.892   -45.583 1.00 68.72  ?  27  GLN F CB    1 
ATOM 4236 C CG    . GLN F 1 29  ? 17.631  8.815   -44.530 1.00 68.63  ?  27  GLN F CG    1 
ATOM 4237 C CD    . GLN F 1 29  ? 17.600  9.367   -43.130 1.00 66.41  ?  27  GLN F CD    1 
ATOM 4238 O OE1   . GLN F 1 29  ? 17.543  10.579  -42.932 1.00 65.48  ?  27  GLN F OE1   1 
ATOM 4239 N NE2   . GLN F 1 29  ? 17.642  8.481   -42.144 1.00 65.97  ?  27  GLN F NE2   1 
ATOM 4240 N N     . THR F 1 30  ? 17.431  11.330  -48.445 1.00 71.56  ?  28  THR F N     1 
ATOM 4241 C CA    . THR F 1 30  ? 16.767  12.155  -49.443 1.00 84.91  ?  28  THR F CA    1 
ATOM 4242 C C     . THR F 1 30  ? 16.607  11.415  -50.764 1.00 89.72  ?  28  THR F C     1 
ATOM 4243 O O     . THR F 1 30  ? 15.602  11.603  -51.455 1.00 91.63  ?  28  THR F O     1 
ATOM 4244 C CB    . THR F 1 30  ? 17.538  13.456  -49.646 1.00 83.66  ?  28  THR F CB    1 
ATOM 4245 O OG1   . THR F 1 30  ? 17.773  14.073  -48.374 1.00 81.23  ?  28  THR F OG1   1 
ATOM 4246 C CG2   . THR F 1 30  ? 16.746  14.412  -50.520 1.00 82.82  ?  28  THR F CG2   1 
ATOM 4247 N N     . ASN F 1 31  ? 17.560  10.548  -51.117 1.00 92.43  ?  29  ASN F N     1 
ATOM 4248 C CA    . ASN F 1 31  ? 17.460  9.832   -52.386 1.00 97.37  ?  29  ASN F CA    1 
ATOM 4249 C C     . ASN F 1 31  ? 16.327  8.815   -52.363 1.00 100.56 ?  29  ASN F C     1 
ATOM 4250 O O     . ASN F 1 31  ? 15.575  8.698   -53.337 1.00 102.05 ?  29  ASN F O     1 
ATOM 4251 C CB    . ASN F 1 31  ? 18.784  9.145   -52.720 1.00 97.33  ?  29  ASN F CB    1 
ATOM 4252 C CG    . ASN F 1 31  ? 19.853  10.120  -53.160 1.00 96.58  ?  29  ASN F CG    1 
ATOM 4253 O OD1   . ASN F 1 31  ? 20.705  10.526  -52.372 1.00 95.93  ?  29  ASN F OD1   1 
ATOM 4254 N ND2   . ASN F 1 31  ? 19.818  10.497  -54.431 1.00 97.39  ?  29  ASN F ND2   1 
ATOM 4255 N N     . VAL F 1 32  ? 16.192  8.065   -51.269 1.00 98.07  ?  30  VAL F N     1 
ATOM 4256 C CA    . VAL F 1 32  ? 15.076  7.130   -51.156 1.00 75.15  ?  30  VAL F CA    1 
ATOM 4257 C C     . VAL F 1 32  ? 13.761  7.892   -51.181 1.00 110.49 ?  30  VAL F C     1 
ATOM 4258 O O     . VAL F 1 32  ? 12.773  7.444   -51.776 1.00 73.60  ?  30  VAL F O     1 
ATOM 4259 C CB    . VAL F 1 32  ? 15.215  6.271   -49.888 1.00 74.05  ?  30  VAL F CB    1 
ATOM 4260 C CG1   . VAL F 1 32  ? 14.384  5.011   -50.013 1.00 74.34  ?  30  VAL F CG1   1 
ATOM 4261 C CG2   . VAL F 1 32  ? 16.668  5.919   -49.652 1.00 77.84  ?  30  VAL F CG2   1 
ATOM 4262 N N     . GLY F 1 33  ? 13.725  9.047   -50.517 1.00 110.67 ?  31  GLY F N     1 
ATOM 4263 C CA    . GLY F 1 33  ? 12.537  9.881   -50.554 1.00 102.67 ?  31  GLY F CA    1 
ATOM 4264 C C     . GLY F 1 33  ? 12.184  10.341  -51.955 1.00 101.72 ?  31  GLY F C     1 
ATOM 4265 O O     . GLY F 1 33  ? 11.010  10.540  -52.273 1.00 100.69 ?  31  GLY F O     1 
ATOM 4266 N N     . GLU F 1 34  ? 13.194  10.572  -52.795 1.00 99.19  ?  32  GLU F N     1 
ATOM 4267 C CA    . GLU F 1 34  ? 12.922  10.992  -54.166 1.00 99.47  ?  32  GLU F CA    1 
ATOM 4268 C C     . GLU F 1 34  ? 12.564  9.811   -55.062 1.00 98.60  ?  32  GLU F C     1 
ATOM 4269 O O     . GLU F 1 34  ? 11.613  9.883   -55.847 1.00 97.52  ?  32  GLU F O     1 
ATOM 4270 C CB    . GLU F 1 34  ? 14.132  11.735  -54.740 1.00 103.98 ?  32  GLU F CB    1 
ATOM 4271 C CG    . GLU F 1 34  ? 14.522  12.997  -53.993 1.00 103.62 ?  32  GLU F CG    1 
ATOM 4272 C CD    . GLU F 1 34  ? 15.613  13.781  -54.703 1.00 105.31 ?  32  GLU F CD    1 
ATOM 4273 O OE1   . GLU F 1 34  ? 16.062  14.811  -54.157 1.00 104.04 ?  32  GLU F OE1   1 
ATOM 4274 O OE2   . GLU F 1 34  ? 16.024  13.363  -55.806 1.00 107.10 -1 32  GLU F OE2   1 
ATOM 4275 N N     . ALA F 1 35  ? 13.312  8.716   -54.956 1.00 99.91  ?  33  ALA F N     1 
ATOM 4276 C CA    . ALA F 1 35  ? 13.187  7.599   -55.882 1.00 102.37 ?  33  ALA F CA    1 
ATOM 4277 C C     . ALA F 1 35  ? 12.072  6.615   -55.538 1.00 101.33 ?  33  ALA F C     1 
ATOM 4278 O O     . ALA F 1 35  ? 12.150  5.467   -55.986 1.00 103.08 ?  33  ALA F O     1 
ATOM 4279 C CB    . ALA F 1 35  ? 14.521  6.852   -55.970 1.00 104.41 ?  33  ALA F CB    1 
ATOM 4280 N N     . LEU F 1 36  ? 11.041  6.995   -54.785 1.00 99.01  ?  34  LEU F N     1 
ATOM 4281 C CA    . LEU F 1 36  ? 9.952   6.068   -54.504 1.00 97.73  ?  34  LEU F CA    1 
ATOM 4282 C C     . LEU F 1 36  ? 8.666   6.423   -55.235 1.00 96.17  ?  34  LEU F C     1 
ATOM 4283 O O     . LEU F 1 36  ? 7.703   5.654   -55.165 1.00 95.92  ?  34  LEU F O     1 
ATOM 4284 C CB    . LEU F 1 36  ? 9.677   5.963   -52.995 1.00 95.14  ?  34  LEU F CB    1 
ATOM 4285 C CG    . LEU F 1 36  ? 8.650   6.855   -52.304 1.00 93.01  ?  34  LEU F CG    1 
ATOM 4286 C CD1   . LEU F 1 36  ? 8.483   6.403   -50.865 1.00 91.14  ?  34  LEU F CD1   1 
ATOM 4287 C CD2   . LEU F 1 36  ? 9.040   8.297   -52.362 1.00 92.83  ?  34  LEU F CD2   1 
ATOM 4288 N N     . ALA F 1 37  ? 8.627   7.565   -55.925 1.00 93.62  ?  35  ALA F N     1 
ATOM 4289 C CA    . ALA F 1 37  ? 7.451   7.961   -56.693 1.00 93.60  ?  35  ALA F CA    1 
ATOM 4290 C C     . ALA F 1 37  ? 7.057   6.938   -57.750 1.00 95.14  ?  35  ALA F C     1 
ATOM 4291 O O     . ALA F 1 37  ? 5.931   6.992   -58.256 1.00 94.31  ?  35  ALA F O     1 
ATOM 4292 C CB    . ALA F 1 37  ? 7.698   9.317   -57.354 1.00 95.03  ?  35  ALA F CB    1 
ATOM 4293 N N     . ALA F 1 38  ? 7.952   6.016   -58.106 1.00 96.06  ?  36  ALA F N     1 
ATOM 4294 C CA    . ALA F 1 38  ? 7.613   5.009   -59.104 1.00 95.51  ?  36  ALA F CA    1 
ATOM 4295 C C     . ALA F 1 38  ? 6.602   4.006   -58.565 1.00 95.02  ?  36  ALA F C     1 
ATOM 4296 O O     . ALA F 1 38  ? 5.809   3.452   -59.335 1.00 97.48  ?  36  ALA F O     1 
ATOM 4297 C CB    . ALA F 1 38  ? 8.875   4.290   -59.577 1.00 95.04  ?  36  ALA F CB    1 
ATOM 4298 N N     . VAL F 1 39  ? 6.617   3.757   -57.257 1.00 91.90  ?  37  VAL F N     1 
ATOM 4299 C CA    . VAL F 1 39  ? 5.718   2.802   -56.619 1.00 89.66  ?  37  VAL F CA    1 
ATOM 4300 C C     . VAL F 1 39  ? 4.642   3.492   -55.797 1.00 84.31  ?  37  VAL F C     1 
ATOM 4301 O O     . VAL F 1 39  ? 3.741   2.819   -55.274 1.00 81.13  ?  37  VAL F O     1 
ATOM 4302 C CB    . VAL F 1 39  ? 6.508   1.805   -55.746 1.00 89.48  ?  37  VAL F CB    1 
ATOM 4303 C CG1   . VAL F 1 39  ? 5.698   0.545   -55.462 1.00 90.11  ?  37  VAL F CG1   1 
ATOM 4304 C CG2   . VAL F 1 39  ? 7.830   1.460   -56.404 1.00 90.93  ?  37  VAL F CG2   1 
ATOM 4305 N N     . HIS F 1 40  ? 4.686   4.816   -55.690 1.00 82.75  ?  38  HIS F N     1 
ATOM 4306 C CA    . HIS F 1 40  ? 3.775   5.561   -54.837 1.00 80.84  ?  38  HIS F CA    1 
ATOM 4307 C C     . HIS F 1 40  ? 3.002   6.650   -55.563 1.00 83.54  ?  38  HIS F C     1 
ATOM 4308 O O     . HIS F 1 40  ? 1.847   6.899   -55.213 1.00 80.41  ?  38  HIS F O     1 
ATOM 4309 C CB    . HIS F 1 40  ? 4.559   6.191   -53.672 1.00 78.90  ?  38  HIS F CB    1 
ATOM 4310 C CG    . HIS F 1 40  ? 3.703   6.889   -52.662 1.00 76.79  ?  38  HIS F CG    1 
ATOM 4311 N ND1   . HIS F 1 40  ? 3.080   6.224   -51.629 1.00 75.36  ?  38  HIS F ND1   1 
ATOM 4312 C CD2   . HIS F 1 40  ? 3.381   8.195   -52.517 1.00 75.28  ?  38  HIS F CD2   1 
ATOM 4313 C CE1   . HIS F 1 40  ? 2.402   7.088   -50.897 1.00 72.51  ?  38  HIS F CE1   1 
ATOM 4314 N NE2   . HIS F 1 40  ? 2.567   8.292   -51.415 1.00 72.19  ?  38  HIS F NE2   1 
ATOM 4315 N N     . GLY F 1 41  ? 3.595   7.297   -56.562 1.00 89.56  ?  39  GLY F N     1 
ATOM 4316 C CA    . GLY F 1 41  ? 2.947   8.377   -57.273 1.00 93.21  ?  39  GLY F CA    1 
ATOM 4317 C C     . GLY F 1 41  ? 3.302   9.756   -56.769 1.00 94.39  ?  39  GLY F C     1 
ATOM 4318 O O     . GLY F 1 41  ? 2.793   10.746  -57.307 1.00 96.81  ?  39  GLY F O     1 
ATOM 4319 N N     . SER F 1 42  ? 4.160   9.847   -55.759 1.00 93.06  ?  40  SER F N     1 
ATOM 4320 C CA    . SER F 1 42  ? 4.572   11.090  -55.127 1.00 94.41  ?  40  SER F CA    1 
ATOM 4321 C C     . SER F 1 42  ? 5.757   10.775  -54.232 1.00 96.70  ?  40  SER F C     1 
ATOM 4322 O O     . SER F 1 42  ? 5.865   9.666   -53.704 1.00 101.21 ?  40  SER F O     1 
ATOM 4323 C CB    . SER F 1 42  ? 3.435   11.722  -54.314 1.00 91.50  ?  40  SER F CB    1 
ATOM 4324 N N     . GLU F 1 43  ? 6.638   11.752  -54.065 1.00 91.60  ?  41  GLU F N     1 
ATOM 4325 C CA    . GLU F 1 43  ? 7.881   11.528  -53.346 1.00 88.92  ?  41  GLU F CA    1 
ATOM 4326 C C     . GLU F 1 43  ? 7.732   11.907  -51.877 1.00 84.14  ?  41  GLU F C     1 
ATOM 4327 O O     . GLU F 1 43  ? 6.808   12.619  -51.483 1.00 81.39  ?  41  GLU F O     1 
ATOM 4328 C CB    . GLU F 1 43  ? 9.022   12.316  -53.997 1.00 91.60  ?  41  GLU F CB    1 
ATOM 4329 C CG    . GLU F 1 43  ? 8.676   13.753  -54.345 1.00 92.21  ?  41  GLU F CG    1 
ATOM 4330 C CD    . GLU F 1 43  ? 9.710   14.392  -55.252 1.00 94.64  ?  41  GLU F CD    1 
ATOM 4331 O OE1   . GLU F 1 43  ? 9.826   15.635  -55.251 1.00 94.25  ?  41  GLU F OE1   1 
ATOM 4332 O OE2   . GLU F 1 43  ? 10.403  13.647  -55.975 1.00 96.81  ?  41  GLU F OE2   1 
ATOM 4333 N N     . PHE F 1 44  ? 8.659   11.405  -51.064 1.00 84.11  ?  42  PHE F N     1 
ATOM 4334 C CA    . PHE F 1 44  ? 8.678   11.668  -49.639 1.00 79.89  ?  42  PHE F CA    1 
ATOM 4335 C C     . PHE F 1 44  ? 9.886   12.532  -49.274 1.00 79.05  ?  42  PHE F C     1 
ATOM 4336 O O     . PHE F 1 44  ? 10.512  13.151  -50.146 1.00 80.81  ?  42  PHE F O     1 
ATOM 4337 C CB    . PHE F 1 44  ? 8.651   10.338  -48.883 1.00 78.76  ?  42  PHE F CB    1 
ATOM 4338 C CG    . PHE F 1 44  ? 7.280   9.737   -48.762 1.00 78.19  ?  42  PHE F CG    1 
ATOM 4339 C CD1   . PHE F 1 44  ? 6.152   10.498  -49.001 1.00 77.57  ?  42  PHE F CD1   1 
ATOM 4340 C CD2   . PHE F 1 44  ? 7.118   8.414   -48.403 1.00 78.65  ?  42  PHE F CD2   1 
ATOM 4341 C CE1   . PHE F 1 44  ? 4.893   9.948   -48.889 1.00 76.63  ?  42  PHE F CE1   1 
ATOM 4342 C CE2   . PHE F 1 44  ? 5.861   7.862   -48.293 1.00 77.57  ?  42  PHE F CE2   1 
ATOM 4343 C CZ    . PHE F 1 44  ? 4.749   8.630   -48.534 1.00 76.49  ?  42  PHE F CZ    1 
ATOM 4344 N N     . SER F 1 45  ? 10.210  12.574  -47.986 1.00 75.79  ?  43  SER F N     1 
ATOM 4345 C CA    . SER F 1 45  ? 11.256  13.435  -47.462 1.00 62.17  ?  43  SER F CA    1 
ATOM 4346 C C     . SER F 1 45  ? 12.186  12.625  -46.572 1.00 77.64  ?  43  SER F C     1 
ATOM 4347 O O     . SER F 1 45  ? 11.813  11.578  -46.040 1.00 77.15  ?  43  SER F O     1 
ATOM 4348 C CB    . SER F 1 45  ? 10.667  14.609  -46.673 1.00 59.88  ?  43  SER F CB    1 
ATOM 4349 O OG    . SER F 1 45  ? 9.745   14.149  -45.703 1.00 57.76  ?  43  SER F OG    1 
ATOM 4350 N N     . GLN F 1 46  ? 13.418  13.120  -46.426 1.00 67.57  ?  44  GLN F N     1 
ATOM 4351 C CA    . GLN F 1 46  ? 14.374  12.453  -45.549 1.00 67.45  ?  44  GLN F CA    1 
ATOM 4352 C C     . GLN F 1 46  ? 13.867  12.385  -44.116 1.00 66.67  ?  44  GLN F C     1 
ATOM 4353 O O     . GLN F 1 46  ? 14.171  11.428  -43.397 1.00 67.79  ?  44  GLN F O     1 
ATOM 4354 C CB    . GLN F 1 46  ? 15.730  13.157  -45.603 1.00 66.27  ?  44  GLN F CB    1 
ATOM 4355 C CG    . GLN F 1 46  ? 15.672  14.659  -45.432 1.00 62.57  ?  44  GLN F CG    1 
ATOM 4356 C CD    . GLN F 1 46  ? 16.047  15.092  -44.035 1.00 59.34  ?  44  GLN F CD    1 
ATOM 4357 O OE1   . GLN F 1 46  ? 16.295  14.261  -43.163 1.00 54.64  ?  44  GLN F OE1   1 
ATOM 4358 N NE2   . GLN F 1 46  ? 16.096  16.399  -43.814 1.00 56.72  ?  44  GLN F NE2   1 
ATOM 4359 N N     . THR F 1 47  ? 13.102  13.389  -43.685 1.00 63.89  ?  45  THR F N     1 
ATOM 4360 C CA    . THR F 1 47  ? 12.484  13.340  -42.364 1.00 62.61  ?  45  THR F CA    1 
ATOM 4361 C C     . THR F 1 47  ? 11.548  12.146  -42.252 1.00 61.03  ?  45  THR F C     1 
ATOM 4362 O O     . THR F 1 47  ? 11.607  11.385  -41.281 1.00 61.52  ?  45  THR F O     1 
ATOM 4363 C CB    . THR F 1 47  ? 11.733  14.638  -42.088 1.00 60.59  ?  45  THR F CB    1 
ATOM 4364 O OG1   . THR F 1 47  ? 10.394  14.521  -42.577 1.00 62.06  ?  45  THR F OG1   1 
ATOM 4365 C CG2   . THR F 1 47  ? 12.411  15.789  -42.797 1.00 59.26  ?  45  THR F CG2   1 
ATOM 4366 N N     . THR F 1 48  ? 10.679  11.963  -43.248 1.00 58.11  ?  46  THR F N     1 
ATOM 4367 C CA    . THR F 1 48  ? 9.738   10.850  -43.222 1.00 56.23  ?  46  THR F CA    1 
ATOM 4368 C C     . THR F 1 48  ? 10.469  9.515   -43.211 1.00 56.25  ?  46  THR F C     1 
ATOM 4369 O O     . THR F 1 48  ? 10.103  8.604   -42.460 1.00 55.07  ?  46  THR F O     1 
ATOM 4370 C CB    . THR F 1 48  ? 8.803   10.934  -44.425 1.00 57.71  ?  46  THR F CB    1 
ATOM 4371 O OG1   . THR F 1 48  ? 8.015   12.125  -44.334 1.00 42.75  ?  46  THR F OG1   1 
ATOM 4372 C CG2   . THR F 1 48  ? 7.889   9.728   -44.475 1.00 43.99  ?  46  THR F CG2   1 
ATOM 4373 N N     . ILE F 1 49  ? 11.504  9.381   -44.041 1.00 56.90  ?  47  ILE F N     1 
ATOM 4374 C CA    . ILE F 1 49  ? 12.286  8.149   -44.068 1.00 57.33  ?  47  ILE F CA    1 
ATOM 4375 C C     . ILE F 1 49  ? 12.990  7.936   -42.733 1.00 56.03  ?  47  ILE F C     1 
ATOM 4376 O O     . ILE F 1 49  ? 12.983  6.832   -42.178 1.00 54.68  ?  47  ILE F O     1 
ATOM 4377 C CB    . ILE F 1 49  ? 13.285  8.177   -45.237 1.00 58.82  ?  47  ILE F CB    1 
ATOM 4378 C CG1   . ILE F 1 49  ? 12.549  8.362   -46.563 1.00 58.25  ?  47  ILE F CG1   1 
ATOM 4379 C CG2   . ILE F 1 49  ? 14.105  6.900   -45.266 1.00 60.71  ?  47  ILE F CG2   1 
ATOM 4380 C CD1   . ILE F 1 49  ? 11.476  7.332   -46.812 1.00 57.91  ?  47  ILE F CD1   1 
ATOM 4381 N N     . CYS F 1 50  ? 13.614  8.991   -42.203 1.00 55.64  ?  48  CYS F N     1 
ATOM 4382 C CA    . CYS F 1 50  ? 14.270  8.889   -40.903 1.00 55.21  ?  48  CYS F CA    1 
ATOM 4383 C C     . CYS F 1 50  ? 13.288  8.456   -39.824 1.00 53.98  ?  48  CYS F C     1 
ATOM 4384 O O     . CYS F 1 50  ? 13.613  7.611   -38.982 1.00 54.52  ?  48  CYS F O     1 
ATOM 4385 C CB    . CYS F 1 50  ? 14.922  10.222  -40.534 1.00 54.03  ?  48  CYS F CB    1 
ATOM 4386 S SG    . CYS F 1 50  ? 15.685  10.254  -38.901 1.00 55.69  ?  48  CYS F SG    1 
ATOM 4387 N N     . ARG F 1 51  ? 12.078  9.022   -39.835 1.00 52.27  ?  49  ARG F N     1 
ATOM 4388 C CA    . ARG F 1 51  ? 11.068  8.617   -38.865 1.00 52.04  ?  49  ARG F CA    1 
ATOM 4389 C C     . ARG F 1 51  ? 10.745  7.137   -39.002 1.00 51.90  ?  49  ARG F C     1 
ATOM 4390 O O     . ARG F 1 51  ? 10.527  6.447   -38.002 1.00 50.79  ?  49  ARG F O     1 
ATOM 4391 C CB    . ARG F 1 51  ? 9.806   9.463   -39.031 1.00 50.41  ?  49  ARG F CB    1 
ATOM 4392 C CG    . ARG F 1 51  ? 9.981   10.932  -38.682 1.00 49.83  ?  49  ARG F CG    1 
ATOM 4393 C CD    . ARG F 1 51  ? 8.653   11.567  -38.312 1.00 41.85  ?  49  ARG F CD    1 
ATOM 4394 N NE    . ARG F 1 51  ? 8.777   12.988  -38.010 1.00 48.92  ?  49  ARG F NE    1 
ATOM 4395 C CZ    . ARG F 1 51  ? 8.439   13.959  -38.850 1.00 48.10  ?  49  ARG F CZ    1 
ATOM 4396 N NH1   . ARG F 1 51  ? 7.952   13.660  -40.043 1.00 48.09  1  49  ARG F NH1   1 
ATOM 4397 N NH2   . ARG F 1 51  ? 8.581   15.227  -38.495 1.00 41.00  ?  49  ARG F NH2   1 
ATOM 4398 N N     . PHE F 1 52  ? 10.706  6.631   -40.234 1.00 53.61  ?  50  PHE F N     1 
ATOM 4399 C CA    . PHE F 1 52  ? 10.462  5.208   -40.434 1.00 56.66  ?  50  PHE F CA    1 
ATOM 4400 C C     . PHE F 1 52  ? 11.653  4.388   -39.961 1.00 64.89  ?  50  PHE F C     1 
ATOM 4401 O O     . PHE F 1 52  ? 11.490  3.379   -39.267 1.00 67.00  ?  50  PHE F O     1 
ATOM 4402 C CB    . PHE F 1 52  ? 10.157  4.919   -41.900 1.00 54.48  ?  50  PHE F CB    1 
ATOM 4403 C CG    . PHE F 1 52  ? 9.905   3.469   -42.184 1.00 56.51  ?  50  PHE F CG    1 
ATOM 4404 C CD1   . PHE F 1 52  ? 8.656   2.920   -41.975 1.00 55.21  ?  50  PHE F CD1   1 
ATOM 4405 C CD2   . PHE F 1 52  ? 10.921  2.649   -42.639 1.00 61.73  ?  50  PHE F CD2   1 
ATOM 4406 C CE1   . PHE F 1 52  ? 8.422   1.586   -42.227 1.00 57.92  ?  50  PHE F CE1   1 
ATOM 4407 C CE2   . PHE F 1 52  ? 10.691  1.314   -42.892 1.00 63.76  ?  50  PHE F CE2   1 
ATOM 4408 C CZ    . PHE F 1 52  ? 9.441   0.783   -42.685 1.00 61.88  ?  50  PHE F CZ    1 
ATOM 4409 N N     . GLU F 1 53  ? 12.862  4.798   -40.356 1.00 68.98  ?  51  GLU F N     1 
ATOM 4410 C CA    . GLU F 1 53  ? 14.069  4.082   -39.955 1.00 75.35  ?  51  GLU F CA    1 
ATOM 4411 C C     . GLU F 1 53  ? 14.174  3.985   -38.441 1.00 78.08  ?  51  GLU F C     1 
ATOM 4412 O O     . GLU F 1 53  ? 14.568  2.944   -37.903 1.00 80.50  ?  51  GLU F O     1 
ATOM 4413 C CB    . GLU F 1 53  ? 15.295  4.793   -40.520 1.00 78.75  ?  51  GLU F CB    1 
ATOM 4414 C CG    . GLU F 1 53  ? 15.526  4.567   -41.995 1.00 80.57  ?  51  GLU F CG    1 
ATOM 4415 C CD    . GLU F 1 53  ? 16.718  5.339   -42.509 1.00 81.33  ?  51  GLU F CD    1 
ATOM 4416 O OE1   . GLU F 1 53  ? 17.368  6.038   -41.705 1.00 80.50  ?  51  GLU F OE1   1 
ATOM 4417 O OE2   . GLU F 1 53  ? 16.997  5.259   -43.720 1.00 82.53  -1 51  GLU F OE2   1 
ATOM 4418 N N     . ASN F 1 54  ? 13.835  5.061   -37.738 1.00 78.86  ?  52  ASN F N     1 
ATOM 4419 C CA    . ASN F 1 54  ? 13.820  5.082   -36.283 1.00 81.34  ?  52  ASN F CA    1 
ATOM 4420 C C     . ASN F 1 54  ? 12.453  4.736   -35.708 1.00 78.49  ?  52  ASN F C     1 
ATOM 4421 O O     . ASN F 1 54  ? 12.275  4.801   -34.488 1.00 79.22  ?  52  ASN F O     1 
ATOM 4422 C CB    . ASN F 1 54  ? 14.269  6.452   -35.772 1.00 83.08  ?  52  ASN F CB    1 
ATOM 4423 C CG    . ASN F 1 54  ? 15.654  6.828   -36.256 1.00 87.52  ?  52  ASN F CG    1 
ATOM 4424 O OD1   . ASN F 1 54  ? 16.654  6.511   -35.615 1.00 89.81  ?  52  ASN F OD1   1 
ATOM 4425 N ND2   . ASN F 1 54  ? 15.719  7.509   -37.394 1.00 88.77  ?  52  ASN F ND2   1 
ATOM 4426 N N     . LEU F 1 55  ? 11.494  4.364   -36.557 1.00 72.86  ?  53  LEU F N     1 
ATOM 4427 C CA    . LEU F 1 55  ? 10.132  4.041   -36.132 1.00 73.10  ?  53  LEU F CA    1 
ATOM 4428 C C     . LEU F 1 55  ? 9.527   5.167   -35.301 1.00 73.50  ?  53  LEU F C     1 
ATOM 4429 O O     . LEU F 1 55  ? 8.883   4.934   -34.277 1.00 75.13  ?  53  LEU F O     1 
ATOM 4430 C CB    . LEU F 1 55  ? 10.080  2.719   -35.365 1.00 76.05  ?  53  LEU F CB    1 
ATOM 4431 C CG    . LEU F 1 55  ? 10.025  1.432   -36.188 1.00 77.28  ?  53  LEU F CG    1 
ATOM 4432 C CD1   . LEU F 1 55  ? 11.327  1.238   -36.911 1.00 55.15  ?  53  LEU F CD1   1 
ATOM 4433 C CD2   . LEU F 1 55  ? 9.744   0.236   -35.301 1.00 77.81  ?  53  LEU F CD2   1 
ATOM 4434 N N     . GLN F 1 56  ? 9.724   6.402   -35.747 1.00 72.31  ?  54  GLN F N     1 
ATOM 4435 C CA    . GLN F 1 56  ? 9.114   7.553   -35.084 1.00 68.69  ?  54  GLN F CA    1 
ATOM 4436 C C     . GLN F 1 56  ? 7.869   8.010   -35.841 1.00 66.46  ?  54  GLN F C     1 
ATOM 4437 O O     . GLN F 1 56  ? 7.748   9.145   -36.296 1.00 65.36  ?  54  GLN F O     1 
ATOM 4438 C CB    . GLN F 1 56  ? 10.130  8.681   -34.944 1.00 67.83  ?  54  GLN F CB    1 
ATOM 4439 C CG    . GLN F 1 56  ? 11.312  8.328   -34.058 1.00 69.91  ?  54  GLN F CG    1 
ATOM 4440 C CD    . GLN F 1 56  ? 12.354  9.423   -34.003 1.00 73.44  ?  54  GLN F CD    1 
ATOM 4441 O OE1   . GLN F 1 56  ? 12.327  10.362  -34.794 1.00 74.90  ?  54  GLN F OE1   1 
ATOM 4442 N NE2   . GLN F 1 56  ? 13.280  9.309   -33.062 1.00 76.78  ?  54  GLN F NE2   1 
ATOM 4443 N N     . LEU F 1 57  ? 6.937   7.071   -35.969 1.00 65.47  ?  55  LEU F N     1 
ATOM 4444 C CA    . LEU F 1 57  ? 5.608   7.328   -36.499 1.00 63.71  ?  55  LEU F CA    1 
ATOM 4445 C C     . LEU F 1 57  ? 4.665   6.273   -35.934 1.00 63.53  ?  55  LEU F C     1 
ATOM 4446 O O     . LEU F 1 57  ? 5.090   5.331   -35.263 1.00 65.42  ?  55  LEU F O     1 
ATOM 4447 C CB    . LEU F 1 57  ? 5.621   7.397   -38.030 1.00 63.78  ?  55  LEU F CB    1 
ATOM 4448 C CG    . LEU F 1 57  ? 6.461   6.425   -38.854 1.00 42.67  ?  55  LEU F CG    1 
ATOM 4449 C CD1   . LEU F 1 57  ? 6.029   5.001   -38.682 1.00 46.60  ?  55  LEU F CD1   1 
ATOM 4450 C CD2   . LEU F 1 57  ? 6.384   6.826   -40.314 1.00 48.66  ?  55  LEU F CD2   1 
ATOM 4451 N N     . SER F 1 58  ? 3.375   6.435   -36.215 1.00 61.11  ?  56  SER F N     1 
ATOM 4452 C CA    . SER F 1 58  ? 2.377   5.529   -35.666 1.00 58.74  ?  56  SER F CA    1 
ATOM 4453 C C     . SER F 1 58  ? 2.496   4.131   -36.265 1.00 56.16  ?  56  SER F C     1 
ATOM 4454 O O     . SER F 1 58  ? 3.068   3.926   -37.337 1.00 53.04  ?  56  SER F O     1 
ATOM 4455 C CB    . SER F 1 58  ? 0.969   6.077   -35.900 1.00 58.72  ?  56  SER F CB    1 
ATOM 4456 O OG    . SER F 1 58  ? 0.654   6.114   -37.278 1.00 58.81  ?  56  SER F OG    1 
ATOM 4457 N N     . PHE F 1 59  ? 1.943   3.159   -35.536 1.00 59.74  ?  57  PHE F N     1 
ATOM 4458 C CA    . PHE F 1 59  ? 1.961   1.769   -35.984 1.00 65.50  ?  57  PHE F CA    1 
ATOM 4459 C C     . PHE F 1 59  ? 1.259   1.599   -37.323 1.00 69.76  ?  57  PHE F C     1 
ATOM 4460 O O     . PHE F 1 59  ? 1.774   0.931   -38.227 1.00 70.87  ?  57  PHE F O     1 
ATOM 4461 C CB    . PHE F 1 59  ? 1.305   0.878   -34.933 1.00 65.70  ?  57  PHE F CB    1 
ATOM 4462 C CG    . PHE F 1 59  ? 1.106   -0.534  -35.384 1.00 66.85  ?  57  PHE F CG    1 
ATOM 4463 C CD1   . PHE F 1 59  ? 2.178   -1.395  -35.517 1.00 68.64  ?  57  PHE F CD1   1 
ATOM 4464 C CD2   . PHE F 1 59  ? -0.160  -0.998  -35.686 1.00 66.43  ?  57  PHE F CD2   1 
ATOM 4465 C CE1   . PHE F 1 59  ? 1.989   -2.692  -35.938 1.00 69.74  ?  57  PHE F CE1   1 
ATOM 4466 C CE2   . PHE F 1 59  ? -0.354  -2.293  -36.107 1.00 68.10  ?  57  PHE F CE2   1 
ATOM 4467 C CZ    . PHE F 1 59  ? 0.721   -3.140  -36.233 1.00 69.79  ?  57  PHE F CZ    1 
ATOM 4468 N N     . LYS F 1 60  ? 0.077   2.196   -37.468 1.00 72.12  ?  58  LYS F N     1 
ATOM 4469 C CA    . LYS F 1 60  ? -0.652  2.086   -38.725 1.00 74.21  ?  58  LYS F CA    1 
ATOM 4470 C C     . LYS F 1 60  ? 0.126   2.739   -39.856 1.00 76.91  ?  58  LYS F C     1 
ATOM 4471 O O     . LYS F 1 60  ? 0.200   2.197   -40.964 1.00 78.70  ?  58  LYS F O     1 
ATOM 4472 C CB    . LYS F 1 60  ? -2.042  2.706   -38.588 1.00 72.43  ?  58  LYS F CB    1 
ATOM 4473 C CG    . LYS F 1 60  ? -2.640  2.611   -37.190 1.00 73.10  ?  58  LYS F CG    1 
ATOM 4474 C CD    . LYS F 1 60  ? -2.270  3.805   -36.318 1.00 72.86  ?  58  LYS F CD    1 
ATOM 4475 C CE    . LYS F 1 60  ? -2.898  3.692   -34.942 1.00 73.35  ?  58  LYS F CE    1 
ATOM 4476 N NZ    . LYS F 1 60  ? -2.327  4.683   -33.994 1.00 72.84  1  58  LYS F NZ    1 
ATOM 4477 N N     . ASN F 1 61  ? 0.712   3.906   -39.592 1.00 78.31  ?  59  ASN F N     1 
ATOM 4478 C CA    . ASN F 1 61  ? 1.524   4.568   -40.603 1.00 78.75  ?  59  ASN F CA    1 
ATOM 4479 C C     . ASN F 1 61  ? 2.747   3.726   -40.943 1.00 80.69  ?  59  ASN F C     1 
ATOM 4480 O O     . ASN F 1 61  ? 3.195   3.703   -42.094 1.00 82.57  ?  59  ASN F O     1 
ATOM 4481 C CB    . ASN F 1 61  ? 1.932   5.955   -40.109 1.00 78.25  ?  59  ASN F CB    1 
ATOM 4482 C CG    . ASN F 1 61  ? 2.398   6.857   -41.224 1.00 79.70  ?  59  ASN F CG    1 
ATOM 4483 O OD1   . ASN F 1 61  ? 2.273   6.521   -42.397 1.00 82.51  ?  59  ASN F OD1   1 
ATOM 4484 N ND2   . ASN F 1 61  ? 2.921   8.021   -40.864 1.00 78.72  ?  59  ASN F ND2   1 
ATOM 4485 N N     . ALA F 1 62  ? 3.304   3.032   -39.946 1.00 80.73  ?  60  ALA F N     1 
ATOM 4486 C CA    . ALA F 1 62  ? 4.458   2.171   -40.187 1.00 83.03  ?  60  ALA F CA    1 
ATOM 4487 C C     . ALA F 1 62  ? 4.101   1.001   -41.091 1.00 84.85  ?  60  ALA F C     1 
ATOM 4488 O O     . ALA F 1 62  ? 4.864   0.659   -42.001 1.00 88.36  ?  60  ALA F O     1 
ATOM 4489 C CB    . ALA F 1 62  ? 5.019   1.661   -38.863 1.00 84.00  ?  60  ALA F CB    1 
ATOM 4490 N N     . CYS F 1 63  ? 2.950   0.370   -40.852 1.00 81.54  ?  61  CYS F N     1 
ATOM 4491 C CA    . CYS F 1 63  ? 2.521   -0.722  -41.717 1.00 80.04  ?  61  CYS F CA    1 
ATOM 4492 C C     . CYS F 1 63  ? 2.287   -0.223  -43.134 1.00 76.48  ?  61  CYS F C     1 
ATOM 4493 O O     . CYS F 1 63  ? 2.596   -0.920  -44.106 1.00 79.27  ?  61  CYS F O     1 
ATOM 4494 C CB    . CYS F 1 63  ? 1.261   -1.377  -41.156 1.00 80.78  ?  61  CYS F CB    1 
ATOM 4495 S SG    . CYS F 1 63  ? 1.499   -2.210  -39.575 1.00 83.09  ?  61  CYS F SG    1 
ATOM 4496 N N     . LYS F 1 64  ? 1.730   0.980   -43.268 1.00 68.30  ?  62  LYS F N     1 
ATOM 4497 C CA    . LYS F 1 64  ? 1.565   1.584   -44.584 1.00 65.88  ?  62  LYS F CA    1 
ATOM 4498 C C     . LYS F 1 64  ? 2.914   1.768   -45.264 1.00 66.65  ?  62  LYS F C     1 
ATOM 4499 O O     . LYS F 1 64  ? 3.115   1.332   -46.402 1.00 70.57  ?  62  LYS F O     1 
ATOM 4500 C CB    . LYS F 1 64  ? 0.831   2.918   -44.452 1.00 62.64  ?  62  LYS F CB    1 
ATOM 4501 C CG    . LYS F 1 64  ? 0.813   3.764   -45.710 1.00 60.64  ?  62  LYS F CG    1 
ATOM 4502 C CD    . LYS F 1 64  ? 0.086   5.077   -45.462 1.00 56.10  ?  62  LYS F CD    1 
ATOM 4503 C CE    . LYS F 1 64  ? -0.007  5.909   -46.728 1.00 54.46  ?  62  LYS F CE    1 
ATOM 4504 N NZ    . LYS F 1 64  ? -0.768  7.168   -46.512 1.00 51.26  1  62  LYS F NZ    1 
ATOM 4505 N N     . LEU F 1 65  ? 3.859   2.408   -44.571 1.00 63.21  ?  63  LEU F N     1 
ATOM 4506 C CA    . LEU F 1 65  ? 5.161   2.686   -45.169 1.00 61.55  ?  63  LEU F CA    1 
ATOM 4507 C C     . LEU F 1 65  ? 5.936   1.406   -45.440 1.00 63.71  ?  63  LEU F C     1 
ATOM 4508 O O     . LEU F 1 65  ? 6.643   1.308   -46.449 1.00 65.13  ?  63  LEU F O     1 
ATOM 4509 C CB    . LEU F 1 65  ? 5.970   3.616   -44.268 1.00 58.20  ?  63  LEU F CB    1 
ATOM 4510 C CG    . LEU F 1 65  ? 5.867   5.120   -44.521 1.00 55.40  ?  63  LEU F CG    1 
ATOM 4511 C CD1   . LEU F 1 65  ? 6.564   5.473   -45.821 1.00 56.39  ?  63  LEU F CD1   1 
ATOM 4512 C CD2   . LEU F 1 65  ? 4.428   5.596   -44.529 1.00 53.73  ?  63  LEU F CD2   1 
ATOM 4513 N N     . LYS F 1 66  ? 5.835   0.421   -44.546 1.00 64.57  ?  64  LYS F N     1 
ATOM 4514 C CA    . LYS F 1 66  ? 6.497   -0.855  -44.791 1.00 69.60  ?  64  LYS F CA    1 
ATOM 4515 C C     . LYS F 1 66  ? 6.009   -1.484  -46.088 1.00 72.30  ?  64  LYS F C     1 
ATOM 4516 O O     . LYS F 1 66  ? 6.791   -2.100  -46.820 1.00 78.03  ?  64  LYS F O     1 
ATOM 4517 C CB    . LYS F 1 66  ? 6.268   -1.804  -43.616 1.00 70.66  ?  64  LYS F CB    1 
ATOM 4518 N N     . ALA F 1 67  ? 4.721   -1.329  -46.396 1.00 68.27  ?  65  ALA F N     1 
ATOM 4519 C CA    . ALA F 1 67  ? 4.190   -1.855  -47.648 1.00 70.26  ?  65  ALA F CA    1 
ATOM 4520 C C     . ALA F 1 67  ? 4.758   -1.104  -48.844 1.00 73.04  ?  65  ALA F C     1 
ATOM 4521 O O     . ALA F 1 67  ? 5.194   -1.716  -49.824 1.00 78.24  ?  65  ALA F O     1 
ATOM 4522 C CB    . ALA F 1 67  ? 2.664   -1.783  -47.643 1.00 66.61  ?  65  ALA F CB    1 
ATOM 4523 N N     . ILE F 1 68  ? 4.755   0.229   -48.781 1.00 68.93  ?  66  ILE F N     1 
ATOM 4524 C CA    . ILE F 1 68  ? 5.297   1.029   -49.875 1.00 70.24  ?  66  ILE F CA    1 
ATOM 4525 C C     . ILE F 1 68  ? 6.788   0.778   -50.039 1.00 73.92  ?  66  ILE F C     1 
ATOM 4526 O O     . ILE F 1 68  ? 7.290   0.638   -51.160 1.00 78.81  ?  66  ILE F O     1 
ATOM 4527 C CB    . ILE F 1 68  ? 5.000   2.520   -49.644 1.00 67.85  ?  66  ILE F CB    1 
ATOM 4528 C CG1   . ILE F 1 68  ? 3.540   2.711   -49.238 1.00 65.58  ?  66  ILE F CG1   1 
ATOM 4529 C CG2   . ILE F 1 68  ? 5.329   3.325   -50.886 1.00 70.17  ?  66  ILE F CG2   1 
ATOM 4530 C CD1   . ILE F 1 68  ? 3.168   4.144   -48.974 1.00 63.18  ?  66  ILE F CD1   1 
ATOM 4531 N N     . LEU F 1 69  ? 7.521   0.716   -48.928 1.00 73.98  ?  67  LEU F N     1 
ATOM 4532 C CA    . LEU F 1 69  ? 8.969   0.583   -49.017 1.00 78.94  ?  67  LEU F CA    1 
ATOM 4533 C C     . LEU F 1 69  ? 9.386   -0.820  -49.436 1.00 85.09  ?  67  LEU F C     1 
ATOM 4534 O O     . LEU F 1 69  ? 10.397  -0.980  -50.128 1.00 90.99  ?  67  LEU F O     1 
ATOM 4535 C CB    . LEU F 1 69  ? 9.615   0.965   -47.687 1.00 76.50  ?  67  LEU F CB    1 
ATOM 4536 C CG    . LEU F 1 69  ? 9.713   2.471   -47.450 1.00 73.04  ?  67  LEU F CG    1 
ATOM 4537 C CD1   . LEU F 1 69  ? 10.167  2.759   -46.039 1.00 71.17  ?  67  LEU F CD1   1 
ATOM 4538 C CD2   . LEU F 1 69  ? 10.658  3.105   -48.453 1.00 74.75  ?  67  LEU F CD2   1 
ATOM 4539 N N     . SER F 1 70  ? 8.637   -1.845  -49.024 1.00 83.08  ?  68  SER F N     1 
ATOM 4540 C CA    . SER F 1 70  ? 8.982   -3.205  -49.421 1.00 87.34  ?  68  SER F CA    1 
ATOM 4541 C C     . SER F 1 70  ? 8.851   -3.387  -50.927 1.00 90.42  ?  68  SER F C     1 
ATOM 4542 O O     . SER F 1 70  ? 9.725   -3.979  -51.569 1.00 92.39  ?  68  SER F O     1 
ATOM 4543 C CB    . SER F 1 70  ? 8.095   -4.208  -48.684 1.00 88.65  ?  68  SER F CB    1 
ATOM 4544 O OG    . SER F 1 70  ? 6.748   -4.096  -49.104 1.00 88.47  ?  68  SER F OG    1 
ATOM 4545 N N     . LYS F 1 71  ? 7.767   -2.872  -51.510 1.00 91.39  ?  69  LYS F N     1 
ATOM 4546 C CA    . LYS F 1 71  ? 7.598   -2.950  -52.956 1.00 94.63  ?  69  LYS F CA    1 
ATOM 4547 C C     . LYS F 1 71  ? 8.655   -2.144  -53.696 1.00 94.18  ?  69  LYS F C     1 
ATOM 4548 O O     . LYS F 1 71  ? 9.092   -2.547  -54.779 1.00 95.99  ?  69  LYS F O     1 
ATOM 4549 C CB    . LYS F 1 71  ? 6.200   -2.475  -53.347 1.00 92.80  ?  69  LYS F CB    1 
ATOM 4550 N N     . TRP F 1 72  ? 9.090   -1.018  -53.129 1.00 90.84  ?  70  TRP F N     1 
ATOM 4551 C CA    . TRP F 1 72  ? 10.099  -0.200  -53.793 1.00 93.44  ?  70  TRP F CA    1 
ATOM 4552 C C     . TRP F 1 72  ? 11.465  -0.871  -53.769 1.00 97.16  ?  70  TRP F C     1 
ATOM 4553 O O     . TRP F 1 72  ? 12.189  -0.848  -54.771 1.00 102.95 ?  70  TRP F O     1 
ATOM 4554 C CB    . TRP F 1 72  ? 10.168  1.178   -53.142 1.00 91.60  ?  70  TRP F CB    1 
ATOM 4555 C CG    . TRP F 1 72  ? 11.292  2.024   -53.650 1.00 95.64  ?  70  TRP F CG    1 
ATOM 4556 C CD1   . TRP F 1 72  ? 11.255  2.879   -54.707 1.00 97.76  ?  70  TRP F CD1   1 
ATOM 4557 C CD2   . TRP F 1 72  ? 12.619  2.100   -53.118 1.00 97.24  ?  70  TRP F CD2   1 
ATOM 4558 N NE1   . TRP F 1 72  ? 12.476  3.483   -54.871 1.00 99.15  ?  70  TRP F NE1   1 
ATOM 4559 C CE2   . TRP F 1 72  ? 13.332  3.021   -53.907 1.00 98.47  ?  70  TRP F CE2   1 
ATOM 4560 C CE3   . TRP F 1 72  ? 13.273  1.477   -52.053 1.00 97.71  ?  70  TRP F CE3   1 
ATOM 4561 C CZ2   . TRP F 1 72  ? 14.664  3.334   -53.666 1.00 99.42  ?  70  TRP F CZ2   1 
ATOM 4562 C CZ3   . TRP F 1 72  ? 14.596  1.790   -51.815 1.00 99.07  ?  70  TRP F CZ3   1 
ATOM 4563 C CH2   . TRP F 1 72  ? 15.277  2.710   -52.617 1.00 99.93  ?  70  TRP F CH2   1 
ATOM 4564 N N     . LEU F 1 73  ? 11.845  -1.450  -52.627 1.00 93.09  ?  71  LEU F N     1 
ATOM 4565 C CA    . LEU F 1 73  ? 13.146  -2.103  -52.514 1.00 93.68  ?  71  LEU F CA    1 
ATOM 4566 C C     . LEU F 1 73  ? 13.318  -3.168  -53.589 1.00 98.94  ?  71  LEU F C     1 
ATOM 4567 O O     . LEU F 1 73  ? 14.356  -3.230  -54.257 1.00 100.58 ?  71  LEU F O     1 
ATOM 4568 C CB    . LEU F 1 73  ? 13.306  -2.707  -51.119 1.00 90.76  ?  71  LEU F CB    1 
ATOM 4569 C CG    . LEU F 1 73  ? 14.644  -3.373  -50.797 1.00 93.24  ?  71  LEU F CG    1 
ATOM 4570 C CD1   . LEU F 1 73  ? 15.211  -2.815  -49.504 1.00 90.05  ?  71  LEU F CD1   1 
ATOM 4571 C CD2   . LEU F 1 73  ? 14.492  -4.881  -50.703 1.00 96.09  ?  71  LEU F CD2   1 
ATOM 4572 N N     . GLU F 1 74  ? 12.309  -4.026  -53.758 1.00 103.11 ?  72  GLU F N     1 
ATOM 4573 C CA    . GLU F 1 74  ? 12.325  -5.006  -54.839 1.00 112.06 ?  72  GLU F CA    1 
ATOM 4574 C C     . GLU F 1 74  ? 12.546  -4.340  -56.192 1.00 116.80 ?  72  GLU F C     1 
ATOM 4575 O O     . GLU F 1 74  ? 13.409  -4.757  -56.971 1.00 125.00 ?  72  GLU F O     1 
ATOM 4576 C CB    . GLU F 1 74  ? 11.018  -5.801  -54.838 1.00 110.94 ?  72  GLU F CB    1 
ATOM 4577 N N     . GLU F 1 75  ? 11.769  -3.296  -56.489 1.00 110.55 ?  73  GLU F N     1 
ATOM 4578 C CA    . GLU F 1 75  ? 11.883  -2.618  -57.775 1.00 116.54 ?  73  GLU F CA    1 
ATOM 4579 C C     . GLU F 1 75  ? 13.215  -1.899  -57.937 1.00 121.23 ?  73  GLU F C     1 
ATOM 4580 O O     . GLU F 1 75  ? 13.611  -1.605  -59.070 1.00 123.88 ?  73  GLU F O     1 
ATOM 4581 C CB    . GLU F 1 75  ? 10.722  -1.642  -57.966 1.00 113.09 ?  73  GLU F CB    1 
ATOM 4582 C CG    . GLU F 1 75  ? 9.362   -2.320  -57.967 1.00 112.69 ?  73  GLU F CG    1 
ATOM 4583 C CD    . GLU F 1 75  ? 8.314   -1.535  -58.727 1.00 112.15 ?  73  GLU F CD    1 
ATOM 4584 O OE1   . GLU F 1 75  ? 8.651   -0.468  -59.280 1.00 112.41 ?  73  GLU F OE1   1 
ATOM 4585 O OE2   . GLU F 1 75  ? 7.154   -1.991  -58.776 1.00 111.68 ?  73  GLU F OE2   1 
ATOM 4586 N N     . ALA F 1 76  ? 13.906  -1.595  -56.839 1.00 81.58  ?  74  ALA F N     1 
ATOM 4587 C CA    . ALA F 1 76  ? 15.202  -0.924  -56.895 1.00 81.37  ?  74  ALA F CA    1 
ATOM 4588 C C     . ALA F 1 76  ? 16.276  -2.003  -56.805 1.00 81.26  ?  74  ALA F C     1 
ATOM 4589 O O     . ALA F 1 76  ? 16.889  -2.236  -55.764 1.00 80.45  ?  74  ALA F O     1 
ATOM 4590 C CB    . ALA F 1 76  ? 15.330  0.111   -55.783 1.00 79.75  ?  74  ALA F CB    1 
ATOM 4591 N N     . GLU F 1 77  ? 16.493  -2.674  -57.932 1.00 82.30  ?  75  GLU F N     1 
ATOM 4592 C CA    . GLU F 1 77  ? 17.522  -3.681  -58.093 1.00 83.51  ?  75  GLU F CA    1 
ATOM 4593 C C     . GLU F 1 77  ? 18.673  -3.110  -58.926 1.00 83.48  ?  75  GLU F C     1 
ATOM 4594 O O     . GLU F 1 77  ? 18.857  -1.886  -58.998 1.00 82.87  ?  75  GLU F O     1 
ATOM 4595 C CB    . GLU F 1 77  ? 16.893  -4.929  -58.718 1.00 85.99  ?  75  GLU F CB    1 
ATOM 4596 C CG    . GLU F 1 77  ? 15.978  -4.626  -59.899 1.00 88.75  ?  75  GLU F CG    1 
ATOM 4597 C CD    . GLU F 1 77  ? 14.766  -5.538  -59.959 1.00 90.22  ?  75  GLU F CD    1 
ATOM 4598 O OE1   . GLU F 1 77  ? 13.911  -5.332  -60.845 1.00 91.53  ?  75  GLU F OE1   1 
ATOM 4599 O OE2   . GLU F 1 77  ? 14.662  -6.456  -59.119 1.00 89.91  ?  75  GLU F OE2   1 
ATOM 4600 N N     . GLN F 1 78  ? 19.443  -3.993  -59.552 1.00 83.85  ?  76  GLN F N     1 
ATOM 4601 C CA    . GLN F 1 78  ? 20.595  -3.583  -60.346 1.00 85.34  ?  76  GLN F CA    1 
ATOM 4602 C C     . GLN F 1 78  ? 21.019  -4.690  -61.309 1.00 85.51  ?  76  GLN F C     1 
ATOM 4603 O O     . GLN F 1 78  ? 21.538  -4.421  -62.393 1.00 85.57  ?  76  GLN F O     1 
ATOM 4604 C CB    . GLN F 1 78  ? 21.763  -3.197  -59.438 1.00 85.58  ?  76  GLN F CB    1 
ATOM 4605 C CG    . GLN F 1 78  ? 21.924  -4.091  -58.221 1.00 85.13  ?  76  GLN F CG    1 
ATOM 4606 C CD    . GLN F 1 78  ? 23.268  -3.915  -57.549 1.00 85.16  ?  76  GLN F CD    1 
ATOM 4607 O OE1   . GLN F 1 78  ? 24.066  -3.069  -57.947 1.00 86.60  ?  76  GLN F OE1   1 
ATOM 4608 N NE2   . GLN F 1 78  ? 23.528  -4.716  -56.523 1.00 83.42  ?  76  GLN F NE2   1 
ATOM 4609 N N     . ARG F 1 96  ? 12.343  29.569  -41.230 1.00 80.09  ?  94  ARG F N     1 
ATOM 4610 C CA    . ARG F 1 96  ? 12.031  30.695  -40.363 1.00 81.89  ?  94  ARG F CA    1 
ATOM 4611 C C     . ARG F 1 96  ? 11.348  30.233  -39.082 1.00 83.61  ?  94  ARG F C     1 
ATOM 4612 O O     . ARG F 1 96  ? 10.400  30.861  -38.615 1.00 86.38  ?  94  ARG F O     1 
ATOM 4613 C CB    . ARG F 1 96  ? 11.147  31.703  -41.095 1.00 81.20  ?  94  ARG F CB    1 
ATOM 4614 N N     . ARG F 1 97  ? 11.835  29.132  -38.519 1.00 81.60  ?  95  ARG F N     1 
ATOM 4615 C CA    . ARG F 1 97  ? 11.284  28.611  -37.278 1.00 81.46  ?  95  ARG F CA    1 
ATOM 4616 C C     . ARG F 1 97  ? 11.884  29.328  -36.077 1.00 85.38  ?  95  ARG F C     1 
ATOM 4617 O O     . ARG F 1 97  ? 13.006  29.839  -36.126 1.00 86.34  ?  95  ARG F O     1 
ATOM 4618 C CB    . ARG F 1 97  ? 11.561  27.118  -37.141 1.00 77.61  ?  95  ARG F CB    1 
ATOM 4619 C CG    . ARG F 1 97  ? 10.872  26.226  -38.142 1.00 75.17  ?  95  ARG F CG    1 
ATOM 4620 C CD    . ARG F 1 97  ? 10.685  24.862  -37.522 1.00 73.82  ?  95  ARG F CD    1 
ATOM 4621 N NE    . ARG F 1 97  ? 11.829  24.507  -36.687 1.00 73.02  ?  95  ARG F NE    1 
ATOM 4622 C CZ    . ARG F 1 97  ? 12.768  23.632  -37.024 1.00 71.59  ?  95  ARG F CZ    1 
ATOM 4623 N NH1   . ARG F 1 97  ? 12.708  23.008  -38.191 1.00 71.33  1  95  ARG F NH1   1 
ATOM 4624 N NH2   . ARG F 1 97  ? 13.767  23.380  -36.191 1.00 71.16  ?  95  ARG F NH2   1 
ATOM 4625 N N     . THR F 1 98  ? 11.117  29.369  -34.992 1.00 84.58  ?  96  THR F N     1 
ATOM 4626 C CA    . THR F 1 98  ? 11.582  29.900  -33.718 1.00 86.92  ?  96  THR F CA    1 
ATOM 4627 C C     . THR F 1 98  ? 11.724  28.743  -32.741 1.00 89.17  ?  96  THR F C     1 
ATOM 4628 O O     . THR F 1 98  ? 10.746  28.043  -32.461 1.00 94.04  ?  96  THR F O     1 
ATOM 4629 C CB    . THR F 1 98  ? 10.616  30.944  -33.164 1.00 87.77  ?  96  THR F CB    1 
ATOM 4630 O OG1   . THR F 1 98  ? 9.620   30.292  -32.368 1.00 88.36  ?  96  THR F OG1   1 
ATOM 4631 C CG2   . THR F 1 98  ? 9.936   31.689  -34.300 1.00 87.89  ?  96  THR F CG2   1 
ATOM 4632 N N     . THR F 1 99  ? 12.929  28.553  -32.216 1.00 85.94  ?  97  THR F N     1 
ATOM 4633 C CA    . THR F 1 99  ? 13.204  27.461  -31.295 1.00 87.47  ?  97  THR F CA    1 
ATOM 4634 C C     . THR F 1 99  ? 12.852  27.886  -29.874 1.00 89.56  ?  97  THR F C     1 
ATOM 4635 O O     . THR F 1 99  ? 13.127  29.017  -29.461 1.00 96.35  ?  97  THR F O     1 
ATOM 4636 C CB    . THR F 1 99  ? 14.667  27.017  -31.390 1.00 87.91  ?  97  THR F CB    1 
ATOM 4637 O OG1   . THR F 1 99  ? 14.884  25.887  -30.535 1.00 86.92  ?  97  THR F OG1   1 
ATOM 4638 C CG2   . THR F 1 99  ? 15.618  28.146  -31.009 1.00 89.33  ?  97  THR F CG2   1 
ATOM 4639 N N     . ILE F 1 100 ? 12.216  26.985  -29.142 1.00 82.60  ?  98  ILE F N     1 
ATOM 4640 C CA    . ILE F 1 100 ? 11.751  27.258  -27.788 1.00 78.54  ?  98  ILE F CA    1 
ATOM 4641 C C     . ILE F 1 100 ? 12.864  26.947  -26.797 1.00 78.28  ?  98  ILE F C     1 
ATOM 4642 O O     . ILE F 1 100 ? 13.578  25.947  -26.933 1.00 79.19  ?  98  ILE F O     1 
ATOM 4643 C CB    . ILE F 1 100 ? 10.480  26.444  -27.482 1.00 75.16  ?  98  ILE F CB    1 
ATOM 4644 C CG1   . ILE F 1 100 ? 9.311   26.965  -28.316 1.00 74.41  ?  98  ILE F CG1   1 
ATOM 4645 C CG2   . ILE F 1 100 ? 10.141  26.500  -26.010 1.00 74.74  ?  98  ILE F CG2   1 
ATOM 4646 C CD1   . ILE F 1 100 ? 8.015   26.224  -28.084 1.00 73.54  ?  98  ILE F CD1   1 
ATOM 4647 N N     . SER F 1 101 ? 13.026  27.826  -25.808 1.00 76.58  ?  99  SER F N     1 
ATOM 4648 C CA    . SER F 1 101 ? 14.086  27.679  -24.821 1.00 74.68  ?  99  SER F CA    1 
ATOM 4649 C C     . SER F 1 101 ? 13.937  26.381  -24.038 1.00 72.68  ?  99  SER F C     1 
ATOM 4650 O O     . SER F 1 101 ? 12.837  25.853  -23.865 1.00 72.11  ?  99  SER F O     1 
ATOM 4651 C CB    . SER F 1 101 ? 14.077  28.863  -23.858 1.00 73.91  ?  99  SER F CB    1 
ATOM 4652 O OG    . SER F 1 101 ? 12.887  28.876  -23.089 1.00 70.87  ?  99  SER F OG    1 
ATOM 4653 N N     . ILE F 1 102 ? 15.074  25.865  -23.566 1.00 76.27  ?  100 ILE F N     1 
ATOM 4654 C CA    . ILE F 1 102 ? 15.083  24.632  -22.785 1.00 74.82  ?  100 ILE F CA    1 
ATOM 4655 C C     . ILE F 1 102 ? 14.291  24.802  -21.498 1.00 76.69  ?  100 ILE F C     1 
ATOM 4656 O O     . ILE F 1 102 ? 13.646  23.858  -21.025 1.00 77.02  ?  100 ILE F O     1 
ATOM 4657 C CB    . ILE F 1 102 ? 16.531  24.187  -22.500 1.00 75.46  ?  100 ILE F CB    1 
ATOM 4658 C CG1   . ILE F 1 102 ? 17.307  24.011  -23.805 1.00 74.35  ?  100 ILE F CG1   1 
ATOM 4659 C CG2   . ILE F 1 102 ? 16.546  22.887  -21.718 1.00 63.55  ?  100 ILE F CG2   1 
ATOM 4660 C CD1   . ILE F 1 102 ? 18.204  25.182  -24.151 1.00 64.50  ?  100 ILE F CD1   1 
ATOM 4661 N N     . ALA F 1 103 ? 14.317  26.000  -20.912 1.00 77.80  ?  101 ALA F N     1 
ATOM 4662 C CA    . ALA F 1 103 ? 13.594  26.222  -19.665 1.00 77.09  ?  101 ALA F CA    1 
ATOM 4663 C C     . ALA F 1 103 ? 12.090  26.120  -19.873 1.00 74.33  ?  101 ALA F C     1 
ATOM 4664 O O     . ALA F 1 103 ? 11.372  25.614  -19.003 1.00 74.39  ?  101 ALA F O     1 
ATOM 4665 C CB    . ALA F 1 103 ? 13.965  27.584  -19.081 1.00 79.24  ?  101 ALA F CB    1 
ATOM 4666 N N     . ALA F 1 104 ? 11.592  26.601  -21.012 1.00 73.00  ?  102 ALA F N     1 
ATOM 4667 C CA    . ALA F 1 104 ? 10.171  26.460  -21.306 1.00 73.96  ?  102 ALA F CA    1 
ATOM 4668 C C     . ALA F 1 104 ? 9.813   25.009  -21.597 1.00 74.56  ?  102 ALA F C     1 
ATOM 4669 O O     . ALA F 1 104 ? 8.761   24.527  -21.166 1.00 76.67  ?  102 ALA F O     1 
ATOM 4670 C CB    . ALA F 1 104 ? 9.782   27.359  -22.478 1.00 72.98  ?  102 ALA F CB    1 
ATOM 4671 N N     . LYS F 1 105 ? 10.683  24.296  -22.318 1.00 73.38  ?  103 LYS F N     1 
ATOM 4672 C CA    . LYS F 1 105 ? 10.410  22.903  -22.660 1.00 70.96  ?  103 LYS F CA    1 
ATOM 4673 C C     . LYS F 1 105 ? 10.260  22.052  -21.409 1.00 75.16  ?  103 LYS F C     1 
ATOM 4674 O O     . LYS F 1 105 ? 9.337   21.235  -21.303 1.00 75.08  ?  103 LYS F O     1 
ATOM 4675 C CB    . LYS F 1 105 ? 11.538  22.348  -23.528 1.00 66.80  ?  103 LYS F CB    1 
ATOM 4676 C CG    . LYS F 1 105 ? 11.713  23.000  -24.883 1.00 63.77  ?  103 LYS F CG    1 
ATOM 4677 C CD    . LYS F 1 105 ? 12.705  22.199  -25.709 1.00 60.59  ?  103 LYS F CD    1 
ATOM 4678 C CE    . LYS F 1 105 ? 13.024  22.876  -27.024 1.00 57.60  ?  103 LYS F CE    1 
ATOM 4679 N NZ    . LYS F 1 105 ? 13.879  22.017  -27.884 1.00 55.47  1  103 LYS F NZ    1 
ATOM 4680 N N     . ASP F 1 106 ? 11.164  22.231  -20.445 1.00 78.73  ?  104 ASP F N     1 
ATOM 4681 C CA    . ASP F 1 106 ? 11.070  21.485  -19.197 1.00 80.55  ?  104 ASP F CA    1 
ATOM 4682 C C     . ASP F 1 106 ? 9.823   21.869  -18.415 1.00 81.19  ?  104 ASP F C     1 
ATOM 4683 O O     . ASP F 1 106 ? 9.245   21.027  -17.719 1.00 81.58  ?  104 ASP F O     1 
ATOM 4684 C CB    . ASP F 1 106 ? 12.328  21.709  -18.363 1.00 83.24  ?  104 ASP F CB    1 
ATOM 4685 C CG    . ASP F 1 106 ? 13.533  20.992  -18.934 1.00 83.33  ?  104 ASP F CG    1 
ATOM 4686 O OD1   . ASP F 1 106 ? 13.341  20.021  -19.694 1.00 80.90  -1 104 ASP F OD1   1 
ATOM 4687 O OD2   . ASP F 1 106 ? 14.671  21.427  -18.662 1.00 86.59  ?  104 ASP F OD2   1 
ATOM 4688 N N     . ALA F 1 107 ? 9.396   23.128  -18.516 1.00 82.15  ?  105 ALA F N     1 
ATOM 4689 C CA    . ALA F 1 107 ? 8.150   23.540  -17.883 1.00 85.45  ?  105 ALA F CA    1 
ATOM 4690 C C     . ALA F 1 107 ? 6.960   22.897  -18.578 1.00 83.36  ?  105 ALA F C     1 
ATOM 4691 O O     . ALA F 1 107 ? 6.054   22.370  -17.923 1.00 83.49  ?  105 ALA F O     1 
ATOM 4692 C CB    . ALA F 1 107 ? 8.028   25.063  -17.901 1.00 88.05  ?  105 ALA F CB    1 
ATOM 4693 N N     . LEU F 1 108 ? 6.944   22.947  -19.912 1.00 80.58  ?  106 LEU F N     1 
ATOM 4694 C CA    . LEU F 1 108 ? 5.871   22.320  -20.674 1.00 59.08  ?  106 LEU F CA    1 
ATOM 4695 C C     . LEU F 1 108 ? 5.796   20.828  -20.390 1.00 63.68  ?  106 LEU F C     1 
ATOM 4696 O O     . LEU F 1 108 ? 4.705   20.277  -20.207 1.00 63.66  ?  106 LEU F O     1 
ATOM 4697 C CB    . LEU F 1 108 ? 6.073   22.579  -22.164 1.00 56.21  ?  106 LEU F CB    1 
ATOM 4698 C CG    . LEU F 1 108 ? 5.917   24.035  -22.596 1.00 57.04  ?  106 LEU F CG    1 
ATOM 4699 C CD1   . LEU F 1 108 ? 6.436   24.235  -24.007 1.00 57.30  ?  106 LEU F CD1   1 
ATOM 4700 C CD2   . LEU F 1 108 ? 4.472   24.472  -22.489 1.00 57.94  ?  106 LEU F CD2   1 
ATOM 4701 N N     . GLU F 1 109 ? 6.947   20.152  -20.361 1.00 63.56  ?  107 GLU F N     1 
ATOM 4702 C CA    . GLU F 1 109 ? 6.958   18.737  -20.009 1.00 64.31  ?  107 GLU F CA    1 
ATOM 4703 C C     . GLU F 1 109 ? 6.437   18.514  -18.595 1.00 70.47  ?  107 GLU F C     1 
ATOM 4704 O O     . GLU F 1 109 ? 5.813   17.483  -18.319 1.00 70.36  ?  107 GLU F O     1 
ATOM 4705 C CB    . GLU F 1 109 ? 8.369   18.172  -20.156 1.00 62.43  ?  107 GLU F CB    1 
ATOM 4706 C CG    . GLU F 1 109 ? 8.664   17.572  -21.519 1.00 59.28  ?  107 GLU F CG    1 
ATOM 4707 C CD    . GLU F 1 109 ? 8.217   16.131  -21.633 1.00 57.93  ?  107 GLU F CD    1 
ATOM 4708 O OE1   . GLU F 1 109 ? 7.798   15.554  -20.610 1.00 59.12  ?  107 GLU F OE1   1 
ATOM 4709 O OE2   . GLU F 1 109 ? 8.289   15.573  -22.747 1.00 54.94  -1 107 GLU F OE2   1 
ATOM 4710 N N     . ARG F 1 110 ? 6.679   19.465  -17.689 1.00 75.23  ?  108 ARG F N     1 
ATOM 4711 C CA    . ARG F 1 110 ? 6.089   19.378  -16.358 1.00 79.17  ?  108 ARG F CA    1 
ATOM 4712 C C     . ARG F 1 110 ? 4.582   19.582  -16.422 1.00 81.25  ?  108 ARG F C     1 
ATOM 4713 O O     . ARG F 1 110 ? 3.821   18.866  -15.762 1.00 82.29  ?  108 ARG F O     1 
ATOM 4714 C CB    . ARG F 1 110 ? 6.722   20.413  -15.425 1.00 81.41  ?  108 ARG F CB    1 
ATOM 4715 C CG    . ARG F 1 110 ? 6.567   20.090  -13.943 1.00 83.56  ?  108 ARG F CG    1 
ATOM 4716 C CD    . ARG F 1 110 ? 7.649   20.716  -13.064 1.00 84.23  ?  108 ARG F CD    1 
ATOM 4717 N NE    . ARG F 1 110 ? 8.949   20.833  -13.716 1.00 79.79  ?  108 ARG F NE    1 
ATOM 4718 C CZ    . ARG F 1 110 ? 9.434   21.965  -14.216 1.00 77.45  ?  108 ARG F CZ    1 
ATOM 4719 N NH1   . ARG F 1 110 ? 8.726   23.082  -14.134 1.00 77.57  1  108 ARG F NH1   1 
ATOM 4720 N NH2   . ARG F 1 110 ? 10.627  21.981  -14.791 1.00 74.27  ?  108 ARG F NH2   1 
ATOM 4721 N N     . HIS F 1 111 ? 4.137   20.558  -17.216 1.00 82.12  ?  109 HIS F N     1 
ATOM 4722 C CA    . HIS F 1 111 ? 2.711   20.768  -17.427 1.00 83.29  ?  109 HIS F CA    1 
ATOM 4723 C C     . HIS F 1 111 ? 2.072   19.612  -18.183 1.00 81.42  ?  109 HIS F C     1 
ATOM 4724 O O     . HIS F 1 111 ? 0.881   19.342  -18.001 1.00 81.22  ?  109 HIS F O     1 
ATOM 4725 C CB    . HIS F 1 111 ? 2.483   22.074  -18.181 1.00 83.51  ?  109 HIS F CB    1 
ATOM 4726 C CG    . HIS F 1 111 ? 2.588   23.295  -17.323 1.00 88.86  ?  109 HIS F CG    1 
ATOM 4727 N ND1   . HIS F 1 111 ? 1.838   23.467  -16.180 1.00 93.40  ?  109 HIS F ND1   1 
ATOM 4728 C CD2   . HIS F 1 111 ? 3.361   24.400  -17.436 1.00 90.06  ?  109 HIS F CD2   1 
ATOM 4729 C CE1   . HIS F 1 111 ? 2.141   24.628  -15.629 1.00 96.49  ?  109 HIS F CE1   1 
ATOM 4730 N NE2   . HIS F 1 111 ? 3.063   25.213  -16.371 1.00 94.35  ?  109 HIS F NE2   1 
ATOM 4731 N N     . PHE F 1 112 ? 2.834   18.929  -19.040 1.00 81.32  ?  110 PHE F N     1 
ATOM 4732 C CA    . PHE F 1 112 ? 2.256   17.834  -19.809 1.00 80.82  ?  110 PHE F CA    1 
ATOM 4733 C C     . PHE F 1 112 ? 1.915   16.645  -18.923 1.00 83.29  ?  110 PHE F C     1 
ATOM 4734 O O     . PHE F 1 112 ? 0.956   15.920  -19.210 1.00 83.16  ?  110 PHE F O     1 
ATOM 4735 C CB    . PHE F 1 112 ? 3.208   17.416  -20.929 1.00 78.05  ?  110 PHE F CB    1 
ATOM 4736 C CG    . PHE F 1 112 ? 2.659   16.336  -21.816 1.00 76.74  ?  110 PHE F CG    1 
ATOM 4737 C CD1   . PHE F 1 112 ? 1.788   16.644  -22.842 1.00 75.63  ?  110 PHE F CD1   1 
ATOM 4738 C CD2   . PHE F 1 112 ? 3.026   15.016  -21.634 1.00 76.81  ?  110 PHE F CD2   1 
ATOM 4739 C CE1   . PHE F 1 112 ? 1.282   15.655  -23.656 1.00 74.12  ?  110 PHE F CE1   1 
ATOM 4740 C CE2   . PHE F 1 112 ? 2.524   14.025  -22.451 1.00 75.12  ?  110 PHE F CE2   1 
ATOM 4741 C CZ    . PHE F 1 112 ? 1.652   14.346  -23.462 1.00 73.71  ?  110 PHE F CZ    1 
ATOM 4742 N N     . GLY F 1 113 ? 2.675   16.426  -17.848 1.00 84.37  ?  111 GLY F N     1 
ATOM 4743 C CA    . GLY F 1 113 ? 2.338   15.350  -16.933 1.00 86.78  ?  111 GLY F CA    1 
ATOM 4744 C C     . GLY F 1 113 ? 1.039   15.597  -16.198 1.00 88.62  ?  111 GLY F C     1 
ATOM 4745 O O     . GLY F 1 113 ? 0.375   14.651  -15.768 1.00 90.06  ?  111 GLY F O     1 
ATOM 4746 N N     . GLU F 1 114 ? 0.668   16.863  -16.030 1.00 88.30  ?  112 GLU F N     1 
ATOM 4747 C CA    . GLU F 1 114 ? -0.581  17.258  -15.388 1.00 89.99  ?  112 GLU F CA    1 
ATOM 4748 C C     . GLU F 1 114 ? -1.578  17.573  -16.497 1.00 90.51  ?  112 GLU F C     1 
ATOM 4749 O O     . GLU F 1 114 ? -1.535  18.654  -17.088 1.00 90.85  ?  112 GLU F O     1 
ATOM 4750 C CB    . GLU F 1 114 ? -0.367  18.452  -14.465 1.00 90.49  ?  112 GLU F CB    1 
ATOM 4751 N N     . GLN F 1 115 ? -2.476  16.626  -16.775 1.00 90.27  ?  113 GLN F N     1 
ATOM 4752 C CA    . GLN F 1 115 ? -3.477  16.769  -17.830 1.00 89.05  ?  113 GLN F CA    1 
ATOM 4753 C C     . GLN F 1 115 ? -2.808  16.874  -19.194 1.00 86.06  ?  113 GLN F C     1 
ATOM 4754 O O     . GLN F 1 115 ? -2.344  17.947  -19.589 1.00 85.29  ?  113 GLN F O     1 
ATOM 4755 C CB    . GLN F 1 115 ? -4.382  17.980  -17.583 1.00 91.09  ?  113 GLN F CB    1 
ATOM 4756 N N     . ASN F 1 116 ? -2.757  15.754  -19.916 1.00 85.51  ?  114 ASN F N     1 
ATOM 4757 C CA    . ASN F 1 116 ? -2.157  15.738  -21.245 1.00 81.83  ?  114 ASN F CA    1 
ATOM 4758 C C     . ASN F 1 116 ? -2.855  16.713  -22.183 1.00 79.50  ?  114 ASN F C     1 
ATOM 4759 O O     . ASN F 1 116 ? -2.200  17.495  -22.880 1.00 78.95  ?  114 ASN F O     1 
ATOM 4760 C CB    . ASN F 1 116 ? -2.198  14.323  -21.819 1.00 82.83  ?  114 ASN F CB    1 
ATOM 4761 C CG    . ASN F 1 116 ? -1.454  13.328  -20.960 1.00 87.67  ?  114 ASN F CG    1 
ATOM 4762 O OD1   . ASN F 1 116 ? -1.083  13.628  -19.826 1.00 91.99  ?  114 ASN F OD1   1 
ATOM 4763 N ND2   . ASN F 1 116 ? -1.234  12.132  -21.492 1.00 86.86  ?  114 ASN F ND2   1 
ATOM 4764 N N     . LYS F 1 117 ? -4.184  16.668  -22.228 1.00 77.57  ?  115 LYS F N     1 
ATOM 4765 C CA    . LYS F 1 117 ? -4.962  17.544  -23.095 1.00 75.14  ?  115 LYS F CA    1 
ATOM 4766 C C     . LYS F 1 117 ? -5.589  18.693  -22.313 1.00 79.02  ?  115 LYS F C     1 
ATOM 4767 O O     . LYS F 1 117 ? -6.720  18.569  -21.828 1.00 80.23  ?  115 LYS F O     1 
ATOM 4768 C CB    . LYS F 1 117 ? -6.051  16.743  -23.810 1.00 71.37  ?  115 LYS F CB    1 
ATOM 4769 C CG    . LYS F 1 117 ? -5.625  15.339  -24.199 1.00 66.01  ?  115 LYS F CG    1 
ATOM 4770 C CD    . LYS F 1 117 ? -6.724  14.621  -24.956 1.00 62.95  ?  115 LYS F CD    1 
ATOM 4771 N N     . PRO F 1 118 ? -4.902  19.822  -22.185 1.00 81.87  ?  116 PRO F N     1 
ATOM 4772 C CA    . PRO F 1 118 ? -5.458  20.948  -21.437 1.00 88.65  ?  116 PRO F CA    1 
ATOM 4773 C C     . PRO F 1 118 ? -6.494  21.707  -22.250 1.00 90.86  ?  116 PRO F C     1 
ATOM 4774 O O     . PRO F 1 118 ? -6.508  21.679  -23.482 1.00 90.02  ?  116 PRO F O     1 
ATOM 4775 C CB    . PRO F 1 118 ? -4.231  21.820  -21.165 1.00 89.52  ?  116 PRO F CB    1 
ATOM 4776 C CG    . PRO F 1 118 ? -3.371  21.589  -22.349 1.00 84.51  ?  116 PRO F CG    1 
ATOM 4777 C CD    . PRO F 1 118 ? -3.615  20.170  -22.808 1.00 79.92  ?  116 PRO F CD    1 
ATOM 4778 N N     . SER F 1 119 ? -7.376  22.389  -21.527 1.00 94.27  ?  117 SER F N     1 
ATOM 4779 C CA    . SER F 1 119 ? -8.457  23.127  -22.156 1.00 97.55  ?  117 SER F CA    1 
ATOM 4780 C C     . SER F 1 119 ? -7.910  24.355  -22.879 1.00 95.80  ?  117 SER F C     1 
ATOM 4781 O O     . SER F 1 119 ? -6.761  24.763  -22.694 1.00 94.44  ?  117 SER F O     1 
ATOM 4782 C CB    . SER F 1 119 ? -9.495  23.535  -21.114 1.00 105.88 ?  117 SER F CB    1 
ATOM 4783 O OG    . SER F 1 119 ? -9.841  22.434  -20.292 1.00 109.98 ?  117 SER F OG    1 
ATOM 4784 N N     . SER F 1 120 ? -8.759  24.949  -23.721 1.00 95.49  ?  118 SER F N     1 
ATOM 4785 C CA    . SER F 1 120 ? -8.372  26.154  -24.446 1.00 98.33  ?  118 SER F CA    1 
ATOM 4786 C C     . SER F 1 120 ? -8.039  27.312  -23.518 1.00 102.17 ?  118 SER F C     1 
ATOM 4787 O O     . SER F 1 120 ? -7.294  28.214  -23.915 1.00 104.45 ?  118 SER F O     1 
ATOM 4788 C CB    . SER F 1 120 ? -9.483  26.565  -25.409 1.00 101.77 ?  118 SER F CB    1 
ATOM 4789 O OG    . SER F 1 120 ? -9.019  27.538  -26.328 1.00 102.23 ?  118 SER F OG    1 
ATOM 4790 N N     . GLN F 1 121 ? -8.571  27.313  -22.299 1.00 103.04 ?  119 GLN F N     1 
ATOM 4791 C CA    . GLN F 1 121 ? -8.253  28.357  -21.334 1.00 108.72 ?  119 GLN F CA    1 
ATOM 4792 C C     . GLN F 1 121 ? -6.991  28.039  -20.547 1.00 108.18 ?  119 GLN F C     1 
ATOM 4793 O O     . GLN F 1 121 ? -6.200  28.942  -20.259 1.00 115.74 ?  119 GLN F O     1 
ATOM 4794 C CB    . GLN F 1 121 ? -9.427  28.573  -20.377 1.00 115.61 ?  119 GLN F CB    1 
ATOM 4795 C CG    . GLN F 1 121 ? -10.750 27.999  -20.863 1.00 119.06 ?  119 GLN F CG    1 
ATOM 4796 C CD    . GLN F 1 121 ? -11.279 28.701  -22.098 1.00 120.74 ?  119 GLN F CD    1 
ATOM 4797 O OE1   . GLN F 1 121 ? -10.894 29.829  -22.402 1.00 121.43 ?  119 GLN F OE1   1 
ATOM 4798 N NE2   . GLN F 1 121 ? -12.172 28.033  -22.817 1.00 121.47 ?  119 GLN F NE2   1 
ATOM 4799 N N     . GLU F 1 122 ? -6.791  26.768  -20.188 1.00 100.20 ?  120 GLU F N     1 
ATOM 4800 C CA    . GLU F 1 122 ? -5.556  26.372  -19.519 1.00 96.57  ?  120 GLU F CA    1 
ATOM 4801 C C     . GLU F 1 122 ? -4.337  26.666  -20.380 1.00 91.43  ?  120 GLU F C     1 
ATOM 4802 O O     . GLU F 1 122 ? -3.260  26.961  -19.852 1.00 89.53  ?  120 GLU F O     1 
ATOM 4803 C CB    . GLU F 1 122 ? -5.604  24.886  -19.169 1.00 95.34  ?  120 GLU F CB    1 
ATOM 4804 C CG    . GLU F 1 122 ? -6.843  24.471  -18.401 1.00 98.87  ?  120 GLU F CG    1 
ATOM 4805 C CD    . GLU F 1 122 ? -6.644  23.190  -17.619 1.00 98.69  ?  120 GLU F CD    1 
ATOM 4806 O OE1   . GLU F 1 122 ? -5.500  22.694  -17.571 1.00 96.23  ?  120 GLU F OE1   1 
ATOM 4807 O OE2   . GLU F 1 122 ? -7.631  22.677  -17.053 1.00 101.17 -1 120 GLU F OE2   1 
ATOM 4808 N N     . ILE F 1 123 ? -4.486  26.587  -21.701 1.00 89.24  ?  121 ILE F N     1 
ATOM 4809 C CA    . ILE F 1 123 ? -3.377  26.876  -22.601 1.00 85.81  ?  121 ILE F CA    1 
ATOM 4810 C C     . ILE F 1 123 ? -2.979  28.344  -22.512 1.00 88.46  ?  121 ILE F C     1 
ATOM 4811 O O     . ILE F 1 123 ? -1.788  28.677  -22.520 1.00 90.02  ?  121 ILE F O     1 
ATOM 4812 C CB    . ILE F 1 123 ? -3.752  26.469  -24.036 1.00 83.60  ?  121 ILE F CB    1 
ATOM 4813 C CG1   . ILE F 1 123 ? -3.817  24.946  -24.144 1.00 60.54  ?  121 ILE F CG1   1 
ATOM 4814 C CG2   . ILE F 1 123 ? -2.752  27.029  -25.031 1.00 83.14  ?  121 ILE F CG2   1 
ATOM 4815 C CD1   . ILE F 1 123 ? -4.402  24.452  -25.440 1.00 58.06  ?  121 ILE F CD1   1 
ATOM 4816 N N     . MET F 1 124 ? -3.959  29.243  -22.404 1.00 90.70  ?  122 MET F N     1 
ATOM 4817 C CA    . MET F 1 124 ? -3.635  30.662  -22.295 1.00 93.60  ?  122 MET F CA    1 
ATOM 4818 C C     . MET F 1 124 ? -2.980  30.987  -20.961 1.00 95.29  ?  122 MET F C     1 
ATOM 4819 O O     . MET F 1 124 ? -2.157  31.905  -20.886 1.00 96.43  ?  122 MET F O     1 
ATOM 4820 C CB    . MET F 1 124 ? -4.886  31.516  -22.490 1.00 99.26  ?  122 MET F CB    1 
ATOM 4821 C CG    . MET F 1 124 ? -5.137  31.934  -23.929 1.00 99.86  ?  122 MET F CG    1 
ATOM 4822 S SD    . MET F 1 124 ? -6.819  32.525  -24.201 1.00 105.68 ?  122 MET F SD    1 
ATOM 4823 C CE    . MET F 1 124 ? -6.588  33.552  -25.650 1.00 104.72 ?  122 MET F CE    1 
ATOM 4824 N N     . ARG F 1 125 ? -3.337  30.260  -19.901 1.00 95.64  ?  123 ARG F N     1 
ATOM 4825 C CA    . ARG F 1 125 ? -2.701  30.483  -18.608 1.00 99.51  ?  123 ARG F CA    1 
ATOM 4826 C C     . ARG F 1 125 ? -1.236  30.071  -18.638 1.00 98.64  ?  123 ARG F C     1 
ATOM 4827 O O     . ARG F 1 125 ? -0.408  30.667  -17.940 1.00 102.05 ?  123 ARG F O     1 
ATOM 4828 C CB    . ARG F 1 125 ? -3.448  29.721  -17.514 1.00 102.51 ?  123 ARG F CB    1 
ATOM 4829 N N     . MET F 1 126 ? -0.902  29.054  -19.435 1.00 93.01  ?  124 MET F N     1 
ATOM 4830 C CA    . MET F 1 126 ? 0.479   28.602  -19.556 1.00 87.64  ?  124 MET F CA    1 
ATOM 4831 C C     . MET F 1 126 ? 1.267   29.466  -20.530 1.00 81.69  ?  124 MET F C     1 
ATOM 4832 O O     . MET F 1 126 ? 2.456   29.721  -20.312 1.00 81.75  ?  124 MET F O     1 
ATOM 4833 C CB    . MET F 1 126 ? 0.511   27.144  -20.002 1.00 85.91  ?  124 MET F CB    1 
ATOM 4834 C CG    . MET F 1 126 ? -0.208  26.196  -19.071 1.00 89.81  ?  124 MET F CG    1 
ATOM 4835 S SD    . MET F 1 126 ? -0.280  24.540  -19.765 1.00 87.68  ?  124 MET F SD    1 
ATOM 4836 C CE    . MET F 1 126 ? 1.334   24.453  -20.526 1.00 83.10  ?  124 MET F CE    1 
ATOM 4837 N N     . ALA F 1 127 ? 0.629   29.898  -21.618 1.00 77.94  ?  125 ALA F N     1 
ATOM 4838 C CA    . ALA F 1 127 ? 1.294   30.783  -22.569 1.00 77.55  ?  125 ALA F CA    1 
ATOM 4839 C C     . ALA F 1 127 ? 1.824   32.035  -21.885 1.00 85.19  ?  125 ALA F C     1 
ATOM 4840 O O     . ALA F 1 127 ? 2.890   32.546  -22.248 1.00 83.74  ?  125 ALA F O     1 
ATOM 4841 C CB    . ALA F 1 127 ? 0.332   31.158  -23.694 1.00 74.44  ?  125 ALA F CB    1 
ATOM 4842 N N     . GLU F 1 128 ? 1.102   32.537  -20.885 1.00 93.42  ?  126 GLU F N     1 
ATOM 4843 C CA    . GLU F 1 128 ? 1.582   33.698  -20.147 1.00 100.58 ?  126 GLU F CA    1 
ATOM 4844 C C     . GLU F 1 128 ? 2.693   33.317  -19.179 1.00 103.88 ?  126 GLU F C     1 
ATOM 4845 O O     . GLU F 1 128 ? 3.657   34.070  -19.009 1.00 110.13 ?  126 GLU F O     1 
ATOM 4846 C CB    . GLU F 1 128 ? 0.423   34.359  -19.401 1.00 82.31  ?  126 GLU F CB    1 
ATOM 4847 N N     . GLU F 1 129 ? 2.580   32.147  -18.547 1.00 99.13  ?  127 GLU F N     1 
ATOM 4848 C CA    . GLU F 1 129 ? 3.616   31.700  -17.623 1.00 102.62 ?  127 GLU F CA    1 
ATOM 4849 C C     . GLU F 1 129 ? 4.935   31.433  -18.337 1.00 102.48 ?  127 GLU F C     1 
ATOM 4850 O O     . GLU F 1 129 ? 6.005   31.624  -17.749 1.00 108.13 ?  127 GLU F O     1 
ATOM 4851 C CB    . GLU F 1 129 ? 3.141   30.446  -16.886 1.00 101.74 ?  127 GLU F CB    1 
ATOM 4852 C CG    . GLU F 1 129 ? 4.252   29.586  -16.311 1.00 101.16 ?  127 GLU F CG    1 
ATOM 4853 C CD    . GLU F 1 129 ? 3.742   28.288  -15.730 1.00 102.15 ?  127 GLU F CD    1 
ATOM 4854 O OE1   . GLU F 1 129 ? 4.513   27.307  -15.699 1.00 101.06 ?  127 GLU F OE1   1 
ATOM 4855 O OE2   . GLU F 1 129 ? 2.576   28.256  -15.286 1.00 104.88 -1 127 GLU F OE2   1 
ATOM 4856 N N     . LEU F 1 130 ? 4.886   31.035  -19.606 1.00 95.66  ?  128 LEU F N     1 
ATOM 4857 C CA    . LEU F 1 130 ? 6.086   30.700  -20.360 1.00 93.59  ?  128 LEU F CA    1 
ATOM 4858 C C     . LEU F 1 130 ? 6.483   31.779  -21.356 1.00 91.15  ?  128 LEU F C     1 
ATOM 4859 O O     . LEU F 1 130 ? 7.519   31.642  -22.012 1.00 91.67  ?  128 LEU F O     1 
ATOM 4860 C CB    . LEU F 1 130 ? 5.891   29.368  -21.091 1.00 92.93  ?  128 LEU F CB    1 
ATOM 4861 N N     . ASN F 1 131 ? 5.679   32.834  -21.490 1.00 89.22  ?  129 ASN F N     1 
ATOM 4862 C CA    . ASN F 1 131 ? 5.971   33.953  -22.386 1.00 89.03  ?  129 ASN F CA    1 
ATOM 4863 C C     . ASN F 1 131 ? 6.034   33.482  -23.839 1.00 85.71  ?  129 ASN F C     1 
ATOM 4864 O O     . ASN F 1 131 ? 6.971   33.787  -24.579 1.00 84.99  ?  129 ASN F O     1 
ATOM 4865 C CB    . ASN F 1 131 ? 7.264   34.663  -21.968 1.00 89.71  ?  129 ASN F CB    1 
ATOM 4866 C CG    . ASN F 1 131 ? 7.422   36.026  -22.612 1.00 90.32  ?  129 ASN F CG    1 
ATOM 4867 O OD1   . ASN F 1 131 ? 6.445   36.644  -23.033 1.00 91.04  ?  129 ASN F OD1   1 
ATOM 4868 N ND2   . ASN F 1 131 ? 8.658   36.505  -22.685 1.00 90.99  ?  129 ASN F ND2   1 
ATOM 4869 N N     . LEU F 1 132 ? 5.024   32.713  -24.241 1.00 82.75  ?  130 LEU F N     1 
ATOM 4870 C CA    . LEU F 1 132 ? 4.900   32.227  -25.606 1.00 80.86  ?  130 LEU F CA    1 
ATOM 4871 C C     . LEU F 1 132 ? 3.501   32.517  -26.133 1.00 80.32  ?  130 LEU F C     1 
ATOM 4872 O O     . LEU F 1 132 ? 2.565   32.758  -25.368 1.00 83.42  ?  130 LEU F O     1 
ATOM 4873 C CB    . LEU F 1 132 ? 5.194   30.726  -25.698 1.00 79.95  ?  130 LEU F CB    1 
ATOM 4874 C CG    . LEU F 1 132 ? 6.654   30.322  -25.506 1.00 79.63  ?  130 LEU F CG    1 
ATOM 4875 C CD1   . LEU F 1 132 ? 6.769   28.824  -25.287 1.00 76.91  ?  130 LEU F CD1   1 
ATOM 4876 C CD2   . LEU F 1 132 ? 7.491   30.764  -26.689 1.00 78.83  ?  130 LEU F CD2   1 
ATOM 4877 N N     . GLU F 1 133 ? 3.371   32.493  -27.457 1.00 76.21  ?  131 GLU F N     1 
ATOM 4878 C CA    . GLU F 1 133 ? 2.072   32.663  -28.089 1.00 74.24  ?  131 GLU F CA    1 
ATOM 4879 C C     . GLU F 1 133 ? 1.179   31.454  -27.821 1.00 73.89  ?  131 GLU F C     1 
ATOM 4880 O O     . GLU F 1 133 ? 1.648   30.345  -27.553 1.00 72.71  ?  131 GLU F O     1 
ATOM 4881 C CB    . GLU F 1 133 ? 2.228   32.875  -29.594 1.00 70.00  ?  131 GLU F CB    1 
ATOM 4882 N N     . LYS F 1 134 ? -0.134  31.688  -27.893 1.00 75.13  ?  132 LYS F N     1 
ATOM 4883 C CA    . LYS F 1 134 ? -1.099  30.626  -27.621 1.00 76.11  ?  132 LYS F CA    1 
ATOM 4884 C C     . LYS F 1 134 ? -1.013  29.511  -28.655 1.00 75.91  ?  132 LYS F C     1 
ATOM 4885 O O     . LYS F 1 134 ? -1.100  28.328  -28.308 1.00 75.79  ?  132 LYS F O     1 
ATOM 4886 C CB    . LYS F 1 134 ? -2.511  31.204  -27.576 1.00 76.97  ?  132 LYS F CB    1 
ATOM 4887 C CG    . LYS F 1 134 ? -2.638  32.460  -26.736 1.00 79.20  ?  132 LYS F CG    1 
ATOM 4888 N N     . GLU F 1 135 ? -0.848  29.869  -29.929 1.00 76.21  ?  133 GLU F N     1 
ATOM 4889 C CA    . GLU F 1 135 ? -0.811  28.864  -30.987 1.00 76.78  ?  133 GLU F CA    1 
ATOM 4890 C C     . GLU F 1 135 ? 0.383   27.935  -30.819 1.00 75.67  ?  133 GLU F C     1 
ATOM 4891 O O     . GLU F 1 135 ? 0.258   26.713  -30.947 1.00 72.28  ?  133 GLU F O     1 
ATOM 4892 C CB    . GLU F 1 135 ? -0.759  29.551  -32.352 1.00 82.71  ?  133 GLU F CB    1 
ATOM 4893 C CG    . GLU F 1 135 ? -2.108  29.897  -32.950 1.00 88.21  ?  133 GLU F CG    1 
ATOM 4894 C CD    . GLU F 1 135 ? -2.809  28.699  -33.546 1.00 87.96  ?  133 GLU F CD    1 
ATOM 4895 O OE1   . GLU F 1 135 ? -3.884  28.327  -33.036 1.00 87.93  ?  133 GLU F OE1   1 
ATOM 4896 O OE2   . GLU F 1 135 ? -2.287  28.129  -34.525 1.00 86.15  -1 133 GLU F OE2   1 
ATOM 4897 N N     . VAL F 1 136 ? 1.555   28.505  -30.536 1.00 80.64  ?  134 VAL F N     1 
ATOM 4898 C CA    . VAL F 1 136 ? 2.773   27.708  -30.416 1.00 81.28  ?  134 VAL F CA    1 
ATOM 4899 C C     . VAL F 1 136 ? 2.640   26.690  -29.293 1.00 79.12  ?  134 VAL F C     1 
ATOM 4900 O O     . VAL F 1 136 ? 3.101   25.549  -29.410 1.00 77.22  ?  134 VAL F O     1 
ATOM 4901 C CB    . VAL F 1 136 ? 3.988   28.629  -30.204 1.00 86.09  ?  134 VAL F CB    1 
ATOM 4902 C CG1   . VAL F 1 136 ? 5.249   27.811  -29.999 1.00 84.90  ?  134 VAL F CG1   1 
ATOM 4903 C CG2   . VAL F 1 136 ? 4.145   29.571  -31.382 1.00 89.90  ?  134 VAL F CG2   1 
ATOM 4904 N N     . VAL F 1 137 ? 2.004   27.082  -28.190 1.00 77.66  ?  135 VAL F N     1 
ATOM 4905 C CA    . VAL F 1 137 ? 1.840   26.156  -27.079 1.00 78.41  ?  135 VAL F CA    1 
ATOM 4906 C C     . VAL F 1 137 ? 0.814   25.080  -27.409 1.00 77.99  ?  135 VAL F C     1 
ATOM 4907 O O     . VAL F 1 137 ? 0.968   23.925  -26.995 1.00 80.85  ?  135 VAL F O     1 
ATOM 4908 C CB    . VAL F 1 137 ? 1.462   26.927  -25.803 1.00 82.29  ?  135 VAL F CB    1 
ATOM 4909 C CG1   . VAL F 1 137 ? 1.339   25.978  -24.626 1.00 83.54  ?  135 VAL F CG1   1 
ATOM 4910 C CG2   . VAL F 1 137 ? 2.495   27.999  -25.515 1.00 83.72  ?  135 VAL F CG2   1 
ATOM 4911 N N     . ARG F 1 138 ? -0.241  25.426  -28.152 1.00 73.19  ?  136 ARG F N     1 
ATOM 4912 C CA    . ARG F 1 138 ? -1.246  24.428  -28.510 1.00 71.59  ?  136 ARG F CA    1 
ATOM 4913 C C     . ARG F 1 138 ? -0.651  23.340  -29.393 1.00 66.57  ?  136 ARG F C     1 
ATOM 4914 O O     . ARG F 1 138 ? -0.822  22.147  -29.126 1.00 64.96  ?  136 ARG F O     1 
ATOM 4915 C CB    . ARG F 1 138 ? -2.438  25.081  -29.207 1.00 74.27  ?  136 ARG F CB    1 
ATOM 4916 C CG    . ARG F 1 138 ? -3.636  24.143  -29.310 1.00 76.63  ?  136 ARG F CG    1 
ATOM 4917 C CD    . ARG F 1 138 ? -4.735  24.670  -30.214 1.00 80.73  ?  136 ARG F CD    1 
ATOM 4918 N NE    . ARG F 1 138 ? -4.406  24.507  -31.625 1.00 82.94  ?  136 ARG F NE    1 
ATOM 4919 C CZ    . ARG F 1 138 ? -3.922  25.475  -32.392 1.00 84.74  ?  136 ARG F CZ    1 
ATOM 4920 N NH1   . ARG F 1 138 ? -3.721  26.680  -31.883 1.00 84.59  1  136 ARG F NH1   1 
ATOM 4921 N NH2   . ARG F 1 138 ? -3.649  25.242  -33.668 1.00 84.20  ?  136 ARG F NH2   1 
ATOM 4922 N N     . VAL F 1 139 ? 0.042   23.738  -30.462 1.00 62.60  ?  137 VAL F N     1 
ATOM 4923 C CA    . VAL F 1 139 ? 0.645   22.760  -31.362 1.00 59.11  ?  137 VAL F CA    1 
ATOM 4924 C C     . VAL F 1 139 ? 1.704   21.939  -30.643 1.00 59.95  ?  137 VAL F C     1 
ATOM 4925 O O     . VAL F 1 139 ? 1.935   20.775  -30.991 1.00 41.99  ?  137 VAL F O     1 
ATOM 4926 C CB    . VAL F 1 139 ? 1.209   23.456  -32.615 1.00 58.15  ?  137 VAL F CB    1 
ATOM 4927 C CG1   . VAL F 1 139 ? 0.146   24.330  -33.245 1.00 44.42  ?  137 VAL F CG1   1 
ATOM 4928 C CG2   . VAL F 1 139 ? 2.434   24.279  -32.274 1.00 61.22  ?  137 VAL F CG2   1 
ATOM 4929 N N     . TRP F 1 140 ? 2.372   22.524  -29.645 1.00 61.60  ?  138 TRP F N     1 
ATOM 4930 C CA    . TRP F 1 140 ? 3.358   21.772  -28.876 1.00 59.85  ?  138 TRP F CA    1 
ATOM 4931 C C     . TRP F 1 140 ? 2.724   20.533  -28.264 1.00 60.47  ?  138 TRP F C     1 
ATOM 4932 O O     . TRP F 1 140 ? 3.239   19.420  -28.406 1.00 56.71  ?  138 TRP F O     1 
ATOM 4933 C CB    . TRP F 1 140 ? 3.968   22.656  -27.788 1.00 60.01  ?  138 TRP F CB    1 
ATOM 4934 C CG    . TRP F 1 140 ? 5.205   22.073  -27.169 1.00 58.38  ?  138 TRP F CG    1 
ATOM 4935 C CD1   . TRP F 1 140 ? 6.493   22.338  -27.517 1.00 58.85  ?  138 TRP F CD1   1 
ATOM 4936 C CD2   . TRP F 1 140 ? 5.267   21.115  -26.105 1.00 58.55  ?  138 TRP F CD2   1 
ATOM 4937 N NE1   . TRP F 1 140 ? 7.355   21.613  -26.734 1.00 60.17  ?  138 TRP F NE1   1 
ATOM 4938 C CE2   . TRP F 1 140 ? 6.626   20.853  -25.859 1.00 60.01  ?  138 TRP F CE2   1 
ATOM 4939 C CE3   . TRP F 1 140 ? 4.305   20.457  -25.335 1.00 58.56  ?  138 TRP F CE3   1 
ATOM 4940 C CZ2   . TRP F 1 140 ? 7.046   19.961  -24.879 1.00 60.43  ?  138 TRP F CZ2   1 
ATOM 4941 C CZ3   . TRP F 1 140 ? 4.724   19.574  -24.364 1.00 58.96  ?  138 TRP F CZ3   1 
ATOM 4942 C CH2   . TRP F 1 140 ? 6.081   19.333  -24.144 1.00 60.23  ?  138 TRP F CH2   1 
ATOM 4943 N N     . PHE F 1 141 ? 1.600   20.714  -27.570 1.00 67.14  ?  139 PHE F N     1 
ATOM 4944 C CA    . PHE F 1 141 ? 0.894   19.575  -26.999 1.00 72.57  ?  139 PHE F CA    1 
ATOM 4945 C C     . PHE F 1 141 ? 0.402   18.630  -28.082 1.00 77.25  ?  139 PHE F C     1 
ATOM 4946 O O     . PHE F 1 141 ? 0.356   17.415  -27.868 1.00 77.32  ?  139 PHE F O     1 
ATOM 4947 C CB    . PHE F 1 141 ? -0.275  20.054  -26.145 1.00 74.36  ?  139 PHE F CB    1 
ATOM 4948 C CG    . PHE F 1 141 ? 0.128   20.531  -24.786 1.00 76.92  ?  139 PHE F CG    1 
ATOM 4949 C CD1   . PHE F 1 141 ? 0.226   19.645  -23.730 1.00 78.65  ?  139 PHE F CD1   1 
ATOM 4950 C CD2   . PHE F 1 141 ? 0.413   21.864  -24.565 1.00 78.74  ?  139 PHE F CD2   1 
ATOM 4951 C CE1   . PHE F 1 141 ? 0.597   20.079  -22.481 1.00 82.18  ?  139 PHE F CE1   1 
ATOM 4952 C CE2   . PHE F 1 141 ? 0.784   22.303  -23.318 1.00 82.17  ?  139 PHE F CE2   1 
ATOM 4953 C CZ    . PHE F 1 141 ? 0.876   21.410  -22.274 1.00 83.93  ?  139 PHE F CZ    1 
ATOM 4954 N N     . CYS F 1 142 ? 0.018   19.166  -29.241 1.00 71.37  ?  140 CYS F N     1 
ATOM 4955 C CA    . CYS F 1 142 ? -0.384  18.317  -30.355 1.00 66.21  ?  140 CYS F CA    1 
ATOM 4956 C C     . CYS F 1 142 ? 0.754   17.393  -30.772 1.00 63.04  ?  140 CYS F C     1 
ATOM 4957 O O     . CYS F 1 142 ? 0.606   16.166  -30.776 1.00 62.75  ?  140 CYS F O     1 
ATOM 4958 C CB    . CYS F 1 142 ? -0.848  19.182  -31.527 1.00 67.30  ?  140 CYS F CB    1 
ATOM 4959 S SG    . CYS F 1 142 ? -2.301  20.198  -31.172 1.00 69.56  ?  140 CYS F SG    1 
ATOM 4960 N N     . ASN F 1 143 ? 1.907   17.970  -31.124 1.00 60.66  ?  141 ASN F N     1 
ATOM 4961 C CA    . ASN F 1 143 ? 3.061   17.150  -31.481 1.00 54.75  ?  141 ASN F CA    1 
ATOM 4962 C C     . ASN F 1 143 ? 3.523   16.292  -30.313 1.00 50.81  ?  141 ASN F C     1 
ATOM 4963 O O     . ASN F 1 143 ? 3.995   15.169  -30.517 1.00 47.92  ?  141 ASN F O     1 
ATOM 4964 C CB    . ASN F 1 143 ? 4.211   18.030  -31.968 1.00 52.61  ?  141 ASN F CB    1 
ATOM 4965 C CG    . ASN F 1 143 ? 3.911   18.704  -33.287 1.00 51.55  ?  141 ASN F CG    1 
ATOM 4966 O OD1   . ASN F 1 143 ? 3.161   18.179  -34.108 1.00 51.41  ?  141 ASN F OD1   1 
ATOM 4967 N ND2   . ASN F 1 143 ? 4.496   19.876  -33.499 1.00 50.70  ?  141 ASN F ND2   1 
ATOM 4968 N N     . ARG F 1 144 ? 3.411   16.807  -29.087 1.00 50.53  ?  142 ARG F N     1 
ATOM 4969 C CA    . ARG F 1 144 ? 3.743   16.001  -27.918 1.00 51.79  ?  142 ARG F CA    1 
ATOM 4970 C C     . ARG F 1 144 ? 2.789   14.824  -27.783 1.00 53.77  ?  142 ARG F C     1 
ATOM 4971 O O     . ARG F 1 144 ? 3.207   13.711  -27.447 1.00 53.94  ?  142 ARG F O     1 
ATOM 4972 C CB    . ARG F 1 144 ? 3.719   16.859  -26.658 1.00 43.38  ?  142 ARG F CB    1 
ATOM 4973 C CG    . ARG F 1 144 ? 4.262   16.151  -25.433 1.00 54.24  ?  142 ARG F CG    1 
ATOM 4974 C CD    . ARG F 1 144 ? 5.686   15.693  -25.671 1.00 53.25  ?  142 ARG F CD    1 
ATOM 4975 N NE    . ARG F 1 144 ? 6.261   15.058  -24.495 1.00 45.30  ?  142 ARG F NE    1 
ATOM 4976 C CZ    . ARG F 1 144 ? 6.143   13.767  -24.218 1.00 55.25  ?  142 ARG F CZ    1 
ATOM 4977 N NH1   . ARG F 1 144 ? 5.467   12.976  -25.032 1.00 52.79  1  142 ARG F NH1   1 
ATOM 4978 N NH2   . ARG F 1 144 ? 6.702   13.267  -23.127 1.00 58.13  ?  142 ARG F NH2   1 
ATOM 4979 N N     . ARG F 1 145 ? 1.501   15.057  -28.031 1.00 55.49  ?  143 ARG F N     1 
ATOM 4980 C CA    . ARG F 1 145 ? 0.522   13.979  -27.975 1.00 56.17  ?  143 ARG F CA    1 
ATOM 4981 C C     . ARG F 1 145 ? 0.781   12.952  -29.068 1.00 55.13  ?  143 ARG F C     1 
ATOM 4982 O O     . ARG F 1 145 ? 0.695   11.744  -28.824 1.00 57.47  ?  143 ARG F O     1 
ATOM 4983 C CB    . ARG F 1 145 ? -0.883  14.559  -28.085 1.00 57.57  ?  143 ARG F CB    1 
ATOM 4984 C CG    . ARG F 1 145 ? -1.476  14.962  -26.749 1.00 60.75  ?  143 ARG F CG    1 
ATOM 4985 C CD    . ARG F 1 145 ? -2.823  15.620  -26.935 1.00 63.01  ?  143 ARG F CD    1 
ATOM 4986 N NE    . ARG F 1 145 ? -2.709  17.074  -26.910 1.00 64.58  ?  143 ARG F NE    1 
ATOM 4987 C CZ    . ARG F 1 145 ? -3.605  17.903  -27.432 1.00 65.97  ?  143 ARG F CZ    1 
ATOM 4988 N NH1   . ARG F 1 145 ? -4.680  17.423  -28.037 1.00 67.36  1  143 ARG F NH1   1 
ATOM 4989 N NH2   . ARG F 1 145 ? -3.421  19.213  -27.360 1.00 66.34  ?  143 ARG F NH2   1 
ATOM 4990 N N     . GLN F 1 146 ? 1.081   13.415  -30.283 1.00 51.82  ?  144 GLN F N     1 
ATOM 4991 C CA    . GLN F 1 146 ? 1.426   12.494  -31.360 1.00 49.65  ?  144 GLN F CA    1 
ATOM 4992 C C     . GLN F 1 146 ? 2.669   11.689  -31.014 1.00 49.89  ?  144 GLN F C     1 
ATOM 4993 O O     . GLN F 1 146 ? 2.790   10.522  -31.400 1.00 49.17  ?  144 GLN F O     1 
ATOM 4994 C CB    . GLN F 1 146 ? 1.653   13.261  -32.658 1.00 49.02  ?  144 GLN F CB    1 
ATOM 4995 C CG    . GLN F 1 146 ? 0.408   13.763  -33.342 1.00 48.90  ?  144 GLN F CG    1 
ATOM 4996 C CD    . GLN F 1 146 ? 0.680   14.135  -34.780 1.00 50.52  ?  144 GLN F CD    1 
ATOM 4997 O OE1   . GLN F 1 146 ? 1.670   14.798  -35.082 1.00 50.86  ?  144 GLN F OE1   1 
ATOM 4998 N NE2   . GLN F 1 146 ? -0.182  13.691  -35.679 1.00 52.72  ?  144 GLN F NE2   1 
ATOM 4999 N N     . ARG F 1 147 ? 3.611   12.307  -30.298 1.00 51.56  ?  145 ARG F N     1 
ATOM 5000 C CA    . ARG F 1 147 ? 4.846   11.625  -29.926 1.00 53.10  ?  145 ARG F CA    1 
ATOM 5001 C C     . ARG F 1 147 ? 4.556   10.361  -29.129 1.00 54.96  ?  145 ARG F C     1 
ATOM 5002 O O     . ARG F 1 147 ? 5.124   9.297   -29.397 1.00 55.68  ?  145 ARG F O     1 
ATOM 5003 C CB    . ARG F 1 147 ? 5.741   12.575  -29.131 1.00 52.54  ?  145 ARG F CB    1 
ATOM 5004 C CG    . ARG F 1 147 ? 7.026   11.951  -28.630 1.00 52.56  ?  145 ARG F CG    1 
ATOM 5005 C CD    . ARG F 1 147 ? 8.034   13.013  -28.233 1.00 53.92  ?  145 ARG F CD    1 
ATOM 5006 N NE    . ARG F 1 147 ? 9.277   12.426  -27.747 1.00 40.33  ?  145 ARG F NE    1 
ATOM 5007 N N     . GLU F 1 148 ? 3.654   10.454  -28.155 1.00 54.38  ?  146 GLU F N     1 
ATOM 5008 C CA    . GLU F 1 148 ? 3.299   9.290   -27.356 1.00 57.76  ?  146 GLU F CA    1 
ATOM 5009 C C     . GLU F 1 148 ? 2.492   8.261   -28.134 1.00 60.27  ?  146 GLU F C     1 
ATOM 5010 O O     . GLU F 1 148 ? 2.201   7.192   -27.589 1.00 62.91  ?  146 GLU F O     1 
ATOM 5011 C CB    . GLU F 1 148 ? 2.523   9.729   -26.115 1.00 58.97  ?  146 GLU F CB    1 
ATOM 5012 C CG    . GLU F 1 148 ? 3.356   10.502  -25.108 1.00 59.65  ?  146 GLU F CG    1 
ATOM 5013 C CD    . GLU F 1 148 ? 4.291   9.610   -24.316 1.00 60.92  ?  146 GLU F CD    1 
ATOM 5014 O OE1   . GLU F 1 148 ? 5.238   10.142  -23.703 1.00 62.68  ?  146 GLU F OE1   1 
ATOM 5015 O OE2   . GLU F 1 148 ? 4.098   8.378   -24.331 1.00 60.63  -1 146 GLU F OE2   1 
ATOM 5016 N N     . LYS F 1 149 ? 2.136   8.547   -29.383 1.00 59.05  ?  147 LYS F N     1 
ATOM 5017 C CA    . LYS F 1 149 ? 1.415   7.607   -30.226 1.00 58.63  ?  147 LYS F CA    1 
ATOM 5018 C C     . LYS F 1 149 ? 2.336   6.866   -31.182 1.00 59.06  ?  147 LYS F C     1 
ATOM 5019 O O     . LYS F 1 149 ? 1.856   6.082   -32.005 1.00 57.54  ?  147 LYS F O     1 
ATOM 5020 C CB    . LYS F 1 149 ? 0.322   8.334   -31.015 1.00 57.61  ?  147 LYS F CB    1 
ATOM 5021 N N     . ARG F 1 150 ? 3.642   7.097   -31.091 1.00 61.24  ?  148 ARG F N     1 
ATOM 5022 C CA    . ARG F 1 150 ? 4.600   6.392   -31.920 1.00 60.49  ?  148 ARG F CA    1 
ATOM 5023 C C     . ARG F 1 150 ? 4.672   4.925   -31.511 1.00 63.12  ?  148 ARG F C     1 
ATOM 5024 O O     . ARG F 1 150 ? 4.151   4.509   -30.474 1.00 64.49  ?  148 ARG F O     1 
ATOM 5025 C CB    . ARG F 1 150 ? 5.982   7.031   -31.801 1.00 57.48  ?  148 ARG F CB    1 
ATOM 5026 C CG    . ARG F 1 150 ? 6.081   8.455   -32.311 1.00 54.78  ?  148 ARG F CG    1 
ATOM 5027 C CD    . ARG F 1 150 ? 7.376   9.082   -31.831 1.00 53.53  ?  148 ARG F CD    1 
ATOM 5028 N NE    . ARG F 1 150 ? 7.642   10.379  -32.440 1.00 51.49  ?  148 ARG F NE    1 
ATOM 5029 C CZ    . ARG F 1 150 ? 8.648   11.170  -32.086 1.00 49.93  ?  148 ARG F CZ    1 
ATOM 5030 N NH1   . ARG F 1 150 ? 9.479   10.793  -31.128 1.00 50.23  1  148 ARG F NH1   1 
ATOM 5031 N NH2   . ARG F 1 150 ? 8.823   12.336  -32.687 1.00 49.77  ?  148 ARG F NH2   1 
ATOM 5032 N N     . VAL F 1 151 ? 5.338   4.134   -32.347 1.00 64.63  ?  149 VAL F N     1 
ATOM 5033 C CA    . VAL F 1 151 ? 5.561   2.729   -32.033 1.00 66.99  ?  149 VAL F CA    1 
ATOM 5034 C C     . VAL F 1 151 ? 6.804   2.530   -31.172 1.00 69.37  ?  149 VAL F C     1 
ATOM 5035 O O     . VAL F 1 151 ? 6.851   1.574   -30.385 1.00 71.02  ?  149 VAL F O     1 
ATOM 5036 C CB    . VAL F 1 151 ? 5.639   1.909   -33.334 1.00 67.00  ?  149 VAL F CB    1 
ATOM 5037 C CG1   . VAL F 1 151 ? 6.681   2.491   -34.263 1.00 67.22  ?  149 VAL F CG1   1 
ATOM 5038 C CG2   . VAL F 1 151 ? 5.913   0.442   -33.047 1.00 68.36  ?  149 VAL F CG2   1 
ATOM 5039 N N     . LYS F 1 152 ? 7.766   3.450   -31.239 1.00 70.21  ?  150 LYS F N     1 
ATOM 5040 C CA    . LYS F 1 152 ? 9.042   3.364   -30.529 1.00 73.15  ?  150 LYS F CA    1 
ATOM 5041 C C     . LYS F 1 152 ? 9.970   4.474   -30.999 1.00 74.03  ?  150 LYS F C     1 
ATOM 5042 O O     . LYS F 1 152 ? 11.090  4.221   -31.440 1.00 74.59  ?  150 LYS F O     1 
ATOM 5043 C CB    . LYS F 1 152 ? 9.724   2.011   -30.754 1.00 74.55  ?  150 LYS F CB    1 
ATOM 5044 O OXT   . LYS F 1 152 ? 9.619   5.652   -30.947 1.00 73.85  ?  150 LYS F OXT   1 
ATOM 5045 C "C4'" . DC  G 2 1   ? 24.536  12.696  -46.374 1.00 71.14  ?  170 DC  G "C4'" 1 
ATOM 5046 O "O4'" . DC  G 2 1   ? 24.687  13.971  -45.728 1.00 72.37  ?  170 DC  G "O4'" 1 
ATOM 5047 C "C3'" . DC  G 2 1   ? 23.202  12.148  -45.877 1.00 71.42  ?  170 DC  G "C3'" 1 
ATOM 5048 O "O3'" . DC  G 2 1   ? 23.302  10.745  -45.635 1.00 72.70  ?  170 DC  G "O3'" 1 
ATOM 5049 C "C2'" . DC  G 2 1   ? 22.915  12.933  -44.585 1.00 71.60  ?  170 DC  G "C2'" 1 
ATOM 5050 C "C1'" . DC  G 2 1   ? 24.086  13.903  -44.462 1.00 71.75  ?  170 DC  G "C1'" 1 
ATOM 5051 N N1    . DC  G 2 1   ? 23.670  15.274  -44.053 1.00 70.22  ?  170 DC  G N1    1 
ATOM 5052 C C2    . DC  G 2 1   ? 23.353  15.528  -42.718 1.00 69.25  ?  170 DC  G C2    1 
ATOM 5053 O O2    . DC  G 2 1   ? 23.424  14.607  -41.899 1.00 67.73  ?  170 DC  G O2    1 
ATOM 5054 N N3    . DC  G 2 1   ? 22.974  16.778  -42.359 1.00 70.57  ?  170 DC  G N3    1 
ATOM 5055 C C4    . DC  G 2 1   ? 22.908  17.744  -43.274 1.00 70.79  ?  170 DC  G C4    1 
ATOM 5056 N N4    . DC  G 2 1   ? 22.530  18.962  -42.873 1.00 71.12  ?  170 DC  G N4    1 
ATOM 5057 C C5    . DC  G 2 1   ? 23.228  17.505  -44.641 1.00 70.13  ?  170 DC  G C5    1 
ATOM 5058 C C6    . DC  G 2 1   ? 23.599  16.267  -44.983 1.00 69.94  ?  170 DC  G C6    1 
ATOM 5059 P P     . DC  G 2 2   ? 22.077  9.946   -44.971 1.00 74.22  ?  171 DC  G P     1 
ATOM 5060 O OP1   . DC  G 2 2   ? 22.308  8.498   -45.143 1.00 75.16  ?  171 DC  G OP1   1 
ATOM 5061 O OP2   . DC  G 2 2   ? 20.830  10.553  -45.475 1.00 72.28  ?  171 DC  G OP2   1 
ATOM 5062 O "O5'" . DC  G 2 2   ? 22.189  10.296  -43.421 1.00 75.35  ?  171 DC  G "O5'" 1 
ATOM 5063 C "C5'" . DC  G 2 2   ? 21.576  9.473   -42.458 1.00 74.66  ?  171 DC  G "C5'" 1 
ATOM 5064 C "C4'" . DC  G 2 2   ? 21.587  10.154  -41.105 1.00 77.06  ?  171 DC  G "C4'" 1 
ATOM 5065 O "O4'" . DC  G 2 2   ? 21.718  11.578  -41.288 1.00 79.02  ?  171 DC  G "O4'" 1 
ATOM 5066 C "C3'" . DC  G 2 2   ? 20.320  9.946   -40.274 1.00 77.00  ?  171 DC  G "C3'" 1 
ATOM 5067 O "O3'" . DC  G 2 2   ? 20.615  9.191   -39.117 1.00 76.63  ?  171 DC  G "O3'" 1 
ATOM 5068 C "C2'" . DC  G 2 2   ? 19.843  11.360  -39.919 1.00 78.49  ?  171 DC  G "C2'" 1 
ATOM 5069 C "C1'" . DC  G 2 2   ? 21.042  12.234  -40.251 1.00 81.10  ?  171 DC  G "C1'" 1 
ATOM 5070 N N1    . DC  G 2 2   ? 20.655  13.586  -40.725 1.00 82.76  ?  171 DC  G N1    1 
ATOM 5071 C C2    . DC  G 2 2   ? 20.916  14.703  -39.927 1.00 85.18  ?  171 DC  G C2    1 
ATOM 5072 O O2    . DC  G 2 2   ? 21.484  14.549  -38.840 1.00 88.13  ?  171 DC  G O2    1 
ATOM 5073 N N3    . DC  G 2 2   ? 20.547  15.927  -40.375 1.00 83.80  ?  171 DC  G N3    1 
ATOM 5074 C C4    . DC  G 2 2   ? 19.938  16.052  -41.554 1.00 80.93  ?  171 DC  G C4    1 
ATOM 5075 N N4    . DC  G 2 2   ? 19.592  17.279  -41.953 1.00 80.62  ?  171 DC  G N4    1 
ATOM 5076 C C5    . DC  G 2 2   ? 19.660  14.925  -42.376 1.00 79.80  ?  171 DC  G C5    1 
ATOM 5077 C C6    . DC  G 2 2   ? 20.029  13.723  -41.925 1.00 80.70  ?  171 DC  G C6    1 
ATOM 5078 P P     . DA  G 2 3   ? 19.425  8.553   -38.253 1.00 73.86  ?  172 DA  G P     1 
ATOM 5079 O OP1   . DA  G 2 3   ? 20.017  7.490   -37.416 1.00 74.82  ?  172 DA  G OP1   1 
ATOM 5080 O OP2   . DA  G 2 3   ? 18.303  8.238   -39.161 1.00 70.14  ?  172 DA  G OP2   1 
ATOM 5081 O "O5'" . DA  G 2 3   ? 18.980  9.753   -37.305 1.00 74.29  ?  172 DA  G "O5'" 1 
ATOM 5082 C "C5'" . DA  G 2 3   ? 19.888  10.258  -36.353 1.00 76.48  ?  172 DA  G "C5'" 1 
ATOM 5083 C "C4'" . DA  G 2 3   ? 19.326  11.479  -35.653 1.00 76.57  ?  172 DA  G "C4'" 1 
ATOM 5084 O "O4'" . DA  G 2 3   ? 19.261  12.586  -36.574 1.00 77.57  ?  172 DA  G "O4'" 1 
ATOM 5085 C "C3'" . DA  G 2 3   ? 17.918  11.320  -35.066 1.00 72.60  ?  172 DA  G "C3'" 1 
ATOM 5086 O "O3'" . DA  G 2 3   ? 17.964  11.547  -33.667 1.00 70.23  ?  172 DA  G "O3'" 1 
ATOM 5087 C "C2'" . DA  G 2 3   ? 17.089  12.391  -35.790 1.00 74.27  ?  172 DA  G "C2'" 1 
ATOM 5088 C "C1'" . DA  G 2 3   ? 18.157  13.373  -36.237 1.00 77.90  ?  172 DA  G "C1'" 1 
ATOM 5089 N N9    . DA  G 2 3   ? 17.789  14.165  -37.402 1.00 81.00  ?  172 DA  G N9    1 
ATOM 5090 C C8    . DA  G 2 3   ? 17.233  13.718  -38.564 1.00 80.28  ?  172 DA  G C8    1 
ATOM 5091 N N7    . DA  G 2 3   ? 17.017  14.665  -39.444 1.00 79.76  ?  172 DA  G N7    1 
ATOM 5092 C C5    . DA  G 2 3   ? 17.462  15.811  -38.812 1.00 82.38  ?  172 DA  G C5    1 
ATOM 5093 C C6    . DA  G 2 3   ? 17.507  17.158  -39.211 1.00 84.48  ?  172 DA  G C6    1 
ATOM 5094 N N6    . DA  G 2 3   ? 17.080  17.586  -40.398 1.00 82.66  ?  172 DA  G N6    1 
ATOM 5095 N N1    . DA  G 2 3   ? 18.011  18.052  -38.339 1.00 88.06  ?  172 DA  G N1    1 
ATOM 5096 C C2    . DA  G 2 3   ? 18.437  17.621  -37.150 1.00 88.74  ?  172 DA  G C2    1 
ATOM 5097 N N3    . DA  G 2 3   ? 18.448  16.383  -36.665 1.00 88.12  ?  172 DA  G N3    1 
ATOM 5098 C C4    . DA  G 2 3   ? 17.941  15.519  -37.554 1.00 84.40  ?  172 DA  G C4    1 
ATOM 5099 P P     . DT  G 2 4   ? 16.639  11.446  -32.770 1.00 66.92  ?  173 DT  G P     1 
ATOM 5100 O OP1   . DT  G 2 4   ? 17.063  11.143  -31.390 1.00 69.22  -1 173 DT  G OP1   1 
ATOM 5101 O OP2   . DT  G 2 4   ? 15.695  10.549  -33.463 1.00 65.22  ?  173 DT  G OP2   1 
ATOM 5102 O "O5'" . DT  G 2 4   ? 16.038  12.923  -32.800 1.00 64.41  ?  173 DT  G "O5'" 1 
ATOM 5103 C "C5'" . DT  G 2 4   ? 16.771  13.984  -32.225 1.00 64.91  ?  173 DT  G "C5'" 1 
ATOM 5104 C "C4'" . DT  G 2 4   ? 16.057  15.307  -32.411 1.00 64.95  ?  173 DT  G "C4'" 1 
ATOM 5105 O "O4'" . DT  G 2 4   ? 15.988  15.617  -33.817 1.00 64.98  ?  173 DT  G "O4'" 1 
ATOM 5106 C "C3'" . DT  G 2 4   ? 14.608  15.338  -31.910 1.00 63.91  ?  173 DT  G "C3'" 1 
ATOM 5107 O "O3'" . DT  G 2 4   ? 14.494  16.232  -30.809 1.00 65.98  ?  173 DT  G "O3'" 1 
ATOM 5108 C "C2'" . DT  G 2 4   ? 13.797  15.830  -33.116 1.00 62.95  ?  173 DT  G "C2'" 1 
ATOM 5109 C "C1'" . DT  G 2 4   ? 14.861  16.413  -34.026 1.00 64.97  ?  173 DT  G "C1'" 1 
ATOM 5110 N N1    . DT  G 2 4   ? 14.488  16.349  -35.457 1.00 66.71  ?  173 DT  G N1    1 
ATOM 5111 C C2    . DT  G 2 4   ? 14.668  17.454  -36.244 1.00 69.80  ?  173 DT  G C2    1 
ATOM 5112 O O2    . DT  G 2 4   ? 15.161  18.487  -35.838 1.00 72.36  ?  173 DT  G O2    1 
ATOM 5113 N N3    . DT  G 2 4   ? 14.274  17.299  -37.545 1.00 69.33  ?  173 DT  G N3    1 
ATOM 5114 C C4    . DT  G 2 4   ? 13.709  16.176  -38.118 1.00 66.25  ?  173 DT  G C4    1 
ATOM 5115 O O4    . DT  G 2 4   ? 13.384  16.133  -39.299 1.00 64.28  ?  173 DT  G O4    1 
ATOM 5116 C C5    . DT  G 2 4   ? 13.531  15.058  -37.230 1.00 64.97  ?  173 DT  G C5    1 
ATOM 5117 C C7    . DT  G 2 4   ? 12.929  13.785  -37.736 1.00 63.07  ?  173 DT  G C7    1 
ATOM 5118 C C6    . DT  G 2 4   ? 13.918  15.199  -35.955 1.00 65.84  ?  173 DT  G C6    1 
ATOM 5119 P P     . DT  G 2 5   ? 13.059  16.551  -30.160 1.00 63.70  ?  174 DT  G P     1 
ATOM 5120 O OP1   . DT  G 2 5   ? 13.288  16.797  -28.723 1.00 62.75  -1 174 DT  G OP1   1 
ATOM 5121 O OP2   . DT  G 2 5   ? 12.087  15.517  -30.568 1.00 59.13  ?  174 DT  G OP2   1 
ATOM 5122 O "O5'" . DT  G 2 5   ? 12.645  17.939  -30.825 1.00 61.78  ?  174 DT  G "O5'" 1 
ATOM 5123 C "C5'" . DT  G 2 5   ? 13.452  19.083  -30.621 1.00 63.87  ?  174 DT  G "C5'" 1 
ATOM 5124 C "C4'" . DT  G 2 5   ? 13.117  20.162  -31.630 1.00 63.92  ?  174 DT  G "C4'" 1 
ATOM 5125 O "O4'" . DT  G 2 5   ? 12.989  19.560  -32.932 1.00 67.05  ?  174 DT  G "O4'" 1 
ATOM 5126 C "C3'" . DT  G 2 5   ? 11.799  20.903  -31.373 1.00 63.34  ?  174 DT  G "C3'" 1 
ATOM 5127 O "O3'" . DT  G 2 5   ? 12.043  22.282  -31.140 1.00 69.83  ?  174 DT  G "O3'" 1 
ATOM 5128 C "C2'" . DT  G 2 5   ? 10.978  20.682  -32.647 1.00 65.43  ?  174 DT  G "C2'" 1 
ATOM 5129 C "C1'" . DT  G 2 5   ? 12.029  20.265  -33.661 1.00 65.71  ?  174 DT  G "C1'" 1 
ATOM 5130 N N1    . DT  G 2 5   ? 11.487  19.371  -34.706 1.00 59.66  ?  174 DT  G N1    1 
ATOM 5131 C C2    . DT  G 2 5   ? 11.434  19.811  -35.998 1.00 59.35  ?  174 DT  G C2    1 
ATOM 5132 O O2    . DT  G 2 5   ? 11.840  20.900  -36.345 1.00 60.64  ?  174 DT  G O2    1 
ATOM 5133 N N3    . DT  G 2 5   ? 10.905  18.918  -36.885 1.00 70.98  ?  174 DT  G N3    1 
ATOM 5134 C C4    . DT  G 2 5   ? 10.417  17.657  -36.607 1.00 68.35  ?  174 DT  G C4    1 
ATOM 5135 O O4    . DT  G 2 5   ? 9.954   16.927  -37.475 1.00 66.84  ?  174 DT  G O4    1 
ATOM 5136 C C5    . DT  G 2 5   ? 10.490  17.261  -35.226 1.00 66.67  ?  174 DT  G C5    1 
ATOM 5137 C C7    . DT  G 2 5   ? 9.992   15.913  -34.802 1.00 63.74  ?  174 DT  G C7    1 
ATOM 5138 C C6    . DT  G 2 5   ? 11.011  18.129  -34.350 1.00 67.50  ?  174 DT  G C6    1 
ATOM 5139 P P     . DC  G 2 6   ? 10.890  23.206  -30.512 1.00 80.91  ?  175 DC  G P     1 
ATOM 5140 O OP1   . DC  G 2 6   ? 11.523  24.432  -29.987 1.00 82.50  ?  175 DC  G OP1   1 
ATOM 5141 O OP2   . DC  G 2 6   ? 10.068  22.358  -29.628 1.00 83.55  ?  175 DC  G OP2   1 
ATOM 5142 O "O5'" . DC  G 2 6   ? 9.996   23.618  -31.764 1.00 72.67  ?  175 DC  G "O5'" 1 
ATOM 5143 C "C5'" . DC  G 2 6   ? 10.012  24.957  -32.217 1.00 71.40  ?  175 DC  G "C5'" 1 
ATOM 5144 C "C4'" . DC  G 2 6   ? 9.536   25.054  -33.653 1.00 70.21  ?  175 DC  G "C4'" 1 
ATOM 5145 O "O4'" . DC  G 2 6   ? 9.534   23.742  -34.257 1.00 71.67  ?  175 DC  G "O4'" 1 
ATOM 5146 C "C3'" . DC  G 2 6   ? 8.117   25.610  -33.838 1.00 67.46  ?  175 DC  G "C3'" 1 
ATOM 5147 O "O3'" . DC  G 2 6   ? 8.140   26.658  -34.786 1.00 67.68  ?  175 DC  G "O3'" 1 
ATOM 5148 C "C2'" . DC  G 2 6   ? 7.326   24.411  -34.359 1.00 64.55  ?  175 DC  G "C2'" 1 
ATOM 5149 C "C1'" . DC  G 2 6   ? 8.410   23.642  -35.086 1.00 67.69  ?  175 DC  G "C1'" 1 
ATOM 5150 N N1    . DC  G 2 6   ? 8.097   22.210  -35.304 1.00 69.42  ?  175 DC  G N1    1 
ATOM 5151 C C2    . DC  G 2 6   ? 7.977   21.728  -36.608 1.00 69.99  ?  175 DC  G C2    1 
ATOM 5152 O O2    . DC  G 2 6   ? 8.142   22.505  -37.555 1.00 70.18  ?  175 DC  G O2    1 
ATOM 5153 N N3    . DC  G 2 6   ? 7.691   20.420  -36.798 1.00 70.26  ?  175 DC  G N3    1 
ATOM 5154 C C4    . DC  G 2 6   ? 7.522   19.616  -35.752 1.00 70.54  ?  175 DC  G C4    1 
ATOM 5155 N N4    . DC  G 2 6   ? 7.239   18.334  -35.990 1.00 71.07  ?  175 DC  G N4    1 
ATOM 5156 C C5    . DC  G 2 6   ? 7.638   20.091  -34.415 1.00 71.97  ?  175 DC  G C5    1 
ATOM 5157 C C6    . DC  G 2 6   ? 7.924   21.383  -34.240 1.00 71.46  ?  175 DC  G C6    1 
ATOM 5158 P P     . DA  G 2 7   ? 6.909   27.679  -34.887 1.00 69.08  ?  176 DA  G P     1 
ATOM 5159 O OP1   . DA  G 2 7   ? 7.453   29.011  -35.214 1.00 70.99  ?  176 DA  G OP1   1 
ATOM 5160 O OP2   . DA  G 2 7   ? 6.081   27.492  -33.681 1.00 72.58  ?  176 DA  G OP2   1 
ATOM 5161 O "O5'" . DA  G 2 7   ? 6.105   27.177  -36.169 1.00 66.71  ?  176 DA  G "O5'" 1 
ATOM 5162 C "C5'" . DA  G 2 7   ? 6.798   26.909  -37.375 1.00 66.29  ?  176 DA  G "C5'" 1 
ATOM 5163 C "C4'" . DA  G 2 7   ? 5.907   26.183  -38.366 1.00 65.57  ?  176 DA  G "C4'" 1 
ATOM 5164 O "O4'" . DA  G 2 7   ? 5.933   24.766  -38.090 1.00 65.26  ?  176 DA  G "O4'" 1 
ATOM 5165 C "C3'" . DA  G 2 7   ? 4.433   26.595  -38.329 1.00 66.58  ?  176 DA  G "C3'" 1 
ATOM 5166 O "O3'" . DA  G 2 7   ? 4.073   27.229  -39.546 1.00 69.40  ?  176 DA  G "O3'" 1 
ATOM 5167 C "C2'" . DA  G 2 7   ? 3.667   25.278  -38.126 1.00 63.62  ?  176 DA  G "C2'" 1 
ATOM 5168 C "C1'" . DA  G 2 7   ? 4.701   24.217  -38.459 1.00 64.49  ?  176 DA  G "C1'" 1 
ATOM 5169 N N9    . DA  G 2 7   ? 4.501   22.981  -37.712 1.00 68.14  ?  176 DA  G N9    1 
ATOM 5170 C C8    . DA  G 2 7   ? 4.556   22.823  -36.359 1.00 71.97  ?  176 DA  G C8    1 
ATOM 5171 N N7    . DA  G 2 7   ? 4.324   21.598  -35.958 1.00 73.41  ?  176 DA  G N7    1 
ATOM 5172 C C5    . DA  G 2 7   ? 4.097   20.905  -37.130 1.00 70.52  ?  176 DA  G C5    1 
ATOM 5173 C C6    . DA  G 2 7   ? 3.796   19.557  -37.388 1.00 70.90  ?  176 DA  G C6    1 
ATOM 5174 N N6    . DA  G 2 7   ? 3.667   18.638  -36.430 1.00 73.81  ?  176 DA  G N6    1 
ATOM 5175 N N1    . DA  G 2 7   ? 3.631   19.189  -38.669 1.00 69.02  ?  176 DA  G N1    1 
ATOM 5176 C C2    . DA  G 2 7   ? 3.759   20.113  -39.624 1.00 67.30  ?  176 DA  G C2    1 
ATOM 5177 N N3    . DA  G 2 7   ? 4.042   21.407  -39.506 1.00 67.54  ?  176 DA  G N3    1 
ATOM 5178 C C4    . DA  G 2 7   ? 4.200   21.742  -38.221 1.00 68.51  ?  176 DA  G C4    1 
ATOM 5179 P P     . DT  G 2 8   ? 2.569   27.742  -39.788 1.00 71.92  ?  177 DT  G P     1 
ATOM 5180 O OP1   . DT  G 2 8   ? 2.648   29.006  -40.546 1.00 74.56  -1 177 DT  G OP1   1 
ATOM 5181 O OP2   . DT  G 2 8   ? 1.817   27.702  -38.517 1.00 73.59  ?  177 DT  G OP2   1 
ATOM 5182 O "O5'" . DT  G 2 8   ? 1.968   26.630  -40.753 1.00 69.23  ?  177 DT  G "O5'" 1 
ATOM 5183 C "C5'" . DT  G 2 8   ? 2.702   26.247  -41.895 1.00 66.02  ?  177 DT  G "C5'" 1 
ATOM 5184 C "C4'" . DT  G 2 8   ? 2.113   25.007  -42.525 1.00 60.76  ?  177 DT  G "C4'" 1 
ATOM 5185 O "O4'" . DT  G 2 8   ? 2.155   23.928  -41.576 1.00 58.51  ?  177 DT  G "O4'" 1 
ATOM 5186 C "C3'" . DT  G 2 8   ? 0.650   25.137  -42.938 1.00 58.69  ?  177 DT  G "C3'" 1 
ATOM 5187 O "O3'" . DT  G 2 8   ? 0.550   25.196  -44.347 1.00 61.05  ?  177 DT  G "O3'" 1 
ATOM 5188 C "C2'" . DT  G 2 8   ? -0.027  23.878  -42.375 1.00 54.90  ?  177 DT  G "C2'" 1 
ATOM 5189 C "C1'" . DT  G 2 8   ? 1.142   23.027  -41.901 1.00 53.74  ?  177 DT  G "C1'" 1 
ATOM 5190 N N1    . DT  G 2 8   ? 0.822   22.226  -40.700 1.00 50.65  ?  177 DT  G N1    1 
ATOM 5191 C C2    . DT  G 2 8   ? 0.815   20.860  -40.791 1.00 48.24  ?  177 DT  G C2    1 
ATOM 5192 O O2    . DT  G 2 8   ? 1.091   20.260  -41.809 1.00 47.98  ?  177 DT  G O2    1 
ATOM 5193 N N3    . DT  G 2 8   ? 0.494   20.212  -39.631 1.00 48.38  ?  177 DT  G N3    1 
ATOM 5194 C C4    . DT  G 2 8   ? 0.171   20.786  -38.419 1.00 50.45  ?  177 DT  G C4    1 
ATOM 5195 O O4    . DT  G 2 8   ? -0.107  20.119  -37.430 1.00 53.04  ?  177 DT  G O4    1 
ATOM 5196 C C5    . DT  G 2 8   ? 0.183   22.225  -38.397 1.00 51.46  ?  177 DT  G C5    1 
ATOM 5197 C C7    . DT  G 2 8   ? -0.152  22.961  -37.137 1.00 54.08  ?  177 DT  G C7    1 
ATOM 5198 C C6    . DT  G 2 8   ? 0.499   22.869  -39.528 1.00 51.16  ?  177 DT  G C6    1 
ATOM 5199 P P     . DT  G 2 9   ? -0.874  25.428  -45.049 1.00 61.53  ?  178 DT  G P     1 
ATOM 5200 O OP1   . DT  G 2 9   ? -0.637  26.168  -46.303 1.00 63.51  -1 178 DT  G OP1   1 
ATOM 5201 O OP2   . DT  G 2 9   ? -1.809  25.963  -44.038 1.00 62.73  ?  178 DT  G OP2   1 
ATOM 5202 O "O5'" . DT  G 2 9   ? -1.344  23.953  -45.416 1.00 55.78  ?  178 DT  G "O5'" 1 
ATOM 5203 C "C5'" . DT  G 2 9   ? -0.634  23.224  -46.392 1.00 52.87  ?  178 DT  G "C5'" 1 
ATOM 5204 C "C4'" . DT  G 2 9   ? -0.977  21.753  -46.316 1.00 48.23  ?  178 DT  G "C4'" 1 
ATOM 5205 O "O4'" . DT  G 2 9   ? -0.858  21.309  -44.953 1.00 48.02  ?  178 DT  G "O4'" 1 
ATOM 5206 C "C3'" . DT  G 2 9   ? -2.400  21.408  -46.752 1.00 44.73  ?  178 DT  G "C3'" 1 
ATOM 5207 O "O3'" . DT  G 2 9   ? -2.377  20.641  -47.939 1.00 42.87  ?  178 DT  G "O3'" 1 
ATOM 5208 C "C2'" . DT  G 2 9   ? -2.980  20.604  -45.580 1.00 43.95  ?  178 DT  G "C2'" 1 
ATOM 5209 C "C1'" . DT  G 2 9   ? -1.755  20.261  -44.749 1.00 45.33  ?  178 DT  G "C1'" 1 
ATOM 5210 N N1    . DT  G 2 9   ? -2.043  20.158  -43.300 1.00 45.04  ?  178 DT  G N1    1 
ATOM 5211 C C2    . DT  G 2 9   ? -1.924  18.941  -42.681 1.00 46.63  ?  178 DT  G C2    1 
ATOM 5212 O O2    . DT  G 2 9   ? -1.572  17.933  -43.259 1.00 47.74  ?  178 DT  G O2    1 
ATOM 5213 N N3    . DT  G 2 9   ? -2.221  18.947  -41.349 1.00 48.72  ?  178 DT  G N3    1 
ATOM 5214 C C4    . DT  G 2 9   ? -2.626  20.025  -40.591 1.00 51.09  ?  178 DT  G C4    1 
ATOM 5215 O O4    . DT  G 2 9   ? -2.872  19.929  -39.394 1.00 56.51  ?  178 DT  G O4    1 
ATOM 5216 C C5    . DT  G 2 9   ? -2.740  21.271  -41.304 1.00 46.00  ?  178 DT  G C5    1 
ATOM 5217 C C7    . DT  G 2 9   ? -3.173  22.513  -40.587 1.00 45.05  ?  178 DT  G C7    1 
ATOM 5218 C C6    . DT  G 2 9   ? -2.450  21.275  -42.610 1.00 44.55  ?  178 DT  G C6    1 
ATOM 5219 P P     . DC  G 2 10  ? -3.753  20.256  -48.666 1.00 42.18  ?  179 DC  G P     1 
ATOM 5220 O OP1   . DC  G 2 10  ? -3.442  19.935  -50.070 1.00 45.71  ?  179 DC  G OP1   1 
ATOM 5221 O OP2   . DC  G 2 10  ? -4.726  21.315  -48.345 1.00 41.79  ?  179 DC  G OP2   1 
ATOM 5222 O "O5'" . DC  G 2 10  ? -4.222  18.922  -47.930 1.00 37.28  ?  179 DC  G "O5'" 1 
ATOM 5223 C "C5'" . DC  G 2 10  ? -3.529  17.710  -48.151 1.00 37.00  ?  179 DC  G "C5'" 1 
ATOM 5224 C "C4'" . DC  G 2 10  ? -4.028  16.625  -47.216 1.00 36.61  ?  179 DC  G "C4'" 1 
ATOM 5225 O "O4'" . DC  G 2 10  ? -4.037  17.133  -45.862 1.00 43.32  ?  179 DC  G "O4'" 1 
ATOM 5226 C "C3'" . DC  G 2 10  ? -5.452  16.132  -47.489 1.00 44.29  ?  179 DC  G "C3'" 1 
ATOM 5227 O "O3'" . DC  G 2 10  ? -5.475  14.720  -47.530 1.00 42.53  ?  179 DC  G "O3'" 1 
ATOM 5228 C "C2'" . DC  G 2 10  ? -6.252  16.664  -46.305 1.00 45.45  ?  179 DC  G "C2'" 1 
ATOM 5229 C "C1'" . DC  G 2 10  ? -5.200  16.693  -45.220 1.00 44.78  ?  179 DC  G "C1'" 1 
ATOM 5230 N N1    . DC  G 2 10  ? -5.522  17.635  -44.133 1.00 38.92  ?  179 DC  G N1    1 
ATOM 5231 C C2    . DC  G 2 10  ? -5.579  17.176  -42.820 1.00 52.78  ?  179 DC  G C2    1 
ATOM 5232 O O2    . DC  G 2 10  ? -5.335  15.989  -42.588 1.00 51.92  ?  179 DC  G O2    1 
ATOM 5233 N N3    . DC  G 2 10  ? -5.884  18.049  -41.834 1.00 57.03  ?  179 DC  G N3    1 
ATOM 5234 C C4    . DC  G 2 10  ? -6.136  19.320  -42.128 1.00 58.57  ?  179 DC  G C4    1 
ATOM 5235 N N4    . DC  G 2 10  ? -6.436  20.146  -41.122 1.00 45.57  ?  179 DC  G N4    1 
ATOM 5236 C C5    . DC  G 2 10  ? -6.094  19.803  -43.464 1.00 57.68  ?  179 DC  G C5    1 
ATOM 5237 C C6    . DC  G 2 10  ? -5.792  18.931  -44.427 1.00 39.16  ?  179 DC  G C6    1 
ATOM 5238 P P     . DA  G 2 11  ? -6.817  13.942  -47.937 1.00 51.41  ?  180 DA  G P     1 
ATOM 5239 O OP1   . DA  G 2 11  ? -6.420  12.774  -48.744 1.00 55.09  -1 180 DA  G OP1   1 
ATOM 5240 O OP2   . DA  G 2 11  ? -7.787  14.915  -48.474 1.00 51.97  ?  180 DA  G OP2   1 
ATOM 5241 O "O5'" . DA  G 2 11  ? -7.371  13.404  -46.546 1.00 44.26  ?  180 DA  G "O5'" 1 
ATOM 5242 C "C5'" . DA  G 2 11  ? -6.760  12.282  -45.948 1.00 41.95  ?  180 DA  G "C5'" 1 
ATOM 5243 C "C4'" . DA  G 2 11  ? -7.245  12.095  -44.527 1.00 40.12  ?  180 DA  G "C4'" 1 
ATOM 5244 O "O4'" . DA  G 2 11  ? -7.254  13.370  -43.864 1.00 41.01  ?  180 DA  G "O4'" 1 
ATOM 5245 C "C3'" . DA  G 2 11  ? -8.659  11.536  -44.398 1.00 36.79  ?  180 DA  G "C3'" 1 
ATOM 5246 O "O3'" . DA  G 2 11  ? -8.621  10.296  -43.726 1.00 35.04  ?  180 DA  G "O3'" 1 
ATOM 5247 C "C2'" . DA  G 2 11  ? -9.422  12.592  -43.595 1.00 36.17  ?  180 DA  G "C2'" 1 
ATOM 5248 C "C1'" . DA  G 2 11  ? -8.315  13.413  -42.961 1.00 36.14  ?  180 DA  G "C1'" 1 
ATOM 5249 N N9    . DA  G 2 11  ? -8.682  14.808  -42.794 1.00 41.05  ?  180 DA  G N9    1 
ATOM 5250 C C8    . DA  G 2 11  ? -8.660  15.773  -43.752 1.00 44.16  ?  180 DA  G C8    1 
ATOM 5251 N N7    . DA  G 2 11  ? -9.046  16.947  -43.329 1.00 45.06  ?  180 DA  G N7    1 
ATOM 5252 C C5    . DA  G 2 11  ? -9.337  16.740  -41.996 1.00 42.98  ?  180 DA  G C5    1 
ATOM 5253 C C6    . DA  G 2 11  ? -9.798  17.599  -40.985 1.00 43.49  ?  180 DA  G C6    1 
ATOM 5254 N N6    . DA  G 2 11  ? -10.052 18.891  -41.180 1.00 46.26  ?  180 DA  G N6    1 
ATOM 5255 N N1    . DA  G 2 11  ? -9.987  17.077  -39.762 1.00 40.56  ?  180 DA  G N1    1 
ATOM 5256 C C2    . DA  G 2 11  ? -9.729  15.783  -39.571 1.00 38.27  ?  180 DA  G C2    1 
ATOM 5257 N N3    . DA  G 2 11  ? -9.297  14.876  -40.444 1.00 37.64  ?  180 DA  G N3    1 
ATOM 5258 C C4    . DA  G 2 11  ? -9.119  15.426  -41.649 1.00 40.42  ?  180 DA  G C4    1 
ATOM 5259 P P     . DT  G 2 12  ? -9.911  9.347   -43.714 1.00 34.68  ?  181 DT  G P     1 
ATOM 5260 O OP1   . DT  G 2 12  ? -9.437  7.953   -43.615 1.00 37.66  -1 181 DT  G OP1   1 
ATOM 5261 O OP2   . DT  G 2 12  ? -10.793 9.762   -44.819 1.00 36.69  ?  181 DT  G OP2   1 
ATOM 5262 O "O5'" . DT  G 2 12  ? -10.653 9.739   -42.366 1.00 32.99  ?  181 DT  G "O5'" 1 
ATOM 5263 C "C5'" . DT  G 2 12  ? -10.037 9.473   -41.127 1.00 31.45  ?  181 DT  G "C5'" 1 
ATOM 5264 C "C4'" . DT  G 2 12  ? -10.829 10.089  -39.995 1.00 41.27  ?  181 DT  G "C4'" 1 
ATOM 5265 O "O4'" . DT  G 2 12  ? -10.834 11.515  -40.135 1.00 41.65  ?  181 DT  G "O4'" 1 
ATOM 5266 C "C3'" . DT  G 2 12  ? -12.302 9.685   -39.946 1.00 42.28  ?  181 DT  G "C3'" 1 
ATOM 5267 O "O3'" . DT  G 2 12  ? -12.504 8.710   -38.935 1.00 42.56  ?  181 DT  G "O3'" 1 
ATOM 5268 C "C2'" . DT  G 2 12  ? -13.053 10.990  -39.638 1.00 41.69  ?  181 DT  G "C2'" 1 
ATOM 5269 C "C1'" . DT  G 2 12  ? -11.939 12.010  -39.441 1.00 41.04  ?  181 DT  G "C1'" 1 
ATOM 5270 N N1    . DT  G 2 12  ? -12.271 13.338  -39.980 1.00 41.91  ?  181 DT  G N1    1 
ATOM 5271 C C2    . DT  G 2 12  ? -12.532 14.366  -39.113 1.00 44.37  ?  181 DT  G C2    1 
ATOM 5272 O O2    . DT  G 2 12  ? -12.498 14.243  -37.905 1.00 45.56  ?  181 DT  G O2    1 
ATOM 5273 N N3    . DT  G 2 12  ? -12.830 15.554  -39.712 1.00 34.89  ?  181 DT  G N3    1 
ATOM 5274 C C4    . DT  G 2 12  ? -12.894 15.810  -41.064 1.00 36.22  ?  181 DT  G C4    1 
ATOM 5275 O O4    . DT  G 2 12  ? -13.167 16.913  -41.506 1.00 38.02  ?  181 DT  G O4    1 
ATOM 5276 C C5    . DT  G 2 12  ? -12.614 14.689  -41.918 1.00 35.85  ?  181 DT  G C5    1 
ATOM 5277 C C7    . DT  G 2 12  ? -12.655 14.851  -43.406 1.00 37.87  ?  181 DT  G C7    1 
ATOM 5278 C C6    . DT  G 2 12  ? -12.318 13.519  -41.342 1.00 34.16  ?  181 DT  G C6    1 
ATOM 5279 P P     . DT  G 2 13  ? -13.989 8.251   -38.539 1.00 45.09  ?  182 DT  G P     1 
ATOM 5280 O OP1   . DT  G 2 13  ? -13.886 6.918   -37.918 1.00 43.33  -1 182 DT  G OP1   1 
ATOM 5281 O OP2   . DT  G 2 13  ? -14.877 8.449   -39.702 1.00 51.24  ?  182 DT  G OP2   1 
ATOM 5282 O "O5'" . DT  G 2 13  ? -14.404 9.294   -37.411 1.00 30.67  ?  182 DT  G "O5'" 1 
ATOM 5283 C "C5'" . DT  G 2 13  ? -13.818 9.205   -36.135 1.00 30.33  ?  182 DT  G "C5'" 1 
ATOM 5284 C "C4'" . DT  G 2 13  ? -14.027 10.485  -35.352 1.00 34.59  ?  182 DT  G "C4'" 1 
ATOM 5285 O "O4'" . DT  G 2 13  ? -14.015 11.613  -36.251 1.00 35.52  ?  182 DT  G "O4'" 1 
ATOM 5286 C "C3'" . DT  G 2 13  ? -15.354 10.564  -34.588 1.00 36.17  ?  182 DT  G "C3'" 1 
ATOM 5287 O "O3'" . DT  G 2 13  ? -15.110 10.715  -33.206 1.00 37.66  ?  182 DT  G "O3'" 1 
ATOM 5288 C "C2'" . DT  G 2 13  ? -16.051 11.797  -35.168 1.00 36.70  ?  182 DT  G "C2'" 1 
ATOM 5289 C "C1'" . DT  G 2 13  ? -14.889 12.580  -35.746 1.00 36.60  ?  182 DT  G "C1'" 1 
ATOM 5290 N N1    . DT  G 2 13  ? -15.281 13.495  -36.837 1.00 37.25  ?  182 DT  G N1    1 
ATOM 5291 C C2    . DT  G 2 13  ? -15.242 14.845  -36.615 1.00 40.97  ?  182 DT  G C2    1 
ATOM 5292 O O2    . DT  G 2 13  ? -14.879 15.336  -35.564 1.00 43.39  ?  182 DT  G O2    1 
ATOM 5293 N N3    . DT  G 2 13  ? -15.629 15.610  -37.677 1.00 42.29  ?  182 DT  G N3    1 
ATOM 5294 C C4    . DT  G 2 13  ? -16.056 15.167  -38.911 1.00 41.19  ?  182 DT  G C4    1 
ATOM 5295 O O4    . DT  G 2 13  ? -16.388 15.934  -39.803 1.00 45.60  ?  182 DT  G O4    1 
ATOM 5296 C C5    . DT  G 2 13  ? -16.083 13.738  -39.075 1.00 37.62  ?  182 DT  G C5    1 
ATOM 5297 C C7    . DT  G 2 13  ? -16.528 13.140  -40.373 1.00 34.41  ?  182 DT  G C7    1 
ATOM 5298 C C6    . DT  G 2 13  ? -15.702 12.978  -38.040 1.00 35.82  ?  182 DT  G C6    1 
ATOM 5299 P P     . DC  G 2 14  ? -16.232 10.280  -32.149 1.00 38.71  ?  183 DC  G P     1 
ATOM 5300 O OP1   . DC  G 2 14  ? -15.550 10.051  -30.864 1.00 41.22  -1 183 DC  G OP1   1 
ATOM 5301 O OP2   . DC  G 2 14  ? -17.037 9.209   -32.761 1.00 40.15  ?  183 DC  G OP2   1 
ATOM 5302 O "O5'" . DC  G 2 14  ? -17.159 11.568  -32.013 1.00 37.94  ?  183 DC  G "O5'" 1 
ATOM 5303 C "C5'" . DC  G 2 14  ? -16.800 12.597  -31.120 1.00 39.83  ?  183 DC  G "C5'" 1 
ATOM 5304 C "C4'" . DC  G 2 14  ? -17.539 13.883  -31.438 1.00 42.15  ?  183 DC  G "C4'" 1 
ATOM 5305 O "O4'" . DC  G 2 14  ? -17.513 14.131  -32.862 1.00 41.56  ?  183 DC  G "O4'" 1 
ATOM 5306 C "C3'" . DC  G 2 14  ? -19.022 13.914  -31.036 1.00 43.73  ?  183 DC  G "C3'" 1 
ATOM 5307 O "O3'" . DC  G 2 14  ? -19.266 15.017  -30.188 1.00 47.17  ?  183 DC  G "O3'" 1 
ATOM 5308 C "C2'" . DC  G 2 14  ? -19.746 14.087  -32.369 1.00 42.72  ?  183 DC  G "C2'" 1 
ATOM 5309 C "C1'" . DC  G 2 14  ? -18.692 14.800  -33.182 1.00 42.09  ?  183 DC  G "C1'" 1 
ATOM 5310 N N1    . DC  G 2 14  ? -18.924 14.727  -34.633 1.00 42.88  ?  183 DC  G N1    1 
ATOM 5311 C C2    . DC  G 2 14  ? -18.784 15.877  -35.403 1.00 46.21  ?  183 DC  G C2    1 
ATOM 5312 O O2    . DC  G 2 14  ? -18.430 16.925  -34.856 1.00 48.74  ?  183 DC  G O2    1 
ATOM 5313 N N3    . DC  G 2 14  ? -19.018 15.807  -36.733 1.00 44.56  ?  183 DC  G N3    1 
ATOM 5314 C C4    . DC  G 2 14  ? -19.396 14.657  -37.282 1.00 40.60  ?  183 DC  G C4    1 
ATOM 5315 N N4    . DC  G 2 14  ? -19.618 14.638  -38.597 1.00 40.32  ?  183 DC  G N4    1 
ATOM 5316 C C5    . DC  G 2 14  ? -19.561 13.475  -36.508 1.00 39.51  ?  183 DC  G C5    1 
ATOM 5317 C C6    . DC  G 2 14  ? -19.323 13.558  -35.198 1.00 40.67  ?  183 DC  G C6    1 
ATOM 5318 P P     . DA  G 2 15  ? -20.710 15.231  -29.520 1.00 52.29  ?  184 DA  G P     1 
ATOM 5319 O OP1   . DA  G 2 15  ? -20.474 15.578  -28.107 1.00 57.20  -1 184 DA  G OP1   1 
ATOM 5320 O OP2   . DA  G 2 15  ? -21.579 14.086  -29.853 1.00 53.77  ?  184 DA  G OP2   1 
ATOM 5321 O "O5'" . DA  G 2 15  ? -21.279 16.529  -30.251 1.00 50.50  ?  184 DA  G "O5'" 1 
ATOM 5322 C "C5'" . DA  G 2 15  ? -20.387 17.443  -30.852 1.00 50.47  ?  184 DA  G "C5'" 1 
ATOM 5323 C "C4'" . DA  G 2 15  ? -21.123 18.385  -31.785 1.00 52.39  ?  184 DA  G "C4'" 1 
ATOM 5324 O "O4'" . DA  G 2 15  ? -21.034 17.895  -33.138 1.00 51.93  ?  184 DA  G "O4'" 1 
ATOM 5325 C "C3'" . DA  G 2 15  ? -22.615 18.555  -31.491 1.00 55.17  ?  184 DA  G "C3'" 1 
ATOM 5326 O "O3'" . DA  G 2 15  ? -22.869 19.878  -31.039 1.00 58.37  ?  184 DA  G "O3'" 1 
ATOM 5327 C "C2'" . DA  G 2 15  ? -23.314 18.270  -32.826 1.00 55.14  ?  184 DA  G "C2'" 1 
ATOM 5328 C "C1'" . DA  G 2 15  ? -22.178 18.293  -33.835 1.00 53.64  ?  184 DA  G "C1'" 1 
ATOM 5329 N N9    . DA  G 2 15  ? -22.391 17.375  -34.944 1.00 54.71  ?  184 DA  G N9    1 
ATOM 5330 C C8    . DA  G 2 15  ? -22.222 16.023  -34.935 1.00 53.98  ?  184 DA  G C8    1 
ATOM 5331 N N7    . DA  G 2 15  ? -22.513 15.447  -36.075 1.00 53.86  ?  184 DA  G N7    1 
ATOM 5332 C C5    . DA  G 2 15  ? -22.920 16.494  -36.881 1.00 54.81  ?  184 DA  G C5    1 
ATOM 5333 C C6    . DA  G 2 15  ? -23.364 16.548  -38.215 1.00 54.81  ?  184 DA  G C6    1 
ATOM 5334 N N6    . DA  G 2 15  ? -23.474 15.472  -38.997 1.00 53.12  ?  184 DA  G N6    1 
ATOM 5335 N N1    . DA  G 2 15  ? -23.691 17.752  -38.715 1.00 56.72  ?  184 DA  G N1    1 
ATOM 5336 C C2    . DA  G 2 15  ? -23.580 18.826  -37.930 1.00 58.63  ?  184 DA  G C2    1 
ATOM 5337 N N3    . DA  G 2 15  ? -23.178 18.900  -36.666 1.00 59.58  ?  184 DA  G N3    1 
ATOM 5338 C C4    . DA  G 2 15  ? -22.858 17.688  -36.197 1.00 56.66  ?  184 DA  G C4    1 
ATOM 5339 P P     . DT  G 2 16  ? -24.371 20.386  -30.787 1.00 59.80  ?  185 DT  G P     1 
ATOM 5340 O OP1   . DT  G 2 16  ? -24.295 21.469  -29.790 1.00 63.43  -1 185 DT  G OP1   1 
ATOM 5341 O OP2   . DT  G 2 16  ? -25.233 19.216  -30.529 1.00 59.50  ?  185 DT  G OP2   1 
ATOM 5342 O "O5'" . DT  G 2 16  ? -24.796 21.026  -32.185 1.00 58.29  ?  185 DT  G "O5'" 1 
ATOM 5343 C "C5'" . DT  G 2 16  ? -23.977 22.015  -32.776 1.00 57.94  ?  185 DT  G "C5'" 1 
ATOM 5344 C "C4'" . DT  G 2 16  ? -24.644 22.631  -33.993 1.00 59.47  ?  185 DT  G "C4'" 1 
ATOM 5345 O "O4'" . DT  G 2 16  ? -24.685 21.667  -35.076 1.00 59.26  ?  185 DT  G "O4'" 1 
ATOM 5346 C "C3'" . DT  G 2 16  ? -26.093 23.092  -33.780 1.00 61.42  ?  185 DT  G "C3'" 1 
ATOM 5347 O "O3'" . DT  G 2 16  ? -26.261 24.407  -34.288 1.00 63.89  ?  185 DT  G "O3'" 1 
ATOM 5348 C "C2'" . DT  G 2 16  ? -26.905 22.083  -34.584 1.00 60.43  ?  185 DT  G "C2'" 1 
ATOM 5349 C "C1'" . DT  G 2 16  ? -25.936 21.758  -35.701 1.00 60.69  ?  185 DT  G "C1'" 1 
ATOM 5350 N N1    . DT  G 2 16  ? -26.239 20.483  -36.391 1.00 60.87  ?  185 DT  G N1    1 
ATOM 5351 C C2    . DT  G 2 16  ? -26.500 20.502  -37.736 1.00 64.48  ?  185 DT  G C2    1 
ATOM 5352 O O2    . DT  G 2 16  ? -26.467 21.515  -38.406 1.00 69.11  ?  185 DT  G O2    1 
ATOM 5353 N N3    . DT  G 2 16  ? -26.785 19.283  -38.281 1.00 62.04  ?  185 DT  G N3    1 
ATOM 5354 C C4    . DT  G 2 16  ? -26.849 18.074  -37.623 1.00 59.44  ?  185 DT  G C4    1 
ATOM 5355 O O4    . DT  G 2 16  ? -27.115 17.027  -38.201 1.00 60.10  ?  185 DT  G O4    1 
ATOM 5356 C C5    . DT  G 2 16  ? -26.577 18.126  -36.210 1.00 56.55  ?  185 DT  G C5    1 
ATOM 5357 C C7    . DT  G 2 16  ? -26.618 16.875  -35.391 1.00 54.29  ?  185 DT  G C7    1 
ATOM 5358 C C6    . DT  G 2 16  ? -26.295 19.316  -35.666 1.00 57.67  ?  185 DT  G C6    1 
ATOM 5359 P P     . DT  G 2 17  ? -27.610 25.229  -33.997 1.00 67.19  ?  186 DT  G P     1 
ATOM 5360 O OP1   . DT  G 2 17  ? -27.212 26.575  -33.543 1.00 70.84  -1 186 DT  G OP1   1 
ATOM 5361 O OP2   . DT  G 2 17  ? -28.500 24.402  -33.157 1.00 69.11  ?  186 DT  G OP2   1 
ATOM 5362 O "O5'" . DT  G 2 17  ? -28.277 25.384  -35.437 1.00 64.38  ?  186 DT  G "O5'" 1 
ATOM 5363 C "C5'" . DT  G 2 17  ? -27.577 26.064  -36.458 1.00 62.38  ?  186 DT  G "C5'" 1 
ATOM 5364 C "C4'" . DT  G 2 17  ? -28.080 25.658  -37.829 1.00 59.46  ?  186 DT  G "C4'" 1 
ATOM 5365 O "O4'" . DT  G 2 17  ? -28.079 24.222  -37.946 1.00 56.48  ?  186 DT  G "O4'" 1 
ATOM 5366 C "C3'" . DT  G 2 17  ? -29.510 26.102  -38.157 1.00 61.48  ?  186 DT  G "C3'" 1 
ATOM 5367 O "O3'" . DT  G 2 17  ? -29.489 27.042  -39.221 1.00 63.64  ?  186 DT  G "O3'" 1 
ATOM 5368 C "C2'" . DT  G 2 17  ? -30.226 24.805  -38.559 1.00 63.13  ?  186 DT  G "C2'" 1 
ATOM 5369 C "C1'" . DT  G 2 17  ? -29.068 23.874  -38.864 1.00 59.05  ?  186 DT  G "C1'" 1 
ATOM 5370 N N1    . DT  G 2 17  ? -29.402 22.447  -38.693 1.00 58.59  ?  186 DT  G N1    1 
ATOM 5371 C C2    . DT  G 2 17  ? -29.494 21.651  -39.802 1.00 61.01  ?  186 DT  G C2    1 
ATOM 5372 O O2    . DT  G 2 17  ? -29.298 22.059  -40.930 1.00 64.15  ?  186 DT  G O2    1 
ATOM 5373 N N3    . DT  G 2 17  ? -29.817 20.349  -39.547 1.00 59.29  ?  186 DT  G N3    1 
ATOM 5374 C C4    . DT  G 2 17  ? -30.059 19.777  -38.315 1.00 56.79  ?  186 DT  G C4    1 
ATOM 5375 O O4    . DT  G 2 17  ? -30.345 18.594  -38.187 1.00 55.37  ?  186 DT  G O4    1 
ATOM 5376 C C5    . DT  G 2 17  ? -29.954 20.671  -37.191 1.00 57.46  ?  186 DT  G C5    1 
ATOM 5377 C C7    . DT  G 2 17  ? -30.196 20.163  -35.802 1.00 53.11  ?  186 DT  G C7    1 
ATOM 5378 C C6    . DT  G 2 17  ? -29.636 21.950  -37.432 1.00 57.47  ?  186 DT  G C6    1 
ATOM 5379 P P     . DC  G 2 18  ? -30.808 27.872  -39.602 1.00 67.05  ?  187 DC  G P     1 
ATOM 5380 O OP1   . DC  G 2 18  ? -30.383 29.012  -40.437 1.00 75.54  -1 187 DC  G OP1   1 
ATOM 5381 O OP2   . DC  G 2 18  ? -31.576 28.104  -38.363 1.00 68.38  ?  187 DC  G OP2   1 
ATOM 5382 O "O5'" . DC  G 2 18  ? -31.647 26.868  -40.512 1.00 66.12  ?  187 DC  G "O5'" 1 
ATOM 5383 C "C5'" . DC  G 2 18  ? -31.077 26.355  -41.696 1.00 71.49  ?  187 DC  G "C5'" 1 
ATOM 5384 C "C4'" . DC  G 2 18  ? -32.001 25.347  -42.350 1.00 72.16  ?  187 DC  G "C4'" 1 
ATOM 5385 O "O4'" . DC  G 2 18  ? -31.964 24.088  -41.637 1.00 70.14  ?  187 DC  G "O4'" 1 
ATOM 5386 C "C3'" . DC  G 2 18  ? -33.475 25.759  -42.413 1.00 75.90  ?  187 DC  G "C3'" 1 
ATOM 5387 O "O3'" . DC  G 2 18  ? -33.926 25.698  -43.755 1.00 78.07  ?  187 DC  G "O3'" 1 
ATOM 5388 C "C2'" . DC  G 2 18  ? -34.190 24.732  -41.531 1.00 74.67  ?  187 DC  G "C2'" 1 
ATOM 5389 C "C1'" . DC  G 2 18  ? -33.257 23.544  -41.634 1.00 71.14  ?  187 DC  G "C1'" 1 
ATOM 5390 N N1    . DC  G 2 18  ? -33.382 22.576  -40.516 1.00 67.33  ?  187 DC  G N1    1 
ATOM 5391 C C2    . DC  G 2 18  ? -33.343 21.210  -40.787 1.00 64.97  ?  187 DC  G C2    1 
ATOM 5392 O O2    . DC  G 2 18  ? -33.214 20.833  -41.955 1.00 66.54  ?  187 DC  G O2    1 
ATOM 5393 N N3    . DC  G 2 18  ? -33.460 20.335  -39.766 1.00 62.01  ?  187 DC  G N3    1 
ATOM 5394 C C4    . DC  G 2 18  ? -33.601 20.782  -38.522 1.00 58.46  ?  187 DC  G C4    1 
ATOM 5395 N N4    . DC  G 2 18  ? -33.710 19.878  -37.546 1.00 57.72  ?  187 DC  G N4    1 
ATOM 5396 C C5    . DC  G 2 18  ? -33.639 22.172  -38.223 1.00 60.22  ?  187 DC  G C5    1 
ATOM 5397 C C6    . DC  G 2 18  ? -33.526 23.026  -39.242 1.00 66.86  ?  187 DC  G C6    1 
ATOM 5398 P P     . DG  G 2 19  ? -35.131 26.628  -44.256 1.00 83.33  ?  188 DG  G P     1 
ATOM 5399 O OP1   . DG  G 2 19  ? -34.674 27.359  -45.455 1.00 84.87  ?  188 DG  G OP1   1 
ATOM 5400 O OP2   . DG  G 2 19  ? -35.639 27.376  -43.088 1.00 84.17  ?  188 DG  G OP2   1 
ATOM 5401 O "O5'" . DG  G 2 19  ? -36.241 25.573  -44.699 1.00 85.32  ?  188 DG  G "O5'" 1 
ATOM 5402 C "C5'" . DG  G 2 19  ? -36.487 25.355  -46.073 1.00 87.38  ?  188 DG  G "C5'" 1 
ATOM 5403 C "C4'" . DG  G 2 19  ? -35.843 24.061  -46.532 1.00 83.01  ?  188 DG  G "C4'" 1 
ATOM 5404 O "O4'" . DG  G 2 19  ? -35.204 23.421  -45.408 1.00 76.57  ?  188 DG  G "O4'" 1 
ATOM 5405 C "C3'" . DG  G 2 19  ? -36.801 23.054  -47.161 1.00 85.21  ?  188 DG  G "C3'" 1 
ATOM 5406 O "O3'" . DG  G 2 19  ? -36.394 22.773  -48.506 1.00 90.19  ?  188 DG  G "O3'" 1 
ATOM 5407 C "C2'" . DG  G 2 19  ? -36.739 21.807  -46.269 1.00 79.75  ?  188 DG  G "C2'" 1 
ATOM 5408 C "C1'" . DG  G 2 19  ? -35.702 22.120  -45.197 1.00 75.63  ?  188 DG  G "C1'" 1 
ATOM 5409 N N9    . DG  G 2 19  ? -36.224 22.029  -43.833 1.00 75.27  ?  188 DG  G N9    1 
ATOM 5410 C C8    . DG  G 2 19  ? -36.729 23.051  -43.069 1.00 76.88  ?  188 DG  G C8    1 
ATOM 5411 N N7    . DG  G 2 19  ? -37.115 22.672  -41.883 1.00 76.16  ?  188 DG  G N7    1 
ATOM 5412 C C5    . DG  G 2 19  ? -36.847 21.312  -41.857 1.00 74.10  ?  188 DG  G C5    1 
ATOM 5413 C C6    . DG  G 2 19  ? -37.055 20.364  -40.831 1.00 73.76  ?  188 DG  G C6    1 
ATOM 5414 O O6    . DG  G 2 19  ? -37.530 20.546  -39.703 1.00 73.95  ?  188 DG  G O6    1 
ATOM 5415 N N1    . DG  G 2 19  ? -36.643 19.092  -41.215 1.00 72.09  ?  188 DG  G N1    1 
ATOM 5416 C C2    . DG  G 2 19  ? -36.102 18.777  -42.437 1.00 70.08  ?  188 DG  G C2    1 
ATOM 5417 N N2    . DG  G 2 19  ? -35.767 17.494  -42.624 1.00 68.66  ?  188 DG  G N2    1 
ATOM 5418 N N3    . DG  G 2 19  ? -35.902 19.657  -43.407 1.00 70.17  ?  188 DG  G N3    1 
ATOM 5419 C C4    . DG  G 2 19  ? -36.297 20.900  -43.049 1.00 72.85  ?  188 DG  G C4    1 
ATOM 5420 P P     . DG  G 2 20  ? -37.408 22.093  -49.554 1.00 93.93  ?  189 DG  G P     1 
ATOM 5421 O OP1   . DG  G 2 20  ? -36.624 21.643  -50.722 1.00 95.92  ?  189 DG  G OP1   1 
ATOM 5422 O OP2   . DG  G 2 20  ? -38.543 23.018  -49.737 1.00 97.53  ?  189 DG  G OP2   1 
ATOM 5423 O "O5'" . DG  G 2 20  ? -37.962 20.815  -48.781 1.00 92.37  ?  189 DG  G "O5'" 1 
ATOM 5424 C "C5'" . DG  G 2 20  ? -39.000 20.033  -49.327 1.00 96.39  ?  189 DG  G "C5'" 1 
ATOM 5425 C "C4'" . DG  G 2 20  ? -38.957 18.639  -48.737 1.00 95.20  ?  189 DG  G "C4'" 1 
ATOM 5426 O "O4'" . DG  G 2 20  ? -38.601 18.736  -47.338 1.00 91.03  ?  189 DG  G "O4'" 1 
ATOM 5427 C "C3'" . DG  G 2 20  ? -40.271 17.870  -48.792 1.00 99.76  ?  189 DG  G "C3'" 1 
ATOM 5428 O "O3'" . DG  G 2 20  ? -40.031 16.505  -49.077 1.00 102.50 ?  189 DG  G "O3'" 1 
ATOM 5429 C "C2'" . DG  G 2 20  ? -40.843 18.060  -47.395 1.00 97.52  ?  189 DG  G "C2'" 1 
ATOM 5430 C "C1'" . DG  G 2 20  ? -39.586 18.125  -46.542 1.00 91.31  ?  189 DG  G "C1'" 1 
ATOM 5431 N N9    . DG  G 2 20  ? -39.759 18.938  -45.347 1.00 88.14  ?  189 DG  G N9    1 
ATOM 5432 C C8    . DG  G 2 20  ? -39.824 20.305  -45.288 1.00 88.18  ?  189 DG  G C8    1 
ATOM 5433 N N7    . DG  G 2 20  ? -39.988 20.765  -44.082 1.00 73.63  ?  189 DG  G N7    1 
ATOM 5434 C C5    . DG  G 2 20  ? -40.035 19.629  -43.290 1.00 72.04  ?  189 DG  G C5    1 
ATOM 5435 C C6    . DG  G 2 20  ? -40.196 19.504  -41.896 1.00 71.13  ?  189 DG  G C6    1 
ATOM 5436 O O6    . DG  G 2 20  ? -40.334 20.401  -41.060 1.00 71.57  ?  189 DG  G O6    1 
ATOM 5437 N N1    . DG  G 2 20  ? -40.187 18.173  -41.494 1.00 73.97  ?  189 DG  G N1    1 
ATOM 5438 C C2    . DG  G 2 20  ? -40.042 17.100  -42.336 1.00 70.02  ?  189 DG  G C2    1 
ATOM 5439 N N2    . DG  G 2 20  ? -40.060 15.891  -41.762 1.00 69.42  ?  189 DG  G N2    1 
ATOM 5440 N N3    . DG  G 2 20  ? -39.890 17.203  -43.648 1.00 70.94  ?  189 DG  G N3    1 
ATOM 5441 C C4    . DG  G 2 20  ? -39.896 18.495  -44.053 1.00 85.79  ?  189 DG  G C4    1 
ATOM 5442 P P     . DA  G 2 21  ? -40.975 15.728  -50.116 1.00 111.93 ?  190 DA  G P     1 
ATOM 5443 O OP1   . DA  G 2 21  ? -41.264 14.397  -49.541 1.00 112.82 ?  190 DA  G OP1   1 
ATOM 5444 O OP2   . DA  G 2 21  ? -40.362 15.838  -51.457 1.00 113.70 ?  190 DA  G OP2   1 
ATOM 5445 O "O5'" . DA  G 2 21  ? -42.322 16.590  -50.118 1.00 114.45 ?  190 DA  G "O5'" 1 
ATOM 5446 C "C4'" . DC  H 3 1   ? -40.252 12.866  -34.490 1.00 92.75  ?  170 DC  H "C4'" 1 
ATOM 5447 O "O4'" . DC  H 3 1   ? -40.294 14.140  -35.156 1.00 93.89  ?  170 DC  H "O4'" 1 
ATOM 5448 C "C3'" . DC  H 3 1   ? -38.884 12.275  -34.819 1.00 87.52  ?  170 DC  H "C3'" 1 
ATOM 5449 O "O3'" . DC  H 3 1   ? -39.016 10.915  -35.194 1.00 91.22  ?  170 DC  H "O3'" 1 
ATOM 5450 C "C2'" . DC  H 3 1   ? -38.355 13.127  -35.983 1.00 82.61  ?  170 DC  H "C2'" 1 
ATOM 5451 C "C1'" . DC  H 3 1   ? -39.509 14.064  -36.312 1.00 85.51  ?  170 DC  H "C1'" 1 
ATOM 5452 N N1    . DC  H 3 1   ? -39.058 15.430  -36.665 1.00 83.55  ?  170 DC  H N1    1 
ATOM 5453 C C2    . DC  H 3 1   ? -39.068 15.835  -37.997 1.00 88.16  ?  170 DC  H C2    1 
ATOM 5454 O O2    . DC  H 3 1   ? -39.470 15.049  -38.861 1.00 87.30  ?  170 DC  H O2    1 
ATOM 5455 N N3    . DC  H 3 1   ? -38.645 17.085  -38.306 1.00 87.03  ?  170 DC  H N3    1 
ATOM 5456 C C4    . DC  H 3 1   ? -38.224 17.904  -37.342 1.00 80.69  ?  170 DC  H C4    1 
ATOM 5457 N N4    . DC  H 3 1   ? -37.814 19.127  -37.693 1.00 79.65  ?  170 DC  H N4    1 
ATOM 5458 C C5    . DC  H 3 1   ? -38.200 17.504  -35.978 1.00 84.65  ?  170 DC  H C5    1 
ATOM 5459 C C6    . DC  H 3 1   ? -38.619 16.269  -35.688 1.00 84.97  ?  170 DC  H C6    1 
ATOM 5460 P P     . DC  H 3 2   ? -37.708 10.029  -35.478 1.00 86.76  ?  171 DC  H P     1 
ATOM 5461 O OP1   . DC  H 3 2   ? -38.091 8.602   -35.437 1.00 88.56  ?  171 DC  H OP1   1 
ATOM 5462 O OP2   . DC  H 3 2   ? -36.630 10.523  -34.598 1.00 86.30  ?  171 DC  H OP2   1 
ATOM 5463 O "O5'" . DC  H 3 2   ? -37.340 10.387  -36.986 1.00 77.96  ?  171 DC  H "O5'" 1 
ATOM 5464 C "C5'" . DC  H 3 2   ? -37.518 9.425   -37.999 1.00 76.62  ?  171 DC  H "C5'" 1 
ATOM 5465 C "C4'" . DC  H 3 2   ? -37.148 9.994   -39.354 1.00 72.21  ?  171 DC  H "C4'" 1 
ATOM 5466 O "O4'" . DC  H 3 2   ? -37.309 11.432  -39.345 1.00 71.98  ?  171 DC  H "O4'" 1 
ATOM 5467 C "C3'" . DC  H 3 2   ? -35.701 9.735   -39.780 1.00 67.68  ?  171 DC  H "C3'" 1 
ATOM 5468 O "O3'" . DC  H 3 2   ? -35.671 9.101   -41.032 1.00 65.66  ?  171 DC  H "O3'" 1 
ATOM 5469 C "C2'" . DC  H 3 2   ? -35.077 11.126  -39.847 1.00 69.52  ?  171 DC  H "C2'" 1 
ATOM 5470 C "C1'" . DC  H 3 2   ? -36.288 11.991  -40.120 1.00 67.35  ?  171 DC  H "C1'" 1 
ATOM 5471 N N1    . DC  H 3 2   ? -36.095 13.402  -39.723 1.00 76.70  ?  171 DC  H N1    1 
ATOM 5472 C C2    . DC  H 3 2   ? -36.166 14.405  -40.692 1.00 74.89  ?  171 DC  H C2    1 
ATOM 5473 O O2    . DC  H 3 2   ? -36.410 14.096  -41.863 1.00 72.81  ?  171 DC  H O2    1 
ATOM 5474 N N3    . DC  H 3 2   ? -35.976 15.691  -40.317 1.00 75.27  ?  171 DC  H N3    1 
ATOM 5475 C C4    . DC  H 3 2   ? -35.717 15.981  -39.045 1.00 76.35  ?  171 DC  H C4    1 
ATOM 5476 N N4    . DC  H 3 2   ? -35.535 17.264  -38.723 1.00 76.78  ?  171 DC  H N4    1 
ATOM 5477 C C5    . DC  H 3 2   ? -35.631 14.971  -38.046 1.00 69.77  ?  171 DC  H C5    1 
ATOM 5478 C C6    . DC  H 3 2   ? -35.821 13.707  -38.428 1.00 69.33  ?  171 DC  H C6    1 
ATOM 5479 P P     . DG  H 3 3   ? -34.369 8.278   -41.469 1.00 73.98  ?  172 DG  H P     1 
ATOM 5480 O OP1   . DG  H 3 3   ? -34.795 7.138   -42.304 1.00 77.05  ?  172 DG  H OP1   1 
ATOM 5481 O OP2   . DG  H 3 3   ? -33.570 8.039   -40.251 1.00 76.10  ?  172 DG  H OP2   1 
ATOM 5482 O "O5'" . DG  H 3 3   ? -33.575 9.316   -42.376 1.00 66.48  ?  172 DG  H "O5'" 1 
ATOM 5483 C "C5'" . DG  H 3 3   ? -34.116 9.709   -43.615 1.00 63.42  ?  172 DG  H "C5'" 1 
ATOM 5484 C "C4'" . DG  H 3 3   ? -33.548 11.042  -44.055 1.00 60.03  ?  172 DG  H "C4'" 1 
ATOM 5485 O "O4'" . DG  H 3 3   ? -33.642 11.994  -42.968 1.00 55.63  ?  172 DG  H "O4'" 1 
ATOM 5486 C "C3'" . DG  H 3 3   ? -32.070 11.013  -44.462 1.00 55.16  ?  172 DG  H "C3'" 1 
ATOM 5487 O "O3'" . DG  H 3 3   ? -31.901 11.629  -45.713 1.00 52.99  ?  172 DG  H "O3'" 1 
ATOM 5488 C "C2'" . DG  H 3 3   ? -31.383 11.818  -43.369 1.00 54.09  ?  172 DG  H "C2'" 1 
ATOM 5489 C "C1'" . DG  H 3 3   ? -32.482 12.775  -42.974 1.00 52.67  ?  172 DG  H "C1'" 1 
ATOM 5490 N N9    . DG  H 3 3   ? -32.281 13.353  -41.658 1.00 54.27  ?  172 DG  H N9    1 
ATOM 5491 C C8    . DG  H 3 3   ? -31.979 12.684  -40.504 1.00 58.69  ?  172 DG  H C8    1 
ATOM 5492 N N7    . DG  H 3 3   ? -31.843 13.467  -39.473 1.00 60.66  ?  172 DG  H N7    1 
ATOM 5493 C C5    . DG  H 3 3   ? -32.073 14.736  -39.980 1.00 59.53  ?  172 DG  H C5    1 
ATOM 5494 C C6    . DG  H 3 3   ? -32.064 15.988  -39.330 1.00 60.91  ?  172 DG  H C6    1 
ATOM 5495 O O6    . DG  H 3 3   ? -31.844 16.230  -38.136 1.00 63.39  ?  172 DG  H O6    1 
ATOM 5496 N N1    . DG  H 3 3   ? -32.347 17.026  -40.209 1.00 57.41  ?  172 DG  H N1    1 
ATOM 5497 C C2    . DG  H 3 3   ? -32.605 16.871  -41.547 1.00 58.71  ?  172 DG  H C2    1 
ATOM 5498 N N2    . DG  H 3 3   ? -32.859 17.990  -42.236 1.00 55.44  ?  172 DG  H N2    1 
ATOM 5499 N N3    . DG  H 3 3   ? -32.615 15.702  -42.168 1.00 57.27  ?  172 DG  H N3    1 
ATOM 5500 C C4    . DG  H 3 3   ? -32.341 14.682  -41.323 1.00 57.49  ?  172 DG  H C4    1 
ATOM 5501 P P     . DA  H 3 4   ? -30.916 10.979  -46.795 1.00 54.21  ?  173 DA  H P     1 
ATOM 5502 O OP1   . DA  H 3 4   ? -31.744 10.218  -47.750 1.00 57.91  ?  173 DA  H OP1   1 
ATOM 5503 O OP2   . DA  H 3 4   ? -29.837 10.294  -46.058 1.00 56.56  ?  173 DA  H OP2   1 
ATOM 5504 O "O5'" . DA  H 3 4   ? -30.291 12.244  -47.540 1.00 50.63  ?  173 DA  H "O5'" 1 
ATOM 5505 C "C5'" . DA  H 3 4   ? -31.144 13.213  -48.119 1.00 48.60  ?  173 DA  H "C5'" 1 
ATOM 5506 C "C4'" . DA  H 3 4   ? -30.661 14.617  -47.813 1.00 45.79  ?  173 DA  H "C4'" 1 
ATOM 5507 O "O4'" . DA  H 3 4   ? -30.753 14.859  -46.402 1.00 45.40  ?  173 DA  H "O4'" 1 
ATOM 5508 C "C3'" . DA  H 3 4   ? -29.204 14.887  -48.183 1.00 46.17  ?  173 DA  H "C3'" 1 
ATOM 5509 O "O3'" . DA  H 3 4   ? -29.135 15.710  -49.333 1.00 50.74  ?  173 DA  H "O3'" 1 
ATOM 5510 C "C2'" . DA  H 3 4   ? -28.609 15.591  -46.958 1.00 43.98  ?  173 DA  H "C2'" 1 
ATOM 5511 C "C1'" . DA  H 3 4   ? -29.811 15.836  -46.063 1.00 44.70  ?  173 DA  H "C1'" 1 
ATOM 5512 N N9    . DA  H 3 4   ? -29.504 15.715  -44.648 1.00 45.69  ?  173 DA  H N9    1 
ATOM 5513 C C8    . DA  H 3 4   ? -29.085 14.597  -43.993 1.00 46.17  ?  173 DA  H C8    1 
ATOM 5514 N N7    . DA  H 3 4   ? -28.878 14.781  -42.714 1.00 48.42  ?  173 DA  H N7    1 
ATOM 5515 C C5    . DA  H 3 4   ? -29.182 16.116  -42.519 1.00 48.95  ?  173 DA  H C5    1 
ATOM 5516 C C6    . DA  H 3 4   ? -29.165 16.935  -41.376 1.00 51.15  ?  173 DA  H C6    1 
ATOM 5517 N N6    . DA  H 3 4   ? -28.811 16.497  -40.165 1.00 53.79  ?  173 DA  H N6    1 
ATOM 5518 N N1    . DA  H 3 4   ? -29.526 18.225  -41.526 1.00 50.47  ?  173 DA  H N1    1 
ATOM 5519 C C2    . DA  H 3 4   ? -29.873 18.658  -42.739 1.00 49.48  ?  173 DA  H C2    1 
ATOM 5520 N N3    . DA  H 3 4   ? -29.928 17.983  -43.884 1.00 47.91  ?  173 DA  H N3    1 
ATOM 5521 C C4    . DA  H 3 4   ? -29.567 16.706  -43.702 1.00 47.16  ?  173 DA  H C4    1 
ATOM 5522 P P     . DA  H 3 5   ? -27.708 16.082  -49.965 1.00 52.91  ?  174 DA  H P     1 
ATOM 5523 O OP1   . DA  H 3 5   ? -27.930 16.525  -51.354 1.00 58.30  -1 174 DA  H OP1   1 
ATOM 5524 O OP2   . DA  H 3 5   ? -26.778 14.974  -49.677 1.00 52.40  ?  174 DA  H OP2   1 
ATOM 5525 O "O5'" . DA  H 3 5   ? -27.233 17.344  -49.120 1.00 47.44  ?  174 DA  H "O5'" 1 
ATOM 5526 C "C5'" . DA  H 3 5   ? -27.884 18.583  -49.294 1.00 47.17  ?  174 DA  H "C5'" 1 
ATOM 5527 C "C4'" . DA  H 3 5   ? -27.318 19.624  -48.353 1.00 46.03  ?  174 DA  H "C4'" 1 
ATOM 5528 O "O4'" . DA  H 3 5   ? -27.445 19.175  -46.982 1.00 46.51  ?  174 DA  H "O4'" 1 
ATOM 5529 C "C3'" . DA  H 3 5   ? -25.837 19.935  -48.557 1.00 42.82  ?  174 DA  H "C3'" 1 
ATOM 5530 O "O3'" . DA  H 3 5   ? -25.630 21.336  -48.463 1.00 44.51  ?  174 DA  H "O3'" 1 
ATOM 5531 C "C2'" . DA  H 3 5   ? -25.187 19.193  -47.394 1.00 40.91  ?  174 DA  H "C2'" 1 
ATOM 5532 C "C1'" . DA  H 3 5   ? -26.229 19.411  -46.326 1.00 42.24  ?  174 DA  H "C1'" 1 
ATOM 5533 N N9    . DA  H 3 5   ? -26.121 18.499  -45.198 1.00 39.28  ?  174 DA  H N9    1 
ATOM 5534 C C8    . DA  H 3 5   ? -25.987 17.145  -45.247 1.00 38.08  ?  174 DA  H C8    1 
ATOM 5535 N N7    . DA  H 3 5   ? -25.922 16.578  -44.068 1.00 39.43  ?  174 DA  H N7    1 
ATOM 5536 C C5    . DA  H 3 5   ? -26.024 17.636  -43.185 1.00 41.05  ?  174 DA  H C5    1 
ATOM 5537 C C6    . DA  H 3 5   ? -26.021 17.701  -41.782 1.00 43.98  ?  174 DA  H C6    1 
ATOM 5538 N N6    . DA  H 3 5   ? -25.906 16.628  -40.999 1.00 46.88  ?  174 DA  H N6    1 
ATOM 5539 N N1    . DA  H 3 5   ? -26.142 18.913  -41.212 1.00 45.18  ?  174 DA  H N1    1 
ATOM 5540 C C2    . DA  H 3 5   ? -26.256 19.984  -42.000 1.00 44.26  ?  174 DA  H C2    1 
ATOM 5541 N N3    . DA  H 3 5   ? -26.271 20.047  -43.327 1.00 43.01  ?  174 DA  H N3    1 
ATOM 5542 C C4    . DA  H 3 5   ? -26.150 18.826  -43.864 1.00 40.47  ?  174 DA  H C4    1 
ATOM 5543 P P     . DT  H 3 6   ? -24.285 22.005  -49.025 1.00 39.86  ?  175 DT  H P     1 
ATOM 5544 O OP1   . DT  H 3 6   ? -24.687 23.048  -49.987 1.00 42.00  -1 175 DT  H OP1   1 
ATOM 5545 O OP2   . DT  H 3 6   ? -23.375 20.926  -49.449 1.00 40.41  ?  175 DT  H OP2   1 
ATOM 5546 O "O5'" . DT  H 3 6   ? -23.659 22.703  -47.738 1.00 40.29  ?  175 DT  H "O5'" 1 
ATOM 5547 C "C5'" . DT  H 3 6   ? -23.549 21.954  -46.549 1.00 39.71  ?  175 DT  H "C5'" 1 
ATOM 5548 C "C4'" . DT  H 3 6   ? -22.878 22.730  -45.446 1.00 37.98  ?  175 DT  H "C4'" 1 
ATOM 5549 O "O4'" . DT  H 3 6   ? -23.133 22.061  -44.187 1.00 36.99  ?  175 DT  H "O4'" 1 
ATOM 5550 C "C3'" . DT  H 3 6   ? -21.368 22.826  -45.560 1.00 37.41  ?  175 DT  H "C3'" 1 
ATOM 5551 O "O3'" . DT  H 3 6   ? -20.924 24.026  -44.968 1.00 36.86  ?  175 DT  H "O3'" 1 
ATOM 5552 C "C2'" . DT  H 3 6   ? -20.904 21.607  -44.778 1.00 38.39  ?  175 DT  H "C2'" 1 
ATOM 5553 C "C1'" . DT  H 3 6   ? -21.930 21.548  -43.660 1.00 37.83  ?  175 DT  H "C1'" 1 
ATOM 5554 N N1    . DT  H 3 6   ? -22.180 20.174  -43.167 1.00 37.18  ?  175 DT  H N1    1 
ATOM 5555 C C2    . DT  H 3 6   ? -22.453 19.984  -41.842 1.00 40.23  ?  175 DT  H C2    1 
ATOM 5556 O O2    . DT  H 3 6   ? -22.519 20.894  -41.041 1.00 44.35  ?  175 DT  H O2    1 
ATOM 5557 N N3    . DT  H 3 6   ? -22.662 18.683  -41.483 1.00 39.40  ?  175 DT  H N3    1 
ATOM 5558 C C4    . DT  H 3 6   ? -22.616 17.575  -42.300 1.00 36.48  ?  175 DT  H C4    1 
ATOM 5559 O O4    . DT  H 3 6   ? -22.818 16.443  -41.882 1.00 37.02  ?  175 DT  H O4    1 
ATOM 5560 C C5    . DT  H 3 6   ? -22.316 17.842  -43.679 1.00 33.34  ?  175 DT  H C5    1 
ATOM 5561 C C7    . DT  H 3 6   ? -22.239 16.716  -44.662 1.00 32.64  ?  175 DT  H C7    1 
ATOM 5562 C C6    . DT  H 3 6   ? -22.112 19.115  -44.043 1.00 36.07  ?  175 DT  H C6    1 
ATOM 5563 P P     . DG  H 3 7   ? -19.378 24.443  -45.026 1.00 35.24  ?  176 DG  H P     1 
ATOM 5564 O OP1   . DG  H 3 7   ? -19.328 25.869  -45.392 1.00 36.30  -1 176 DG  H OP1   1 
ATOM 5565 O OP2   . DG  H 3 7   ? -18.636 23.448  -45.821 1.00 35.50  ?  176 DG  H OP2   1 
ATOM 5566 O "O5'" . DG  H 3 7   ? -18.917 24.322  -43.510 1.00 35.85  ?  176 DG  H "O5'" 1 
ATOM 5567 C "C5'" . DG  H 3 7   ? -19.477 25.190  -42.553 1.00 38.66  ?  176 DG  H "C5'" 1 
ATOM 5568 C "C4'" . DG  H 3 7   ? -19.084 24.789  -41.145 1.00 44.61  ?  176 DG  H "C4'" 1 
ATOM 5569 O "O4'" . DG  H 3 7   ? -19.558 23.446  -40.867 1.00 43.94  ?  176 DG  H "O4'" 1 
ATOM 5570 C "C3'" . DG  H 3 7   ? -17.580 24.766  -40.872 1.00 42.73  ?  176 DG  H "C3'" 1 
ATOM 5571 O "O3'" . DG  H 3 7   ? -17.332 25.287  -39.597 1.00 44.07  ?  176 DG  H "O3'" 1 
ATOM 5572 C "C2'" . DG  H 3 7   ? -17.257 23.281  -40.917 1.00 40.95  ?  176 DG  H "C2'" 1 
ATOM 5573 C "C1'" . DG  H 3 7   ? -18.510 22.711  -40.293 1.00 43.85  ?  176 DG  H "C1'" 1 
ATOM 5574 N N9    . DG  H 3 7   ? -18.710 21.299  -40.579 1.00 45.14  ?  176 DG  H N9    1 
ATOM 5575 C C8    . DG  H 3 7   ? -18.529 20.667  -41.779 1.00 44.54  ?  176 DG  H C8    1 
ATOM 5576 N N7    . DG  H 3 7   ? -18.785 19.392  -41.737 1.00 44.64  ?  176 DG  H N7    1 
ATOM 5577 C C5    . DG  H 3 7   ? -19.168 19.167  -40.424 1.00 45.29  ?  176 DG  H C5    1 
ATOM 5578 C C6    . DG  H 3 7   ? -19.566 17.975  -39.787 1.00 46.10  ?  176 DG  H C6    1 
ATOM 5579 O O6    . DG  H 3 7   ? -19.661 16.842  -40.271 1.00 44.44  ?  176 DG  H O6    1 
ATOM 5580 N N1    . DG  H 3 7   ? -19.870 18.186  -38.448 1.00 50.89  ?  176 DG  H N1    1 
ATOM 5581 C C2    . DG  H 3 7   ? -19.799 19.398  -37.808 1.00 53.69  ?  176 DG  H C2    1 
ATOM 5582 N N2    . DG  H 3 7   ? -20.134 19.406  -36.510 1.00 57.40  ?  176 DG  H N2    1 
ATOM 5583 N N3    . DG  H 3 7   ? -19.428 20.523  -38.395 1.00 51.67  ?  176 DG  H N3    1 
ATOM 5584 C C4    . DG  H 3 7   ? -19.127 20.332  -39.699 1.00 47.24  ?  176 DG  H C4    1 
ATOM 5585 P P     . DA  H 3 8   ? -16.431 26.599  -39.419 1.00 48.49  ?  177 DA  H P     1 
ATOM 5586 O OP1   . DA  H 3 8   ? -17.281 27.762  -39.737 1.00 50.34  -1 177 DA  H OP1   1 
ATOM 5587 O OP2   . DA  H 3 8   ? -15.161 26.395  -40.142 1.00 49.20  ?  177 DA  H OP2   1 
ATOM 5588 O "O5'" . DA  H 3 8   ? -16.122 26.607  -37.860 1.00 51.82  ?  177 DA  H "O5'" 1 
ATOM 5589 C "C5'" . DA  H 3 8   ? -17.197 26.570  -36.945 1.00 54.81  ?  177 DA  H "C5'" 1 
ATOM 5590 C "C4'" . DA  H 3 8   ? -16.904 25.626  -35.799 1.00 56.26  ?  177 DA  H "C4'" 1 
ATOM 5591 O "O4'" . DA  H 3 8   ? -17.051 24.255  -36.248 1.00 54.90  ?  177 DA  H "O4'" 1 
ATOM 5592 C "C3'" . DA  H 3 8   ? -15.497 25.734  -35.217 1.00 56.72  ?  177 DA  H "C3'" 1 
ATOM 5593 O "O3'" . DA  H 3 8   ? -15.552 25.605  -33.810 1.00 58.43  ?  177 DA  H "O3'" 1 
ATOM 5594 C "C2'" . DA  H 3 8   ? -14.776 24.553  -35.852 1.00 54.84  ?  177 DA  H "C2'" 1 
ATOM 5595 C "C1'" . DA  H 3 8   ? -15.892 23.530  -35.919 1.00 53.94  ?  177 DA  H "C1'" 1 
ATOM 5596 N N9    . DA  H 3 8   ? -15.676 22.500  -36.924 1.00 50.89  ?  177 DA  H N9    1 
ATOM 5597 C C8    . DA  H 3 8   ? -15.086 22.652  -38.143 1.00 49.29  ?  177 DA  H C8    1 
ATOM 5598 N N7    . DA  H 3 8   ? -15.022 21.545  -38.838 1.00 47.71  ?  177 DA  H N7    1 
ATOM 5599 C C5    . DA  H 3 8   ? -15.605 20.602  -38.014 1.00 48.64  ?  177 DA  H C5    1 
ATOM 5600 C C6    . DA  H 3 8   ? -15.843 19.227  -38.170 1.00 48.94  ?  177 DA  H C6    1 
ATOM 5601 N N6    . DA  H 3 8   ? -15.499 18.541  -39.261 1.00 46.11  ?  177 DA  H N6    1 
ATOM 5602 N N1    . DA  H 3 8   ? -16.447 18.580  -37.156 1.00 51.48  ?  177 DA  H N1    1 
ATOM 5603 C C2    . DA  H 3 8   ? -16.787 19.270  -36.064 1.00 53.31  ?  177 DA  H C2    1 
ATOM 5604 N N3    . DA  H 3 8   ? -16.614 20.561  -35.805 1.00 53.88  ?  177 DA  H N3    1 
ATOM 5605 C C4    . DA  H 3 8   ? -16.012 21.175  -36.830 1.00 51.21  ?  177 DA  H C4    1 
ATOM 5606 P P     . DA  H 3 9   ? -14.234 25.829  -32.924 1.00 61.01  ?  178 DA  H P     1 
ATOM 5607 O OP1   . DA  H 3 9   ? -14.632 26.609  -31.736 1.00 66.96  -1 178 DA  H OP1   1 
ATOM 5608 O OP2   . DA  H 3 9   ? -13.164 26.334  -33.807 1.00 57.50  ?  178 DA  H OP2   1 
ATOM 5609 O "O5'" . DA  H 3 9   ? -13.848 24.359  -32.445 1.00 59.16  ?  178 DA  H "O5'" 1 
ATOM 5610 C "C5'" . DA  H 3 9   ? -14.853 23.501  -31.936 1.00 60.20  ?  178 DA  H "C5'" 1 
ATOM 5611 C "C4'" . DA  H 3 9   ? -14.320 22.093  -31.742 1.00 61.23  ?  178 DA  H "C4'" 1 
ATOM 5612 O "O4'" . DA  H 3 9   ? -14.207 21.438  -33.029 1.00 59.16  ?  178 DA  H "O4'" 1 
ATOM 5613 C "C3'" . DA  H 3 9   ? -12.935 22.013  -31.100 1.00 63.04  ?  178 DA  H "C3'" 1 
ATOM 5614 O "O3'" . DA  H 3 9   ? -12.900 20.979  -30.136 1.00 63.49  ?  178 DA  H "O3'" 1 
ATOM 5615 C "C2'" . DA  H 3 9   ? -12.020 21.703  -32.276 1.00 59.92  ?  178 DA  H "C2'" 1 
ATOM 5616 C "C1'" . DA  H 3 9   ? -12.929 20.868  -33.154 1.00 57.55  ?  178 DA  H "C1'" 1 
ATOM 5617 N N9    . DA  H 3 9   ? -12.543 20.895  -34.554 1.00 55.30  ?  178 DA  H N9    1 
ATOM 5618 C C8    . DA  H 3 9   ? -11.914 21.910  -35.211 1.00 55.04  ?  178 DA  H C8    1 
ATOM 5619 N N7    . DA  H 3 9   ? -11.682 21.656  -36.473 1.00 52.02  ?  178 DA  H N7    1 
ATOM 5620 C C5    . DA  H 3 9   ? -12.194 20.385  -36.653 1.00 51.87  ?  178 DA  H C5    1 
ATOM 5621 C C6    . DA  H 3 9   ? -12.259 19.543  -37.774 1.00 52.29  ?  178 DA  H C6    1 
ATOM 5622 N N6    . DA  H 3 9   ? -11.781 19.881  -38.975 1.00 51.87  ?  178 DA  H N6    1 
ATOM 5623 N N1    . DA  H 3 9   ? -12.836 18.337  -37.616 1.00 52.04  ?  178 DA  H N1    1 
ATOM 5624 C C2    . DA  H 3 9   ? -13.310 18.003  -36.413 1.00 52.26  ?  178 DA  H C2    1 
ATOM 5625 N N3    . DA  H 3 9   ? -13.305 18.710  -35.288 1.00 53.95  ?  178 DA  H N3    1 
ATOM 5626 C C4    . DA  H 3 9   ? -12.726 19.901  -35.479 1.00 53.64  ?  178 DA  H C4    1 
ATOM 5627 P P     . DT  H 3 10  ? -11.564 20.720  -29.288 1.00 62.98  ?  179 DT  H P     1 
ATOM 5628 O OP1   . DT  H 3 10  ? -11.973 20.193  -27.972 1.00 64.08  -1 179 DT  H OP1   1 
ATOM 5629 O OP2   . DT  H 3 10  ? -10.723 21.930  -29.374 1.00 64.66  ?  179 DT  H OP2   1 
ATOM 5630 O "O5'" . DT  H 3 10  ? -10.833 19.548  -30.084 1.00 58.95  ?  179 DT  H "O5'" 1 
ATOM 5631 C "C5'" . DT  H 3 10  ? -11.288 18.223  -29.934 1.00 57.33  ?  179 DT  H "C5'" 1 
ATOM 5632 C "C4'" . DT  H 3 10  ? -10.708 17.322  -31.005 1.00 55.22  ?  179 DT  H "C4'" 1 
ATOM 5633 O "O4'" . DT  H 3 10  ? -10.747 17.985  -32.271 1.00 54.85  ?  179 DT  H "O4'" 1 
ATOM 5634 C "C3'" . DT  H 3 10  ? -9.244  16.952  -30.831 1.00 55.47  ?  179 DT  H "C3'" 1 
ATOM 5635 O "O3'" . DT  H 3 10  ? -9.143  15.729  -30.130 1.00 57.29  ?  179 DT  H "O3'" 1 
ATOM 5636 C "C2'" . DT  H 3 10  ? -8.717  16.834  -32.274 1.00 52.01  ?  179 DT  H "C2'" 1 
ATOM 5637 C "C1'" . DT  H 3 10  ? -9.907  17.269  -33.129 1.00 51.74  ?  179 DT  H "C1'" 1 
ATOM 5638 N N1    . DT  H 3 10  ? -9.532  18.140  -34.271 1.00 49.70  ?  179 DT  H N1    1 
ATOM 5639 C C2    . DT  H 3 10  ? -9.668  17.663  -35.546 1.00 47.12  ?  179 DT  H C2    1 
ATOM 5640 O O2    . DT  H 3 10  ? -10.100 16.556  -35.799 1.00 47.91  ?  179 DT  H O2    1 
ATOM 5641 N N3    . DT  H 3 10  ? -9.294  18.538  -36.526 1.00 43.37  ?  179 DT  H N3    1 
ATOM 5642 C C4    . DT  H 3 10  ? -8.796  19.814  -36.359 1.00 42.34  ?  179 DT  H C4    1 
ATOM 5643 O O4    . DT  H 3 10  ? -8.483  20.526  -37.306 1.00 40.70  ?  179 DT  H O4    1 
ATOM 5644 C C5    . DT  H 3 10  ? -8.671  20.251  -34.996 1.00 45.25  ?  179 DT  H C5    1 
ATOM 5645 C C7    . DT  H 3 10  ? -8.142  21.617  -34.692 1.00 43.91  ?  179 DT  H C7    1 
ATOM 5646 C C6    . DT  H 3 10  ? -9.037  19.402  -34.027 1.00 49.02  ?  179 DT  H C6    1 
ATOM 5647 P P     . DG  H 3 11  ? -7.711  15.053  -29.878 1.00 70.57  ?  180 DG  H P     1 
ATOM 5648 O OP1   . DG  H 3 11  ? -7.858  14.100  -28.759 1.00 73.97  ?  180 DG  H OP1   1 
ATOM 5649 O OP2   . DG  H 3 11  ? -6.704  16.132  -29.812 1.00 71.04  ?  180 DG  H OP2   1 
ATOM 5650 O "O5'" . DG  H 3 11  ? -7.469  14.196  -31.198 1.00 64.29  ?  180 DG  H "O5'" 1 
ATOM 5651 C "C5'" . DG  H 3 11  ? -8.326  13.105  -31.481 1.00 62.38  ?  180 DG  H "C5'" 1 
ATOM 5652 C "C4'" . DG  H 3 11  ? -8.011  12.499  -32.833 1.00 58.40  ?  180 DG  H "C4'" 1 
ATOM 5653 O "O4'" . DG  H 3 11  ? -8.079  13.528  -33.852 1.00 56.14  ?  180 DG  H "O4'" 1 
ATOM 5654 C "C3'" . DG  H 3 11  ? -6.615  11.888  -32.951 1.00 58.38  ?  180 DG  H "C3'" 1 
ATOM 5655 O "O3'" . DG  H 3 11  ? -6.677  10.695  -33.694 1.00 57.74  ?  180 DG  H "O3'" 1 
ATOM 5656 C "C2'" . DG  H 3 11  ? -5.845  12.958  -33.710 1.00 55.87  ?  180 DG  H "C2'" 1 
ATOM 5657 C "C1'" . DG  H 3 11  ? -6.924  13.455  -34.645 1.00 53.56  ?  180 DG  H "C1'" 1 
ATOM 5658 N N9    . DG  H 3 11  ? -6.651  14.767  -35.206 1.00 54.32  ?  180 DG  H N9    1 
ATOM 5659 C C8    . DG  H 3 11  ? -6.363  15.918  -34.524 1.00 57.71  ?  180 DG  H C8    1 
ATOM 5660 N N7    . DG  H 3 11  ? -6.162  16.944  -35.300 1.00 56.98  ?  180 DG  H N7    1 
ATOM 5661 C C5    . DG  H 3 11  ? -6.337  16.438  -36.578 1.00 54.91  ?  180 DG  H C5    1 
ATOM 5662 C C6    . DG  H 3 11  ? -6.248  17.079  -37.834 1.00 56.45  ?  180 DG  H C6    1 
ATOM 5663 O O6    . DG  H 3 11  ? -5.989  18.265  -38.074 1.00 57.64  ?  180 DG  H O6    1 
ATOM 5664 N N1    . DG  H 3 11  ? -6.495  16.194  -38.880 1.00 54.70  ?  180 DG  H N1    1 
ATOM 5665 C C2    . DG  H 3 11  ? -6.787  14.861  -38.727 1.00 52.77  ?  180 DG  H C2    1 
ATOM 5666 N N2    . DG  H 3 11  ? -6.999  14.165  -39.849 1.00 49.46  ?  180 DG  H N2    1 
ATOM 5667 N N3    . DG  H 3 11  ? -6.877  14.253  -37.559 1.00 54.17  ?  180 DG  H N3    1 
ATOM 5668 C C4    . DG  H 3 11  ? -6.638  15.099  -36.533 1.00 53.79  ?  180 DG  H C4    1 
ATOM 5669 P P     . DA  H 3 12  ? -5.363  9.796   -33.868 1.00 57.77  ?  181 DA  H P     1 
ATOM 5670 O OP1   . DA  H 3 12  ? -5.778  8.382   -33.920 1.00 60.53  ?  181 DA  H OP1   1 
ATOM 5671 O OP2   . DA  H 3 12  ? -4.365  10.247  -32.881 1.00 62.57  ?  181 DA  H OP2   1 
ATOM 5672 O "O5'" . DA  H 3 12  ? -4.826  10.200  -35.304 1.00 52.51  ?  181 DA  H "O5'" 1 
ATOM 5673 C "C5'" . DA  H 3 12  ? -5.412  9.644   -36.453 1.00 51.05  ?  181 DA  H "C5'" 1 
ATOM 5674 C "C4'" . DA  H 3 12  ? -4.773  10.221  -37.692 1.00 49.82  ?  181 DA  H "C4'" 1 
ATOM 5675 O "O4'" . DA  H 3 12  ? -4.736  11.652  -37.579 1.00 48.99  ?  181 DA  H "O4'" 1 
ATOM 5676 C "C3'" . DA  H 3 12  ? -3.327  9.786   -37.904 1.00 51.44  ?  181 DA  H "C3'" 1 
ATOM 5677 O "O3'" . DA  H 3 12  ? -3.249  8.883   -38.982 1.00 53.34  ?  181 DA  H "O3'" 1 
ATOM 5678 C "C2'" . DA  H 3 12  ? -2.562  11.085  -38.198 1.00 50.62  ?  181 DA  H "C2'" 1 
ATOM 5679 C "C1'" . DA  H 3 12  ? -3.661  12.128  -38.331 1.00 49.35  ?  181 DA  H "C1'" 1 
ATOM 5680 N N9    . DA  H 3 12  ? -3.277  13.424  -37.798 1.00 53.66  ?  181 DA  H N9    1 
ATOM 5681 C C8    . DA  H 3 12  ? -3.121  13.755  -36.486 1.00 57.02  ?  181 DA  H C8    1 
ATOM 5682 N N7    . DA  H 3 12  ? -2.752  14.997  -36.294 1.00 58.12  ?  181 DA  H N7    1 
ATOM 5683 C C5    . DA  H 3 12  ? -2.651  15.512  -37.571 1.00 56.49  ?  181 DA  H C5    1 
ATOM 5684 C C6    . DA  H 3 12  ? -2.299  16.784  -38.051 1.00 57.56  ?  181 DA  H C6    1 
ATOM 5685 N N6    . DA  H 3 12  ? -1.971  17.803  -37.256 1.00 59.22  ?  181 DA  H N6    1 
ATOM 5686 N N1    . DA  H 3 12  ? -2.298  16.969  -39.384 1.00 57.01  ?  181 DA  H N1    1 
ATOM 5687 C C2    . DA  H 3 12  ? -2.629  15.945  -40.176 1.00 54.48  ?  181 DA  H C2    1 
ATOM 5688 N N3    . DA  H 3 12  ? -2.976  14.705  -39.841 1.00 53.90  ?  181 DA  H N3    1 
ATOM 5689 C C4    . DA  H 3 12  ? -2.966  14.554  -38.511 1.00 54.82  ?  181 DA  H C4    1 
ATOM 5690 P P     . DA  H 3 13  ? -1.863  8.149   -39.305 1.00 55.47  ?  182 DA  H P     1 
ATOM 5691 O OP1   . DA  H 3 13  ? -2.186  6.877   -39.981 1.00 58.64  -1 182 DA  H OP1   1 
ATOM 5692 O OP2   . DA  H 3 13  ? -1.048  8.154   -38.075 1.00 59.65  ?  182 DA  H OP2   1 
ATOM 5693 O "O5'" . DA  H 3 13  ? -1.171  9.114   -40.362 1.00 49.84  ?  182 DA  H "O5'" 1 
ATOM 5694 C "C5'" . DA  H 3 13  ? -1.735  9.255   -41.644 1.00 46.20  ?  182 DA  H "C5'" 1 
ATOM 5695 C "C4'" . DA  H 3 13  ? -1.139  10.442  -42.366 1.00 45.37  ?  182 DA  H "C4'" 1 
ATOM 5696 O "O4'" . DA  H 3 13  ? -1.189  11.601  -41.517 1.00 45.80  ?  182 DA  H "O4'" 1 
ATOM 5697 C "C3'" . DA  H 3 13  ? 0.326   10.269  -42.765 1.00 47.61  ?  182 DA  H "C3'" 1 
ATOM 5698 O "O3'" . DA  H 3 13  ? 0.445   10.262  -44.168 1.00 49.12  ?  182 DA  H "O3'" 1 
ATOM 5699 C "C2'" . DA  H 3 13  ? 1.042   11.476  -42.141 1.00 46.55  ?  182 DA  H "C2'" 1 
ATOM 5700 C "C1'" . DA  H 3 13  ? -0.103  12.422  -41.827 1.00 46.44  ?  182 DA  H "C1'" 1 
ATOM 5701 N N9    . DA  H 3 13  ? 0.157   13.286  -40.687 1.00 48.70  ?  182 DA  H N9    1 
ATOM 5702 C C8    . DA  H 3 13  ? 0.239   12.916  -39.377 1.00 50.56  ?  182 DA  H C8    1 
ATOM 5703 N N7    . DA  H 3 13  ? 0.485   13.912  -38.562 1.00 51.77  ?  182 DA  H N7    1 
ATOM 5704 C C5    . DA  H 3 13  ? 0.568   15.010  -39.397 1.00 51.08  ?  182 DA  H C5    1 
ATOM 5705 C C6    . DA  H 3 13  ? 0.814   16.372  -39.150 1.00 52.38  ?  182 DA  H C6    1 
ATOM 5706 N N6    . DA  H 3 13  ? 1.025   16.871  -37.932 1.00 54.08  ?  182 DA  H N6    1 
ATOM 5707 N N1    . DA  H 3 13  ? 0.832   17.204  -40.206 1.00 52.61  ?  182 DA  H N1    1 
ATOM 5708 C C2    . DA  H 3 13  ? 0.619   16.700  -41.424 1.00 50.52  ?  182 DA  H C2    1 
ATOM 5709 N N3    . DA  H 3 13  ? 0.380   15.442  -41.780 1.00 48.98  ?  182 DA  H N3    1 
ATOM 5710 C C4    . DA  H 3 13  ? 0.369   14.641  -40.709 1.00 49.32  ?  182 DA  H C4    1 
ATOM 5711 P P     . DT  H 3 14  ? 1.821   9.812   -44.854 1.00 52.46  ?  183 DT  H P     1 
ATOM 5712 O OP1   . DT  H 3 14  ? 1.507   9.313   -46.207 1.00 52.75  -1 183 DT  H OP1   1 
ATOM 5713 O OP2   . DT  H 3 14  ? 2.544   8.955   -43.894 1.00 58.08  ?  183 DT  H OP2   1 
ATOM 5714 O "O5'" . DT  H 3 14  ? 2.632   11.174  -44.983 1.00 49.15  ?  183 DT  H "O5'" 1 
ATOM 5715 C "C5'" . DT  H 3 14  ? 2.008   12.293  -45.564 1.00 44.12  ?  183 DT  H "C5'" 1 
ATOM 5716 C "C4'" . DT  H 3 14  ? 2.883   13.521  -45.447 1.00 43.67  ?  183 DT  H "C4'" 1 
ATOM 5717 O "O4'" . DT  H 3 14  ? 2.722   14.121  -44.145 1.00 44.16  ?  183 DT  H "O4'" 1 
ATOM 5718 C "C3'" . DT  H 3 14  ? 4.388   13.268  -45.613 1.00 46.97  ?  183 DT  H "C3'" 1 
ATOM 5719 O "O3'" . DT  H 3 14  ? 4.863   14.010  -46.733 1.00 44.49  ?  183 DT  H "O3'" 1 
ATOM 5720 C "C2'" . DT  H 3 14  ? 4.989   13.767  -44.291 1.00 49.69  ?  183 DT  H "C2'" 1 
ATOM 5721 C "C1'" . DT  H 3 14  ? 3.929   14.738  -43.815 1.00 47.45  ?  183 DT  H "C1'" 1 
ATOM 5722 N N1    . DT  H 3 14  ? 3.967   14.994  -42.355 1.00 48.09  ?  183 DT  H N1    1 
ATOM 5723 C C2    . DT  H 3 14  ? 3.972   16.290  -41.910 1.00 46.21  ?  183 DT  H C2    1 
ATOM 5724 O O2    . DT  H 3 14  ? 3.925   17.249  -42.655 1.00 43.14  ?  183 DT  H O2    1 
ATOM 5725 N N3    . DT  H 3 14  ? 4.015   16.427  -40.552 1.00 48.28  ?  183 DT  H N3    1 
ATOM 5726 C C4    . DT  H 3 14  ? 4.064   15.419  -39.614 1.00 49.71  ?  183 DT  H C4    1 
ATOM 5727 O O4    . DT  H 3 14  ? 4.103   15.644  -38.412 1.00 54.28  ?  183 DT  H O4    1 
ATOM 5728 C C5    . DT  H 3 14  ? 4.067   14.084  -40.145 1.00 48.89  ?  183 DT  H C5    1 
ATOM 5729 C C7    . DT  H 3 14  ? 4.118   12.910  -39.219 1.00 46.30  ?  183 DT  H C7    1 
ATOM 5730 C C6    . DT  H 3 14  ? 4.024   13.935  -41.477 1.00 49.23  ?  183 DT  H C6    1 
ATOM 5731 P P     . DG  H 3 15  ? 6.393   13.932  -47.215 1.00 43.63  ?  184 DG  H P     1 
ATOM 5732 O OP1   . DG  H 3 15  ? 6.356   13.525  -48.629 1.00 45.84  ?  184 DG  H OP1   1 
ATOM 5733 O OP2   . DG  H 3 15  ? 7.206   13.171  -46.248 1.00 44.49  ?  184 DG  H OP2   1 
ATOM 5734 O "O5'" . DG  H 3 15  ? 6.850   15.453  -47.185 1.00 42.66  ?  184 DG  H "O5'" 1 
ATOM 5735 C "C5'" . DG  H 3 15  ? 6.374   16.278  -46.159 1.00 42.85  ?  184 DG  H "C5'" 1 
ATOM 5736 C "C4'" . DG  H 3 15  ? 6.646   17.732  -46.445 1.00 47.34  ?  184 DG  H "C4'" 1 
ATOM 5737 O "O4'" . DG  H 3 15  ? 6.380   18.502  -45.261 1.00 49.92  ?  184 DG  H "O4'" 1 
ATOM 5738 C "C3'" . DG  H 3 15  ? 8.071   18.068  -46.818 1.00 52.11  ?  184 DG  H "C3'" 1 
ATOM 5739 O "O3'" . DG  H 3 15  ? 8.084   19.270  -47.565 1.00 54.05  ?  184 DG  H "O3'" 1 
ATOM 5740 C "C2'" . DG  H 3 15  ? 8.730   18.244  -45.452 1.00 55.36  ?  184 DG  H "C2'" 1 
ATOM 5741 C "C1'" . DG  H 3 15  ? 7.584   18.760  -44.575 1.00 54.66  ?  184 DG  H "C1'" 1 
ATOM 5742 N N9    . DG  H 3 15  ? 7.520   18.105  -43.275 1.00 57.02  ?  184 DG  H N9    1 
ATOM 5743 C C8    . DG  H 3 15  ? 7.671   16.767  -43.015 1.00 57.77  ?  184 DG  H C8    1 
ATOM 5744 N N7    . DG  H 3 15  ? 7.554   16.468  -41.752 1.00 59.04  ?  184 DG  H N7    1 
ATOM 5745 C C5    . DG  H 3 15  ? 7.289   17.683  -41.140 1.00 59.70  ?  184 DG  H C5    1 
ATOM 5746 C C6    . DG  H 3 15  ? 7.063   17.987  -39.780 1.00 61.28  ?  184 DG  H C6    1 
ATOM 5747 O O6    . DG  H 3 15  ? 7.050   17.215  -38.813 1.00 61.57  ?  184 DG  H O6    1 
ATOM 5748 N N1    . DG  H 3 15  ? 6.835   19.343  -39.588 1.00 64.11  ?  184 DG  H N1    1 
ATOM 5749 C C2    . DG  H 3 15  ? 6.826   20.287  -40.585 1.00 65.11  ?  184 DG  H C2    1 
ATOM 5750 N N2    . DG  H 3 15  ? 6.586   21.550  -40.206 1.00 67.82  ?  184 DG  H N2    1 
ATOM 5751 N N3    . DG  H 3 15  ? 7.036   20.016  -41.862 1.00 62.51  ?  184 DG  H N3    1 
ATOM 5752 C C4    . DG  H 3 15  ? 7.260   18.699  -42.065 1.00 59.50  ?  184 DG  H C4    1 
ATOM 5753 P P     . DA  H 3 16  ? 9.462   19.916  -48.069 1.00 66.73  ?  185 DA  H P     1 
ATOM 5754 O OP1   . DA  H 3 16  ? 9.215   20.501  -49.401 1.00 71.80  -1 185 DA  H OP1   1 
ATOM 5755 O OP2   . DA  H 3 16  ? 10.549  18.934  -47.891 1.00 71.70  ?  185 DA  H OP2   1 
ATOM 5756 O "O5'" . DA  H 3 16  ? 9.687   21.110  -47.046 1.00 61.66  ?  185 DA  H "O5'" 1 
ATOM 5757 C "C5'" . DA  H 3 16  ? 8.854   22.247  -47.112 1.00 60.04  ?  185 DA  H "C5'" 1 
ATOM 5758 C "C4'" . DA  H 3 16  ? 9.222   23.244  -46.037 1.00 61.30  ?  185 DA  H "C4'" 1 
ATOM 5759 O "O4'" . DA  H 3 16  ? 9.248   22.565  -44.756 1.00 60.10  ?  185 DA  H "O4'" 1 
ATOM 5760 C "C3'" . DA  H 3 16  ? 10.593  23.885  -46.197 1.00 65.59  ?  185 DA  H "C3'" 1 
ATOM 5761 O "O3'" . DA  H 3 16  ? 10.564  25.213  -45.712 1.00 69.44  ?  185 DA  H "O3'" 1 
ATOM 5762 C "C2'" . DA  H 3 16  ? 11.477  23.000  -45.330 1.00 64.84  ?  185 DA  H "C2'" 1 
ATOM 5763 C "C1'" . DA  H 3 16  ? 10.535  22.655  -44.189 1.00 62.59  ?  185 DA  H "C1'" 1 
ATOM 5764 N N9    . DA  H 3 16  ? 10.852  21.383  -43.549 1.00 62.83  ?  185 DA  H N9    1 
ATOM 5765 C C8    . DA  H 3 16  ? 11.458  20.303  -44.123 1.00 63.75  ?  185 DA  H C8    1 
ATOM 5766 N N7    . DA  H 3 16  ? 11.618  19.292  -43.306 1.00 63.54  ?  185 DA  H N7    1 
ATOM 5767 C C5    . DA  H 3 16  ? 11.072  19.736  -42.118 1.00 62.75  ?  185 DA  H C5    1 
ATOM 5768 C C6    . DA  H 3 16  ? 10.930  19.132  -40.858 1.00 64.02  ?  185 DA  H C6    1 
ATOM 5769 N N6    . DA  H 3 16  ? 11.347  17.895  -40.585 1.00 65.91  ?  185 DA  H N6    1 
ATOM 5770 N N1    . DA  H 3 16  ? 10.341  19.851  -39.884 1.00 64.25  ?  185 DA  H N1    1 
ATOM 5771 C C2    . DA  H 3 16  ? 9.927   21.091  -40.159 1.00 63.49  ?  185 DA  H C2    1 
ATOM 5772 N N3    . DA  H 3 16  ? 10.005  21.764  -41.302 1.00 63.20  ?  185 DA  H N3    1 
ATOM 5773 C C4    . DA  H 3 16  ? 10.595  21.023  -42.250 1.00 62.66  ?  185 DA  H C4    1 
ATOM 5774 P P     . DA  H 3 17  ? 11.868  26.141  -45.827 1.00 75.34  ?  186 DA  H P     1 
ATOM 5775 O OP1   . DA  H 3 17  ? 11.390  27.515  -46.083 1.00 79.00  -1 186 DA  H OP1   1 
ATOM 5776 O OP2   . DA  H 3 17  ? 12.818  25.504  -46.763 1.00 77.41  ?  186 DA  H OP2   1 
ATOM 5777 O "O5'" . DA  H 3 17  ? 12.497  26.094  -44.361 1.00 75.49  ?  186 DA  H "O5'" 1 
ATOM 5778 C "C5'" . DA  H 3 17  ? 11.798  26.670  -43.272 1.00 74.21  ?  186 DA  H "C5'" 1 
ATOM 5779 C "C4'" . DA  H 3 17  ? 12.442  26.290  -41.950 1.00 74.83  ?  186 DA  H "C4'" 1 
ATOM 5780 O "O4'" . DA  H 3 17  ? 12.433  24.853  -41.800 1.00 70.84  ?  186 DA  H "O4'" 1 
ATOM 5781 C "C3'" . DA  H 3 17  ? 13.897  26.736  -41.797 1.00 80.23  ?  186 DA  H "C3'" 1 
ATOM 5782 O "O3'" . DA  H 3 17  ? 14.028  27.617  -40.696 1.00 85.88  ?  186 DA  H "O3'" 1 
ATOM 5783 C "C2'" . DA  H 3 17  ? 14.685  25.442  -41.584 1.00 77.28  ?  186 DA  H "C2'" 1 
ATOM 5784 C "C1'" . DA  H 3 17  ? 13.618  24.441  -41.177 1.00 72.20  ?  186 DA  H "C1'" 1 
ATOM 5785 N N9    . DA  H 3 17  ? 13.921  23.091  -41.620 1.00 72.74  ?  186 DA  H N9    1 
ATOM 5786 C C8    . DA  H 3 17  ? 14.132  22.682  -42.903 1.00 73.96  ?  186 DA  H C8    1 
ATOM 5787 N N7    . DA  H 3 17  ? 14.401  21.406  -43.013 1.00 73.77  ?  186 DA  H N7    1 
ATOM 5788 C C5    . DA  H 3 17  ? 14.371  20.949  -41.710 1.00 73.70  ?  186 DA  H C5    1 
ATOM 5789 C C6    . DA  H 3 17  ? 14.575  19.678  -41.153 1.00 77.33  ?  186 DA  H C6    1 
ATOM 5790 N N6    . DA  H 3 17  ? 14.861  18.597  -41.881 1.00 79.68  ?  186 DA  H N6    1 
ATOM 5791 N N1    . DA  H 3 17  ? 14.472  19.558  -39.815 1.00 77.88  ?  186 DA  H N1    1 
ATOM 5792 C C2    . DA  H 3 17  ? 14.184  20.644  -39.093 1.00 77.47  ?  186 DA  H C2    1 
ATOM 5793 N N3    . DA  H 3 17  ? 13.970  21.891  -39.507 1.00 79.25  ?  186 DA  H N3    1 
ATOM 5794 C C4    . DA  H 3 17  ? 14.080  21.975  -40.838 1.00 74.63  ?  186 DA  H C4    1 
ATOM 5795 P P     . DT  H 3 18  ? 15.434  28.328  -40.389 1.00 92.67  ?  187 DT  H P     1 
ATOM 5796 O OP1   . DT  H 3 18  ? 15.149  29.549  -39.610 1.00 97.20  ?  187 DT  H OP1   1 
ATOM 5797 O OP2   . DT  H 3 18  ? 16.185  28.427  -41.658 1.00 79.72  ?  187 DT  H OP2   1 
ATOM 5798 O "O5'" . DT  H 3 18  ? 16.198  27.283  -39.457 1.00 77.46  ?  187 DT  H "O5'" 1 
ATOM 5799 C "C5'" . DT  H 3 18  ? 15.779  27.121  -38.118 1.00 77.09  ?  187 DT  H "C5'" 1 
ATOM 5800 C "C4'" . DT  H 3 18  ? 16.477  25.951  -37.454 1.00 76.89  ?  187 DT  H "C4'" 1 
ATOM 5801 O "O4'" . DT  H 3 18  ? 16.343  24.766  -38.262 1.00 78.17  ?  187 DT  H "O4'" 1 
ATOM 5802 C "C3'" . DT  H 3 18  ? 17.984  26.121  -37.240 1.00 81.49  ?  187 DT  H "C3'" 1 
ATOM 5803 O "O3'" . DT  H 3 18  ? 18.244  26.346  -35.858 1.00 94.25  ?  187 DT  H "O3'" 1 
ATOM 5804 C "C2'" . DT  H 3 18  ? 18.589  24.794  -37.728 1.00 80.18  ?  187 DT  H "C2'" 1 
ATOM 5805 C "C1'" . DT  H 3 18  ? 17.370  23.902  -37.881 1.00 75.12  ?  187 DT  H "C1'" 1 
ATOM 5806 N N1    . DT  H 3 18  ? 17.543  22.853  -38.914 1.00 88.38  ?  187 DT  H N1    1 
ATOM 5807 C C2    . DT  H 3 18  ? 17.619  21.540  -38.525 1.00 88.92  ?  187 DT  H C2    1 
ATOM 5808 O O2    . DT  H 3 18  ? 17.530  21.183  -37.367 1.00 90.82  ?  187 DT  H O2    1 
ATOM 5809 N N3    . DT  H 3 18  ? 17.794  20.649  -39.545 1.00 88.38  ?  187 DT  H N3    1 
ATOM 5810 C C4    . DT  H 3 18  ? 17.906  20.935  -40.888 1.00 71.47  ?  187 DT  H C4    1 
ATOM 5811 O O4    . DT  H 3 18  ? 18.062  20.062  -41.733 1.00 71.28  ?  187 DT  H O4    1 
ATOM 5812 C C5    . DT  H 3 18  ? 17.825  22.332  -41.228 1.00 72.45  ?  187 DT  H C5    1 
ATOM 5813 C C7    . DT  H 3 18  ? 17.935  22.764  -42.657 1.00 73.36  ?  187 DT  H C7    1 
ATOM 5814 C C6    . DT  H 3 18  ? 17.654  23.214  -40.236 1.00 73.31  ?  187 DT  H C6    1 
ATOM 5815 P P     . DG  H 3 19  ? 19.737  26.267  -35.269 1.00 97.85  ?  188 DG  H P     1 
ATOM 5816 O OP1   . DG  H 3 19  ? 19.748  27.050  -34.015 1.00 101.96 ?  188 DG  H OP1   1 
ATOM 5817 O OP2   . DG  H 3 19  ? 20.694  26.607  -36.342 1.00 99.83  ?  188 DG  H OP2   1 
ATOM 5818 O "O5'" . DG  H 3 19  ? 19.908  24.721  -34.898 1.00 93.66  ?  188 DG  H "O5'" 1 
ATOM 5819 C "C5'" . DG  H 3 19  ? 18.916  24.077  -34.108 1.00 89.12  ?  188 DG  H "C5'" 1 
ATOM 5820 C "C4'" . DG  H 3 19  ? 19.364  22.697  -33.650 1.00 89.68  ?  188 DG  H "C4'" 1 
ATOM 5821 O "O4'" . DG  H 3 19  ? 19.410  21.785  -34.778 1.00 87.96  ?  188 DG  H "O4'" 1 
ATOM 5822 C "C3'" . DG  H 3 19  ? 20.745  22.640  -33.014 1.00 96.42  ?  188 DG  H "C3'" 1 
ATOM 5823 O "O3'" . DG  H 3 19  ? 20.774  21.604  -32.039 1.00 98.19  ?  188 DG  H "O3'" 1 
ATOM 5824 C "C2'" . DG  H 3 19  ? 21.638  22.309  -34.207 1.00 97.98  ?  188 DG  H "C2'" 1 
ATOM 5825 C "C1'" . DG  H 3 19  ? 20.743  21.374  -35.013 1.00 94.35  ?  188 DG  H "C1'" 1 
ATOM 5826 N N9    . DG  H 3 19  ? 20.991  21.399  -36.455 1.00 97.31  ?  188 DG  H N9    1 
ATOM 5827 C C8    . DG  H 3 19  ? 21.029  22.505  -37.266 1.00 98.70  ?  188 DG  H C8    1 
ATOM 5828 N N7    . DG  H 3 19  ? 21.271  22.224  -38.516 1.00 98.56  ?  188 DG  H N7    1 
ATOM 5829 C C5    . DG  H 3 19  ? 21.407  20.843  -38.536 1.00 97.44  ?  188 DG  H C5    1 
ATOM 5830 C C6    . DG  H 3 19  ? 21.678  19.971  -39.616 1.00 96.81  ?  188 DG  H C6    1 
ATOM 5831 O O6    . DG  H 3 19  ? 21.857  20.255  -40.808 1.00 95.72  ?  188 DG  H O6    1 
ATOM 5832 N N1    . DG  H 3 19  ? 21.734  18.645  -39.204 1.00 97.72  ?  188 DG  H N1    1 
ATOM 5833 C C2    . DG  H 3 19  ? 21.552  18.216  -37.913 1.00 98.55  ?  188 DG  H C2    1 
ATOM 5834 N N2    . DG  H 3 19  ? 21.643  16.894  -37.710 1.00 99.86  ?  188 DG  H N2    1 
ATOM 5835 N N3    . DG  H 3 19  ? 21.297  19.022  -36.891 1.00 98.36  ?  188 DG  H N3    1 
ATOM 5836 C C4    . DG  H 3 19  ? 21.238  20.319  -37.276 1.00 97.64  ?  188 DG  H C4    1 
ATOM 5837 P P     . DG  H 3 20  ? 21.928  21.560  -30.924 1.00 105.30 ?  189 DG  H P     1 
ATOM 5838 O OP1   . DG  H 3 20  ? 21.596  20.469  -29.983 1.00 104.79 ?  189 DG  H OP1   1 
ATOM 5839 O OP2   . DG  H 3 20  ? 22.111  22.939  -30.425 1.00 108.23 ?  189 DG  H OP2   1 
ATOM 5840 O "O5'" . DG  H 3 20  ? 23.240  21.158  -31.736 1.00 111.38 ?  189 DG  H "O5'" 1 
ATOM 5841 C "C5'" . DG  H 3 20  ? 24.156  20.210  -31.203 1.00 117.77 ?  189 DG  H "C5'" 1 
ATOM 5842 C "C4'" . DG  H 3 20  ? 23.882  18.825  -31.758 1.00 116.93 ?  189 DG  H "C4'" 1 
ATOM 5843 O "O4'" . DG  H 3 20  ? 23.207  18.953  -33.024 1.00 113.21 ?  189 DG  H "O4'" 1 
ATOM 5844 C "C3'" . DG  H 3 20  ? 25.127  17.972  -31.977 1.00 120.89 ?  189 DG  H "C3'" 1 
ATOM 5845 O "O3'" . DG  H 3 20  ? 25.152  16.899  -31.041 1.00 121.51 ?  189 DG  H "O3'" 1 
ATOM 5846 C "C2'" . DG  H 3 20  ? 25.021  17.460  -33.420 1.00 119.42 ?  189 DG  H "C2'" 1 
ATOM 5847 C "C1'" . DG  H 3 20  ? 23.902  18.290  -34.050 1.00 115.12 ?  189 DG  H "C1'" 1 
ATOM 5848 N N9    . DG  H 3 20  ? 24.377  19.309  -34.980 1.00 118.24 ?  189 DG  H N9    1 
ATOM 5849 C C8    . DG  H 3 20  ? 24.610  20.631  -34.697 1.00 121.04 ?  189 DG  H C8    1 
ATOM 5850 N N7    . DG  H 3 20  ? 25.009  21.321  -35.727 1.00 122.37 ?  189 DG  H N7    1 
ATOM 5851 C C5    . DG  H 3 20  ? 25.028  20.401  -36.763 1.00 120.30 ?  189 DG  H C5    1 
ATOM 5852 C C6    . DG  H 3 20  ? 25.374  20.572  -38.118 1.00 121.34 ?  189 DG  H C6    1 
ATOM 5853 O O6    . DG  H 3 20  ? 25.746  21.607  -38.686 1.00 124.38 ?  189 DG  H O6    1 
ATOM 5854 N N1    . DG  H 3 20  ? 25.260  19.385  -38.833 1.00 118.89 ?  189 DG  H N1    1 
ATOM 5855 C C2    . DG  H 3 20  ? 24.855  18.185  -38.300 1.00 115.72 ?  189 DG  H C2    1 
ATOM 5856 N N2    . DG  H 3 20  ? 24.802  17.146  -39.146 1.00 113.55 ?  189 DG  H N2    1 
ATOM 5857 N N3    . DG  H 3 20  ? 24.526  18.011  -37.029 1.00 115.91 ?  189 DG  H N3    1 
ATOM 5858 C C4    . DG  H 3 20  ? 24.634  19.158  -36.322 1.00 118.02 ?  189 DG  H C4    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . ASP A 4   ? 0.8710 0.7873 1.0233 0.0027  -0.1994 -0.1950 2   ASP B N     
2    C CA    . ASP A 4   ? 0.8925 0.7480 1.0628 -0.0144 -0.2048 -0.1725 2   ASP B CA    
3    C C     . ASP A 4   ? 0.9078 0.7047 1.0938 -0.0106 -0.2090 -0.1537 2   ASP B C     
4    O O     . ASP A 4   ? 0.9309 0.7238 1.1433 0.0016  -0.2152 -0.1784 2   ASP B O     
5    C CB    . ASP A 4   ? 0.9311 0.7822 1.1476 -0.0235 -0.2156 -0.2086 2   ASP B CB    
6    C CG    . ASP A 4   ? 0.9500 0.7536 1.1835 -0.0429 -0.2135 -0.1782 2   ASP B CG    
7    O OD1   . ASP A 4   ? 0.9578 0.7086 1.1858 -0.0452 -0.2090 -0.1389 2   ASP B OD1   
8    O OD2   . ASP A 4   ? 0.9629 0.7862 1.2160 -0.0539 -0.2160 -0.1939 2   ASP B OD2   
9    N N     . SER A 5   ? 0.8883 0.6435 1.0568 -0.0184 -0.2062 -0.1109 3   SER B N     
10   C CA    . SER A 5   ? 0.8805 0.5858 1.0531 -0.0104 -0.2123 -0.0881 3   SER B CA    
11   C C     . SER A 5   ? 0.8685 0.5325 1.0220 -0.0190 -0.2083 -0.0453 3   SER B C     
12   O O     . SER A 5   ? 0.8420 0.5225 0.9711 -0.0302 -0.1987 -0.0305 3   SER B O     
13   C CB    . SER A 5   ? 0.8636 0.5893 1.0143 0.0032  -0.2122 -0.0823 3   SER B CB    
14   O OG    . SER A 5   ? 0.8341 0.5863 0.9479 -0.0017 -0.2019 -0.0604 3   SER B OG    
15   N N     . PRO A 6   ? 0.9453 0.5633 1.1066 -0.0112 -0.2126 -0.0227 4   PRO B N     
16   C CA    . PRO A 6   ? 0.9967 0.5934 1.1307 -0.0148 -0.2005 0.0205  4   PRO B CA    
17   C C     . PRO A 6   ? 0.9659 0.5734 1.0464 -0.0131 -0.1992 0.0421  4   PRO B C     
18   O O     . PRO A 6   ? 0.9996 0.6026 1.0557 -0.0188 -0.1859 0.0697  4   PRO B O     
19   C CB    . PRO A 6   ? 1.0917 0.6633 1.2324 0.0008  -0.2014 0.0380  4   PRO B CB    
20   C CG    . PRO A 6   ? 1.1096 0.6841 1.3018 0.0047  -0.2103 0.0028  4   PRO B CG    
21   C CD    . PRO A 6   ? 1.0232 0.6312 1.2158 0.0031  -0.2191 -0.0343 4   PRO B CD    
22   N N     . GLU A 7   ? 0.9286 0.5584 0.9956 -0.0045 -0.2084 0.0286  5   GLU B N     
23   C CA    . GLU A 7   ? 0.9058 0.5555 0.9344 -0.0031 -0.2048 0.0436  5   GLU B CA    
24   C C     . GLU A 7   ? 0.8469 0.5332 0.8698 -0.0189 -0.1905 0.0399  5   GLU B C     
25   O O     . GLU A 7   ? 0.8414 0.5316 0.8382 -0.0231 -0.1829 0.0594  5   GLU B O     
26   C CB    . GLU A 7   ? 0.9239 0.5925 0.9566 0.0111  -0.2154 0.0297  5   GLU B CB    
27   C CG    . GLU A 7   ? 0.9751 0.6178 1.0214 0.0285  -0.2318 0.0267  5   GLU B CG    
28   C CD    . GLU A 7   ? 0.9978 0.6441 1.0877 0.0306  -0.2356 -0.0021 5   GLU B CD    
29   O OE1   . GLU A 7   ? 0.9800 0.6648 1.0830 0.0224  -0.2249 -0.0234 5   GLU B OE1   
30   O OE2   . GLU A 7   ? 1.0375 0.6677 1.1455 0.0406  -0.2426 -0.0037 5   GLU B OE2   
31   N N     . ILE A 8   ? 0.7944 0.5112 0.8409 -0.0248 -0.1876 0.0140  6   ILE B N     
32   C CA    . ILE A 8   ? 0.7607 0.5167 0.8007 -0.0359 -0.1767 0.0113  6   ILE B CA    
33   C C     . ILE A 8   ? 0.7841 0.5226 0.8278 -0.0503 -0.1709 0.0232  6   ILE B C     
34   O O     . ILE A 8   ? 0.7823 0.5393 0.8112 -0.0582 -0.1617 0.0365  6   ILE B O     
35   C CB    . ILE A 8   ? 0.7532 0.5529 0.8112 -0.0329 -0.1771 -0.0212 6   ILE B CB    
36   C CG1   . ILE A 8   ? 0.7291 0.5538 0.7857 -0.0193 -0.1752 -0.0256 6   ILE B CG1   
37   C CG2   . ILE A 8   ? 0.7535 0.5962 0.8036 -0.0408 -0.1696 -0.0242 6   ILE B CG2   
38   C CD1   . ILE A 8   ? 0.7191 0.5959 0.7835 -0.0119 -0.1702 -0.0521 6   ILE B CD1   
39   N N     . ARG A 9   ? 0.7601 0.4628 0.8322 -0.0537 -0.1745 0.0200  7   ARG B N     
40   C CA    . ARG A 9   ? 0.7339 0.4179 0.8235 -0.0683 -0.1653 0.0341  7   ARG B CA    
41   C C     . ARG A 9   ? 0.7328 0.3961 0.7849 -0.0673 -0.1541 0.0749  7   ARG B C     
42   O O     . ARG A 9   ? 0.7497 0.4253 0.7977 -0.0783 -0.1421 0.0871  7   ARG B O     
43   C CB    . ARG A 9   ? 0.7597 0.4049 0.9004 -0.0710 -0.1690 0.0263  7   ARG B CB    
44   C CG    . ARG A 9   ? 0.5891 0.2536 0.7680 -0.0675 -0.1824 -0.0207 7   ARG B CG    
45   C CD    . ARG A 9   ? 0.6271 0.2589 0.8628 -0.0677 -0.1817 -0.0278 7   ARG B CD    
46   N NE    . ARG A 9   ? 0.7407 0.3839 1.0029 -0.0562 -0.1948 -0.0676 7   ARG B NE    
47   C CZ    . ARG A 9   ? 0.7905 0.4098 1.0822 -0.0462 -0.1941 -0.0656 7   ARG B CZ    
48   N NH1   . ARG A 9   ? 0.8312 0.4142 1.1256 -0.0458 -0.1811 -0.0244 7   ARG B NH1   
49   N NH2   . ARG A 9   ? 0.8003 0.4356 1.1175 -0.0351 -0.2050 -0.1041 7   ARG B NH2   
50   N N     . GLU A 10  ? 0.7286 0.3644 0.7534 -0.0518 -0.1591 0.0936  8   GLU B N     
51   C CA    . GLU A 10  ? 0.7498 0.3886 0.7314 -0.0435 -0.1463 0.1213  8   GLU B CA    
52   C C     . GLU A 10  ? 0.7293 0.3962 0.6860 -0.0456 -0.1477 0.1188  8   GLU B C     
53   O O     . GLU A 10  ? 0.7284 0.4052 0.6592 -0.0433 -0.1347 0.1343  8   GLU B O     
54   C CB    . GLU A 10  ? 0.7842 0.4089 0.7425 -0.0215 -0.1522 0.1303  8   GLU B CB    
55   N N     . LEU A 11  ? 0.7139 0.4099 0.6831 -0.0466 -0.1557 0.0952  9   LEU B N     
56   C CA    . LEU A 11  ? 0.6652 0.3969 0.6237 -0.0473 -0.1513 0.0937  9   LEU B CA    
57   C C     . LEU A 11  ? 0.6911 0.4473 0.6587 -0.0622 -0.1392 0.0961  9   LEU B C     
58   O O     . LEU A 11  ? 0.6615 0.4307 0.6165 -0.0640 -0.1306 0.1086  9   LEU B O     
59   C CB    . LEU A 11  ? 0.5956 0.3546 0.5696 -0.0408 -0.1580 0.0740  9   LEU B CB    
60   C CG    . LEU A 11  ? 0.5521 0.3273 0.5242 -0.0319 -0.1591 0.0759  9   LEU B CG    
61   C CD1   . LEU A 11  ? 0.5778 0.3234 0.5313 -0.0197 -0.1698 0.0819  9   LEU B CD1   
62   C CD2   . LEU A 11  ? 0.5295 0.3284 0.5265 -0.0256 -0.1613 0.0598  9   LEU B CD2   
63   N N     . GLU A 12  ? 0.7463 0.5118 0.7410 -0.0714 -0.1403 0.0803  10  GLU B N     
64   C CA    . GLU A 12  ? 0.7708 0.5622 0.7810 -0.0844 -0.1329 0.0783  10  GLU B CA    
65   C C     . GLU A 12  ? 0.8101 0.5767 0.8185 -0.0928 -0.1197 0.1026  10  GLU B C     
66   O O     . GLU A 12  ? 0.8031 0.5905 0.8088 -0.0984 -0.1102 0.1121  10  GLU B O     
67   C CB    . GLU A 12  ? 0.8015 0.6079 0.8476 -0.0903 -0.1413 0.0483  10  GLU B CB    
68   C CG    . GLU A 12  ? 0.8286 0.6720 0.8717 -0.0793 -0.1507 0.0230  10  GLU B CG    
69   C CD    . GLU A 12  ? 0.9043 0.7762 0.9792 -0.0821 -0.1608 -0.0142 10  GLU B CD    
70   O OE1   . GLU A 12  ? 0.9387 0.7947 1.0363 -0.0788 -0.1696 -0.0383 10  GLU B OE1   
71   O OE2   . GLU A 12  ? 0.9270 0.8395 1.0072 -0.0858 -0.1618 -0.0226 10  GLU B OE2   
72   N N     . LYS A 13  ? 0.8069 0.5306 0.8195 -0.0922 -0.1169 0.1155  11  LYS B N     
73   C CA    . LYS A 13  ? 0.8678 0.5701 0.8792 -0.0978 -0.0987 0.1441  11  LYS B CA    
74   C C     . LYS A 13  ? 0.8435 0.5613 0.8106 -0.0864 -0.0878 0.1586  11  LYS B C     
75   O O     . LYS A 13  ? 0.8660 0.5974 0.8356 -0.0923 -0.0711 0.1692  11  LYS B O     
76   C CB    . LYS A 13  ? 0.9563 0.6260 0.9727 -0.0880 -0.0902 0.1556  11  LYS B CB    
77   C CG    . LYS A 13  ? 0.6161 0.2751 0.6461 -0.0921 -0.0623 0.1787  11  LYS B CG    
78   C CD    . LYS A 13  ? 0.6673 0.2919 0.6875 -0.0774 -0.0517 0.1991  11  LYS B CD    
79   C CE    . LYS A 13  ? 0.7124 0.3238 0.7256 -0.0775 -0.0209 0.2290  11  LYS B CE    
80   N NZ    . LYS A 13  ? 0.6995 0.3336 0.6740 -0.0748 -0.0092 0.2381  11  LYS B NZ    
81   N N     . PHE A 14  ? 0.7899 0.5070 0.7240 -0.0698 -0.0981 0.1551  12  PHE B N     
82   C CA    . PHE A 14  ? 0.7030 0.4340 0.6050 -0.0585 -0.0923 0.1609  12  PHE B CA    
83   C C     . PHE A 14  ? 0.6437 0.4052 0.5585 -0.0682 -0.0911 0.1554  12  PHE B C     
84   O O     . PHE A 14  ? 0.6036 0.3764 0.5101 -0.0675 -0.0781 0.1636  12  PHE B O     
85   C CB    . PHE A 14  ? 0.6479 0.3724 0.5264 -0.0403 -0.1089 0.1523  12  PHE B CB    
86   C CG    . PHE A 14  ? 0.6376 0.3712 0.4887 -0.0282 -0.1097 0.1532  12  PHE B CG    
87   C CD1   . PHE A 14  ? 0.6924 0.4174 0.5074 -0.0156 -0.0997 0.1693  12  PHE B CD1   
88   C CD2   . PHE A 14  ? 0.6022 0.3523 0.4663 -0.0281 -0.1207 0.1397  12  PHE B CD2   
89   C CE1   . PHE A 14  ? 0.7079 0.4384 0.4923 -0.0026 -0.1061 0.1663  12  PHE B CE1   
90   C CE2   . PHE A 14  ? 0.6307 0.3891 0.4812 -0.0166 -0.1234 0.1340  12  PHE B CE2   
91   C CZ    . PHE A 14  ? 0.6793 0.4287 0.4879 -0.0034 -0.1180 0.1436  12  PHE B CZ    
92   N N     . ALA A 15  ? 0.6182 0.3974 0.5542 -0.0742 -0.1026 0.1420  13  ALA B N     
93   C CA    . ALA A 15  ? 0.5798 0.3971 0.5311 -0.0783 -0.0985 0.1391  13  ALA B CA    
94   C C     . ALA A 15  ? 0.6178 0.4485 0.5863 -0.0914 -0.0866 0.1458  13  ALA B C     
95   O O     . ALA A 15  ? 0.6332 0.4847 0.6065 -0.0920 -0.0784 0.1525  13  ALA B O     
96   C CB    . ALA A 15  ? 0.5401 0.3844 0.5079 -0.0769 -0.1077 0.1247  13  ALA B CB    
97   N N     . ASN A 16  ? 0.6257 0.4458 0.6135 -0.1019 -0.0859 0.1422  14  ASN B N     
98   C CA    . ASN A 16  ? 0.6109 0.4436 0.6279 -0.1154 -0.0746 0.1463  14  ASN B CA    
99   C C     . ASN A 16  ? 0.5831 0.3966 0.5852 -0.1150 -0.0545 0.1705  14  ASN B C     
100  O O     . ASN A 16  ? 0.5749 0.4097 0.5902 -0.1199 -0.0426 0.1765  14  ASN B O     
101  C CB    . ASN A 16  ? 0.6648 0.4892 0.7211 -0.1271 -0.0796 0.1321  14  ASN B CB    
102  C CG    . ASN A 16  ? 0.6897 0.5411 0.7572 -0.1240 -0.0995 0.1022  14  ASN B CG    
103  O OD1   . ASN A 16  ? 0.6813 0.5619 0.7280 -0.1140 -0.1061 0.0983  14  ASN B OD1   
104  N ND2   . ASN A 16  ? 0.7206 0.5639 0.8248 -0.1312 -0.1075 0.0812  14  ASN B ND2   
105  N N     . GLU A 17  ? 0.6011 0.3842 0.5746 -0.1027 -0.0478 0.1794  15  GLU B N     
106  C CA    . GLU A 17  ? 0.6381 0.4132 0.5870 -0.0932 -0.0250 0.1973  15  GLU B CA    
107  C C     . GLU A 17  ? 0.6137 0.4057 0.5349 -0.0829 -0.0257 0.1966  15  GLU B C     
108  O O     . GLU A 17  ? 0.6085 0.4079 0.5226 -0.0817 -0.0077 0.2084  15  GLU B O     
109  C CB    . GLU A 17  ? 0.7208 0.4632 0.6394 -0.0780 -0.0204 0.2098  15  GLU B CB    
110  C CG    . GLU A 17  ? 0.8145 0.5335 0.7643 -0.0868 -0.0090 0.2188  15  GLU B CG    
111  C CD    . GLU A 17  ? 0.9316 0.6182 0.8446 -0.0680 -0.0001 0.2391  15  GLU B CD    
112  O OE1   . GLU A 17  ? 0.9466 0.6277 0.8328 -0.0518 -0.0179 0.2343  15  GLU B OE1   
113  O OE2   . GLU A 17  ? 1.0048 0.6728 0.9150 -0.0699 0.0223  0.2604  15  GLU B OE2   
114  N N     . PHE A 18  ? 0.5953 0.3924 0.5061 -0.0757 -0.0457 0.1830  16  PHE B N     
115  C CA    . PHE A 18  ? 0.5754 0.3854 0.4746 -0.0677 -0.0488 0.1805  16  PHE B CA    
116  C C     . PHE A 18  ? 0.5738 0.4158 0.5082 -0.0779 -0.0399 0.1796  16  PHE B C     
117  O O     . PHE A 18  ? 0.6074 0.4618 0.5407 -0.0713 -0.0309 0.1790  16  PHE B O     
118  C CB    . PHE A 18  ? 0.5500 0.3606 0.4488 -0.0579 -0.0691 0.1636  16  PHE B CB    
119  C CG    . PHE A 18  ? 0.5544 0.3837 0.4653 -0.0491 -0.0710 0.1523  16  PHE B CG    
120  C CD1   . PHE A 18  ? 0.5964 0.4218 0.4823 -0.0336 -0.0696 0.1452  16  PHE B CD1   
121  C CD2   . PHE A 18  ? 0.5233 0.3756 0.4734 -0.0538 -0.0741 0.1483  16  PHE B CD2   
122  C CE1   . PHE A 18  ? 0.5873 0.4291 0.4970 -0.0255 -0.0728 0.1286  16  PHE B CE1   
123  C CE2   . PHE A 18  ? 0.5115 0.3772 0.4870 -0.0461 -0.0742 0.1401  16  PHE B CE2   
124  C CZ    . PHE A 18  ? 0.5366 0.3956 0.4967 -0.0331 -0.0745 0.1271  16  PHE B CZ    
125  N N     . LYS A 19  ? 0.5442 0.4027 0.5109 -0.0912 -0.0441 0.1770  17  LYS B N     
126  C CA    . LYS A 19  ? 0.5137 0.4073 0.5138 -0.0975 -0.0394 0.1771  17  LYS B CA    
127  C C     . LYS A 19  ? 0.5266 0.4243 0.5393 -0.1047 -0.0193 0.1873  17  LYS B C     
128  O O     . LYS A 19  ? 0.5519 0.4693 0.5774 -0.1014 -0.0101 0.1893  17  LYS B O     
129  C CB    . LYS A 19  ? 0.4899 0.4073 0.5154 -0.1052 -0.0522 0.1685  17  LYS B CB    
130  C CG    . LYS A 19  ? 0.4413 0.3999 0.5002 -0.1089 -0.0508 0.1696  17  LYS B CG    
131  C CD    . LYS A 19  ? 0.3522 0.3441 0.4229 -0.1071 -0.0675 0.1595  17  LYS B CD    
132  N N     . VAL A 20  ? 0.5291 0.4085 0.5461 -0.1143 -0.0100 0.1950  18  VAL B N     
133  C CA    . VAL A 20  ? 0.5595 0.4453 0.5973 -0.1209 0.0141  0.2054  18  VAL B CA    
134  C C     . VAL A 20  ? 0.5962 0.4741 0.5963 -0.1071 0.0324  0.2182  18  VAL B C     
135  O O     . VAL A 20  ? 0.6123 0.5120 0.6284 -0.1070 0.0480  0.2218  18  VAL B O     
136  C CB    . VAL A 20  ? 0.5765 0.4431 0.6361 -0.1312 0.0232  0.2084  18  VAL B CB    
137  C CG1   . VAL A 20  ? 0.5537 0.4430 0.6738 -0.1499 0.0086  0.1949  18  VAL B CG1   
138  C CG2   . VAL A 20  ? 0.6081 0.4391 0.6323 -0.1219 0.0163  0.2099  18  VAL B CG2   
139  N N     . ARG A 21  ? 0.6220 0.4725 0.5722 -0.0930 0.0298  0.2235  19  ARG B N     
140  C CA    . ARG A 21  ? 0.6581 0.5077 0.5644 -0.0741 0.0439  0.2298  19  ARG B CA    
141  C C     . ARG A 21  ? 0.6304 0.5036 0.5408 -0.0639 0.0349  0.2077  19  ARG B C     
142  O O     . ARG A 21  ? 0.6279 0.5143 0.5234 -0.0514 0.0501  0.2051  19  ARG B O     
143  C CB    . ARG A 21  ? 0.7079 0.5287 0.5588 -0.0569 0.0363  0.2364  19  ARG B CB    
144  C CG    . ARG A 21  ? 0.7951 0.5896 0.6444 -0.0620 0.0500  0.2560  19  ARG B CG    
145  C CD    . ARG A 21  ? 0.9122 0.6803 0.7051 -0.0414 0.0410  0.2646  19  ARG B CD    
146  N NE    . ARG A 21  ? 1.0125 0.7934 0.7474 -0.0155 0.0491  0.2745  19  ARG B NE    
147  C CZ    . ARG A 21  ? 1.1254 0.8970 0.8050 0.0090  0.0389  0.2787  19  ARG B CZ    
148  N NH1   . ARG A 21  ? 1.1495 0.8991 0.8341 0.0064  0.0200  0.2811  19  ARG B NH1   
149  N NH2   . ARG A 21  ? 1.2001 0.9889 0.8204 0.0385  0.0461  0.2776  19  ARG B NH2   
150  N N     . ARG A 22  ? 0.6076 0.4876 0.5425 -0.0675 0.0126  0.1923  20  ARG B N     
151  C CA    . ARG A 22  ? 0.5925 0.4929 0.5494 -0.0594 0.0065  0.1761  20  ARG B CA    
152  C C     . ARG A 22  ? 0.5400 0.4683 0.5388 -0.0675 0.0217  0.1807  20  ARG B C     
153  O O     . ARG A 22  ? 0.5284 0.4711 0.5383 -0.0573 0.0295  0.1710  20  ARG B O     
154  C CB    . ARG A 22  ? 0.5764 0.4784 0.5556 -0.0612 -0.0154 0.1677  20  ARG B CB    
155  C CG    . ARG A 22  ? 0.6143 0.5338 0.6302 -0.0533 -0.0196 0.1567  20  ARG B CG    
156  C CD    . ARG A 22  ? 0.6337 0.5658 0.6843 -0.0588 -0.0309 0.1630  20  ARG B CD    
157  N NE    . ARG A 22  ? 0.6567 0.6167 0.7388 -0.0673 -0.0247 0.1764  20  ARG B NE    
158  C CZ    . ARG A 22  ? 0.6790 0.6571 0.7739 -0.0726 -0.0328 0.1860  20  ARG B CZ    
159  N NH1   . ARG A 22  ? 0.7391 0.7091 0.8196 -0.0716 -0.0440 0.1844  20  ARG B NH1   
160  N NH2   . ARG A 22  ? 0.6747 0.6837 0.7967 -0.0766 -0.0304 0.1952  20  ARG B NH2   
161  N N     . ILE A 23  ? 0.5325 0.4711 0.5604 -0.0844 0.0242  0.1916  21  ILE B N     
162  C CA    . ILE A 23  ? 0.5254 0.4948 0.5995 -0.0915 0.0351  0.1947  21  ILE B CA    
163  C C     . ILE A 23  ? 0.5760 0.5476 0.6448 -0.0903 0.0637  0.2023  21  ILE B C     
164  O O     . ILE A 23  ? 0.5897 0.5838 0.6828 -0.0852 0.0761  0.1982  21  ILE B O     
165  C CB    . ILE A 23  ? 0.4851 0.4707 0.5943 -0.1074 0.0246  0.1974  21  ILE B CB    
166  C CG1   . ILE A 23  ? 0.3683 0.3602 0.4768 -0.1035 0.0000  0.1918  21  ILE B CG1   
167  C CG2   . ILE A 23  ? 0.4796 0.5007 0.6402 -0.1133 0.0332  0.1991  21  ILE B CG2   
168  C CD1   . ILE A 23  ? 0.3564 0.3702 0.4889 -0.1136 -0.0141 0.1881  21  ILE B CD1   
169  N N     . LYS A 24  ? 0.5778 0.5273 0.6185 -0.0938 0.0770  0.2159  22  LYS B N     
170  C CA    . LYS A 24  ? 0.5698 0.5225 0.5999 -0.0897 0.1100  0.2303  22  LYS B CA    
171  C C     . LYS A 24  ? 0.5432 0.5027 0.5328 -0.0656 0.1173  0.2182  22  LYS B C     
172  O O     . LYS A 24  ? 0.7211 0.7000 0.7141 -0.0589 0.1441  0.2217  22  LYS B O     
173  C CB    . LYS A 24  ? 0.6055 0.5291 0.6099 -0.0936 0.1231  0.2538  22  LYS B CB    
174  C CG    . LYS A 24  ? 0.6978 0.6258 0.6934 -0.0890 0.1616  0.2755  22  LYS B CG    
175  C CD    . LYS A 24  ? 0.7748 0.6793 0.6954 -0.0679 0.1695  0.2909  22  LYS B CD    
176  C CE    . LYS A 24  ? 0.7781 0.6480 0.6886 -0.0742 0.1460  0.2901  22  LYS B CE    
177  N NZ    . LYS A 24  ? 0.8119 0.6628 0.6478 -0.0496 0.1427  0.3009  22  LYS B NZ    
178  N N     . LEU A 25  ? 0.5496 0.5363 0.4233 -0.0894 0.1364  0.1565  23  LEU B N     
179  C CA    . LEU A 25  ? 0.5860 0.5760 0.4137 -0.0839 0.1413  0.1511  23  LEU B CA    
180  C C     . LEU A 25  ? 0.5763 0.5846 0.4149 -0.0793 0.1424  0.1288  23  LEU B C     
181  O O     . LEU A 25  ? 0.6018 0.6101 0.4047 -0.0746 0.1470  0.1173  23  LEU B O     
182  C CB    . LEU A 25  ? 0.6215 0.5790 0.4101 -0.0846 0.1272  0.1483  23  LEU B CB    
183  C CG    . LEU A 25  ? 0.7001 0.6399 0.4555 -0.0839 0.1269  0.1729  23  LEU B CG    
184  C CD1   . LEU A 25  ? 0.7256 0.6349 0.4483 -0.0839 0.1060  0.1697  23  LEU B CD1   
185  C CD2   . LEU A 25  ? 0.7598 0.7178 0.4737 -0.0770 0.1416  0.1841  23  LEU B CD2   
186  N N     . GLY A 26  ? 0.5643 0.5863 0.4481 -0.0794 0.1376  0.1216  24  GLY B N     
187  C CA    . GLY A 26  ? 0.5367 0.5769 0.4319 -0.0733 0.1391  0.1047  24  GLY B CA    
188  C C     . GLY A 26  ? 0.5224 0.5420 0.4073 -0.0716 0.1314  0.0848  24  GLY B C     
189  O O     . GLY A 26  ? 0.5328 0.5581 0.4129 -0.0659 0.1375  0.0703  24  GLY B O     
190  N N     . TYR A 27  ? 0.4735 0.4685 0.3572 -0.0765 0.1195  0.0841  25  TYR B N     
191  C CA    . TYR A 27  ? 0.4750 0.4508 0.3540 -0.0771 0.1134  0.0675  25  TYR B CA    
192  C C     . TYR A 27  ? 0.4555 0.4400 0.3776 -0.0733 0.1037  0.0632  25  TYR B C     
193  O O     . TYR A 27  ? 0.4522 0.4425 0.3964 -0.0742 0.0956  0.0726  25  TYR B O     
194  C CB    . TYR A 27  ? 0.5091 0.4546 0.3545 -0.0852 0.1047  0.0705  25  TYR B CB    
195  C CG    . TYR A 27  ? 0.5790 0.5129 0.3651 -0.0874 0.1095  0.0693  25  TYR B CG    
196  C CD1   . TYR A 27  ? 0.5970 0.5179 0.3515 -0.0893 0.1126  0.0487  25  TYR B CD1   
197  C CD2   . TYR A 27  ? 0.6292 0.5660 0.3889 -0.0858 0.1113  0.0877  25  TYR B CD2   
198  C CE1   . TYR A 27  ? 0.6519 0.5656 0.3452 -0.0874 0.1123  0.0424  25  TYR B CE1   
199  C CE2   . TYR A 27  ? 0.6728 0.6040 0.3734 -0.0827 0.1128  0.0864  25  TYR B CE2   
200  C CZ    . TYR A 27  ? 0.6860 0.6070 0.3520 -0.0824 0.1110  0.0620  25  TYR B CZ    
201  O OH    . TYR A 27  ? 0.7406 0.6600 0.3455 -0.0753 0.1079  0.0553  25  TYR B OH    
202  N N     . THR A 28  ? 0.4408 0.4243 0.3717 -0.0684 0.1057  0.0489  26  THR B N     
203  C CA    . THR A 28  ? 0.3946 0.3833 0.3558 -0.0632 0.0960  0.0451  26  THR B CA    
204  C C     . THR A 28  ? 0.4239 0.3900 0.3854 -0.0667 0.0896  0.0407  26  THR B C     
205  O O     . THR A 28  ? 0.4420 0.3862 0.3786 -0.0751 0.0935  0.0374  26  THR B O     
206  C CB    . THR A 28  ? 0.3422 0.3401 0.3144 -0.0542 0.1023  0.0353  26  THR B CB    
207  O OG1   . THR A 28  ? 0.3376 0.3127 0.2980 -0.0546 0.1134  0.0229  26  THR B OG1   
208  C CG2   . THR A 28  ? 0.3881 0.4056 0.3577 -0.0522 0.1115  0.0382  26  THR B CG2   
209  N N     . GLN A 29  ? 0.4200 0.3924 0.4053 -0.0618 0.0793  0.0405  27  GLN B N     
210  C CA    . GLN A 29  ? 0.4498 0.4071 0.4430 -0.0630 0.0725  0.0375  27  GLN B CA    
211  C C     . GLN A 29  ? 0.4697 0.4121 0.4623 -0.0644 0.0820  0.0259  27  GLN B C     
212  O O     . GLN A 29  ? 0.4807 0.4055 0.4725 -0.0728 0.0783  0.0232  27  GLN B O     
213  C CB    . GLN A 29  ? 0.4236 0.3915 0.4358 -0.0556 0.0645  0.0363  27  GLN B CB    
214  C CG    . GLN A 29  ? 0.4079 0.3763 0.4212 -0.0599 0.0564  0.0435  27  GLN B CG    
215  C CD    . GLN A 29  ? 0.3882 0.3601 0.4126 -0.0531 0.0569  0.0375  27  GLN B CD    
216  O OE1   . GLN A 29  ? 0.3942 0.3696 0.4271 -0.0428 0.0640  0.0308  27  GLN B OE1   
217  N NE2   . GLN A 29  ? 0.3767 0.3457 0.4025 -0.0581 0.0503  0.0412  27  GLN B NE2   
218  N N     . THR A 30  ? 0.4610 0.4079 0.4575 -0.0575 0.0935  0.0183  28  THR B N     
219  C CA    . THR A 30  ? 0.5214 0.4507 0.5218 -0.0607 0.1063  0.0052  28  THR B CA    
220  C C     . THR A 30  ? 0.5823 0.4922 0.5481 -0.0784 0.1160  -0.0018 28  THR B C     
221  O O     . THR A 30  ? 0.6610 0.5580 0.6305 -0.0825 0.1073  -0.0171 28  THR B O     
222  C CB    . THR A 30  ? 0.5414 0.4743 0.5521 -0.0486 0.1180  0.0004  28  THR B CB    
223  O OG1   . THR A 30  ? 0.5390 0.4866 0.5662 -0.0360 0.1082  0.0078  28  THR B OG1   
224  C CG2   . THR A 30  ? 0.2364 0.1490 0.2630 -0.0513 0.1327  -0.0141 28  THR B CG2   
225  N N     . ASN A 31  ? 0.5556 0.4727 0.4878 -0.0793 0.1182  0.0057  29  ASN B N     
226  C CA    . ASN A 31  ? 0.6274 0.5346 0.5122 -0.0857 0.1182  -0.0017 29  ASN B CA    
227  C C     . ASN A 31  ? 0.6631 0.5612 0.5320 -0.0896 0.0912  0.0014  29  ASN B C     
228  O O     . ASN A 31  ? 0.7027 0.5945 0.5526 -0.0882 0.0759  -0.0148 29  ASN B O     
229  C CB    . ASN A 31  ? 0.6400 0.5625 0.4996 -0.0825 0.1291  0.0091  29  ASN B CB    
230  C CG    . ASN A 31  ? 0.6416 0.5794 0.5218 -0.0695 0.1409  0.0015  29  ASN B CG    
231  O OD1   . ASN A 31  ? 0.6292 0.5563 0.5259 -0.0663 0.1502  -0.0129 29  ASN B OD1   
232  N ND2   . ASN A 31  ? 0.6637 0.6264 0.5459 -0.0625 0.1411  0.0126  29  ASN B ND2   
233  N N     . VAL A 32  ? 0.6519 0.5492 0.5283 -0.0934 0.0835  0.0208  30  VAL B N     
234  C CA    . VAL A 32  ? 0.6762 0.5639 0.5402 -0.0939 0.0577  0.0260  30  VAL B CA    
235  C C     . VAL A 32  ? 0.6857 0.5724 0.5842 -0.0909 0.0404  0.0087  30  VAL B C     
236  O O     . VAL A 32  ? 0.7436 0.6281 0.6279 -0.0891 0.0179  0.0000  30  VAL B O     
237  C CB    . VAL A 32  ? 0.6609 0.5433 0.5298 -0.0976 0.0548  0.0495  30  VAL B CB    
238  C CG1   . VAL A 32  ? 0.6672 0.5612 0.5274 -0.0983 0.0724  0.0615  30  VAL B CG1   
239  C CG2   . VAL A 32  ? 0.6215 0.5056 0.5392 -0.0958 0.0531  0.0487  30  VAL B CG2   
240  N N     . GLY A 33  ? 0.6506 0.5415 0.5957 -0.0899 0.0508  0.0042  31  GLY B N     
241  C CA    . GLY A 33  ? 0.6548 0.5468 0.6393 -0.0889 0.0394  -0.0109 31  GLY B CA    
242  C C     . GLY A 33  ? 0.6880 0.5772 0.6648 -0.0904 0.0340  -0.0355 31  GLY B C     
243  O O     . GLY A 33  ? 0.7117 0.6030 0.7077 -0.0921 0.0137  -0.0502 31  GLY B O     
244  N N     . GLU A 34  ? 0.7035 0.5895 0.6543 -0.0896 0.0515  -0.0422 32  GLU B N     
245  C CA    . GLU A 34  ? 0.7548 0.6347 0.6939 -0.0900 0.0478  -0.0695 32  GLU B CA    
246  C C     . GLU A 34  ? 0.8030 0.6843 0.6881 -0.0889 0.0258  -0.0765 32  GLU B C     
247  O O     . GLU A 34  ? 0.8335 0.7143 0.7180 -0.0901 0.0054  -0.1012 32  GLU B O     
248  C CB    . GLU A 34  ? 0.8085 0.6841 0.7395 -0.0859 0.0766  -0.0742 32  GLU B CB    
249  C CG    . GLU A 34  ? 0.8994 0.7626 0.8359 -0.0854 0.0786  -0.1054 32  GLU B CG    
250  C CD    . GLU A 34  ? 0.9543 0.8124 0.8809 -0.0778 0.1081  -0.1083 32  GLU B CD    
251  O OE1   . GLU A 34  ? 0.9570 0.8268 0.8567 -0.0735 0.1227  -0.0893 32  GLU B OE1   
252  O OE2   . GLU A 34  ? 0.9846 0.8272 0.9339 -0.0760 0.1170  -0.1296 32  GLU B OE2   
253  N N     . ALA A 35  ? 0.8172 0.7011 0.6572 -0.0867 0.0296  -0.0549 33  ALA B N     
254  C CA    . ALA A 35  ? 0.8635 0.7486 0.6427 -0.0829 0.0140  -0.0561 33  ALA B CA    
255  C C     . ALA A 35  ? 0.8835 0.7708 0.6599 -0.0812 -0.0181 -0.0481 33  ALA B C     
256  O O     . ALA A 35  ? 0.9390 0.8264 0.6635 -0.0761 -0.0293 -0.0346 33  ALA B O     
257  C CB    . ALA A 35  ? 0.8659 0.7526 0.6006 -0.0816 0.0353  -0.0322 33  ALA B CB    
258  N N     . LEU A 36  ? 0.8442 0.7346 0.6764 -0.0838 -0.0320 -0.0547 34  LEU B N     
259  C CA    . LEU A 36  ? 0.8376 0.7339 0.6768 -0.0800 -0.0629 -0.0487 34  LEU B CA    
260  C C     . LEU A 36  ? 0.8687 0.7766 0.7222 -0.0797 -0.0916 -0.0795 34  LEU B C     
261  O O     . LEU A 36  ? 0.8813 0.7994 0.7347 -0.0741 -0.1213 -0.0766 34  LEU B O     
262  C CB    . LEU A 36  ? 0.7735 0.6700 0.6679 -0.0813 -0.0593 -0.0323 34  LEU B CB    
263  C CG    . LEU A 36  ? 0.7817 0.6699 0.6588 -0.0770 -0.0610 -0.0008 34  LEU B CG    
264  C CD1   . LEU A 36  ? 0.8018 0.6798 0.6344 -0.0796 -0.0382 0.0171  34  LEU B CD1   
265  C CD2   . LEU A 36  ? 0.7359 0.6246 0.6693 -0.0774 -0.0540 0.0074  34  LEU B CD2   
266  N N     . ALA A 37  ? 0.8829 0.7898 0.7517 -0.0854 -0.0847 -0.1098 35  ALA B N     
267  C CA    . ALA A 37  ? 0.9121 0.8302 0.7952 -0.0875 -0.1139 -0.1438 35  ALA B CA    
268  C C     . ALA A 37  ? 0.9304 0.8569 0.7435 -0.0777 -0.1415 -0.1499 35  ALA B C     
269  O O     . ALA A 37  ? 0.9574 0.9004 0.7795 -0.0767 -0.1754 -0.1733 35  ALA B O     
270  C CB    . ALA A 37  ? 0.9613 0.8694 0.8688 -0.0957 -0.0985 -0.1759 35  ALA B CB    
271  N N     . ALA A 38  ? 0.9109 0.8293 0.6554 -0.0701 -0.1277 -0.1286 36  ALA B N     
272  C CA    . ALA A 38  ? 0.9340 0.8603 0.6039 -0.0581 -0.1507 -0.1288 36  ALA B CA    
273  C C     . ALA A 38  ? 0.9424 0.8785 0.6106 -0.0493 -0.1797 -0.1049 36  ALA B C     
274  O O     . ALA A 38  ? 1.0034 0.9541 0.6324 -0.0385 -0.2125 -0.1139 36  ALA B O     
275  C CB    . ALA A 38  ? 0.9327 0.8483 0.5336 -0.0528 -0.1222 -0.1086 36  ALA B CB    
276  N N     . VAL A 39  ? 0.8988 0.8275 0.6073 -0.0518 -0.1691 -0.0753 37  VAL B N     
277  C CA    . VAL A 39  ? 0.9251 0.8584 0.6372 -0.0416 -0.1934 -0.0507 37  VAL B CA    
278  C C     . VAL A 39  ? 0.8957 0.8431 0.6908 -0.0452 -0.2086 -0.0614 37  VAL B C     
279  O O     . VAL A 39  ? 0.9127 0.8683 0.7198 -0.0347 -0.2322 -0.0461 37  VAL B O     
280  C CB    . VAL A 39  ? 0.9289 0.8404 0.6182 -0.0393 -0.1710 -0.0072 37  VAL B CB    
281  C CG1   . VAL A 39  ? 0.9694 0.8792 0.6367 -0.0241 -0.1968 0.0203  37  VAL B CG1   
282  C CG2   . VAL A 39  ? 0.9650 0.8649 0.5918 -0.0413 -0.1434 0.0022  37  VAL B CG2   
283  N N     . HIS A 40  ? 0.8626 0.8136 0.7161 -0.0584 -0.1950 -0.0857 38  HIS B N     
284  C CA    . HIS A 40  ? 0.8454 0.8109 0.7811 -0.0626 -0.2027 -0.0922 38  HIS B CA    
285  C C     . HIS A 40  ? 0.8898 0.8736 0.8710 -0.0726 -0.2173 -0.1327 38  HIS B C     
286  O O     . HIS A 40  ? 0.8983 0.9056 0.9384 -0.0735 -0.2389 -0.1432 38  HIS B O     
287  C CB    . HIS A 40  ? 0.7755 0.7263 0.7509 -0.0690 -0.1669 -0.0746 38  HIS B CB    
288  C CG    . HIS A 40  ? 0.7175 0.6834 0.7729 -0.0713 -0.1691 -0.0772 38  HIS B CG    
289  N ND1   . HIS A 40  ? 0.7026 0.6774 0.7791 -0.0605 -0.1844 -0.0594 38  HIS B ND1   
290  C CD2   . HIS A 40  ? 0.6774 0.6504 0.7971 -0.0820 -0.1546 -0.0934 38  HIS B CD2   
291  C CE1   . HIS A 40  ? 0.6627 0.6533 0.8127 -0.0641 -0.1793 -0.0662 38  HIS B CE1   
292  N NE2   . HIS A 40  ? 0.6494 0.6390 0.8266 -0.0778 -0.1607 -0.0853 38  HIS B NE2   
293  N N     . GLY A 41  ? 0.9167 0.8902 0.8756 -0.0805 -0.2049 -0.1566 39  GLY B N     
294  C CA    . GLY A 41  ? 0.9349 0.9183 0.9391 -0.0924 -0.2155 -0.1975 39  GLY B CA    
295  C C     . GLY A 41  ? 0.9012 0.8716 0.9712 -0.1063 -0.1826 -0.2023 39  GLY B C     
296  O O     . GLY A 41  ? 0.9157 0.8895 1.0281 -0.1168 -0.1819 -0.2278 39  GLY B O     
297  N N     . SER A 42  ? 0.8628 0.8182 0.9370 -0.1043 -0.1501 -0.1713 40  SER B N     
298  C CA    . SER A 42  ? 0.8041 0.7478 0.9332 -0.1129 -0.1166 -0.1676 40  SER B CA    
299  C C     . SER A 42  ? 0.7584 0.6875 0.8573 -0.1058 -0.0875 -0.1339 40  SER B C     
300  O O     . SER A 42  ? 0.7596 0.6914 0.8254 -0.0971 -0.0954 -0.1107 40  SER B O     
301  C CB    . SER A 42  ? 0.7711 0.7342 0.9780 -0.1166 -0.1186 -0.1632 40  SER B CB    
302  O OG    . SER A 42  ? 0.7941 0.7816 1.0181 -0.1173 -0.1500 -0.1815 40  SER B OG    
303  N N     . GLU A 43  ? 0.7232 0.6369 0.8357 -0.1092 -0.0547 -0.1316 41  GLU B N     
304  C CA    . GLU A 43  ? 0.7131 0.6169 0.7965 -0.1030 -0.0287 -0.1042 41  GLU B CA    
305  C C     . GLU A 43  ? 0.6684 0.5777 0.7987 -0.1011 -0.0143 -0.0829 41  GLU B C     
306  O O     . GLU A 43  ? 0.6652 0.5844 0.8500 -0.1034 -0.0156 -0.0870 41  GLU B O     
307  C CB    . GLU A 43  ? 0.7561 0.6439 0.8223 -0.1036 -0.0014 -0.1116 41  GLU B CB    
308  C CG    . GLU A 43  ? 0.7983 0.6769 0.9190 -0.1099 0.0133  -0.1290 41  GLU B CG    
309  C CD    . GLU A 43  ? 0.8441 0.7043 0.9431 -0.1073 0.0372  -0.1387 41  GLU B CD    
310  O OE1   . GLU A 43  ? 0.8836 0.7419 0.9243 -0.1025 0.0352  -0.1433 41  GLU B OE1   
311  O OE2   . GLU A 43  ? 0.8438 0.7035 0.9743 -0.1002 0.0555  -0.1298 41  GLU B OE2   
312  N N     . PHE A 44  ? 0.6286 0.5340 0.7332 -0.0952 0.0003  -0.0590 42  PHE B N     
313  C CA    . PHE A 44  ? 0.5443 0.4544 0.6812 -0.0909 0.0150  -0.0402 42  PHE B CA    
314  C C     . PHE A 44  ? 0.5319 0.4420 0.6575 -0.0828 0.0426  -0.0301 42  PHE B C     
315  O O     . PHE A 44  ? 0.5946 0.4959 0.7111 -0.0854 0.0541  -0.0411 42  PHE B O     
316  C CB    . PHE A 44  ? 0.5011 0.4123 0.6140 -0.0852 0.0032  -0.0214 42  PHE B CB    
317  C CG    . PHE A 44  ? 0.5143 0.4356 0.6483 -0.0821 -0.0235 -0.0232 42  PHE B CG    
318  C CD1   . PHE A 44  ? 0.4983 0.4327 0.6886 -0.0794 -0.0218 -0.0231 42  PHE B CD1   
319  C CD2   . PHE A 44  ? 0.5590 0.4788 0.6560 -0.0798 -0.0495 -0.0232 42  PHE B CD2   
320  C CE1   . PHE A 44  ? 0.4949 0.4428 0.7094 -0.0748 -0.0462 -0.0250 42  PHE B CE1   
321  C CE2   . PHE A 44  ? 0.5590 0.4908 0.6770 -0.0740 -0.0758 -0.0237 42  PHE B CE2   
322  C CZ    . PHE A 44  ? 0.5194 0.4663 0.6986 -0.0716 -0.0744 -0.0255 42  PHE B CZ    
323  N N     . SER A 45  ? 0.4470 0.3697 0.5714 -0.0701 0.0500  -0.0124 43  SER B N     
324  C CA    . SER A 45  ? 0.3844 0.3155 0.5018 -0.0574 0.0681  -0.0060 43  SER B CA    
325  C C     . SER A 45  ? 0.3726 0.3092 0.4640 -0.0525 0.0677  0.0060  43  SER B C     
326  O O     . SER A 45  ? 0.3972 0.3321 0.4821 -0.0561 0.0562  0.0124  43  SER B O     
327  C CB    . SER A 45  ? 0.3169 0.2599 0.4633 -0.0447 0.0756  -0.0046 43  SER B CB    
328  O OG    . SER A 45  ? 0.2638 0.2153 0.4237 -0.0414 0.0673  0.0005  43  SER B OG    
329  N N     . GLN A 46  ? 0.3425 0.2842 0.4220 -0.0443 0.0789  0.0076  44  GLN B N     
330  C CA    . GLN A 46  ? 0.3334 0.2843 0.3950 -0.0401 0.0751  0.0154  44  GLN B CA    
331  C C     . GLN A 46  ? 0.3501 0.3083 0.4217 -0.0328 0.0694  0.0186  44  GLN B C     
332  O O     . GLN A 46  ? 0.4009 0.3612 0.4631 -0.0349 0.0633  0.0229  44  GLN B O     
333  C CB    . GLN A 46  ? 0.2736 0.2292 0.3283 -0.0321 0.0843  0.0145  44  GLN B CB    
334  C CG    . GLN A 46  ? 0.2001 0.1639 0.2501 -0.0262 0.0836  0.0188  44  GLN B CG    
335  C CD    . GLN A 46  ? 0.1710 0.1338 0.2359 -0.0126 0.0885  0.0197  44  GLN B CD    
336  O OE1   . GLN A 46  ? 0.1680 0.1351 0.2368 -0.0098 0.0845  0.0221  44  GLN B OE1   
337  N NE2   . GLN A 46  ? 0.1834 0.1380 0.2559 -0.0044 0.0980  0.0197  44  GLN B NE2   
338  N N     . THR A 47  ? 0.2964 0.2559 0.3908 -0.0240 0.0751  0.0160  45  THR B N     
339  C CA    . THR A 47  ? 0.2804 0.2447 0.3885 -0.0160 0.0745  0.0186  45  THR B CA    
340  C C     . THR A 47  ? 0.2492 0.2115 0.3601 -0.0245 0.0627  0.0204  45  THR B C     
341  O O     . THR A 47  ? 0.2457 0.2083 0.3532 -0.0230 0.0592  0.0233  45  THR B O     
342  C CB    . THR A 47  ? 0.3224 0.2862 0.4567 -0.0059 0.0843  0.0179  45  THR B CB    
343  O OG1   . THR A 47  ? 0.3514 0.3070 0.4835 0.0025  0.0954  0.0189  45  THR B OG1   
344  C CG2   . THR A 47  ? 0.1218 0.0878 0.2676 0.0030  0.0855  0.0222  45  THR B CG2   
345  N N     . THR A 48  ? 0.2614 0.2175 0.3821 -0.0336 0.0564  0.0179  46  THR B N     
346  C CA    . THR A 48  ? 0.2642 0.2127 0.3925 -0.0398 0.0429  0.0200  46  THR B CA    
347  C C     . THR A 48  ? 0.3013 0.2355 0.3982 -0.0473 0.0348  0.0264  46  THR B C     
348  O O     . THR A 48  ? 0.3175 0.2446 0.4164 -0.0452 0.0275  0.0307  46  THR B O     
349  C CB    . THR A 48  ? 0.2468 0.1901 0.3939 -0.0492 0.0340  0.0135  46  THR B CB    
350  O OG1   . THR A 48  ? 0.2484 0.2054 0.4306 -0.0428 0.0413  0.0080  46  THR B OG1   
351  C CG2   . THR A 48  ? 0.2357 0.1697 0.3942 -0.0537 0.0143  0.0160  46  THR B CG2   
352  N N     . ILE A 49  ? 0.3199 0.2491 0.3912 -0.0551 0.0370  0.0280  47  ILE B N     
353  C CA    . ILE A 49  ? 0.3370 0.2543 0.3807 -0.0631 0.0316  0.0369  47  ILE B CA    
354  C C     . ILE A 49  ? 0.3720 0.2977 0.4124 -0.0573 0.0328  0.0380  47  ILE B C     
355  O O     . ILE A 49  ? 0.4060 0.3169 0.4358 -0.0612 0.0263  0.0426  47  ILE B O     
356  C CB    . ILE A 49  ? 0.2811 0.2005 0.3095 -0.0692 0.0384  0.0397  47  ILE B CB    
357  C CG1   . ILE A 49  ? 0.2544 0.1574 0.2825 -0.0781 0.0402  0.0324  47  ILE B CG1   
358  C CG2   . ILE A 49  ? 0.2907 0.2060 0.3029 -0.0730 0.0371  0.0524  47  ILE B CG2   
359  C CD1   . ILE A 49  ? 0.2510 0.1385 0.2720 -0.0815 0.0197  0.0349  47  ILE B CD1   
360  N N     . CYS A 50  ? 0.3517 0.2962 0.4011 -0.0479 0.0423  0.0328  48  CYS B N     
361  C CA    . CYS A 50  ? 0.3544 0.3054 0.4058 -0.0432 0.0445  0.0320  48  CYS B CA    
362  C C     . CYS A 50  ? 0.3796 0.3217 0.4457 -0.0390 0.0415  0.0316  48  CYS B C     
363  O O     . CYS A 50  ? 0.4325 0.3662 0.4957 -0.0417 0.0381  0.0326  48  CYS B O     
364  C CB    . CYS A 50  ? 0.3581 0.3240 0.4194 -0.0314 0.0570  0.0274  48  CYS B CB    
365  S SG    . CYS A 50  ? 0.3985 0.3717 0.4644 -0.0265 0.0608  0.0262  48  CYS B SG    
366  N N     . ARG A 51  ? 0.3109 0.2552 0.3985 -0.0320 0.0430  0.0299  49  ARG B N     
367  C CA    . ARG A 51  ? 0.2751 0.2143 0.3849 -0.0259 0.0397  0.0303  49  ARG B CA    
368  C C     . ARG A 51  ? 0.2741 0.1894 0.3704 -0.0328 0.0249  0.0349  49  ARG B C     
369  O O     . ARG A 51  ? 0.2876 0.1921 0.3904 -0.0286 0.0206  0.0348  49  ARG B O     
370  C CB    . ARG A 51  ? 0.2449 0.1953 0.3876 -0.0187 0.0436  0.0289  49  ARG B CB    
371  C CG    . ARG A 51  ? 0.1732 0.1403 0.3298 -0.0083 0.0609  0.0267  49  ARG B CG    
372  C CD    . ARG A 51  ? 0.1192 0.0954 0.3165 0.0007  0.0677  0.0272  49  ARG B CD    
373  N NE    . ARG A 51  ? 0.1157 0.0898 0.3108 0.0106  0.0812  0.0284  49  ARG B NE    
374  C CZ    . ARG A 51  ? 0.1194 0.0920 0.3200 0.0103  0.0841  0.0276  49  ARG B CZ    
375  N NH1   . ARG A 51  ? 0.1203 0.0981 0.3334 0.0014  0.0769  0.0231  49  ARG B NH1   
376  N NH2   . ARG A 51  ? 0.1282 0.0946 0.3166 0.0139  0.0913  0.0324  49  ARG B NH2   
377  N N     . PHE A 52  ? 0.3061 0.2095 0.3839 -0.0421 0.0183  0.0393  50  PHE B N     
378  C CA    . PHE A 52  ? 0.3977 0.2756 0.4627 -0.0455 0.0068  0.0475  50  PHE B CA    
379  C C     . PHE A 52  ? 0.4468 0.3109 0.4861 -0.0520 0.0108  0.0495  50  PHE B C     
380  O O     . PHE A 52  ? 0.4575 0.3042 0.4987 -0.0489 0.0052  0.0526  50  PHE B O     
381  C CB    . PHE A 52  ? 0.4237 0.2927 0.4792 -0.0526 -0.0004 0.0549  50  PHE B CB    
382  C CG    . PHE A 52  ? 0.4758 0.3207 0.5173 -0.0529 -0.0163 0.0697  50  PHE B CG    
383  C CD1   . PHE A 52  ? 0.4995 0.3357 0.5606 -0.0437 -0.0371 0.0751  50  PHE B CD1   
384  C CD2   . PHE A 52  ? 0.5059 0.3387 0.5162 -0.0599 -0.0103 0.0793  50  PHE B CD2   
385  C CE1   . PHE A 52  ? 0.5582 0.3704 0.5995 -0.0406 -0.0535 0.0911  50  PHE B CE1   
386  C CE2   . PHE A 52  ? 0.5507 0.3610 0.5429 -0.0585 -0.0237 0.0959  50  PHE B CE2   
387  C CZ    . PHE A 52  ? 0.5863 0.3846 0.5902 -0.0484 -0.0459 0.1023  50  PHE B CZ    
388  N N     . GLU A 53  ? 0.4725 0.3446 0.4915 -0.0616 0.0187  0.0480  51  GLU B N     
389  C CA    . GLU A 53  ? 0.4926 0.3584 0.4962 -0.0690 0.0215  0.0488  51  GLU B CA    
390  C C     . GLU A 53  ? 0.4588 0.3228 0.4789 -0.0664 0.0182  0.0443  51  GLU B C     
391  O O     . GLU A 53  ? 0.5029 0.3466 0.5179 -0.0713 0.0177  0.0453  51  GLU B O     
392  C CB    . GLU A 53  ? 0.5222 0.4180 0.5236 -0.0755 0.0194  0.0518  51  GLU B CB    
393  C CG    . GLU A 53  ? 0.5786 0.4942 0.6145 -0.0668 0.0243  0.0691  51  GLU B CG    
394  C CD    . GLU A 53  ? 0.6588 0.5940 0.6843 -0.0714 0.0312  0.0688  51  GLU B CD    
395  O OE1   . GLU A 53  ? 0.6785 0.6252 0.7013 -0.0739 0.0324  0.0611  51  GLU B OE1   
396  O OE2   . GLU A 53  ? 0.7338 0.6656 0.7475 -0.0726 0.0426  0.0745  51  GLU B OE2   
397  N N     . ASN A 54  ? 0.3934 0.2790 0.4381 -0.0558 0.0212  0.0378  52  ASN B N     
398  C CA    . ASN A 54  ? 0.4100 0.2944 0.4753 -0.0493 0.0229  0.0304  52  ASN B CA    
399  C C     . ASN A 54  ? 0.4364 0.3077 0.5189 -0.0372 0.0174  0.0282  52  ASN B C     
400  O O     . ASN A 54  ? 0.4670 0.3347 0.5673 -0.0293 0.0189  0.0194  52  ASN B O     
401  C CB    . ASN A 54  ? 0.3976 0.3088 0.4799 -0.0423 0.0364  0.0244  52  ASN B CB    
402  C CG    . ASN A 54  ? 0.3828 0.3106 0.4531 -0.0508 0.0413  0.0261  52  ASN B CG    
403  O OD1   . ASN A 54  ? 0.3988 0.3283 0.4731 -0.0582 0.0427  0.0224  52  ASN B OD1   
404  N ND2   . ASN A 54  ? 0.3537 0.2944 0.4130 -0.0497 0.0429  0.0302  52  ASN B ND2   
405  N N     . LEU A 55  ? 0.4231 0.2872 0.5029 -0.0348 0.0108  0.0347  53  LEU B N     
406  C CA    . LEU A 55  ? 0.3709 0.2280 0.4725 -0.0219 0.0033  0.0343  53  LEU B CA    
407  C C     . LEU A 55  ? 0.3134 0.1920 0.4463 -0.0090 0.0123  0.0260  53  LEU B C     
408  O O     . LEU A 55  ? 0.2219 0.0946 0.3707 0.0029  0.0106  0.0197  53  LEU B O     
409  C CB    . LEU A 55  ? 0.4006 0.2280 0.4959 -0.0203 -0.0049 0.0347  53  LEU B CB    
410  C CG    . LEU A 55  ? 0.4335 0.2373 0.5075 -0.0269 -0.0119 0.0477  53  LEU B CG    
411  C CD1   . LEU A 55  ? 0.3436 0.1170 0.4175 -0.0222 -0.0179 0.0492  53  LEU B CD1   
412  C CD2   . LEU A 55  ? 0.4423 0.2533 0.5242 -0.0216 -0.0210 0.0563  53  LEU B CD2   
413  N N     . GLN A 56  ? 0.2797 0.1825 0.4200 -0.0098 0.0244  0.0260  54  GLN B N     
414  C CA    . GLN A 56  ? 0.2586 0.1822 0.4287 0.0023  0.0389  0.0221  54  GLN B CA    
415  C C     . GLN A 56  ? 0.2409 0.1786 0.4367 0.0048  0.0381  0.0259  54  GLN B C     
416  O O     . GLN A 56  ? 0.2317 0.1886 0.4417 0.0044  0.0511  0.0275  54  GLN B O     
417  C CB    . GLN A 56  ? 0.2713 0.2103 0.4373 0.0016  0.0571  0.0217  54  GLN B CB    
418  C CG    . GLN A 56  ? 0.3280 0.2556 0.4805 -0.0005 0.0589  0.0155  54  GLN B CG    
419  C CD    . GLN A 56  ? 0.3676 0.3119 0.5153 -0.0009 0.0762  0.0174  54  GLN B CD    
420  O OE1   . GLN A 56  ? 0.3522 0.3129 0.4976 0.0009  0.0829  0.0233  54  GLN B OE1   
421  N NE2   . GLN A 56  ? 0.4004 0.3517 0.5358 0.0012  0.0757  0.0073  54  GLN B NE2   
422  N N     . LEU A 57  ? 0.2646 0.1911 0.4695 0.0079  0.0220  0.0271  55  LEU B N     
423  C CA    . LEU A 57  ? 0.2944 0.2343 0.5348 0.0115  0.0173  0.0288  55  LEU B CA    
424  C C     . LEU A 57  ? 0.3278 0.2585 0.5806 0.0230  0.0024  0.0279  55  LEU B C     
425  O O     . LEU A 57  ? 0.3481 0.2579 0.5787 0.0271  -0.0033 0.0265  55  LEU B O     
426  C CB    . LEU A 57  ? 0.3017 0.2393 0.5366 -0.0004 0.0082  0.0326  55  LEU B CB    
427  C CG    . LEU A 57  ? 0.3170 0.2304 0.5082 -0.0107 -0.0045 0.0380  55  LEU B CG    
428  C CD1   . LEU A 57  ? 0.3556 0.2469 0.5422 -0.0049 -0.0234 0.0441  55  LEU B CD1   
429  C CD2   . LEU A 57  ? 0.2907 0.2060 0.4786 -0.0215 -0.0095 0.0387  55  LEU B CD2   
430  N N     . SER A 58  ? 0.3088 0.2560 0.5996 0.0286  -0.0037 0.0280  56  SER B N     
431  C CA    . SER A 58  ? 0.3098 0.2548 0.6144 0.0422  -0.0171 0.0269  56  SER B CA    
432  C C     . SER A 58  ? 0.3298 0.2462 0.6118 0.0422  -0.0409 0.0349  56  SER B C     
433  O O     . SER A 58  ? 0.3318 0.2348 0.5930 0.0305  -0.0495 0.0419  56  SER B O     
434  C CB    . SER A 58  ? 0.2021 0.1773 0.5545 0.0465  -0.0187 0.0248  56  SER B CB    
435  O OG    . SER A 58  ? 0.1974 0.1771 0.5683 0.0383  -0.0349 0.0277  56  SER B OG    
436  N N     . PHE A 59  ? 0.3471 0.2523 0.6287 0.0560  -0.0497 0.0349  57  PHE B N     
437  C CA    . PHE A 59  ? 0.3805 0.2571 0.6397 0.0585  -0.0702 0.0458  57  PHE B CA    
438  C C     . PHE A 59  ? 0.4230 0.3099 0.6969 0.0583  -0.0926 0.0539  57  PHE B C     
439  O O     . PHE A 59  ? 0.5016 0.3664 0.7440 0.0523  -0.1068 0.0661  57  PHE B O     
440  C CB    . PHE A 59  ? 0.4095 0.2738 0.6719 0.0764  -0.0737 0.0441  57  PHE B CB    
441  C CG    . PHE A 59  ? 0.4786 0.3130 0.7195 0.0815  -0.0922 0.0582  57  PHE B CG    
442  C CD1   . PHE A 59  ? 0.5204 0.3189 0.7212 0.0715  -0.0897 0.0662  57  PHE B CD1   
443  C CD2   . PHE A 59  ? 0.5116 0.3564 0.7726 0.0966  -0.1111 0.0645  57  PHE B CD2   
444  C CE1   . PHE A 59  ? 0.5873 0.3574 0.7669 0.0766  -0.1030 0.0825  57  PHE B CE1   
445  C CE2   . PHE A 59  ? 0.5708 0.3883 0.8080 0.1038  -0.1273 0.0805  57  PHE B CE2   
446  C CZ    . PHE A 59  ? 0.6137 0.3920 0.8093 0.0938  -0.1220 0.0907  57  PHE B CZ    
447  N N     . LYS A 60  ? 0.3732 0.2951 0.6934 0.0650  -0.0967 0.0471  58  LYS B N     
448  C CA    . LYS A 60  ? 0.3751 0.3139 0.7147 0.0657  -0.1227 0.0505  58  LYS B CA    
449  C C     . LYS A 60  ? 0.3657 0.3017 0.6891 0.0481  -0.1244 0.0512  58  LYS B C     
450  O O     . LYS A 60  ? 0.3832 0.3143 0.6762 0.0432  -0.1450 0.0565  58  LYS B O     
451  C CB    . LYS A 60  ? 0.3787 0.3619 0.7753 0.0719  -0.1222 0.0391  58  LYS B CB    
452  C CG    . LYS A 60  ? 0.3974 0.4070 0.8173 0.0721  -0.1520 0.0371  58  LYS B CG    
453  C CD    . LYS A 60  ? 0.3761 0.4304 0.8533 0.0694  -0.1443 0.0231  58  LYS B CD    
454  C CE    . LYS A 60  ? 0.3823 0.4650 0.8794 0.0620  -0.1717 0.0147  58  LYS B CE    
455  N NZ    . LYS A 60  ? 0.3660 0.4837 0.9140 0.0504  -0.1567 -0.0001 58  LYS B NZ    
456  N N     . ASN A 61  ? 0.3548 0.2978 0.6828 0.0355  -0.0977 0.0433  59  ASN B N     
457  C CA    . ASN A 61  ? 0.3965 0.3381 0.6957 0.0152  -0.0908 0.0401  59  ASN B CA    
458  C C     . ASN A 61  ? 0.3861 0.2916 0.6237 0.0078  -0.0931 0.0519  59  ASN B C     
459  O O     . ASN A 61  ? 0.3644 0.2671 0.5697 -0.0036 -0.0997 0.0525  59  ASN B O     
460  C CB    . ASN A 61  ? 0.4422 0.3966 0.7604 0.0076  -0.0602 0.0327  59  ASN B CB    
461  C CG    . ASN A 61  ? 0.4918 0.4514 0.7978 -0.0103 -0.0533 0.0264  59  ASN B CG    
462  O OD1   . ASN A 61  ? 0.5372 0.4964 0.8255 -0.0172 -0.0724 0.0233  59  ASN B OD1   
463  N ND2   . ASN A 61  ? 0.4754 0.4396 0.7888 -0.0159 -0.0262 0.0242  59  ASN B ND2   
464  N N     . ALA A 62  ? 0.4156 0.2939 0.6383 0.0140  -0.0868 0.0602  60  ALA B N     
465  C CA    . ALA A 62  ? 0.5053 0.3516 0.6764 0.0046  -0.0853 0.0720  60  ALA B CA    
466  C C     . ALA A 62  ? 0.6125 0.4426 0.7549 0.0083  -0.1105 0.0872  60  ALA B C     
467  O O     . ALA A 62  ? 0.6638 0.4822 0.7629 -0.0033 -0.1103 0.0956  60  ALA B O     
468  C CB    . ALA A 62  ? 0.5326 0.3683 0.6913 0.0087  -0.0704 0.0689  60  ALA B CB    
469  N N     . CYS A 63  ? 0.6550 0.4876 0.8185 0.0266  -0.1311 0.0914  61  CYS B N     
470  C CA    . CYS A 63  ? 0.7465 0.5678 0.8794 0.0343  -0.1566 0.1074  61  CYS B CA    
471  C C     . CYS A 63  ? 0.6946 0.5434 0.8111 0.0260  -0.1686 0.0996  61  CYS B C     
472  O O     . CYS A 63  ? 0.7271 0.5633 0.7937 0.0238  -0.1792 0.1123  61  CYS B O     
473  C CB    . CYS A 63  ? 0.8747 0.7039 1.0369 0.0570  -0.1732 0.1091  61  CYS B CB    
474  S SG    . CYS A 63  ? 1.0086 0.8135 1.1713 0.0643  -0.1506 0.1080  61  CYS B SG    
475  N N     . LYS A 64  ? 0.6164 0.5021 0.7745 0.0216  -0.1662 0.0782  62  LYS B N     
476  C CA    . LYS A 64  ? 0.6427 0.5523 0.7902 0.0115  -0.1767 0.0649  62  LYS B CA    
477  C C     . LYS A 64  ? 0.6659 0.5585 0.7632 -0.0057 -0.1588 0.0663  62  LYS B C     
478  O O     . LYS A 64  ? 0.7519 0.6410 0.8023 -0.0079 -0.1712 0.0697  62  LYS B O     
479  C CB    . LYS A 64  ? 0.6111 0.5580 0.8210 0.0069  -0.1721 0.0422  62  LYS B CB    
480  N N     . LEU A 65  ? 0.5646 0.4491 0.6700 -0.0160 -0.1296 0.0636  63  LEU B N     
481  C CA    . LEU A 65  ? 0.5165 0.3912 0.5831 -0.0312 -0.1109 0.0632  63  LEU B CA    
482  C C     . LEU A 65  ? 0.5635 0.4088 0.5745 -0.0323 -0.1113 0.0851  63  LEU B C     
483  O O     . LEU A 65  ? 0.6097 0.4523 0.5780 -0.0405 -0.1068 0.0868  63  LEU B O     
484  C CB    . LEU A 65  ? 0.4504 0.3270 0.5412 -0.0387 -0.0817 0.0569  63  LEU B CB    
485  C CG    . LEU A 65  ? 0.4117 0.3124 0.5364 -0.0450 -0.0705 0.0378  63  LEU B CG    
486  C CD1   . LEU A 65  ? 0.3903 0.3151 0.5647 -0.0380 -0.0866 0.0269  63  LEU B CD1   
487  C CD2   . LEU A 65  ? 0.3919 0.2931 0.5342 -0.0476 -0.0422 0.0375  63  LEU B CD2   
488  N N     . LYS A 66  ? 0.5637 0.3857 0.5760 -0.0241 -0.1144 0.1020  64  LYS B N     
489  C CA    . LYS A 66  ? 0.6259 0.4166 0.5905 -0.0260 -0.1139 0.1263  64  LYS B CA    
490  C C     . LYS A 66  ? 0.7056 0.4994 0.6267 -0.0191 -0.1353 0.1357  64  LYS B C     
491  O O     . LYS A 66  ? 0.7504 0.5303 0.6209 -0.0254 -0.1282 0.1509  64  LYS B O     
492  C CB    . LYS A 66  ? 0.4643 0.2256 0.4444 -0.0165 -0.1167 0.1412  64  LYS B CB    
493  C CG    . LYS A 66  ? 0.5190 0.2581 0.4590 -0.0126 -0.1160 0.1625  64  LYS B CG    
494  C CD    . LYS A 66  ? 0.5261 0.2489 0.4864 -0.0060 -0.1031 0.1624  64  LYS B CD    
495  C CE    . LYS A 66  ? 0.7017 0.4038 0.6441 0.0104  -0.1168 0.1833  64  LYS B CE    
496  N NZ    . LYS A 66  ? 0.7559 0.4699 0.7254 0.0305  -0.1427 0.1795  64  LYS B NZ    
497  N N     . ALA A 67  ? 0.5061 0.3217 0.4462 -0.0055 -0.1615 0.1263  65  ALA B N     
498  C CA    . ALA A 67  ? 0.6454 0.4705 0.5431 0.0032  -0.1862 0.1309  65  ALA B CA    
499  C C     . ALA A 67  ? 0.6478 0.4907 0.5164 -0.0096 -0.1790 0.1128  65  ALA B C     
500  O O     . ALA A 67  ? 0.7028 0.5394 0.5111 -0.0087 -0.1819 0.1235  65  ALA B O     
501  C CB    . ALA A 67  ? 0.5610 0.4125 0.4955 0.0203  -0.2180 0.1208  65  ALA B CB    
502  N N     . ILE A 68  ? 0.5951 0.4591 0.5050 -0.0202 -0.1683 0.0857  66  ILE B N     
503  C CA    . ILE A 68  ? 0.6052 0.4819 0.4934 -0.0317 -0.1593 0.0659  66  ILE B CA    
504  C C     . ILE A 68  ? 0.6443 0.5006 0.4890 -0.0418 -0.1309 0.0800  66  ILE B C     
505  O O     . ILE A 68  ? 0.7212 0.5793 0.5162 -0.0442 -0.1281 0.0774  66  ILE B O     
506  C CB    . ILE A 68  ? 0.4534 0.3505 0.4017 -0.0406 -0.1499 0.0384  66  ILE B CB    
507  C CG1   . ILE A 68  ? 0.4675 0.3865 0.4718 -0.0316 -0.1731 0.0288  66  ILE B CG1   
508  C CG2   . ILE A 68  ? 0.4629 0.3712 0.3933 -0.0497 -0.1466 0.0142  66  ILE B CG2   
509  C CD1   . ILE A 68  ? 0.3953 0.3338 0.4629 -0.0406 -0.1612 0.0063  66  ILE B CD1   
510  N N     . LEU A 69  ? 0.6020 0.4417 0.4662 -0.0476 -0.1093 0.0932  67  LEU B N     
511  C CA    . LEU A 69  ? 0.6279 0.4549 0.4643 -0.0593 -0.0813 0.1041  67  LEU B CA    
512  C C     . LEU A 69  ? 0.7144 0.5200 0.4960 -0.0572 -0.0818 0.1332  67  LEU B C     
513  O O     . LEU A 69  ? 0.7391 0.5434 0.4830 -0.0651 -0.0631 0.1399  67  LEU B O     
514  C CB    . LEU A 69  ? 0.5558 0.3762 0.4342 -0.0660 -0.0616 0.1056  67  LEU B CB    
515  C CG    . LEU A 69  ? 0.4678 0.3091 0.3880 -0.0700 -0.0499 0.0815  67  LEU B CG    
516  C CD1   . LEU A 69  ? 0.4189 0.2568 0.3772 -0.0716 -0.0356 0.0831  67  LEU B CD1   
517  C CD2   . LEU A 69  ? 0.4537 0.3043 0.3506 -0.0784 -0.0319 0.0718  67  LEU B CD2   
518  N N     . SER A 70  ? 0.7482 0.5370 0.5262 -0.0456 -0.1006 0.1527  68  SER B N     
519  C CA    . SER A 70  ? 0.8225 0.5868 0.5486 -0.0424 -0.0997 0.1854  68  SER B CA    
520  C C     . SER A 70  ? 0.9084 0.6861 0.5729 -0.0356 -0.1093 0.1858  68  SER B C     
521  O O     . SER A 70  ? 0.9740 0.7450 0.5938 -0.0389 -0.0909 0.2037  68  SER B O     
522  C CB    . SER A 70  ? 0.8239 0.5675 0.5646 -0.0274 -0.1176 0.2042  68  SER B CB    
523  O OG    . SER A 70  ? 0.8407 0.6007 0.5807 -0.0101 -0.1515 0.1963  68  SER B OG    
524  N N     . LYS A 71  ? 0.9042 0.7065 0.5715 -0.0248 -0.1362 0.1630  69  LYS B N     
525  C CA    . LYS A 71  ? 0.9854 0.8033 0.5923 -0.0172 -0.1484 0.1567  69  LYS B CA    
526  C C     . LYS A 71  ? 1.0090 0.8372 0.5955 -0.0305 -0.1219 0.1394  69  LYS B C     
527  O O     . LYS A 71  ? 1.1079 0.9381 0.6304 -0.0268 -0.1160 0.1465  69  LYS B O     
528  C CB    . LYS A 71  ? 0.9657 0.8114 0.5910 -0.0054 -0.1851 0.1295  69  LYS B CB    
529  C CG    . LYS A 71  ? 0.9630 0.8050 0.6123 0.0112  -0.2134 0.1450  69  LYS B CG    
530  N N     . TRP A 72  ? 0.8930 0.7285 0.5316 -0.0436 -0.1046 0.1175  70  TRP B N     
531  C CA    . TRP A 72  ? 0.8550 0.6997 0.4796 -0.0537 -0.0787 0.1015  70  TRP B CA    
532  C C     . TRP A 72  ? 0.8470 0.6777 0.4467 -0.0625 -0.0468 0.1289  70  TRP B C     
533  O O     . TRP A 72  ? 0.8817 0.7191 0.4365 -0.0636 -0.0297 0.1288  70  TRP B O     
534  C CB    . TRP A 72  ? 0.7743 0.6300 0.4620 -0.0626 -0.0698 0.0735  70  TRP B CB    
535  C CG    . TRP A 72  ? 0.7187 0.5805 0.3981 -0.0709 -0.0408 0.0610  70  TRP B CG    
536  C CD1   . TRP A 72  ? 0.7332 0.6065 0.3921 -0.0693 -0.0399 0.0339  70  TRP B CD1   
537  C CD2   . TRP A 72  ? 0.6381 0.4960 0.3318 -0.0807 -0.0094 0.0737  70  TRP B CD2   
538  N NE1   . TRP A 72  ? 0.6945 0.5699 0.3537 -0.0757 -0.0083 0.0307  70  TRP B NE1   
539  C CE2   . TRP A 72  ? 0.6362 0.5053 0.3176 -0.0828 0.0101  0.0554  70  TRP B CE2   
540  C CE3   . TRP A 72  ? 0.5997 0.4468 0.3173 -0.0876 0.0027  0.0966  70  TRP B CE3   
541  C CZ2   . TRP A 72  ? 0.6119 0.4856 0.3055 -0.0902 0.0407  0.0616  70  TRP B CZ2   
542  C CZ3   . TRP A 72  ? 0.5900 0.4425 0.3196 -0.0970 0.0315  0.1003  70  TRP B CZ3   
543  C CH2   . TRP A 72  ? 0.5985 0.4663 0.3169 -0.0976 0.0500  0.0840  70  TRP B CH2   
544  N N     . LEU A 73  ? 0.8074 0.6205 0.4392 -0.0691 -0.0377 0.1505  71  LEU B N     
545  C CA    . LEU A 73  ? 0.8221 0.6329 0.4574 -0.0764 -0.0067 0.1693  71  LEU B CA    
546  C C     . LEU A 73  ? 0.9272 0.7436 0.5165 -0.0652 0.0001  0.1881  71  LEU B C     
547  O O     . LEU A 73  ? 0.9397 0.7740 0.5218 -0.0661 0.0253  0.1894  71  LEU B O     
548  C CB    . LEU A 73  ? 0.7656 0.5649 0.4571 -0.0776 -0.0034 0.1794  71  LEU B CB    
549  C CG    . LEU A 73  ? 0.7247 0.5328 0.4463 -0.0803 0.0253  0.1888  71  LEU B CG    
550  C CD1   . LEU A 73  ? 0.6831 0.5179 0.4246 -0.0873 0.0459  0.1715  71  LEU B CD1   
551  C CD2   . LEU A 73  ? 0.6860 0.4798 0.4564 -0.0804 0.0247  0.1913  71  LEU B CD2   
552  N N     . GLU A 74  ? 1.0044 0.8091 0.5659 -0.0518 -0.0222 0.2047  72  GLU B N     
553  C CA    . GLU A 74  ? 1.1099 0.9234 0.6208 -0.0376 -0.0179 0.2239  72  GLU B CA    
554  C C     . GLU A 74  ? 1.1749 1.0120 0.6381 -0.0348 -0.0152 0.2034  72  GLU B C     
555  O O     . GLU A 74  ? 1.2166 1.0720 0.6587 -0.0310 0.0085  0.2130  72  GLU B O     
556  C CB    . GLU A 74  ? 1.1541 0.9568 0.6425 -0.0201 -0.0482 0.2400  72  GLU B CB    
557  N N     . GLU A 75  ? 1.1924 1.0308 0.6416 -0.0361 -0.0398 0.1731  73  GLU B N     
558  C CA    . GLU A 75  ? 1.2698 1.1279 0.6750 -0.0317 -0.0404 0.1453  73  GLU B CA    
559  C C     . GLU A 75  ? 1.2313 1.1008 0.6530 -0.0423 -0.0040 0.1338  73  GLU B C     
560  O O     . GLU A 75  ? 1.2544 1.1433 0.6407 -0.0348 0.0060  0.1188  73  GLU B O     
561  C CB    . GLU A 75  ? 1.3161 1.1769 0.7279 -0.0309 -0.0751 0.1087  73  GLU B CB    
562  C CG    . GLU A 75  ? 1.4032 1.2833 0.7653 -0.0210 -0.0877 0.0760  73  GLU B CG    
563  C CD    . GLU A 75  ? 1.4141 1.3087 0.8206 -0.0204 -0.1192 0.0341  73  GLU B CD    
564  O OE1   . GLU A 75  ? 1.4269 1.3249 0.8531 -0.0133 -0.1516 0.0376  73  GLU B OE1   
565  O OE2   . GLU A 75  ? 1.4085 1.3110 0.8338 -0.0269 -0.1105 -0.0018 73  GLU B OE2   
566  N N     . ALA A 76  ? 0.9376 1.0919 0.9971 0.1620  0.2399  -0.1442 74  ALA B N     
567  C CA    . ALA A 76  ? 0.9389 1.0834 1.0038 0.1659  0.2400  -0.1444 74  ALA B CA    
568  C C     . ALA A 76  ? 0.9281 1.0823 1.0066 0.1691  0.2387  -0.1398 74  ALA B C     
569  O O     . ALA A 76  ? 0.9406 1.0931 1.0303 0.1729  0.2356  -0.1377 74  ALA B O     
570  C CB    . ALA A 76  ? 0.9378 1.0741 1.0093 0.1675  0.2348  -0.1434 74  ALA B CB    
571  N N     . GLU A 77  ? 0.8871 1.0514 0.9642 0.1674  0.2414  -0.1386 75  GLU B N     
572  C CA    . GLU A 77  ? 0.8630 1.0346 0.9502 0.1691  0.2422  -0.1348 75  GLU B CA    
573  C C     . GLU A 77  ? 0.8569 1.0246 0.9328 0.1696  0.2500  -0.1385 75  GLU B C     
574  O O     . GLU A 77  ? 0.8676 1.0393 0.9332 0.1670  0.2543  -0.1396 75  GLU B O     
575  C CB    . GLU A 77  ? 0.8620 1.0448 0.9553 0.1666  0.2404  -0.1299 75  GLU B CB    
576  C CG    . GLU A 77  ? 0.8572 1.0432 0.9618 0.1660  0.2330  -0.1262 75  GLU B CG    
577  C CD    . GLU A 77  ? 0.8615 1.0501 0.9821 0.1683  0.2287  -0.1220 75  GLU B CD    
578  O OE1   . GLU A 77  ? 0.8785 1.0667 1.0022 0.1708  0.2313  -0.1226 75  GLU B OE1   
579  O OE2   . GLU A 77  ? 0.8471 1.0389 0.9771 0.1676  0.2228  -0.1184 75  GLU B OE2   
580  N N     . GLN A 78  ? 0.8261 0.9862 0.9035 0.1731  0.2518  -0.1404 76  GLN B N     
581  C CA    . GLN A 78  ? 0.8046 0.9589 0.8709 0.1738  0.2592  -0.1443 76  GLN B CA    
582  C C     . GLN A 78  ? 0.7883 0.9488 0.8663 0.1771  0.2607  -0.1415 76  GLN B C     
583  O O     . GLN A 78  ? 0.7620 0.9320 0.8553 0.1778  0.2563  -0.1367 76  GLN B O     
584  C CB    . GLN A 78  ? 0.7932 0.9314 0.8487 0.1749  0.2616  -0.1497 76  GLN B CB    
585  C CG    . GLN A 78  ? 0.7983 0.9287 0.8339 0.1700  0.2657  -0.1553 76  GLN B CG    
586  C CD    . GLN A 78  ? 0.8054 0.9412 0.8408 0.1663  0.2611  -0.1543 76  GLN B CD    
587  O OE1   . GLN A 78  ? 0.8248 0.9730 0.8599 0.1641  0.2605  -0.1522 76  GLN B OE1   
588  N NE2   . GLN A 78  ? 0.7972 0.9236 0.8326 0.1657  0.2582  -0.1557 76  GLN B NE2   
589  N N     . VAL A 79  ? 0.7975 0.9526 0.8677 0.1788  0.2672  -0.1447 77  VAL B N     
590  C CA    . VAL A 79  ? 0.7567 0.9186 0.8357 0.1813  0.2701  -0.1427 77  VAL B CA    
591  C C     . VAL A 79  ? 0.7192 0.8728 0.7967 0.1860  0.2738  -0.1462 77  VAL B C     
592  O O     . VAL A 79  ? 0.6879 0.8288 0.7501 0.1859  0.2783  -0.1510 77  VAL B O     
593  C CB    . VAL A 79  ? 0.7327 0.8995 0.8032 0.1783  0.2759  -0.1422 77  VAL B CB    
594  C CG1   . VAL A 79  ? 0.6947 0.8723 0.7729 0.1754  0.2725  -0.1368 77  VAL B CG1   
595  C CG2   . VAL A 79  ? 0.7235 0.8817 0.7731 0.1754  0.2802  -0.1474 77  VAL B CG2   
596  N N     . ARG A 96  ? 1.0436 0.7162 0.9194 0.1993  0.2556  -0.1163 94  ARG B N     
597  C CA    . ARG A 96  ? 1.0627 0.7348 0.9371 0.1827  0.2592  -0.1238 94  ARG B CA    
598  C C     . ARG A 96  ? 1.1124 0.8072 1.0044 0.1812  0.2489  -0.1226 94  ARG B C     
599  O O     . ARG A 96  ? 1.1556 0.8414 1.0418 0.1721  0.2517  -0.1245 94  ARG B O     
600  C CB    . ARG A 96  ? 1.0121 0.6944 0.8905 0.1749  0.2621  -0.1313 94  ARG B CB    
601  C CG    . ARG A 96  ? 1.0062 0.6765 0.8733 0.1564  0.2713  -0.1404 94  ARG B CG    
602  C CD    . ARG A 96  ? 1.0323 0.6946 0.8899 0.1504  0.2796  -0.1467 94  ARG B CD    
603  N NE    . ARG A 96  ? 1.0984 0.7370 0.9406 0.1598  0.2861  -0.1425 94  ARG B NE    
604  C CZ    . ARG A 96  ? 1.1545 0.7796 0.9845 0.1565  0.2948  -0.1466 94  ARG B CZ    
605  N NH1   . ARG A 96  ? 1.1807 0.7843 0.9968 0.1663  0.3007  -0.1419 94  ARG B NH1   
606  N NH2   . ARG A 96  ? 1.1697 0.8032 1.0011 0.1436  0.2978  -0.1556 94  ARG B NH2   
607  N N     . ARG A 97  ? 1.0975 0.8219 1.0111 0.1896  0.2374  -0.1194 95  ARG B N     
608  C CA    . ARG A 97  ? 1.0638 0.8101 0.9945 0.1893  0.2273  -0.1174 95  ARG B CA    
609  C C     . ARG A 97  ? 1.1064 0.8464 1.0352 0.1991  0.2227  -0.1099 95  ARG B C     
610  O O     . ARG A 97  ? 1.1742 0.9051 1.0968 0.2101  0.2234  -0.1050 95  ARG B O     
611  C CB    . ARG A 97  ? 0.9805 0.7603 0.9345 0.1933  0.2173  -0.1171 95  ARG B CB    
612  C CG    . ARG A 97  ? 0.9272 0.7176 0.8851 0.1831  0.2205  -0.1243 95  ARG B CG    
613  C CD    . ARG A 97  ? 0.8483 0.6726 0.8297 0.1846  0.2101  -0.1234 95  ARG B CD    
614  N NE    . ARG A 97  ? 0.8152 0.6542 0.8095 0.1971  0.2017  -0.1176 95  ARG B NE    
615  C CZ    . ARG A 97  ? 0.7814 0.6362 0.7898 0.2023  0.1919  -0.1128 95  ARG B CZ    
616  N NH1   . ARG A 97  ? 0.7698 0.6272 0.7808 0.1972  0.1890  -0.1125 95  ARG B NH1   
617  N NH2   . ARG A 97  ? 0.7771 0.6454 0.7970 0.2121  0.1853  -0.1088 95  ARG B NH2   
618  N N     . THR A 98  ? 1.0669 0.8123 1.0010 0.1953  0.2183  -0.1089 96  THR B N     
619  C CA    . THR A 98  ? 1.0613 0.8039 0.9952 0.2038  0.2130  -0.1020 96  THR B CA    
620  C C     . THR A 98  ? 1.0232 0.7978 0.9812 0.2079  0.1996  -0.0995 96  THR B C     
621  O O     . THR A 98  ? 1.0258 0.8151 0.9945 0.2000  0.1963  -0.1026 96  THR B O     
622  C CB    . THR A 98  ? 1.0841 0.8050 1.0032 0.1960  0.2191  -0.1026 96  THR B CB    
623  O OG1   . THR A 98  ? 1.1287 0.8184 1.0245 0.1914  0.2322  -0.1050 96  THR B OG1   
624  C CG2   . THR A 98  ? 1.0842 0.8030 1.0029 0.2051  0.2133  -0.0953 96  THR B CG2   
625  N N     . THR A 99  ? 0.9824 0.7675 0.9485 0.2199  0.1926  -0.0941 97  THR B N     
626  C CA    . THR A 99  ? 0.9075 0.7227 0.8965 0.2232  0.1805  -0.0920 97  THR B CA    
627  C C     . THR A 99  ? 0.8190 0.6336 0.8088 0.2239  0.1754  -0.0883 97  THR B C     
628  O O     . THR A 99  ? 0.8071 0.6026 0.7826 0.2292  0.1784  -0.0843 97  THR B O     
629  C CB    . THR A 99  ? 0.9489 0.7771 0.9471 0.2344  0.1757  -0.0888 97  THR B CB    
630  O OG1   . THR A 99  ? 0.9402 0.7789 0.9452 0.2322  0.1775  -0.0928 97  THR B OG1   
631  C CG2   . THR A 99  ? 0.9465 0.8001 0.9646 0.2385  0.1640  -0.0855 97  THR B CG2   
632  N N     . ILE A 100 ? 0.7704 0.6057 0.7763 0.2188  0.1682  -0.0894 98  ILE B N     
633  C CA    . ILE A 100 ? 0.7656 0.6025 0.7739 0.2182  0.1631  -0.0865 98  ILE B CA    
634  C C     . ILE A 100 ? 0.8141 0.6683 0.8357 0.2274  0.1533  -0.0817 98  ILE B C     
635  O O     . ILE A 100 ? 0.7947 0.6706 0.8327 0.2297  0.1478  -0.0822 98  ILE B O     
636  C CB    . ILE A 100 ? 0.7019 0.5517 0.7199 0.2080  0.1610  -0.0901 98  ILE B CB    
637  C CG1   . ILE A 100 ? 0.6984 0.5288 0.7011 0.1982  0.1718  -0.0949 98  ILE B CG1   
638  C CG2   . ILE A 100 ? 0.6730 0.5295 0.6973 0.2081  0.1541  -0.0869 98  ILE B CG2   
639  C CD1   . ILE A 100 ? 0.6702 0.5131 0.6814 0.1882  0.1711  -0.0986 98  ILE B CD1   
640  N N     . SER A 101 ? 0.8830 0.7275 0.8973 0.2323  0.1518  -0.0773 99  SER B N     
641  C CA    . SER A 101 ? 0.9444 0.8033 0.9689 0.2411  0.1435  -0.0727 99  SER B CA    
642  C C     . SER A 101 ? 0.9494 0.8366 0.9969 0.2371  0.1341  -0.0738 99  SER B C     
643  O O     . SER A 101 ? 0.9743 0.8669 1.0271 0.2283  0.1331  -0.0766 99  SER B O     
644  C CB    . SER A 101 ? 0.9919 0.8343 1.0026 0.2459  0.1440  -0.0679 99  SER B CB    
645  O OG    . SER A 101 ? 1.0039 0.8447 1.0150 0.2381  0.1428  -0.0689 99  SER B OG    
646  N N     . ILE A 102 ? 0.6568 0.7869 0.7152 -0.0278 -0.1128 0.1415  100 ILE B N     
647  C CA    . ILE A 102 ? 0.7079 0.8187 0.7401 -0.0236 -0.1279 0.1235  100 ILE B CA    
648  C C     . ILE A 102 ? 0.7503 0.8621 0.7347 -0.0180 -0.1400 0.1105  100 ILE B C     
649  O O     . ILE A 102 ? 0.7426 0.8423 0.6997 -0.0081 -0.1469 0.0898  100 ILE B O     
650  C CB    . ILE A 102 ? 0.7256 0.8273 0.7723 -0.0360 -0.1373 0.1369  100 ILE B CB    
651  C CG1   . ILE A 102 ? 0.7268 0.8279 0.8183 -0.0404 -0.1231 0.1493  100 ILE B CG1   
652  C CG2   . ILE A 102 ? 0.7174 0.8000 0.7364 -0.0350 -0.1536 0.1214  100 ILE B CG2   
653  C CD1   . ILE A 102 ? 0.7122 0.7979 0.8064 -0.0318 -0.1160 0.1321  100 ILE B CD1   
654  N N     . ALA A 103 ? 0.7485 0.8745 0.7195 -0.0240 -0.1412 0.1230  101 ALA B N     
655  C CA    . ALA A 103 ? 0.7631 0.8876 0.6809 -0.0195 -0.1499 0.1115  101 ALA B CA    
656  C C     . ALA A 103 ? 0.7453 0.8803 0.6484 -0.0063 -0.1392 0.0967  101 ALA B C     
657  O O     . ALA A 103 ? 0.7924 0.9170 0.6477 0.0020  -0.1447 0.0795  101 ALA B O     
658  C CB    . ALA A 103 ? 0.7755 0.9143 0.6826 -0.0303 -0.1512 0.1305  101 ALA B CB    
659  N N     . ALA A 104 ? 0.6773 0.8348 0.6188 -0.0056 -0.1222 0.1046  102 ALA B N     
660  C CA    . ALA A 104 ? 0.6887 0.8673 0.6248 0.0054  -0.1101 0.0930  102 ALA B CA    
661  C C     . ALA A 104 ? 0.6853 0.8451 0.6190 0.0165  -0.1155 0.0718  102 ALA B C     
662  O O     . ALA A 104 ? 0.7271 0.8959 0.6346 0.0291  -0.1116 0.0561  102 ALA B O     
663  C CB    . ALA A 104 ? 0.6848 0.8937 0.6627 0.0013  -0.0913 0.1080  102 ALA B CB    
664  N N     . LYS A 105 ? 0.6482 0.7852 0.6087 0.0143  -0.1206 0.0707  103 LYS B N     
665  C CA    . LYS A 105 ? 0.6074 0.7267 0.5687 0.0246  -0.1251 0.0524  103 LYS B CA    
666  C C     . LYS A 105 ? 0.6550 0.7483 0.5694 0.0294  -0.1419 0.0379  103 LYS B C     
667  O O     . LYS A 105 ? 0.6681 0.7704 0.5738 0.0363  -0.1348 0.0270  103 LYS B O     
668  C CB    . LYS A 105 ? 0.5643 0.6707 0.5573 0.0210  -0.1211 0.0555  103 LYS B CB    
669  C CG    . LYS A 105 ? 0.5263 0.6416 0.5571 0.0134  -0.1046 0.0683  103 LYS B CG    
670  C CD    . LYS A 105 ? 0.5029 0.5993 0.5540 0.0104  -0.0994 0.0688  103 LYS B CD    
671  C CE    . LYS A 105 ? 0.4677 0.5666 0.5490 0.0021  -0.0838 0.0835  103 LYS B CE    
672  N NZ    . LYS A 105 ? 0.4750 0.5629 0.5762 -0.0084 -0.0810 0.1012  103 LYS B NZ    
673  N N     . ASP A 106 ? 0.7069 0.8035 0.5982 0.0273  -0.1487 0.0394  104 ASP B N     
674  C CA    . ASP A 106 ? 0.7977 0.8815 0.6457 0.0198  -0.1568 0.0301  104 ASP B CA    
675  C C     . ASP A 106 ? 0.8655 0.9380 0.6630 0.0280  -0.1524 0.0183  104 ASP B C     
676  O O     . ASP A 106 ? 0.9788 1.0268 0.7394 0.0443  -0.1491 -0.0049 104 ASP B O     
677  C CB    . ASP A 106 ? 0.8574 0.9200 0.6886 0.0094  -0.1712 0.0331  104 ASP B CB    
678  C CG    . ASP A 106 ? 0.9518 1.0191 0.7494 0.0061  -0.1753 0.0392  104 ASP B CG    
679  O OD1   . ASP A 106 ? 0.9589 1.0402 0.7783 0.0054  -0.1696 0.0542  104 ASP B OD1   
680  O OD2   . ASP A 106 ? 1.0527 1.1010 0.7993 0.0004  -0.1836 0.0295  104 ASP B OD2   
681  N N     . ALA A 107 ? 0.7882 0.8823 0.5849 0.0292  -0.1443 0.0285  105 ALA B N     
682  C CA    . ALA A 107 ? 0.8014 0.9157 0.5630 0.0477  -0.1244 0.0159  105 ALA B CA    
683  C C     . ALA A 107 ? 0.7366 0.8781 0.5228 0.0713  -0.1058 0.0034  105 ALA B C     
684  O O     . ALA A 107 ? 0.7753 0.9104 0.5285 0.0929  -0.0939 -0.0158 105 ALA B O     
685  C CB    . ALA A 107 ? 0.8325 0.9786 0.5987 0.0392  -0.1149 0.0351  105 ALA B CB    
686  N N     . LEU A 108 ? 0.6347 0.8033 0.4790 0.0667  -0.1017 0.0151  106 LEU B N     
687  C CA    . LEU A 108 ? 0.5404 0.7327 0.4152 0.0821  -0.0861 0.0064  106 LEU B CA    
688  C C     . LEU A 108 ? 0.5541 0.7153 0.4153 0.0975  -0.0937 -0.0131 106 LEU B C     
689  O O     . LEU A 108 ? 0.5722 0.7426 0.4284 0.1183  -0.0790 -0.0259 106 LEU B O     
690  C CB    . LEU A 108 ? 0.4490 0.6633 0.3802 0.0689  -0.0838 0.0217  106 LEU B CB    
691  C CG    . LEU A 108 ? 0.4258 0.6718 0.3756 0.0560  -0.0709 0.0405  106 LEU B CG    
692  C CD1   . LEU A 108 ? 0.3791 0.6263 0.3743 0.0407  -0.0705 0.0544  106 LEU B CD1   
693  C CD2   . LEU A 108 ? 0.4178 0.7013 0.3700 0.0669  -0.0489 0.0362  106 LEU B CD2   
694  N N     . GLU A 109 ? 0.5639 0.6857 0.4267 0.0848  -0.1126 -0.0126 107 GLU B N     
695  C CA    . GLU A 109 ? 0.5930 0.6797 0.4410 0.0966  -0.1196 -0.0296 107 GLU B CA    
696  C C     . GLU A 109 ? 0.6741 0.7334 0.4571 0.1139  -0.1185 -0.0487 107 GLU B C     
697  O O     . GLU A 109 ? 0.6842 0.7258 0.4492 0.1365  -0.1144 -0.0661 107 GLU B O     
698  C CB    . GLU A 109 ? 0.5935 0.6476 0.4589 0.0741  -0.1350 -0.0206 107 GLU B CB    
699  C CG    . GLU A 109 ? 0.6470 0.6628 0.4980 0.0833  -0.1425 -0.0359 107 GLU B CG    
700  C CD    . GLU A 109 ? 0.6534 0.6814 0.5308 0.1016  -0.1330 -0.0437 107 GLU B CD    
701  O OE1   . GLU A 109 ? 0.6305 0.6936 0.5476 0.0974  -0.1213 -0.0334 107 GLU B OE1   
702  O OE2   . GLU A 109 ? 0.6921 0.6922 0.5485 0.1190  -0.1376 -0.0592 107 GLU B OE2   
703  N N     . ARG A 110 ? 0.7398 0.7913 0.4850 0.1033  -0.1196 -0.0452 108 ARG B N     
704  C CA    . ARG A 110 ? 0.8399 0.8603 0.5192 0.1173  -0.1114 -0.0634 108 ARG B CA    
705  C C     . ARG A 110 ? 0.8309 0.8857 0.5055 0.1472  -0.0817 -0.0715 108 ARG B C     
706  O O     . ARG A 110 ? 0.8956 0.9254 0.5355 0.1715  -0.0681 -0.0898 108 ARG B O     
707  C CB    . ARG A 110 ? 0.9388 0.9450 0.5815 0.0938  -0.1197 -0.0548 108 ARG B CB    
708  C CG    . ARG A 110 ? 1.0823 1.0373 0.6550 0.0960  -0.1185 -0.0731 108 ARG B CG    
709  C CD    . ARG A 110 ? 1.1548 1.0899 0.7083 0.0620  -0.1417 -0.0625 108 ARG B CD    
710  N NE    . ARG A 110 ? 1.1466 1.1231 0.7207 0.0440  -0.1452 -0.0386 108 ARG B NE    
711  C CZ    . ARG A 110 ? 1.1305 1.1219 0.7313 0.0184  -0.1649 -0.0184 108 ARG B CZ    
712  N NH1   . ARG A 110 ? 1.1309 1.0990 0.7423 0.0083  -0.1819 -0.0201 108 ARG B NH1   
713  N NH2   . ARG A 110 ? 1.1117 1.1442 0.7327 0.0087  -0.1650 0.0038  108 ARG B NH2   
714  N N     . HIS A 111 ? 0.7545 0.8658 0.4734 0.1429  -0.0675 -0.0547 109 HIS B N     
715  C CA    . HIS A 111 ? 0.7269 0.8800 0.4641 0.1653  -0.0376 -0.0556 109 HIS B CA    
716  C C     . HIS A 111 ? 0.6960 0.8588 0.4725 0.1827  -0.0335 -0.0613 109 HIS B C     
717  O O     . HIS A 111 ? 0.7185 0.9002 0.4973 0.2086  -0.0110 -0.0667 109 HIS B O     
718  C CB    . HIS A 111 ? 0.6654 0.8751 0.4437 0.1516  -0.0268 -0.0344 109 HIS B CB    
719  C CG    . HIS A 111 ? 0.6877 0.9009 0.4256 0.1448  -0.0188 -0.0283 109 HIS B CG    
720  N ND1   . HIS A 111 ? 0.6507 0.9068 0.4169 0.1299  -0.0107 -0.0079 109 HIS B ND1   
721  C CD2   . HIS A 111 ? 0.7528 0.9291 0.4200 0.1502  -0.0175 -0.0396 109 HIS B CD2   
722  C CE1   . HIS A 111 ? 0.6980 0.9472 0.4158 0.1271  -0.0050 -0.0054 109 HIS B CE1   
723  N NE2   . HIS A 111 ? 0.7633 0.9639 0.4184 0.1387  -0.0091 -0.0250 109 HIS B NE2   
724  N N     . PHE A 112 ? 0.6470 0.7996 0.4562 0.1697  -0.0538 -0.0579 110 PHE B N     
725  C CA    . PHE A 112 ? 0.6270 0.7887 0.4717 0.1842  -0.0518 -0.0615 110 PHE B CA    
726  C C     . PHE A 112 ? 0.7071 0.8225 0.5122 0.2087  -0.0506 -0.0808 110 PHE B C     
727  O O     . PHE A 112 ? 0.7038 0.8339 0.5295 0.2316  -0.0386 -0.0837 110 PHE B O     
728  C CB    . PHE A 112 ? 0.5508 0.7095 0.4346 0.1636  -0.0720 -0.0528 110 PHE B CB    
729  C CG    . PHE A 112 ? 0.5174 0.6893 0.4377 0.1747  -0.0713 -0.0538 110 PHE B CG    
730  C CD1   . PHE A 112 ? 0.4898 0.7152 0.4547 0.1742  -0.0595 -0.0427 110 PHE B CD1   
731  C CD2   . PHE A 112 ? 0.5402 0.6706 0.4492 0.1833  -0.0842 -0.0642 110 PHE B CD2   
732  C CE1   . PHE A 112 ? 0.4960 0.7236 0.4876 0.1739  -0.0575 -0.0414 110 PHE B CE1   
733  C CE2   . PHE A 112 ? 0.5348 0.6763 0.4757 0.1911  -0.0831 -0.0629 110 PHE B CE2   
734  C CZ    . PHE A 112 ? 0.5150 0.7000 0.4940 0.1805  -0.0675 -0.0508 110 PHE B CZ    
735  N N     . GLY A 113 ? 0.7851 0.8432 0.5328 0.2035  -0.0634 -0.0929 111 GLY B N     
736  C CA    . GLY A 113 ? 0.8871 0.8908 0.5885 0.2254  -0.0610 -0.1128 111 GLY B CA    
737  C C     . GLY A 113 ? 0.9655 0.9752 0.6391 0.2575  -0.0291 -0.1220 111 GLY B C     
738  O O     . GLY A 113 ? 1.0155 0.9947 0.6779 0.2797  -0.0199 -0.1313 111 GLY B O     
739  N N     . GLU A 114 ? 0.9787 1.0273 0.6495 0.2568  -0.0110 -0.1140 112 GLU B N     
740  C CA    . GLU A 114 ? 1.0151 1.0738 0.6724 0.2819  0.0213  -0.1153 112 GLU B CA    
741  C C     . GLU A 114 ? 0.9520 1.0858 0.6766 0.2974  0.0420  -0.0986 112 GLU B C     
742  O O     . GLU A 114 ? 0.9651 1.1067 0.6944 0.3181  0.0655  -0.0950 112 GLU B O     
743  C CB    . GLU A 114 ? 1.0521 1.1036 0.6641 0.2696  0.0297  -0.1143 112 GLU B CB    
744  C CG    . GLU A 114 ? 1.0094 1.1218 0.6514 0.2514  0.0290  -0.0966 112 GLU B CG    
745  C CD    . GLU A 114 ? 1.0794 1.1718 0.6722 0.2312  0.0265  -0.0947 112 GLU B CD    
746  O OE1   . GLU A 114 ? 1.1553 1.1838 0.6887 0.2262  0.0199  -0.1086 112 GLU B OE1   
747  O OE2   . GLU A 114 ? 1.0593 1.1996 0.6734 0.2181  0.0309  -0.0779 112 GLU B OE2   
748  N N     . GLN A 115 ? 0.8961 1.0829 0.6764 0.2826  0.0319  -0.0852 113 GLN B N     
749  C CA    . GLN A 115 ? 0.8701 1.1278 0.7176 0.2875  0.0460  -0.0658 113 GLN B CA    
750  C C     . GLN A 115 ? 0.7917 1.0754 0.6928 0.2659  0.0243  -0.0561 113 GLN B C     
751  O O     . GLN A 115 ? 0.7367 1.0384 0.6543 0.2370  0.0144  -0.0456 113 GLN B O     
752  C CB    . GLN A 115 ? 0.8853 1.1888 0.7397 0.2812  0.0653  -0.0517 113 GLN B CB    
753  C CG    . GLN A 115 ? 0.8511 1.2184 0.7703 0.2773  0.0750  -0.0290 113 GLN B CG    
754  C CD    . GLN A 115 ? 0.8962 1.2597 0.8252 0.3006  0.0887  -0.0264 113 GLN B CD    
755  O OE1   . GLN A 115 ? 0.8868 1.2341 0.8304 0.3056  0.0780  -0.0291 113 GLN B OE1   
756  N NE2   . GLN A 115 ? 0.9453 1.3236 0.8671 0.3146  0.1135  -0.0198 113 GLN B NE2   
757  N N     . ASN A 116 ? 0.7893 1.0627 0.7139 0.2717  0.0151  -0.0561 114 ASN B N     
758  C CA    . ASN A 116 ? 0.7218 1.0090 0.6899 0.2461  -0.0045 -0.0461 114 ASN B CA    
759  C C     . ASN A 116 ? 0.6586 1.0006 0.6697 0.2233  0.0025  -0.0260 114 ASN B C     
760  O O     . ASN A 116 ? 0.6174 0.9669 0.6465 0.1953  -0.0081 -0.0192 114 ASN B O     
761  C CB    . ASN A 116 ? 0.7518 1.0118 0.7279 0.2508  -0.0114 -0.0479 114 ASN B CB    
762  C CG    . ASN A 116 ? 0.8199 1.0164 0.7514 0.2680  -0.0208 -0.0671 114 ASN B CG    
763  O OD1   . ASN A 116 ? 0.8768 1.0432 0.7628 0.2790  -0.0194 -0.0817 114 ASN B OD1   
764  N ND2   . ASN A 116 ? 0.8172 0.9871 0.7560 0.2669  -0.0298 -0.0677 114 ASN B ND2   
765  N N     . LYS A 117 ? 0.6500 1.0237 0.6767 0.2332  0.0200  -0.0155 115 LYS B N     
766  C CA    . LYS A 117 ? 0.5793 1.0010 0.6434 0.2124  0.0256  0.0035  115 LYS B CA    
767  C C     . LYS A 117 ? 0.5905 1.0419 0.6454 0.2180  0.0440  0.0096  115 LYS B C     
768  O O     . LYS A 117 ? 0.6420 1.1109 0.6980 0.2370  0.0623  0.0154  115 LYS B O     
769  C CB    . LYS A 117 ? 0.5444 0.9863 0.6398 0.2165  0.0297  0.0150  115 LYS B CB    
770  C CG    . LYS A 117 ? 0.4973 0.9105 0.6011 0.2116  0.0139  0.0107  115 LYS B CG    
771  C CD    . LYS A 117 ? 0.4497 0.8942 0.5930 0.2025  0.0128  0.0266  115 LYS B CD    
772  C CE    . LYS A 117 ? 0.4046 0.8831 0.5707 0.1737  0.0105  0.0396  115 LYS B CE    
773  N N     . PRO A 118 ? 0.5432 1.0001 0.5898 0.2016  0.0410  0.0103  116 PRO B N     
774  C CA    . PRO A 118 ? 0.5448 1.0275 0.5805 0.2038  0.0590  0.0176  116 PRO B CA    
775  C C     . PRO A 118 ? 0.5067 1.0329 0.5815 0.1845  0.0646  0.0386  116 PRO B C     
776  O O     . PRO A 118 ? 0.4671 1.0002 0.5718 0.1617  0.0522  0.0463  116 PRO B O     
777  C CB    . PRO A 118 ? 0.5459 1.0175 0.5615 0.1898  0.0512  0.0127  116 PRO B CB    
778  C CG    . PRO A 118 ? 0.5182 0.9777 0.5600 0.1671  0.0291  0.0139  116 PRO B CG    
779  C CD    . PRO A 118 ? 0.5224 0.9614 0.5723 0.1778  0.0219  0.0074  116 PRO B CD    
780  N N     . SER A 119 ? 0.5103 1.0604 0.5800 0.1936  0.0841  0.0468  117 SER B N     
781  C CA    . SER A 119 ? 0.4546 1.0467 0.5601 0.1784  0.0903  0.0670  117 SER B CA    
782  C C     . SER A 119 ? 0.4392 1.0385 0.5558 0.1440  0.0804  0.0759  117 SER B C     
783  O O     . SER A 119 ? 0.4616 1.0389 0.5580 0.1347  0.0733  0.0689  117 SER B O     
784  C CB    . SER A 119 ? 0.4462 1.0587 0.5424 0.1984  0.1151  0.0737  117 SER B CB    
785  O OG    . SER A 119 ? 0.4345 1.0387 0.4997 0.1940  0.1222  0.0713  117 SER B OG    
786  N N     . SER A 120 ? 0.4196 1.0485 0.5686 0.1251  0.0800  0.0923  118 SER B N     
787  C CA    . SER A 120 ? 0.4171 1.0477 0.5741 0.0931  0.0733  0.1014  118 SER B CA    
788  C C     . SER A 120 ? 0.4681 1.1026 0.6048 0.0936  0.0854  0.1051  118 SER B C     
789  O O     . SER A 120 ? 0.4639 1.0861 0.5973 0.0708  0.0793  0.1090  118 SER B O     
790  C CB    . SER A 120 ? 0.4222 1.0831 0.6135 0.0747  0.0713  0.1177  118 SER B CB    
791  O OG    . SER A 120 ? 0.4156 1.0657 0.6113 0.0426  0.0620  0.1230  118 SER B OG    
792  N N     . GLN A 121 ? 0.5213 1.1683 0.6422 0.1193  0.1038  0.1045  119 GLN B N     
793  C CA    . GLN A 121 ? 0.5724 1.2185 0.6664 0.1214  0.1167  0.1069  119 GLN B CA    
794  C C     . GLN A 121 ? 0.6035 1.2138 0.6536 0.1320  0.1139  0.0905  119 GLN B C     
795  O O     . GLN A 121 ? 0.6150 1.2147 0.6449 0.1190  0.1130  0.0934  119 GLN B O     
796  C CB    . GLN A 121 ? 0.6313 1.3020 0.7230 0.1434  0.1402  0.1134  119 GLN B CB    
797  N N     . GLU A 122 ? 0.6328 1.2217 0.6658 0.1549  0.1120  0.0741  120 GLU B N     
798  C CA    . GLU A 122 ? 0.6425 1.1927 0.6304 0.1627  0.1058  0.0571  120 GLU B CA    
799  C C     . GLU A 122 ? 0.5941 1.1359 0.5929 0.1370  0.0866  0.0594  120 GLU B C     
800  O O     . GLU A 122 ? 0.5994 1.1177 0.5616 0.1319  0.0822  0.0555  120 GLU B O     
801  C CB    . GLU A 122 ? 0.6654 1.1881 0.6353 0.1904  0.1049  0.0386  120 GLU B CB    
802  C CG    . GLU A 122 ? 0.7518 1.2596 0.6874 0.2192  0.1262  0.0311  120 GLU B CG    
803  C CD    . GLU A 122 ? 0.8336 1.2866 0.7228 0.2419  0.1228  0.0076  120 GLU B CD    
804  O OE1   . GLU A 122 ? 0.8548 1.2727 0.7121 0.2333  0.1057  -0.0047 120 GLU B OE1   
805  O OE2   . GLU A 122 ? 0.8827 1.3239 0.7660 0.2669  0.1364  0.0022  120 GLU B OE2   
806  N N     . ILE A 123 ? 0.5643 1.1174 0.6068 0.1186  0.0746  0.0667  121 ILE B N     
807  C CA    . ILE A 123 ? 0.5893 1.1271 0.6437 0.0937  0.0586  0.0696  121 ILE B CA    
808  C C     . ILE A 123 ? 0.6468 1.1886 0.6980 0.0721  0.0625  0.0849  121 ILE B C     
809  O O     . ILE A 123 ? 0.7061 1.2307 0.7453 0.0610  0.0560  0.0875  121 ILE B O     
810  C CB    . ILE A 123 ? 0.5958 1.1284 0.6846 0.0774  0.0463  0.0717  121 ILE B CB    
811  C CG1   . ILE A 123 ? 0.6119 1.1277 0.6996 0.0952  0.0378  0.0569  121 ILE B CG1   
812  C CG2   . ILE A 123 ? 0.1929 0.7023 0.2915 0.0484  0.0353  0.0777  121 ILE B CG2   
813  C CD1   . ILE A 123 ? 0.1983 0.7086 0.3120 0.0810  0.0288  0.0593  121 ILE B CD1   
814  N N     . MET A 124 ? 0.6360 1.1996 0.6987 0.0660  0.0730  0.0971  122 MET B N     
815  C CA    . MET A 124 ? 0.6403 1.2035 0.6997 0.0470  0.0764  0.1116  122 MET B CA    
816  C C     . MET A 124 ? 0.6469 1.2034 0.6632 0.0586  0.0848  0.1106  122 MET B C     
817  O O     . MET A 124 ? 0.6367 1.1802 0.6416 0.0433  0.0814  0.1209  122 MET B O     
818  C CB    . MET A 124 ? 0.6726 1.2605 0.7561 0.0370  0.0846  0.1244  122 MET B CB    
819  C CG    . MET A 124 ? 0.6956 1.2740 0.8083 0.0113  0.0736  0.1298  122 MET B CG    
820  S SD    . MET A 124 ? 0.7757 1.3890 0.9177 0.0020  0.0807  0.1426  122 MET B SD    
821  C CE    . MET A 124 ? 0.7944 1.4103 0.9293 -0.0113 0.0908  0.1576  122 MET B CE    
822  N N     . ARG A 125 ? 0.6544 1.2113 0.6414 0.0852  0.0951  0.0982  123 ARG B N     
823  C CA    . ARG A 125 ? 0.6630 1.1974 0.5942 0.0947  0.1008  0.0935  123 ARG B CA    
824  C C     . ARG A 125 ? 0.6438 1.1402 0.5408 0.0885  0.0821  0.0869  123 ARG B C     
825  O O     . ARG A 125 ? 0.6884 1.1626 0.5505 0.0787  0.0759  0.0930  123 ARG B O     
826  C CB    . ARG A 125 ? 0.6882 1.2173 0.5907 0.1247  0.1163  0.0788  123 ARG B CB    
827  C CG    . ARG A 125 ? 0.7285 1.2083 0.5606 0.1371  0.1132  0.0616  123 ARG B CG    
828  C CD    . ARG A 125 ? 0.7768 1.2468 0.5677 0.1344  0.1253  0.0670  123 ARG B CD    
829  N NE    . ARG A 125 ? 0.8015 1.3062 0.6147 0.1451  0.1500  0.0752  123 ARG B NE    
830  C CZ    . ARG A 125 ? 0.8646 1.3666 0.6459 0.1470  0.1666  0.0799  123 ARG B CZ    
831  N NH1   . ARG A 125 ? 0.9083 1.3727 0.6316 0.1375  0.1597  0.0768  123 ARG B NH1   
832  N NH2   . ARG A 125 ? 0.8779 1.4139 0.6844 0.1569  0.1889  0.0889  123 ARG B NH2   
833  N N     . MET A 126 ? 0.6025 1.0827 0.5134 0.0914  0.0676  0.0757  124 MET B N     
834  C CA    . MET A 126 ? 0.6059 1.0349 0.4964 0.0822  0.0416  0.0694  124 MET B CA    
835  C C     . MET A 126 ? 0.5609 0.9888 0.4869 0.0557  0.0303  0.0876  124 MET B C     
836  O O     . MET A 126 ? 0.5769 0.9756 0.4854 0.0444  0.0146  0.0945  124 MET B O     
837  C CB    . MET A 126 ? 0.6061 1.0079 0.4977 0.0963  0.0295  0.0492  124 MET B CB    
838  C CG    . MET A 126 ? 0.6075 1.0353 0.5542 0.0955  0.0310  0.0499  124 MET B CG    
839  S SD    . MET A 126 ? 0.6651 1.0572 0.6096 0.1115  0.0152  0.0287  124 MET B SD    
840  C CE    . MET A 126 ? 0.6963 1.0885 0.6002 0.1459  0.0343  0.0130  124 MET B CE    
841  N N     . ALA A 127 ? 0.4759 0.9335 0.4509 0.0453  0.0380  0.0965  125 ALA B N     
842  C CA    . ALA A 127 ? 0.4780 0.9292 0.4825 0.0212  0.0326  0.1135  125 ALA B CA    
843  C C     . ALA A 127 ? 0.5049 0.9576 0.4920 0.0099  0.0368  0.1330  125 ALA B C     
844  O O     . ALA A 127 ? 0.2604 0.6906 0.2555 -0.0043 0.0271  0.1465  125 ALA B O     
845  C CB    . ALA A 127 ? 0.4886 0.9710 0.5378 0.0095  0.0429  0.1195  125 ALA B CB    
846  N N     . GLU A 128 ? 0.5252 1.0052 0.4893 0.0173  0.0527  0.1367  126 GLU B N     
847  C CA    . GLU A 128 ? 0.5177 0.9912 0.4638 0.0078  0.0536  0.1521  126 GLU B CA    
848  C C     . GLU A 128 ? 0.5201 0.9612 0.4160 0.0118  0.0378  0.1493  126 GLU B C     
849  O O     . GLU A 128 ? 0.3710 0.7965 0.2627 -0.0015 0.0283  0.1653  126 GLU B O     
850  C CB    . GLU A 128 ? 0.5494 1.0486 0.4920 0.0143  0.0720  0.1526  126 GLU B CB    
851  N N     . GLU A 129 ? 0.5531 0.9780 0.4122 0.0293  0.0325  0.1279  127 GLU B N     
852  C CA    . GLU A 129 ? 0.6262 1.0085 0.4376 0.0293  0.0122  0.1210  127 GLU B CA    
853  C C     . GLU A 129 ? 0.5708 0.9280 0.4046 0.0147  -0.0127 0.1308  127 GLU B C     
854  O O     . GLU A 129 ? 0.5644 0.8921 0.3769 0.0052  -0.0302 0.1362  127 GLU B O     
855  C CB    . GLU A 129 ? 0.7240 1.0841 0.4939 0.0504  0.0118  0.0932  127 GLU B CB    
856  C CG    . GLU A 129 ? 0.8250 1.1995 0.5685 0.0684  0.0381  0.0829  127 GLU B CG    
857  C CD    . GLU A 129 ? 0.9050 1.2505 0.6108 0.0917  0.0404  0.0556  127 GLU B CD    
858  O OE1   . GLU A 129 ? 0.9299 1.2349 0.6152 0.0898  0.0175  0.0438  127 GLU B OE1   
859  O OE2   . GLU A 129 ? 0.9341 1.2950 0.6349 0.1116  0.0651  0.0472  127 GLU B OE2   
860  N N     . LEU A 130 ? 0.5399 0.9021 0.4224 0.0123  -0.0135 0.1312  128 LEU B N     
861  C CA    . LEU A 130 ? 0.5167 0.8545 0.4261 0.0015  -0.0326 0.1404  128 LEU B CA    
862  C C     . LEU A 130 ? 0.5042 0.8527 0.4578 -0.0138 -0.0251 0.1656  128 LEU B C     
863  O O     . LEU A 130 ? 0.5148 0.8437 0.4932 -0.0211 -0.0366 0.1772  128 LEU B O     
864  C CB    . LEU A 130 ? 0.4764 0.7986 0.4060 0.0101  -0.0388 0.1207  128 LEU B CB    
865  C CG    . LEU A 130 ? 0.5201 0.8330 0.4162 0.0290  -0.0394 0.0937  128 LEU B CG    
866  C CD1   . LEU A 130 ? 0.4886 0.7918 0.4148 0.0352  -0.0435 0.0800  128 LEU B CD1   
867  C CD2   . LEU A 130 ? 0.5967 0.8770 0.4395 0.0300  -0.0583 0.0874  128 LEU B CD2   
868  N N     . ASN A 131 ? 0.4537 0.8308 0.4180 -0.0184 -0.0046 0.1751  129 ASN B N     
869  C CA    . ASN A 131 ? 0.4301 0.8112 0.4319 -0.0337 0.0051  0.1981  129 ASN B CA    
870  C C     . ASN A 131 ? 0.3791 0.7448 0.4204 -0.0375 0.0066  0.1923  129 ASN B C     
871  O O     . ASN A 131 ? 0.3669 0.7084 0.4329 -0.0447 0.0033  0.2052  129 ASN B O     
872  C CB    . ASN A 131 ? 0.4721 0.8335 0.4762 -0.0410 -0.0064 0.2164  129 ASN B CB    
873  C CG    . ASN A 131 ? 0.4933 0.8500 0.5326 -0.0505 0.0040  0.2317  129 ASN B CG    
874  O OD1   . ASN A 131 ? 0.4984 0.8635 0.5487 -0.0532 0.0183  0.2267  129 ASN B OD1   
875  N ND2   . ASN A 131 ? 0.5023 0.8400 0.5584 -0.0541 -0.0049 0.2471  129 ASN B ND2   
876  N N     . LEU A 132 ? 0.3588 0.7357 0.4058 -0.0310 0.0116  0.1712  130 LEU B N     
877  C CA    . LEU A 132 ? 0.3028 0.6662 0.3802 -0.0360 0.0130  0.1633  130 LEU B CA    
878  C C     . LEU A 132 ? 0.2327 0.6130 0.3213 -0.0408 0.0248  0.1552  130 LEU B C     
879  O O     . LEU A 132 ? 0.2181 0.6290 0.2961 -0.0359 0.0322  0.1537  130 LEU B O     
880  C CB    . LEU A 132 ? 0.3116 0.6579 0.3827 -0.0227 -0.0018 0.1422  130 LEU B CB    
881  C CG    . LEU A 132 ? 0.3156 0.6295 0.3803 -0.0196 -0.0197 0.1461  130 LEU B CG    
882  C CD1   . LEU A 132 ? 0.3110 0.6128 0.3602 -0.0056 -0.0336 0.1239  130 LEU B CD1   
883  C CD2   . LEU A 132 ? 0.2944 0.5836 0.3908 -0.0298 -0.0170 0.1597  130 LEU B CD2   
884  N N     . GLU A 133 ? 0.2307 0.5809 0.3353 -0.0495 0.0245  0.1482  131 GLU B N     
885  C CA    . GLU A 133 ? 0.2940 0.6515 0.4051 -0.0566 0.0304  0.1395  131 GLU B CA    
886  C C     . GLU A 133 ? 0.3423 0.7319 0.4526 -0.0447 0.0278  0.1261  131 GLU B C     
887  O O     . GLU A 133 ? 0.3687 0.7631 0.4752 -0.0318 0.0210  0.1181  131 GLU B O     
888  C CB    . GLU A 133 ? 0.2885 0.6048 0.4093 -0.0702 0.0314  0.1345  131 GLU B CB    
889  C CG    . GLU A 133 ? 0.2075 0.4913 0.3293 -0.0803 0.0392  0.1447  131 GLU B CG    
890  N N     . LYS A 134 ? 0.3384 0.7505 0.4542 -0.0479 0.0331  0.1245  132 LYS B N     
891  C CA    . LYS A 134 ? 0.3324 0.7746 0.4503 -0.0340 0.0322  0.1144  132 LYS B CA    
892  C C     . LYS A 134 ? 0.2985 0.7214 0.4234 -0.0344 0.0226  0.1019  132 LYS B C     
893  O O     . LYS A 134 ? 0.2816 0.7141 0.4033 -0.0171 0.0183  0.0916  132 LYS B O     
894  C CB    . LYS A 134 ? 0.3690 0.8400 0.4970 -0.0392 0.0395  0.1201  132 LYS B CB    
895  N N     . GLU A 135 ? 0.3040 0.6967 0.4359 -0.0532 0.0199  0.1020  133 GLU B N     
896  C CA    . GLU A 135 ? 0.3275 0.7015 0.4633 -0.0556 0.0115  0.0910  133 GLU B CA    
897  C C     . GLU A 135 ? 0.3051 0.6565 0.4352 -0.0436 0.0047  0.0840  133 GLU B C     
898  O O     . GLU A 135 ? 0.2821 0.6321 0.4118 -0.0327 -0.0028 0.0729  133 GLU B O     
899  C CB    . GLU A 135 ? 0.3810 0.7264 0.5200 -0.0790 0.0124  0.0924  133 GLU B CB    
900  C CG    . GLU A 135 ? 0.4467 0.8147 0.5935 -0.0916 0.0114  0.0941  133 GLU B CG    
901  C CD    . GLU A 135 ? 0.4834 0.8594 0.6337 -0.0885 0.0017  0.0857  133 GLU B CD    
902  O OE1   . GLU A 135 ? 0.4906 0.8351 0.6353 -0.0968 -0.0035 0.0787  133 GLU B OE1   
903  O OE2   . GLU A 135 ? 0.4989 0.9112 0.6573 -0.0768 0.0003  0.0870  133 GLU B OE2   
904  N N     . VAL A 136 ? 0.3195 0.6511 0.4463 -0.0453 0.0063  0.0918  134 VAL B N     
905  C CA    . VAL A 136 ? 0.3208 0.6305 0.4463 -0.0360 -0.0021 0.0883  134 VAL B CA    
906  C C     . VAL A 136 ? 0.3488 0.6779 0.4646 -0.0144 -0.0101 0.0784  134 VAL B C     
907  O O     . VAL A 136 ? 0.3536 0.6604 0.4651 -0.0047 -0.0203 0.0672  134 VAL B O     
908  C CB    . VAL A 136 ? 0.2953 0.5841 0.4225 -0.0414 0.0008  0.1040  134 VAL B CB    
909  C CG1   . VAL A 136 ? 0.3021 0.5605 0.4324 -0.0582 0.0112  0.1096  134 VAL B CG1   
910  C CG2   . VAL A 136 ? 0.3110 0.6294 0.4311 -0.0356 0.0026  0.1151  134 VAL B CG2   
911  N N     . VAL A 137 ? 0.3402 0.7060 0.4489 -0.0055 -0.0046 0.0815  135 VAL B N     
912  C CA    . VAL A 137 ? 0.3645 0.7460 0.4586 0.0181  -0.0102 0.0700  135 VAL B CA    
913  C C     . VAL A 137 ? 0.3908 0.7772 0.4890 0.0268  -0.0089 0.0576  135 VAL B C     
914  O O     . VAL A 137 ? 0.4119 0.7863 0.4999 0.0444  -0.0163 0.0447  135 VAL B O     
915  C CB    . VAL A 137 ? 0.1613 0.5656 0.2344 0.0261  -0.0004 0.0753  135 VAL B CB    
916  C CG1   . VAL A 137 ? 0.1858 0.5822 0.2276 0.0507  -0.0042 0.0597  135 VAL B CG1   
917  C CG2   . VAL A 137 ? 0.3329 0.7178 0.3956 0.0136  -0.0021 0.0898  135 VAL B CG2   
918  N N     . ARG A 138 ? 0.3781 0.7787 0.4899 0.0140  -0.0015 0.0631  136 ARG B N     
919  C CA    . ARG A 138 ? 0.3249 0.7333 0.4446 0.0193  -0.0027 0.0567  136 ARG B CA    
920  C C     . ARG A 138 ? 0.2677 0.6385 0.3885 0.0168  -0.0143 0.0468  136 ARG B C     
921  O O     . ARG A 138 ? 0.1336 0.4991 0.2518 0.0321  -0.0190 0.0376  136 ARG B O     
922  C CB    . ARG A 138 ? 0.3089 0.7387 0.4434 0.0018  0.0031  0.0673  136 ARG B CB    
923  C CG    . ARG A 138 ? 0.1554 0.6070 0.3022 0.0075  0.0023  0.0666  136 ARG B CG    
924  C CD    . ARG A 138 ? 0.3130 0.7806 0.4745 -0.0151 0.0032  0.0778  136 ARG B CD    
925  N NE    . ARG A 138 ? 0.2941 0.7303 0.4553 -0.0364 -0.0055 0.0749  136 ARG B NE    
926  C CZ    . ARG A 138 ? 0.1526 0.5754 0.3156 -0.0367 -0.0148 0.0681  136 ARG B CZ    
927  N NH1   . ARG A 138 ? 0.1531 0.5891 0.3209 -0.0169 -0.0171 0.0640  136 ARG B NH1   
928  N NH2   . ARG A 138 ? 0.1518 0.5465 0.3105 -0.0565 -0.0210 0.0657  136 ARG B NH2   
929  N N     . VAL A 139 ? 0.2364 0.5797 0.3606 -0.0019 -0.0173 0.0497  137 VAL B N     
930  C CA    . VAL A 139 ? 0.2263 0.5346 0.3505 -0.0047 -0.0264 0.0416  137 VAL B CA    
931  C C     . VAL A 139 ? 0.2481 0.5298 0.3611 0.0119  -0.0342 0.0332  137 VAL B C     
932  O O     . VAL A 139 ? 0.2300 0.4882 0.3411 0.0175  -0.0419 0.0248  137 VAL B O     
933  C CB    . VAL A 139 ? 0.1992 0.4863 0.3277 -0.0267 -0.0244 0.0478  137 VAL B CB    
934  C CG1   . VAL A 139 ? 0.1029 0.3591 0.2301 -0.0294 -0.0318 0.0405  137 VAL B CG1   
935  C CG2   . VAL A 139 ? 0.2049 0.5112 0.3393 -0.0454 -0.0182 0.0552  137 VAL B CG2   
936  N N     . TRP A 140 ? 0.2554 0.5390 0.3596 0.0183  -0.0338 0.0366  138 TRP B N     
937  C CA    . TRP A 140 ? 0.2533 0.5086 0.3432 0.0311  -0.0441 0.0294  138 TRP B CA    
938  C C     . TRP A 140 ? 0.2788 0.5356 0.3596 0.0494  -0.0474 0.0172  138 TRP B C     
939  O O     . TRP A 140 ? 0.3130 0.5370 0.3898 0.0528  -0.0559 0.0104  138 TRP B O     
940  C CB    . TRP A 140 ? 0.2653 0.5292 0.3429 0.0341  -0.0453 0.0366  138 TRP B CB    
941  C CG    . TRP A 140 ? 0.2963 0.5230 0.3577 0.0395  -0.0591 0.0325  138 TRP B CG    
942  C CD1   . TRP A 140 ? 0.2944 0.4909 0.3609 0.0294  -0.0652 0.0405  138 TRP B CD1   
943  C CD2   . TRP A 140 ? 0.3219 0.5365 0.3592 0.0556  -0.0681 0.0202  138 TRP B CD2   
944  N NE1   . TRP A 140 ? 0.3222 0.4893 0.3718 0.0349  -0.0795 0.0350  138 TRP B NE1   
945  C CE2   . TRP A 140 ? 0.3454 0.5206 0.3744 0.0492  -0.0819 0.0227  138 TRP B CE2   
946  C CE3   . TRP A 140 ? 0.3224 0.5562 0.3442 0.0762  -0.0653 0.0080  138 TRP B CE3   
947  C CZ2   . TRP A 140 ? 0.3846 0.5360 0.3872 0.0574  -0.0939 0.0135  138 TRP B CZ2   
948  C CZ3   . TRP A 140 ? 0.3487 0.5557 0.3406 0.0903  -0.0763 -0.0040 138 TRP B CZ3   
949  C CH2   . TRP A 140 ? 0.3894 0.5533 0.3702 0.0785  -0.0908 -0.0018 138 TRP B CH2   
950  N N     . PHE A 141 ? 0.2873 0.5836 0.3658 0.0620  -0.0391 0.0166  139 PHE B N     
951  C CA    . PHE A 141 ? 0.3250 0.6266 0.3964 0.0836  -0.0392 0.0066  139 PHE B CA    
952  C C     . PHE A 141 ? 0.3618 0.6520 0.4486 0.0773  -0.0417 0.0058  139 PHE B C     
953  O O     . PHE A 141 ? 0.3955 0.6690 0.4763 0.0904  -0.0465 -0.0017 139 PHE B O     
954  C CB    . PHE A 141 ? 0.3247 0.6754 0.3948 0.1004  -0.0258 0.0092  139 PHE B CB    
955  C CG    . PHE A 141 ? 0.3249 0.6857 0.3695 0.1188  -0.0253 0.0053  139 PHE B CG    
956  C CD1   . PHE A 141 ? 0.3478 0.6832 0.3609 0.1434  -0.0281 -0.0093 139 PHE B CD1   
957  C CD2   . PHE A 141 ? 0.3025 0.6757 0.3421 0.1054  -0.0201 0.0156  139 PHE B CD2   
958  C CE1   . PHE A 141 ? 0.3731 0.6843 0.3417 0.1492  -0.0252 -0.0151 139 PHE B CE1   
959  C CE2   . PHE A 141 ? 0.3243 0.6782 0.3233 0.1122  -0.0177 0.0118  139 PHE B CE2   
960  C CZ    . PHE A 141 ? 0.3654 0.6877 0.3266 0.1331  -0.0208 -0.0042 139 PHE B CZ    
961  N N     . CYS A 142 ? 0.3546 0.6540 0.4588 0.0577  -0.0395 0.0139  140 CYS B N     
962  C CA    . CYS A 142 ? 0.3530 0.6417 0.4683 0.0503  -0.0450 0.0138  140 CYS B CA    
963  C C     . CYS A 142 ? 0.3190 0.5609 0.4269 0.0480  -0.0550 0.0082  140 CYS B C     
964  O O     . CYS A 142 ? 0.3235 0.5523 0.4301 0.0562  -0.0601 0.0048  140 CYS B O     
965  C CB    . CYS A 142 ? 0.3763 0.6800 0.5044 0.0283  -0.0428 0.0219  140 CYS B CB    
966  S SG    . CYS A 142 ? 0.4208 0.7794 0.5614 0.0259  -0.0317 0.0331  140 CYS B SG    
967  N N     . ASN A 143 ? 0.2805 0.4988 0.3852 0.0368  -0.0570 0.0097  141 ASN B N     
968  C CA    . ASN A 143 ? 0.2624 0.4394 0.3627 0.0340  -0.0651 0.0082  141 ASN B CA    
969  C C     . ASN A 143 ? 0.2625 0.4237 0.3487 0.0474  -0.0689 0.0045  141 ASN B C     
970  O O     . ASN A 143 ? 0.2761 0.4142 0.3579 0.0470  -0.0724 0.0050  141 ASN B O     
971  C CB    . ASN A 143 ? 0.2467 0.4088 0.3497 0.0233  -0.0646 0.0115  141 ASN B CB    
972  C CG    . ASN A 143 ? 0.2455 0.4215 0.3567 0.0082  -0.0585 0.0143  141 ASN B CG    
973  O OD1   . ASN A 143 ? 0.2694 0.4511 0.3831 0.0033  -0.0604 0.0122  141 ASN B OD1   
974  N ND2   . ASN A 143 ? 0.1975 0.3790 0.3126 -0.0025 -0.0512 0.0230  141 ASN B ND2   
975  N N     . ARG A 144 ? 0.2646 0.4412 0.3397 0.0595  -0.0669 0.0003  142 ARG B N     
976  C CA    . ARG A 144 ? 0.3028 0.4640 0.3580 0.0753  -0.0723 -0.0085 142 ARG B CA    
977  C C     . ARG A 144 ? 0.3409 0.5053 0.3944 0.0906  -0.0715 -0.0159 142 ARG B C     
978  O O     . ARG A 144 ? 0.3594 0.4960 0.4009 0.0973  -0.0776 -0.0223 142 ARG B O     
979  C CB    . ARG A 144 ? 0.3440 0.5241 0.3819 0.0884  -0.0716 -0.0127 142 ARG B CB    
980  C CG    . ARG A 144 ? 0.4083 0.5645 0.4159 0.1059  -0.0813 -0.0248 142 ARG B CG    
981  C CD    . ARG A 144 ? 0.4351 0.5488 0.4389 0.0905  -0.0923 -0.0215 142 ARG B CD    
982  N NE    . ARG A 144 ? 0.4859 0.5710 0.4560 0.1044  -0.1045 -0.0340 142 ARG B NE    
983  C CZ    . ARG A 144 ? 0.4870 0.5488 0.4454 0.1189  -0.1094 -0.0460 142 ARG B CZ    
984  N NH1   . ARG A 144 ? 0.4546 0.5238 0.4345 0.1194  -0.1019 -0.0449 142 ARG B NH1   
985  N NH2   . ARG A 144 ? 0.5229 0.5496 0.4433 0.1309  -0.1230 -0.0582 142 ARG B NH2   
986  N N     . ARG A 145 ? 0.3437 0.5427 0.4102 0.0959  -0.0641 -0.0135 143 ARG B N     
987  C CA    . ARG A 145 ? 0.3317 0.5371 0.4017 0.1105  -0.0632 -0.0161 143 ARG B CA    
988  C C     . ARG A 145 ? 0.3100 0.4910 0.3889 0.0970  -0.0695 -0.0115 143 ARG B C     
989  O O     . ARG A 145 ? 0.3291 0.4927 0.4010 0.1074  -0.0729 -0.0157 143 ARG B O     
990  C CB    . ARG A 145 ? 0.3512 0.6033 0.4389 0.1154  -0.0537 -0.0091 143 ARG B CB    
991  C CG    . ARG A 145 ? 0.3986 0.6777 0.4747 0.1412  -0.0434 -0.0132 143 ARG B CG    
992  C CD    . ARG A 145 ? 0.4035 0.7315 0.5025 0.1417  -0.0320 -0.0014 143 ARG B CD    
993  N NE    . ARG A 145 ? 0.4160 0.7703 0.5171 0.1310  -0.0250 0.0045  143 ARG B NE    
994  C CZ    . ARG A 145 ? 0.4405 0.8322 0.5631 0.1192  -0.0182 0.0173  143 ARG B CZ    
995  N NH1   . ARG A 145 ? 0.4706 0.8797 0.6155 0.1168  -0.0193 0.0253  143 ARG B NH1   
996  N NH2   . ARG A 145 ? 0.4243 0.8362 0.5467 0.1086  -0.0116 0.0233  143 ARG B NH2   
997  N N     . GLN A 146 ? 0.2920 0.4712 0.3836 0.0753  -0.0710 -0.0029 144 GLN B N     
998  C CA    . GLN A 146 ? 0.2944 0.4539 0.3900 0.0637  -0.0760 0.0027  144 GLN B CA    
999  C C     . GLN A 146 ? 0.2924 0.4187 0.3717 0.0641  -0.0773 -0.0006 144 GLN B C     
1000 O O     . GLN A 146 ? 0.3014 0.4154 0.3772 0.0659  -0.0800 -0.0019 144 GLN B O     
1001 C CB    . GLN A 146 ? 0.3038 0.4648 0.4089 0.0438  -0.0780 0.0092  144 GLN B CB    
1002 C CG    . GLN A 146 ? 0.3334 0.5264 0.4532 0.0409  -0.0789 0.0098  144 GLN B CG    
1003 C CD    . GLN A 146 ? 0.3728 0.5714 0.5010 0.0424  -0.0861 0.0131  144 GLN B CD    
1004 O OE1   . GLN A 146 ? 0.3940 0.5775 0.5203 0.0311  -0.0939 0.0142  144 GLN B OE1   
1005 N NE2   . GLN A 146 ? 0.3938 0.6165 0.5308 0.0584  -0.0838 0.0142  144 GLN B NE2   
1006 N N     . ARG A 147 ? 0.3095 0.4232 0.3790 0.0634  -0.0766 -0.0034 145 ARG B N     
1007 C CA    A ARG A 147 ? 0.2880 0.3714 0.3439 0.0637  -0.0797 -0.0079 145 ARG B CA    
1008 C CA    B ARG A 147 ? 0.2878 0.3712 0.3437 0.0637  -0.0798 -0.0080 145 ARG B CA    
1009 C C     . ARG A 147 ? 0.3617 0.4298 0.4062 0.0785  -0.0847 -0.0176 145 ARG B C     
1010 O O     . ARG A 147 ? 0.3734 0.4161 0.4113 0.0771  -0.0891 -0.0215 145 ARG B O     
1011 C CB    A ARG A 147 ? 0.3143 0.3925 0.3643 0.0602  -0.0808 -0.0065 145 ARG B CB    
1012 C CB    B ARG A 147 ? 0.3147 0.3923 0.3643 0.0604  -0.0810 -0.0067 145 ARG B CB    
1013 C CG    A ARG A 147 ? 0.2778 0.3272 0.3133 0.0628  -0.0881 -0.0123 145 ARG B CG    
1014 C CG    B ARG A 147 ? 0.2788 0.3268 0.3136 0.0636  -0.0884 -0.0130 145 ARG B CG    
1015 C CD    A ARG A 147 ? 0.2953 0.3413 0.3334 0.0511  -0.0879 -0.0034 145 ARG B CD    
1016 C CD    B ARG A 147 ? 0.3030 0.3479 0.3352 0.0557  -0.0911 -0.0070 145 ARG B CD    
1017 N NE    A ARG A 147 ? 0.2445 0.3096 0.2818 0.0513  -0.0889 0.0005  145 ARG B NE    
1018 N NE    B ARG A 147 ? 0.2788 0.2984 0.3107 0.0483  -0.0950 -0.0053 145 ARG B NE    
1019 C CZ    A ARG A 147 ? 0.1722 0.2573 0.2228 0.0421  -0.0823 0.0118  145 ARG B CZ    
1020 C CZ    B ARG A 147 ? 0.2839 0.2976 0.3154 0.0411  -0.0992 0.0013  145 ARG B CZ    
1021 N NH1   A ARG A 147 ? 0.1302 0.2189 0.1908 0.0355  -0.0733 0.0172  145 ARG B NH1   
1022 N NH1   B ARG A 147 ? 0.2921 0.3247 0.3199 0.0402  -0.0995 0.0068  145 ARG B NH1   
1023 N NH2   A ARG A 147 ? 0.1551 0.2540 0.2046 0.0424  -0.0860 0.0145  145 ARG B NH2   
1024 N NH2   B ARG A 147 ? 0.2636 0.2540 0.2998 0.0336  -0.1041 0.0038  145 ARG B NH2   
1025 N N     . GLU A 148 ? 0.3843 0.4667 0.4244 0.0972  -0.0857 -0.0252 146 GLU B N     
1026 C CA    . GLU A 148 ? 0.4147 0.4813 0.4405 0.1167  -0.0907 -0.0357 146 GLU B CA    
1027 C C     . GLU A 148 ? 0.4209 0.4944 0.4606 0.1166  -0.0888 -0.0288 146 GLU B C     
1028 O O     . GLU A 148 ? 0.4805 0.5406 0.5114 0.1322  -0.0921 -0.0346 146 GLU B O     
1029 C CB    . GLU A 148 ? 0.4352 0.5166 0.4472 0.1424  -0.0890 -0.0454 146 GLU B CB    
1030 C CG    . GLU A 148 ? 0.4810 0.5255 0.4583 0.1628  -0.0987 -0.0612 146 GLU B CG    
1031 C CD    . GLU A 148 ? 0.4866 0.5063 0.4446 0.1552  -0.1096 -0.0667 146 GLU B CD    
1032 O OE1   . GLU A 148 ? 0.4618 0.5043 0.4301 0.1441  -0.1052 -0.0596 146 GLU B OE1   
1033 O OE2   . GLU A 148 ? 0.5097 0.4863 0.4431 0.1582  -0.1235 -0.0758 146 GLU B OE2   
1034 N N     . LYS A 149 ? 0.3929 0.4850 0.4519 0.1004  -0.0852 -0.0162 147 LYS B N     
1035 C CA    . LYS A 149 ? 0.4034 0.5041 0.4736 0.1007  -0.0874 -0.0099 147 LYS B CA    
1036 C C     . LYS A 149 ? 0.4045 0.4808 0.4674 0.0897  -0.0912 -0.0106 147 LYS B C     
1037 O O     . LYS A 149 ? 0.4521 0.5377 0.5232 0.0850  -0.0933 -0.0033 147 LYS B O     
1038 C CB    . LYS A 149 ? 0.3839 0.5203 0.4760 0.0924  -0.0864 0.0014  147 LYS B CB    
1039 C CG    . LYS A 149 ? 0.4081 0.5737 0.5152 0.1070  -0.0832 0.0038  147 LYS B CG    
1040 C CD    . LYS A 149 ? 0.4486 0.6220 0.5675 0.1206  -0.0860 0.0089  147 LYS B CD    
1041 C CE    . LYS A 149 ? 0.4906 0.6979 0.6255 0.1402  -0.0801 0.0108  147 LYS B CE    
1042 N NZ    . LYS A 149 ? 0.4890 0.7332 0.6445 0.1281  -0.0805 0.0183  147 LYS B NZ    
1043 N N     . ARG A 150 ? 0.3719 0.4183 0.4210 0.0854  -0.0929 -0.0183 148 ARG B N     
1044 C CA    . ARG A 150 ? 0.3814 0.4041 0.4267 0.0747  -0.0953 -0.0188 148 ARG B CA    
1045 C C     . ARG A 150 ? 0.4462 0.4470 0.4840 0.0819  -0.1022 -0.0235 148 ARG B C     
1046 O O     . ARG A 150 ? 0.4836 0.4831 0.5161 0.0961  -0.1049 -0.0274 148 ARG B O     
1047 C CB    . ARG A 150 ? 0.3402 0.3445 0.3812 0.0648  -0.0946 -0.0208 148 ARG B CB    
1048 C CG    . ARG A 150 ? 0.2827 0.3053 0.3315 0.0561  -0.0876 -0.0140 148 ARG B CG    
1049 C CD    . ARG A 150 ? 0.3034 0.3108 0.3503 0.0494  -0.0874 -0.0135 148 ARG B CD    
1050 N NE    . ARG A 150 ? 0.2906 0.3148 0.3449 0.0422  -0.0805 -0.0060 148 ARG B NE    
1051 C CZ    . ARG A 150 ? 0.2716 0.2912 0.3276 0.0373  -0.0792 -0.0020 148 ARG B CZ    
1052 N NH1   . ARG A 150 ? 0.2820 0.2822 0.3337 0.0370  -0.0855 -0.0039 148 ARG B NH1   
1053 N NH2   . ARG A 150 ? 0.2475 0.2827 0.3099 0.0321  -0.0728 0.0047  148 ARG B NH2   
1054 N N     . VAL A 151 ? 0.4659 0.4485 0.5029 0.0723  -0.1047 -0.0225 149 VAL B N     
1055 C CA    . VAL A 151 ? 0.5185 0.4791 0.5490 0.0756  -0.1122 -0.0257 149 VAL B CA    
1056 C C     . VAL A 151 ? 0.6317 0.5657 0.6539 0.0693  -0.1185 -0.0319 149 VAL B C     
1057 O O     . VAL A 151 ? 0.7398 0.6549 0.7607 0.0626  -0.1250 -0.0320 149 VAL B O     
1058 C CB    . VAL A 151 ? 0.4603 0.4183 0.4954 0.0682  -0.1126 -0.0194 149 VAL B CB    
1059 C CG1   . VAL A 151 ? 0.2318 0.1771 0.2630 0.0755  -0.1196 -0.0196 149 VAL B CG1   
1060 C CG2   . VAL A 151 ? 0.4357 0.4222 0.4791 0.0677  -0.1078 -0.0111 149 VAL B CG2   
1061 N N     . LYS A 152 ? 0.6278 0.5632 0.6460 0.0705  -0.1177 -0.0353 150 LYS B N     
1062 C CA    . LYS A 152 ? 0.6647 0.5786 0.6769 0.0631  -0.1252 -0.0383 150 LYS B CA    
1063 C C     . LYS A 152 ? 0.6139 0.5224 0.6388 0.0458  -0.1241 -0.0310 150 LYS B C     
1064 O O     . LYS A 152 ? 0.5761 0.4944 0.6098 0.0389  -0.1170 -0.0251 150 LYS B O     
1065 C CB    . LYS A 152 ? 0.7308 0.6210 0.7280 0.0695  -0.1378 -0.0450 150 LYS B CB    
1066 C CG    . LYS A 152 ? 0.7521 0.6332 0.7306 0.0816  -0.1429 -0.0523 150 LYS B CG    
1067 C CD    . LYS A 152 ? 0.7381 0.6025 0.7124 0.0709  -0.1514 -0.0528 150 LYS B CD    
1068 C CE    . LYS A 152 ? 0.7404 0.5884 0.7227 0.0536  -0.1597 -0.0473 150 LYS B CE    
1069 N NZ    . LYS A 152 ? 0.7638 0.6035 0.7513 0.0410  -0.1636 -0.0399 150 LYS B NZ    
1070 O OXT   . LYS A 152 ? 0.6077 0.5045 0.6356 0.0391  -0.1299 -0.0293 150 LYS B OXT   
1071 N N     . ASP B 4   ? 1.4018 0.8256 0.8003 -0.2809 -0.0663 -0.0118 2   ASP A N     
1072 C CA    . ASP B 4   ? 1.3714 0.8233 0.7983 -0.2836 -0.0329 -0.0299 2   ASP A CA    
1073 C C     . ASP B 4   ? 1.3566 0.8250 0.7980 -0.2840 -0.0172 -0.0414 2   ASP A C     
1074 O O     . ASP B 4   ? 1.3909 0.8402 0.8076 -0.2865 -0.0274 -0.0359 2   ASP A O     
1075 C CB    . ASP B 4   ? 1.3046 0.8046 0.8010 -0.2676 -0.0321 -0.0363 2   ASP A CB    
1076 C CG    . ASP B 4   ? 1.3206 0.8088 0.8021 -0.2783 -0.0171 -0.0403 2   ASP A CG    
1077 O OD1   . ASP B 4   ? 1.3743 0.8332 0.8078 -0.2984 0.0051  -0.0460 2   ASP A OD1   
1078 O OD2   . ASP B 4   ? 1.2778 0.7837 0.7933 -0.2681 -0.0250 -0.0389 2   ASP A OD2   
1079 N N     . SER B 5   ? 1.3020 0.8031 0.7812 -0.2829 0.0074  -0.0583 3   SER A N     
1080 C CA    . SER B 5   ? 1.2874 0.7954 0.7724 -0.2862 0.0285  -0.0720 3   SER A CA    
1081 C C     . SER B 5   ? 1.2487 0.7667 0.7572 -0.2710 0.0132  -0.0688 3   SER A C     
1082 O O     . SER B 5   ? 1.1873 0.7258 0.7305 -0.2548 -0.0105 -0.0601 3   SER A O     
1083 C CB    . SER B 5   ? 1.2586 0.8052 0.7873 -0.2862 0.0517  -0.0909 3   SER A CB    
1084 O OG    . SER B 5   ? 1.1997 0.7879 0.7866 -0.2678 0.0355  -0.0906 3   SER A OG    
1085 N N     . PRO B 6   ? 1.3015 0.8024 0.7900 -0.2772 0.0295  -0.0767 4   PRO A N     
1086 C CA    . PRO B 6   ? 1.3148 0.8182 0.8192 -0.2657 0.0187  -0.0749 4   PRO A CA    
1087 C C     . PRO B 6   ? 1.2891 0.8320 0.8563 -0.2448 0.0130  -0.0790 4   PRO A C     
1088 O O     . PRO B 6   ? 1.3062 0.8532 0.8904 -0.2343 -0.0012 -0.0739 4   PRO A O     
1089 C CB    . PRO B 6   ? 1.3686 0.8425 0.8377 -0.2782 0.0473  -0.0868 4   PRO A CB    
1090 C CG    . PRO B 6   ? 1.4301 0.8757 0.8482 -0.2999 0.0639  -0.0880 4   PRO A CG    
1091 C CD    . PRO B 6   ? 1.3832 0.8541 0.8256 -0.2979 0.0606  -0.0872 4   PRO A CD    
1092 N N     . GLU B 7   ? 1.2654 0.8358 0.8644 -0.2410 0.0243  -0.0892 5   GLU A N     
1093 C CA    . GLU B 7   ? 1.2057 0.8091 0.8560 -0.2233 0.0174  -0.0928 5   GLU A CA    
1094 C C     . GLU B 7   ? 1.1250 0.7510 0.8049 -0.2118 -0.0095 -0.0794 5   GLU A C     
1095 O O     . GLU B 7   ? 1.1181 0.7605 0.8305 -0.1973 -0.0206 -0.0765 5   GLU A O     
1096 C CB    . GLU B 7   ? 1.2207 0.8479 0.8912 -0.2269 0.0387  -0.1117 5   GLU A CB    
1097 C CG    . GLU B 7   ? 1.2755 0.9045 0.9282 -0.2456 0.0537  -0.1182 5   GLU A CG    
1098 C CD    . GLU B 7   ? 1.3576 0.9671 0.9819 -0.2618 0.0881  -0.1350 5   GLU A CD    
1099 O OE1   . GLU B 7   ? 1.4116 0.9823 0.9974 -0.2661 0.0937  -0.1298 5   GLU A OE1   
1100 O OE2   . GLU B 7   ? 1.3726 1.0091 1.0151 -0.2718 0.1118  -0.1560 5   GLU A OE2   
1101 N N     . ILE B 8   ? 1.0436 0.6654 0.7090 -0.2188 -0.0169 -0.0718 6   ILE A N     
1102 C CA    . ILE B 8   ? 0.9778 0.6133 0.6657 -0.2085 -0.0386 -0.0600 6   ILE A CA    
1103 C C     . ILE B 8   ? 1.0039 0.6275 0.6858 -0.2033 -0.0578 -0.0482 6   ILE A C     
1104 O O     . ILE B 8   ? 0.9646 0.6072 0.6793 -0.1911 -0.0723 -0.0422 6   ILE A O     
1105 C CB    . ILE B 8   ? 0.9864 0.6074 0.6490 -0.2192 -0.0386 -0.0554 6   ILE A CB    
1106 C CG1   . ILE B 8   ? 0.9499 0.5926 0.6297 -0.2252 -0.0194 -0.0696 6   ILE A CG1   
1107 C CG2   . ILE B 8   ? 0.9900 0.6128 0.6650 -0.2101 -0.0602 -0.0425 6   ILE A CG2   
1108 C CD1   . ILE B 8   ? 0.9686 0.5957 0.6256 -0.2365 -0.0157 -0.0668 6   ILE A CD1   
1109 N N     . ARG B 9   ? 1.0925 0.6847 0.7316 -0.2149 -0.0569 -0.0460 7   ARG A N     
1110 C CA    . ARG B 9   ? 1.1144 0.6962 0.7456 -0.2147 -0.0758 -0.0372 7   ARG A CA    
1111 C C     . ARG B 9   ? 1.0556 0.6609 0.7307 -0.2013 -0.0753 -0.0418 7   ARG A C     
1112 O O     . ARG B 9   ? 1.0264 0.6443 0.7247 -0.1946 -0.0919 -0.0352 7   ARG A O     
1113 C CB    . ARG B 9   ? 1.1720 0.7144 0.7454 -0.2330 -0.0720 -0.0372 7   ARG A CB    
1114 N N     . GLU B 10  ? 1.0262 0.6324 0.7086 -0.1986 -0.0554 -0.0530 8   GLU A N     
1115 C CA    . GLU B 10  ? 1.0451 0.6635 0.7607 -0.1865 -0.0526 -0.0565 8   GLU A CA    
1116 C C     . GLU B 10  ? 0.9964 0.6478 0.7573 -0.1721 -0.0607 -0.0536 8   GLU A C     
1117 O O     . GLU B 10  ? 0.9643 0.6248 0.7511 -0.1630 -0.0638 -0.0522 8   GLU A O     
1118 C CB    . GLU B 10  ? 1.1077 0.7084 0.8110 -0.1868 -0.0282 -0.0684 8   GLU A CB    
1119 C CG    . GLU B 10  ? 1.1532 0.7506 0.8772 -0.1747 -0.0216 -0.0709 8   GLU A CG    
1120 C CD    . GLU B 10  ? 1.2244 0.8083 0.9435 -0.1783 -0.0274 -0.0670 8   GLU A CD    
1121 O OE1   . GLU B 10  ? 1.2896 0.8502 0.9734 -0.1924 -0.0243 -0.0689 8   GLU A OE1   
1122 O OE2   . GLU B 10  ? 1.2217 0.8174 0.9705 -0.1694 -0.0338 -0.0633 8   GLU A OE2   
1123 N N     . LEU B 11  ? 0.9863 0.6528 0.7540 -0.1718 -0.0623 -0.0533 9   LEU A N     
1124 C CA    . LEU B 11  ? 0.9198 0.6158 0.7259 -0.1606 -0.0680 -0.0522 9   LEU A CA    
1125 C C     . LEU B 11  ? 0.9005 0.6033 0.7200 -0.1559 -0.0852 -0.0409 9   LEU A C     
1126 O O     . LEU B 11  ? 0.8781 0.5988 0.7283 -0.1459 -0.0887 -0.0393 9   LEU A O     
1127 C CB    . LEU B 11  ? 0.9063 0.6134 0.7123 -0.1653 -0.0617 -0.0581 9   LEU A CB    
1128 C CG    . LEU B 11  ? 0.8735 0.6081 0.7080 -0.1602 -0.0562 -0.0684 9   LEU A CG    
1129 C CD1   . LEU B 11  ? 0.8908 0.6187 0.7210 -0.1589 -0.0459 -0.0783 9   LEU A CD1   
1130 C CD2   . LEU B 11  ? 0.8710 0.6143 0.6990 -0.1709 -0.0478 -0.0765 9   LEU A CD2   
1131 N N     . GLU B 12  ? 0.9039 0.5883 0.6955 -0.1645 -0.0966 -0.0329 10  GLU A N     
1132 C CA    . GLU B 12  ? 0.8691 0.5535 0.6676 -0.1623 -0.1166 -0.0220 10  GLU A CA    
1133 C C     . GLU B 12  ? 0.8502 0.5391 0.6644 -0.1605 -0.1207 -0.0225 10  GLU A C     
1134 O O     . GLU B 12  ? 0.8473 0.5521 0.6913 -0.1533 -0.1287 -0.0191 10  GLU A O     
1135 C CB    . GLU B 12  ? 0.9166 0.5695 0.6702 -0.1748 -0.1322 -0.0124 10  GLU A CB    
1136 C CG    . GLU B 12  ? 0.9651 0.6049 0.6970 -0.1793 -0.1281 -0.0108 10  GLU A CG    
1137 C CD    . GLU B 12  ? 1.0706 0.6689 0.7503 -0.1918 -0.1483 0.0022  10  GLU A CD    
1138 O OE1   . GLU B 12  ? 1.1010 0.6910 0.7830 -0.1894 -0.1741 0.0140  10  GLU A OE1   
1139 O OE2   . GLU B 12  ? 1.1344 0.7045 0.7676 -0.2052 -0.1399 0.0012  10  GLU A OE2   
1140 N N     . LYS B 13  ? 0.8602 0.5322 0.6525 -0.1690 -0.1136 -0.0279 11  LYS A N     
1141 C CA    . LYS B 13  ? 0.8771 0.5476 0.6794 -0.1718 -0.1148 -0.0308 11  LYS A CA    
1142 C C     . LYS B 13  ? 0.8170 0.5066 0.6592 -0.1593 -0.1046 -0.0345 11  LYS A C     
1143 O O     . LYS B 13  ? 0.8495 0.5480 0.7144 -0.1589 -0.1106 -0.0334 11  LYS A O     
1144 C CB    . LYS B 13  ? 0.9547 0.5985 0.7230 -0.1832 -0.1029 -0.0382 11  LYS A CB    
1145 C CG    . LYS B 13  ? 0.9908 0.6215 0.7473 -0.1965 -0.1111 -0.0403 11  LYS A CG    
1146 C CD    . LYS B 13  ? 1.0160 0.6161 0.7350 -0.2080 -0.0947 -0.0488 11  LYS A CD    
1147 C CE    . LYS B 13  ? 0.9893 0.5850 0.7192 -0.1966 -0.0700 -0.0556 11  LYS A CE    
1148 N NZ    . LYS B 13  ? 1.0411 0.6022 0.7282 -0.2064 -0.0507 -0.0633 11  LYS A NZ    
1149 N N     . PHE B 14  ? 0.7441 0.4373 0.5926 -0.1510 -0.0899 -0.0389 12  PHE A N     
1150 C CA    . PHE B 14  ? 0.6848 0.3870 0.5609 -0.1402 -0.0819 -0.0403 12  PHE A CA    
1151 C C     . PHE B 14  ? 0.6702 0.3970 0.5752 -0.1330 -0.0917 -0.0345 12  PHE A C     
1152 O O     . PHE B 14  ? 0.6579 0.3893 0.5840 -0.1291 -0.0899 -0.0334 12  PHE A O     
1153 C CB    . PHE B 14  ? 0.6219 0.3174 0.4908 -0.1344 -0.0691 -0.0458 12  PHE A CB    
1154 C CG    . PHE B 14  ? 0.6066 0.2995 0.4913 -0.1234 -0.0631 -0.0452 12  PHE A CG    
1155 C CD1   . PHE B 14  ? 0.5973 0.3123 0.5024 -0.1161 -0.0698 -0.0428 12  PHE A CD1   
1156 C CD2   . PHE B 14  ? 0.6441 0.3054 0.5169 -0.1197 -0.0494 -0.0461 12  PHE A CD2   
1157 C CE1   . PHE B 14  ? 0.6228 0.3279 0.5342 -0.1057 -0.0667 -0.0408 12  PHE A CE1   
1158 C CE2   . PHE B 14  ? 0.6710 0.3182 0.5488 -0.1065 -0.0425 -0.0423 12  PHE A CE2   
1159 C CZ    . PHE B 14  ? 0.6600 0.3280 0.5556 -0.0994 -0.0529 -0.0393 12  PHE A CZ    
1160 N N     . ALA B 15  ? 0.6603 0.3987 0.5645 -0.1319 -0.0996 -0.0311 13  ALA A N     
1161 C CA    . ALA B 15  ? 0.6293 0.3856 0.5576 -0.1251 -0.1074 -0.0258 13  ALA A CA    
1162 C C     . ALA B 15  ? 0.6821 0.4390 0.6228 -0.1276 -0.1207 -0.0200 13  ALA A C     
1163 O O     . ALA B 15  ? 0.6971 0.4663 0.6642 -0.1218 -0.1221 -0.0180 13  ALA A O     
1164 C CB    . ALA B 15  ? 0.5984 0.3570 0.5181 -0.1258 -0.1121 -0.0236 13  ALA A CB    
1165 N N     . ASN B 16  ? 0.7094 0.4523 0.6307 -0.1379 -0.1321 -0.0179 14  ASN A N     
1166 C CA    . ASN B 16  ? 0.7375 0.4828 0.6730 -0.1436 -0.1484 -0.0143 14  ASN A CA    
1167 C C     . ASN B 16  ? 0.7204 0.4700 0.6755 -0.1461 -0.1347 -0.0223 14  ASN A C     
1168 O O     . ASN B 16  ? 0.7164 0.4786 0.7008 -0.1456 -0.1387 -0.0215 14  ASN A O     
1169 C CB    . ASN B 16  ? 0.8240 0.5507 0.7289 -0.1573 -0.1665 -0.0107 14  ASN A CB    
1170 C CG    . ASN B 16  ? 0.8850 0.5970 0.7645 -0.1568 -0.1816 -0.0004 14  ASN A CG    
1171 O OD1   . ASN B 16  ? 0.8892 0.6077 0.7800 -0.1469 -0.1792 0.0029  14  ASN A OD1   
1172 N ND2   . ASN B 16  ? 0.9293 0.6168 0.7704 -0.1698 -0.1966 0.0041  14  ASN A ND2   
1173 N N     . GLU B 17  ? 0.7266 0.4616 0.6659 -0.1494 -0.1176 -0.0299 15  GLU A N     
1174 C CA    . GLU B 17  ? 0.7281 0.4565 0.6819 -0.1521 -0.1018 -0.0370 15  GLU A CA    
1175 C C     . GLU B 17  ? 0.6950 0.4307 0.6702 -0.1394 -0.0899 -0.0347 15  GLU A C     
1176 O O     . GLU B 17  ? 0.6970 0.4314 0.6920 -0.1416 -0.0812 -0.0369 15  GLU A O     
1177 C CB    . GLU B 17  ? 0.7737 0.4757 0.7025 -0.1568 -0.0874 -0.0434 15  GLU A CB    
1178 C CG    . GLU B 17  ? 0.8376 0.5217 0.7772 -0.1589 -0.0695 -0.0490 15  GLU A CG    
1179 C CD    . GLU B 17  ? 0.9313 0.6188 0.8868 -0.1754 -0.0747 -0.0559 15  GLU A CD    
1180 O OE1   . GLU B 17  ? 0.9714 0.6715 0.9219 -0.1864 -0.0945 -0.0565 15  GLU A OE1   
1181 O OE2   . GLU B 17  ? 0.9627 0.6379 0.9351 -0.1780 -0.0602 -0.0600 15  GLU A OE2   
1182 N N     . PHE B 18  ? 0.6829 0.4242 0.6527 -0.1282 -0.0890 -0.0310 16  PHE A N     
1183 C CA    . PHE B 18  ? 0.6837 0.4306 0.6691 -0.1172 -0.0822 -0.0283 16  PHE A CA    
1184 C C     . PHE B 18  ? 0.6879 0.4541 0.6996 -0.1161 -0.0916 -0.0243 16  PHE A C     
1185 O O     . PHE B 18  ? 0.6922 0.4576 0.7199 -0.1121 -0.0835 -0.0232 16  PHE A O     
1186 C CB    . PHE B 18  ? 0.6705 0.4219 0.6452 -0.1093 -0.0832 -0.0279 16  PHE A CB    
1187 C CG    . PHE B 18  ? 0.6430 0.4007 0.6312 -0.0994 -0.0821 -0.0254 16  PHE A CG    
1188 C CD1   . PHE B 18  ? 0.6570 0.3917 0.6399 -0.0918 -0.0724 -0.0239 16  PHE A CD1   
1189 C CD2   . PHE B 18  ? 0.6167 0.3964 0.6194 -0.0967 -0.0905 -0.0239 16  PHE A CD2   
1190 C CE1   . PHE B 18  ? 0.6491 0.3848 0.6409 -0.0818 -0.0747 -0.0210 16  PHE A CE1   
1191 C CE2   . PHE B 18  ? 0.6070 0.3919 0.6218 -0.0895 -0.0902 -0.0235 16  PHE A CE2   
1192 C CZ    . PHE B 18  ? 0.6245 0.3888 0.6346 -0.0824 -0.0843 -0.0223 16  PHE A CZ    
1193 N N     . LYS B 19  ? 0.6830 0.4611 0.6979 -0.1188 -0.1090 -0.0207 17  LYS A N     
1194 C CA    . LYS B 19  ? 0.6520 0.4449 0.6953 -0.1158 -0.1204 -0.0158 17  LYS A CA    
1195 C C     . LYS B 19  ? 0.6416 0.4367 0.7073 -0.1248 -0.1205 -0.0185 17  LYS A C     
1196 O O     . LYS B 19  ? 0.6415 0.4450 0.7345 -0.1218 -0.1166 -0.0177 17  LYS A O     
1197 C CB    . LYS B 19  ? 0.6536 0.4488 0.6934 -0.1153 -0.1414 -0.0091 17  LYS A CB    
1198 C CG    . LYS B 19  ? 0.6244 0.4304 0.6967 -0.1085 -0.1536 -0.0032 17  LYS A CG    
1199 C CD    . LYS B 19  ? 0.6503 0.4471 0.7152 -0.1075 -0.1755 0.0052  17  LYS A CD    
1200 C CE    . LYS B 19  ? 0.6612 0.4611 0.7477 -0.0977 -0.1768 0.0080  17  LYS A CE    
1201 N NZ    . LYS B 19  ? 0.6722 0.4782 0.8043 -0.0942 -0.1973 0.0145  17  LYS A NZ    
1202 N N     . VAL B 20  ? 0.6318 0.4195 0.6872 -0.1383 -0.1240 -0.0232 18  VAL A N     
1203 C CA    . VAL B 20  ? 0.6525 0.4447 0.7303 -0.1521 -0.1227 -0.0295 18  VAL A CA    
1204 C C     . VAL B 20  ? 0.6313 0.4087 0.7110 -0.1535 -0.0940 -0.0353 18  VAL A C     
1205 O O     . VAL B 20  ? 0.6204 0.4041 0.7253 -0.1577 -0.0884 -0.0365 18  VAL A O     
1206 C CB    . VAL B 20  ? 0.6929 0.4802 0.7566 -0.1693 -0.1327 -0.0361 18  VAL A CB    
1207 C CG1   . VAL B 20  ? 0.7300 0.5234 0.7853 -0.1674 -0.1633 -0.0265 18  VAL A CG1   
1208 C CG2   . VAL B 20  ? 0.6898 0.4522 0.7216 -0.1722 -0.1137 -0.0431 18  VAL A CG2   
1209 N N     . ARG B 21  ? 0.6305 0.3845 0.6846 -0.1494 -0.0757 -0.0378 19  ARG A N     
1210 C CA    . ARG B 21  ? 0.6535 0.3825 0.7061 -0.1476 -0.0486 -0.0398 19  ARG A CA    
1211 C C     . ARG B 21  ? 0.6202 0.3519 0.6793 -0.1342 -0.0453 -0.0315 19  ARG A C     
1212 O O     . ARG B 21  ? 0.6227 0.3337 0.6813 -0.1357 -0.0267 -0.0307 19  ARG A O     
1213 C CB    . ARG B 21  ? 0.6983 0.4010 0.7303 -0.1400 -0.0361 -0.0399 19  ARG A CB    
1214 C CG    . ARG B 21  ? 0.7639 0.4568 0.7903 -0.1529 -0.0383 -0.0480 19  ARG A CG    
1215 C CD    . ARG B 21  ? 0.8291 0.4907 0.8286 -0.1433 -0.0299 -0.0441 19  ARG A CD    
1216 N NE    . ARG B 21  ? 0.9072 0.5383 0.8992 -0.1519 -0.0210 -0.0468 19  ARG A NE    
1217 C CZ    . ARG B 21  ? 0.9544 0.5698 0.9203 -0.1638 -0.0223 -0.0532 19  ARG A CZ    
1218 N NH1   . ARG B 21  ? 0.9724 0.6005 0.9218 -0.1668 -0.0340 -0.0563 19  ARG A NH1   
1219 N NH2   . ARG B 21  ? 0.9832 0.5656 0.9308 -0.1738 -0.0100 -0.0563 19  ARG A NH2   
1220 N N     . ARG B 22  ? 0.5990 0.3516 0.6616 -0.1221 -0.0620 -0.0255 20  ARG A N     
1221 C CA    . ARG B 22  ? 0.5843 0.3432 0.6600 -0.1103 -0.0607 -0.0202 20  ARG A CA    
1222 C C     . ARG B 22  ? 0.5732 0.3483 0.6835 -0.1155 -0.0645 -0.0201 20  ARG A C     
1223 O O     . ARG B 22  ? 0.5716 0.3389 0.6923 -0.1120 -0.0519 -0.0183 20  ARG A O     
1224 C CB    . ARG B 22  ? 0.5609 0.3373 0.6335 -0.1000 -0.0749 -0.0175 20  ARG A CB    
1225 C CG    . ARG B 22  ? 0.5552 0.3415 0.6448 -0.0906 -0.0751 -0.0152 20  ARG A CG    
1226 C CD    . ARG B 22  ? 0.5572 0.3612 0.6466 -0.0870 -0.0884 -0.0155 20  ARG A CD    
1227 N NE    . ARG B 22  ? 0.5600 0.3775 0.6710 -0.0891 -0.1009 -0.0132 20  ARG A NE    
1228 C CZ    . ARG B 22  ? 0.5444 0.3705 0.6856 -0.0852 -0.1019 -0.0122 20  ARG A CZ    
1229 N NH1   . ARG B 22  ? 0.5401 0.3635 0.6890 -0.0808 -0.0887 -0.0143 20  ARG A NH1   
1230 N NH2   . ARG B 22  ? 0.5452 0.3795 0.7108 -0.0851 -0.1171 -0.0087 20  ARG A NH2   
1231 N N     . ILE B 23  ? 0.5592 0.3554 0.6900 -0.1228 -0.0829 -0.0213 21  ILE A N     
1232 C CA    . ILE B 23  ? 0.5408 0.3569 0.7164 -0.1262 -0.0899 -0.0213 21  ILE A CA    
1233 C C     . ILE B 23  ? 0.5659 0.3736 0.7500 -0.1439 -0.0756 -0.0279 21  ILE A C     
1234 O O     . ILE B 23  ? 0.5704 0.3828 0.7838 -0.1452 -0.0652 -0.0284 21  ILE A O     
1235 C CB    . ILE B 23  ? 0.5188 0.3566 0.7165 -0.1258 -0.1188 -0.0180 21  ILE A CB    
1236 C CG1   . ILE B 23  ? 0.4753 0.3129 0.6597 -0.1109 -0.1284 -0.0114 21  ILE A CG1   
1237 C CG2   . ILE B 23  ? 0.5282 0.3901 0.7845 -0.1281 -0.1280 -0.0182 21  ILE A CG2   
1238 C CD1   . ILE B 23  ? 0.4825 0.3270 0.6780 -0.1094 -0.1567 -0.0050 21  ILE A CD1   
1239 N N     . LYS B 24  ? 0.5805 0.3743 0.7393 -0.1596 -0.0721 -0.0346 22  LYS A N     
1240 C CA    . LYS B 24  ? 0.5895 0.3692 0.7473 -0.1822 -0.0561 -0.0430 22  LYS A CA    
1241 C C     . LYS B 24  ? 0.5983 0.3406 0.7327 -0.1793 -0.0308 -0.0380 22  LYS A C     
1242 O O     . LYS B 24  ? 0.6323 0.3674 0.7791 -0.1933 -0.0225 -0.0391 22  LYS A O     
1243 C CB    . LYS B 24  ? 0.5999 0.3642 0.7290 -0.1993 -0.0514 -0.0539 22  LYS A CB    
1244 N N     . LEU B 25  ? 0.5836 0.3029 0.6878 -0.1599 -0.0224 -0.0306 23  LEU A N     
1245 C CA    . LEU B 25  ? 0.6238 0.3088 0.7100 -0.1494 -0.0072 -0.0212 23  LEU A CA    
1246 C C     . LEU B 25  ? 0.5875 0.2959 0.7126 -0.1360 -0.0026 -0.0184 23  LEU A C     
1247 O O     . LEU B 25  ? 0.6195 0.3060 0.7376 -0.1245 0.0160  -0.0124 23  LEU A O     
1248 C CB    . LEU B 25  ? 0.6664 0.3183 0.7087 -0.1319 -0.0047 -0.0134 23  LEU A CB    
1249 C CG    . LEU B 25  ? 0.7055 0.3369 0.7413 -0.1291 -0.0110 -0.0090 23  LEU A CG    
1250 C CD1   . LEU B 25  ? 0.7203 0.3672 0.7632 -0.1487 -0.0293 -0.0154 23  LEU A CD1   
1251 C CD2   . LEU B 25  ? 0.6715 0.2999 0.7041 -0.1058 -0.0076 -0.0052 23  LEU A CD2   
1252 N N     . GLY B 26  ? 0.5195 0.2702 0.6867 -0.1350 -0.0180 -0.0220 24  GLY A N     
1253 C CA    . GLY B 26  ? 0.4505 0.2197 0.6555 -0.1244 -0.0128 -0.0206 24  GLY A CA    
1254 C C     . GLY B 26  ? 0.6146 0.3764 0.8013 -0.1054 -0.0109 -0.0153 24  GLY A C     
1255 O O     . GLY B 26  ? 0.6137 0.3726 0.8133 -0.0976 0.0044  -0.0141 24  GLY A O     
1256 N N     . TYR B 27  ? 0.6014 0.3609 0.7593 -0.0992 -0.0241 -0.0135 25  TYR A N     
1257 C CA    . TYR B 27  ? 0.5660 0.3239 0.7109 -0.0844 -0.0262 -0.0108 25  TYR A CA    
1258 C C     . TYR B 27  ? 0.5592 0.3488 0.7256 -0.0826 -0.0453 -0.0136 25  TYR A C     
1259 O O     . TYR B 27  ? 0.5531 0.3576 0.7236 -0.0877 -0.0614 -0.0143 25  TYR A O     
1260 C CB    . TYR B 27  ? 0.5454 0.2823 0.6514 -0.0784 -0.0279 -0.0079 25  TYR A CB    
1261 C CG    . TYR B 27  ? 0.5579 0.2520 0.6361 -0.0707 -0.0063 -0.0011 25  TYR A CG    
1262 C CD1   . TYR B 27  ? 0.5389 0.2191 0.6047 -0.0511 0.0084  0.0059  25  TYR A CD1   
1263 C CD2   . TYR B 27  ? 0.5909 0.2596 0.6471 -0.0802 0.0014  -0.0007 25  TYR A CD2   
1264 C CE1   . TYR B 27  ? 0.5707 0.2163 0.5968 -0.0361 0.0333  0.0157  25  TYR A CE1   
1265 C CE2   . TYR B 27  ? 0.6175 0.2501 0.6504 -0.0686 0.0213  0.0077  25  TYR A CE2   
1266 C CZ    . TYR B 27  ? 0.6219 0.2382 0.6361 -0.0452 0.0422  0.0167  25  TYR A CZ    
1267 O OH    . TYR B 27  ? 0.6971 0.2768 0.6702 -0.0285 0.0688  0.0273  25  TYR A OH    
1268 N N     . THR B 28  ? 0.5653 0.3592 0.7416 -0.0750 -0.0416 -0.0150 26  THR A N     
1269 C CA    . THR B 28  ? 0.5450 0.3574 0.7303 -0.0727 -0.0554 -0.0178 26  THR A CA    
1270 C C     . THR B 28  ? 0.5519 0.3610 0.7045 -0.0705 -0.0632 -0.0200 26  THR A C     
1271 O O     . THR B 28  ? 0.5900 0.3835 0.7221 -0.0670 -0.0595 -0.0194 26  THR A O     
1272 C CB    . THR B 28  ? 0.5084 0.3244 0.7211 -0.0689 -0.0443 -0.0216 26  THR A CB    
1273 O OG1   . THR B 28  ? 0.4949 0.2942 0.6898 -0.0648 -0.0300 -0.0248 26  THR A OG1   
1274 C CG2   . THR B 28  ? 0.5063 0.3285 0.7595 -0.0716 -0.0338 -0.0211 26  THR A CG2   
1275 N N     . GLN B 29  ? 0.4746 0.2957 0.6244 -0.0720 -0.0744 -0.0223 27  GLN A N     
1276 C CA    . GLN B 29  ? 0.4875 0.3100 0.6098 -0.0737 -0.0802 -0.0273 27  GLN A CA    
1277 C C     . GLN B 29  ? 0.5084 0.3262 0.6259 -0.0721 -0.0759 -0.0355 27  GLN A C     
1278 O O     . GLN B 29  ? 0.4734 0.3000 0.5650 -0.0686 -0.0787 -0.0384 27  GLN A O     
1279 C CB    . GLN B 29  ? 0.4822 0.3109 0.6013 -0.0770 -0.0860 -0.0291 27  GLN A CB    
1280 C CG    . GLN B 29  ? 0.4724 0.3011 0.5831 -0.0790 -0.0963 -0.0228 27  GLN A CG    
1281 C CD    . GLN B 29  ? 0.4566 0.2804 0.5661 -0.0805 -0.1023 -0.0218 27  GLN A CD    
1282 O OE1   . GLN B 29  ? 0.4570 0.2762 0.5736 -0.0803 -0.0964 -0.0261 27  GLN A OE1   
1283 N NE2   . GLN B 29  ? 0.4518 0.2705 0.5496 -0.0827 -0.1135 -0.0164 27  GLN A NE2   
1284 N N     . THR B 30  ? 0.5185 0.3335 0.6544 -0.0703 -0.0648 -0.0391 28  THR A N     
1285 C CA    . THR B 30  ? 0.4866 0.3171 0.5961 -0.0611 -0.0504 -0.0439 28  THR A CA    
1286 C C     . THR B 30  ? 0.4975 0.3250 0.5848 -0.0468 -0.0405 -0.0339 28  THR A C     
1287 O O     . THR B 30  ? 0.5379 0.3834 0.5916 -0.0351 -0.0376 -0.0344 28  THR A O     
1288 C CB    . THR B 30  ? 0.4770 0.3030 0.6036 -0.0622 -0.0347 -0.0497 28  THR A CB    
1289 O OG1   . THR B 30  ? 0.4682 0.2877 0.6155 -0.0724 -0.0414 -0.0567 28  THR A OG1   
1290 C CG2   . THR B 30  ? 0.3822 0.2248 0.4734 -0.0565 -0.0225 -0.0573 28  THR A CG2   
1291 N N     . ASN B 31  ? 0.4918 0.2966 0.5964 -0.0476 -0.0350 -0.0250 29  ASN A N     
1292 C CA    . ASN B 31  ? 0.5328 0.3219 0.6120 -0.0349 -0.0203 -0.0148 29  ASN A CA    
1293 C C     . ASN B 31  ? 0.5246 0.3152 0.5754 -0.0267 -0.0293 -0.0103 29  ASN A C     
1294 O O     . ASN B 31  ? 0.5356 0.3266 0.5515 -0.0073 -0.0202 -0.0030 29  ASN A O     
1295 C CB    . ASN B 31  ? 0.5858 0.3488 0.6931 -0.0439 -0.0088 -0.0102 29  ASN A CB    
1296 C CG    . ASN B 31  ? 0.6442 0.4061 0.7773 -0.0471 0.0087  -0.0136 29  ASN A CG    
1297 O OD1   . ASN B 31  ? 0.7102 0.4832 0.8299 -0.0406 0.0158  -0.0180 29  ASN A OD1   
1298 N ND2   . ASN B 31  ? 0.6369 0.3876 0.8081 -0.0589 0.0169  -0.0135 29  ASN A ND2   
1299 N N     . VAL B 32  ? 0.5117 0.3016 0.5751 -0.0393 -0.0462 -0.0137 30  VAL A N     
1300 C CA    . VAL B 32  ? 0.5195 0.3095 0.5579 -0.0329 -0.0517 -0.0115 30  VAL A CA    
1301 C C     . VAL B 32  ? 0.5440 0.3711 0.5604 -0.0194 -0.0556 -0.0160 30  VAL A C     
1302 O O     . VAL B 32  ? 0.5799 0.4138 0.5710 0.0000  -0.0507 -0.0100 30  VAL A O     
1303 C CB    . VAL B 32  ? 0.4722 0.2529 0.5239 -0.0524 -0.0686 -0.0160 30  VAL A CB    
1304 C CG1   . VAL B 32  ? 0.4629 0.2467 0.4885 -0.0472 -0.0717 -0.0169 30  VAL A CG1   
1305 C CG2   . VAL B 32  ? 0.4650 0.2203 0.5337 -0.0642 -0.0651 -0.0122 30  VAL A CG2   
1306 N N     . GLY B 33  ? 0.5294 0.3822 0.5559 -0.0291 -0.0634 -0.0272 31  GLY A N     
1307 C CA    . GLY B 33  ? 0.5251 0.4206 0.5339 -0.0215 -0.0673 -0.0355 31  GLY A CA    
1308 C C     . GLY B 33  ? 0.5364 0.4466 0.5197 0.0027  -0.0574 -0.0281 31  GLY A C     
1309 O O     . GLY B 33  ? 0.5227 0.4681 0.4871 0.0192  -0.0617 -0.0282 31  GLY A O     
1310 N N     . GLU B 34  ? 0.5580 0.4424 0.5400 0.0061  -0.0437 -0.0211 32  GLU A N     
1311 C CA    . GLU B 34  ? 0.5995 0.4883 0.5481 0.0293  -0.0323 -0.0117 32  GLU A CA    
1312 C C     . GLU B 34  ? 0.6302 0.4922 0.5561 0.0525  -0.0228 0.0064  32  GLU A C     
1313 O O     . GLU B 34  ? 0.6660 0.5449 0.5587 0.0796  -0.0216 0.0157  32  GLU A O     
1314 C CB    . GLU B 34  ? 0.6200 0.4857 0.5712 0.0229  -0.0162 -0.0117 32  GLU A CB    
1315 C CG    . GLU B 34  ? 0.6188 0.5043 0.5870 0.0033  -0.0203 -0.0296 32  GLU A CG    
1316 C CD    . GLU B 34  ? 0.6648 0.5311 0.6282 0.0014  -0.0004 -0.0303 32  GLU A CD    
1317 O OE1   . GLU B 34  ? 0.7052 0.5444 0.6500 0.0146  0.0165  -0.0168 32  GLU A OE1   
1318 O OE2   . GLU B 34  ? 0.6613 0.5354 0.6368 -0.0137 0.0016  -0.0451 32  GLU A OE2   
1319 N N     . ALA B 35  ? 0.6311 0.4510 0.5725 0.0427  -0.0156 0.0115  33  ALA A N     
1320 C CA    . ALA B 35  ? 0.6729 0.4542 0.5896 0.0608  -0.0004 0.0271  33  ALA A CA    
1321 C C     . ALA B 35  ? 0.7106 0.5062 0.6176 0.0744  -0.0089 0.0287  33  ALA A C     
1322 O O     . ALA B 35  ? 0.7591 0.5146 0.6532 0.0816  0.0037  0.0376  33  ALA A O     
1323 C CB    . ALA B 35  ? 0.6482 0.3805 0.5851 0.0399  0.0122  0.0280  33  ALA A CB    
1324 N N     . LEU B 36  ? 0.6897 0.5406 0.6028 0.0768  -0.0270 0.0186  34  LEU A N     
1325 C CA    . LEU B 36  ? 0.6802 0.5541 0.5888 0.0908  -0.0332 0.0182  34  LEU A CA    
1326 C C     . LEU B 36  ? 0.7273 0.6438 0.6116 0.1274  -0.0354 0.0265  34  LEU A C     
1327 O O     . LEU B 36  ? 0.7629 0.6966 0.6429 0.1482  -0.0359 0.0301  34  LEU A O     
1328 C CB    . LEU B 36  ? 0.6212 0.5310 0.5574 0.0649  -0.0508 -0.0011 34  LEU A CB    
1329 C CG    . LEU B 36  ? 0.6272 0.5082 0.5751 0.0450  -0.0520 -0.0061 34  LEU A CG    
1330 C CD1   . LEU B 36  ? 0.6624 0.4866 0.6161 0.0275  -0.0450 -0.0011 34  LEU A CD1   
1331 C CD2   . LEU B 36  ? 0.5890 0.5023 0.5563 0.0196  -0.0672 -0.0240 34  LEU A CD2   
1332 N N     . ALA B 37  ? 0.7378 0.6730 0.6055 0.1367  -0.0367 0.0295  35  ALA A N     
1333 C CA    . ALA B 37  ? 0.8009 0.7788 0.6406 0.1740  -0.0419 0.0395  35  ALA A CA    
1334 C C     . ALA B 37  ? 0.8887 0.8225 0.6949 0.2127  -0.0243 0.0647  35  ALA A C     
1335 O O     . ALA B 37  ? 0.9577 0.9286 0.7455 0.2506  -0.0302 0.0754  35  ALA A O     
1336 C CB    . ALA B 37  ? 0.8240 0.8195 0.6432 0.1732  -0.0448 0.0381  35  ALA A CB    
1337 N N     . ALA B 38  ? 0.8903 0.7462 0.6885 0.2042  -0.0021 0.0739  36  ALA A N     
1338 C CA    . ALA B 38  ? 0.9544 0.7552 0.7151 0.2384  0.0205  0.0971  36  ALA A CA    
1339 C C     . ALA B 38  ? 1.0003 0.8065 0.7698 0.2543  0.0212  0.0978  36  ALA A C     
1340 O O     . ALA B 38  ? 1.1063 0.8991 0.8457 0.2972  0.0324  0.1169  36  ALA A O     
1341 C CB    . ALA B 38  ? 0.9644 0.6804 0.7149 0.2182  0.0471  0.1025  36  ALA A CB    
1342 N N     . VAL B 39  ? 0.9439 0.7666 0.7512 0.2224  0.0112  0.0780  37  VAL A N     
1343 C CA    . VAL B 39  ? 0.9953 0.8186 0.8107 0.2320  0.0153  0.0756  37  VAL A CA    
1344 C C     . VAL B 39  ? 0.9424 0.8529 0.7890 0.2317  -0.0074 0.0596  37  VAL A C     
1345 O O     . VAL B 39  ? 0.9988 0.9193 0.8556 0.2401  -0.0032 0.0555  37  VAL A O     
1346 C CB    . VAL B 39  ? 1.0515 0.8139 0.8764 0.1955  0.0267  0.0661  37  VAL A CB    
1347 C CG1   . VAL B 39  ? 0.6720 0.3555 0.4722 0.1888  0.0496  0.0775  37  VAL A CG1   
1348 C CG2   . VAL B 39  ? 1.0321 0.8262 0.8933 0.1514  0.0054  0.0443  37  VAL A CG2   
1349 N N     . HIS B 40  ? 0.8410 0.8132 0.7026 0.2195  -0.0284 0.0482  38  HIS A N     
1350 C CA    . HIS B 40  ? 0.8540 0.9090 0.7469 0.2109  -0.0476 0.0286  38  HIS A CA    
1351 C C     . HIS B 40  ? 0.9373 1.0697 0.8253 0.2377  -0.0640 0.0303  38  HIS A C     
1352 O O     . HIS B 40  ? 0.9237 1.1322 0.8331 0.2500  -0.0759 0.0207  38  HIS A O     
1353 C CB    . HIS B 40  ? 0.8063 0.8650 0.7250 0.1599  -0.0578 0.0060  38  HIS A CB    
1354 C CG    . HIS B 40  ? 0.7810 0.9136 0.7286 0.1441  -0.0721 -0.0164 38  HIS A CG    
1355 N ND1   . HIS B 40  ? 0.7624 0.9514 0.7210 0.1264  -0.0874 -0.0328 38  HIS A ND1   
1356 C CD2   . HIS B 40  ? 0.7730 0.9300 0.7394 0.1406  -0.0700 -0.0272 38  HIS A CD2   
1357 C CE1   . HIS B 40  ? 0.7419 0.9874 0.7259 0.1110  -0.0940 -0.0530 38  HIS A CE1   
1358 N NE2   . HIS B 40  ? 0.7449 0.9735 0.7350 0.1198  -0.0836 -0.0497 38  HIS A NE2   
1359 N N     . GLY B 41  ? 1.0078 0.6130 0.8442 0.0028  0.0348  -0.0420 39  GLY A N     
1360 C CA    . GLY B 41  ? 1.0861 0.6879 0.9180 0.0086  0.0323  -0.0422 39  GLY A CA    
1361 C C     . GLY B 41  ? 1.0796 0.7067 0.9376 0.0071  0.0319  -0.0451 39  GLY A C     
1362 O O     . GLY B 41  ? 1.1315 0.7577 0.9881 0.0120  0.0296  -0.0457 39  GLY A O     
1363 N N     . SER B 42  ? 1.0025 0.6510 0.8825 0.0009  0.0334  -0.0468 40  SER A N     
1364 C CA    . SER B 42  ? 0.9320 0.6051 0.8362 -0.0006 0.0323  -0.0495 40  SER A CA    
1365 C C     . SER B 42  ? 0.8586 0.5461 0.7750 -0.0092 0.0353  -0.0499 40  SER A C     
1366 O O     . SER B 42  ? 0.8807 0.5668 0.7970 -0.0103 0.0355  -0.0493 40  SER A O     
1367 C CB    . SER B 42  ? 0.9005 0.5917 0.8272 0.0094  0.0253  -0.0528 40  SER A CB    
1368 O OG    . SER B 42  ? 0.8918 0.5855 0.8243 0.0139  0.0230  -0.0532 40  SER A OG    
1369 N N     . GLU B 43  ? 0.7289 0.4297 0.6549 -0.0151 0.0378  -0.0509 41  GLU A N     
1370 C CA    . GLU B 43  ? 0.6706 0.3840 0.6059 -0.0237 0.0420  -0.0514 41  GLU A CA    
1371 C C     . GLU B 43  ? 0.5784 0.3171 0.5365 -0.0206 0.0380  -0.0529 41  GLU A C     
1372 O O     . GLU B 43  ? 0.5835 0.3311 0.5504 -0.0130 0.0325  -0.0539 41  GLU A O     
1373 C CB    . GLU B 43  ? 0.7577 0.4706 0.6885 -0.0328 0.0490  -0.0517 41  GLU A CB    
1374 C CG    . GLU B 43  ? 0.8353 0.5542 0.7702 -0.0299 0.0478  -0.0529 41  GLU A CG    
1375 C CD    . GLU B 43  ? 0.9106 0.6237 0.8360 -0.0391 0.0559  -0.0532 41  GLU A CD    
1376 O OE1   . GLU B 43  ? 0.9453 0.6416 0.8535 -0.0464 0.0620  -0.0519 41  GLU A OE1   
1377 O OE2   . GLU B 43  ? 0.9284 0.6535 0.8629 -0.0393 0.0566  -0.0550 41  GLU A OE2   
1378 N N     . PHE B 44  ? 0.5096 0.2589 0.4757 -0.0265 0.0413  -0.0531 42  PHE A N     
1379 C CA    . PHE B 44  ? 0.4843 0.2565 0.4688 -0.0253 0.0404  -0.0539 42  PHE A CA    
1380 C C     . PHE B 44  ? 0.4844 0.2738 0.4812 -0.0325 0.0468  -0.0555 42  PHE A C     
1381 O O     . PHE B 44  ? 0.5190 0.3028 0.5099 -0.0371 0.0507  -0.0562 42  PHE A O     
1382 C CB    . PHE B 44  ? 0.5098 0.2809 0.4949 -0.0250 0.0389  -0.0534 42  PHE A CB    
1383 C CG    . PHE B 44  ? 0.5319 0.2956 0.5129 -0.0163 0.0329  -0.0528 42  PHE A CG    
1384 C CD1   . PHE B 44  ? 0.4764 0.2546 0.4682 -0.0105 0.0301  -0.0531 42  PHE A CD1   
1385 C CD2   . PHE B 44  ? 0.5619 0.3049 0.5286 -0.0142 0.0316  -0.0522 42  PHE A CD2   
1386 C CE1   . PHE B 44  ? 0.4470 0.2187 0.4355 -0.0025 0.0250  -0.0533 42  PHE A CE1   
1387 C CE2   . PHE B 44  ? 0.5316 0.2697 0.4973 -0.0059 0.0270  -0.0525 42  PHE A CE2   
1388 C CZ    . PHE B 44  ? 0.4789 0.2316 0.4562 0.0001  0.0230  -0.0534 42  PHE A CZ    
1389 N N     . SER B 45  ? 0.4631 0.2737 0.4776 -0.0333 0.0485  -0.0565 43  SER A N     
1390 C CA    . SER B 45  ? 0.4381 0.2697 0.4699 -0.0382 0.0544  -0.0590 43  SER A CA    
1391 C C     . SER B 45  ? 0.4594 0.2992 0.4997 -0.0422 0.0565  -0.0604 43  SER A C     
1392 O O     . SER B 45  ? 0.4980 0.3322 0.5345 -0.0401 0.0530  -0.0591 43  SER A O     
1393 C CB    . SER B 45  ? 0.3461 0.2013 0.3978 -0.0335 0.0543  -0.0597 43  SER A CB    
1394 O OG    . SER B 45  ? 0.2927 0.1559 0.3521 -0.0284 0.0509  -0.0584 43  SER A OG    
1395 N N     . GLN B 46  ? 0.4255 0.2776 0.4769 -0.0476 0.0620  -0.0635 44  GLN A N     
1396 C CA    . GLN B 46  ? 0.4021 0.2630 0.4635 -0.0506 0.0632  -0.0658 44  GLN A CA    
1397 C C     . GLN B 46  ? 0.3858 0.2644 0.4635 -0.0449 0.0602  -0.0655 44  GLN A C     
1398 O O     . GLN B 46  ? 0.4056 0.2826 0.4837 -0.0454 0.0580  -0.0656 44  GLN A O     
1399 C CB    . GLN B 46  ? 0.3771 0.2509 0.4507 -0.0559 0.0694  -0.0703 44  GLN A CB    
1400 C CG    . GLN B 46  ? 0.3499 0.2397 0.4410 -0.0565 0.0698  -0.0737 44  GLN A CG    
1401 C CD    . GLN B 46  ? 0.3120 0.2293 0.4282 -0.0510 0.0711  -0.0762 44  GLN A CD    
1402 O OE1   . GLN B 46  ? 0.3269 0.2532 0.4496 -0.0499 0.0744  -0.0775 44  GLN A OE1   
1403 N NE2   . GLN B 46  ? 0.2688 0.1987 0.3990 -0.0474 0.0682  -0.0770 44  GLN A NE2   
1404 N N     . THR B 47  ? 0.3422 0.2369 0.4332 -0.0397 0.0601  -0.0651 45  THR A N     
1405 C CA    . THR B 47  ? 0.3456 0.2568 0.4522 -0.0345 0.0577  -0.0644 45  THR A CA    
1406 C C     . THR B 47  ? 0.3992 0.2936 0.4903 -0.0323 0.0531  -0.0613 45  THR A C     
1407 O O     . THR B 47  ? 0.4159 0.3134 0.5108 -0.0314 0.0513  -0.0612 45  THR A O     
1408 C CB    . THR B 47  ? 0.3268 0.2570 0.4501 -0.0301 0.0581  -0.0644 45  THR A CB    
1409 O OG1   . THR B 47  ? 0.3500 0.2869 0.4790 -0.0323 0.0621  -0.0670 45  THR A OG1   
1410 C CG2   . THR B 47  ? 0.2850 0.2393 0.4322 -0.0263 0.0575  -0.0654 45  THR A CG2   
1411 N N     . THR B 48  ? 0.4193 0.2948 0.4922 -0.0306 0.0508  -0.0590 46  THR A N     
1412 C CA    . THR B 48  ? 0.3932 0.2520 0.4512 -0.0272 0.0464  -0.0567 46  THR A CA    
1413 C C     . THR B 48  ? 0.3687 0.2121 0.4145 -0.0308 0.0449  -0.0569 46  THR A C     
1414 O O     . THR B 48  ? 0.2631 0.1034 0.3065 -0.0286 0.0423  -0.0561 46  THR A O     
1415 C CB    . THR B 48  ? 0.4374 0.2777 0.4785 -0.0237 0.0433  -0.0552 46  THR A CB    
1416 O OG1   . THR B 48  ? 0.4634 0.3178 0.5161 -0.0197 0.0435  -0.0552 46  THR A OG1   
1417 C CG2   . THR B 48  ? 0.4450 0.2671 0.4710 -0.0193 0.0386  -0.0538 46  THR A CG2   
1418 N N     . ILE B 49  ? 0.3889 0.2223 0.4270 -0.0365 0.0467  -0.0579 47  ILE A N     
1419 C CA    . ILE B 49  ? 0.3860 0.2055 0.4144 -0.0408 0.0452  -0.0584 47  ILE A CA    
1420 C C     . ILE B 49  ? 0.3777 0.2121 0.4203 -0.0422 0.0451  -0.0602 47  ILE A C     
1421 O O     . ILE B 49  ? 0.3809 0.2066 0.4173 -0.0419 0.0414  -0.0598 47  ILE A O     
1422 C CB    . ILE B 49  ? 0.3841 0.1922 0.4041 -0.0478 0.0484  -0.0595 47  ILE A CB    
1423 C CG1   . ILE B 49  ? 0.3965 0.1883 0.4015 -0.0459 0.0481  -0.0576 47  ILE A CG1   
1424 C CG2   . ILE B 49  ? 0.3957 0.1903 0.4076 -0.0529 0.0469  -0.0603 47  ILE A CG2   
1425 C CD1   . ILE B 49  ? 0.4141 0.1888 0.4057 -0.0403 0.0430  -0.0555 47  ILE A CD1   
1426 N N     . CYS B 50  ? 0.3456 0.2021 0.4076 -0.0431 0.0488  -0.0625 48  CYS A N     
1427 C CA    . CYS B 50  ? 0.3246 0.1961 0.4019 -0.0432 0.0482  -0.0646 48  CYS A CA    
1428 C C     . CYS B 50  ? 0.3396 0.2143 0.4188 -0.0379 0.0447  -0.0627 48  CYS A C     
1429 O O     . CYS B 50  ? 0.3952 0.2667 0.4732 -0.0385 0.0415  -0.0631 48  CYS A O     
1430 C CB    . CYS B 50  ? 0.2821 0.1783 0.3822 -0.0428 0.0524  -0.0678 48  CYS A CB    
1431 S SG    . CYS B 50  ? 0.2715 0.1876 0.3930 -0.0407 0.0506  -0.0706 48  CYS A SG    
1432 N N     . ARG B 51  ? 0.2918 0.1721 0.3736 -0.0330 0.0452  -0.0607 49  ARG A N     
1433 C CA    . ARG B 51  ? 0.2669 0.1502 0.3506 -0.0286 0.0430  -0.0591 49  ARG A CA    
1434 C C     . ARG B 51  ? 0.2973 0.1565 0.3594 -0.0284 0.0389  -0.0576 49  ARG A C     
1435 O O     . ARG B 51  ? 0.2951 0.1535 0.3566 -0.0269 0.0367  -0.0573 49  ARG A O     
1436 C CB    . ARG B 51  ? 0.2372 0.1297 0.3276 -0.0242 0.0443  -0.0576 49  ARG A CB    
1437 C CG    . ARG B 51  ? 0.2022 0.1209 0.3170 -0.0235 0.0473  -0.0592 49  ARG A CG    
1438 C CD    . ARG B 51  ? 0.2103 0.1412 0.3360 -0.0194 0.0473  -0.0579 49  ARG A CD    
1439 N NE    . ARG B 51  ? 0.2118 0.1684 0.3621 -0.0185 0.0493  -0.0595 49  ARG A NE    
1440 C CZ    . ARG B 51  ? 0.2020 0.1635 0.3566 -0.0181 0.0503  -0.0597 49  ARG A CZ    
1441 N NH1   . ARG B 51  ? 0.2205 0.1619 0.3552 -0.0182 0.0493  -0.0584 49  ARG A NH1   
1442 N NH2   . ARG B 51  ? 0.1721 0.1571 0.3497 -0.0170 0.0515  -0.0615 49  ARG A NH2   
1443 N N     . PHE B 52  ? 0.3271 0.1659 0.3714 -0.0296 0.0376  -0.0569 50  PHE A N     
1444 C CA    . PHE B 52  ? 0.3703 0.1869 0.3963 -0.0285 0.0332  -0.0559 50  PHE A CA    
1445 C C     . PHE B 52  ? 0.4123 0.2230 0.4359 -0.0329 0.0305  -0.0574 50  PHE A C     
1446 O O     . PHE B 52  ? 0.4337 0.2367 0.4513 -0.0310 0.0268  -0.0572 50  PHE A O     
1447 C CB    . PHE B 52  ? 0.3966 0.1945 0.4078 -0.0283 0.0321  -0.0552 50  PHE A CB    
1448 C CG    . PHE B 52  ? 0.4480 0.2255 0.4448 -0.0266 0.0281  -0.0549 50  PHE A CG    
1449 C CD1   . PHE B 52  ? 0.4657 0.2381 0.4579 -0.0199 0.0261  -0.0541 50  PHE A CD1   
1450 C CD2   . PHE B 52  ? 0.4649 0.2295 0.4548 -0.0319 0.0270  -0.0559 50  PHE A CD2   
1451 C CE1   . PHE B 52  ? 0.4763 0.2322 0.4583 -0.0181 0.0236  -0.0545 50  PHE A CE1   
1452 C CE2   . PHE B 52  ? 0.4852 0.2330 0.4644 -0.0304 0.0246  -0.0560 50  PHE A CE2   
1453 C CZ    . PHE B 52  ? 0.4833 0.2270 0.4588 -0.0233 0.0232  -0.0554 50  PHE A CZ    
1454 N N     . GLU B 53  ? 0.4217 0.2351 0.4497 -0.0388 0.0321  -0.0592 51  GLU A N     
1455 C CA    . GLU B 53  ? 0.4359 0.2438 0.4628 -0.0435 0.0289  -0.0611 51  GLU A CA    
1456 C C     . GLU B 53  ? 0.4594 0.2785 0.4954 -0.0413 0.0269  -0.0617 51  GLU A C     
1457 O O     . GLU B 53  ? 0.5228 0.3309 0.5513 -0.0422 0.0219  -0.0622 51  GLU A O     
1458 C CB    . GLU B 53  ? 0.4594 0.2731 0.4939 -0.0501 0.0322  -0.0637 51  GLU A CB    
1459 C CG    . GLU B 53  ? 0.5358 0.3329 0.5580 -0.0543 0.0335  -0.0635 51  GLU A CG    
1460 C CD    . GLU B 53  ? 0.6220 0.4255 0.6520 -0.0615 0.0380  -0.0664 51  GLU A CD    
1461 O OE1   . GLU B 53  ? 0.6430 0.4648 0.6895 -0.0623 0.0396  -0.0690 51  GLU A OE1   
1462 O OE2   . GLU B 53  ? 0.6726 0.4629 0.6930 -0.0662 0.0403  -0.0665 51  GLU A OE2   
1463 N N     . ASN B 54  ? 0.4290 0.2697 0.4817 -0.0383 0.0305  -0.0618 52  ASN A N     
1464 C CA    . ASN B 54  ? 0.4529 0.3057 0.5161 -0.0359 0.0290  -0.0622 52  ASN A CA    
1465 C C     . ASN B 54  ? 0.5018 0.3518 0.5595 -0.0305 0.0284  -0.0597 52  ASN A C     
1466 O O     . ASN B 54  ? 0.5455 0.4050 0.6113 -0.0285 0.0277  -0.0598 52  ASN A O     
1467 C CB    . ASN B 54  ? 0.4419 0.3214 0.5299 -0.0351 0.0326  -0.0641 52  ASN A CB    
1468 C CG    . ASN B 54  ? 0.4839 0.3678 0.5794 -0.0398 0.0339  -0.0673 52  ASN A CG    
1469 O OD1   . ASN B 54  ? 0.5249 0.4115 0.6264 -0.0418 0.0311  -0.0698 52  ASN A OD1   
1470 N ND2   . ASN B 54  ? 0.4742 0.3577 0.5686 -0.0418 0.0380  -0.0676 52  ASN A ND2   
1471 N N     . LEU B 55  ? 0.4918 0.3286 0.5362 -0.0282 0.0286  -0.0579 53  LEU A N     
1472 C CA    . LEU B 55  ? 0.4985 0.3326 0.5384 -0.0229 0.0288  -0.0562 53  LEU A CA    
1473 C C     . LEU B 55  ? 0.4635 0.3215 0.5234 -0.0206 0.0328  -0.0559 53  LEU A C     
1474 O O     . LEU B 55  ? 0.4628 0.3244 0.5253 -0.0181 0.0328  -0.0553 53  LEU A O     
1475 C CB    . LEU B 55  ? 0.5368 0.3557 0.5639 -0.0218 0.0241  -0.0562 53  LEU A CB    
1476 C CG    . LEU B 55  ? 0.5782 0.3733 0.5870 -0.0211 0.0198  -0.0563 53  LEU A CG    
1477 C CD1   . LEU B 55  ? 0.5895 0.3771 0.5953 -0.0265 0.0176  -0.0575 53  LEU A CD1   
1478 C CD2   . LEU B 55  ? 0.6143 0.3979 0.6146 -0.0188 0.0154  -0.0568 53  LEU A CD2   
1479 N N     . GLN B 56  ? 0.4220 0.2962 0.4967 -0.0215 0.0360  -0.0564 54  GLN A N     
1480 C CA    . GLN B 56  ? 0.3953 0.2932 0.4913 -0.0192 0.0392  -0.0564 54  GLN A CA    
1481 C C     . GLN B 56  ? 0.3680 0.2646 0.4618 -0.0164 0.0410  -0.0550 54  GLN A C     
1482 O O     . GLN B 56  ? 0.3091 0.2176 0.4140 -0.0164 0.0429  -0.0553 54  GLN A O     
1483 C CB    . GLN B 56  ? 0.4103 0.3283 0.5263 -0.0210 0.0407  -0.0585 54  GLN A CB    
1484 C CG    . GLN B 56  ? 0.3895 0.3105 0.5103 -0.0228 0.0381  -0.0604 54  GLN A CG    
1485 C CD    . GLN B 56  ? 0.3575 0.2970 0.4977 -0.0235 0.0396  -0.0632 54  GLN A CD    
1486 O OE1   . GLN B 56  ? 0.3429 0.2898 0.4895 -0.0236 0.0428  -0.0638 54  GLN A OE1   
1487 N NE2   . GLN B 56  ? 0.3427 0.2886 0.4917 -0.0236 0.0369  -0.0652 54  GLN A NE2   
1488 N N     . LEU B 57  ? 0.4116 0.2921 0.4901 -0.0136 0.0398  -0.0537 55  LEU A N     
1489 C CA    . LEU B 57  ? 0.4163 0.2933 0.4915 -0.0098 0.0406  -0.0528 55  LEU A CA    
1490 C C     . LEU B 57  ? 0.4220 0.2916 0.4908 -0.0062 0.0405  -0.0522 55  LEU A C     
1491 O O     . LEU B 57  ? 0.4313 0.2947 0.4941 -0.0069 0.0394  -0.0523 55  LEU A O     
1492 C CB    . LEU B 57  ? 0.4161 0.2723 0.4722 -0.0089 0.0382  -0.0525 55  LEU A CB    
1493 C CG    . LEU B 57  ? 0.4157 0.2693 0.4695 -0.0130 0.0381  -0.0531 55  LEU A CG    
1494 C CD1   . LEU B 57  ? 0.3989 0.2263 0.4301 -0.0124 0.0345  -0.0528 55  LEU A CD1   
1495 C CD2   . LEU B 57  ? 0.4394 0.3084 0.5069 -0.0128 0.0404  -0.0533 55  LEU A CD2   
1496 N N     . SER B 58  ? 0.4177 0.2868 0.4869 -0.0022 0.0414  -0.0518 56  SER A N     
1497 C CA    . SER B 58  ? 0.4147 0.2763 0.4779 0.0016  0.0421  -0.0517 56  SER A CA    
1498 C C     . SER B 58  ? 0.4661 0.3016 0.5053 0.0044  0.0384  -0.0520 56  SER A C     
1499 O O     . SER B 58  ? 0.4774 0.3003 0.5052 0.0038  0.0351  -0.0522 56  SER A O     
1500 C CB    . SER B 58  ? 0.3624 0.2304 0.4336 0.0055  0.0437  -0.0520 56  SER A CB    
1501 O OG    . SER B 58  ? 0.3403 0.1946 0.3989 0.0093  0.0406  -0.0524 56  SER A OG    
1502 N N     . PHE B 59  ? 0.4834 0.3113 0.5164 0.0072  0.0390  -0.0523 57  PHE A N     
1503 C CA    . PHE B 59  ? 0.4941 0.2997 0.5082 0.0102  0.0351  -0.0532 57  PHE A CA    
1504 C C     . PHE B 59  ? 0.5529 0.3467 0.5587 0.0151  0.0323  -0.0540 57  PHE A C     
1505 O O     . PHE B 59  ? 0.5954 0.3747 0.5907 0.0148  0.0284  -0.0547 57  PHE A O     
1506 C CB    . PHE B 59  ? 0.4887 0.2899 0.4998 0.0132  0.0371  -0.0538 57  PHE A CB    
1507 C CG    . PHE B 59  ? 0.5403 0.3216 0.5365 0.0168  0.0340  -0.0553 57  PHE A CG    
1508 C CD1   . PHE B 59  ? 0.5696 0.3404 0.5577 0.0135  0.0305  -0.0557 57  PHE A CD1   
1509 C CD2   . PHE B 59  ? 0.5581 0.3322 0.5506 0.0234  0.0350  -0.0567 57  PHE A CD2   
1510 C CE1   . PHE B 59  ? 0.5894 0.3442 0.5672 0.0159  0.0293  -0.0572 57  PHE A CE1   
1511 C CE2   . PHE B 59  ? 0.5727 0.3306 0.5544 0.0263  0.0337  -0.0583 57  PHE A CE2   
1512 C CZ    . PHE B 59  ? 0.5828 0.3313 0.5572 0.0222  0.0316  -0.0583 57  PHE A CZ    
1513 N N     . LYS B 60  ? 0.5549 0.3552 0.5669 0.0194  0.0340  -0.0544 58  LYS A N     
1514 C CA    . LYS B 60  ? 0.5387 0.3275 0.5429 0.0253  0.0301  -0.0557 58  LYS A CA    
1515 C C     . LYS B 60  ? 0.5337 0.3205 0.5356 0.0220  0.0273  -0.0551 58  LYS A C     
1516 O O     . LYS B 60  ? 0.5440 0.3161 0.5367 0.0240  0.0230  -0.0562 58  LYS A O     
1517 C CB    . LYS B 60  ? 0.5155 0.3126 0.5275 0.0310  0.0320  -0.0567 58  LYS A CB    
1518 C CG    . LYS B 60  ? 0.5168 0.3265 0.5405 0.0305  0.0379  -0.0565 58  LYS A CG    
1519 C CD    . LYS B 60  ? 0.5158 0.3490 0.5599 0.0238  0.0421  -0.0549 58  LYS A CD    
1520 C CE    . LYS B 60  ? 0.5728 0.4191 0.6311 0.0227  0.0476  -0.0550 58  LYS A CE    
1521 N NZ    . LYS B 60  ? 0.5887 0.4580 0.6686 0.0155  0.0505  -0.0538 58  LYS A NZ    
1522 N N     . ASN B 61  ? 0.5070 0.3101 0.5203 0.0167  0.0304  -0.0536 59  ASN A N     
1523 C CA    . ASN B 61  ? 0.5268 0.3289 0.5386 0.0132  0.0288  -0.0531 59  ASN A CA    
1524 C C     . ASN B 61  ? 0.5606 0.3505 0.5629 0.0086  0.0267  -0.0531 59  ASN A C     
1525 O O     . ASN B 61  ? 0.5887 0.3680 0.5839 0.0075  0.0243  -0.0533 59  ASN A O     
1526 C CB    . ASN B 61  ? 0.2707 0.0964 0.3016 0.0083  0.0333  -0.0523 59  ASN A CB    
1527 C CG    . ASN B 61  ? 0.3454 0.1712 0.3758 0.0064  0.0323  -0.0523 59  ASN A CG    
1528 O OD1   . ASN B 61  ? 0.3682 0.1757 0.3834 0.0092  0.0281  -0.0527 59  ASN A OD1   
1529 N ND2   . ASN B 61  ? 0.2474 0.0944 0.2961 0.0018  0.0358  -0.0522 59  ASN A ND2   
1530 N N     . ALA B 62  ? 0.5497 0.3409 0.5526 0.0055  0.0277  -0.0529 60  ALA A N     
1531 C CA    . ALA B 62  ? 0.5084 0.2884 0.5036 0.0009  0.0255  -0.0533 60  ALA A CA    
1532 C C     . ALA B 62  ? 0.5566 0.3172 0.5403 0.0040  0.0228  -0.0543 60  ALA A C     
1533 O O     . ALA B 62  ? 0.5843 0.3347 0.5620 0.0004  0.0223  -0.0544 60  ALA A O     
1534 C CB    . ALA B 62  ? 0.4428 0.2273 0.4408 -0.0020 0.0259  -0.0534 60  ALA A CB    
1535 N N     . CYS B 63  ? 0.5809 0.3369 0.5623 0.0104  0.0226  -0.0552 61  CYS A N     
1536 C CA    . CYS B 63  ? 0.6204 0.3597 0.5927 0.0137  0.0223  -0.0562 61  CYS A CA    
1537 C C     . CYS B 63  ? 0.6002 0.3332 0.5696 0.0154  0.0217  -0.0562 61  CYS A C     
1538 O O     . CYS B 63  ? 0.6205 0.3380 0.5787 0.0141  0.0232  -0.0558 61  CYS A O     
1539 C CB    . CYS B 63  ? 0.6423 0.3799 0.6145 0.0206  0.0232  -0.0575 61  CYS A CB    
1540 S SG    . CYS B 63  ? 0.6480 0.3883 0.6201 0.0189  0.0249  -0.0576 61  CYS A SG    
1541 N N     . LYS B 64  ? 0.5636 0.3070 0.5405 0.0183  0.0201  -0.0564 62  LYS A N     
1542 C CA    . LYS B 64  ? 0.5892 0.3269 0.5639 0.0199  0.0191  -0.0566 62  LYS A CA    
1543 C C     . LYS B 64  ? 0.6287 0.3610 0.5977 0.0121  0.0208  -0.0550 62  LYS A C     
1544 O O     . LYS B 64  ? 0.6722 0.3886 0.6294 0.0112  0.0226  -0.0543 62  LYS A O     
1545 C CB    . LYS B 64  ? 0.5732 0.3235 0.5564 0.0241  0.0164  -0.0572 62  LYS A CB    
1546 N N     . LEU B 65  ? 0.6148 0.3591 0.5898 0.0061  0.0214  -0.0541 63  LEU A N     
1547 C CA    . LEU B 65  ? 0.5806 0.3216 0.5521 -0.0015 0.0234  -0.0533 63  LEU A CA    
1548 C C     . LEU B 65  ? 0.5479 0.2745 0.5092 -0.0060 0.0250  -0.0532 63  LEU A C     
1549 O O     . LEU B 65  ? 0.5225 0.2373 0.4741 -0.0106 0.0273  -0.0526 63  LEU A O     
1550 C CB    . LEU B 65  ? 0.5666 0.3254 0.5486 -0.0065 0.0249  -0.0529 63  LEU A CB    
1551 C CG    . LEU B 65  ? 0.5737 0.3437 0.5623 -0.0061 0.0260  -0.0526 63  LEU A CG    
1552 C CD1   . LEU B 65  ? 0.5796 0.3527 0.5705 0.0021  0.0235  -0.0529 63  LEU A CD1   
1553 C CD2   . LEU B 65  ? 0.5592 0.3493 0.5612 -0.0114 0.0300  -0.0525 63  LEU A CD2   
1554 N N     . LYS B 66  ? 0.5547 0.2810 0.5164 -0.0050 0.0242  -0.0538 64  LYS A N     
1555 C CA    . LYS B 66  ? 0.5963 0.3078 0.5471 -0.0089 0.0254  -0.0539 64  LYS A CA    
1556 C C     . LYS B 66  ? 0.6434 0.3341 0.5769 -0.0067 0.0275  -0.0530 64  LYS A C     
1557 O O     . LYS B 66  ? 0.6737 0.3497 0.5943 -0.0120 0.0292  -0.0524 64  LYS A O     
1558 C CB    . LYS B 66  ? 0.6019 0.3152 0.5548 -0.0066 0.0241  -0.0548 64  LYS A CB    
1559 C CG    . LYS B 66  ? 0.6458 0.3439 0.5873 -0.0104 0.0247  -0.0552 64  LYS A CG    
1560 C CD    . LYS B 66  ? 0.6608 0.3613 0.6048 -0.0082 0.0234  -0.0563 64  LYS A CD    
1561 C CE    . LYS B 66  ? 0.6864 0.3691 0.6162 -0.0107 0.0240  -0.0568 64  LYS A CE    
1562 N NZ    . LYS B 66  ? 0.7161 0.3800 0.6281 -0.0068 0.0264  -0.0557 64  LYS A NZ    
1563 N N     . ALA B 67  ? 0.6816 0.3700 0.6134 0.0010  0.0271  -0.0529 65  ALA A N     
1564 C CA    . ALA B 67  ? 0.7081 0.3755 0.6208 0.0040  0.0285  -0.0517 65  ALA A CA    
1565 C C     . ALA B 67  ? 0.7481 0.4079 0.6525 -0.0003 0.0300  -0.0502 65  ALA A C     
1566 O O     . ALA B 67  ? 0.7871 0.4267 0.6717 -0.0037 0.0319  -0.0487 65  ALA A O     
1567 C CB    . ALA B 67  ? 0.6620 0.3303 0.5773 0.0140  0.0273  -0.0525 65  ALA A CB    
1568 N N     . ILE B 68  ? 0.7232 0.3977 0.6409 -0.0005 0.0292  -0.0507 66  ILE A N     
1569 C CA    . ILE B 68  ? 0.6717 0.3392 0.5813 -0.0047 0.0312  -0.0494 66  ILE A CA    
1570 C C     . ILE B 68  ? 0.6692 0.3326 0.5739 -0.0150 0.0341  -0.0490 66  ILE A C     
1571 O O     . ILE B 68  ? 0.7118 0.3573 0.5987 -0.0195 0.0370  -0.0476 66  ILE A O     
1572 C CB    . ILE B 68  ? 0.6074 0.2929 0.5332 -0.0026 0.0295  -0.0503 66  ILE A CB    
1573 C CG1   . ILE B 68  ? 0.6075 0.3011 0.5434 0.0073  0.0259  -0.0518 66  ILE A CG1   
1574 C CG2   . ILE B 68  ? 0.5799 0.2546 0.4940 -0.0049 0.0317  -0.0490 66  ILE A CG2   
1575 C CD1   . ILE B 68  ? 0.5870 0.2975 0.5383 0.0098  0.0230  -0.0531 66  ILE A CD1   
1576 N N     . LEU B 69  ? 0.6259 0.3048 0.5456 -0.0190 0.0333  -0.0505 67  LEU A N     
1577 C CA    . LEU B 69  ? 0.6680 0.3457 0.5868 -0.0287 0.0357  -0.0509 67  LEU A CA    
1578 C C     . LEU B 69  ? 0.7398 0.3976 0.6422 -0.0322 0.0367  -0.0507 67  LEU A C     
1579 O O     . LEU B 69  ? 0.8142 0.4618 0.7077 -0.0401 0.0396  -0.0506 67  LEU A O     
1580 C CB    . LEU B 69  ? 0.6443 0.3437 0.5828 -0.0313 0.0337  -0.0527 67  LEU A CB    
1581 C CG    . LEU B 69  ? 0.6161 0.3340 0.5683 -0.0322 0.0343  -0.0530 67  LEU A CG    
1582 C CD1   . LEU B 69  ? 0.6399 0.3639 0.5958 -0.0243 0.0325  -0.0523 67  LEU A CD1   
1583 C CD2   . LEU B 69  ? 0.5620 0.2980 0.5292 -0.0347 0.0329  -0.0543 67  LEU A CD2   
1584 N N     . SER B 70  ? 0.7126 0.3643 0.6103 -0.0266 0.0347  -0.0507 68  SER A N     
1585 C CA    . SER B 70  ? 0.7443 0.3756 0.6246 -0.0294 0.0354  -0.0504 68  SER A CA    
1586 C C     . SER B 70  ? 0.7571 0.3649 0.6134 -0.0303 0.0379  -0.0481 68  SER A C     
1587 O O     . SER B 70  ? 0.7590 0.3509 0.6015 -0.0373 0.0398  -0.0479 68  SER A O     
1588 C CB    . SER B 70  ? 0.7769 0.4055 0.6550 -0.0225 0.0331  -0.0507 68  SER A CB    
1589 O OG    . SER B 70  ? 0.7675 0.4177 0.6662 -0.0194 0.0308  -0.0522 68  SER A OG    
1590 N N     . LYS B 71  ? 0.7781 0.3827 0.6289 -0.0233 0.0377  -0.0467 69  LYS A N     
1591 C CA    . LYS B 71  ? 0.8540 0.4353 0.6805 -0.0234 0.0394  -0.0443 69  LYS A CA    
1592 C C     . LYS B 71  ? 0.9098 0.4893 0.7336 -0.0329 0.0433  -0.0440 69  LYS A C     
1593 O O     . LYS B 71  ? 0.9628 0.5198 0.7641 -0.0376 0.0458  -0.0424 69  LYS A O     
1594 C CB    . LYS B 71  ? 0.8674 0.4481 0.6915 -0.0133 0.0374  -0.0433 69  LYS A CB    
1595 C CG    . LYS B 71  ? 0.8770 0.4575 0.7019 -0.0035 0.0343  -0.0440 69  LYS A CG    
1596 C CD    . LYS B 71  ? 0.8722 0.4560 0.7000 0.0063  0.0321  -0.0439 69  LYS A CD    
1597 C CE    . LYS B 71  ? 0.8713 0.4553 0.7010 0.0159  0.0296  -0.0452 69  LYS A CE    
1598 N NZ    . LYS B 71  ? 0.8666 0.4581 0.7049 0.0253  0.0272  -0.0462 69  LYS A NZ    
1599 N N     . TRP B 72  ? 0.9094 0.5115 0.7550 -0.0361 0.0440  -0.0455 70  TRP A N     
1600 C CA    . TRP B 72  ? 0.9221 0.5241 0.7667 -0.0454 0.0483  -0.0457 70  TRP A CA    
1601 C C     . TRP B 72  ? 0.9543 0.5511 0.7972 -0.0553 0.0504  -0.0471 70  TRP A C     
1602 O O     . TRP B 72  ? 0.9833 0.5645 0.8111 -0.0632 0.0547  -0.0466 70  TRP A O     
1603 C CB    . TRP B 72  ? 0.8733 0.5013 0.7416 -0.0455 0.0481  -0.0473 70  TRP A CB    
1604 C CG    . TRP B 72  ? 0.8645 0.4956 0.7347 -0.0554 0.0531  -0.0482 70  TRP A CG    
1605 C CD1   . TRP B 72  ? 0.8707 0.4934 0.7296 -0.0582 0.0573  -0.0471 70  TRP A CD1   
1606 C CD2   . TRP B 72  ? 0.8420 0.4854 0.7262 -0.0638 0.0547  -0.0509 70  TRP A CD2   
1607 N NE1   . TRP B 72  ? 0.8495 0.4790 0.7147 -0.0682 0.0622  -0.0490 70  TRP A NE1   
1608 C CE2   . TRP B 72  ? 0.8232 0.4659 0.7047 -0.0716 0.0606  -0.0515 70  TRP A CE2   
1609 C CE3   . TRP B 72  ? 0.8332 0.4874 0.7314 -0.0652 0.0516  -0.0530 70  TRP A CE3   
1610 C CZ2   . TRP B 72  ? 0.8071 0.4609 0.7009 -0.0807 0.0637  -0.0545 70  TRP A CZ2   
1611 C CZ3   . TRP B 72  ? 0.8097 0.4739 0.7195 -0.0738 0.0537  -0.0557 70  TRP A CZ3   
1612 C CH2   . TRP B 72  ? 0.7994 0.4641 0.7076 -0.0814 0.0598  -0.0566 70  TRP A CH2   
1613 N N     . LEU B 73  ? 0.9573 0.5663 0.8153 -0.0551 0.0473  -0.0492 71  LEU A N     
1614 C CA    . LEU B 73  ? 1.0074 0.6121 0.8659 -0.0640 0.0480  -0.0511 71  LEU A CA    
1615 C C     . LEU B 73  ? 1.0753 0.6512 0.9074 -0.0672 0.0498  -0.0496 71  LEU A C     
1616 O O     . LEU B 73  ? 1.0962 0.6621 0.9210 -0.0769 0.0535  -0.0503 71  LEU A O     
1617 C CB    . LEU B 73  ? 1.0004 0.6185 0.8751 -0.0613 0.0431  -0.0532 71  LEU A CB    
1618 C CG    . LEU B 73  ? 0.9805 0.6214 0.8792 -0.0657 0.0417  -0.0561 71  LEU A CG    
1619 C CD1   . LEU B 73  ? 0.9721 0.6203 0.8811 -0.0626 0.0363  -0.0578 71  LEU A CD1   
1620 C CD2   . LEU B 73  ? 0.9837 0.6205 0.8818 -0.0770 0.0452  -0.0579 71  LEU A CD2   
1621 N N     . GLU B 74  ? 1.1200 0.6818 0.9369 -0.0592 0.0475  -0.0477 72  GLU A N     
1622 C CA    . GLU B 74  ? 1.1907 0.7230 0.9794 -0.0610 0.0486  -0.0458 72  GLU A CA    
1623 C C     . GLU B 74  ? 1.2054 0.7227 0.9770 -0.0667 0.0535  -0.0440 72  GLU A C     
1624 O O     . GLU B 74  ? 1.2345 0.7353 0.9926 -0.0759 0.0567  -0.0441 72  GLU A O     
1625 C CB    . GLU B 74  ? 1.2271 0.7480 1.0022 -0.0497 0.0452  -0.0439 72  GLU A CB    
1626 C CG    . GLU B 74  ? 1.2430 0.7742 1.0300 -0.0444 0.0413  -0.0457 72  GLU A CG    
1627 C CD    . GLU B 74  ? 1.2952 0.8158 1.0692 -0.0332 0.0387  -0.0442 72  GLU A CD    
1628 O OE1   . GLU B 74  ? 1.3326 0.8367 1.0877 -0.0293 0.0391  -0.0419 72  GLU A OE1   
1629 O OE2   . GLU B 74  ? 1.3180 0.8463 1.1002 -0.0281 0.0362  -0.0455 72  GLU A OE2   
1630 N N     . GLU B 75  ? 1.1897 0.7118 0.9612 -0.0616 0.0542  -0.0424 73  GLU A N     
1631 C CA    . GLU B 75  ? 1.2046 0.7111 0.9576 -0.0663 0.0588  -0.0405 73  GLU A CA    
1632 C C     . GLU B 75  ? 1.1584 0.6754 0.9229 -0.0782 0.0643  -0.0426 73  GLU A C     
1633 O O     . GLU B 75  ? 1.1789 0.6786 0.9251 -0.0857 0.0695  -0.0415 73  GLU A O     
1634 C CB    . GLU B 75  ? 1.2246 0.7336 0.9751 -0.0569 0.0572  -0.0385 73  GLU A CB    
1635 C CG    . GLU B 75  ? 1.2746 0.7570 0.9951 -0.0580 0.0599  -0.0355 73  GLU A CG    
1636 C CD    . GLU B 75  ? 1.3206 0.7766 1.0144 -0.0505 0.0562  -0.0331 73  GLU A CD    
1637 O OE1   . GLU B 75  ? 1.3108 0.7734 1.0123 -0.0413 0.0512  -0.0336 73  GLU A OE1   
1638 O OE2   . GLU B 75  ? 1.3662 0.7944 1.0308 -0.0539 0.0584  -0.0308 73  GLU A OE2   
1639 N N     . ALA B 76  ? 1.0942 0.6384 0.8876 -0.0800 0.0633  -0.0456 74  ALA A N     
1640 C CA    . ALA B 76  ? 1.0883 0.6449 0.8950 -0.0905 0.0681  -0.0483 74  ALA A CA    
1641 C C     . ALA B 76  ? 1.1101 0.6664 0.9235 -0.0995 0.0684  -0.0512 74  ALA A C     
1642 O O     . ALA B 76  ? 1.1231 0.6888 0.9477 -0.1088 0.0725  -0.0539 74  ALA A O     
1643 C CB    . ALA B 76  ? 1.0526 0.6392 0.8867 -0.0868 0.0665  -0.0501 74  ALA A CB    
1644 N N     . GLU B 77  ? 1.1167 0.6626 0.9240 -0.0969 0.0642  -0.0510 75  GLU A N     
1645 C CA    . GLU B 77  ? 1.0883 0.6303 0.8995 -0.1054 0.0638  -0.0538 75  GLU A CA    
1646 C C     . GLU B 77  ? 1.1189 0.6302 0.9024 -0.1113 0.0667  -0.0522 75  GLU A C     
1647 O O     . GLU B 77  ? 1.1401 0.6456 0.9253 -0.1195 0.0668  -0.0546 75  GLU A O     
1648 C CB    . GLU B 77  ? 1.0481 0.6003 0.8732 -0.0995 0.0567  -0.0553 75  GLU A CB    
1649 C CG    . GLU B 77  ? 1.0491 0.6165 0.8964 -0.1064 0.0547  -0.0596 75  GLU A CG    
1650 C CD    . GLU B 77  ? 1.0566 0.6390 0.9204 -0.0990 0.0475  -0.0610 75  GLU A CD    
1651 O OE1   . GLU B 77  ? 1.0626 0.6406 0.9183 -0.0894 0.0450  -0.0588 75  GLU A OE1   
1652 O OE2   . GLU B 77  ? 1.0540 0.6518 0.9379 -0.1026 0.0444  -0.0645 75  GLU A OE2   
1653 N N     . GLN B 78  ? 1.1762 0.7650 0.6545 -0.2537 -0.0999 0.0434  76  GLN A N     
1654 C CA    . GLN B 78  ? 1.2170 0.7840 0.6777 -0.2642 -0.1023 0.0484  76  GLN A CA    
1655 C C     . GLN B 78  ? 1.2533 0.8193 0.7036 -0.2762 -0.1019 0.0497  76  GLN A C     
1656 O O     . GLN B 78  ? 1.2610 0.8180 0.7012 -0.2818 -0.1037 0.0512  76  GLN A O     
1657 C CB    . GLN B 78  ? 1.2194 0.7667 0.6769 -0.2547 -0.1126 0.0517  76  GLN A CB    
1658 N N     . VAL B 79  ? 1.2657 0.8455 0.7201 -0.2780 -0.0986 0.0467  77  VAL A N     
1659 C CA    . VAL B 79  ? 1.3538 0.9301 0.7941 -0.2920 -0.0956 0.0471  77  VAL A CA    
1660 C C     . VAL B 79  ? 1.3257 0.9238 0.7743 -0.2912 -0.0878 0.0400  77  VAL A C     
1661 O O     . VAL B 79  ? 1.3624 0.9536 0.8075 -0.2910 -0.0918 0.0418  77  VAL A O     
1662 C CB    . VAL B 79  ? 1.4529 1.0054 0.8799 -0.2948 -0.1074 0.0541  77  VAL A CB    
1663 N N     . GLY B 80  ? 1.2515 0.8737 0.7095 -0.2922 -0.0775 0.0325  78  GLY A N     
1664 C CA    . GLY B 80  ? 1.2574 0.8984 0.7211 -0.2939 -0.0690 0.0251  78  GLY A CA    
1665 C C     . GLY B 80  ? 1.2173 0.8852 0.6976 -0.2901 -0.0622 0.0185  78  GLY A C     
1666 O O     . GLY B 80  ? 1.1803 0.8545 0.6726 -0.2802 -0.0660 0.0196  78  GLY A O     
1667 N N     . ALA B 81  ? 1.2178 0.8991 0.6960 -0.3003 -0.0517 0.0117  79  ALA A N     
1668 C CA    . ALA B 81  ? 1.2173 0.9236 0.7091 -0.3006 -0.0458 0.0058  79  ALA A CA    
1669 C C     . ALA B 81  ? 1.2313 0.9482 0.7195 -0.3123 -0.0334 -0.0027 79  ALA A C     
1670 O O     . ALA B 81  ? 1.2522 0.9550 0.7245 -0.3214 -0.0279 -0.0040 79  ALA A O     
1671 C CB    . ALA B 81  ? 1.2380 0.9455 0.7252 -0.3093 -0.0452 0.0079  79  ALA A CB    
1672 N N     . LYS B 95  ? 1.2614 0.8129 0.6477 -0.3048 0.0102  -0.0593 93  LYS A N     
1673 C CA    . LYS B 95  ? 1.2461 0.8110 0.6530 -0.2959 0.0238  -0.0712 93  LYS A CA    
1674 C C     . LYS B 95  ? 1.2288 0.8244 0.6713 -0.2873 0.0550  -0.0909 93  LYS A C     
1675 O O     . LYS B 95  ? 1.2334 0.8259 0.6667 -0.3001 0.0763  -0.0974 93  LYS A O     
1676 C CB    . LYS B 95  ? 1.1903 0.7720 0.6287 -0.2726 -0.0054 -0.0636 93  LYS A CB    
1677 C CG    . LYS B 95  ? 1.1825 0.7617 0.6240 -0.2703 -0.0006 -0.0688 93  LYS A CG    
1678 C CD    . LYS B 95  ? 1.1077 0.7184 0.5990 -0.2415 -0.0171 -0.0699 93  LYS A CD    
1679 C CE    . LYS B 95  ? 1.0765 0.6989 0.5865 -0.2350 0.0023  -0.0843 93  LYS A CE    
1680 N NZ    . LYS B 95  ? 0.9952 0.6524 0.5581 -0.2065 -0.0064 -0.0893 93  LYS A NZ    
1681 N N     . ARG B 96  ? 1.2108 0.8351 0.6953 -0.2664 0.0577  -0.0999 94  ARG A N     
1682 C CA    . ARG B 96  ? 1.2009 0.8558 0.7255 -0.2565 0.0857  -0.1174 94  ARG A CA    
1683 C C     . ARG B 96  ? 1.1848 0.8722 0.7568 -0.2280 0.0720  -0.1198 94  ARG A C     
1684 O O     . ARG B 96  ? 1.1957 0.8784 0.7685 -0.2205 0.0558  -0.1148 94  ARG A O     
1685 C CB    . ARG B 96  ? 1.2131 0.8567 0.7306 -0.2724 0.1242  -0.1313 94  ARG A CB    
1686 N N     . ARG B 97  ? 1.1662 0.8847 0.7765 -0.2136 0.0785  -0.1273 95  ARG A N     
1687 C CA    . ARG B 97  ? 1.1291 0.8770 0.7832 -0.1879 0.0678  -0.1301 95  ARG A CA    
1688 C C     . ARG B 97  ? 1.1688 0.9327 0.8545 -0.1814 0.0961  -0.1451 95  ARG A C     
1689 O O     . ARG B 97  ? 1.2264 0.9893 0.9151 -0.1938 0.1291  -0.1559 95  ARG A O     
1690 C CB    . ARG B 97  ? 1.0557 0.8292 0.7369 -0.1760 0.0630  -0.1312 95  ARG A CB    
1691 C CG    . ARG B 97  ? 1.0518 0.8145 0.7120 -0.1770 0.0339  -0.1154 95  ARG A CG    
1692 C CD    . ARG B 97  ? 1.0049 0.7929 0.6969 -0.1576 0.0196  -0.1135 95  ARG A CD    
1693 N NE    . ARG B 97  ? 0.9637 0.7831 0.6994 -0.1443 0.0388  -0.1270 95  ARG A NE    
1694 C CZ    . ARG B 97  ? 0.9585 0.8041 0.7235 -0.1422 0.0575  -0.1317 95  ARG A CZ    
1695 N NH1   . ARG B 97  ? 0.9838 0.8164 0.7210 -0.1600 0.0611  -0.1332 95  ARG A NH1   
1696 N NH2   . ARG B 97  ? 0.9297 0.8141 0.7533 -0.1230 0.0713  -0.1337 95  ARG A NH2   
1697 N N     . THR B 98  ? 1.1167 0.8956 0.8303 -0.1615 0.0841  -0.1452 96  THR A N     
1698 C CA    . THR B 98  ? 1.0701 0.8704 0.8242 -0.1496 0.1086  -0.1577 96  THR A CA    
1699 C C     . THR B 98  ? 1.0197 0.8652 0.8356 -0.1224 0.1072  -0.1574 96  THR A C     
1700 O O     . THR B 98  ? 1.0445 0.9018 0.8747 -0.1043 0.0785  -0.1447 96  THR A O     
1701 C CB    . THR B 98  ? 1.0292 0.8163 0.7746 -0.1453 0.0961  -0.1538 96  THR A CB    
1702 O OG1   . THR B 98  ? 1.0572 0.8066 0.7492 -0.1691 0.0923  -0.1470 96  THR A OG1   
1703 C CG2   . THR B 98  ? 0.9865 0.7966 0.7759 -0.1328 0.1234  -0.1653 96  THR A CG2   
1704 N N     . THR B 99  ? 0.9589 0.8332 0.8188 -0.1174 0.1362  -0.1653 97  THR A N     
1705 C CA    . THR B 99  ? 0.9108 0.8322 0.8348 -0.0921 0.1325  -0.1583 97  THR A CA    
1706 C C     . THR B 99  ? 0.8703 0.8181 0.8423 -0.0686 0.1341  -0.1571 97  THR A C     
1707 O O     . THR B 99  ? 0.9253 0.8686 0.9043 -0.0724 0.1567  -0.1670 97  THR A O     
1708 C CB    . THR B 99  ? 0.9184 0.8596 0.8731 -0.0985 0.1600  -0.1647 97  THR A CB    
1709 O OG1   . THR B 99  ? 0.9319 0.8596 0.8539 -0.1125 0.1502  -0.1613 97  THR A OG1   
1710 C CG2   . THR B 99  ? 0.8607 0.8512 0.8898 -0.0736 0.1611  -0.1585 97  THR A CG2   
1711 N N     . ILE B 100 ? 0.7443 0.7172 0.7477 -0.0454 0.1112  -0.1455 98  ILE A N     
1712 C CA    . ILE B 100 ? 0.6484 0.6466 0.6970 -0.0218 0.1095  -0.1428 98  ILE A CA    
1713 C C     . ILE B 100 ? 0.6139 0.6520 0.7248 -0.0109 0.1289  -0.1443 98  ILE A C     
1714 O O     . ILE B 100 ? 0.6033 0.6569 0.7295 -0.0121 0.1276  -0.1401 98  ILE A O     
1715 C CB    . ILE B 100 ? 0.5747 0.5764 0.6251 -0.0036 0.0773  -0.1297 98  ILE A CB    
1716 C CG1   . ILE B 100 ? 0.6096 0.5732 0.6088 -0.0135 0.0578  -0.1265 98  ILE A CG1   
1717 C CG2   . ILE B 100 ? 0.4996 0.5303 0.6002 0.0212  0.0769  -0.1266 98  ILE A CG2   
1718 C CD1   . ILE B 100 ? 0.5844 0.5488 0.5901 0.0042  0.0293  -0.1136 98  ILE A CD1   
1719 N N     . SER B 101 ? 0.5689 0.6195 0.7103 -0.0027 0.1378  -0.1416 99  SER A N     
1720 C CA    . SER B 101 ? 0.5082 0.5837 0.6931 0.0032  0.1408  -0.1297 99  SER A CA    
1721 C C     . SER B 101 ? 0.4422 0.5413 0.6504 0.0192  0.1186  -0.1147 99  SER A C     
1722 O O     . SER B 101 ? 0.4585 0.5571 0.6569 0.0308  0.0990  -0.1089 99  SER A O     
1723 C CB    . SER B 101 ? 0.5292 0.6042 0.7248 0.0087  0.1424  -0.1235 99  SER A CB    
1724 O OG    . SER B 101 ? 0.5366 0.6152 0.7278 0.0247  0.1209  -0.1130 99  SER A OG    
1725 N N     . ILE B 102 ? 0.4302 0.4016 0.8856 -0.0264 -0.1136 -0.0389 100 ILE A N     
1726 C CA    . ILE B 102 ? 0.4777 0.4011 0.9028 -0.0220 -0.1374 -0.0286 100 ILE A CA    
1727 C C     . ILE B 102 ? 0.5264 0.4000 0.9089 -0.0160 -0.1357 -0.0218 100 ILE A C     
1728 O O     . ILE B 102 ? 0.5563 0.3877 0.8839 -0.0126 -0.1393 -0.0096 100 ILE A O     
1729 C CB    . ILE B 102 ? 0.4920 0.4206 0.9502 -0.0135 -0.1660 -0.0372 100 ILE A CB    
1730 C CG1   . ILE B 102 ? 0.4780 0.4491 0.9616 -0.0201 -0.1539 -0.0376 100 ILE A CG1   
1731 C CG2   . ILE B 102 ? 0.5134 0.3959 0.9366 -0.0059 -0.1959 -0.0335 100 ILE A CG2   
1732 C CD1   . ILE B 102 ? 0.4733 0.4510 0.9880 -0.0134 -0.1730 -0.0480 100 ILE A CD1   
1733 N N     . ALA B 103 ? 0.5414 0.4185 0.9474 -0.0125 -0.1272 -0.0292 101 ALA A N     
1734 C CA    . ALA B 103 ? 0.5930 0.4214 0.9601 -0.0064 -0.1178 -0.0163 101 ALA A CA    
1735 C C     . ALA B 103 ? 0.6072 0.4235 0.9369 -0.0152 -0.0892 -0.0068 101 ALA A C     
1736 O O     . ALA B 103 ? 0.6890 0.4560 0.9662 -0.0100 -0.0817 0.0114  101 ALA A O     
1737 C CB    . ALA B 103 ? 0.5893 0.4278 1.0040 -0.0020 -0.1140 -0.0280 101 ALA A CB    
1738 N N     . ALA B 104 ? 0.5248 0.3864 0.8819 -0.0260 -0.0730 -0.0188 102 ALA A N     
1739 C CA    . ALA B 104 ? 0.5062 0.3624 0.8353 -0.0336 -0.0488 -0.0132 102 ALA A CA    
1740 C C     . ALA B 104 ? 0.5179 0.3485 0.7947 -0.0343 -0.0529 0.0014  102 ALA A C     
1741 O O     . ALA B 104 ? 0.5607 0.3577 0.7951 -0.0344 -0.0386 0.0122  102 ALA A O     
1742 C CB    . ALA B 104 ? 0.4636 0.3784 0.8367 -0.0406 -0.0343 -0.0324 102 ALA A CB    
1743 N N     . LYS B 105 ? 0.5007 0.3478 0.7863 -0.0344 -0.0715 0.0003  103 LYS A N     
1744 C CA    . LYS B 105 ? 0.5510 0.3768 0.7987 -0.0340 -0.0777 0.0086  103 LYS A CA    
1745 C C     . LYS B 105 ? 0.6538 0.4210 0.8493 -0.0216 -0.0891 0.0172  103 LYS A C     
1746 O O     . LYS B 105 ? 0.6954 0.4327 0.8484 -0.0190 -0.0818 0.0238  103 LYS A O     
1747 C CB    . LYS B 105 ? 0.5284 0.3828 0.8084 -0.0362 -0.0961 0.0051  103 LYS A CB    
1748 C CG    . LYS B 105 ? 0.4674 0.3758 0.7905 -0.0450 -0.0814 0.0047  103 LYS A CG    
1749 C CD    . LYS B 105 ? 0.4350 0.3619 0.7831 -0.0471 -0.0919 0.0100  103 LYS A CD    
1750 C CE    . LYS B 105 ? 0.4283 0.3841 0.8210 -0.0455 -0.1018 0.0040  103 LYS A CE    
1751 N NZ    . LYS B 105 ? 0.4346 0.4055 0.8544 -0.0484 -0.1061 0.0117  103 LYS A NZ    
1752 N N     . ASP B 106 ? 0.7129 0.4625 0.9115 -0.0105 -0.1088 0.0177  104 ASP A N     
1753 C CA    . ASP B 106 ? 0.8250 0.5177 0.9691 0.0081  -0.1216 0.0307  104 ASP A CA    
1754 C C     . ASP B 106 ? 0.8642 0.5243 0.9750 0.0099  -0.0897 0.0496  104 ASP A C     
1755 O O     . ASP B 106 ? 0.9317 0.5464 0.9855 0.0239  -0.0896 0.0667  104 ASP A O     
1756 C CB    . ASP B 106 ? 0.9159 0.6004 1.0733 0.0230  -0.1500 0.0293  104 ASP A CB    
1757 C CG    . ASP B 106 ? 0.9922 0.6977 1.1774 0.0251  -0.1867 0.0105  104 ASP A CG    
1758 O OD1   . ASP B 106 ? 1.0302 0.7404 1.2098 0.0198  -0.1934 0.0023  104 ASP A OD1   
1759 O OD2   . ASP B 106 ? 1.0191 0.7370 1.2388 0.0320  -0.2086 0.0023  104 ASP A OD2   
1760 N N     . ALA B 107 ? 0.8216 0.5053 0.9687 -0.0028 -0.0644 0.0457  105 ALA A N     
1761 C CA    . ALA B 107 ? 0.8378 0.4959 0.9665 -0.0057 -0.0329 0.0595  105 ALA A CA    
1762 C C     . ALA B 107 ? 0.8265 0.4862 0.9318 -0.0146 -0.0150 0.0599  105 ALA A C     
1763 O O     . ALA B 107 ? 0.9175 0.5373 0.9810 -0.0092 0.0004  0.0793  105 ALA A O     
1764 C CB    . ALA B 107 ? 0.8053 0.4970 0.9918 -0.0168 -0.0191 0.0461  105 ALA A CB    
1765 N N     . LEU B 108 ? 0.7044 0.4117 0.8386 -0.0265 -0.0164 0.0416  106 LEU A N     
1766 C CA    . LEU B 108 ? 0.6439 0.3561 0.7620 -0.0330 -0.0021 0.0407  106 LEU A CA    
1767 C C     . LEU B 108 ? 0.6599 0.3257 0.7269 -0.0205 -0.0129 0.0517  106 LEU A C     
1768 O O     . LEU B 108 ? 0.6935 0.3337 0.7317 -0.0184 0.0059  0.0618  106 LEU A O     
1769 C CB    . LEU B 108 ? 0.5795 0.3486 0.7374 -0.0425 -0.0055 0.0252  106 LEU A CB    
1770 C CG    . LEU B 108 ? 0.5289 0.3481 0.7406 -0.0503 0.0068  0.0117  106 LEU A CG    
1771 C CD1   . LEU B 108 ? 0.4677 0.3384 0.7165 -0.0541 -0.0003 0.0030  106 LEU A CD1   
1772 C CD2   . LEU B 108 ? 0.5292 0.3533 0.7453 -0.0555 0.0328  0.0088  106 LEU A CD2   
1773 N N     . GLU B 109 ? 0.6476 0.3071 0.7084 -0.0106 -0.0456 0.0470  107 GLU A N     
1774 C CA    . GLU B 109 ? 0.6755 0.2995 0.6799 0.0066  -0.0658 0.0480  107 GLU A CA    
1775 C C     . GLU B 109 ? 0.7069 0.2924 0.6470 0.0256  -0.0552 0.0697  107 GLU A C     
1776 O O     . GLU B 109 ? 0.6641 0.2351 0.5440 0.0401  -0.0516 0.0717  107 GLU A O     
1777 C CB    . GLU B 109 ? 0.6824 0.3123 0.7009 0.0142  -0.1070 0.0323  107 GLU A CB    
1778 C CG    . GLU B 109 ? 0.5125 0.1654 0.5631 0.0046  -0.1181 0.0140  107 GLU A CG    
1779 C CD    . GLU B 109 ? 0.7122 0.3442 0.7142 0.0199  -0.1301 0.0011  107 GLU A CD    
1780 O OE1   . GLU B 109 ? 0.7663 0.3736 0.7018 0.0410  -0.1329 0.0057  107 GLU A OE1   
1781 O OE2   . GLU B 109 ? 0.6984 0.3412 0.7299 0.0129  -0.1359 -0.0133 107 GLU A OE2   
1782 N N     . ARG B 110 ? 0.7119 0.2820 0.6651 0.0279  -0.0489 0.0875  108 ARG A N     
1783 C CA    . ARG B 110 ? 0.7974 0.3294 0.6958 0.0453  -0.0310 0.1188  108 ARG A CA    
1784 C C     . ARG B 110 ? 0.8184 0.3476 0.7136 0.0329  0.0152  0.1315  108 ARG A C     
1785 O O     . ARG B 110 ? 0.8983 0.4073 0.7298 0.0479  0.0335  0.1520  108 ARG A O     
1786 C CB    . ARG B 110 ? 0.8261 0.3390 0.7548 0.0501  -0.0352 0.1362  108 ARG A CB    
1787 C CG    . ARG B 110 ? 0.9429 0.4133 0.8069 0.0782  -0.0311 0.1746  108 ARG A CG    
1788 C CD    . ARG B 110 ? 0.9924 0.4621 0.8864 0.0912  -0.0554 0.1806  108 ARG A CD    
1789 N NE    . ARG B 110 ? 0.9602 0.4510 0.9339 0.0692  -0.0373 0.1629  108 ARG A NE    
1790 C CZ    . ARG B 110 ? 0.9063 0.4345 0.9314 0.0616  -0.0623 0.1324  108 ARG A CZ    
1791 N NH1   . ARG B 110 ? 0.8894 0.4309 0.9044 0.0724  -0.1034 0.1176  108 ARG A NH1   
1792 N NH2   . ARG B 110 ? 0.8668 0.4218 0.9521 0.0433  -0.0498 0.1139  108 ARG A NH2   
1793 N N     . HIS B 111 ? 0.7496 0.3066 0.7144 0.0073  0.0341  0.1173  109 HIS A N     
1794 C CA    . HIS B 111 ? 0.7509 0.3267 0.7264 -0.0065 0.0706  0.1176  109 HIS A CA    
1795 C C     . HIS B 111 ? 0.7576 0.3340 0.6910 -0.0019 0.0768  0.1088  109 HIS A C     
1796 O O     . HIS B 111 ? 0.7534 0.3266 0.6662 -0.0027 0.1094  0.1179  109 HIS A O     
1797 C CB    . HIS B 111 ? 0.6784 0.3097 0.7293 -0.0289 0.0749  0.0915  109 HIS A CB    
1798 C CG    . HIS B 111 ? 0.6932 0.3288 0.7828 -0.0337 0.0820  0.0946  109 HIS A CG    
1799 N ND1   . HIS B 111 ? 0.7594 0.3702 0.8430 -0.0316 0.1074  0.1186  109 HIS A ND1   
1800 C CD2   . HIS B 111 ? 0.6651 0.3276 0.8040 -0.0389 0.0699  0.0762  109 HIS A CD2   
1801 C CE1   . HIS B 111 ? 0.7620 0.3797 0.8939 -0.0364 0.1079  0.1138  109 HIS A CE1   
1802 N NE2   . HIS B 111 ? 0.7047 0.3540 0.8696 -0.0399 0.0855  0.0866  109 HIS A NE2   
1803 N N     . PHE B 112 ? 0.7661 0.3585 0.6951 0.0021  0.0432  0.0872  110 PHE A N     
1804 C CA    . PHE B 112 ? 0.7913 0.3955 0.6954 0.0059  0.0419  0.0712  110 PHE A CA    
1805 C C     . PHE B 112 ? 0.9290 0.5089 0.7508 0.0303  0.0435  0.0792  110 PHE A C     
1806 O O     . PHE B 112 ? 0.9201 0.5076 0.7183 0.0340  0.0595  0.0706  110 PHE A O     
1807 C CB    . PHE B 112 ? 0.7152 0.3385 0.6493 0.0031  0.0065  0.0487  110 PHE A CB    
1808 C CG    . PHE B 112 ? 0.7112 0.3447 0.6388 0.0056  0.0039  0.0311  110 PHE A CG    
1809 C CD1   . PHE B 112 ? 0.6697 0.3308 0.6375 -0.0082 0.0234  0.0261  110 PHE A CD1   
1810 C CD2   . PHE B 112 ? 0.7547 0.3728 0.6408 0.0243  -0.0207 0.0162  110 PHE A CD2   
1811 C CE1   . PHE B 112 ? 0.6484 0.3158 0.6158 -0.0037 0.0204  0.0115  110 PHE A CE1   
1812 C CE2   . PHE B 112 ? 0.7450 0.3701 0.6354 0.0274  -0.0239 -0.0037 110 PHE A CE2   
1813 C CZ    . PHE B 112 ? 0.6775 0.3245 0.6094 0.0132  -0.0026 -0.0037 110 PHE A CZ    
1814 N N     . GLY B 113 ? 1.0504 0.6059 0.8263 0.0503  0.0267  0.0944  111 GLY A N     
1815 C CA    . GLY B 113 ? 1.2151 0.7562 0.9038 0.0790  0.0279  0.1027  111 GLY A CA    
1816 C C     . GLY B 113 ? 1.3301 0.8627 0.9872 0.0804  0.0781  0.1325  111 GLY A C     
1817 O O     . GLY B 113 ? 1.4537 0.9890 1.0439 0.1007  0.0893  0.1332  111 GLY A O     
1818 N N     . GLU B 114 ? 1.2828 0.8085 0.9927 0.0592  0.1100  0.1547  112 GLU A N     
1819 C CA    . GLU B 114 ? 1.3784 0.8954 1.0780 0.0558  0.1621  0.1852  112 GLU A CA    
1820 C C     . GLU B 114 ? 1.3718 0.9175 1.1247 0.0319  0.1917  0.1653  112 GLU A C     
1821 O O     . GLU B 114 ? 1.4061 0.9502 1.1711 0.0237  0.2376  0.1861  112 GLU A O     
1822 C CB    . GLU B 114 ? 1.4082 0.8964 1.1438 0.0486  0.1812  0.2219  112 GLU A CB    
1823 C CG    . GLU B 114 ? 1.4718 0.9325 1.1676 0.0728  0.1485  0.2422  112 GLU A CG    
1824 C CD    . GLU B 114 ? 1.6174 1.0600 1.2114 0.1082  0.1588  0.2798  112 GLU A CD    
1825 O OE1   . GLU B 114 ? 1.6758 1.1291 1.2249 0.1143  0.1910  0.2873  112 GLU A OE1   
1826 O OE2   . GLU B 114 ? 1.6774 1.1073 1.2410 0.1305  0.1325  0.2979  112 GLU A OE2   
1827 N N     . GLN B 115 ? 1.2342 0.8074 1.0199 0.0227  0.1671  0.1276  113 GLN A N     
1828 C CA    . GLN B 115 ? 1.1277 0.7333 0.9654 0.0042  0.1880  0.1067  113 GLN A CA    
1829 C C     . GLN B 115 ? 1.0287 0.6594 0.9044 -0.0025 0.1534  0.0748  113 GLN A C     
1830 O O     . GLN B 115 ? 1.0157 0.6598 0.9482 -0.0171 0.1405  0.0689  113 GLN A O     
1831 C CB    . GLN B 115 ? 1.0928 0.7064 1.0038 -0.0197 0.2212  0.1159  113 GLN A CB    
1832 C CG    . GLN B 115 ? 1.0197 0.6729 0.9837 -0.0352 0.2434  0.0928  113 GLN A CG    
1833 C CD    . GLN B 115 ? 0.9911 0.6487 0.9127 -0.0253 0.2736  0.0962  113 GLN A CD    
1834 O OE1   . GLN B 115 ? 1.0246 0.6578 0.8928 -0.0132 0.2970  0.1249  113 GLN A OE1   
1835 N NE2   . GLN B 115 ? 0.9168 0.6090 0.8614 -0.0278 0.2741  0.0683  113 GLN A NE2   
1836 N N     . ASN B 116 ? 0.9534 0.5914 0.7998 0.0099  0.1393  0.0551  114 ASN A N     
1837 C CA    . ASN B 116 ? 0.8817 0.5399 0.7691 0.0045  0.1110  0.0313  114 ASN A CA    
1838 C C     . ASN B 116 ? 0.8273 0.5217 0.7815 -0.0140 0.1290  0.0245  114 ASN A C     
1839 O O     . ASN B 116 ? 0.8121 0.5271 0.8143 -0.0243 0.1124  0.0200  114 ASN A O     
1840 C CB    . ASN B 116 ? 0.9015 0.5563 0.7533 0.0226  0.0959  0.0101  114 ASN A CB    
1841 C CG    . ASN B 116 ? 0.9903 0.6196 0.7793 0.0446  0.0702  0.0074  114 ASN A CG    
1842 O OD1   . ASN B 116 ? 1.0393 0.6514 0.7996 0.0492  0.0693  0.0280  114 ASN A OD1   
1843 N ND2   . ASN B 116 ? 1.0281 0.6566 0.7994 0.0606  0.0472  -0.0206 114 ASN A ND2   
1844 N N     . LYS B 117 ? 0.7788 0.4875 0.7367 -0.0161 0.1627  0.0223  115 LYS A N     
1845 C CA    . LYS B 117 ? 0.6719 0.4219 0.6934 -0.0301 0.1787  0.0111  115 LYS A CA    
1846 C C     . LYS B 117 ? 0.6350 0.3919 0.6923 -0.0455 0.2095  0.0197  115 LYS A C     
1847 O O     . LYS B 117 ? 0.6775 0.4345 0.7323 -0.0475 0.2447  0.0241  115 LYS A O     
1848 C CB    . LYS B 117 ? 0.6557 0.4244 0.6746 -0.0219 0.1931  -0.0043 115 LYS A CB    
1849 C CG    . LYS B 117 ? 0.6624 0.4132 0.6414 -0.0034 0.1689  -0.0150 115 LYS A CG    
1850 C CD    . LYS B 117 ? 0.6562 0.4283 0.6430 0.0057  0.1839  -0.0332 115 LYS A CD    
1851 C CE    . LYS B 117 ? 0.6903 0.4395 0.6244 0.0273  0.1721  -0.0476 115 LYS A CE    
1852 N NZ    . LYS B 117 ? 0.6771 0.4485 0.6259 0.0380  0.1849  -0.0692 115 LYS A NZ    
1853 N N     . PRO B 118 ? 0.5747 0.3390 0.6728 -0.0567 0.1990  0.0205  116 PRO A N     
1854 C CA    . PRO B 118 ? 0.5730 0.3480 0.7166 -0.0687 0.2220  0.0217  116 PRO A CA    
1855 C C     . PRO B 118 ? 0.5099 0.3404 0.7162 -0.0758 0.2339  -0.0051 116 PRO A C     
1856 O O     . PRO B 118 ? 0.4739 0.3387 0.7006 -0.0757 0.2224  -0.0217 116 PRO A O     
1857 C CB    . PRO B 118 ? 0.5551 0.3358 0.7142 -0.0683 0.1914  0.0217  116 PRO A CB    
1858 C CG    . PRO B 118 ? 0.4958 0.2933 0.6550 -0.0659 0.1633  0.0118  116 PRO A CG    
1859 C CD    . PRO B 118 ? 0.5229 0.2980 0.6356 -0.0565 0.1634  0.0155  116 PRO A CD    
1860 N N     . SER B 119 ? 0.5145 0.3526 0.7531 -0.0798 0.2554  -0.0088 117 SER A N     
1861 C CA    . SER B 119 ? 0.5058 0.3898 0.8018 -0.0836 0.2624  -0.0384 117 SER A CA    
1862 C C     . SER B 119 ? 0.4651 0.3884 0.8048 -0.0835 0.2360  -0.0634 117 SER A C     
1863 O O     . SER B 119 ? 0.4391 0.3559 0.7732 -0.0821 0.2175  -0.0569 117 SER A O     
1864 C CB    . SER B 119 ? 0.5485 0.4221 0.8716 -0.0884 0.2913  -0.0359 117 SER A CB    
1865 O OG    . SER B 119 ? 0.5626 0.4262 0.9165 -0.0908 0.2885  -0.0327 117 SER A OG    
1866 N N     . SER B 120 ? 0.6114 0.3848 0.8309 -0.1674 -0.0688 -0.0216 118 SER A N     
1867 C CA    . SER B 120 ? 0.6177 0.4018 0.8537 -0.1599 -0.0715 -0.0241 118 SER A CA    
1868 C C     . SER B 120 ? 0.6618 0.4393 0.9053 -0.1599 -0.0749 -0.0237 118 SER A C     
1869 O O     . SER B 120 ? 0.6628 0.4481 0.9211 -0.1527 -0.0791 -0.0244 118 SER A O     
1870 C CB    . SER B 120 ? 0.6126 0.4046 0.8504 -0.1599 -0.0654 -0.0296 118 SER A CB    
1871 O OG    . SER B 120 ? 0.6076 0.4125 0.8626 -0.1512 -0.0677 -0.0322 118 SER A OG    
1872 N N     . GLN B 121 ? 0.6993 0.4621 0.9330 -0.1677 -0.0729 -0.0226 119 GLN A N     
1873 C CA    . GLN B 121 ? 0.7093 0.4640 0.9488 -0.1683 -0.0757 -0.0220 119 GLN A CA    
1874 C C     . GLN B 121 ? 0.7050 0.4553 0.9469 -0.1655 -0.0833 -0.0162 119 GLN A C     
1875 O O     . GLN B 121 ? 0.6949 0.4461 0.9482 -0.1611 -0.0882 -0.0155 119 GLN A O     
1876 C CB    . GLN B 121 ? 0.7289 0.4690 0.9568 -0.1780 -0.0697 -0.0233 119 GLN A CB    
1877 C CG    . GLN B 121 ? 0.7434 0.4868 0.9698 -0.1813 -0.0630 -0.0289 119 GLN A CG    
1878 C CD    . GLN B 121 ? 0.7923 0.5207 1.0054 -0.1914 -0.0572 -0.0298 119 GLN A CD    
1879 O OE1   . GLN B 121 ? 0.8291 0.5443 1.0350 -0.1957 -0.0576 -0.0265 119 GLN A OE1   
1880 N NE2   . GLN B 121 ? 0.7831 0.5136 0.9934 -0.1952 -0.0518 -0.0342 119 GLN A NE2   
1881 N N     . GLU B 122 ? 0.7224 0.4680 0.9540 -0.1680 -0.0846 -0.0121 120 GLU A N     
1882 C CA    . GLU B 122 ? 0.7553 0.4982 0.9894 -0.1649 -0.0927 -0.0063 120 GLU A CA    
1883 C C     . GLU B 122 ? 0.7635 0.5204 1.0115 -0.1553 -0.0992 -0.0054 120 GLU A C     
1884 O O     . GLU B 122 ? 0.7516 0.5078 1.0072 -0.1514 -0.1064 -0.0020 120 GLU A O     
1885 C CB    . GLU B 122 ? 0.7721 0.5090 0.9929 -0.1691 -0.0928 -0.0023 120 GLU A CB    
1886 C CG    . GLU B 122 ? 0.8167 0.5423 1.0236 -0.1780 -0.0849 -0.0040 120 GLU A CG    
1887 C CD    . GLU B 122 ? 0.8694 0.5876 1.0648 -0.1819 -0.0859 0.0005  120 GLU A CD    
1888 O OE1   . GLU B 122 ? 0.8953 0.6138 1.0930 -0.1786 -0.0937 0.0055  120 GLU A OE1   
1889 O OE2   . GLU B 122 ? 0.8914 0.6037 1.0757 -0.1881 -0.0790 -0.0011 120 GLU A OE2   
1890 N N     . ILE B 123 ? 0.7541 0.5238 1.0059 -0.1514 -0.0967 -0.0086 121 ILE A N     
1891 C CA    . ILE B 123 ? 0.7577 0.5409 1.0232 -0.1419 -0.1022 -0.0081 121 ILE A CA    
1892 C C     . ILE B 123 ? 0.8067 0.5929 1.0872 -0.1371 -0.1048 -0.0100 121 ILE A C     
1893 O O     . ILE B 123 ? 0.8391 0.6303 1.1306 -0.1307 -0.1119 -0.0074 121 ILE A O     
1894 C CB    . ILE B 123 ? 0.7225 0.5177 0.9885 -0.1389 -0.0979 -0.0113 121 ILE A CB    
1895 C CG1   . ILE B 123 ? 0.6946 0.4878 0.9475 -0.1421 -0.0971 -0.0085 121 ILE A CG1   
1896 C CG2   . ILE B 123 ? 0.7175 0.5270 0.9999 -0.1288 -0.1021 -0.0121 121 ILE A CG2   
1897 C CD1   . ILE B 123 ? 0.6540 0.4568 0.9046 -0.1405 -0.0917 -0.0117 121 ILE A CD1   
1898 N N     . MET B 124 ? 0.8225 0.6057 1.1039 -0.1404 -0.0993 -0.0146 122 MET A N     
1899 C CA    . MET B 124 ? 0.8225 0.6074 1.1176 -0.1366 -0.1014 -0.0167 122 MET A CA    
1900 C C     . MET B 124 ? 0.8273 0.5998 1.1214 -0.1390 -0.1062 -0.0126 122 MET A C     
1901 O O     . MET B 124 ? 0.7982 0.5732 1.1046 -0.1338 -0.1111 -0.0120 122 MET A O     
1902 C CB    . MET B 124 ? 0.8480 0.6324 1.1436 -0.1401 -0.0941 -0.0229 122 MET A CB    
1903 C CG    . MET B 124 ? 0.8703 0.6705 1.1762 -0.1339 -0.0914 -0.0277 122 MET A CG    
1904 S SD    . MET B 124 ? 0.9154 0.7229 1.2414 -0.1271 -0.0933 -0.0318 122 MET A SD    
1905 C CE    . MET B 124 ? 0.8730 0.7003 1.2107 -0.1182 -0.0912 -0.0361 122 MET A CE    
1906 N N     . ARG B 125 ? 0.8153 0.5742 1.0947 -0.1468 -0.1046 -0.0097 123 ARG A N     
1907 C CA    . ARG B 125 ? 0.8262 0.5723 1.1035 -0.1493 -0.1088 -0.0054 123 ARG A CA    
1908 C C     . ARG B 125 ? 0.8158 0.5662 1.0985 -0.1434 -0.1181 0.0002  123 ARG A C     
1909 O O     . ARG B 125 ? 0.8449 0.5905 1.1336 -0.1416 -0.1234 0.0030  123 ARG A O     
1910 C CB    . ARG B 125 ? 0.8534 0.5847 1.1137 -0.1586 -0.1044 -0.0037 123 ARG A CB    
1911 C CG    . ARG B 125 ? 0.8844 0.6008 1.1410 -0.1620 -0.1074 0.0006  123 ARG A CG    
1912 C CD    . ARG B 125 ? 0.9152 0.6183 1.1552 -0.1705 -0.1026 0.0022  123 ARG A CD    
1913 N NE    . ARG B 125 ? 0.9203 0.6240 1.1534 -0.1755 -0.0937 -0.0030 123 ARG A NE    
1914 C CZ    . ARG B 125 ? 0.9240 0.6214 1.1435 -0.1818 -0.0886 -0.0027 123 ARG A CZ    
1915 N NH1   . ARG B 125 ? 0.9324 0.6226 1.1440 -0.1838 -0.0916 0.0026  123 ARG A NH1   
1916 N NH2   . ARG B 125 ? 0.9123 0.6108 1.1263 -0.1860 -0.0807 -0.0076 123 ARG A NH2   
1917 N N     . MET B 126 ? 0.7513 0.5104 1.0319 -0.1406 -0.1200 0.0019  124 MET A N     
1918 C CA    . MET B 126 ? 0.7068 0.4709 0.9925 -0.1352 -0.1288 0.0071  124 MET A CA    
1919 C C     . MET B 126 ? 0.6725 0.4502 0.9756 -0.1258 -0.1328 0.0055  124 MET A C     
1920 O O     . MET B 126 ? 0.6925 0.4718 1.0039 -0.1213 -0.1405 0.0091  124 MET A O     
1921 C CB    . MET B 126 ? 0.7087 0.4760 0.9846 -0.1363 -0.1289 0.0093  124 MET A CB    
1922 C CG    . MET B 126 ? 0.7540 0.5088 1.0128 -0.1451 -0.1250 0.0109  124 MET A CG    
1923 S SD    . MET B 126 ? 0.7675 0.5281 1.0161 -0.1458 -0.1238 0.0122  124 MET A SD    
1924 C CE    . MET B 126 ? 0.8078 0.5527 1.0378 -0.1564 -0.1181 0.0132  124 MET A CE    
1925 N N     . ALA B 127 ? 0.6394 0.4275 0.9485 -0.1228 -0.1278 0.0001  125 ALA A N     
1926 C CA    . ALA B 127 ? 0.5860 0.3875 0.9124 -0.1136 -0.1307 -0.0020 125 ALA A CA    
1927 C C     . ALA B 127 ? 0.5834 0.3812 0.9204 -0.1117 -0.1340 -0.0022 125 ALA A C     
1928 O O     . ALA B 127 ? 0.5842 0.3897 0.9344 -0.1044 -0.1401 -0.0009 125 ALA A O     
1929 C CB    . ALA B 127 ? 0.5616 0.3728 0.8917 -0.1117 -0.1236 -0.0082 125 ALA A CB    
1930 N N     . GLU B 128 ? 0.5901 0.3759 0.9213 -0.1183 -0.1299 -0.0039 126 GLU A N     
1931 C CA    . GLU B 128 ? 0.6089 0.3891 0.9486 -0.1174 -0.1325 -0.0040 126 GLU A CA    
1932 C C     . GLU B 128 ? 0.6313 0.4021 0.9676 -0.1185 -0.1396 0.0027  126 GLU A C     
1933 O O     . GLU B 128 ? 0.6289 0.4011 0.9762 -0.1138 -0.1454 0.0044  126 GLU A O     
1934 C CB    . GLU B 128 ? 0.6265 0.3966 0.9608 -0.1243 -0.1249 -0.0083 126 GLU A CB    
1935 C CG    . GLU B 128 ? 0.6606 0.4190 0.9977 -0.1263 -0.1268 -0.0073 126 GLU A CG    
1936 C CD    . GLU B 128 ? 0.6817 0.4399 1.0257 -0.1270 -0.1214 -0.0136 126 GLU A CD    
1937 O OE1   . GLU B 128 ? 0.6731 0.4389 1.0179 -0.1272 -0.1157 -0.0188 126 GLU A OE1   
1938 O OE2   . GLU B 128 ? 0.7022 0.4524 1.0509 -0.1275 -0.1227 -0.0135 126 GLU A OE2   
1939 N N     . GLU B 129 ? 0.6645 0.4260 0.9859 -0.1246 -0.1394 0.0065  127 GLU A N     
1940 C CA    . GLU B 129 ? 0.6978 0.4502 1.0151 -0.1260 -0.1461 0.0130  127 GLU A CA    
1941 C C     . GLU B 129 ? 0.7151 0.4784 1.0412 -0.1185 -0.1550 0.0170  127 GLU A C     
1942 O O     . GLU B 129 ? 0.7357 0.4950 1.0655 -0.1169 -0.1620 0.0216  127 GLU A O     
1943 C CB    . GLU B 129 ? 0.7025 0.4437 1.0019 -0.1340 -0.1433 0.0157  127 GLU A CB    
1944 C CG    . GLU B 129 ? 0.7121 0.4479 1.0058 -0.1346 -0.1508 0.0228  127 GLU A CG    
1945 C CD    . GLU B 129 ? 0.7437 0.4704 1.0203 -0.1420 -0.1474 0.0248  127 GLU A CD    
1946 O OE1   . GLU B 129 ? 0.7529 0.4720 1.0213 -0.1480 -0.1393 0.0214  127 GLU A OE1   
1947 O OE2   . GLU B 129 ? 0.7603 0.4875 1.0317 -0.1420 -0.1528 0.0297  127 GLU A OE2   
1948 N N     . LEU B 130 ? 0.6902 0.4670 1.0201 -0.1139 -0.1548 0.0154  128 LEU A N     
1949 C CA    . LEU B 130 ? 0.6512 0.4385 0.9889 -0.1070 -0.1626 0.0190  128 LEU A CA    
1950 C C     . LEU B 130 ? 0.6306 0.4316 0.9863 -0.0981 -0.1642 0.0158  128 LEU A C     
1951 O O     . LEU B 130 ? 0.6489 0.4593 1.0129 -0.0917 -0.1705 0.0184  128 LEU A O     
1952 C CB    . LEU B 130 ? 0.4774 0.2693 0.8058 -0.1080 -0.1614 0.0201  128 LEU A CB    
1953 N N     . ASN B 131 ? 0.6032 0.4057 0.9654 -0.0976 -0.1585 0.0101  129 ASN A N     
1954 C CA    . ASN B 131 ? 0.5593 0.3745 0.9390 -0.0893 -0.1593 0.0064  129 ASN A CA    
1955 C C     . ASN B 131 ? 0.5083 0.3378 0.8920 -0.0835 -0.1583 0.0049  129 ASN A C     
1956 O O     . ASN B 131 ? 0.4710 0.3114 0.8673 -0.0755 -0.1632 0.0057  129 ASN A O     
1957 C CB    . ASN B 131 ? 0.5789 0.3951 0.9703 -0.0843 -0.1676 0.0098  129 ASN A CB    
1958 C CG    . ASN B 131 ? 0.5935 0.4206 1.0029 -0.0767 -0.1676 0.0054  129 ASN A CG    
1959 O OD1   . ASN B 131 ? 0.6318 0.4626 1.0443 -0.0766 -0.1608 -0.0006 129 ASN A OD1   
1960 N ND2   . ASN B 131 ? 0.5739 0.4066 0.9954 -0.0705 -0.1752 0.0082  129 ASN A ND2   
1961 N N     . LEU B 132 ? 0.5247 0.3537 0.8976 -0.0877 -0.1516 0.0026  130 LEU A N     
1962 C CA    . LEU B 132 ? 0.5369 0.3779 0.9118 -0.0831 -0.1491 0.0007  130 LEU A CA    
1963 C C     . LEU B 132 ? 0.5320 0.3757 0.9054 -0.0850 -0.1399 -0.0058 130 LEU A C     
1964 O O     . LEU B 132 ? 0.5497 0.3842 0.9165 -0.0916 -0.1353 -0.0081 130 LEU A O     
1965 C CB    . LEU B 132 ? 0.5635 0.4018 0.9250 -0.0864 -0.1505 0.0050  130 LEU A CB    
1966 C CG    . LEU B 132 ? 0.4119 0.2508 0.7758 -0.0833 -0.1598 0.0112  130 LEU A CG    
1967 C CD1   . LEU B 132 ? 0.4202 0.2525 0.7680 -0.0892 -0.1604 0.0152  130 LEU A CD1   
1968 C CD2   . LEU B 132 ? 0.3913 0.2447 0.7695 -0.0735 -0.1629 0.0107  130 LEU A CD2   
1969 N N     . GLU B 133 ? 0.5281 0.3844 0.9080 -0.0790 -0.1371 -0.0088 131 GLU A N     
1970 C CA    . GLU B 133 ? 0.5855 0.4453 0.9635 -0.0806 -0.1285 -0.0147 131 GLU A CA    
1971 C C     . GLU B 133 ? 0.6180 0.4699 0.9773 -0.0891 -0.1235 -0.0140 131 GLU A C     
1972 O O     . GLU B 133 ? 0.5952 0.4428 0.9446 -0.0918 -0.1264 -0.0093 131 GLU A O     
1973 C CB    . GLU B 133 ? 0.6284 0.5036 1.0182 -0.0716 -0.1269 -0.0179 131 GLU A CB    
1974 C CG    . GLU B 133 ? 0.6874 0.5712 1.0957 -0.0624 -0.1322 -0.0181 131 GLU A CG    
1975 C CD    . GLU B 133 ? 0.7518 0.6426 1.1725 -0.0586 -0.1277 -0.0247 131 GLU A CD    
1976 O OE1   . GLU B 133 ? 0.7840 0.6686 1.1994 -0.0648 -0.1225 -0.0281 131 GLU A OE1   
1977 O OE2   . GLU B 133 ? 0.7603 0.6627 1.1961 -0.0494 -0.1292 -0.0266 131 GLU A OE2   
1978 N N     . LYS B 134 ? 0.7781 0.5904 0.8106 0.0437  -0.2027 -0.1742 132 LYS A N     
1979 C CA    . LYS B 134 ? 0.8066 0.6501 0.8909 0.0080  -0.1832 -0.1793 132 LYS A CA    
1980 C C     . LYS B 134 ? 0.7680 0.6612 0.8398 0.0209  -0.1758 -0.1725 132 LYS A C     
1981 O O     . LYS B 134 ? 0.7779 0.6914 0.8566 -0.0005 -0.1566 -0.1652 132 LYS A O     
1982 C CB    . LYS B 134 ? 0.8498 0.7097 1.0098 -0.0119 -0.1872 -0.2038 132 LYS A CB    
1983 C CG    . LYS B 134 ? 0.8531 0.7589 1.0728 -0.0439 -0.1638 -0.2101 132 LYS A CG    
1984 C CD    . LYS B 134 ? 0.9214 0.8562 1.2143 -0.0498 -0.1724 -0.2376 132 LYS A CD    
1985 C CE    . LYS B 134 ? 0.9591 0.9402 1.3136 -0.0810 -0.1440 -0.2433 132 LYS A CE    
1986 N NZ    . LYS B 134 ? 0.9514 0.9747 1.2888 -0.0595 -0.1430 -0.2403 132 LYS A NZ    
1987 N N     . GLU B 135 ? 0.6839 0.5911 0.7372 0.0552  -0.1889 -0.1730 133 GLU A N     
1988 C CA    . GLU B 135 ? 0.6073 0.5468 0.6476 0.0671  -0.1782 -0.1631 133 GLU A CA    
1989 C C     . GLU B 135 ? 0.5657 0.5046 0.5552 0.0682  -0.1590 -0.1371 133 GLU A C     
1990 O O     . GLU B 135 ? 0.5322 0.4994 0.5236 0.0575  -0.1424 -0.1285 133 GLU A O     
1991 C CB    . GLU B 135 ? 0.6215 0.5550 0.6472 0.1025  -0.1938 -0.1663 133 GLU A CB    
1992 C CG    . GLU B 135 ? 0.6190 0.5708 0.6355 0.1131  -0.1829 -0.1586 133 GLU A CG    
1993 C CD    . GLU B 135 ? 0.6135 0.5980 0.6845 0.1001  -0.1841 -0.1772 133 GLU A CD    
1994 O OE1   . GLU B 135 ? 0.6331 0.6308 0.7570 0.0798  -0.1894 -0.1969 133 GLU A OE1   
1995 O OE2   . GLU B 135 ? 0.5977 0.5929 0.6619 0.1092  -0.1774 -0.1731 133 GLU A OE2   
1996 N N     . VAL B 136 ? 0.5708 0.4794 0.5168 0.0833  -0.1609 -0.1248 134 VAL A N     
1997 C CA    . VAL B 136 ? 0.4974 0.4097 0.4022 0.0872  -0.1407 -0.1003 134 VAL A CA    
1998 C C     . VAL B 136 ? 0.4810 0.4040 0.3862 0.0605  -0.1328 -0.0949 134 VAL A C     
1999 O O     . VAL B 136 ? 0.4292 0.3805 0.3225 0.0563  -0.1129 -0.0763 134 VAL A O     
2000 C CB    . VAL B 136 ? 0.4750 0.3533 0.3424 0.1097  -0.1444 -0.0928 134 VAL A CB    
2001 C CG1   . VAL B 136 ? 0.4553 0.3360 0.2951 0.1060  -0.1267 -0.0721 134 VAL A CG1   
2002 C CG2   . VAL B 136 ? 0.4739 0.3502 0.3303 0.1351  -0.1390 -0.0910 134 VAL A CG2   
2003 N N     . VAL B 137 ? 0.5190 0.4170 0.4490 0.0372  -0.1370 -0.1043 135 VAL A N     
2004 C CA    . VAL B 137 ? 0.3527 0.2592 0.2936 0.0071  -0.1055 -0.0808 135 VAL A CA    
2005 C C     . VAL B 137 ? 0.3787 0.3343 0.3643 -0.0131 -0.0934 -0.0921 135 VAL A C     
2006 O O     . VAL B 137 ? 0.3008 0.2778 0.2758 -0.0258 -0.0684 -0.0724 135 VAL A O     
2007 C CB    . VAL B 137 ? 0.4959 0.3549 0.4536 -0.0158 -0.0972 -0.0759 135 VAL A CB    
2008 C CG1   . VAL B 137 ? 0.5044 0.3602 0.4549 -0.0445 -0.0611 -0.0478 135 VAL A CG1   
2009 C CG2   . VAL B 137 ? 0.5325 0.3402 0.4447 0.0093  -0.1135 -0.0680 135 VAL A CG2   
2010 N N     . ARG B 138 ? 0.4042 0.3779 0.4398 -0.0132 -0.1135 -0.1268 136 ARG A N     
2011 C CA    . ARG B 138 ? 0.3477 0.3716 0.4314 -0.0272 -0.1059 -0.1431 136 ARG A CA    
2012 C C     . ARG B 138 ? 0.2674 0.3161 0.3082 -0.0078 -0.1009 -0.1267 136 ARG A C     
2013 O O     . ARG B 138 ? 0.2196 0.3007 0.2691 -0.0227 -0.0816 -0.1216 136 ARG A O     
2014 C CB    . ARG B 138 ? 0.3676 0.4015 0.4962 -0.0170 -0.1200 -0.1644 136 ARG A CB    
2015 C CG    . ARG B 138 ? 0.4011 0.4801 0.5798 -0.0275 -0.1067 -0.1760 136 ARG A CG    
2016 C CD    . ARG B 138 ? 0.4555 0.5415 0.6615 -0.0032 -0.1253 -0.1954 136 ARG A CD    
2017 N NE    . ARG B 138 ? 0.4630 0.5680 0.6557 0.0156  -0.1227 -0.1928 136 ARG A NE    
2018 C CZ    . ARG B 138 ? 0.4906 0.5749 0.6349 0.0460  -0.1327 -0.1807 136 ARG A CZ    
2019 N NH1   . ARG B 138 ? 0.4937 0.5877 0.6299 0.0583  -0.1284 -0.1788 136 ARG A NH1   
2020 N NH2   . ARG B 138 ? 0.5035 0.5544 0.6092 0.0628  -0.1443 -0.1709 136 ARG A NH2   
2021 N N     . VAL B 139 ? 0.2601 0.2903 0.2599 0.0223  -0.1065 -0.1117 137 VAL A N     
2022 C CA    . VAL B 139 ? 0.2596 0.2989 0.2320 0.0323  -0.0911 -0.0902 137 VAL A CA    
2023 C C     . VAL B 139 ? 0.2358 0.2805 0.1777 0.0236  -0.0756 -0.0678 137 VAL A C     
2024 O O     . VAL B 139 ? 0.2042 0.2611 0.1435 0.0192  -0.0616 -0.0550 137 VAL A O     
2025 C CB    . VAL B 139 ? 0.2722 0.2873 0.2242 0.0564  -0.0930 -0.0834 137 VAL A CB    
2026 C CG1   . VAL B 139 ? 0.2590 0.2789 0.2004 0.0648  -0.0803 -0.0723 137 VAL A CG1   
2027 C CG2   . VAL B 139 ? 0.2872 0.2933 0.2622 0.0710  -0.1131 -0.1055 137 VAL A CG2   
2028 N N     . TRP B 140 ? 0.2568 0.2848 0.1739 0.0243  -0.0797 -0.0622 138 TRP A N     
2029 C CA    . TRP B 140 ? 0.2674 0.2980 0.1536 0.0204  -0.0642 -0.0374 138 TRP A CA    
2030 C C     . TRP B 140 ? 0.2806 0.3388 0.1743 0.0000  -0.0486 -0.0358 138 TRP A C     
2031 O O     . TRP B 140 ? 0.3144 0.3809 0.2015 0.0008  -0.0362 -0.0220 138 TRP A O     
2032 C CB    . TRP B 140 ? 0.3161 0.3103 0.1695 0.0284  -0.0702 -0.0274 138 TRP A CB    
2033 C CG    . TRP B 140 ? 0.3425 0.3396 0.1785 0.0288  -0.0539 -0.0009 138 TRP A CG    
2034 C CD1   . TRP B 140 ? 0.3396 0.3409 0.1914 0.0362  -0.0483 0.0050  138 TRP A CD1   
2035 C CD2   . TRP B 140 ? 0.3705 0.3640 0.1812 0.0176  -0.0407 0.0171  138 TRP A CD2   
2036 N NE1   . TRP B 140 ? 0.3322 0.3357 0.1791 0.0305  -0.0417 0.0185  138 TRP A NE1   
2037 C CE2   . TRP B 140 ? 0.3577 0.3565 0.1819 0.0188  -0.0373 0.0278  138 TRP A CE2   
2038 C CE3   . TRP B 140 ? 0.3773 0.3639 0.1902 -0.0068 -0.0221 0.0221  138 TRP A CE3   
2039 C CZ2   . TRP B 140 ? 0.3824 0.3773 0.1920 0.0104  -0.0309 0.0413  138 TRP A CZ2   
2040 C CZ3   . TRP B 140 ? 0.3997 0.3750 0.1751 -0.0116 -0.0070 0.0443  138 TRP A CZ3   
2041 C CH2   . TRP B 140 ? 0.3974 0.3912 0.1853 0.0016  -0.0163 0.0513  138 TRP A CH2   
2042 N N     . PHE B 141 ? 0.3129 0.3656 0.2441 -0.0237 -0.0373 -0.0438 139 PHE A N     
2043 C CA    . PHE B 141 ? 0.3564 0.4312 0.3036 -0.0479 -0.0097 -0.0392 139 PHE A CA    
2044 C C     . PHE B 141 ? 0.3685 0.4901 0.3396 -0.0445 -0.0131 -0.0576 139 PHE A C     
2045 O O     . PHE B 141 ? 0.3805 0.5232 0.3416 -0.0525 0.0057  -0.0497 139 PHE A O     
2046 C CB    . PHE B 141 ? 0.3907 0.4524 0.3829 -0.0772 0.0080  -0.0475 139 PHE A CB    
2047 C CG    . PHE B 141 ? 0.4610 0.4689 0.4163 -0.0880 0.0239  -0.0205 139 PHE A CG    
2048 C CD1   . PHE B 141 ? 0.4743 0.4386 0.4184 -0.0772 0.0047  -0.0191 139 PHE A CD1   
2049 C CD2   . PHE B 141 ? 0.5092 0.5034 0.4332 -0.1059 0.0570  0.0031  139 PHE A CD2   
2050 C CE1   . PHE B 141 ? 0.5483 0.4551 0.4541 -0.0843 0.0163  0.0055  139 PHE A CE1   
2051 C CE2   . PHE B 141 ? 0.5865 0.5193 0.4647 -0.1127 0.0696  0.0297  139 PHE A CE2   
2052 C CZ    . PHE B 141 ? 0.6135 0.5018 0.4842 -0.1019 0.0483  0.0310  139 PHE A CZ    
2053 N N     . CYS B 142 ? 0.3686 0.5015 0.3661 -0.0302 -0.0387 -0.0834 140 CYS A N     
2054 C CA    . CYS B 142 ? 0.3568 0.5068 0.3679 -0.0178 -0.0402 -0.0893 140 CYS A CA    
2055 C C     . CYS B 142 ? 0.3304 0.4623 0.3040 -0.0050 -0.0314 -0.0607 140 CYS A C     
2056 O O     . CYS B 142 ? 0.2826 0.4353 0.2612 -0.0092 -0.0192 -0.0580 140 CYS A O     
2057 C CB    . CYS B 142 ? 0.3626 0.4878 0.3886 0.0019  -0.0580 -0.0980 140 CYS A CB    
2058 S SG    . CYS B 142 ? 0.3859 0.5226 0.4754 -0.0083 -0.0689 -0.1312 140 CYS A SG    
2059 N N     . ASN B 143 ? 0.3549 0.4470 0.3040 0.0062  -0.0359 -0.0426 141 ASN A N     
2060 C CA    . ASN B 143 ? 0.3251 0.4166 0.2695 0.0128  -0.0261 -0.0284 141 ASN A CA    
2061 C C     . ASN B 143 ? 0.3529 0.4508 0.2892 0.0046  -0.0167 -0.0171 141 ASN A C     
2062 O O     . ASN B 143 ? 0.3416 0.4556 0.2889 0.0057  -0.0114 -0.0133 141 ASN A O     
2063 C CB    . ASN B 143 ? 0.2640 0.3385 0.1988 0.0244  -0.0288 -0.0232 141 ASN A CB    
2064 C CG    . ASN B 143 ? 0.2670 0.3321 0.2039 0.0376  -0.0364 -0.0332 141 ASN A CG    
2065 O OD1   . ASN B 143 ? 0.2497 0.3206 0.1964 0.0415  -0.0391 -0.0417 141 ASN A OD1   
2066 N ND2   . ASN B 143 ? 0.2833 0.3313 0.2088 0.0484  -0.0407 -0.0335 141 ASN A ND2   
2067 N N     . ARG B 144 ? 0.3736 0.4572 0.2863 -0.0022 -0.0155 -0.0123 142 ARG A N     
2068 C CA    . ARG B 144 ? 0.3977 0.4745 0.2913 -0.0068 -0.0050 -0.0003 142 ARG A CA    
2069 C C     . ARG B 144 ? 0.4275 0.5336 0.3322 -0.0181 0.0061  -0.0049 142 ARG A C     
2070 O O     . ARG B 144 ? 0.4749 0.5757 0.3736 -0.0154 0.0089  0.0011  142 ARG A O     
2071 C CB    . ARG B 144 ? 0.4437 0.5059 0.3023 -0.0126 0.0007  0.0104  142 ARG A CB    
2072 C CG    . ARG B 144 ? 0.5112 0.5424 0.3379 -0.0095 0.0110  0.0254  142 ARG A CG    
2073 C CD    . ARG B 144 ? 0.5190 0.5426 0.3511 0.0005  -0.0023 0.0249  142 ARG A CD    
2074 N NE    . ARG B 144 ? 0.5719 0.5707 0.3672 0.0005  -0.0005 0.0350  142 ARG A NE    
2075 C CZ    . ARG B 144 ? 0.5811 0.5862 0.3687 -0.0006 0.0061  0.0354  142 ARG A CZ    
2076 N NH1   . ARG B 144 ? 0.5505 0.5903 0.3703 -0.0038 0.0111  0.0267  142 ARG A NH1   
2077 N NH2   . ARG B 144 ? 0.6149 0.5956 0.3661 -0.0030 0.0038  0.0438  142 ARG A NH2   
2078 N N     . ARG B 145 ? 0.3927 0.5396 0.3156 -0.0340 0.0124  -0.0221 143 ARG A N     
2079 C CA    . ARG B 145 ? 0.3671 0.5413 0.3053 -0.0458 0.0257  -0.0321 143 ARG A CA    
2080 C C     . ARG B 145 ? 0.3266 0.5040 0.2835 -0.0305 0.0118  -0.0336 143 ARG A C     
2081 O O     . ARG B 145 ? 0.3384 0.5134 0.2890 -0.0308 0.0167  -0.0306 143 ARG A O     
2082 C CB    . ARG B 145 ? 0.3766 0.5952 0.3539 -0.0672 0.0420  -0.0629 143 ARG A CB    
2083 C CG    . ARG B 145 ? 0.4175 0.6208 0.4039 -0.0940 0.0748  -0.0543 143 ARG A CG    
2084 C CD    . ARG B 145 ? 0.4410 0.6733 0.5087 -0.1122 0.0839  -0.0852 143 ARG A CD    
2085 N NE    . ARG B 145 ? 0.5129 0.7245 0.6137 -0.1139 0.0652  -0.0948 143 ARG A NE    
2086 C CZ    . ARG B 145 ? 0.5876 0.8233 0.7504 -0.1073 0.0398  -0.1293 143 ARG A CZ    
2087 N NH1   . ARG B 145 ? 0.6199 0.8762 0.7974 -0.0882 0.0295  -0.1472 143 ARG A NH1   
2088 N NH2   . ARG B 145 ? 0.6258 0.8376 0.8123 -0.1074 0.0207  -0.1388 143 ARG A NH2   
2089 N N     . GLN B 146 ? 0.3088 0.4786 0.2823 -0.0162 0.0004  -0.0366 144 GLN A N     
2090 C CA    . GLN B 146 ? 0.3146 0.4913 0.3022 -0.0060 -0.0020 -0.0365 144 GLN A CA    
2091 C C     . GLN B 146 ? 0.3004 0.4725 0.2800 -0.0045 -0.0018 -0.0235 144 GLN A C     
2092 O O     . GLN B 146 ? 0.2848 0.4684 0.2717 -0.0024 -0.0015 -0.0253 144 GLN A O     
2093 C CB    . GLN B 146 ? 0.3335 0.4946 0.3233 0.0084  -0.0084 -0.0407 144 GLN A CB    
2094 C CG    . GLN B 146 ? 0.3762 0.5389 0.3767 0.0145  -0.0145 -0.0592 144 GLN A CG    
2095 C CD    . GLN B 146 ? 0.4291 0.5700 0.4241 0.0315  -0.0244 -0.0617 144 GLN A CD    
2096 O OE1   . GLN B 146 ? 0.4335 0.5533 0.4134 0.0359  -0.0267 -0.0514 144 GLN A OE1   
2097 N NE2   . GLN B 146 ? 0.4742 0.6195 0.4803 0.0419  -0.0305 -0.0764 144 GLN A NE2   
2098 N N     . ARG B 147 ? 0.2981 0.4523 0.2619 -0.0037 -0.0028 -0.0133 145 ARG A N     
2099 C CA    A ARG B 147 ? 0.3027 0.4550 0.2608 0.0004  -0.0036 -0.0059 145 ARG A CA    
2100 C CA    B ARG B 147 ? 0.3023 0.4548 0.2606 0.0005  -0.0036 -0.0060 145 ARG A CA    
2101 C C     . ARG B 147 ? 0.3443 0.4993 0.2873 -0.0038 -0.0013 -0.0047 145 ARG A C     
2102 O O     . ARG B 147 ? 0.3730 0.5339 0.3158 0.0006  -0.0033 -0.0040 145 ARG A O     
2103 C CB    A ARG B 147 ? 0.3153 0.4473 0.2569 0.0049  -0.0056 0.0017  145 ARG A CB    
2104 C CB    B ARG B 147 ? 0.3152 0.4477 0.2574 0.0051  -0.0056 0.0016  145 ARG A CB    
2105 C CG    A ARG B 147 ? 0.3202 0.4511 0.2528 0.0109  -0.0077 0.0067  145 ARG A CG    
2106 C CG    B ARG B 147 ? 0.3204 0.4517 0.2522 0.0106  -0.0076 0.0067  145 ARG A CG    
2107 C CD    A ARG B 147 ? 0.3260 0.4401 0.2468 0.0176  -0.0107 0.0112  145 ARG A CD    
2108 C CD    B ARG B 147 ? 0.3252 0.4436 0.2484 0.0184  -0.0108 0.0108  145 ARG A CD    
2109 N NE    A ARG B 147 ? 0.3027 0.4219 0.2412 0.0219  -0.0101 0.0070  145 ARG A NE    
2110 N NE    B ARG B 147 ? 0.3378 0.4583 0.2508 0.0253  -0.0148 0.0132  145 ARG A NE    
2111 C CZ    A ARG B 147 ? 0.3332 0.4352 0.2617 0.0262  -0.0125 0.0079  145 ARG A CZ    
2112 C CZ    B ARG B 147 ? 0.3381 0.4559 0.2467 0.0348  -0.0190 0.0146  145 ARG A CZ    
2113 N NH1   A ARG B 147 ? 0.1239 0.2272 0.0619 0.0321  -0.0120 0.0034  145 ARG A NH1   
2114 N NH1   B ARG B 147 ? 0.3335 0.4559 0.2327 0.0424  -0.0255 0.0146  145 ARG A NH1   
2115 N NH2   A ARG B 147 ? 0.3840 0.4621 0.2863 0.0247  -0.0162 0.0139  145 ARG A NH2   
2116 N NH2   B ARG B 147 ? 0.3083 0.4193 0.2205 0.0384  -0.0182 0.0146  145 ARG A NH2   
2117 N N     . GLU B 148 ? 0.3836 0.5310 0.3082 -0.0118 0.0054  -0.0054 146 GLU A N     
2118 C CA    . GLU B 148 ? 0.4401 0.5824 0.3398 -0.0142 0.0129  -0.0046 146 GLU A CA    
2119 C C     . GLU B 148 ? 0.4386 0.6082 0.3591 -0.0164 0.0127  -0.0168 146 GLU A C     
2120 O O     . GLU B 148 ? 0.5145 0.6808 0.4135 -0.0167 0.0198  -0.0183 146 GLU A O     
2121 C CB    . GLU B 148 ? 0.4939 0.6084 0.3571 -0.0209 0.0317  0.0016  146 GLU A CB    
2122 C CG    . GLU B 148 ? 0.5472 0.6231 0.3739 -0.0153 0.0327  0.0158  146 GLU A CG    
2123 C CD    . GLU B 148 ? 0.6566 0.7096 0.4444 -0.0073 0.0288  0.0222  146 GLU A CD    
2124 O OE1   . GLU B 148 ? 0.6901 0.7524 0.4716 -0.0069 0.0312  0.0176  146 GLU A OE1   
2125 O OE2   . GLU B 148 ? 0.7144 0.7396 0.4754 -0.0026 0.0208  0.0303  146 GLU A OE2   
2126 N N     . LYS B 149 ? 0.3694 0.5603 0.3248 -0.0152 0.0062  -0.0257 147 LYS A N     
2127 C CA    . LYS B 149 ? 0.3821 0.5954 0.3559 -0.0135 0.0048  -0.0383 147 LYS A CA    
2128 C C     . LYS B 149 ? 0.3890 0.6042 0.3735 -0.0037 -0.0002 -0.0373 147 LYS A C     
2129 O O     . LYS B 149 ? 0.4182 0.6440 0.4093 0.0002  -0.0011 -0.0467 147 LYS A O     
2130 C CB    . LYS B 149 ? 0.3964 0.6253 0.3946 -0.0144 0.0040  -0.0519 147 LYS A CB    
2131 C CG    . LYS B 149 ? 0.4451 0.6740 0.4349 -0.0276 0.0130  -0.0597 147 LYS A CG    
2132 C CD    . LYS B 149 ? 0.4641 0.7339 0.4900 -0.0304 0.0097  -0.0886 147 LYS A CD    
2133 C CE    . LYS B 149 ? 0.5176 0.8002 0.5441 -0.0488 0.0307  -0.1082 147 LYS A CE    
2134 N NZ    . LYS B 149 ? 0.5495 0.8257 0.5597 -0.0503 0.0488  -0.1012 147 LYS A NZ    
2135 N N     . ARG B 150 ? 0.3810 0.5836 0.3640 -0.0001 -0.0020 -0.0284 148 ARG A N     
2136 C CA    . ARG B 150 ? 0.3647 0.5640 0.3508 0.0052  -0.0038 -0.0293 148 ARG A CA    
2137 C C     . ARG B 150 ? 0.3758 0.5785 0.3490 0.0057  -0.0059 -0.0308 148 ARG A C     
2138 O O     . ARG B 150 ? 0.4132 0.6133 0.3678 0.0045  -0.0060 -0.0275 148 ARG A O     
2139 C CB    . ARG B 150 ? 0.3430 0.5315 0.3299 0.0067  -0.0040 -0.0221 148 ARG A CB    
2140 C CG    . ARG B 150 ? 0.3365 0.5226 0.3143 0.0064  -0.0048 -0.0146 148 ARG A CG    
2141 C CD    . ARG B 150 ? 0.3545 0.5372 0.3356 0.0096  -0.0049 -0.0108 148 ARG A CD    
2142 N NE    . ARG B 150 ? 0.3508 0.5241 0.3370 0.0111  -0.0037 -0.0101 148 ARG A NE    
2143 C CZ    . ARG B 150 ? 0.3536 0.5215 0.3381 0.0150  -0.0038 -0.0063 148 ARG A CZ    
2144 N NH1   . ARG B 150 ? 0.3618 0.5354 0.3425 0.0180  -0.0046 -0.0033 148 ARG A NH1   
2145 N NH2   . ARG B 150 ? 0.3794 0.5341 0.3619 0.0183  -0.0043 -0.0069 148 ARG A NH2   
2146 N N     . VAL B 151 ? 0.3555 0.5560 0.3294 0.0085  -0.0086 -0.0363 149 VAL A N     
2147 C CA    . VAL B 151 ? 0.3935 0.5954 0.3529 0.0107  -0.0130 -0.0416 149 VAL A CA    
2148 C C     . VAL B 151 ? 0.4467 0.6445 0.3932 0.0121  -0.0171 -0.0365 149 VAL A C     
2149 O O     . VAL B 151 ? 0.4949 0.6893 0.4190 0.0159  -0.0222 -0.0387 149 VAL A O     
2150 C CB    . VAL B 151 ? 0.3861 0.5810 0.3465 0.0127  -0.0177 -0.0507 149 VAL A CB    
2151 C CG1   . VAL B 151 ? 0.3930 0.5840 0.3392 0.0139  -0.0260 -0.0558 149 VAL A CG1   
2152 C CG2   . VAL B 151 ? 0.4005 0.6012 0.3648 0.0166  -0.0173 -0.0603 149 VAL A CG2   
2153 N N     . LYS B 152 ? 0.4528 0.6493 0.4086 0.0108  -0.0160 -0.0307 150 LYS A N     
2154 C CA    . LYS B 152 ? 0.4662 0.6623 0.4123 0.0144  -0.0218 -0.0287 150 LYS A CA    
2155 C C     . LYS B 152 ? 0.4913 0.6863 0.4430 0.0152  -0.0182 -0.0203 150 LYS A C     
2156 O O     . LYS B 152 ? 0.5212 0.7071 0.4587 0.0177  -0.0187 -0.0144 150 LYS A O     
2157 C CB    . LYS B 152 ? 0.4379 0.6372 0.3889 0.0126  -0.0279 -0.0361 150 LYS A CB    
2158 C CG    . LYS B 152 ? 0.4551 0.6528 0.3901 0.0168  -0.0410 -0.0455 150 LYS A CG    
2159 C CD    . LYS B 152 ? 0.4730 0.6716 0.4170 0.0111  -0.0498 -0.0553 150 LYS A CD    
2160 C CE    . LYS B 152 ? 0.5012 0.7106 0.4555 0.0103  -0.0584 -0.0582 150 LYS A CE    
2161 N NZ    . LYS B 152 ? 0.5098 0.7218 0.4801 -0.0003 -0.0683 -0.0684 150 LYS A NZ    
2162 O OXT   . LYS B 152 ? 0.4915 0.6911 0.4569 0.0134  -0.0152 -0.0195 150 LYS A OXT   
2163 C "C5'" . DC  C 1   ? 0.3136 0.6039 0.3390 0.0005  0.1056  0.0052  170 DC  C "C5'" 
2164 C "C4'" . DC  C 1   ? 0.3188 0.5856 0.3679 0.0071  0.0891  0.0061  170 DC  C "C4'" 
2165 O "O4'" . DC  C 1   ? 0.3339 0.6056 0.4064 0.0188  0.0895  -0.0151 170 DC  C "O4'" 
2166 C "C3'" . DC  C 1   ? 0.3201 0.5533 0.3461 0.0040  0.0771  0.0184  170 DC  C "C3'" 
2167 O "O3'" . DC  C 1   ? 0.3227 0.5414 0.3455 -0.0024 0.0683  0.0385  170 DC  C "O3'" 
2168 C "C2'" . DC  C 1   ? 0.3196 0.5372 0.3673 0.0148  0.0682  0.0063  170 DC  C "C2'" 
2169 C "C1'" . DC  C 1   ? 0.3491 0.5920 0.4307 0.0238  0.0748  -0.0129 170 DC  C "C1'" 
2170 N N1    . DC  C 1   ? 0.4069 0.6496 0.4986 0.0332  0.0761  -0.0345 170 DC  C N1    
2171 C C2    . DC  C 1   ? 0.4161 0.6360 0.5296 0.0410  0.0640  -0.0378 170 DC  C C2    
2172 O O2    . DC  C 1   ? 0.3959 0.5962 0.5172 0.0403  0.0527  -0.0219 170 DC  C O2    
2173 N N3    . DC  C 1   ? 0.4353 0.6547 0.5607 0.0492  0.0649  -0.0585 170 DC  C N3    
2174 C C4    . DC  C 1   ? 0.4337 0.6745 0.5471 0.0503  0.0766  -0.0762 170 DC  C C4    
2175 N N4    . DC  C 1   ? 0.4465 0.6856 0.5723 0.0588  0.0760  -0.0981 170 DC  C N4    
2176 C C5    . DC  C 1   ? 0.4289 0.6930 0.5165 0.0429  0.0894  -0.0721 170 DC  C C5    
2177 C C6    . DC  C 1   ? 0.4285 0.6925 0.5075 0.0343  0.0889  -0.0507 170 DC  C C6    
2178 P P     . DC  C 2   ? 0.2928 0.4755 0.2951 -0.0053 0.0559  0.0536  171 DC  C P     
2179 O OP1   . DC  C 2   ? 0.3023 0.4771 0.2965 -0.0130 0.0503  0.0723  171 DC  C OP1   
2180 O OP2   . DC  C 2   ? 0.3286 0.5044 0.3044 -0.0075 0.0602  0.0502  171 DC  C OP2   
2181 O "O5'" . DC  C 2   ? 0.2479 0.4140 0.2777 0.0054  0.0446  0.0479  171 DC  C "O5'" 
2182 C "C5'" . DC  C 2   ? 0.2499 0.3853 0.2734 0.0054  0.0325  0.0621  171 DC  C "C5'" 
2183 C "C4'" . DC  C 2   ? 0.2912 0.4133 0.3412 0.0165  0.0249  0.0541  171 DC  C "C4'" 
2184 O "O4'" . DC  C 2   ? 0.3163 0.4562 0.3828 0.0227  0.0326  0.0323  171 DC  C "O4'" 
2185 C "C3'" . DC  C 2   ? 0.3141 0.4030 0.3513 0.0170  0.0180  0.0629  171 DC  C "C3'" 
2186 O "O3'" . DC  C 2   ? 0.3259 0.3944 0.3723 0.0209  0.0065  0.0756  171 DC  C "O3'" 
2187 C "C2'" . DC  C 2   ? 0.3349 0.4243 0.3888 0.0243  0.0208  0.0444  171 DC  C "C2'" 
2188 C "C1'" . DC  C 2   ? 0.3524 0.4723 0.4316 0.0300  0.0268  0.0262  171 DC  C "C1'" 
2189 N N1    . DC  C 2   ? 0.4012 0.5346 0.4828 0.0332  0.0350  0.0050  171 DC  C N1    
2190 C C2    . DC  C 2   ? 0.4341 0.5690 0.5480 0.0440  0.0334  -0.0131 171 DC  C C2    
2191 O O2    . DC  C 2   ? 0.4775 0.6027 0.6186 0.0507  0.0253  -0.0100 171 DC  C O2    
2192 N N3    . DC  C 2   ? 0.4030 0.5498 0.5174 0.0471  0.0401  -0.0341 171 DC  C N3    
2193 C C4    . DC  C 2   ? 0.3512 0.5079 0.4340 0.0402  0.0476  -0.0360 171 DC  C C4    
2194 N N4    . DC  C 2   ? 0.2865 0.4548 0.3687 0.0442  0.0528  -0.0576 171 DC  C N4    
2195 C C5    . DC  C 2   ? 0.3919 0.5468 0.4423 0.0293  0.0494  -0.0162 171 DC  C C5    
2196 C C6    . DC  C 2   ? 0.4055 0.5484 0.4573 0.0260  0.0432  0.0033  171 DC  C C6    
2197 P P     . DA  C 3   ? 0.3026 0.3347 0.3312 0.0199  -0.0001 0.0913  172 DA  C P     
2198 O OP1   . DA  C 3   ? 0.3855 0.4034 0.4147 0.0220  -0.0110 0.1067  172 DA  C OP1   
2199 O OP2   . DA  C 3   ? 0.3046 0.3325 0.3018 0.0106  0.0067  0.0961  172 DA  C OP2   
2200 O "O5'" . DA  C 3   ? 0.2525 0.2738 0.3063 0.0291  -0.0014 0.0797  172 DA  C "O5'" 
2201 C "C5'" . DA  C 3   ? 0.3006 0.3237 0.3882 0.0394  -0.0076 0.0733  172 DA  C "C5'" 
2202 C "C4'" . DA  C 3   ? 0.3417 0.3544 0.4528 0.0469  -0.0074 0.0607  172 DA  C "C4'" 
2203 O "O4'" . DA  C 3   ? 0.3659 0.4013 0.4817 0.0464  0.0019  0.0393  172 DA  C "O4'" 
2204 C "C3'" . DA  C 3   ? 0.3391 0.3203 0.4375 0.0447  -0.0089 0.0719  172 DA  C "C3'" 
2205 O "O3'" . DA  C 3   ? 0.3602 0.3198 0.4826 0.0534  -0.0165 0.0770  172 DA  C "O3'" 
2206 C "C2'" . DA  C 3   ? 0.3367 0.3261 0.4356 0.0427  -0.0011 0.0543  172 DA  C "C2'" 
2207 C "C1'" . DA  C 3   ? 0.3920 0.4116 0.5133 0.0483  0.0025  0.0322  172 DA  C "C1'" 
2208 N N9    . DA  C 3   ? 0.4726 0.5118 0.5832 0.0448  0.0111  0.0151  172 DA  C N9    
2209 C C8    . DA  C 3   ? 0.4875 0.5330 0.5643 0.0353  0.0166  0.0201  172 DA  C C8    
2210 N N7    . DA  C 3   ? 0.4948 0.5587 0.5673 0.0350  0.0231  0.0018  172 DA  C N7    
2211 C C5    . DA  C 3   ? 0.4931 0.5637 0.5992 0.0450  0.0221  -0.0178 172 DA  C C5    
2212 C C6    . DA  C 3   ? 0.4878 0.5765 0.6054 0.0503  0.0268  -0.0438 172 DA  C C6    
2213 N N6    . DA  C 3   ? 0.4652 0.5694 0.5583 0.0461  0.0331  -0.0538 172 DA  C N6    
2214 N N1    . DA  C 3   ? 0.5257 0.6156 0.6802 0.0606  0.0243  -0.0595 172 DA  C N1    
2215 C C2    . DA  C 3   ? 0.5344 0.6081 0.7127 0.0654  0.0171  -0.0483 172 DA  C C2    
2216 N N3    . DA  C 3   ? 0.5411 0.5970 0.7095 0.0614  0.0117  -0.0233 172 DA  C N3    
2217 C C4    . DA  C 3   ? 0.5128 0.5682 0.6441 0.0511  0.0148  -0.0096 172 DA  C C4    
2218 P P     . DT  C 4   ? 0.3598 0.2844 0.4774 0.0530  -0.0177 0.0899  173 DT  C P     
2219 O OP1   . DT  C 4   ? 0.3838 0.2872 0.5171 0.0612  -0.0268 0.1031  173 DT  C OP1   
2220 O OP2   . DT  C 4   ? 0.2738 0.1914 0.3541 0.0425  -0.0128 0.1020  173 DT  C OP2   
2221 O "O5'" . DT  C 4   ? 0.2821 0.2097 0.4259 0.0563  -0.0134 0.0686  173 DT  C "O5'" 
2222 C "C5'" . DT  C 4   ? 0.3181 0.2518 0.5008 0.0666  -0.0167 0.0530  173 DT  C "C5'" 
2223 C "C4'" . DT  C 4   ? 0.3385 0.2748 0.5406 0.0681  -0.0125 0.0315  173 DT  C "C4'" 
2224 O "O4'" . DT  C 4   ? 0.3524 0.3166 0.5381 0.0630  -0.0055 0.0151  173 DT  C "O4'" 
2225 C "C3'" . DT  C 4   ? 0.3436 0.2525 0.5416 0.0639  -0.0114 0.0402  173 DT  C "C3'" 
2226 O "O3'" . DT  C 4   ? 0.3637 0.2551 0.5994 0.0717  -0.0151 0.0346  173 DT  C "O3'" 
2227 C "C2'" . DT  C 4   ? 0.3412 0.2665 0.5243 0.0572  -0.0052 0.0244  173 DT  C "C2'" 
2228 C "C1'" . DT  C 4   ? 0.3439 0.3024 0.5325 0.0608  -0.0029 0.0032  173 DT  C "C1'" 
2229 N N1    . DT  C 4   ? 0.3163 0.2968 0.4756 0.0535  0.0035  -0.0051 173 DT  C N1    
2230 C C2    . DT  C 4   ? 0.3286 0.3315 0.4964 0.0566  0.0069  -0.0313 173 DT  C C2    
2231 O O2    . DT  C 4   ? 0.3566 0.3631 0.5566 0.0653  0.0052  -0.0496 173 DT  C O2    
2232 N N3    . DT  C 4   ? 0.3364 0.3575 0.4727 0.0497  0.0124  -0.0355 173 DT  C N3    
2233 C C4    . DT  C 4   ? 0.3346 0.3530 0.4356 0.0401  0.0146  -0.0165 173 DT  C C4    
2234 O O4    . DT  C 4   ? 0.3368 0.3717 0.4119 0.0347  0.0193  -0.0210 173 DT  C O4    
2235 C C5    . DT  C 4   ? 0.3160 0.3103 0.4117 0.0372  0.0110  0.0090  173 DT  C C5    
2236 C C7    . DT  C 4   ? 0.2853 0.2741 0.3447 0.0273  0.0131  0.0295  173 DT  C C7    
2237 C C6    . DT  C 4   ? 0.3171 0.2939 0.4404 0.0441  0.0057  0.0135  173 DT  C C6    
2238 P P     . DT  C 5   ? 0.3982 0.2619 0.6433 0.0687  -0.0135 0.0397  174 DT  C P     
2239 O OP1   . DT  C 5   ? 0.4399 0.2902 0.6978 0.0711  -0.0171 0.0456  174 DT  C OP1   
2240 O OP2   . DT  C 5   ? 0.4284 0.2837 0.6361 0.0585  -0.0091 0.0572  174 DT  C OP2   
2241 O "O5'" . DT  C 5   ? 0.3790 0.2594 0.6440 0.0695  -0.0114 0.0088  174 DT  C "O5'" 
2242 C "C5'" . DT  C 5   ? 0.3905 0.2831 0.6904 0.0791  -0.0142 -0.0139 174 DT  C "C5'" 
2243 C "C4'" . DT  C 5   ? 0.3177 0.2320 0.6213 0.0784  -0.0115 -0.0436 174 DT  C "C4'" 
2244 O "O4'" . DT  C 5   ? 0.3054 0.2402 0.5676 0.0703  -0.0066 -0.0426 174 DT  C "O4'" 
2245 C "C3'" . DT  C 5   ? 0.4070 0.3044 0.7298 0.0764  -0.0127 -0.0525 174 DT  C "C3'" 
2246 O "O3'" . DT  C 5   ? 0.4192 0.3220 0.7806 0.0847  -0.0156 -0.0801 174 DT  C "O3'" 
2247 C "C2'" . DT  C 5   ? 0.3970 0.3085 0.6851 0.0672  -0.0092 -0.0571 174 DT  C "C2'" 
2248 C "C1'" . DT  C 5   ? 0.3424 0.2833 0.6015 0.0668  -0.0055 -0.0602 174 DT  C "C1'" 
2249 N N1    . DT  C 5   ? 0.2980 0.2482 0.5137 0.0569  -0.0015 -0.0500 174 DT  C N1    
2250 C C2    . DT  C 5   ? 0.2938 0.2695 0.4913 0.0551  0.0011  -0.0689 174 DT  C C2    
2251 O O2    . DT  C 5   ? 0.3024 0.2942 0.5156 0.0614  0.0008  -0.0947 174 DT  C O2    
2252 N N3    . DT  C 5   ? 0.2844 0.2657 0.4434 0.0461  0.0042  -0.0564 174 DT  C N3    
2253 C C4    . DT  C 5   ? 0.2977 0.2622 0.4361 0.0389  0.0052  -0.0290 174 DT  C C4    
2254 O O4    . DT  C 5   ? 0.3157 0.2865 0.4216 0.0314  0.0080  -0.0203 174 DT  C O4    
2255 C C5    . DT  C 5   ? 0.2945 0.2330 0.4517 0.0414  0.0028  -0.0114 174 DT  C C5    
2256 C C7    . DT  C 5   ? 0.2725 0.1911 0.4071 0.0348  0.0043  0.0177  174 DT  C C7    
2257 C C6    . DT  C 5   ? 0.2918 0.2243 0.4860 0.0502  -0.0006 -0.0218 174 DT  C C6    
2258 P P     . DC  C 6   ? 0.4007 0.2899 0.7830 0.0798  -0.0187 -0.0867 175 DC  C P     
2259 O OP1   . DC  C 6   ? 0.4315 0.3289 0.8449 0.0858  -0.0223 -0.1068 175 DC  C OP1   
2260 O OP2   . DC  C 6   ? 0.3930 0.2596 0.7630 0.0713  -0.0176 -0.0560 175 DC  C OP2   
2261 O "O5'" . DC  C 6   ? 0.3847 0.2842 0.7574 0.0770  -0.0181 -0.1072 175 DC  C "O5'" 
2262 C "C5'" . DC  C 6   ? 0.3519 0.2684 0.7406 0.0808  -0.0211 -0.1400 175 DC  C "C5'" 
2263 C "C4'" . DC  C 6   ? 0.3992 0.3346 0.7587 0.0776  -0.0199 -0.1556 175 DC  C "C4'" 
2264 O "O4'" . DC  C 6   ? 0.4191 0.3586 0.7348 0.0696  -0.0149 -0.1298 175 DC  C "O4'" 
2265 C "C3'" . DC  C 6   ? 0.4155 0.3410 0.7857 0.0729  -0.0249 -0.1662 175 DC  C "C3'" 
2266 O "O3'" . DC  C 6   ? 0.4581 0.4067 0.8237 0.0762  -0.0281 -0.1988 175 DC  C "O3'" 
2267 C "C2'" . DC  C 6   ? 0.4130 0.3335 0.7462 0.0622  -0.0218 -0.1403 175 DC  C "C2'" 
2268 C "C1'" . DC  C 6   ? 0.4234 0.3648 0.7172 0.0617  -0.0159 -0.1303 175 DC  C "C1'" 
2269 N N1    . DC  C 6   ? 0.4379 0.3703 0.6994 0.0531  -0.0117 -0.0988 175 DC  C N1    
2270 C C2    . DC  C 6   ? 0.4776 0.4281 0.6965 0.0468  -0.0088 -0.0952 175 DC  C C2    
2271 O O2    . DC  C 6   ? 0.4931 0.4671 0.6997 0.0486  -0.0096 -0.1172 175 DC  C O2    
2272 N N3    . DC  C 6   ? 0.4773 0.4186 0.6689 0.0392  -0.0051 -0.0675 175 DC  C N3    
2273 C C4    . DC  C 6   ? 0.4507 0.3664 0.6535 0.0381  -0.0040 -0.0447 175 DC  C C4    
2274 N N4    . DC  C 6   ? 0.2821 0.1895 0.4556 0.0310  -0.0002 -0.0193 175 DC  C N4    
2275 C C5    . DC  C 6   ? 0.4417 0.3386 0.6854 0.0445  -0.0066 -0.0466 175 DC  C C5    
2276 C C6    . DC  C 6   ? 0.4350 0.3408 0.7083 0.0518  -0.0105 -0.0737 175 DC  C C6    
2277 P P     . DA  C 7   ? 0.5254 0.4723 0.9071 0.0718  -0.0367 -0.2152 176 DA  C P     
2278 O OP1   . DA  C 7   ? 0.5877 0.5551 0.9806 0.0782  -0.0407 -0.2462 176 DA  C OP1   
2279 O OP2   . DA  C 7   ? 0.5553 0.4783 0.9609 0.0645  -0.0380 -0.1913 176 DA  C OP2   
2280 O "O5'" . DA  C 7   ? 0.4892 0.4446 0.8334 0.0665  -0.0372 -0.2170 176 DA  C "O5'" 
2281 C "C5'" . DA  C 7   ? 0.4775 0.4609 0.7768 0.0668  -0.0326 -0.2204 176 DA  C "C5'" 
2282 C "C4'" . DA  C 7   ? 0.4629 0.4520 0.7222 0.0577  -0.0329 -0.2075 176 DA  C "C4'" 
2283 O "O4'" . DA  C 7   ? 0.4314 0.4075 0.6742 0.0509  -0.0264 -0.1722 176 DA  C "O4'" 
2284 C "C3'" . DA  C 7   ? 0.4631 0.4405 0.7387 0.0536  -0.0422 -0.2156 176 DA  C "C3'" 
2285 O "O3'" . DA  C 7   ? 0.4839 0.4835 0.7330 0.0543  -0.0478 -0.2372 176 DA  C "O3'" 
2286 C "C2'" . DA  C 7   ? 0.4386 0.3984 0.7021 0.0438  -0.0385 -0.1818 176 DA  C "C2'" 
2287 C "C1'" . DA  C 7   ? 0.3962 0.3647 0.6244 0.0425  -0.0288 -0.1600 176 DA  C "C1'" 
2288 N N9    . DA  C 7   ? 0.3338 0.2799 0.5622 0.0368  -0.0235 -0.1273 176 DA  C N9    
2289 C C8    . DA  C 7   ? 0.3311 0.2523 0.5935 0.0382  -0.0221 -0.1152 176 DA  C C8    
2290 N N7    . DA  C 7   ? 0.3054 0.2101 0.5550 0.0324  -0.0166 -0.0851 176 DA  C N7    
2291 C C5    . DA  C 7   ? 0.3022 0.2220 0.5090 0.0267  -0.0145 -0.0777 176 DA  C C5    
2292 C C6    . DA  C 7   ? 0.2936 0.2071 0.4696 0.0193  -0.0091 -0.0507 176 DA  C C6    
2293 N N6    . DA  C 7   ? 0.2983 0.1880 0.4796 0.0168  -0.0044 -0.0256 176 DA  C N6    
2294 N N1    . DA  C 7   ? 0.2792 0.2113 0.4179 0.0151  -0.0086 -0.0504 176 DA  C N1    
2295 C C2    . DA  C 7   ? 0.2866 0.2419 0.4167 0.0182  -0.0129 -0.0746 176 DA  C C2    
2296 N N3    . DA  C 7   ? 0.3453 0.3093 0.4989 0.0253  -0.0179 -0.1019 176 DA  C N3    
2297 C C4    . DA  C 7   ? 0.3196 0.2647 0.5129 0.0291  -0.0186 -0.1024 176 DA  C C4    
2298 P P     . DT  C 8   ? 0.5411 0.5354 0.8015 0.0506  -0.0598 -0.2498 177 DT  C P     
2299 O OP1   . DT  C 8   ? 0.6103 0.6262 0.8626 0.0575  -0.0678 -0.2855 177 DT  C OP1   
2300 O OP2   . DT  C 8   ? 0.5552 0.5208 0.8648 0.0479  -0.0626 -0.2421 177 DT  C OP2   
2301 O "O5'" . DT  C 8   ? 0.4958 0.4950 0.7122 0.0419  -0.0574 -0.2255 177 DT  C "O5'" 
2302 C "C5'" . DT  C 8   ? 0.4770 0.4990 0.6438 0.0420  -0.0513 -0.2206 177 DT  C "C5'" 
2303 C "C4'" . DT  C 8   ? 0.4713 0.4903 0.6060 0.0329  -0.0480 -0.1920 177 DT  C "C4'" 
2304 O "O4'" . DT  C 8   ? 0.4533 0.4500 0.6025 0.0282  -0.0406 -0.1636 177 DT  C "O4'" 
2305 C "C3'" . DT  C 8   ? 0.4925 0.5074 0.6284 0.0283  -0.0586 -0.1952 177 DT  C "C3'" 
2306 O "O3'" . DT  C 8   ? 0.5496 0.5860 0.6405 0.0278  -0.0612 -0.1990 177 DT  C "O3'" 
2307 C "C2'" . DT  C 8   ? 0.4384 0.4302 0.5837 0.0199  -0.0536 -0.1638 177 DT  C "C2'" 
2308 C "C1'" . DT  C 8   ? 0.4073 0.3947 0.5433 0.0200  -0.0410 -0.1433 177 DT  C "C1'" 
2309 N N1    . DT  C 8   ? 0.3462 0.3063 0.5087 0.0161  -0.0359 -0.1207 177 DT  C N1    
2310 C C2    . DT  C 8   ? 0.3309 0.2828 0.4698 0.0098  -0.0280 -0.0911 177 DT  C C2    
2311 O O2    . DT  C 8   ? 0.3427 0.3084 0.4422 0.0068  -0.0252 -0.0823 177 DT  C O2    
2312 N N3    . DT  C 8   ? 0.2864 0.2125 0.4493 0.0072  -0.0231 -0.0719 177 DT  C N3    
2313 C C4    . DT  C 8   ? 0.2926 0.2003 0.5010 0.0099  -0.0249 -0.0777 177 DT  C C4    
2314 O O4    . DT  C 8   ? 0.2887 0.1731 0.5136 0.0073  -0.0191 -0.0575 177 DT  C O4    
2315 C C5    . DT  C 8   ? 0.3172 0.2344 0.5519 0.0161  -0.0337 -0.1093 177 DT  C C5    
2316 C C7    . DT  C 8   ? 0.3592 0.2571 0.6470 0.0192  -0.0365 -0.1184 177 DT  C C7    
2317 C C6    . DT  C 8   ? 0.3240 0.2668 0.5340 0.0190  -0.0390 -0.1298 177 DT  C C6    
2318 P P     . DT  C 9   ? 0.5593 0.5975 0.6440 0.0246  -0.0743 -0.2051 178 DT  C P     
2319 O OP1   . DT  C 9   ? 0.6096 0.6737 0.6550 0.0294  -0.0795 -0.2236 178 DT  C OP1   
2320 O OP2   . DT  C 9   ? 0.5825 0.6029 0.7187 0.0244  -0.0835 -0.2169 178 DT  C OP2   
2321 O "O5'" . DT  C 9   ? 0.4655 0.4947 0.5287 0.0154  -0.0680 -0.1705 178 DT  C "O5'" 
2322 C "C5'" . DT  C 9   ? 0.4328 0.4755 0.4496 0.0134  -0.0593 -0.1540 178 DT  C "C5'" 
2323 C "C4'" . DT  C 9   ? 0.3990 0.4264 0.4084 0.0050  -0.0520 -0.1211 178 DT  C "C4'" 
2324 O "O4'" . DT  C 9   ? 0.3957 0.4006 0.4407 0.0035  -0.0462 -0.1102 178 DT  C "O4'" 
2325 C "C3'" . DT  C 9   ? 0.3675 0.3889 0.3766 -0.0001 -0.0603 -0.1143 178 DT  C "C3'" 
2326 O "O3'" . DT  C 9   ? 0.3623 0.3938 0.3284 -0.0039 -0.0574 -0.0978 178 DT  C "O3'" 
2327 C "C2'" . DT  C 9   ? 0.3254 0.3203 0.3695 -0.0052 -0.0557 -0.0965 178 DT  C "C2'" 
2328 C "C1'" . DT  C 9   ? 0.3443 0.3318 0.3942 -0.0036 -0.0442 -0.0877 178 DT  C "C1'" 
2329 N N1    . DT  C 9   ? 0.3478 0.3114 0.4422 -0.0042 -0.0418 -0.0833 178 DT  C N1    
2330 C C2    . DT  C 9   ? 0.3602 0.3051 0.4555 -0.0089 -0.0316 -0.0562 178 DT  C C2    
2331 O O2    . DT  C 9   ? 0.3828 0.3298 0.4454 -0.0126 -0.0249 -0.0367 178 DT  C O2    
2332 N N3    . DT  C 9   ? 0.3321 0.2550 0.4679 -0.0088 -0.0294 -0.0528 178 DT  C N3    
2333 C C4    . DT  C 9   ? 0.3318 0.2494 0.5100 -0.0052 -0.0363 -0.0733 178 DT  C C4    
2334 O O4    . DT  C 9   ? 0.3614 0.2578 0.5756 -0.0058 -0.0328 -0.0668 178 DT  C O4    
2335 C C5    . DT  C 9   ? 0.3269 0.2650 0.5036 -0.0006 -0.0480 -0.1030 178 DT  C C5    
2336 C C7    . DT  C 9   ? 0.3282 0.2623 0.5504 0.0037  -0.0573 -0.1290 178 DT  C C7    
2337 C C6    . DT  C 9   ? 0.3396 0.2996 0.4733 -0.0001 -0.0501 -0.1064 178 DT  C C6    
2338 P P     . DC  C 10  ? 0.3307 0.3594 0.2896 -0.0085 -0.0661 -0.0894 179 DC  C P     
2339 O OP1   . DC  C 10  ? 0.3353 0.3814 0.2458 -0.0091 -0.0654 -0.0819 179 DC  C OP1   
2340 O OP2   . DC  C 10  ? 0.3578 0.3842 0.3503 -0.0057 -0.0803 -0.1119 179 DC  C OP2   
2341 O "O5'" . DC  C 10  ? 0.2944 0.2999 0.2689 -0.0158 -0.0567 -0.0614 179 DC  C "O5'" 
2342 C "C5'" . DC  C 10  ? 0.2824 0.2856 0.2293 -0.0198 -0.0445 -0.0374 179 DC  C "C5'" 
2343 C "C4'" . DC  C 10  ? 0.2909 0.2697 0.2575 -0.0253 -0.0364 -0.0154 179 DC  C "C4'" 
2344 O "O4'" . DC  C 10  ? 0.3188 0.2834 0.3253 -0.0230 -0.0351 -0.0229 179 DC  C "O4'" 
2345 C "C3'" . DC  C 10  ? 0.2621 0.2317 0.2380 -0.0299 -0.0408 -0.0064 179 DC  C "C3'" 
2346 O "O3'" . DC  C 10  ? 0.4611 0.4194 0.4205 -0.0355 -0.0308 0.0197  179 DC  C "O3'" 
2347 C "C2'" . DC  C 10  ? 0.2616 0.2151 0.2866 -0.0294 -0.0434 -0.0148 179 DC  C "C2'" 
2348 C "C1'" . DC  C 10  ? 0.2583 0.2034 0.2928 -0.0271 -0.0342 -0.0128 179 DC  C "C1'" 
2349 N N1    . DC  C 10  ? 0.2634 0.1983 0.3435 -0.0241 -0.0377 -0.0279 179 DC  C N1    
2350 C C2    . DC  C 10  ? 0.2571 0.1690 0.3635 -0.0258 -0.0283 -0.0140 179 DC  C C2    
2351 O O2    . DC  C 10  ? 0.2478 0.1490 0.3367 -0.0294 -0.0177 0.0097  179 DC  C O2    
2352 N N3    . DC  C 10  ? 0.4125 0.3143 0.5627 -0.0233 -0.0312 -0.0268 179 DC  C N3    
2353 C C4    . DC  C 10  ? 0.4325 0.3463 0.6008 -0.0193 -0.0436 -0.0541 179 DC  C C4    
2354 N N4    . DC  C 10  ? 0.2811 0.1833 0.4955 -0.0172 -0.0462 -0.0665 179 DC  C N4    
2355 C C5    . DC  C 10  ? 0.2822 0.2198 0.4218 -0.0171 -0.0539 -0.0698 179 DC  C C5    
2356 C C6    . DC  C 10  ? 0.2765 0.2236 0.3722 -0.0196 -0.0502 -0.0550 179 DC  C C6    
2357 P P     . DA  C 11  ? 0.3664 0.2834 0.3508 -0.0043 0.0308  0.0701  180 DA  C P     
2358 O OP1   . DA  C 11  ? 0.6916 0.5870 0.6518 -0.0185 0.0086  0.0920  180 DA  C OP1   
2359 O OP2   . DA  C 11  ? 0.3720 0.2953 0.3357 -0.0014 0.0403  0.0536  180 DA  C OP2   
2360 O "O5'" . DA  C 11  ? 0.3471 0.2449 0.3458 0.0115  0.0237  0.0656  180 DA  C "O5'" 
2361 C "C5'" . DA  C 11  ? 0.3469 0.2325 0.3533 0.0082  0.0088  0.0807  180 DA  C "C5'" 
2362 C "C4'" . DA  C 11  ? 0.3304 0.2129 0.3532 0.0187  0.0069  0.0768  180 DA  C "C4'" 
2363 O "O4'" . DA  C 11  ? 0.3788 0.2821 0.4399 0.0256  0.0242  0.0670  180 DA  C "O4'" 
2364 C "C3'" . DA  C 11  ? 0.3341 0.1982 0.3241 0.0283  -0.0012 0.0657  180 DA  C "C3'" 
2365 O "O3'" . DA  C 11  ? 0.4080 0.2611 0.3869 0.0267  -0.0165 0.0719  180 DA  C "O3'" 
2366 C "C2'" . DA  C 11  ? 0.3162 0.1954 0.3274 0.0367  0.0126  0.0539  180 DA  C "C2'" 
2367 C "C1'" . DA  C 11  ? 0.3056 0.2024 0.3653 0.0337  0.0221  0.0602  180 DA  C "C1'" 
2368 N N9    . DA  C 11  ? 0.3297 0.2379 0.4144 0.0401  0.0380  0.0439  180 DA  C N9    
2369 C C8    . DA  C 11  ? 0.3507 0.2706 0.4323 0.0401  0.0533  0.0281  180 DA  C C8    
2370 N N7    . DA  C 11  ? 0.3646 0.2909 0.4708 0.0463  0.0647  0.0103  180 DA  C N7    
2371 C C5    . DA  C 11  ? 0.3475 0.2637 0.4773 0.0496  0.0543  0.0193  180 DA  C C5    
2372 C C6    . DA  C 11  ? 0.3622 0.2739 0.5259 0.0538  0.0545  0.0120  180 DA  C C6    
2373 N N6    . DA  C 11  ? 0.3724 0.2865 0.5527 0.0586  0.0672  -0.0130 180 DA  C N6    
2374 N N1    . DA  C 11  ? 0.2904 0.1954 0.4691 0.0503  0.0392  0.0315  180 DA  C N1    
2375 C C2    . DA  C 11  ? 0.3138 0.2195 0.4714 0.0441  0.0272  0.0521  180 DA  C C2    
2376 N N3    . DA  C 11  ? 0.2876 0.1933 0.4130 0.0419  0.0259  0.0559  180 DA  C N3    
2377 C C4    . DA  C 11  ? 0.3282 0.2373 0.4429 0.0447  0.0389  0.0407  180 DA  C C4    
2378 P P     . DT  C 12  ? 0.4314 0.2705 0.3747 0.0369  -0.0263 0.0574  181 DT  C P     
2379 O OP1   . DT  C 12  ? 0.4681 0.2913 0.3927 0.0310  -0.0437 0.0610  181 DT  C OP1   
2380 O OP2   . DT  C 12  ? 0.4685 0.2974 0.3940 0.0454  -0.0250 0.0459  181 DT  C OP2   
2381 O "O5'" . DT  C 12  ? 0.3663 0.2296 0.3250 0.0408  -0.0174 0.0537  181 DT  C "O5'" 
2382 C "C5'" . DT  C 12  ? 0.3719 0.2487 0.3491 0.0308  -0.0213 0.0686  181 DT  C "C5'" 
2383 C "C4'" . DT  C 12  ? 0.3897 0.2885 0.3847 0.0307  -0.0147 0.0699  181 DT  C "C4'" 
2384 O "O4'" . DT  C 12  ? 0.3944 0.2942 0.4199 0.0348  -0.0027 0.0670  181 DT  C "O4'" 
2385 C "C3'" . DT  C 12  ? 0.4075 0.3184 0.3758 0.0384  -0.0126 0.0537  181 DT  C "C3'" 
2386 O "O3'" . DT  C 12  ? 0.4498 0.3811 0.4043 0.0294  -0.0196 0.0590  181 DT  C "O3'" 
2387 C "C2'" . DT  C 12  ? 0.4047 0.3271 0.3967 0.0404  -0.0021 0.0516  181 DT  C "C2'" 
2388 C "C1'" . DT  C 12  ? 0.3886 0.3019 0.4200 0.0357  0.0011  0.0630  181 DT  C "C1'" 
2389 N N1    . DT  C 12  ? 0.3674 0.2766 0.4136 0.0422  0.0130  0.0494  181 DT  C N1    
2390 C C2    . DT  C 12  ? 0.3660 0.2797 0.4467 0.0390  0.0155  0.0514  181 DT  C C2    
2391 O O2    . DT  C 12  ? 0.3693 0.2897 0.4723 0.0300  0.0066  0.0688  181 DT  C O2    
2392 N N3    . DT  C 12  ? 0.3656 0.2746 0.4540 0.0445  0.0264  0.0332  181 DT  C N3    
2393 C C4    . DT  C 12  ? 0.3516 0.2573 0.4140 0.0500  0.0347  0.0172  181 DT  C C4    
2394 O O4    . DT  C 12  ? 0.3353 0.2413 0.4019 0.0514  0.0440  0.0007  181 DT  C O4    
2395 C C5    . DT  C 12  ? 0.3417 0.2423 0.3705 0.0516  0.0291  0.0218  181 DT  C C5    
2396 C C7    . DT  C 12  ? 0.3285 0.2237 0.3287 0.0535  0.0320  0.0125  181 DT  C C7    
2397 C C6    . DT  C 12  ? 0.3560 0.2561 0.3797 0.0489  0.0186  0.0355  181 DT  C C6    
2398 P P     . DT  C 13  ? 0.5281 0.4908 0.4618 0.0340  -0.0149 0.0438  182 DT  C P     
2399 O OP1   . DT  C 13  ? 0.5798 0.5609 0.4863 0.0254  -0.0222 0.0417  182 DT  C OP1   
2400 O OP2   . DT  C 13  ? 0.5704 0.5231 0.4945 0.0533  -0.0095 0.0215  182 DT  C OP2   
2401 O "O5'" . DT  C 13  ? 0.4350 0.4220 0.3987 0.0214  -0.0108 0.0616  182 DT  C "O5'" 
2402 C "C5'" . DT  C 13  ? 0.3840 0.3856 0.3634 0.0006  -0.0197 0.0886  182 DT  C "C5'" 
2403 C "C4'" . DT  C 13  ? 0.3638 0.3692 0.3829 -0.0082 -0.0198 0.1055  182 DT  C "C4'" 
2404 O "O4'" . DT  C 13  ? 0.3030 0.2824 0.3394 0.0076  -0.0105 0.0897  182 DT  C "O4'" 
2405 C "C3'" . DT  C 13  ? 0.3868 0.4315 0.3995 -0.0194 -0.0180 0.1091  182 DT  C "C3'" 
2406 O "O3'" . DT  C 13  ? 0.4008 0.4611 0.4360 -0.0447 -0.0314 0.1428  182 DT  C "O3'" 
2407 C "C2'" . DT  C 13  ? 0.3075 0.3400 0.3373 -0.0076 -0.0092 0.0945  182 DT  C "C2'" 
2408 C "C1'" . DT  C 13  ? 0.2995 0.2892 0.3547 0.0028  -0.0084 0.0914  182 DT  C "C1'" 
2409 N N1    . DT  C 13  ? 0.2913 0.2652 0.3437 0.0186  0.0025  0.0673  182 DT  C N1    
2410 C C2    . DT  C 13  ? 0.3565 0.3154 0.4409 0.0177  0.0044  0.0648  182 DT  C C2    
2411 O O2    . DT  C 13  ? 0.3708 0.3234 0.4918 0.0069  -0.0039 0.0812  182 DT  C O2    
2412 N N3    . DT  C 13  ? 0.3225 0.2723 0.3953 0.0291  0.0140  0.0418  182 DT  C N3    
2413 C C4    . DT  C 13  ? 0.2897 0.2423 0.3269 0.0409  0.0187  0.0266  182 DT  C C4    
2414 O O4    . DT  C 13  ? 0.2872 0.2331 0.3157 0.0471  0.0241  0.0110  182 DT  C O4    
2415 C C5    . DT  C 13  ? 0.2904 0.2532 0.3022 0.0442  0.0143  0.0300  182 DT  C C5    
2416 C C7    . DT  C 13  ? 0.3118 0.2709 0.2920 0.0589  0.0141  0.0140  182 DT  C C7    
2417 C C6    . DT  C 13  ? 0.2911 0.2650 0.3093 0.0330  0.0079  0.0475  182 DT  C C6    
2418 P P     . DC  C 14  ? 0.3923 0.5092 0.4106 -0.0687 -0.0340 0.1578  183 DC  C P     
2419 O OP1   . DC  C 14  ? 0.4383 0.5656 0.4712 -0.0979 -0.0536 0.1981  183 DC  C OP1   
2420 O OP2   . DC  C 14  ? 0.4112 0.5613 0.3840 -0.0572 -0.0204 0.1280  183 DC  C OP2   
2421 O "O5'" . DC  C 14  ? 0.3385 0.4553 0.3849 -0.0702 -0.0315 0.1587  183 DC  C "O5'" 
2422 C "C5'" . DC  C 14  ? 0.3452 0.4398 0.4376 -0.0861 -0.0473 0.1870  183 DC  C "C5'" 
2423 C "C4'" . DC  C 14  ? 0.5165 0.5941 0.6319 -0.0789 -0.0429 0.1735  183 DC  C "C4'" 
2424 O "O4'" . DC  C 14  ? 0.4980 0.5535 0.5984 -0.0492 -0.0260 0.1360  183 DC  C "O4'" 
2425 C "C3'" . DC  C 14  ? 0.4927 0.6182 0.5976 -0.0962 -0.0413 0.1788  183 DC  C "C3'" 
2426 O "O3'" . DC  C 14  ? 0.4685 0.5758 0.6149 -0.1155 -0.0580 0.2013  183 DC  C "O3'" 
2427 C "C2'" . DC  C 14  ? 0.3262 0.4540 0.4099 -0.0697 -0.0224 0.1397  183 DC  C "C2'" 
2428 C "C1'" . DC  C 14  ? 0.4540 0.5222 0.5525 -0.0475 -0.0198 0.1221  183 DC  C "C1'" 
2429 N N1    . DC  C 14  ? 0.4111 0.4720 0.4834 -0.0212 -0.0048 0.0887  183 DC  C N1    
2430 C C2    . DC  C 14  ? 0.4009 0.4276 0.4850 -0.0090 -0.0004 0.0700  183 DC  C C2    
2431 O O2    . DC  C 14  ? 0.4373 0.4389 0.5550 -0.0171 -0.0071 0.0758  183 DC  C O2    
2432 N N3    . DC  C 14  ? 0.3505 0.3724 0.4095 0.0105  0.0093  0.0456  183 DC  C N3    
2433 C C4    . DC  C 14  ? 0.3150 0.3582 0.3445 0.0211  0.0129  0.0379  183 DC  C C4    
2434 N N4    . DC  C 14  ? 0.2991 0.3317 0.3094 0.0394  0.0172  0.0178  183 DC  C N4    
2435 C C5    . DC  C 14  ? 0.2934 0.3701 0.3119 0.0124  0.0106  0.0498  183 DC  C C5    
2436 C C6    . DC  C 14  ? 0.3981 0.4859 0.4355 -0.0105 0.0026  0.0759  183 DC  C C6    
2437 P P     . DA  C 15  ? 0.4876 0.6421 0.6352 -0.1436 -0.0636 0.2189  184 DA  C P     
2438 O OP1   . DA  C 15  ? 0.5124 0.6587 0.6950 -0.1777 -0.0913 0.2650  184 DA  C OP1   
2439 O OP2   . DA  C 15  ? 0.5108 0.7345 0.6145 -0.1425 -0.0459 0.2064  184 DA  C OP2   
2440 O "O5'" . DA  C 15  ? 0.4718 0.5935 0.6376 -0.1295 -0.0595 0.1926  184 DA  C "O5'" 
2441 C "C5'" . DA  C 15  ? 0.4666 0.5239 0.6547 -0.1068 -0.0585 0.1705  184 DA  C "C5'" 
2442 C "C4'" . DA  C 15  ? 0.4608 0.5058 0.6450 -0.0933 -0.0488 0.1384  184 DA  C "C4'" 
2443 O "O4'" . DA  C 15  ? 0.4175 0.4684 0.5661 -0.0652 -0.0285 0.1076  184 DA  C "O4'" 
2444 C "C3'" . DA  C 15  ? 0.4764 0.5658 0.6557 -0.1139 -0.0523 0.1466  184 DA  C "C3'" 
2445 O "O3'" . DA  C 15  ? 0.5385 0.5922 0.7527 -0.1289 -0.0688 0.1499  184 DA  C "O3'" 
2446 C "C2'" . DA  C 15  ? 0.4247 0.5392 0.5701 -0.0905 -0.0326 0.1140  184 DA  C "C2'" 
2447 C "C1'" . DA  C 15  ? 0.3947 0.4647 0.5294 -0.0613 -0.0219 0.0890  184 DA  C "C1'" 
2448 N N9    . DA  C 15  ? 0.3618 0.4564 0.4606 -0.0391 -0.0070 0.0699  184 DA  C N9    
2449 C C8    . DA  C 15  ? 0.3429 0.4692 0.4202 -0.0340 -0.0013 0.0742  184 DA  C C8    
2450 N N7    . DA  C 15  ? 0.3267 0.4623 0.3789 -0.0109 0.0086  0.0512  184 DA  C N7    
2451 C C5    . DA  C 15  ? 0.3265 0.4384 0.3820 -0.0028 0.0090  0.0351  184 DA  C C5    
2452 C C6    . DA  C 15  ? 0.3139 0.4213 0.3517 0.0174  0.0133  0.0134  184 DA  C C6    
2453 N N6    . DA  C 15  ? 0.2858 0.4072 0.3039 0.0370  0.0170  0.0023  184 DA  C N6    
2454 N N1    . DA  C 15  ? 0.3027 0.3893 0.3445 0.0155  0.0110  0.0036  184 DA  C N1    
2455 C C2    . DA  C 15  ? 0.3170 0.3848 0.3808 -0.0025 0.0058  0.0095  184 DA  C C2    
2456 N N3    . DA  C 15  ? 0.3399 0.4033 0.4276 -0.0198 -0.0005 0.0288  184 DA  C N3    
2457 C C4    . DA  C 15  ? 0.3412 0.4294 0.4228 -0.0201 0.0011  0.0437  184 DA  C C4    
2458 P P     . DT  C 16  ? 0.5390 0.6286 0.7558 -0.1534 -0.0767 0.1578  185 DT  C P     
2459 O OP1   . DT  C 16  ? 0.4376 0.4839 0.6981 -0.1789 -0.1036 0.1771  185 DT  C OP1   
2460 O OP2   . DT  C 16  ? 0.5570 0.7273 0.7491 -0.1656 -0.0685 0.1753  185 DT  C OP2   
2461 O "O5'" . DT  C 16  ? 0.5117 0.5902 0.7092 -0.1295 -0.0621 0.1157  185 DT  C "O5'" 
2462 C "C5'" . DT  C 16  ? 0.5144 0.5301 0.7214 -0.1119 -0.0605 0.0866  185 DT  C "C5'" 
2463 C "C4'" . DT  C 16  ? 0.4842 0.5042 0.6673 -0.1000 -0.0506 0.0545  185 DT  C "C4'" 
2464 O "O4'" . DT  C 16  ? 0.4525 0.5033 0.5998 -0.0764 -0.0323 0.0428  185 DT  C "O4'" 
2465 C "C3'" . DT  C 16  ? 0.4673 0.5225 0.6531 -0.1234 -0.0614 0.0627  185 DT  C "C3'" 
2466 O "O3'" . DT  C 16  ? 0.5227 0.5421 0.7100 -0.1250 -0.0667 0.0359  185 DT  C "O3'" 
2467 C "C2'" . DT  C 16  ? 0.4122 0.5310 0.5680 -0.1102 -0.0468 0.0606  185 DT  C "C2'" 
2468 C "C1'" . DT  C 16  ? 0.4222 0.5134 0.5539 -0.0780 -0.0311 0.0361  185 DT  C "C1'" 
2469 N N1    . DT  C 16  ? 0.3918 0.5272 0.4996 -0.0587 -0.0185 0.0350  185 DT  C N1    
2470 C C2    . DT  C 16  ? 0.3924 0.5321 0.4778 -0.0383 -0.0121 0.0140  185 DT  C C2    
2471 O O2    . DT  C 16  ? 0.4107 0.5247 0.4893 -0.0380 -0.0150 -0.0023 185 DT  C O2    
2472 N N3    . DT  C 16  ? 0.3788 0.5537 0.4499 -0.0192 -0.0041 0.0123  185 DT  C N3    
2473 C C4    . DT  C 16  ? 0.3911 0.6013 0.4633 -0.0190 0.0012  0.0246  185 DT  C C4    
2474 O O4    . DT  C 16  ? 0.3995 0.6381 0.4592 0.0009  0.0082  0.0153  185 DT  C O4    
2475 C C5    . DT  C 16  ? 0.3080 0.5187 0.3977 -0.0448 -0.0045 0.0485  185 DT  C C5    
2476 C C7    . DT  C 16  ? 0.3058 0.5600 0.3919 -0.0521 -0.0002 0.0653  185 DT  C C7    
2477 C C6    . DT  C 16  ? 0.3574 0.5289 0.4664 -0.0630 -0.0156 0.0547  185 DT  C C6    
2478 P P     . DT  C 17  ? 0.5843 0.6238 0.7807 -0.1539 -0.0839 0.0418  186 DT  C P     
2479 O OP1   . DT  C 17  ? 0.6392 0.6135 0.8615 -0.1669 -0.1008 0.0273  186 DT  C OP1   
2480 O OP2   . DT  C 17  ? 0.5839 0.6876 0.7892 -0.1753 -0.0896 0.0791  186 DT  C OP2   
2481 O "O5'" . DT  C 17  ? 0.5357 0.5998 0.6972 -0.1384 -0.0726 0.0154  186 DT  C "O5'" 
2482 C "C5'" . DT  C 17  ? 0.5180 0.5399 0.6595 -0.1206 -0.0638 -0.0195 186 DT  C "C5'" 
2483 C "C4'" . DT  C 17  ? 0.4894 0.5456 0.5952 -0.1032 -0.0531 -0.0312 186 DT  C "C4'" 
2484 O "O4'" . DT  C 17  ? 0.4659 0.5613 0.5658 -0.0855 -0.0423 -0.0145 186 DT  C "O4'" 
2485 C "C3'" . DT  C 17  ? 0.4371 0.5322 0.5377 -0.1194 -0.0653 -0.0294 186 DT  C "C3'" 
2486 O "O3'" . DT  C 17  ? 0.5152 0.5884 0.5890 -0.1182 -0.0661 -0.0571 186 DT  C "O3'" 
2487 C "C2'" . DT  C 17  ? 0.5112 0.6698 0.6065 -0.1037 -0.0584 -0.0134 186 DT  C "C2'" 
2488 C "C1'" . DT  C 17  ? 0.4711 0.6098 0.5542 -0.0770 -0.0421 -0.0169 186 DT  C "C1'" 
2489 N N1    . DT  C 17  ? 0.4648 0.6538 0.5520 -0.0629 -0.0346 -0.0015 186 DT  C N1    
2490 C C2    . DT  C 17  ? 0.4618 0.6646 0.5306 -0.0363 -0.0281 -0.0105 186 DT  C C2    
2491 O O2    . DT  C 17  ? 0.4418 0.6184 0.4894 -0.0267 -0.0294 -0.0249 186 DT  C O2    
2492 N N3    . DT  C 17  ? 0.4828 0.7315 0.5587 -0.0225 -0.0213 -0.0022 186 DT  C N3    
2493 C C4    . DT  C 17  ? 0.4988 0.7893 0.5931 -0.0357 -0.0181 0.0149  186 DT  C C4    
2494 O O4    . DT  C 17  ? 0.5472 0.8837 0.6436 -0.0221 -0.0096 0.0160  186 DT  C O4    
2495 C C5    . DT  C 17  ? 0.4591 0.7358 0.5702 -0.0680 -0.0270 0.0308  186 DT  C C5    
2496 C C7    . DT  C 17  ? 0.4055 0.7279 0.5351 -0.0908 -0.0277 0.0569  186 DT  C C7    
2497 C C6    . DT  C 17  ? 0.4748 0.6979 0.5840 -0.0785 -0.0359 0.0211  186 DT  C C6    
2498 P P     . DC  C 18  ? 0.5586 0.6596 0.6248 -0.1398 -0.0832 -0.0600 187 DC  C P     
2499 O OP1   . DC  C 18  ? 0.5866 0.6501 0.6227 -0.1438 -0.0836 -0.0931 187 DC  C OP1   
2500 O OP2   . DC  C 18  ? 0.5633 0.6817 0.6632 -0.1674 -0.0992 -0.0389 187 DC  C OP2   
2501 O "O5'" . DC  C 18  ? 0.5515 0.7129 0.6073 -0.1221 -0.0806 -0.0458 187 DC  C "O5'" 
2502 C "C5'" . DC  C 18  ? 0.5640 0.7176 0.5923 -0.0961 -0.0696 -0.0549 187 DC  C "C5'" 
2503 C "C4'" . DC  C 18  ? 0.5600 0.7690 0.5926 -0.0789 -0.0729 -0.0397 187 DC  C "C4'" 
2504 O "O4'" . DC  C 18  ? 0.5334 0.7710 0.5901 -0.0650 -0.0630 -0.0246 187 DC  C "O4'" 
2505 C "C3'" . DC  C 18  ? 0.5960 0.8542 0.6421 -0.0961 -0.0912 -0.0304 187 DC  C "C3'" 
2506 O "O3'" . DC  C 18  ? 0.6315 0.9044 0.6594 -0.0855 -0.1010 -0.0320 187 DC  C "O3'" 
2507 C "C2'" . DC  C 18  ? 0.5574 0.8759 0.6409 -0.0910 -0.0879 -0.0102 187 DC  C "C2'" 
2508 C "C1'" . DC  C 18  ? 0.5306 0.8352 0.6093 -0.0619 -0.0699 -0.0120 187 DC  C "C1'" 
2509 N N1    . DC  C 18  ? 0.5290 0.8745 0.6342 -0.0621 -0.0603 0.0026  187 DC  C N1    
2510 C C2    . DC  C 18  ? 0.5321 0.9052 0.6411 -0.0331 -0.0482 0.0017  187 DC  C C2    
2511 O O2    . DC  C 18  ? 0.5679 0.9230 0.6620 -0.0070 -0.0481 -0.0094 187 DC  C O2    
2512 N N3    . DC  C 18  ? 0.4815 0.9002 0.6092 -0.0367 -0.0382 0.0129  187 DC  C N3    
2513 C C4    . DC  C 18  ? 0.4625 0.8995 0.6063 -0.0698 -0.0423 0.0305  187 DC  C C4    
2514 N N4    . DC  C 18  ? 0.4099 0.8989 0.5678 -0.0771 -0.0328 0.0447  187 DC  C N4    
2515 C C5    . DC  C 18  ? 0.5080 0.9108 0.6529 -0.0992 -0.0580 0.0342  187 DC  C C5    
2516 C C6    . DC  C 18  ? 0.5312 0.8895 0.6559 -0.0930 -0.0654 0.0169  187 DC  C C6    
2517 P P     . DG  C 19  ? 0.6729 0.9733 0.6974 -0.1101 -0.1243 -0.0298 188 DG  C P     
2518 O OP1   . DG  C 19  ? 0.7210 0.9868 0.7006 -0.1149 -0.1299 -0.0439 188 DG  C OP1   
2519 O OP2   . DG  C 19  ? 0.6841 0.9902 0.7287 -0.1407 -0.1305 -0.0276 188 DG  C OP2   
2520 O "O5'" . DG  C 19  ? 0.6681 1.0376 0.7242 -0.0906 -0.1343 -0.0108 188 DG  C "O5'" 
2521 C "C5'" . DG  C 19  ? 0.6829 1.0600 0.7261 -0.0767 -0.1488 -0.0070 188 DG  C "C5'" 
2522 C "C4'" . DG  C 19  ? 0.6418 1.0110 0.6899 -0.0385 -0.1390 -0.0057 188 DG  C "C4'" 
2523 O "O4'" . DG  C 19  ? 0.6181 0.9793 0.6788 -0.0282 -0.1157 -0.0106 188 DG  C "O4'" 
2524 C "C3'" . DG  C 19  ? 0.6447 1.0691 0.7316 -0.0121 -0.1533 0.0066  188 DG  C "C3'" 
2525 O "O3'" . DG  C 19  ? 0.7076 1.1047 0.7757 0.0040  -0.1681 0.0110  188 DG  C "O3'" 
2526 C "C2'" . DG  C 19  ? 0.5938 1.0470 0.7149 0.0139  -0.1332 0.0028  188 DG  C "C2'" 
2527 C "C1'" . DG  C 19  ? 0.5986 1.0094 0.6968 -0.0009 -0.1110 -0.0053 188 DG  C "C1'" 
2528 N N9    . DG  C 19  ? 0.5999 1.0544 0.7263 -0.0153 -0.1006 0.0001  188 DG  C N9    
2529 C C8    . DG  C 19  ? 0.6223 1.0854 0.7528 -0.0514 -0.1062 0.0066  188 DG  C C8    
2530 N N7    . DG  C 19  ? 0.6315 1.1386 0.7895 -0.0614 -0.0971 0.0163  188 DG  C N7    
2531 C C5    . DG  C 19  ? 0.5790 1.1123 0.7493 -0.0288 -0.0818 0.0121  188 DG  C C5    
2532 C C6    . DG  C 19  ? 0.5192 1.1092 0.7137 -0.0254 -0.0657 0.0173  188 DG  C C6    
2533 O O6    . DG  C 19  ? 0.5289 1.1604 0.7406 -0.0537 -0.0630 0.0323  188 DG  C O6    
2534 N N1    . DG  C 19  ? 0.4489 1.0476 0.6455 0.0126  -0.0536 0.0035  188 DG  C N1    
2535 C C2    . DG  C 19  ? 0.4167 0.9692 0.5976 0.0425  -0.0596 -0.0094 188 DG  C C2    
2536 N N2    . DG  C 19  ? 0.3616 0.9242 0.5493 0.0764  -0.0493 -0.0233 188 DG  C N2    
2537 N N3    . DG  C 19  ? 0.4837 0.9850 0.6421 0.0368  -0.0760 -0.0085 188 DG  C N3    
2538 C C4    . DG  C 19  ? 0.5632 1.0605 0.7160 0.0010  -0.0847 0.0008  188 DG  C C4    
2539 P P     . DG  C 20  ? 0.7711 1.2131 0.8783 0.0272  -0.1957 0.0260  189 DG  C P     
2540 O OP1   . DG  C 20  ? 0.8271 1.2233 0.9128 0.0442  -0.2088 0.0319  189 DG  C OP1   
2541 O OP2   . DG  C 20  ? 0.7771 1.2620 0.8942 0.0000  -0.2165 0.0373  189 DG  C OP2   
2542 O "O5'" . DG  C 20  ? 0.7247 1.2193 0.8884 0.0598  -0.1808 0.0190  189 DG  C "O5'" 
2543 C "C5'" . DG  C 20  ? 0.7376 1.2889 0.9563 0.0881  -0.1976 0.0243  189 DG  C "C5'" 
2544 C "C4'" . DG  C 20  ? 0.7395 1.3162 0.9938 0.1257  -0.1768 0.0071  189 DG  C "C4'" 
2545 O "O4'" . DG  C 20  ? 0.7160 1.2998 0.9560 0.1078  -0.1461 -0.0016 189 DG  C "O4'" 
2546 C "C3'" . DG  C 20  ? 0.7606 1.4241 1.0867 0.1543  -0.1838 0.0040  189 DG  C "C3'" 
2547 O "O3'" . DG  C 20  ? 0.7970 1.4507 1.1484 0.1991  -0.1799 -0.0138 189 DG  C "O3'" 
2548 C "C2'" . DG  C 20  ? 0.7306 1.4604 1.0724 0.1338  -0.1586 0.0006  189 DG  C "C2'" 
2549 C "C1'" . DG  C 20  ? 0.6983 1.3676 0.9881 0.1184  -0.1335 -0.0071 189 DG  C "C1'" 
2550 N N9    . DG  C 20  ? 0.6378 1.3300 0.9175 0.0786  -0.1197 0.0010  189 DG  C N9    
2551 C C8    . DG  C 20  ? 0.6330 1.3033 0.8886 0.0380  -0.1313 0.0144  189 DG  C C8    
2552 N N7    . DG  C 20  ? 0.6153 1.3081 0.8722 0.0077  -0.1192 0.0205  189 DG  C N7    
2553 C C5    . DG  C 20  ? 0.5900 1.3290 0.8701 0.0272  -0.0968 0.0132  189 DG  C C5    
2554 C C6    . DG  C 20  ? 0.5229 1.3058 0.8126 0.0056  -0.0786 0.0200  189 DG  C C6    
2555 O O6    . DG  C 20  ? 0.5029 1.2862 0.7868 -0.0352 -0.0813 0.0360  189 DG  C O6    
2556 N N1    . DG  C 20  ? 0.5003 1.3293 0.8074 0.0340  -0.0578 0.0066  189 DG  C N1    
2557 C C2    . DG  C 20  ? 0.5128 1.3389 0.8309 0.0806  -0.0560 -0.0147 189 DG  C C2    
2558 N N2    . DG  C 20  ? 0.4915 1.3447 0.8134 0.1000  -0.0331 -0.0310 189 DG  C N2    
2559 N N3    . DG  C 20  ? 0.5685 1.3468 0.8828 0.1020  -0.0763 -0.0189 189 DG  C N3    
2560 C C4    . DG  C 20  ? 0.6005 1.3403 0.8940 0.0720  -0.0955 -0.0024 189 DG  C C4    
2561 P P     . DA  C 21  ? 0.9021 1.5640 1.3078 0.2294  -0.2012 -0.0118 190 DA  C P     
2562 O OP1   . DA  C 21  ? 0.9185 1.5390 1.3088 0.2193  -0.2405 0.0137  190 DA  C OP1   
2563 O OP2   . DA  C 21  ? 0.8948 1.6381 1.3492 0.2276  -0.1885 -0.0153 190 DA  C OP2   
2564 O "O5'" . DA  C 21  ? 0.9378 1.5558 1.3488 0.2676  -0.1889 -0.0360 190 DA  C "O5'" 
2565 C "C4'" . DC  D 1   ? 0.5217 0.9380 0.7053 0.0116  -0.0121 0.1885  170 DC  D "C4'" 
2566 O "O4'" . DC  D 1   ? 0.5299 0.8996 0.7383 -0.0246 -0.0218 0.1828  170 DC  D "O4'" 
2567 C "C3'" . DC  D 1   ? 0.5139 0.8872 0.6588 0.0259  -0.0231 0.1536  170 DC  D "C3'" 
2568 O "O3'" . DC  D 1   ? 0.5234 0.9269 0.6365 0.0630  -0.0243 0.1318  170 DC  D "O3'" 
2569 C "C2'" . DC  D 1   ? 0.5100 0.8185 0.6586 0.0017  -0.0389 0.1266  170 DC  D "C2'" 
2570 C "C1'" . DC  D 1   ? 0.5259 0.8470 0.7099 -0.0234 -0.0369 0.1443  170 DC  D "C1'" 
2571 N N1    . DC  D 1   ? 0.5423 0.8110 0.7421 -0.0596 -0.0453 0.1369  170 DC  D N1    
2572 C C2    . DC  D 1   ? 0.5472 0.7909 0.7441 -0.0720 -0.0587 0.1148  170 DC  D C2    
2573 O O2    . DC  D 1   ? 0.5495 0.8117 0.7369 -0.0532 -0.0637 0.1048  170 DC  D O2    
2574 N N3    . DC  D 1   ? 0.5482 0.7511 0.7544 -0.1034 -0.0654 0.1055  170 DC  D N3    
2575 C C4    . DC  D 1   ? 0.5571 0.7375 0.7782 -0.1208 -0.0593 0.1142  170 DC  D C4    
2576 N N4    . DC  D 1   ? 0.5780 0.7189 0.8065 -0.1492 -0.0656 0.0990  170 DC  D N4    
2577 C C5    . DC  D 1   ? 0.5560 0.7562 0.7865 -0.1088 -0.0463 0.1394  170 DC  D C5    
2578 C C6    . DC  D 1   ? 0.5546 0.8016 0.7720 -0.0788 -0.0398 0.1514  170 DC  D C6    
2579 P P     . DC  D 2   ? 0.5023 0.8745 0.5760 0.0826  -0.0371 0.0955  171 DC  D P     
2580 O OP1   . DC  D 2   ? 0.5416 0.9638 0.5870 0.1225  -0.0338 0.0799  171 DC  D OP1   
2581 O OP2   . DC  D 2   ? 0.5076 0.8567 0.5825 0.0673  -0.0364 0.1102  171 DC  D OP2   
2582 O "O5'" . DC  D 2   ? 0.4568 0.7676 0.5319 0.0706  -0.0555 0.0618  171 DC  D "O5'" 
2583 C "C5'" . DC  D 2   ? 0.4910 0.8001 0.5510 0.0958  -0.0656 0.0293  171 DC  D "C5'" 
2584 C "C4'" . DC  D 2   ? 0.5382 0.7902 0.6091 0.0780  -0.0825 0.0094  171 DC  D "C4'" 
2585 O "O4'" . DC  D 2   ? 0.5198 0.7542 0.6148 0.0420  -0.0798 0.0308  171 DC  D "O4'" 
2586 C "C3'" . DC  D 2   ? 0.6152 0.8172 0.6694 0.0767  -0.0985 -0.0165 171 DC  D "C3'" 
2587 O "O3'" . DC  D 2   ? 0.6841 0.8627 0.7391 0.0900  -0.1143 -0.0452 171 DC  D "O3'" 
2588 C "C2'" . DC  D 2   ? 0.5854 0.7482 0.6546 0.0403  -0.0998 -0.0036 171 DC  D "C2'" 
2589 C "C1'" . DC  D 2   ? 0.5530 0.7326 0.6466 0.0235  -0.0934 0.0148  171 DC  D "C1'" 
2590 N N1    . DC  D 2   ? 0.5821 0.7442 0.6916 -0.0102 -0.0882 0.0323  171 DC  D N1    
2591 C C2    . DC  D 2   ? 0.6318 0.7687 0.7537 -0.0352 -0.0962 0.0282  171 DC  D C2    
2592 O O2    . DC  D 2   ? 0.6485 0.7796 0.7709 -0.0293 -0.1074 0.0160  171 DC  D O2    
2593 N N3    . DC  D 2   ? 0.6315 0.7526 0.7660 -0.0647 -0.0918 0.0376  171 DC  D N3    
2594 C C4    . DC  D 2   ? 0.5904 0.7148 0.7318 -0.0696 -0.0802 0.0529  171 DC  D C4    
2595 N N4    . DC  D 2   ? 0.5686 0.6718 0.7271 -0.0980 -0.0770 0.0577  171 DC  D N4    
2596 C C5    . DC  D 2   ? 0.5701 0.7220 0.7027 -0.0450 -0.0718 0.0640  171 DC  D C5    
2597 C C6    . DC  D 2   ? 0.5716 0.7440 0.6850 -0.0158 -0.0760 0.0519  171 DC  D C6    
2598 P P     . DG  D 3   ? 0.7925 0.9344 0.8309 0.1011  -0.1329 -0.0773 172 DG  D P     
2599 O OP1   . DG  D 3   ? 0.8607 1.0034 0.9004 0.1293  -0.1436 -0.1065 172 DG  D OP1   
2600 O OP2   . DG  D 3   ? 0.8295 0.9864 0.8454 0.1047  -0.1276 -0.0720 172 DG  D OP2   
2601 O "O5'" . DG  D 3   ? 0.7307 0.8197 0.7866 0.0701  -0.1447 -0.0752 172 DG  D "O5'" 
2602 C "C5'" . DG  D 3   ? 0.6623 0.7346 0.7414 0.0614  -0.1527 -0.0753 172 DG  D "C5'" 
2603 C "C4'" . DG  D 3   ? 0.5851 0.6280 0.6755 0.0274  -0.1550 -0.0616 172 DG  D "C4'" 
2604 O "O4'" . DG  D 3   ? 0.5575 0.6147 0.6435 0.0098  -0.1388 -0.0412 172 DG  D "O4'" 
2605 C "C3'" . DG  D 3   ? 0.5448 0.5484 0.6329 0.0195  -0.1684 -0.0737 172 DG  D "C3'" 
2606 O "O3'" . DG  D 3   ? 0.5262 0.5073 0.6337 0.0019  -0.1785 -0.0693 172 DG  D "O3'" 
2607 C "C2'" . DG  D 3   ? 0.5247 0.5279 0.6019 0.0038  -0.1561 -0.0610 172 DG  D "C2'" 
2608 C "C1'" . DG  D 3   ? 0.5256 0.5516 0.6102 -0.0105 -0.1410 -0.0406 172 DG  D "C1'" 
2609 N N9    . DG  D 3   ? 0.5263 0.5631 0.6063 -0.0179 -0.1259 -0.0259 172 DG  D N9    
2610 C C8    . DG  D 3   ? 0.5344 0.5904 0.6015 -0.0006 -0.1196 -0.0225 172 DG  D C8    
2611 N N7    . DG  D 3   ? 0.5253 0.5874 0.5989 -0.0127 -0.1062 -0.0027 172 DG  D N7    
2612 C C5    . DG  D 3   ? 0.5311 0.5743 0.6210 -0.0396 -0.1039 0.0018  172 DG  D C5    
2613 C C6    . DG  D 3   ? 0.5948 0.6303 0.7010 -0.0621 -0.0926 0.0164  172 DG  D C6    
2614 O O6    . DG  D 3   ? 0.6565 0.6987 0.7715 -0.0628 -0.0817 0.0332  172 DG  D O6    
2615 N N1    . DG  D 3   ? 0.5901 0.6094 0.7052 -0.0855 -0.0959 0.0101  172 DG  D N1    
2616 C C2    . DG  D 3   ? 0.5750 0.5907 0.6852 -0.0869 -0.1080 -0.0019 172 DG  D C2    
2617 N N2    . DG  D 3   ? 0.5722 0.5805 0.6893 -0.1110 -0.1098 -0.0043 172 DG  D N2    
2618 N N3    . DG  D 3   ? 0.5549 0.5749 0.6562 -0.0660 -0.1184 -0.0111 172 DG  D N3    
2619 C C4    . DG  D 3   ? 0.5285 0.5600 0.6195 -0.0431 -0.1158 -0.0115 172 DG  D C4    
2620 P P     . DA  D 4   ? 0.5978 0.5446 0.7199 0.0053  -0.1999 -0.0840 173 DA  D P     
2621 O OP1   . DA  D 4   ? 0.6822 0.6297 0.8251 0.0215  -0.2105 -0.0906 173 DA  D OP1   
2622 O OP2   . DA  D 4   ? 0.6014 0.5371 0.7086 0.0148  -0.2050 -0.0997 173 DA  D OP2   
2623 O "O5'" . DA  D 4   ? 0.5429 0.4752 0.6764 -0.0250 -0.2008 -0.0666 173 DA  D "O5'" 
2624 C "C5'" . DA  D 4   ? 0.4853 0.4340 0.6270 -0.0409 -0.1951 -0.0490 173 DA  D "C5'" 
2625 C "C4'" . DA  D 4   ? 0.4774 0.4273 0.6084 -0.0667 -0.1834 -0.0388 173 DA  D "C4'" 
2626 O "O4'" . DA  D 4   ? 0.4830 0.4404 0.5969 -0.0639 -0.1686 -0.0414 173 DA  D "O4'" 
2627 C "C3'" . DA  D 4   ? 0.5300 0.4596 0.6574 -0.0732 -0.1803 -0.0371 173 DA  D "C3'" 
2628 O "O3'" . DA  D 4   ? 0.5504 0.4874 0.6816 -0.0869 -0.1758 -0.0224 173 DA  D "O3'" 
2629 C "C2'" . DA  D 4   ? 0.5306 0.4580 0.6417 -0.0799 -0.1654 -0.0398 173 DA  D "C2'" 
2630 C "C1'" . DA  D 4   ? 0.5126 0.4572 0.6205 -0.0812 -0.1609 -0.0395 173 DA  D "C1'" 
2631 N N9    . DA  D 4   ? 0.5262 0.4703 0.6236 -0.0722 -0.1509 -0.0418 173 DA  D N9    
2632 C C8    . DA  D 4   ? 0.5365 0.4792 0.6271 -0.0511 -0.1562 -0.0501 173 DA  D C8    
2633 N N7    . DA  D 4   ? 0.5505 0.4999 0.6332 -0.0473 -0.1450 -0.0448 173 DA  D N7    
2634 C C5    . DA  D 4   ? 0.5295 0.4788 0.6183 -0.0674 -0.1313 -0.0340 173 DA  D C5    
2635 C C6    . DA  D 4   ? 0.5016 0.4527 0.5944 -0.0744 -0.1161 -0.0230 173 DA  D C6    
2636 N N6    . DA  D 4   ? 0.5105 0.4695 0.6003 -0.0608 -0.1110 -0.0154 173 DA  D N6    
2637 N N1    . DA  D 4   ? 0.4850 0.4305 0.5874 -0.0962 -0.1075 -0.0197 173 DA  D N1    
2638 C C2    . DA  D 4   ? 0.5053 0.4506 0.6079 -0.1098 -0.1136 -0.0258 173 DA  D C2    
2639 N N3    . DA  D 4   ? 0.5082 0.4564 0.6076 -0.1048 -0.1270 -0.0306 173 DA  D N3    
2640 C C4    . DA  D 4   ? 0.5169 0.4638 0.6119 -0.0831 -0.1353 -0.0348 173 DA  D C4    
2641 P P     . DA  D 5   ? 0.5532 0.4815 0.6839 -0.0918 -0.1707 -0.0154 174 DA  D P     
2642 O OP1   . DA  D 5   ? 0.6181 0.5594 0.7601 -0.1023 -0.1758 0.0012  174 DA  D OP1   
2643 O OP2   . DA  D 5   ? 0.5632 0.4714 0.7011 -0.0765 -0.1796 -0.0233 174 DA  D OP2   
2644 O "O5'" . DA  D 5   ? 0.4444 0.3783 0.5554 -0.1032 -0.1508 -0.0197 174 DA  D "O5'" 
2645 C "C5'" . DA  D 5   ? 0.3923 0.3442 0.4942 -0.1189 -0.1406 -0.0183 174 DA  D "C5'" 
2646 C "C4'" . DA  D 5   ? 0.3733 0.3214 0.4638 -0.1258 -0.1237 -0.0283 174 DA  D "C4'" 
2647 O "O4'" . DA  D 5   ? 0.3454 0.2804 0.4353 -0.1174 -0.1225 -0.0339 174 DA  D "O4'" 
2648 C "C3'" . DA  D 5   ? 0.3926 0.3342 0.4841 -0.1270 -0.1187 -0.0284 174 DA  D "C3'" 
2649 O "O3'" . DA  D 5   ? 0.3948 0.3436 0.4800 -0.1405 -0.1054 -0.0371 174 DA  D "O3'" 
2650 C "C2'" . DA  D 5   ? 0.3796 0.3025 0.4733 -0.1141 -0.1193 -0.0321 174 DA  D "C2'" 
2651 C "C1'" . DA  D 5   ? 0.3572 0.2791 0.4463 -0.1151 -0.1149 -0.0375 174 DA  D "C1'" 
2652 N N9    . DA  D 5   ? 0.3728 0.2831 0.4655 -0.1028 -0.1224 -0.0388 174 DA  D N9    
2653 C C8    . DA  D 5   ? 0.3922 0.2982 0.4891 -0.0883 -0.1385 -0.0402 174 DA  D C8    
2654 N N7    . DA  D 5   ? 0.4029 0.3033 0.5008 -0.0798 -0.1457 -0.0450 174 DA  D N7    
2655 C C5    . DA  D 5   ? 0.3251 0.2231 0.4245 -0.0906 -0.1328 -0.0414 174 DA  D C5    
2656 C C6    . DA  D 5   ? 0.3298 0.2311 0.4291 -0.0831 -0.1231 -0.0352 174 DA  D C6    
2657 N N6    . DA  D 5   ? 0.3357 0.2479 0.4283 -0.0640 -0.1288 -0.0337 174 DA  D N6    
2658 N N1    . DA  D 5   ? 0.3324 0.2279 0.4397 -0.0954 -0.1073 -0.0300 174 DA  D N1    
2659 C C2    . DA  D 5   ? 0.3323 0.2211 0.4413 -0.1133 -0.1019 -0.0363 174 DA  D C2    
2660 N N3    . DA  D 5   ? 0.3973 0.2963 0.4945 -0.1154 -0.1018 -0.0409 174 DA  D N3    
2661 C C4    . DA  D 5   ? 0.3871 0.2895 0.4826 -0.1038 -0.1172 -0.0400 174 DA  D C4    
2662 P P     . DT  D 6   ? 0.3770 0.3292 0.4656 -0.1483 -0.1017 -0.0369 175 DT  D P     
2663 O OP1   . DT  D 6   ? 0.4424 0.4186 0.5249 -0.1644 -0.1025 -0.0374 175 DT  D OP1   
2664 O OP2   . DT  D 6   ? 0.3435 0.2887 0.4438 -0.1383 -0.1122 -0.0239 175 DT  D OP2   
2665 O "O5'" . DT  D 6   ? 0.3437 0.2787 0.4319 -0.1487 -0.0870 -0.0511 175 DT  D "O5'" 
2666 C "C5'" . DT  D 6   ? 0.3324 0.2487 0.4225 -0.1362 -0.0861 -0.0495 175 DT  D "C5'" 
2667 C "C4'" . DT  D 6   ? 0.3428 0.2418 0.4364 -0.1385 -0.0730 -0.0577 175 DT  D "C4'" 
2668 O "O4'" . DT  D 6   ? 0.4896 0.3751 0.5878 -0.1276 -0.0748 -0.0526 175 DT  D "O4'" 
2669 C "C3'" . DT  D 6   ? 0.3451 0.2386 0.4499 -0.1371 -0.0721 -0.0550 175 DT  D "C3'" 
2670 O "O3'" . DT  D 6   ? 0.3630 0.2429 0.4713 -0.1443 -0.0587 -0.0668 175 DT  D "O3'" 
2671 C "C2'" . DT  D 6   ? 0.5251 0.4092 0.6396 -0.1207 -0.0809 -0.0447 175 DT  D "C2'" 
2672 C "C1'" . DT  D 6   ? 0.3378 0.2132 0.4485 -0.1175 -0.0780 -0.0466 175 DT  D "C1'" 
2673 N N1    . DT  D 6   ? 0.3297 0.2054 0.4430 -0.1050 -0.0936 -0.0394 175 DT  D N1    
2674 C C2    . DT  D 6   ? 0.3387 0.2054 0.4611 -0.1007 -0.0950 -0.0358 175 DT  D C2    
2675 O O2    . DT  D 6   ? 0.3568 0.2138 0.4887 -0.1057 -0.0817 -0.0352 175 DT  D O2    
2676 N N3    . DT  D 6   ? 0.3308 0.2004 0.4533 -0.0906 -0.1136 -0.0332 175 DT  D N3    
2677 C C4    . DT  D 6   ? 0.3786 0.2554 0.4939 -0.0827 -0.1295 -0.0369 175 DT  D C4    
2678 O O4    . DT  D 6   ? 0.3813 0.2631 0.4923 -0.0702 -0.1439 -0.0399 175 DT  D O4    
2679 C C5    . DT  D 6   ? 0.3714 0.2543 0.4831 -0.0870 -0.1245 -0.0362 175 DT  D C5    
2680 C C7    . DT  D 6   ? 0.3229 0.2096 0.4359 -0.0793 -0.1394 -0.0359 175 DT  D C7    
2681 C C6    . DT  D 6   ? 0.3811 0.2652 0.4918 -0.0985 -0.1082 -0.0365 175 DT  D C6    
2682 P P     . DG  D 7   ? 0.3780 0.2554 0.5102 -0.1433 -0.0535 -0.0683 176 DG  D P     
2683 O OP1   . DG  D 7   ? 0.3884 0.2730 0.5163 -0.1548 -0.0388 -0.0890 176 DG  D OP1   
2684 O OP2   . DG  D 7   ? 0.3518 0.2435 0.4935 -0.1395 -0.0677 -0.0510 176 DG  D OP2   
2685 O "O5'" . DG  D 7   ? 0.4387 0.2935 0.5888 -0.1291 -0.0448 -0.0655 176 DG  D "O5'" 
2686 C "C5'" . DG  D 7   ? 0.5243 0.3618 0.6742 -0.1292 -0.0315 -0.0761 176 DG  D "C5'" 
2687 C "C4'" . DG  D 7   ? 0.5739 0.3955 0.7470 -0.1153 -0.0274 -0.0639 176 DG  D "C4'" 
2688 O "O4'" . DG  D 7   ? 0.5851 0.4140 0.7528 -0.1092 -0.0428 -0.0482 176 DG  D "O4'" 
2689 C "C3'" . DG  D 7   ? 0.3895 0.2077 0.5947 -0.1054 -0.0216 -0.0578 176 DG  D "C3'" 
2690 O "O3'" . DG  D 7   ? 0.4059 0.2054 0.6355 -0.0962 -0.0079 -0.0546 176 DG  D "O3'" 
2691 C "C2'" . DG  D 7   ? 0.5132 0.3434 0.7197 -0.0986 -0.0419 -0.0385 176 DG  D "C2'" 
2692 C "C1'" . DG  D 7   ? 0.3645 0.1923 0.5557 -0.0975 -0.0487 -0.0341 176 DG  D "C1'" 
2693 N N9    . DG  D 7   ? 0.3488 0.1890 0.5293 -0.0936 -0.0703 -0.0261 176 DG  D N9    
2694 C C8    . DG  D 7   ? 0.3390 0.1932 0.5058 -0.0955 -0.0832 -0.0278 176 DG  D C8    
2695 N N7    . DG  D 7   ? 0.3325 0.1922 0.4931 -0.0889 -0.1019 -0.0241 176 DG  D N7    
2696 C C5    . DG  D 7   ? 0.3374 0.1939 0.5012 -0.0812 -0.0997 -0.0179 176 DG  D C5    
2697 C C6    . DG  D 7   ? 0.3384 0.2072 0.4912 -0.0688 -0.1121 -0.0132 176 DG  D C6    
2698 O O6    . DG  D 7   ? 0.3370 0.2137 0.4787 -0.0633 -0.1309 -0.0193 176 DG  D O6    
2699 N N1    . DG  D 7   ? 0.3460 0.2192 0.5037 -0.0617 -0.1006 -0.0004 176 DG  D N1    
2700 C C2    . DG  D 7   ? 0.3894 0.2490 0.5665 -0.0667 -0.0809 0.0061  176 DG  D C2    
2701 N N2    . DG  D 7   ? 0.3622 0.2285 0.5493 -0.0594 -0.0730 0.0239  176 DG  D N2    
2702 N N3    . DG  D 7   ? 0.3871 0.2295 0.5749 -0.0775 -0.0698 -0.0042 176 DG  D N3    
2703 C C4    . DG  D 7   ? 0.3581 0.2033 0.5354 -0.0839 -0.0795 -0.0157 176 DG  D C4    
2704 P P     . DA  D 8   ? 0.5240 0.3091 0.7803 -0.0921 0.0147  -0.0705 177 DA  D P     
2705 O OP1   . DA  D 8   ? 0.5699 0.3481 0.8065 -0.1031 0.0231  -0.0972 177 DA  D OP1   
2706 O OP2   . DA  D 8   ? 0.5510 0.3576 0.8133 -0.0855 0.0153  -0.0644 177 DA  D OP2   
2707 O "O5'" . DA  D 8   ? 0.5058 0.2747 0.7949 -0.0771 0.0222  -0.0522 177 DA  D "O5'" 
2708 C "C5'" . DA  D 8   ? 0.5074 0.2686 0.7919 -0.0789 0.0194  -0.0441 177 DA  D "C5'" 
2709 C "C4'" . DA  D 8   ? 0.5065 0.2712 0.8162 -0.0667 0.0140  -0.0116 177 DA  D "C4'" 
2710 O "O4'" . DA  D 8   ? 0.4959 0.2791 0.7881 -0.0682 -0.0057 0.0003  177 DA  D "O4'" 
2711 C "C3'" . DA  D 8   ? 0.4481 0.2103 0.7979 -0.0507 0.0233  0.0033  177 DA  D "C3'" 
2712 O "O3'" . DA  D 8   ? 0.4979 0.2574 0.8767 -0.0410 0.0264  0.0298  177 DA  D "O3'" 
2713 C "C2'" . DA  D 8   ? 0.4214 0.2075 0.7620 -0.0470 0.0069  0.0160  177 DA  D "C2'" 
2714 C "C1'" . DA  D 8   ? 0.4050 0.2037 0.7126 -0.0540 -0.0115 0.0209  177 DA  D "C1'" 
2715 N N9    . DA  D 8   ? 0.3841 0.2050 0.6643 -0.0563 -0.0304 0.0176  177 DA  D N9    
2716 C C8    . DA  D 8   ? 0.4954 0.3227 0.7693 -0.0616 -0.0318 0.0050  177 DA  D C8    
2717 N N7    . DA  D 8   ? 0.4816 0.3262 0.7377 -0.0639 -0.0524 0.0073  177 DA  D N7    
2718 C C5    . DA  D 8   ? 0.4614 0.3117 0.7064 -0.0581 -0.0647 0.0172  177 DA  D C5    
2719 C C6    . DA  D 8   ? 0.4351 0.3011 0.6600 -0.0553 -0.0877 0.0187  177 DA  D C6    
2720 N N6    . DA  D 8   ? 0.3416 0.2146 0.5598 -0.0601 -0.1047 0.0115  177 DA  D N6    
2721 N N1    . DA  D 8   ? 0.3542 0.2298 0.5689 -0.0468 -0.0924 0.0279  177 DA  D N1    
2722 C C2    . DA  D 8   ? 0.3641 0.2339 0.5927 -0.0434 -0.0759 0.0405  177 DA  D C2    
2723 N N3    . DA  D 8   ? 0.4897 0.3390 0.7435 -0.0469 -0.0555 0.0413  177 DA  D N3    
2724 C C4    . DA  D 8   ? 0.4879 0.3277 0.7466 -0.0535 -0.0507 0.0263  177 DA  D C4    
2725 P P     . DA  D 9   ? 0.5434 0.3032 0.9700 -0.0224 0.0374  0.0510  178 DA  D P     
2726 O OP1   . DA  D 9   ? 0.5870 0.3327 1.0417 -0.0195 0.0490  0.0577  178 DA  D OP1   
2727 O OP2   . DA  D 9   ? 0.5477 0.3052 0.9816 -0.0185 0.0462  0.0329  178 DA  D OP2   
2728 O "O5'" . DA  D 9   ? 0.5271 0.3125 0.9601 -0.0132 0.0202  0.0893  178 DA  D "O5'" 
2729 C "C5'" . DA  D 9   ? 0.4992 0.2979 0.9151 -0.0166 0.0078  0.1075  178 DA  D "C5'" 
2730 C "C4'" . DA  D 9   ? 0.4731 0.3142 0.8724 -0.0060 -0.0117 0.1309  178 DA  D "C4'" 
2731 O "O4'" . DA  D 9   ? 0.4084 0.2618 0.7673 -0.0129 -0.0276 0.1075  178 DA  D "O4'" 
2732 C "C3'" . DA  D 9   ? 0.4908 0.3472 0.9274 0.0100  -0.0099 0.1562  178 DA  D "C3'" 
2733 O "O3'" . DA  D 9   ? 0.5144 0.4081 0.9514 0.0206  -0.0224 0.1914  178 DA  D "O3'" 
2734 C "C2'" . DA  D 9   ? 0.4558 0.3238 0.8749 0.0078  -0.0201 0.1373  178 DA  D "C2'" 
2735 C "C1'" . DA  D 9   ? 0.4283 0.3047 0.7959 -0.0039 -0.0380 0.1177  178 DA  D "C1'" 
2736 N N9    . DA  D 9   ? 0.4068 0.2808 0.7567 -0.0132 -0.0442 0.0926  178 DA  D N9    
2737 C C8    . DA  D 9   ? 0.4033 0.2632 0.7698 -0.0162 -0.0294 0.0784  178 DA  D C8    
2738 N N7    . DA  D 9   ? 0.3812 0.2494 0.7283 -0.0254 -0.0395 0.0632  178 DA  D N7    
2739 C C5    . DA  D 9   ? 0.3732 0.2555 0.6916 -0.0284 -0.0634 0.0644  178 DA  D C5    
2740 C C6    . DA  D 9   ? 0.3756 0.2675 0.6707 -0.0371 -0.0843 0.0529  178 DA  D C6    
2741 N N6    . DA  D 9   ? 0.3917 0.2843 0.6898 -0.0463 -0.0844 0.0435  178 DA  D N6    
2742 N N1    . DA  D 9   ? 0.3646 0.2671 0.6358 -0.0350 -0.1049 0.0524  178 DA  D N1    
2743 C C2    . DA  D 9   ? 0.3613 0.2718 0.6285 -0.0250 -0.1034 0.0655  178 DA  D C2    
2744 N N3    . DA  D 9   ? 0.3713 0.2775 0.6607 -0.0177 -0.0850 0.0830  178 DA  D N3    
2745 C C4    . DA  D 9   ? 0.3862 0.2744 0.7027 -0.0200 -0.0659 0.0804  178 DA  D C4    
2746 P P     . DT  D 10  ? 0.5333 0.4548 1.0089 0.0378  -0.0248 0.2264  179 DT  D P     
2747 O OP1   . DT  D 10  ? 0.5665 0.5162 1.0556 0.0472  -0.0271 0.2680  179 DT  D OP1   
2748 O OP2   . DT  D 10  ? 0.5657 0.4577 1.0856 0.0420  -0.0052 0.2192  179 DT  D OP2   
2749 O "O5'" . DT  D 10  ? 0.4952 0.4527 0.9361 0.0374  -0.0508 0.2170  179 DT  D "O5'" 
2750 C "C5'" . DT  D 10  ? 0.4971 0.4922 0.8990 0.0391  -0.0728 0.2234  179 DT  D "C5'" 
2751 C "C4'" . DT  D 10  ? 0.4991 0.5114 0.8706 0.0341  -0.0974 0.2004  179 DT  D "C4'" 
2752 O "O4'" . DT  D 10  ? 0.4767 0.4544 0.8406 0.0209  -0.0917 0.1673  179 DT  D "O4'" 
2753 C "C3'" . DT  D 10  ? 0.5460 0.5875 0.9444 0.0414  -0.1095 0.2180  179 DT  D "C3'" 
2754 O "O3'" . DT  D 10  ? 0.6421 0.7326 1.0244 0.0503  -0.1312 0.2374  179 DT  D "O3'" 
2755 C "C2'" . DT  D 10  ? 0.5079 0.5387 0.8939 0.0291  -0.1222 0.1870  179 DT  D "C2'" 
2756 C "C1'" . DT  D 10  ? 0.4866 0.4813 0.8415 0.0170  -0.1136 0.1561  179 DT  D "C1'" 
2757 N N1    . DT  D 10  ? 0.4926 0.4613 0.8564 0.0060  -0.1045 0.1352  179 DT  D N1    
2758 C C2    . DT  D 10  ? 0.5157 0.4814 0.8543 -0.0059 -0.1216 0.1116  179 DT  D C2    
2759 O O2    . DT  D 10  ? 0.5349 0.5123 0.8444 -0.0071 -0.1440 0.1022  179 DT  D O2    
2760 N N3    . DT  D 10  ? 0.4995 0.4492 0.8494 -0.0154 -0.1110 0.0994  179 DT  D N3    
2761 C C4    . DT  D 10  ? 0.4682 0.4068 0.8475 -0.0125 -0.0848 0.1034  179 DT  D C4    
2762 O O4    . DT  D 10  ? 0.4473 0.3801 0.8311 -0.0204 -0.0760 0.0915  179 DT  D O4    
2763 C C5    . DT  D 10  ? 0.4826 0.4194 0.8890 0.0015  -0.0682 0.1232  179 DT  D C5    
2764 C C7    . DT  D 10  ? 0.5069 0.4282 0.9500 0.0083  -0.0390 0.1241  179 DT  D C7    
2765 C C6    . DT  D 10  ? 0.4939 0.4456 0.8937 0.0093  -0.0791 0.1408  179 DT  D C6    
2766 P P     . DG  D 11  ? 0.6343 0.5160 0.6760 -0.0835 0.0826  -0.1083 180 DG  D P     
2767 O OP1   . DG  D 11  ? 0.6729 0.5680 0.7227 -0.0735 0.0834  -0.0932 180 DG  D OP1   
2768 O OP2   . DG  D 11  ? 0.6801 0.5219 0.7102 -0.0705 0.1137  -0.0949 180 DG  D OP2   
2769 O "O5'" . DG  D 11  ? 0.5383 0.4727 0.6021 -0.0819 0.0423  -0.1095 180 DG  D "O5'" 
2770 C "C5'" . DG  D 11  ? 0.4604 0.4339 0.5379 -0.0919 0.0130  -0.1205 180 DG  D "C5'" 
2771 C "C4'" . DG  D 11  ? 0.4004 0.4083 0.4858 -0.0820 -0.0138 -0.1103 180 DG  D "C4'" 
2772 O "O4'" . DG  D 11  ? 0.3919 0.3849 0.4606 -0.0827 -0.0113 -0.1126 180 DG  D "O4'" 
2773 C "C3'" . DG  D 11  ? 0.4018 0.4340 0.5132 -0.0699 -0.0192 -0.0975 180 DG  D "C3'" 
2774 O "O3'" . DG  D 11  ? 0.4116 0.4765 0.5277 -0.0666 -0.0413 -0.0901 180 DG  D "O3'" 
2775 C "C2'" . DG  D 11  ? 0.3990 0.4080 0.5022 -0.0636 -0.0076 -0.0941 180 DG  D "C2'" 
2776 C "C1'" . DG  D 11  ? 0.3701 0.3723 0.4550 -0.0766 -0.0161 -0.1102 180 DG  D "C1'" 
2777 N N9    . DG  D 11  ? 0.3676 0.3418 0.4373 -0.0805 -0.0019 -0.1174 180 DG  D N9    
2778 C C8    . DG  D 11  ? 0.4093 0.3371 0.4635 -0.0866 0.0301  -0.1247 180 DG  D C8    
2779 N N7    . DG  D 11  ? 0.4217 0.3342 0.4593 -0.0887 0.0375  -0.1276 180 DG  D N7    
2780 C C5    . DG  D 11  ? 0.3930 0.3431 0.4386 -0.0840 0.0082  -0.1232 180 DG  D C5    
2781 C C6    . DG  D 11  ? 0.3917 0.3449 0.4275 -0.0841 0.0025  -0.1238 180 DG  D C6    
2782 O O6    . DG  D 11  ? 0.4135 0.3423 0.4318 -0.0902 0.0195  -0.1305 180 DG  D O6    
2783 N N1    . DG  D 11  ? 0.3704 0.3556 0.4159 -0.0762 -0.0216 -0.1138 180 DG  D N1    
2784 C C2    . DG  D 11  ? 0.3744 0.3817 0.4322 -0.0695 -0.0347 -0.1028 180 DG  D C2    
2785 N N2    . DG  D 11  ? 0.3878 0.4122 0.4475 -0.0634 -0.0462 -0.0923 180 DG  D N2    
2786 N N3    . DG  D 11  ? 0.3597 0.3687 0.4254 -0.0700 -0.0323 -0.1024 180 DG  D N3    
2787 C C4    . DG  D 11  ? 0.3653 0.3479 0.4274 -0.0775 -0.0126 -0.1143 180 DG  D C4    
2788 P P     . DA  D 12  ? 0.4105 0.5153 0.5524 -0.0578 -0.0514 -0.0773 181 DA  D P     
2789 O OP1   . DA  D 12  ? 0.4295 0.5411 0.5525 -0.0579 -0.0584 -0.0634 181 DA  D OP1   
2790 O OP2   . DA  D 12  ? 0.4440 0.5485 0.5909 -0.0420 -0.0343 -0.0567 181 DA  D OP2   
2791 O "O5'" . DA  D 12  ? 0.3393 0.4346 0.4749 -0.0535 -0.0531 -0.0755 181 DA  D "O5'" 
2792 C "C5'" . DA  D 12  ? 0.2976 0.3810 0.4067 -0.0532 -0.0558 -0.0676 181 DA  D "C5'" 
2793 C "C4'" . DA  D 12  ? 0.3074 0.3861 0.4183 -0.0494 -0.0555 -0.0692 181 DA  D "C4'" 
2794 O "O4'" . DA  D 12  ? 0.3146 0.3767 0.4296 -0.0520 -0.0498 -0.0826 181 DA  D "O4'" 
2795 C "C3'" . DA  D 12  ? 0.3620 0.4636 0.4934 -0.0441 -0.0584 -0.0629 181 DA  D "C3'" 
2796 O "O3'" . DA  D 12  ? 0.3914 0.4915 0.5106 -0.0446 -0.0589 -0.0560 181 DA  D "O3'" 
2797 C "C2'" . DA  D 12  ? 0.3665 0.4631 0.5191 -0.0404 -0.0562 -0.0720 181 DA  D "C2'" 
2798 C "C1'" . DA  D 12  ? 0.3626 0.4263 0.4924 -0.0476 -0.0501 -0.0845 181 DA  D "C1'" 
2799 N N9    . DA  D 12  ? 0.3969 0.4304 0.5209 -0.0458 -0.0319 -0.0860 181 DA  D N9    
2800 C C8    . DA  D 12  ? 0.4221 0.4389 0.5401 -0.0389 -0.0129 -0.0743 181 DA  D C8    
2801 N N7    . DA  D 12  ? 0.4636 0.4407 0.5643 -0.0348 0.0117  -0.0711 181 DA  D N7    
2802 C C5    . DA  D 12  ? 0.4572 0.4287 0.5513 -0.0411 0.0053  -0.0826 181 DA  D C5    
2803 C C6    . DA  D 12  ? 0.4892 0.4258 0.5638 -0.0431 0.0231  -0.0872 181 DA  D C6    
2804 N N6    . DA  D 12  ? 0.5382 0.4322 0.5961 -0.0395 0.0553  -0.0816 181 DA  D N6    
2805 N N1    . DA  D 12  ? 0.4769 0.4221 0.5485 -0.0489 0.0098  -0.0972 181 DA  D N1    
2806 C C2    . DA  D 12  ? 0.4430 0.4251 0.5313 -0.0505 -0.0165 -0.1008 181 DA  D C2    
2807 N N3    . DA  D 12  ? 0.4080 0.4201 0.5155 -0.0498 -0.0321 -0.0985 181 DA  D N3    
2808 C C4    . DA  D 12  ? 0.4183 0.4250 0.5272 -0.0461 -0.0215 -0.0901 181 DA  D C4    
2809 P P     . DA  D 13  ? 0.4000 0.5223 0.5323 -0.0436 -0.0604 -0.0481 182 DA  D P     
2810 O OP1   . DA  D 13  ? 0.4537 0.5713 0.5780 -0.0472 -0.0593 -0.0499 182 DA  D OP1   
2811 O OP2   . DA  D 13  ? 0.4142 0.5679 0.5670 -0.0412 -0.0632 -0.0401 182 DA  D OP2   
2812 O "O5'" . DA  D 13  ? 0.3385 0.4555 0.4818 -0.0374 -0.0589 -0.0540 182 DA  D "O5'" 
2813 C "C5'" . DA  D 13  ? 0.3064 0.4032 0.4376 -0.0368 -0.0570 -0.0594 182 DA  D "C5'" 
2814 C "C4'" . DA  D 13  ? 0.2908 0.3807 0.4345 -0.0316 -0.0570 -0.0660 182 DA  D "C4'" 
2815 O "O4'" . DA  D 13  ? 0.3000 0.3853 0.4554 -0.0314 -0.0569 -0.0722 182 DA  D "O4'" 
2816 C "C3'" . DA  D 13  ? 0.2786 0.3847 0.4429 -0.0278 -0.0564 -0.0619 182 DA  D "C3'" 
2817 O "O3'" . DA  D 13  ? 0.2684 0.3628 0.4308 -0.0263 -0.0550 -0.0664 182 DA  D "O3'" 
2818 C "C2'" . DA  D 13  ? 0.2976 0.4087 0.4866 -0.0205 -0.0542 -0.0597 182 DA  D "C2'" 
2819 C "C1'" . DA  D 13  ? 0.3389 0.4179 0.5052 -0.0236 -0.0499 -0.0674 182 DA  D "C1'" 
2820 N N9    . DA  D 13  ? 0.4201 0.4829 0.5784 -0.0154 -0.0338 -0.0552 182 DA  D N9    
2821 C C8    . DA  D 13  ? 0.4477 0.5279 0.6139 -0.0109 -0.0310 -0.0437 182 DA  D C8    
2822 N N7    . DA  D 13  ? 0.4846 0.5393 0.6406 0.0000  -0.0097 -0.0307 182 DA  D N7    
2823 C C5    . DA  D 13  ? 0.5007 0.5177 0.6400 -0.0004 0.0022  -0.0371 182 DA  D C5    
2824 C C6    . DA  D 13  ? 0.5807 0.5533 0.7017 0.0061  0.0298  -0.0314 182 DA  D C6    
2825 N N6    . DA  D 13  ? 0.6420 0.5974 0.7599 0.0181  0.0535  -0.0148 182 DA  D N6    
2826 N N1    . DA  D 13  ? 0.5925 0.5376 0.6971 0.0001  0.0354  -0.0427 182 DA  D N1    
2827 C C2    . DA  D 13  ? 0.5446 0.5075 0.6522 -0.0084 0.0141  -0.0554 182 DA  D C2    
2828 N N3    . DA  D 13  ? 0.4992 0.4995 0.6246 -0.0124 -0.0097 -0.0597 182 DA  D N3    
2829 C C4    . DA  D 13  ? 0.4765 0.5014 0.6169 -0.0097 -0.0143 -0.0516 182 DA  D C4    
2830 P P     . DT  D 14  ? 0.2625 0.3706 0.4428 -0.0250 -0.0518 -0.0638 183 DT  D P     
2831 O OP1   . DT  D 14  ? 0.3022 0.3973 0.4779 -0.0257 -0.0493 -0.0698 183 DT  D OP1   
2832 O OP2   . DT  D 14  ? 0.2711 0.4080 0.4562 -0.0292 -0.0512 -0.0542 183 DT  D OP2   
2833 O "O5'" . DT  D 14  ? 0.1959 0.2998 0.3957 -0.0165 -0.0497 -0.0625 183 DT  D "O5'" 
2834 C "C5'" . DT  D 14  ? 0.1966 0.2662 0.3737 -0.0133 -0.0462 -0.0664 183 DT  D "C5'" 
2835 C "C4'" . DT  D 14  ? 0.2347 0.2821 0.4021 -0.0033 -0.0315 -0.0557 183 DT  D "C4'" 
2836 O "O4'" . DT  D 14  ? 0.2288 0.2686 0.3898 -0.0004 -0.0235 -0.0491 183 DT  D "O4'" 
2837 C "C3'" . DT  D 14  ? 0.2766 0.3391 0.4623 0.0048  -0.0243 -0.0434 183 DT  D "C3'" 
2838 O "O3'" . DT  D 14  ? 0.3142 0.3502 0.4885 0.0097  -0.0157 -0.0435 183 DT  D "O3'" 
2839 C "C2'" . DT  D 14  ? 0.2637 0.3329 0.4546 0.0148  -0.0137 -0.0267 183 DT  D "C2'" 
2840 C "C1'" . DT  D 14  ? 0.2655 0.2996 0.4315 0.0126  -0.0076 -0.0325 183 DT  D "C1'" 
2841 N N1    . DT  D 14  ? 0.3289 0.3656 0.4969 0.0200  0.0026  -0.0194 183 DT  D N1    
2842 C C2    . DT  D 14  ? 0.4225 0.4189 0.5724 0.0273  0.0258  -0.0129 183 DT  D C2    
2843 O O2    . DT  D 14  ? 0.4699 0.4309 0.6014 0.0255  0.0372  -0.0195 183 DT  D O2    
2844 N N3    . DT  D 14  ? 0.4720 0.4699 0.6251 0.0367  0.0386  0.0021  183 DT  D N3    
2845 C C4    . DT  D 14  ? 0.4660 0.5064 0.6374 0.0392  0.0273  0.0115  183 DT  D C4    
2846 O O4    . DT  D 14  ? 0.5167 0.5561 0.6886 0.0504  0.0416  0.0279  183 DT  D O4    
2847 C C5    . DT  D 14  ? 0.3808 0.4652 0.5690 0.0276  0.0007  0.0011  183 DT  D C5    
2848 C C7    . DT  D 14  ? 0.3298 0.4643 0.5355 0.0252  -0.0124 0.0073  183 DT  D C7    
2849 C C6    . DT  D 14  ? 0.3518 0.4293 0.5377 0.0187  -0.0085 -0.0140 183 DT  D C6    
2850 P P     . DG  D 15  ? 0.2619 0.3060 0.4517 0.0177  -0.0057 -0.0327 184 DG  D P     
2851 O OP1   . DG  D 15  ? 0.2757 0.3134 0.4648 0.0138  -0.0081 -0.0417 184 DG  D OP1   
2852 O OP2   . DG  D 15  ? 0.2647 0.3509 0.4801 0.0198  -0.0062 -0.0212 184 DG  D OP2   
2853 O "O5'" . DG  D 15  ? 0.2887 0.2948 0.4593 0.0279  0.0120  -0.0248 184 DG  D "O5'" 
2854 C "C5'" . DG  D 15  ? 0.3306 0.3168 0.4861 0.0297  0.0206  -0.0222 184 DG  D "C5'" 
2855 C "C4'" . DG  D 15  ? 0.3774 0.3188 0.5090 0.0341  0.0414  -0.0208 184 DG  D "C4'" 
2856 O "O4'" . DG  D 15  ? 0.4142 0.3328 0.5337 0.0362  0.0578  -0.0165 184 DG  D "O4'" 
2857 C "C3'" . DG  D 15  ? 0.3661 0.3041 0.5092 0.0473  0.0566  -0.0060 184 DG  D "C3'" 
2858 O "O3'" . DG  D 15  ? 0.3991 0.2942 0.5156 0.0459  0.0716  -0.0119 184 DG  D "O3'" 
2859 C "C2'" . DG  D 15  ? 0.2605 0.2067 0.4177 0.0612  0.0721  0.0146  184 DG  D "C2'" 
2860 C "C1'" . DG  D 15  ? 0.4178 0.3379 0.5530 0.0540  0.0772  0.0063  184 DG  D "C1'" 
2861 N N9    . DG  D 15  ? 0.2665 0.2164 0.4191 0.0604  0.0741  0.0189  184 DG  D N9    
2862 C C8    . DG  D 15  ? 0.2313 0.2365 0.4104 0.0596  0.0529  0.0234  184 DG  D C8    
2863 N N7    . DG  D 15  ? 0.2307 0.2553 0.4183 0.0660  0.0550  0.0358  184 DG  D N7    
2864 C C5    . DG  D 15  ? 0.2693 0.2433 0.4350 0.0723  0.0813  0.0401  184 DG  D C5    
2865 C C6    . DG  D 15  ? 0.4094 0.3727 0.5717 0.0821  0.0989  0.0541  184 DG  D C6    
2866 O O6    . DG  D 15  ? 0.3746 0.3770 0.5531 0.0887  0.0915  0.0676  184 DG  D O6    
2867 N N1    . DG  D 15  ? 0.4914 0.3903 0.6266 0.0830  0.1308  0.0510  184 DG  D N1    
2868 C C2    . DG  D 15  ? 0.5561 0.4117 0.6691 0.0735  0.1417  0.0353  184 DG  D C2    
2869 N N2    . DG  D 15  ? 0.6332 0.4279 0.7185 0.0711  0.1766  0.0311  184 DG  D N2    
2870 N N3    . DG  D 15  ? 0.5424 0.4123 0.6582 0.0659  0.1225  0.0240  184 DG  D N3    
2871 C C4    . DG  D 15  ? 0.2925 0.2200 0.4359 0.0668  0.0937  0.0278  184 DG  D C4    
2872 P P     . DA  D 16  ? 0.4976 0.3463 0.4883 -0.0099 0.1184  -0.0147 185 DA  D P     
2873 O OP1   . DA  D 16  ? 0.5404 0.4498 0.5411 0.0197  0.1655  -0.0041 185 DA  D OP1   
2874 O OP2   . DA  D 16  ? 0.5608 0.3749 0.5791 -0.0450 0.0923  -0.0027 185 DA  D OP2   
2875 O "O5'" . DA  D 16  ? 0.4192 0.3126 0.4569 0.0055  0.0952  -0.0365 185 DA  D "O5'" 
2876 C "C5'" . DA  D 16  ? 0.3817 0.3283 0.4215 0.0398  0.1173  -0.0571 185 DA  D "C5'" 
2877 C "C4'" . DA  D 16  ? 0.3810 0.3596 0.4790 0.0488  0.0914  -0.0789 185 DA  D "C4'" 
2878 O "O4'" . DA  D 16  ? 0.4119 0.3140 0.4821 0.0245  0.0534  -0.0782 185 DA  D "O4'" 
2879 C "C3'" . DA  D 16  ? 0.3757 0.4181 0.5646 0.0513  0.0797  -0.0754 185 DA  D "C3'" 
2880 O "O3'" . DA  D 16  ? 0.3831 0.4755 0.5963 0.0687  0.0681  -0.0892 185 DA  D "O3'" 
2881 C "C2'" . DA  D 16  ? 0.3935 0.3741 0.5866 0.0183  0.0356  -0.0629 185 DA  D "C2'" 
2882 C "C1'" . DA  D 16  ? 0.4175 0.3296 0.5502 0.0131  0.0189  -0.0721 185 DA  D "C1'" 
2883 N N9    . DA  D 16  ? 0.4747 0.3104 0.5650 -0.0179 -0.0147 -0.0567 185 DA  D N9    
2884 C C8    . DA  D 16  ? 0.5008 0.3103 0.5768 -0.0431 -0.0217 -0.0405 185 DA  D C8    
2885 N N7    . DA  D 16  ? 0.5363 0.2868 0.5737 -0.0656 -0.0556 -0.0348 185 DA  D N7    
2886 C C5    . DA  D 16  ? 0.5383 0.2868 0.5588 -0.0513 -0.0634 -0.0395 185 DA  D C5    
2887 C C6    . DA  D 16  ? 0.5665 0.2949 0.5515 -0.0548 -0.0836 -0.0306 185 DA  D C6    
2888 N N6    . DA  D 16  ? 0.6106 0.3190 0.5646 -0.0707 -0.1054 -0.0201 185 DA  D N6    
2889 N N1    . DA  D 16  ? 0.5411 0.2708 0.5283 -0.0403 -0.0817 -0.0340 185 DA  D N1    
2890 C C2    . DA  D 16  ? 0.5061 0.2624 0.5282 -0.0222 -0.0608 -0.0504 185 DA  D C2    
2891 N N3    . DA  D 16  ? 0.4780 0.2673 0.5389 -0.0106 -0.0431 -0.0657 185 DA  D N3    
2892 C C4    . DA  D 16  ? 0.4976 0.2787 0.5570 -0.0264 -0.0448 -0.0569 185 DA  D C4    
2893 P P     . DA  D 17  ? 0.3640 0.5174 0.6460 0.0727  0.0548  -0.0875 186 DA  D P     
2894 O OP1   . DA  D 17  ? 0.3964 0.5770 0.6378 0.0877  0.0629  -0.0771 186 DA  D OP1   
2895 O OP2   . DA  D 17  ? 0.4177 0.5973 0.7497 0.0643  0.0648  -0.0733 186 DA  D OP2   
2896 O "O5'" . DA  D 17  ? 0.2969 0.4226 0.6398 0.0645  0.0163  -0.1058 186 DA  D "O5'" 
2897 C "C5'" . DA  D 17  ? 0.1831 0.2814 0.4994 0.0662  0.0068  -0.1185 186 DA  D "C5'" 
2898 C "C4'" . DA  D 17  ? 0.2952 0.3512 0.6638 0.0610  -0.0334 -0.1230 186 DA  D "C4'" 
2899 O "O4'" . DA  D 17  ? 0.3259 0.3083 0.6439 0.0387  -0.0506 -0.1005 186 DA  D "O4'" 
2900 C "C3'" . DA  D 17  ? 0.3170 0.4077 0.7518 0.0599  -0.0571 -0.1214 186 DA  D "C3'" 
2901 O "O3'" . DA  D 17  ? 0.3592 0.4385 0.8085 0.0625  -0.0710 -0.1321 186 DA  D "O3'" 
2902 C "C2'" . DA  D 17  ? 0.3123 0.3678 0.7658 0.0425  -0.0935 -0.1003 186 DA  D "C2'" 
2903 C "C1'" . DA  D 17  ? 0.3427 0.3100 0.6944 0.0251  -0.0919 -0.0867 186 DA  D "C1'" 
2904 N N9    . DA  D 17  ? 0.3693 0.2996 0.6744 -0.0030 -0.1005 -0.0656 186 DA  D N9    
2905 C C8    . DA  D 17  ? 0.3482 0.3078 0.6576 -0.0117 -0.0771 -0.0591 186 DA  D C8    
2906 N N7    . DA  D 17  ? 0.3746 0.2875 0.6455 -0.0396 -0.0909 -0.0444 186 DA  D N7    
2907 C C5    . DA  D 17  ? 0.3621 0.2169 0.5942 -0.0477 -0.1271 -0.0408 186 DA  D C5    
2908 C C6    . DA  D 17  ? 0.4134 0.2111 0.5936 -0.0720 -0.1569 -0.0303 186 DA  D C6    
2909 N N6    . DA  D 17  ? 0.5080 0.2991 0.6706 -0.0937 -0.1521 -0.0259 186 DA  D N6    
2910 N N1    . DA  D 17  ? 0.4435 0.2100 0.5855 -0.0659 -0.1814 -0.0227 186 DA  D N1    
2911 C C2    . DA  D 17  ? 0.5091 0.2803 0.6756 -0.0446 -0.1817 -0.0269 186 DA  D C2    
2912 N N3    . DA  D 17  ? 0.4637 0.2761 0.6896 -0.0248 -0.1599 -0.0438 186 DA  D N3    
2913 C C4    . DA  D 17  ? 0.3468 0.2080 0.5982 -0.0254 -0.1320 -0.0499 186 DA  D C4    
2914 P P     . DT  D 18  ? 0.3768 0.4817 0.8760 0.0655  -0.0883 -0.1348 187 DT  D P     
2915 O OP1   . DT  D 18  ? 0.3922 0.4954 0.8959 0.0701  -0.0846 -0.1513 187 DT  D OP1   
2916 O OP2   . DT  D 18  ? 0.3937 0.5528 0.8954 0.0668  -0.0711 -0.1286 187 DT  D OP2   
2917 O "O5'" . DT  D 18  ? 0.3965 0.4581 0.9312 0.0585  -0.1352 -0.1176 187 DT  D "O5'" 
2918 C "C5'" . DT  D 18  ? 0.2822 0.2896 0.8166 0.0582  -0.1613 -0.1108 187 DT  D "C5'" 
2919 C "C4'" . DT  D 18  ? 0.4082 0.3744 0.9455 0.0508  -0.2102 -0.0835 187 DT  D "C4'" 
2920 O "O4'" . DT  D 18  ? 0.3235 0.2750 0.8102 0.0322  -0.2090 -0.0704 187 DT  D "O4'" 
2921 C "C3'" . DT  D 18  ? 0.4759 0.4713 1.0557 0.0509  -0.2298 -0.0819 187 DT  D "C3'" 
2922 O "O3'" . DT  D 18  ? 0.5258 0.4897 1.1214 0.0568  -0.2589 -0.0726 187 DT  D "O3'" 
2923 C "C2'" . DT  D 18  ? 0.4744 0.4694 1.0381 0.0328  -0.2525 -0.0651 187 DT  D "C2'" 
2924 C "C1'" . DT  D 18  ? 0.3600 0.3016 0.8494 0.0178  -0.2485 -0.0538 187 DT  D "C1'" 
2925 N N1    . DT  D 18  ? 0.3990 0.3413 0.8496 -0.0079 -0.2382 -0.0486 187 DT  D N1    
2926 C C2    . DT  D 18  ? 0.4404 0.3302 0.8285 -0.0300 -0.2642 -0.0328 187 DT  D C2    
2927 O O2    . DT  D 18  ? 0.4816 0.3260 0.8353 -0.0278 -0.2947 -0.0192 187 DT  D O2    
2928 N N3    . DT  D 18  ? 0.4182 0.3117 0.7861 -0.0537 -0.2513 -0.0334 187 DT  D N3    
2929 C C4    . DT  D 18  ? 0.3795 0.3197 0.7815 -0.0567 -0.2140 -0.0412 187 DT  D C4    
2930 O O4    . DT  D 18  ? 0.3910 0.3249 0.7774 -0.0792 -0.2021 -0.0383 187 DT  D O4    
2931 C C5    . DT  D 18  ? 0.3284 0.3275 0.7888 -0.0304 -0.1886 -0.0532 187 DT  D C5    
2932 C C7    . DT  D 18  ? 0.2890 0.3493 0.7850 -0.0272 -0.1459 -0.0578 187 DT  D C7    
2933 C C6    . DT  D 18  ? 0.3216 0.3214 0.8054 -0.0079 -0.2030 -0.0598 187 DT  D C6    
2934 P P     . DG  D 19  ? 0.5508 0.5325 1.1830 0.0600  -0.2884 -0.0667 188 DG  D P     
2935 O OP1   . DG  D 19  ? 0.6053 0.5679 1.2639 0.0718  -0.3008 -0.0646 188 DG  D OP1   
2936 O OP2   . DG  D 19  ? 0.5089 0.5530 1.1659 0.0595  -0.2648 -0.0835 188 DG  D OP2   
2937 O "O5'" . DG  D 19  ? 0.5822 0.5297 1.1744 0.0470  -0.3297 -0.0400 188 DG  D "O5'" 
2938 C "C5'" . DG  D 19  ? 0.6471 0.5306 1.1825 0.0438  -0.3514 -0.0161 188 DG  D "C5'" 
2939 C "C4'" . DG  D 19  ? 0.7368 0.5994 1.2269 0.0313  -0.3925 0.0048  188 DG  D "C4'" 
2940 O "O4'" . DG  D 19  ? 0.7268 0.6088 1.1962 0.0084  -0.3842 -0.0043 188 DG  D "O4'" 
2941 C "C3'" . DG  D 19  ? 0.8121 0.7063 1.3402 0.0385  -0.4177 0.0046  188 DG  D "C3'" 
2942 O "O3'" . DG  D 19  ? 0.9188 0.7807 1.3927 0.0362  -0.4560 0.0280  188 DG  D "O3'" 
2943 C "C2'" . DG  D 19  ? 0.7710 0.7216 1.3296 0.0254  -0.4026 -0.0160 188 DG  D "C2'" 
2944 C "C1'" . DG  D 19  ? 0.7426 0.6703 1.2456 0.0025  -0.3919 -0.0134 188 DG  D "C1'" 
2945 N N9    . DG  D 19  ? 0.6986 0.6723 1.2298 -0.0084 -0.3540 -0.0312 188 DG  D N9    
2946 C C8    . DG  D 19  ? 0.6563 0.6715 1.2336 0.0048  -0.3167 -0.0464 188 DG  D C8    
2947 N N7    . DG  D 19  ? 0.6311 0.6847 1.2211 -0.0076 -0.2876 -0.0547 188 DG  D N7    
2948 C C5    . DG  D 19  ? 0.6560 0.6882 1.2120 -0.0331 -0.3050 -0.0474 188 DG  D C5    
2949 C C6    . DG  D 19  ? 0.6616 0.7116 1.2190 -0.0575 -0.2849 -0.0510 188 DG  D C6    
2950 O O6    . DG  D 19  ? 0.6270 0.7191 1.2198 -0.0603 -0.2491 -0.0564 188 DG  D O6    
2951 N N1    . DG  D 19  ? 0.7073 0.7218 1.2195 -0.0795 -0.3081 -0.0473 188 DG  D N1    
2952 C C2    . DG  D 19  ? 0.7401 0.7139 1.2065 -0.0760 -0.3476 -0.0391 188 DG  D C2    
2953 N N2    . DG  D 19  ? 0.7865 0.7394 1.2101 -0.0968 -0.3628 -0.0411 188 DG  D N2    
2954 N N3    . DG  D 19  ? 0.7336 0.6904 1.1986 -0.0530 -0.3693 -0.0298 188 DG  D N3    
2955 C C4    . DG  D 19  ? 0.6967 0.6818 1.2110 -0.0334 -0.3454 -0.0353 188 DG  D C4    
2956 P P     . DG  D 20  ? 0.9895 0.8769 1.4920 0.0517  -0.4880 0.0339  189 DG  D P     
2957 O OP1   . DG  D 20  ? 1.0705 0.9220 1.4984 0.0520  -0.5198 0.0605  189 DG  D OP1   
2958 O OP2   . DG  D 20  ? 0.9805 0.8798 1.5450 0.0724  -0.4754 0.0291  189 DG  D OP2   
2959 O "O5'" . DG  D 20  ? 0.9531 0.9040 1.4966 0.0394  -0.4870 0.0083  189 DG  D "O5'" 
2960 C "C5'" . DG  D 20  ? 1.0051 0.9811 1.5402 0.0374  -0.5197 0.0081  189 DG  D "C5'" 
2961 C "C4'" . DG  D 20  ? 1.0191 0.9849 1.4969 0.0115  -0.5252 0.0049  189 DG  D "C4'" 
2962 O "O4'" . DG  D 20  ? 0.9679 0.9237 1.4418 -0.0072 -0.4882 -0.0046 189 DG  D "O4'" 
2963 C "C3'" . DG  D 20  ? 1.0444 1.0651 1.5457 0.0000  -0.5402 -0.0159 189 DG  D "C3'" 
2964 O "O3'" . DG  D 20  ? 1.1358 1.1491 1.5838 0.0034  -0.5772 -0.0065 189 DG  D "O3'" 
2965 C "C2'" . DG  D 20  ? 1.0062 1.0348 1.5062 -0.0305 -0.5095 -0.0340 189 DG  D "C2'" 
2966 C "C1'" . DG  D 20  ? 0.9652 0.9584 1.4558 -0.0301 -0.4753 -0.0252 189 DG  D "C1'" 
2967 N N9    . DG  D 20  ? 0.9378 0.9732 1.4936 -0.0292 -0.4387 -0.0396 189 DG  D N9    
2968 C C8    . DG  D 20  ? 0.9270 0.9820 1.5312 -0.0069 -0.4257 -0.0417 189 DG  D C8    
2969 N N7    . DG  D 20  ? 0.8924 0.9904 1.5398 -0.0105 -0.3901 -0.0561 189 DG  D N7    
2970 C C5    . DG  D 20  ? 0.8736 0.9786 1.5070 -0.0374 -0.3791 -0.0611 189 DG  D C5    
2971 C C6    . DG  D 20  ? 0.8297 0.9739 1.4958 -0.0528 -0.3427 -0.0712 189 DG  D C6    
2972 O O6    . DG  D 20  ? 0.8077 0.9939 1.5159 -0.0436 -0.3134 -0.0775 189 DG  D O6    
2973 N N1    . DG  D 20  ? 0.8168 0.9474 1.4591 -0.0816 -0.3403 -0.0733 189 DG  D N1    
2974 C C2    . DG  D 20  ? 0.8446 0.9329 1.4310 -0.0932 -0.3687 -0.0702 189 DG  D C2    
2975 N N2    . DG  D 20  ? 0.8465 0.9261 1.4158 -0.1218 -0.3570 -0.0780 189 DG  D N2    
2976 N N3    . DG  D 20  ? 0.8935 0.9503 1.4422 -0.0775 -0.4043 -0.0600 189 DG  D N3    
2977 C C4    . DG  D 20  ? 0.9060 0.9717 1.4840 -0.0501 -0.4077 -0.0539 189 DG  D C4    
2978 P P     . DT  D 21  ? 1.2375 1.2981 1.7141 0.0264  -0.6136 -0.0071 190 DT  D P     
2979 O OP1   . DT  D 21  ? 1.2738 1.3015 1.7391 0.0568  -0.6249 0.0238  190 DT  D OP1   
2980 O OP2   . DT  D 21  ? 1.2039 1.3279 1.7601 0.0198  -0.6028 -0.0361 190 DT  D OP2   
2981 O "O5'" . DT  D 21  ? 1.3302 1.4018 1.7450 0.0177  -0.6429 -0.0110 190 DT  D "O5'" 
2982 C "C5'" . DT  D 21  ? 1.3539 1.3846 1.6996 -0.0047 -0.6326 -0.0101 190 DT  D "C5'" 
2983 C "C4'" . DT  D 21  ? 1.4148 1.3911 1.6770 0.0119  -0.6453 0.0256  190 DT  D "C4'" 
2984 O "O4'" . DT  D 21  ? 1.3967 1.3376 1.6795 0.0331  -0.6343 0.0519  190 DT  D "O4'" 
2985 C "C3'" . DT  D 21  ? 1.4156 1.3387 1.6003 -0.0104 -0.6273 0.0294  190 DT  D "C3'" 
2986 O "O3'" . DT  D 21  ? 1.4750 1.4215 1.6095 -0.0202 -0.6450 0.0152  190 DT  D "O3'" 
2987 C "C2'" . DT  D 21  ? 1.4290 1.2924 1.5630 0.0096  -0.6238 0.0697  190 DT  D "C2'" 
2988 C "C1'" . DT  D 21  ? 1.3945 1.2674 1.6104 0.0287  -0.6172 0.0753  190 DT  D "C1'" 
2989 N N     . SER E 5   ? 0.5060 0.9578 0.4385 0.0714  0.0489  -0.0641 3   SER E N     
2990 C CA    . SER E 5   ? 0.5114 0.9551 0.4340 0.0782  0.0530  -0.0610 3   SER E CA    
2991 C C     . SER E 5   ? 0.5380 0.9745 0.4483 0.0765  0.0629  -0.0589 3   SER E C     
2992 O O     . SER E 5   ? 0.5248 0.9570 0.4322 0.0691  0.0685  -0.0589 3   SER E O     
2993 C CB    . SER E 5   ? 0.5027 0.9312 0.4204 0.0784  0.0551  -0.0586 3   SER E CB    
2994 O OG    . SER E 5   ? 0.5230 0.9376 0.4269 0.0812  0.0632  -0.0552 3   SER E OG    
2995 N N     . PRO E 6   ? 0.5725 1.0079 0.4752 0.0833  0.0652  -0.0572 4   PRO E N     
2996 C CA    . PRO E 6   ? 0.6035 1.0315 0.4929 0.0813  0.0752  -0.0553 4   PRO E CA    
2997 C C     . PRO E 6   ? 0.6495 1.0572 0.5264 0.0753  0.0848  -0.0520 4   PRO E C     
2998 O O     . PRO E 6   ? 0.6716 1.0736 0.5391 0.0703  0.0932  -0.0509 4   PRO E O     
2999 C CB    . PRO E 6   ? 0.5892 1.0181 0.4725 0.0904  0.0747  -0.0540 4   PRO E CB    
3000 C CG    . PRO E 6   ? 0.5776 1.0102 0.4694 0.0969  0.0657  -0.0545 4   PRO E CG    
3001 C CD    . PRO E 6   ? 0.5658 1.0087 0.4721 0.0929  0.0583  -0.0576 4   PRO E CD    
3002 N N     . GLU E 7   ? 0.6690 1.0656 0.5451 0.0754  0.0840  -0.0507 5   GLU E N     
3003 C CA    . GLU E 7   ? 0.6832 1.0603 0.5476 0.0697  0.0927  -0.0479 5   GLU E CA    
3004 C C     . GLU E 7   ? 0.6186 0.9953 0.4880 0.0607  0.0939  -0.0490 5   GLU E C     
3005 O O     . GLU E 7   ? 0.6332 0.9975 0.4924 0.0547  0.1024  -0.0470 5   GLU E O     
3006 C CB    . GLU E 7   ? 0.7579 1.1234 0.6191 0.0735  0.0918  -0.0466 5   GLU E CB    
3007 C CG    . GLU E 7   ? 0.8760 1.2204 0.7233 0.0685  0.1008  -0.0439 5   GLU E CG    
3008 C CD    . GLU E 7   ? 0.9510 1.2834 0.7807 0.0701  0.1089  -0.0411 5   GLU E CD    
3009 O OE1   . GLU E 7   ? 0.9622 1.3002 0.7900 0.0771  0.1068  -0.0410 5   GLU E OE1   
3010 O OE2   . GLU E 7   ? 0.9740 1.2908 0.7911 0.0641  0.1174  -0.0389 5   GLU E OE2   
3011 N N     . ILE E 8   ? 0.5443 0.9337 0.4286 0.0595  0.0855  -0.0521 6   ILE E N     
3012 C CA    . ILE E 8   ? 0.5305 0.9204 0.4198 0.0511  0.0859  -0.0535 6   ILE E CA    
3013 C C     . ILE E 8   ? 0.5293 0.9261 0.4174 0.0470  0.0900  -0.0545 6   ILE E C     
3014 O O     . ILE E 8   ? 0.5316 0.9216 0.4160 0.0397  0.0956  -0.0539 6   ILE E O     
3015 C CB    . ILE E 8   ? 0.5163 0.9187 0.4211 0.0508  0.0756  -0.0570 6   ILE E CB    
3016 C CG1   . ILE E 8   ? 0.5112 0.9048 0.4161 0.0527  0.0733  -0.0560 6   ILE E CG1   
3017 C CG2   . ILE E 8   ? 0.5210 0.9267 0.4317 0.0423  0.0751  -0.0591 6   ILE E CG2   
3018 C CD1   . ILE E 8   ? 0.4926 0.8962 0.4109 0.0512  0.0642  -0.0592 6   ILE E CD1   
3019 N N     . ARG E 9   ? 0.5197 0.9304 0.4108 0.0516  0.0874  -0.0562 7   ARG E N     
3020 C CA    . ARG E 9   ? 0.5148 0.9331 0.4044 0.0478  0.0918  -0.0577 7   ARG E CA    
3021 C C     . ARG E 9   ? 0.5620 0.9639 0.4346 0.0445  0.1038  -0.0538 7   ARG E C     
3022 O O     . ARG E 9   ? 0.5820 0.9817 0.4517 0.0374  0.1096  -0.0539 7   ARG E O     
3023 C CB    . ARG E 9   ? 0.4777 0.9134 0.3727 0.0540  0.0869  -0.0604 7   ARG E CB    
3024 N N     . GLU E 10  ? 0.5768 0.9668 0.4377 0.0494  0.1076  -0.0505 8   GLU E N     
3025 C CA    . GLU E 10  ? 0.6181 0.9900 0.4609 0.0460  0.1188  -0.0466 8   GLU E CA    
3026 C C     . GLU E 10  ? 0.6476 1.0039 0.4861 0.0396  0.1229  -0.0446 8   GLU E C     
3027 O O     . GLU E 10  ? 0.6773 1.0205 0.5026 0.0345  0.1322  -0.0419 8   GLU E O     
3028 C CB    . GLU E 10  ? 0.6286 0.9903 0.4596 0.0529  0.1207  -0.0439 8   GLU E CB    
3029 N N     . LEU E 11  ? 0.6330 0.9904 0.4819 0.0395  0.1164  -0.0459 9   LEU E N     
3030 C CA    . LEU E 11  ? 0.6312 0.9746 0.4769 0.0335  0.1197  -0.0444 9   LEU E CA    
3031 C C     . LEU E 11  ? 0.6381 0.9882 0.4900 0.0258  0.1206  -0.0462 9   LEU E C     
3032 O O     . LEU E 11  ? 0.6606 0.9983 0.5042 0.0199  0.1277  -0.0440 9   LEU E O     
3033 C CB    . LEU E 11  ? 0.6195 0.9619 0.4735 0.0359  0.1126  -0.0455 9   LEU E CB    
3034 C CG    . LEU E 11  ? 0.6214 0.9437 0.4656 0.0343  0.1173  -0.0429 9   LEU E CG    
3035 C CD1   . LEU E 11  ? 0.6382 0.9462 0.4657 0.0378  0.1243  -0.0397 9   LEU E CD1   
3036 C CD2   . LEU E 11  ? 0.5936 0.9187 0.4473 0.0373  0.1097  -0.0447 9   LEU E CD2   
3037 N N     . GLU E 12  ? 0.6276 0.9974 0.4942 0.0259  0.1132  -0.0503 10  GLU E N     
3038 C CA    . GLU E 12  ? 0.6238 1.0019 0.4970 0.0190  0.1134  -0.0528 10  GLU E CA    
3039 C C     . GLU E 12  ? 0.6124 0.9883 0.4756 0.0154  0.1228  -0.0514 10  GLU E C     
3040 O O     . GLU E 12  ? 0.6230 0.9935 0.4833 0.0085  0.1280  -0.0507 10  GLU E O     
3041 C CB    . GLU E 12  ? 0.6464 1.0467 0.5361 0.0206  0.1034  -0.0581 10  GLU E CB    
3042 C CG    . GLU E 12  ? 0.6805 1.0842 0.5808 0.0226  0.0938  -0.0598 10  GLU E CG    
3043 C CD    . GLU E 12  ? 0.7054 1.1300 0.6207 0.0232  0.0842  -0.0652 10  GLU E CD    
3044 O OE1   . GLU E 12  ? 0.7073 1.1446 0.6259 0.0288  0.0809  -0.0670 10  GLU E OE1   
3045 O OE2   . GLU E 12  ? 0.7142 1.1424 0.6377 0.0180  0.0799  -0.0678 10  GLU E OE2   
3046 N N     . LYS E 13  ? 0.5912 0.9717 0.4490 0.0199  0.1252  -0.0511 11  LYS E N     
3047 C CA    . LYS E 13  ? 0.6136 0.9933 0.4615 0.0162  0.1344  -0.0501 11  LYS E CA    
3048 C C     . LYS E 13  ? 0.6594 1.0173 0.4911 0.0115  0.1444  -0.0451 11  LYS E C     
3049 O O     . LYS E 13  ? 0.7106 1.0677 0.5389 0.0050  0.1507  -0.0446 11  LYS E O     
3050 C CB    . LYS E 13  ? 0.6075 0.9925 0.4496 0.0222  0.1357  -0.0500 11  LYS E CB    
3051 C CG    . LYS E 13  ? 0.5509 0.9597 0.4076 0.0256  0.1278  -0.0554 11  LYS E CG    
3052 N N     . PHE E 14  ? 0.6428 0.9833 0.4646 0.0147  0.1459  -0.0415 12  PHE E N     
3053 C CA    . PHE E 14  ? 0.6349 0.9537 0.4406 0.0105  0.1549  -0.0368 12  PHE E CA    
3054 C C     . PHE E 14  ? 0.6388 0.9548 0.4505 0.0042  0.1545  -0.0371 12  PHE E C     
3055 O O     . PHE E 14  ? 0.6440 0.9513 0.4472 -0.0015 0.1620  -0.0346 12  PHE E O     
3056 C CB    . PHE E 14  ? 0.6096 0.9110 0.4040 0.0155  0.1557  -0.0339 12  PHE E CB    
3057 C CG    . PHE E 14  ? 0.6329 0.9110 0.4091 0.0117  0.1648  -0.0292 12  PHE E CG    
3058 C CD1   . PHE E 14  ? 0.6728 0.9392 0.4300 0.0109  0.1735  -0.0258 12  PHE E CD1   
3059 C CD2   . PHE E 14  ? 0.6310 0.8985 0.4081 0.0088  0.1645  -0.0283 12  PHE E CD2   
3060 C CE1   . PHE E 14  ? 0.7050 0.9493 0.4443 0.0074  0.1814  -0.0214 12  PHE E CE1   
3061 C CE2   . PHE E 14  ? 0.6584 0.9045 0.4186 0.0057  0.1725  -0.0241 12  PHE E CE2   
3062 C CZ    . PHE E 14  ? 0.6930 0.9274 0.4342 0.0052  0.1808  -0.0206 12  PHE E CZ    
3063 N N     . ALA E 15  ? 0.6290 0.9520 0.4549 0.0051  0.1457  -0.0399 13  ALA E N     
3064 C CA    . ALA E 15  ? 0.6389 0.9590 0.4704 -0.0011 0.1448  -0.0404 13  ALA E CA    
3065 C C     . ALA E 15  ? 0.6414 0.9730 0.4782 -0.0074 0.1469  -0.0425 13  ALA E C     
3066 O O     . ALA E 15  ? 0.6293 0.9532 0.4625 -0.0135 0.1514  -0.0408 13  ALA E O     
3067 C CB    . ALA E 15  ? 0.6152 0.9429 0.4611 0.0007  0.1346  -0.0437 13  ALA E CB    
3068 N N     . ASN E 16  ? 0.6600 1.0107 0.5057 -0.0060 0.1435  -0.0463 14  ASN E N     
3069 C CA    . ASN E 16  ? 0.6943 1.0573 0.5451 -0.0119 0.1460  -0.0490 14  ASN E CA    
3070 C C     . ASN E 16  ? 0.7183 1.0720 0.5538 -0.0151 0.1575  -0.0451 14  ASN E C     
3071 O O     . ASN E 16  ? 0.6971 1.0500 0.5316 -0.0218 0.1622  -0.0447 14  ASN E O     
3072 C CB    . ASN E 16  ? 0.7182 1.1041 0.5818 -0.0091 0.1394  -0.0547 14  ASN E CB    
3073 C CG    . ASN E 16  ? 0.7422 1.1377 0.6205 -0.0063 0.1277  -0.0584 14  ASN E CG    
3074 O OD1   . ASN E 16  ? 0.7574 1.1435 0.6372 -0.0076 0.1247  -0.0573 14  ASN E OD1   
3075 N ND2   . ASN E 16  ? 0.7450 1.1591 0.6336 -0.0024 0.1211  -0.0630 14  ASN E ND2   
3076 N N     . GLU E 17  ? 0.7811 1.1275 0.6040 -0.0105 0.1621  -0.0421 15  GLU E N     
3077 C CA    . GLU E 17  ? 0.8741 1.2103 0.6803 -0.0136 0.1732  -0.0380 15  GLU E CA    
3078 C C     . GLU E 17  ? 0.9201 1.2345 0.7138 -0.0170 0.1792  -0.0326 15  GLU E C     
3079 O O     . GLU E 17  ? 1.0380 1.3474 0.8231 -0.0226 0.1871  -0.0299 15  GLU E O     
3080 C CB    . GLU E 17  ? 0.9170 1.2492 0.7113 -0.0079 0.1762  -0.0362 15  GLU E CB    
3081 C CG    . GLU E 17  ? 0.9427 1.2964 0.7462 -0.0053 0.1729  -0.0410 15  GLU E CG    
3082 C CD    . GLU E 17  ? 1.0194 1.3678 0.8070 -0.0023 0.1793  -0.0385 15  GLU E CD    
3083 O OE1   . GLU E 17  ? 1.0627 1.3942 0.8317 -0.0055 0.1889  -0.0335 15  GLU E OE1   
3084 O OE2   . GLU E 17  ? 1.0361 1.3967 0.8289 0.0032  0.1747  -0.0414 15  GLU E OE2   
3085 N N     . PHE E 18  ? 0.8248 1.1263 0.6171 -0.0138 0.1755  -0.0311 16  PHE E N     
3086 C CA    . PHE E 18  ? 0.7874 1.0688 0.5686 -0.0167 0.1805  -0.0265 16  PHE E CA    
3087 C C     . PHE E 18  ? 0.8032 1.0898 0.5935 -0.0238 0.1799  -0.0277 16  PHE E C     
3088 O O     . PHE E 18  ? 0.8401 1.1147 0.6206 -0.0281 0.1865  -0.0236 16  PHE E O     
3089 C CB    . PHE E 18  ? 0.7180 0.9866 0.4973 -0.0119 0.1763  -0.0257 16  PHE E CB    
3090 C CG    . PHE E 18  ? 0.6690 0.9180 0.4384 -0.0145 0.1805  -0.0217 16  PHE E CG    
3091 C CD1   . PHE E 18  ? 0.6723 0.9023 0.4214 -0.0145 0.1892  -0.0163 16  PHE E CD1   
3092 C CD2   . PHE E 18  ? 0.6257 0.8753 0.4054 -0.0168 0.1755  -0.0233 16  PHE E CD2   
3093 C CE1   . PHE E 18  ? 0.6668 0.8794 0.4068 -0.0162 0.1927  -0.0126 16  PHE E CE1   
3094 C CE2   . PHE E 18  ? 0.6231 0.8555 0.3939 -0.0189 0.1792  -0.0198 16  PHE E CE2   
3095 C CZ    . PHE E 18  ? 0.6452 0.8595 0.3965 -0.0183 0.1877  -0.0145 16  PHE E CZ    
3096 N N     . LYS E 19  ? 0.7631 1.0675 0.5719 -0.0252 0.1719  -0.0332 17  LYS E N     
3097 C CA    . LYS E 19  ? 0.7081 1.0177 0.5259 -0.0322 0.1705  -0.0349 17  LYS E CA    
3098 C C     . LYS E 19  ? 0.7137 1.0304 0.5292 -0.0382 0.1775  -0.0348 17  LYS E C     
3099 O O     . LYS E 19  ? 0.7149 1.0250 0.5267 -0.0440 0.1819  -0.0324 17  LYS E O     
3100 C CB    . LYS E 19  ? 0.6439 0.9706 0.4806 -0.0321 0.1600  -0.0412 17  LYS E CB    
3101 C CG    . LYS E 19  ? 0.6055 0.9357 0.4514 -0.0390 0.1571  -0.0435 17  LYS E CG    
3102 C CD    . LYS E 19  ? 0.5929 0.9388 0.4556 -0.0384 0.1464  -0.0496 17  LYS E CD    
3103 C CE    . LYS E 19  ? 0.5945 0.9384 0.4638 -0.0444 0.1425  -0.0512 17  LYS E CE    
3104 N NZ    . LYS E 19  ? 0.5881 0.9199 0.4561 -0.0419 0.1383  -0.0495 17  LYS E NZ    
3105 N N     . VAL E 20  ? 0.7777 1.1086 0.5955 -0.0369 0.1786  -0.0374 18  VAL E N     
3106 C CA    . VAL E 20  ? 0.8562 1.1959 0.6723 -0.0428 0.1855  -0.0378 18  VAL E CA    
3107 C C     . VAL E 20  ? 0.9173 1.2389 0.7136 -0.0447 0.1961  -0.0307 18  VAL E C     
3108 O O     . VAL E 20  ? 1.0214 1.3412 0.8150 -0.0514 0.2015  -0.0288 18  VAL E O     
3109 C CB    . VAL E 20  ? 0.5158 0.8747 0.3381 -0.0405 0.1844  -0.0425 18  VAL E CB    
3110 C CG1   . VAL E 20  ? 0.5285 0.8987 0.3510 -0.0474 0.1914  -0.0441 18  VAL E CG1   
3111 C CG2   . VAL E 20  ? 0.4905 0.8662 0.3315 -0.0378 0.1731  -0.0493 18  VAL E CG2   
3112 N N     . ARG E 21  ? 0.8295 1.1374 0.6112 -0.0388 0.1990  -0.0266 19  ARG E N     
3113 C CA    . ARG E 21  ? 0.8441 1.1335 0.6048 -0.0400 0.2088  -0.0195 19  ARG E CA    
3114 C C     . ARG E 21  ? 0.8461 1.1192 0.6014 -0.0428 0.2103  -0.0152 19  ARG E C     
3115 O O     . ARG E 21  ? 0.8559 1.1191 0.5983 -0.0466 0.2179  -0.0099 19  ARG E O     
3116 C CB    . ARG E 21  ? 0.8308 1.1074 0.5768 -0.0327 0.2103  -0.0166 19  ARG E CB    
3117 C CG    . ARG E 21  ? 0.8160 1.1065 0.5634 -0.0300 0.2104  -0.0198 19  ARG E CG    
3118 C CD    . ARG E 21  ? 0.8577 1.1452 0.5887 -0.0335 0.2207  -0.0161 19  ARG E CD    
3119 N NE    . ARG E 21  ? 0.8740 1.1680 0.6077 -0.0418 0.2258  -0.0154 19  ARG E NE    
3120 C CZ    . ARG E 21  ? 0.8566 1.1726 0.6035 -0.0467 0.2259  -0.0206 19  ARG E CZ    
3121 N NH1   . ARG E 21  ? 0.8333 1.1672 0.5919 -0.0435 0.2210  -0.0267 19  ARG E NH1   
3122 N NH2   . ARG E 21  ? 0.8636 1.1844 0.6122 -0.0548 0.2308  -0.0199 19  ARG E NH2   
3123 N N     . ARG E 22  ? 0.7810 1.0517 0.5460 -0.0410 0.2029  -0.0172 20  ARG E N     
3124 C CA    . ARG E 22  ? 0.7546 1.0113 0.5156 -0.0438 0.2039  -0.0137 20  ARG E CA    
3125 C C     . ARG E 22  ? 0.7036 0.9700 0.4728 -0.0525 0.2053  -0.0149 20  ARG E C     
3126 O O     . ARG E 22  ? 0.5758 0.8316 0.3358 -0.0565 0.2106  -0.0101 20  ARG E O     
3127 C CB    . ARG E 22  ? 0.7626 1.0155 0.5320 -0.0401 0.1957  -0.0161 20  ARG E CB    
3128 C CG    . ARG E 22  ? 0.7570 0.9963 0.5232 -0.0427 0.1960  -0.0132 20  ARG E CG    
3129 C CD    . ARG E 22  ? 0.7109 0.9542 0.4909 -0.0422 0.1871  -0.0175 20  ARG E CD    
3130 N NE    . ARG E 22  ? 0.7137 0.9723 0.5088 -0.0491 0.1832  -0.0218 20  ARG E NE    
3131 C CZ    . ARG E 22  ? 0.7170 0.9877 0.5275 -0.0495 0.1747  -0.0273 20  ARG E CZ    
3132 N NH1   . ARG E 22  ? 0.7247 0.9949 0.5384 -0.0435 0.1691  -0.0290 20  ARG E NH1   
3133 N NH2   . ARG E 22  ? 0.7251 1.0083 0.5475 -0.0560 0.1716  -0.0312 20  ARG E NH2   
3134 N N     . ILE E 23  ? 0.6797 0.9667 0.4660 -0.0556 0.2005  -0.0213 21  ILE E N     
3135 C CA    . ILE E 23  ? 0.7001 0.9971 0.4956 -0.0642 0.2011  -0.0236 21  ILE E CA    
3136 C C     . ILE E 23  ? 0.7307 1.0316 0.5183 -0.0693 0.2103  -0.0212 21  ILE E C     
3137 O O     . ILE E 23  ? 0.7175 1.0147 0.5019 -0.0760 0.2148  -0.0185 21  ILE E O     
3138 C CB    . ILE E 23  ? 0.6735 0.9909 0.4890 -0.0654 0.1927  -0.0318 21  ILE E CB    
3139 C CG1   . ILE E 23  ? 0.5021 0.8148 0.3247 -0.0619 0.1838  -0.0336 21  ILE E CG1   
3140 C CG2   . ILE E 23  ? 0.6630 0.9921 0.4876 -0.0743 0.1940  -0.0350 21  ILE E CG2   
3141 C CD1   . ILE E 23  ? 0.4803 0.8118 0.3212 -0.0626 0.1748  -0.0411 21  ILE E CD1   
3142 N N     . LYS E 24  ? 0.7568 1.0660 0.5414 -0.0667 0.2132  -0.0223 22  LYS E N     
3143 C CA    . LYS E 24  ? 0.7832 1.0965 0.5593 -0.0718 0.2224  -0.0200 22  LYS E CA    
3144 C C     . LYS E 24  ? 0.8024 1.0949 0.5584 -0.0728 0.2300  -0.0112 22  LYS E C     
3145 O O     . LYS E 24  ? 0.8502 1.1443 0.6002 -0.0796 0.2371  -0.0084 22  LYS E O     
3146 C CB    . LYS E 24  ? 0.7938 1.1180 0.5684 -0.0680 0.2240  -0.0225 22  LYS E CB    
3147 C CG    . LYS E 24  ? 0.5828 0.9318 0.3775 -0.0690 0.2181  -0.0316 22  LYS E CG    
3148 C CD    . LYS E 24  ? 0.5917 0.9533 0.3846 -0.0667 0.2210  -0.0342 22  LYS E CD    
3149 N N     . LEU E 25  ? 0.5521 1.4217 0.6923 -0.1576 0.0924  0.0127  23  LEU E N     
3150 C CA    . LEU E 25  ? 0.5788 1.4233 0.6997 -0.2064 0.0673  0.0421  23  LEU E CA    
3151 C C     . LEU E 25  ? 0.5765 1.3976 0.7241 -0.2229 0.0392  0.0576  23  LEU E C     
3152 O O     . LEU E 25  ? 0.5973 1.3819 0.7270 -0.2618 0.0154  0.0805  23  LEU E O     
3153 C CB    . LEU E 25  ? 0.5778 1.3595 0.6535 -0.2172 0.0582  0.0344  23  LEU E CB    
3154 C CG    . LEU E 25  ? 0.6229 1.4127 0.6537 -0.2249 0.0739  0.0337  23  LEU E CG    
3155 C CD1   . LEU E 25  ? 0.6150 1.3395 0.6087 -0.2318 0.0622  0.0286  23  LEU E CD1   
3156 C CD2   . LEU E 25  ? 0.6735 1.4928 0.6950 -0.2658 0.0674  0.0688  23  LEU E CD2   
3157 N N     . GLY E 26  ? 0.5214 1.3540 0.7067 -0.1952 0.0390  0.0462  24  GLY E N     
3158 C CA    . GLY E 26  ? 0.5197 1.3299 0.7240 -0.2135 0.0111  0.0613  24  GLY E CA    
3159 C C     . GLY E 26  ? 0.5170 1.2421 0.6925 -0.2221 -0.0131 0.0503  24  GLY E C     
3160 O O     . GLY E 26  ? 0.5615 1.2475 0.7287 -0.2509 -0.0395 0.0648  24  GLY E O     
3161 N N     . TYR E 27  ? 0.4698 1.1619 0.6276 -0.1974 -0.0051 0.0246  25  TYR E N     
3162 C CA    . TYR E 27  ? 0.4240 1.0392 0.5588 -0.1985 -0.0248 0.0124  25  TYR E CA    
3163 C C     . TYR E 27  ? 0.3603 0.9675 0.5144 -0.1644 -0.0278 -0.0071 25  TYR E C     
3164 O O     . TYR E 27  ? 0.3152 0.9585 0.4919 -0.1297 -0.0103 -0.0208 25  TYR E O     
3165 C CB    . TYR E 27  ? 0.4161 0.9969 0.5218 -0.1943 -0.0186 0.0026  25  TYR E CB    
3166 C CG    . TYR E 27  ? 0.4511 1.0069 0.5295 -0.2327 -0.0267 0.0259  25  TYR E CG    
3167 C CD1   . TYR E 27  ? 0.4756 0.9481 0.5293 -0.2525 -0.0504 0.0341  25  TYR E CD1   
3168 C CD2   . TYR E 27  ? 0.4798 1.0869 0.5519 -0.2464 -0.0104 0.0399  25  TYR E CD2   
3169 C CE1   . TYR E 27  ? 0.5189 0.9621 0.5523 -0.2865 -0.0614 0.0580  25  TYR E CE1   
3170 C CE2   . TYR E 27  ? 0.5241 1.1044 0.5703 -0.2824 -0.0217 0.0660  25  TYR E CE2   
3171 C CZ    . TYR E 27  ? 0.5445 1.0434 0.5760 -0.3028 -0.0488 0.0764  25  TYR E CZ    
3172 O OH    . TYR E 27  ? 0.5947 1.0583 0.6034 -0.3349 -0.0628 0.1043  25  TYR E OH    
3173 N N     . THR E 28  ? 0.3863 0.9392 0.5260 -0.1749 -0.0509 -0.0082 26  THR E N     
3174 C CA    . THR E 28  ? 0.3898 0.9228 0.5363 -0.1463 -0.0567 -0.0246 26  THR E CA    
3175 C C     . THR E 28  ? 0.4069 0.8791 0.5230 -0.1266 -0.0547 -0.0429 26  THR E C     
3176 O O     . THR E 28  ? 0.4352 0.8593 0.5199 -0.1367 -0.0527 -0.0399 26  THR E O     
3177 C CB    . THR E 28  ? 0.4133 0.9165 0.5500 -0.1676 -0.0816 -0.0161 26  THR E CB    
3178 O OG1   . THR E 28  ? 0.4613 0.8918 0.5486 -0.1948 -0.0971 -0.0185 26  THR E OG1   
3179 C CG2   . THR E 28  ? 0.4342 0.9890 0.6006 -0.1891 -0.0866 0.0084  26  THR E CG2   
3180 N N     . GLN E 29  ? 0.3821 0.8458 0.5074 -0.0947 -0.0546 -0.0564 27  GLN E N     
3181 C CA    . GLN E 29  ? 0.3768 0.7765 0.4748 -0.0721 -0.0513 -0.0671 27  GLN E CA    
3182 C C     . GLN E 29  ? 0.3880 0.7145 0.4443 -0.0883 -0.0592 -0.0645 27  GLN E C     
3183 O O     . GLN E 29  ? 0.3830 0.6626 0.4200 -0.0794 -0.0522 -0.0644 27  GLN E O     
3184 C CB    . GLN E 29  ? 0.3915 0.7954 0.5073 -0.0426 -0.0554 -0.0761 27  GLN E CB    
3185 C CG    . GLN E 29  ? 0.3785 0.8230 0.5250 -0.0148 -0.0447 -0.0847 27  GLN E CG    
3186 C CD    . GLN E 29  ? 0.3691 0.7960 0.5286 0.0112  -0.0515 -0.0870 27  GLN E CD    
3187 O OE1   . GLN E 29  ? 0.3837 0.7873 0.5353 0.0063  -0.0647 -0.0810 27  GLN E OE1   
3188 N NE2   . GLN E 29  ? 0.3604 0.7950 0.5351 0.0365  -0.0437 -0.0956 27  GLN E NE2   
3189 N N     . THR E 30  ? 0.4235 0.7365 0.4647 -0.1116 -0.0744 -0.0619 28  THR E N     
3190 C CA    . THR E 30  ? 0.4778 0.7107 0.4702 -0.1261 -0.0802 -0.0646 28  THR E CA    
3191 C C     . THR E 30  ? 0.5652 0.7738 0.5460 -0.1478 -0.0793 -0.0542 28  THR E C     
3192 O O     . THR E 30  ? 0.6151 0.7526 0.5661 -0.1433 -0.0756 -0.0566 28  THR E O     
3193 C CB    . THR E 30  ? 0.4515 0.6700 0.4195 -0.1521 -0.1010 -0.0656 28  THR E CB    
3194 O OG1   . THR E 30  ? 0.4070 0.6549 0.3899 -0.1347 -0.1052 -0.0698 28  THR E OG1   
3195 C CG2   . THR E 30  ? 0.4993 0.6202 0.4039 -0.1606 -0.1037 -0.0764 28  THR E CG2   
3196 N N     . ASN E 31  ? 0.5864 0.8557 0.5936 -0.1699 -0.0815 -0.0400 29  ASN E N     
3197 C CA    . ASN E 31  ? 0.6490 0.8999 0.6455 -0.1959 -0.0840 -0.0245 29  ASN E CA    
3198 C C     . ASN E 31  ? 0.6778 0.9128 0.6750 -0.1741 -0.0688 -0.0228 29  ASN E C     
3199 O O     . ASN E 31  ? 0.7210 0.8997 0.6993 -0.1833 -0.0727 -0.0132 29  ASN E O     
3200 C CB    . ASN E 31  ? 0.6169 0.9495 0.6432 -0.2271 -0.0879 -0.0053 29  ASN E CB    
3201 C CG    . ASN E 31  ? 0.6128 0.9537 0.6384 -0.2620 -0.1115 0.0038  29  ASN E CG    
3202 O OD1   . ASN E 31  ? 0.5584 0.9473 0.6114 -0.2506 -0.1102 0.0048  29  ASN E OD1   
3203 N ND2   . ASN E 31  ? 0.6826 0.9564 0.6727 -0.2954 -0.1309 0.0134  29  ASN E ND2   
3204 N N     . VAL E 32  ? 0.6667 0.9478 0.6857 -0.1469 -0.0548 -0.0301 30  VAL E N     
3205 C CA    . VAL E 32  ? 0.6791 0.9438 0.6948 -0.1304 -0.0460 -0.0266 30  VAL E CA    
3206 C C     . VAL E 32  ? 0.6873 0.8791 0.6897 -0.1103 -0.0469 -0.0287 30  VAL E C     
3207 O O     . VAL E 32  ? 0.7145 0.8698 0.7119 -0.1111 -0.0477 -0.0146 30  VAL E O     
3208 C CB    . VAL E 32  ? 0.6680 0.9843 0.7011 -0.1061 -0.0345 -0.0381 30  VAL E CB    
3209 C CG1   . VAL E 32  ? 0.6571 0.9512 0.6796 -0.0954 -0.0319 -0.0327 30  VAL E CG1   
3210 C CG2   . VAL E 32  ? 0.7022 1.0946 0.7511 -0.1200 -0.0262 -0.0368 30  VAL E CG2   
3211 N N     . GLY E 33  ? 0.6676 0.8410 0.6663 -0.0920 -0.0462 -0.0430 31  GLY E N     
3212 C CA    . GLY E 33  ? 0.6841 0.7960 0.6703 -0.0706 -0.0408 -0.0445 31  GLY E CA    
3213 C C     . GLY E 33  ? 0.7472 0.7922 0.7094 -0.0839 -0.0436 -0.0389 31  GLY E C     
3214 O O     . GLY E 33  ? 0.7957 0.7961 0.7599 -0.0658 -0.0360 -0.0311 31  GLY E O     
3215 N N     . GLU E 34  ? 0.7540 0.7905 0.6969 -0.1159 -0.0563 -0.0403 32  GLU E N     
3216 C CA    . GLU E 34  ? 0.8017 0.7621 0.7165 -0.1318 -0.0637 -0.0363 32  GLU E CA    
3217 C C     . GLU E 34  ? 0.7794 0.7397 0.7105 -0.1483 -0.0699 -0.0112 32  GLU E C     
3218 O O     . GLU E 34  ? 0.8068 0.7021 0.7329 -0.1406 -0.0697 -0.0024 32  GLU E O     
3219 C CB    . GLU E 34  ? 0.8626 0.8074 0.7466 -0.1668 -0.0822 -0.0437 32  GLU E CB    
3220 C CG    . GLU E 34  ? 0.8887 0.8268 0.7478 -0.1578 -0.0817 -0.0653 32  GLU E CG    
3221 C CD    . GLU E 34  ? 0.9699 0.8721 0.7878 -0.1972 -0.1057 -0.0704 32  GLU E CD    
3222 O OE1   . GLU E 34  ? 1.0138 0.8907 0.8237 -0.2306 -0.1226 -0.0572 32  GLU E OE1   
3223 O OE2   . GLU E 34  ? 0.9942 0.8924 0.7859 -0.1987 -0.1113 -0.0847 32  GLU E OE2   
3224 N N     . ALA E 35  ? 0.7369 0.7700 0.6873 -0.1699 -0.0744 0.0018  33  ALA E N     
3225 C CA    . ALA E 35  ? 0.7385 0.7792 0.6963 -0.1947 -0.0827 0.0286  33  ALA E CA    
3226 C C     . ALA E 35  ? 0.7133 0.7588 0.6886 -0.1733 -0.0753 0.0416  33  ALA E C     
3227 O O     . ALA E 35  ? 0.7211 0.7982 0.7008 -0.1944 -0.0808 0.0632  33  ALA E O     
3228 C CB    . ALA E 35  ? 0.7147 0.8382 0.6814 -0.2272 -0.0860 0.0381  33  ALA E CB    
3229 N N     . LEU E 36  ? 0.6798 0.6967 0.6635 -0.1356 -0.0647 0.0324  34  LEU E N     
3230 C CA    . LEU E 36  ? 0.6475 0.6684 0.6527 -0.1178 -0.0625 0.0500  34  LEU E CA    
3231 C C     . LEU E 36  ? 0.7143 0.6675 0.7327 -0.1034 -0.0643 0.0684  34  LEU E C     
3232 O O     . LEU E 36  ? 0.7341 0.6914 0.7775 -0.0952 -0.0683 0.0933  34  LEU E O     
3233 C CB    . LEU E 36  ? 0.5690 0.6186 0.5860 -0.0864 -0.0512 0.0348  34  LEU E CB    
3234 C CG    . LEU E 36  ? 0.5015 0.6099 0.5214 -0.0907 -0.0532 0.0353  34  LEU E CG    
3235 C CD1   . LEU E 36  ? 0.4975 0.6543 0.5023 -0.1164 -0.0527 0.0256  34  LEU E CD1   
3236 C CD2   . LEU E 36  ? 0.4521 0.5748 0.4828 -0.0611 -0.0465 0.0201  34  LEU E CD2   
3237 N N     . ALA E 37  ? 0.7572 0.6458 0.7590 -0.0999 -0.0623 0.0576  35  ALA E N     
3238 C CA    . ALA E 37  ? 0.8238 0.6412 0.8397 -0.0815 -0.0610 0.0732  35  ALA E CA    
3239 C C     . ALA E 37  ? 0.8808 0.6905 0.9133 -0.1084 -0.0821 0.1104  35  ALA E C     
3240 O O     . ALA E 37  ? 0.9329 0.7007 0.9951 -0.0900 -0.0836 0.1341  35  ALA E O     
3241 C CB    . ALA E 37  ? 0.8842 0.6222 0.8641 -0.0763 -0.0561 0.0484  35  ALA E CB    
3242 N N     . ALA E 38  ? 0.8705 0.7243 0.8877 -0.1514 -0.0979 0.1194  36  ALA E N     
3243 C CA    . ALA E 38  ? 0.8830 0.7348 0.9099 -0.1833 -0.1197 0.1584  36  ALA E CA    
3244 C C     . ALA E 38  ? 0.8503 0.7429 0.9036 -0.1771 -0.1235 0.1855  36  ALA E C     
3245 O O     . ALA E 38  ? 0.8751 0.7455 0.9494 -0.1879 -0.1412 0.2237  36  ALA E O     
3246 C CB    . ALA E 38  ? 0.8773 0.7745 0.8781 -0.2326 -0.1317 0.1621  36  ALA E CB    
3247 N N     . VAL E 39  ? 0.8110 0.7586 0.8630 -0.1622 -0.1111 0.1688  37  VAL E N     
3248 C CA    . VAL E 39  ? 0.8328 0.8159 0.8993 -0.1620 -0.1191 0.1919  37  VAL E CA    
3249 C C     . VAL E 39  ? 0.8506 0.8228 0.9528 -0.1195 -0.1095 0.1927  37  VAL E C     
3250 O O     . VAL E 39  ? 0.8411 0.8360 0.9613 -0.1198 -0.1212 0.2175  37  VAL E O     
3251 C CB    . VAL E 39  ? 0.8031 0.8538 0.8357 -0.1822 -0.1163 0.1757  37  VAL E CB    
3252 C CG1   . VAL E 39  ? 0.7490 0.8211 0.7822 -0.1504 -0.0987 0.1411  37  VAL E CG1   
3253 C CG2   . VAL E 39  ? 0.8328 0.9076 0.8566 -0.2062 -0.1347 0.2070  37  VAL E CG2   
3254 N N     . HIS E 40  ? 0.8852 0.8240 0.9961 -0.0860 -0.0899 0.1693  38  HIS E N     
3255 C CA    . HIS E 40  ? 0.8928 0.8325 1.0375 -0.0457 -0.0759 0.1706  38  HIS E CA    
3256 C C     . HIS E 40  ? 0.9486 0.8278 1.1221 -0.0128 -0.0618 0.1780  38  HIS E C     
3257 O O     . HIS E 40  ? 0.9954 0.8767 1.2168 0.0176  -0.0544 0.2013  38  HIS E O     
3258 C CB    . HIS E 40  ? 0.8716 0.8393 0.9946 -0.0316 -0.0595 0.1324  38  HIS E CB    
3259 C CG    . HIS E 40  ? 0.8793 0.8569 1.0345 0.0043  -0.0463 0.1367  38  HIS E CG    
3260 N ND1   . HIS E 40  ? 0.9043 0.8564 1.0593 0.0360  -0.0219 0.1171  38  HIS E ND1   
3261 C CD2   . HIS E 40  ? 0.8592 0.8712 1.0453 0.0102  -0.0555 0.1608  38  HIS E CD2   
3262 C CE1   . HIS E 40  ? 0.8782 0.8558 1.0676 0.0611  -0.0137 0.1312  38  HIS E CE1   
3263 N NE2   . HIS E 40  ? 0.8517 0.8652 1.0633 0.0450  -0.0360 0.1591  38  HIS E NE2   
3264 N N     . GLY E 41  ? 0.9715 0.7957 1.1164 -0.0184 -0.0581 0.1593  39  GLY E N     
3265 C CA    . GLY E 41  ? 1.0340 0.7857 1.1915 0.0153  -0.0416 0.1562  39  GLY E CA    
3266 C C     . GLY E 41  ? 1.0373 0.7650 1.1620 0.0432  -0.0131 0.1136  39  GLY E C     
3267 O O     . GLY E 41  ? 1.1126 0.7739 1.2347 0.0749  0.0066  0.1029  39  GLY E O     
3268 N N     . SER E 42  ? 0.9573 0.7345 1.0542 0.0324  -0.0106 0.0890  40  SER E N     
3269 C CA    . SER E 42  ? 0.8898 0.6563 0.9521 0.0518  0.0114  0.0525  40  SER E CA    
3270 C C     . SER E 42  ? 0.8148 0.6415 0.8534 0.0252  0.0003  0.0353  40  SER E C     
3271 O O     . SER E 42  ? 0.7462 0.6309 0.8058 0.0098  -0.0135 0.0513  40  SER E O     
3272 C CB    . SER E 42  ? 0.8310 0.6114 0.9278 0.0974  0.0385  0.0599  40  SER E CB    
3273 N N     . GLU E 43  ? 0.8513 0.6612 0.8448 0.0205  0.0058  0.0030  41  GLU E N     
3274 C CA    . GLU E 43  ? 0.8219 0.6867 0.7989 -0.0039 -0.0059 -0.0115 41  GLU E CA    
3275 C C     . GLU E 43  ? 0.7980 0.7051 0.7845 0.0192  0.0059  -0.0195 41  GLU E C     
3276 O O     . GLU E 43  ? 0.8231 0.7132 0.8171 0.0507  0.0254  -0.0183 41  GLU E O     
3277 C CB    . GLU E 43  ? 0.8779 0.7075 0.8054 -0.0300 -0.0150 -0.0346 41  GLU E CB    
3278 C CG    . GLU E 43  ? 0.9888 0.7402 0.8731 -0.0117 0.0000  -0.0569 41  GLU E CG    
3279 C CD    . GLU E 43  ? 1.0968 0.7992 0.9261 -0.0466 -0.0179 -0.0754 41  GLU E CD    
3280 O OE1   . GLU E 43  ? 1.1041 0.8239 0.9401 -0.0837 -0.0411 -0.0625 41  GLU E OE1   
3281 O OE2   . GLU E 43  ? 1.1720 0.8188 0.9484 -0.0398 -0.0098 -0.1010 41  GLU E OE2   
3282 N N     . PHE E 44  ? 0.7639 0.7283 0.7528 0.0038  -0.0056 -0.0257 42  PHE E N     
3283 C CA    . PHE E 44  ? 0.7351 0.7394 0.7336 0.0199  -0.0016 -0.0318 42  PHE E CA    
3284 C C     . PHE E 44  ? 0.7283 0.7375 0.6945 0.0073  -0.0063 -0.0546 42  PHE E C     
3285 O O     . PHE E 44  ? 0.7788 0.7493 0.7100 -0.0104 -0.0099 -0.0663 42  PHE E O     
3286 C CB    . PHE E 44  ? 0.7253 0.7837 0.7544 0.0161  -0.0131 -0.0196 42  PHE E CB    
3287 C CG    . PHE E 44  ? 0.7572 0.8157 0.8183 0.0312  -0.0119 0.0063  42  PHE E CG    
3288 C CD1   . PHE E 44  ? 0.8059 0.8409 0.8784 0.0251  -0.0144 0.0266  42  PHE E CD1   
3289 C CD2   . PHE E 44  ? 0.7422 0.8254 0.8256 0.0483  -0.0126 0.0152  42  PHE E CD2   
3290 C CE1   . PHE E 44  ? 0.8071 0.8475 0.9154 0.0363  -0.0176 0.0566  42  PHE E CE1   
3291 C CE2   . PHE E 44  ? 0.7440 0.8317 0.8611 0.0573  -0.0162 0.0448  42  PHE E CE2   
3292 C CZ    . PHE E 44  ? 0.7704 0.8389 0.9014 0.0515  -0.0188 0.0661  42  PHE E CZ    
3293 N N     . SER E 45  ? 0.6014 0.6547 0.5797 0.0139  -0.0104 -0.0583 43  SER E N     
3294 C CA    . SER E 45  ? 0.5475 0.6107 0.5026 0.0035  -0.0180 -0.0736 43  SER E CA    
3295 C C     . SER E 45  ? 0.4768 0.6027 0.4611 -0.0045 -0.0324 -0.0734 43  SER E C     
3296 O O     . SER E 45  ? 0.4335 0.5885 0.4480 0.0057  -0.0331 -0.0660 43  SER E O     
3297 C CB    . SER E 45  ? 0.5691 0.6203 0.5089 0.0235  -0.0074 -0.0763 43  SER E CB    
3298 O OG    . SER E 45  ? 0.5582 0.6400 0.5362 0.0447  -0.0042 -0.0607 43  SER E OG    
3299 N N     . GLN E 46  ? 0.4612 0.6051 0.4353 -0.0228 -0.0446 -0.0813 44  GLN E N     
3300 C CA    . GLN E 46  ? 0.4023 0.6092 0.4118 -0.0245 -0.0554 -0.0805 44  GLN E CA    
3301 C C     . GLN E 46  ? 0.3922 0.6179 0.4255 0.0014  -0.0564 -0.0783 44  GLN E C     
3302 O O     . GLN E 46  ? 0.3630 0.6272 0.4291 0.0112  -0.0600 -0.0786 44  GLN E O     
3303 C CB    . GLN E 46  ? 0.3751 0.6002 0.3764 -0.0490 -0.0712 -0.0826 44  GLN E CB    
3304 C CG    . GLN E 46  ? 0.2956 0.5860 0.3403 -0.0439 -0.0825 -0.0790 44  GLN E CG    
3305 C CD    . GLN E 46  ? 0.2519 0.5383 0.2911 -0.0352 -0.0934 -0.0775 44  GLN E CD    
3306 O OE1   . GLN E 46  ? 0.2474 0.5544 0.3161 -0.0118 -0.0947 -0.0749 44  GLN E OE1   
3307 N NE2   . GLN E 46  ? 0.2985 0.5532 0.2938 -0.0566 -0.1035 -0.0786 44  GLN E NE2   
3308 N N     . THR E 47  ? 0.3999 0.5963 0.4146 0.0128  -0.0525 -0.0757 45  THR E N     
3309 C CA    . THR E 47  ? 0.2125 0.4231 0.2501 0.0335  -0.0560 -0.0673 45  THR E CA    
3310 C C     . THR E 47  ? 0.2929 0.5054 0.3547 0.0464  -0.0524 -0.0602 45  THR E C     
3311 O O     . THR E 47  ? 0.2692 0.5036 0.3568 0.0559  -0.0630 -0.0592 45  THR E O     
3312 C CB    . THR E 47  ? 0.2385 0.4210 0.2488 0.0407  -0.0474 -0.0615 45  THR E CB    
3313 O OG1   . THR E 47  ? 0.7194 0.8925 0.6930 0.0237  -0.0535 -0.0697 45  THR E OG1   
3314 C CG2   . THR E 47  ? 0.2142 0.4157 0.2507 0.0566  -0.0547 -0.0465 45  THR E CG2   
3315 N N     . THR E 48  ? 0.3012 0.4861 0.3533 0.0461  -0.0399 -0.0543 46  THR E N     
3316 C CA    . THR E 48  ? 0.2699 0.4550 0.3416 0.0528  -0.0411 -0.0423 46  THR E CA    
3317 C C     . THR E 48  ? 0.2666 0.4754 0.3448 0.0441  -0.0483 -0.0516 46  THR E C     
3318 O O     . THR E 48  ? 0.2528 0.4687 0.3424 0.0508  -0.0573 -0.0495 46  THR E O     
3319 C CB    . THR E 48  ? 0.2759 0.4294 0.3416 0.0531  -0.0281 -0.0300 46  THR E CB    
3320 O OG1   . THR E 48  ? 0.2755 0.4110 0.3375 0.0683  -0.0150 -0.0217 46  THR E OG1   
3321 C CG2   . THR E 48  ? 0.2705 0.4272 0.3566 0.0534  -0.0351 -0.0124 46  THR E CG2   
3322 N N     . ILE E 49  ? 0.2647 0.4848 0.3323 0.0278  -0.0445 -0.0614 47  ILE E N     
3323 C CA    . ILE E 49  ? 0.2554 0.5077 0.3282 0.0204  -0.0449 -0.0694 47  ILE E CA    
3324 C C     . ILE E 49  ? 0.2643 0.5475 0.3573 0.0359  -0.0510 -0.0814 47  ILE E C     
3325 O O     . ILE E 49  ? 0.2637 0.5564 0.3593 0.0443  -0.0514 -0.0889 47  ILE E O     
3326 C CB    . ILE E 49  ? 0.2765 0.5434 0.3401 -0.0032 -0.0402 -0.0713 47  ILE E CB    
3327 C CG1   . ILE E 49  ? 0.3002 0.5243 0.3443 -0.0167 -0.0372 -0.0592 47  ILE E CG1   
3328 C CG2   . ILE E 49  ? 0.2851 0.5959 0.3550 -0.0102 -0.0349 -0.0767 47  ILE E CG2   
3329 C CD1   . ILE E 49  ? 0.3227 0.5318 0.3666 -0.0148 -0.0370 -0.0458 47  ILE E CD1   
3330 N N     . CYS E 50  ? 0.2667 0.5612 0.3710 0.0397  -0.0569 -0.0832 48  CYS E N     
3331 C CA    . CYS E 50  ? 0.2780 0.5872 0.4035 0.0549  -0.0628 -0.0878 48  CYS E CA    
3332 C C     . CYS E 50  ? 0.2913 0.5671 0.4156 0.0703  -0.0692 -0.0841 48  CYS E C     
3333 O O     . CYS E 50  ? 0.2875 0.5662 0.4210 0.0833  -0.0717 -0.0940 48  CYS E O     
3334 C CB    . CYS E 50  ? 0.2829 0.5929 0.4125 0.0500  -0.0706 -0.0804 48  CYS E CB    
3335 S SG    . CYS E 50  ? 0.2908 0.5999 0.4458 0.0645  -0.0790 -0.0748 48  CYS E SG    
3336 N N     . ARG E 51  ? 0.3025 0.5500 0.4183 0.0695  -0.0731 -0.0698 49  ARG E N     
3337 C CA    . ARG E 51  ? 0.3253 0.5429 0.4423 0.0761  -0.0824 -0.0589 49  ARG E CA    
3338 C C     . ARG E 51  ? 0.3750 0.5930 0.4859 0.0788  -0.0876 -0.0695 49  ARG E C     
3339 O O     . ARG E 51  ? 0.4012 0.6010 0.5119 0.0869  -0.1007 -0.0734 49  ARG E O     
3340 C CB    . ARG E 51  ? 0.3364 0.5375 0.4529 0.0734  -0.0824 -0.0364 49  ARG E CB    
3341 C CG    . ARG E 51  ? 0.3821 0.5868 0.4994 0.0742  -0.0811 -0.0284 49  ARG E CG    
3342 C CD    . ARG E 51  ? 0.4167 0.6099 0.5415 0.0764  -0.0817 -0.0035 49  ARG E CD    
3343 N NE    . ARG E 51  ? 0.4392 0.6449 0.5593 0.0803  -0.0803 0.0025  49  ARG E NE    
3344 C CZ    . ARG E 51  ? 0.4531 0.6689 0.5577 0.0880  -0.0642 0.0036  49  ARG E CZ    
3345 N NH1   . ARG E 51  ? 0.4621 0.6610 0.5592 0.0886  -0.0468 0.0011  49  ARG E NH1   
3346 N NH2   . ARG E 51  ? 0.4719 0.6914 0.5574 0.0870  -0.0595 0.0087  49  ARG E NH2   
3347 N N     . PHE E 52  ? 0.4213 0.6556 0.5216 0.0689  -0.0796 -0.0737 50  PHE E N     
3348 C CA    . PHE E 52  ? 0.4273 0.6505 0.5049 0.0621  -0.0811 -0.0789 50  PHE E CA    
3349 C C     . PHE E 52  ? 0.4318 0.6721 0.5029 0.0731  -0.0753 -0.1063 50  PHE E C     
3350 O O     . PHE E 52  ? 0.4661 0.6816 0.5184 0.0798  -0.0848 -0.1173 50  PHE E O     
3351 C CB    . PHE E 52  ? 0.4493 0.6751 0.5111 0.0418  -0.0698 -0.0689 50  PHE E CB    
3352 C CG    . PHE E 52  ? 0.5224 0.7391 0.5539 0.0287  -0.0729 -0.0701 50  PHE E CG    
3353 C CD1   . PHE E 52  ? 0.5632 0.7492 0.5859 0.0204  -0.0906 -0.0499 50  PHE E CD1   
3354 C CD2   . PHE E 52  ? 0.5491 0.7919 0.5599 0.0223  -0.0585 -0.0882 50  PHE E CD2   
3355 C CE1   . PHE E 52  ? 0.6102 0.7845 0.5962 0.0031  -0.0977 -0.0496 50  PHE E CE1   
3356 C CE2   . PHE E 52  ? 0.5983 0.8318 0.5699 0.0076  -0.0601 -0.0900 50  PHE E CE2   
3357 C CZ    . PHE E 52  ? 0.6323 0.8277 0.5874 -0.0035 -0.0816 -0.0714 50  PHE E CZ    
3358 N N     . GLU E 53  ? 0.4077 0.6894 0.4935 0.0752  -0.0597 -0.1170 51  GLU E N     
3359 C CA    . GLU E 53  ? 0.3936 0.7037 0.4836 0.0908  -0.0475 -0.1408 51  GLU E CA    
3360 C C     . GLU E 53  ? 0.3806 0.6696 0.4864 0.1181  -0.0612 -0.1531 51  GLU E C     
3361 O O     . GLU E 53  ? 0.4434 0.7227 0.5346 0.1350  -0.0554 -0.1760 51  GLU E O     
3362 C CB    . GLU E 53  ? 0.4076 0.7753 0.5260 0.0868  -0.0324 -0.1405 51  GLU E CB    
3363 C CG    . GLU E 53  ? 0.4415 0.8301 0.5403 0.0591  -0.0185 -0.1320 51  GLU E CG    
3364 C CD    . GLU E 53  ? 0.4616 0.9068 0.5901 0.0489  -0.0093 -0.1263 51  GLU E CD    
3365 O OE1   . GLU E 53  ? 0.4695 0.9399 0.6350 0.0640  -0.0137 -0.1281 51  GLU E OE1   
3366 O OE2   . GLU E 53  ? 0.4774 0.9407 0.5934 0.0226  -0.0014 -0.1157 51  GLU E OE2   
3367 N N     . ASN E 54  ? 0.3455 0.4894 0.2616 -0.0083 -0.0013 -0.0890 52  ASN E N     
3368 C CA    . ASN E 54  ? 0.4017 0.5331 0.3124 -0.0120 -0.0135 -0.0923 52  ASN E CA    
3369 C C     . ASN E 54  ? 0.4164 0.5466 0.3158 -0.0174 -0.0239 -0.0868 52  ASN E C     
3370 O O     . ASN E 54  ? 0.4315 0.5460 0.3244 -0.0236 -0.0383 -0.0875 52  ASN E O     
3371 C CB    . ASN E 54  ? 0.4059 0.5366 0.3269 -0.0150 -0.0142 -0.0913 52  ASN E CB    
3372 C CG    . ASN E 54  ? 0.3940 0.5274 0.3301 -0.0095 -0.0076 -0.0997 52  ASN E CG    
3373 O OD1   . ASN E 54  ? 0.3953 0.5424 0.3456 -0.0079 0.0022  -0.0999 52  ASN E OD1   
3374 N ND2   . ASN E 54  ? 0.3980 0.5167 0.3320 -0.0071 -0.0156 -0.1079 52  ASN E ND2   
3375 N N     . LEU E 55  ? 0.4037 0.5482 0.3007 -0.0157 -0.0199 -0.0812 53  LEU E N     
3376 C CA    . LEU E 55  ? 0.3996 0.5489 0.2901 -0.0202 -0.0302 -0.0775 53  LEU E CA    
3377 C C     . LEU E 55  ? 0.4016 0.5550 0.3002 -0.0308 -0.0354 -0.0715 53  LEU E C     
3378 O O     . LEU E 55  ? 0.4240 0.5690 0.3183 -0.0384 -0.0513 -0.0714 53  LEU E O     
3379 C CB    . LEU E 55  ? 0.4139 0.5494 0.2897 -0.0193 -0.0445 -0.0867 53  LEU E CB    
3380 C CG    . LEU E 55  ? 0.4462 0.5901 0.3081 -0.0097 -0.0402 -0.0904 53  LEU E CG    
3381 C CD1   . LEU E 55  ? 0.4966 0.6358 0.3472 -0.0093 -0.0562 -0.1027 53  LEU E CD1   
3382 C CD2   . LEU E 55  ? 0.4511 0.6120 0.3107 -0.0062 -0.0345 -0.0794 53  LEU E CD2   
3383 N N     . GLN E 56  ? 0.3756 0.5442 0.2875 -0.0321 -0.0238 -0.0671 54  GLN E N     
3384 C CA    . GLN E 56  ? 0.3774 0.5609 0.2953 -0.0427 -0.0248 -0.0600 54  GLN E CA    
3385 C C     . GLN E 56  ? 0.3503 0.5684 0.2816 -0.0442 -0.0171 -0.0561 54  GLN E C     
3386 O O     . GLN E 56  ? 0.3159 0.5616 0.2631 -0.0446 -0.0071 -0.0560 54  GLN E O     
3387 C CB    . GLN E 56  ? 0.4231 0.6074 0.3458 -0.0426 -0.0189 -0.0604 54  GLN E CB    
3388 C CG    . GLN E 56  ? 0.4777 0.6291 0.3874 -0.0407 -0.0299 -0.0650 54  GLN E CG    
3389 C CD    . GLN E 56  ? 0.5016 0.6555 0.4152 -0.0379 -0.0252 -0.0669 54  GLN E CD    
3390 O OE1   . GLN E 56  ? 0.4763 0.6580 0.4062 -0.0358 -0.0127 -0.0677 54  GLN E OE1   
3391 N NE2   . GLN E 56  ? 0.5471 0.6725 0.4481 -0.0370 -0.0390 -0.0699 54  GLN E NE2   
3392 N N     . LEU E 57  ? 0.3957 0.6198 0.3231 -0.0445 -0.0241 -0.0563 55  LEU E N     
3393 C CA    . LEU E 57  ? 0.3674 0.6325 0.3079 -0.0463 -0.0202 -0.0550 55  LEU E CA    
3394 C C     . LEU E 57  ? 0.3816 0.6500 0.3173 -0.0534 -0.0351 -0.0549 55  LEU E C     
3395 O O     . LEU E 57  ? 0.3613 0.5993 0.2856 -0.0553 -0.0497 -0.0578 55  LEU E O     
3396 C CB    . LEU E 57  ? 0.3238 0.5964 0.2681 -0.0313 -0.0145 -0.0579 55  LEU E CB    
3397 C CG    . LEU E 57  ? 0.2804 0.5445 0.2312 -0.0225 -0.0052 -0.0605 55  LEU E CG    
3398 C CD1   . LEU E 57  ? 0.2651 0.5243 0.2052 -0.0099 -0.0049 -0.0599 55  LEU E CD1   
3399 C CD2   . LEU E 57  ? 0.2624 0.5642 0.2383 -0.0244 0.0015  -0.0649 55  LEU E CD2   
3400 N N     . SER E 58  ? 0.4181 0.7264 0.3669 -0.0565 -0.0339 -0.0544 56  SER E N     
3401 C CA    . SER E 58  ? 0.4913 0.8066 0.4432 -0.0626 -0.0507 -0.0564 56  SER E CA    
3402 C C     . SER E 58  ? 0.5378 0.8299 0.4751 -0.0465 -0.0619 -0.0622 56  SER E C     
3403 O O     . SER E 58  ? 0.5228 0.8052 0.4489 -0.0322 -0.0536 -0.0615 56  SER E O     
3404 C CB    . SER E 58  ? 0.5227 0.8900 0.4951 -0.0684 -0.0467 -0.0562 56  SER E CB    
3405 O OG    . SER E 58  ? 0.5395 0.9248 0.5155 -0.0504 -0.0400 -0.0604 56  SER E OG    
3406 N N     . PHE E 59  ? 0.5998 0.8861 0.5383 -0.0503 -0.0820 -0.0680 57  PHE E N     
3407 C CA    . PHE E 59  ? 0.6130 0.8843 0.5336 -0.0361 -0.0935 -0.0742 57  PHE E CA    
3408 C C     . PHE E 59  ? 0.5868 0.8842 0.5052 -0.0216 -0.0885 -0.0704 57  PHE E C     
3409 O O     . PHE E 59  ? 0.6255 0.9117 0.5217 -0.0075 -0.0858 -0.0679 57  PHE E O     
3410 C CB    . PHE E 59  ? 0.6379 0.9065 0.5674 -0.0437 -0.1187 -0.0841 57  PHE E CB    
3411 C CG    . PHE E 59  ? 0.6565 0.9179 0.5653 -0.0304 -0.1307 -0.0921 57  PHE E CG    
3412 C CD1   . PHE E 59  ? 0.6628 0.8963 0.5461 -0.0238 -0.1290 -0.0967 57  PHE E CD1   
3413 C CD2   . PHE E 59  ? 0.6778 0.9662 0.5931 -0.0245 -0.1433 -0.0957 57  PHE E CD2   
3414 C CE1   . PHE E 59  ? 0.7052 0.9425 0.5676 -0.0124 -0.1371 -0.1045 57  PHE E CE1   
3415 C CE2   . PHE E 59  ? 0.7248 1.0128 0.6176 -0.0117 -0.1541 -0.1026 57  PHE E CE2   
3416 C CZ    . PHE E 59  ? 0.7397 1.0041 0.6047 -0.0060 -0.1499 -0.1070 57  PHE E CZ    
3417 N N     . LYS E 60  ? 0.5077 0.8431 0.4499 -0.0250 -0.0882 -0.0696 58  LYS E N     
3418 C CA    . LYS E 60  ? 0.4981 0.8604 0.4428 -0.0089 -0.0881 -0.0670 58  LYS E CA    
3419 C C     . LYS E 60  ? 0.4747 0.8356 0.4122 0.0015  -0.0706 -0.0602 58  LYS E C     
3420 O O     . LYS E 60  ? 0.5081 0.8684 0.4301 0.0186  -0.0733 -0.0540 58  LYS E O     
3421 C CB    . LYS E 60  ? 0.5166 0.9228 0.4952 -0.0150 -0.0916 -0.0712 58  LYS E CB    
3422 C CG    . LYS E 60  ? 0.5372 0.9732 0.5260 0.0039  -0.0966 -0.0709 58  LYS E CG    
3423 C CD    . LYS E 60  ? 0.5387 1.0199 0.5669 -0.0027 -0.0935 -0.0781 58  LYS E CD    
3424 C CE    . LYS E 60  ? 0.5737 1.0819 0.6191 0.0191  -0.0968 -0.0797 58  LYS E CE    
3425 N NZ    . LYS E 60  ? 0.5799 1.1286 0.6635 0.0135  -0.0854 -0.0903 58  LYS E NZ    
3426 N N     . ASN E 61  ? 0.4364 0.7986 0.3848 -0.0084 -0.0543 -0.0605 59  ASN E N     
3427 C CA    . ASN E 61  ? 0.4168 0.7801 0.3651 0.0008  -0.0399 -0.0583 59  ASN E CA    
3428 C C     . ASN E 61  ? 0.4206 0.7436 0.3419 0.0077  -0.0379 -0.0528 59  ASN E C     
3429 O O     . ASN E 61  ? 0.4107 0.7353 0.3238 0.0206  -0.0324 -0.0474 59  ASN E O     
3430 C CB    . ASN E 61  ? 0.3685 0.7433 0.3350 -0.0114 -0.0248 -0.0624 59  ASN E CB    
3431 C CG    . ASN E 61  ? 0.3015 0.6918 0.2798 -0.0007 -0.0137 -0.0672 59  ASN E CG    
3432 O OD1   . ASN E 61  ? 0.3128 0.7109 0.2860 0.0162  -0.0173 -0.0664 59  ASN E OD1   
3433 N ND2   . ASN E 61  ? 0.2339 0.6306 0.2283 -0.0093 -0.0034 -0.0721 59  ASN E ND2   
3434 N N     . ALA E 62  ? 0.4365 0.7264 0.3438 -0.0002 -0.0424 -0.0546 60  ALA E N     
3435 C CA    . ALA E 62  ? 0.4853 0.7428 0.3687 0.0055  -0.0390 -0.0526 60  ALA E CA    
3436 C C     . ALA E 62  ? 0.5304 0.7932 0.3895 0.0197  -0.0453 -0.0459 60  ALA E C     
3437 O O     . ALA E 62  ? 0.5566 0.8105 0.3978 0.0278  -0.0361 -0.0380 60  ALA E O     
3438 C CB    . ALA E 62  ? 0.5154 0.7439 0.3913 -0.0034 -0.0457 -0.0599 60  ALA E CB    
3439 N N     . CYS E 63  ? 0.5497 0.8284 0.4068 0.0226  -0.0612 -0.0475 61  CYS E N     
3440 C CA    . CYS E 63  ? 0.5889 0.8757 0.4207 0.0379  -0.0700 -0.0388 61  CYS E CA    
3441 C C     . CYS E 63  ? 0.5985 0.9046 0.4302 0.0527  -0.0646 -0.0227 61  CYS E C     
3442 O O     . CYS E 63  ? 0.6198 0.9215 0.4232 0.0656  -0.0624 -0.0064 61  CYS E O     
3443 C CB    . CYS E 63  ? 0.5817 0.8847 0.4179 0.0386  -0.0911 -0.0463 61  CYS E CB    
3444 S SG    . CYS E 63  ? 0.5819 0.8649 0.4154 0.0254  -0.1028 -0.0645 61  CYS E SG    
3445 N N     . LYS E 64  ? 0.5445 0.8752 0.4074 0.0520  -0.0629 -0.0258 62  LYS E N     
3446 C CA    . LYS E 64  ? 0.5466 0.8994 0.4151 0.0695  -0.0609 -0.0125 62  LYS E CA    
3447 C C     . LYS E 64  ? 0.5687 0.9026 0.4201 0.0728  -0.0419 -0.0019 62  LYS E C     
3448 O O     . LYS E 64  ? 0.6075 0.9386 0.4367 0.0902  -0.0400 0.0231  62  LYS E O     
3449 C CB    . LYS E 64  ? 0.4757 0.8649 0.3876 0.0670  -0.0621 -0.0263 62  LYS E CB    
3450 C CG    . LYS E 64  ? 0.4454 0.8522 0.3820 0.0853  -0.0590 -0.0193 62  LYS E CG    
3451 C CD    . LYS E 64  ? 0.3750 0.8167 0.3677 0.0811  -0.0567 -0.0410 62  LYS E CD    
3452 C CE    . LYS E 64  ? 0.3240 0.7538 0.3619 0.0946  -0.0429 -0.0422 62  LYS E CE    
3453 N NZ    . LYS E 64  ? 0.2505 0.7238 0.3422 0.0924  -0.0394 -0.0698 62  LYS E NZ    
3454 N N     . LEU E 65  ? 0.5338 0.8517 0.3972 0.0564  -0.0271 -0.0169 63  LEU E N     
3455 C CA    . LEU E 65  ? 0.5165 0.8173 0.3728 0.0576  -0.0068 -0.0125 63  LEU E CA    
3456 C C     . LEU E 65  ? 0.5336 0.8061 0.3553 0.0594  -0.0002 0.0023  63  LEU E C     
3457 O O     . LEU E 65  ? 0.5547 0.8217 0.3639 0.0678  0.0174  0.0205  63  LEU E O     
3458 C CB    . LEU E 65  ? 0.4696 0.7556 0.3521 0.0399  0.0018  -0.0326 63  LEU E CB    
3459 C CG    . LEU E 65  ? 0.4615 0.7771 0.3778 0.0413  0.0075  -0.0461 63  LEU E CG    
3460 C CD1   . LEU E 65  ? 0.4582 0.7578 0.3970 0.0237  0.0090  -0.0590 63  LEU E CD1   
3461 C CD2   . LEU E 65  ? 0.4767 0.7860 0.4118 0.0553  0.0252  -0.0405 63  LEU E CD2   
3462 N N     . LYS E 66  ? 0.5401 0.7977 0.3480 0.0517  -0.0108 -0.0052 64  LYS E N     
3463 C CA    . LYS E 66  ? 0.5768 0.8180 0.3511 0.0540  -0.0051 0.0039  64  LYS E CA    
3464 C C     . LYS E 66  ? 0.6445 0.8988 0.3922 0.0714  -0.0049 0.0344  64  LYS E C     
3465 O O     . LYS E 66  ? 0.7132 0.9578 0.4379 0.0743  0.0110  0.0532  64  LYS E O     
3466 C CB    . LYS E 66  ? 0.3968 0.6299 0.1617 0.0475  -0.0192 -0.0123 64  LYS E CB    
3467 C CG    . LYS E 66  ? 0.4461 0.6771 0.1733 0.0531  -0.0172 -0.0058 64  LYS E CG    
3468 C CD    . LYS E 66  ? 0.5061 0.7417 0.2249 0.0521  -0.0356 -0.0223 64  LYS E CD    
3469 C CE    . LYS E 66  ? 0.5232 0.7715 0.2012 0.0625  -0.0377 -0.0133 64  LYS E CE    
3470 N NZ    . LYS E 66  ? 0.5539 0.8146 0.2256 0.0646  -0.0585 -0.0312 64  LYS E NZ    
3471 N N     . ALA E 67  ? 0.6337 0.9093 0.3868 0.0833  -0.0226 0.0429  65  ALA E N     
3472 C CA    . ALA E 67  ? 0.6546 0.9376 0.3868 0.1033  -0.0273 0.0788  65  ALA E CA    
3473 C C     . ALA E 67  ? 0.6228 0.9015 0.3641 0.1145  -0.0085 0.1101  65  ALA E C     
3474 O O     . ALA E 67  ? 0.6718 0.9354 0.3932 0.1224  0.0037  0.1477  65  ALA E O     
3475 C CB    . ALA E 67  ? 0.4936 0.7993 0.2397 0.1151  -0.0546 0.0775  65  ALA E CB    
3476 N N     . ILE E 68  ? 0.5530 0.8305 0.3461 0.1093  -0.0035 0.0909  66  ILE E N     
3477 C CA    . ILE E 68  ? 0.5780 0.8261 0.4231 0.1103  0.0160  0.1032  66  ILE E CA    
3478 C C     . ILE E 68  ? 0.6286 0.8547 0.4596 0.0982  0.0454  0.1093  66  ILE E C     
3479 O O     . ILE E 68  ? 0.6830 0.8830 0.5317 0.1010  0.0620  0.1397  66  ILE E O     
3480 C CB    . ILE E 68  ? 0.5200 0.7767 0.4276 0.1055  0.0148  0.0692  66  ILE E CB    
3481 C CG1   . ILE E 68  ? 0.5135 0.8045 0.4312 0.1126  -0.0119 0.0558  66  ILE E CG1   
3482 C CG2   . ILE E 68  ? 0.5239 0.7550 0.4955 0.1128  0.0265  0.0782  66  ILE E CG2   
3483 C CD1   . ILE E 68  ? 0.5809 0.8716 0.5125 0.1348  -0.0307 0.0831  66  ILE E CD1   
3484 N N     . LEU E 69  ? 0.6129 0.8493 0.4179 0.0843  0.0517  0.0808  67  LEU E N     
3485 C CA    . LEU E 69  ? 0.6276 0.8489 0.4287 0.0729  0.0791  0.0783  67  LEU E CA    
3486 C C     . LEU E 69  ? 0.7301 0.9490 0.4823 0.0745  0.0888  0.1072  67  LEU E C     
3487 O O     . LEU E 69  ? 0.7655 0.9712 0.5247 0.0693  0.1165  0.1258  67  LEU E O     
3488 C CB    . LEU E 69  ? 0.5597 0.7814 0.3633 0.0572  0.0748  0.0354  67  LEU E CB    
3489 C CG    . LEU E 69  ? 0.4857 0.7137 0.3342 0.0529  0.0776  0.0087  67  LEU E CG    
3490 C CD1   . LEU E 69  ? 0.4304 0.6373 0.2862 0.0360  0.0613  -0.0205 67  LEU E CD1   
3491 C CD2   . LEU E 69  ? 0.4957 0.7035 0.3924 0.0511  0.1014  0.0106  67  LEU E CD2   
3492 N N     . SER E 70  ? 0.7832 1.0082 0.5023 0.0775  0.0647  0.1052  68  SER E N     
3493 C CA    . SER E 70  ? 0.8725 1.0935 0.5542 0.0764  0.0703  0.1232  68  SER E CA    
3494 C C     . SER E 70  ? 0.9487 1.1637 0.6242 0.0876  0.0843  0.1790  68  SER E C     
3495 O O     . SER E 70  ? 1.0424 1.2487 0.7047 0.0803  0.1062  0.1999  68  SER E O     
3496 C CB    . SER E 70  ? 0.5837 0.8167 0.2373 0.0800  0.0431  0.1077  68  SER E CB    
3497 O OG    . SER E 70  ? 0.9166 1.1614 0.5679 0.0959  0.0231  0.1281  68  SER E OG    
3498 N N     . LYS E 71  ? 0.8937 1.1103 0.5837 0.1051  0.0706  0.2062  69  LYS E N     
3499 C CA    . LYS E 71  ? 0.9360 1.1325 0.6358 0.1167  0.0803  0.2663  69  LYS E CA    
3500 C C     . LYS E 71  ? 0.9252 1.0895 0.6826 0.1033  0.1130  0.2758  69  LYS E C     
3501 O O     . LYS E 71  ? 0.9937 1.1368 0.7560 0.1015  0.1322  0.3238  69  LYS E O     
3502 C CB    . LYS E 71  ? 0.9219 1.1139 0.6548 0.1362  0.0502  0.2775  69  LYS E CB    
3503 N N     . TRP E 72  ? 0.8510 1.0106 0.6582 0.0922  0.1182  0.2284  70  TRP E N     
3504 C CA    . TRP E 72  ? 0.8413 0.9731 0.7116 0.0786  0.1458  0.2253  70  TRP E CA    
3505 C C     . TRP E 72  ? 0.8616 1.0022 0.6995 0.0629  0.1769  0.2288  70  TRP E C     
3506 O O     . TRP E 72  ? 0.8937 1.0134 0.7635 0.0533  0.2038  0.2573  70  TRP E O     
3507 C CB    . TRP E 72  ? 0.7763 0.9083 0.7039 0.0739  0.1396  0.1714  70  TRP E CB    
3508 C CG    . TRP E 72  ? 0.7813 0.8926 0.7715 0.0606  0.1650  0.1575  70  TRP E CG    
3509 C CD1   . TRP E 72  ? 0.8057 0.8867 0.8756 0.0619  0.1710  0.1659  70  TRP E CD1   
3510 C CD2   . TRP E 72  ? 0.7639 0.8846 0.7491 0.0451  0.1854  0.1286  70  TRP E CD2   
3511 N NE1   . TRP E 72  ? 0.7954 0.8682 0.9105 0.0471  0.1942  0.1430  70  TRP E NE1   
3512 C CE2   . TRP E 72  ? 0.7611 0.8588 0.8241 0.0371  0.2034  0.1206  70  TRP E CE2   
3513 C CE3   . TRP E 72  ? 0.7455 0.8919 0.6739 0.0386  0.1879  0.1058  70  TRP E CE3   
3514 C CZ2   . TRP E 72  ? 0.7329 0.8358 0.8160 0.0229  0.2238  0.0913  70  TRP E CZ2   
3515 C CZ3   . TRP E 72  ? 0.7131 0.8623 0.6618 0.0257  0.2077  0.0779  70  TRP E CZ3   
3516 C CH2   . TRP E 72  ? 0.7138 0.8429 0.7379 0.0180  0.2255  0.0712  70  TRP E CH2   
3517 N N     . LEU E 73  ? 0.8781 1.0508 0.6605 0.0597  0.1738  0.1976  71  LEU E N     
3518 C CA    . LEU E 73  ? 0.9262 1.1010 0.6936 0.0421  0.1900  0.1798  71  LEU E CA    
3519 C C     . LEU E 73  ? 1.0177 1.1885 0.7575 0.0392  0.2026  0.2251  71  LEU E C     
3520 O O     . LEU E 73  ? 1.1108 1.2743 0.8722 0.0246  0.2311  0.2375  71  LEU E O     
3521 C CB    . LEU E 73  ? 0.5728 0.7598 0.3042 0.0374  0.1661  0.1296  71  LEU E CB    
3522 C CG    . LEU E 73  ? 0.5858 0.7723 0.3062 0.0222  0.1813  0.1060  71  LEU E CG    
3523 C CD1   . LEU E 73  ? 0.5657 0.7448 0.3387 0.0095  0.2060  0.0903  71  LEU E CD1   
3524 C CD2   . LEU E 73  ? 0.5704 0.7568 0.2684 0.0231  0.1569  0.0647  71  LEU E CD2   
3525 N N     . GLU E 74  ? 0.9743 1.1521 0.6686 0.0521  0.1805  0.2483  72  GLU E N     
3526 C CA    . GLU E 74  ? 1.0667 1.2409 0.7326 0.0513  0.1896  0.2958  72  GLU E CA    
3527 C C     . GLU E 74  ? 1.0695 1.2123 0.7908 0.0474  0.2136  0.3471  72  GLU E C     
3528 O O     . GLU E 74  ? 1.1230 1.2590 0.8489 0.0324  0.2388  0.3712  72  GLU E O     
3529 C CB    . GLU E 74  ? 1.1381 1.3225 0.7582 0.0696  0.1578  0.3122  72  GLU E CB    
3530 C CG    . GLU E 74  ? 1.1648 1.3756 0.7406 0.0716  0.1353  0.2642  72  GLU E CG    
3531 C CD    . GLU E 74  ? 1.2307 1.4532 0.7729 0.0894  0.1034  0.2759  72  GLU E CD    
3532 O OE1   . GLU E 74  ? 1.2810 1.4908 0.8281 0.1012  0.0972  0.3225  72  GLU E OE1   
3533 O OE2   . GLU E 74  ? 1.2289 1.4707 0.7461 0.0918  0.0835  0.2382  72  GLU E OE2   
3534 N N     . GLU E 75  ? 1.0173 1.1379 0.7890 0.0600  0.2060  0.3636  73  GLU E N     
3535 C CA    . GLU E 75  ? 1.0725 1.1507 0.9169 0.0569  0.2243  0.4104  73  GLU E CA    
3536 C C     . GLU E 75  ? 1.0635 1.1302 0.9704 0.0346  0.2596  0.3912  73  GLU E C     
3537 O O     . GLU E 75  ? 1.1167 1.1508 1.0814 0.0235  0.2783  0.4250  73  GLU E O     
3538 C CB    . GLU E 75  ? 1.0701 1.1226 0.9723 0.0744  0.1972  0.4066  73  GLU E CB    
3539 C CG    . GLU E 75  ? 1.1303 1.1316 1.1107 0.0766  0.1989  0.4527  73  GLU E CG    
3540 C CD    . GLU E 75  ? 1.0771 1.0586 1.1258 0.0944  0.1659  0.4260  73  GLU E CD    
3541 O OE1   . GLU E 75  ? 1.0678 1.0665 1.0793 0.1147  0.1341  0.4263  73  GLU E OE1   
3542 O OE2   . GLU E 75  ? 1.0396 0.9934 1.1825 0.0887  0.1714  0.4007  73  GLU E OE2   
3543 N N     . ALA E 76  ? 0.5346 0.9198 0.8326 -0.0224 0.0395  0.1676  74  ALA E N     
3544 C CA    . ALA E 76  ? 0.5838 0.9415 0.9011 -0.0251 0.0364  0.1661  74  ALA E CA    
3545 C C     . ALA E 76  ? 0.5858 0.9370 0.9198 -0.0473 0.0512  0.1696  74  ALA E C     
3546 O O     . ALA E 76  ? 0.5674 0.9076 0.9227 -0.0539 0.0545  0.1657  74  ALA E O     
3547 C CB    . ALA E 76  ? 0.5857 0.9487 0.9112 -0.0174 0.0343  0.1552  74  ALA E CB    
3548 N N     . GLU E 77  ? 0.6031 0.9600 0.9282 -0.0594 0.0602  0.1770  75  GLU E N     
3549 C CA    . GLU E 77  ? 0.6077 0.9546 0.9474 -0.0803 0.0749  0.1810  75  GLU E CA    
3550 C C     . GLU E 77  ? 0.6244 0.9419 0.9619 -0.0799 0.0663  0.1924  75  GLU E C     
3551 O O     . GLU E 77  ? 0.6272 0.9467 0.9483 -0.0853 0.0689  0.2007  75  GLU E O     
3552 C CB    . GLU E 77  ? 0.6186 0.9673 0.9272 -0.0904 0.0876  0.1676  75  GLU E CB    
3553 C CG    . GLU E 77  ? 0.6101 0.9638 0.9050 -0.0872 0.0917  0.1463  75  GLU E CG    
3554 C CD    . GLU E 77  ? 0.6211 0.9469 0.9182 -0.0951 0.0993  0.1265  75  GLU E CD    
3555 O OE1   . GLU E 77  ? 0.6305 0.9353 0.9407 -0.1008 0.0994  0.1295  75  GLU E OE1   
3556 O OE2   . GLU E 77  ? 0.6245 0.9489 0.9104 -0.0954 0.1046  0.1080  75  GLU E OE2   
3557 N N     . GLN E 78  ? 0.6314 0.9208 0.9858 -0.0739 0.0557  0.1931  76  GLN E N     
3558 C CA    . GLN E 78  ? 0.6313 0.8905 0.9873 -0.0721 0.0460  0.2036  76  GLN E CA    
3559 C C     . GLN E 78  ? 0.5934 0.8295 0.9779 -0.0859 0.0530  0.2058  76  GLN E C     
3560 O O     . GLN E 78  ? 0.5555 0.7848 0.9604 -0.0850 0.0509  0.1993  76  GLN E O     
3561 C CB    . GLN E 78  ? 0.6453 0.8886 0.9943 -0.0497 0.0234  0.2035  76  GLN E CB    
3562 C CG    . GLN E 78  ? 0.6600 0.9248 0.9842 -0.0349 0.0161  0.2018  76  GLN E CG    
3563 C CD    . GLN E 78  ? 0.6803 0.9600 0.9860 -0.0428 0.0230  0.2104  76  GLN E CD    
3564 O OE1   . GLN E 78  ? 0.6624 0.9715 0.9559 -0.0464 0.0318  0.2070  76  GLN E OE1   
3565 N NE2   . GLN E 78  ? 0.7091 0.9681 1.0124 -0.0459 0.0184  0.2220  76  GLN E NE2   
3566 N N     . LYS E 95  ? 0.8694 1.0881 0.7868 0.1992  -0.0361 -0.0445 93  LYS E N     
3567 C CA    . LYS E 95  ? 0.9124 1.1130 0.7999 0.1942  -0.0406 -0.0489 93  LYS E CA    
3568 C C     . LYS E 95  ? 0.9179 1.1204 0.8242 0.1731  -0.0508 -0.0389 93  LYS E C     
3569 O O     . LYS E 95  ? 0.9436 1.1251 0.8634 0.1631  -0.0671 -0.0330 93  LYS E O     
3570 C CB    . LYS E 95  ? 0.9042 1.1299 0.7761 0.2035  -0.0211 -0.0553 93  LYS E CB    
3571 N N     . ARG E 96  ? 0.8986 1.1263 0.8073 0.1664  -0.0411 -0.0367 94  ARG E N     
3572 C CA    . ARG E 96  ? 0.9003 1.1329 0.8293 0.1465  -0.0493 -0.0269 94  ARG E CA    
3573 C C     . ARG E 96  ? 0.9319 1.2091 0.8791 0.1425  -0.0313 -0.0234 94  ARG E C     
3574 O O     . ARG E 96  ? 0.9571 1.2506 0.8865 0.1538  -0.0163 -0.0300 94  ARG E O     
3575 C CB    . ARG E 96  ? 0.9055 1.1000 0.8037 0.1389  -0.0665 -0.0286 94  ARG E CB    
3576 C CG    . ARG E 96  ? 0.9091 1.0660 0.8122 0.1301  -0.0896 -0.0245 94  ARG E CG    
3577 N N     . ARG E 97  ? 0.9067 1.2031 0.8910 0.1263  -0.0326 -0.0131 95  ARG E N     
3578 C CA    . ARG E 97  ? 0.8238 1.1621 0.8302 0.1201  -0.0171 -0.0088 95  ARG E CA    
3579 C C     . ARG E 97  ? 0.8320 1.1641 0.8221 0.1112  -0.0212 -0.0075 95  ARG E C     
3580 O O     . ARG E 97  ? 0.8443 1.1411 0.8166 0.1041  -0.0392 -0.0065 95  ARG E O     
3581 C CB    . ARG E 97  ? 0.7590 1.1199 0.8128 0.1061  -0.0156 0.0011  95  ARG E CB    
3582 C CG    . ARG E 97  ? 0.7322 1.1054 0.8034 0.1135  -0.0090 0.0009  95  ARG E CG    
3583 C CD    . ARG E 97  ? 0.7082 1.1187 0.8221 0.1022  0.0020  0.0084  95  ARG E CD    
3584 N NE    . ARG E 97  ? 0.7128 1.1123 0.8554 0.0845  -0.0089 0.0171  95  ARG E NE    
3585 C CZ    . ARG E 97  ? 0.7074 1.1196 0.8740 0.0684  -0.0084 0.0236  95  ARG E CZ    
3586 N NH1   . ARG E 97  ? 0.7224 1.1588 0.8865 0.0677  0.0020  0.0226  95  ARG E NH1   
3587 N NH2   . ARG E 97  ? 0.6865 1.0875 0.8814 0.0530  -0.0178 0.0313  95  ARG E NH2   
3588 N N     . THR E 98  ? 0.8105 1.1773 0.8069 0.1114  -0.0049 -0.0071 96  THR E N     
3589 C CA    . THR E 98  ? 0.8682 1.2360 0.8542 0.1019  -0.0065 -0.0043 96  THR E CA    
3590 C C     . THR E 98  ? 0.9028 1.2994 0.9345 0.0845  -0.0041 0.0067  96  THR E C     
3591 O O     . THR E 98  ? 0.9482 1.3824 1.0092 0.0855  0.0117  0.0082  96  THR E O     
3592 C CB    . THR E 98  ? 0.8558 1.2414 0.8161 0.1144  0.0108  -0.0115 96  THR E CB    
3593 O OG1   . THR E 98  ? 0.7897 1.2224 0.7828 0.1125  0.0289  -0.0076 96  THR E OG1   
3594 C CG2   . THR E 98  ? 0.8885 1.2618 0.8207 0.1348  0.0170  -0.0226 96  THR E CG2   
3595 N N     . THR E 99  ? 0.8884 1.2667 0.9267 0.0684  -0.0200 0.0141  97  THR E N     
3596 C CA    . THR E 99  ? 0.8884 1.2896 0.9736 0.0509  -0.0193 0.0248  97  THR E CA    
3597 C C     . THR E 99  ? 0.8733 1.3066 0.9655 0.0466  -0.0063 0.0274  97  THR E C     
3598 O O     . THR E 99  ? 0.8826 1.3046 0.9438 0.0475  -0.0096 0.0260  97  THR E O     
3599 C CB    . THR E 99  ? 0.9246 1.2930 1.0184 0.0351  -0.0424 0.0327  97  THR E CB    
3600 O OG1   . THR E 99  ? 0.9429 1.2722 1.0130 0.0419  -0.0571 0.0281  97  THR E OG1   
3601 C CG2   . THR E 99  ? 0.9100 1.2969 1.0588 0.0194  -0.0416 0.0424  97  THR E CG2   
3602 N N     . ILE E 100 ? 0.7379 1.2108 0.8702 0.0417  0.0087  0.0312  98  ILE E N     
3603 C CA    . ILE E 100 ? 0.6512 1.1586 0.7979 0.0367  0.0221  0.0343  98  ILE E CA    
3604 C C     . ILE E 100 ? 0.5995 1.1072 0.7802 0.0158  0.0123  0.0455  98  ILE E C     
3605 O O     . ILE E 100 ? 0.6919 1.1836 0.8996 0.0053  0.0060  0.0497  98  ILE E O     
3606 C CB    . ILE E 100 ? 0.6434 1.1461 0.7923 0.0396  0.0385  0.0297  98  ILE E CB    
3607 C CG1   . ILE E 100 ? 0.6697 1.1800 0.7895 0.0596  0.0476  0.0204  98  ILE E CG1   
3608 C CG2   . ILE E 100 ? 0.6387 1.1244 0.7889 0.0289  0.0434  0.0317  98  ILE E CG2   
3609 C CD1   . ILE E 100 ? 0.1992 0.6836 0.3148 0.0585  0.0544  0.0171  98  ILE E CD1   
3610 N N     . SER E 101 ? 0.4571 0.9687 0.6305 0.0094  0.0109  0.0497  99  SER E N     
3611 C CA    . SER E 101 ? 0.4347 0.9415 0.6389 -0.0104 0.0011  0.0606  99  SER E CA    
3612 C C     . SER E 101 ? 0.4332 0.8994 0.6499 -0.0164 0.0129  0.0564  99  SER E C     
3613 O O     . SER E 101 ? 0.4601 0.9161 0.6637 -0.0083 0.0265  0.0482  99  SER E O     
3614 C CB    . SER E 101 ? 0.4503 0.9630 0.6382 -0.0149 -0.0014 0.0650  99  SER E CB    
3615 O OG    . SER E 101 ? 0.4511 0.9739 0.6288 -0.0082 0.0184  0.0599  99  SER E OG    
3616 N N     . ILE E 102 ? 0.4673 0.7007 0.6139 0.0976  0.0780  0.2355  100 ILE E N     
3617 C CA    . ILE E 102 ? 0.4828 0.6526 0.6238 0.1034  0.0832  0.2372  100 ILE E CA    
3618 C C     . ILE E 102 ? 0.5502 0.6840 0.6880 0.0931  0.0735  0.2575  100 ILE E C     
3619 O O     . ILE E 102 ? 0.5977 0.6809 0.7273 0.0903  0.0757  0.2524  100 ILE E O     
3620 C CB    . ILE E 102 ? 0.5159 0.6725 0.6657 0.1178  0.0888  0.2445  100 ILE E CB    
3621 C CG1   . ILE E 102 ? 0.4825 0.6664 0.6229 0.1223  0.1028  0.2264  100 ILE E CG1   
3622 C CG2   . ILE E 102 ? 0.5734 0.6607 0.7232 0.1253  0.0909  0.2409  100 ILE E CG2   
3623 C CD1   . ILE E 102 ? 0.4617 0.6064 0.5734 0.1210  0.1120  0.1960  100 ILE E CD1   
3624 N N     . ALA E 103 ? 0.5802 0.7357 0.7195 0.0852  0.0644  0.2811  101 ALA E N     
3625 C CA    . ALA E 103 ? 0.6243 0.7410 0.7527 0.0724  0.0594  0.3028  101 ALA E CA    
3626 C C     . ALA E 103 ? 0.6081 0.7245 0.7249 0.0530  0.0602  0.2922  101 ALA E C     
3627 O O     . ALA E 103 ? 0.6509 0.7200 0.7592 0.0411  0.0630  0.3003  101 ALA E O     
3628 C CB    . ALA E 103 ? 0.6592 0.7961 0.7821 0.0677  0.0509  0.3305  101 ALA E CB    
3629 N N     . ALA E 104 ? 0.5396 0.7068 0.6567 0.0489  0.0581  0.2738  102 ALA E N     
3630 C CA    . ALA E 104 ? 0.5785 0.7504 0.6871 0.0328  0.0578  0.2630  102 ALA E CA    
3631 C C     . ALA E 104 ? 0.5944 0.7306 0.7011 0.0376  0.0633  0.2490  102 ALA E C     
3632 O O     . ALA E 104 ? 0.6285 0.7454 0.7310 0.0208  0.0654  0.2525  102 ALA E O     
3633 C CB    . ALA E 104 ? 0.5555 0.7809 0.6628 0.0316  0.0519  0.2436  102 ALA E CB    
3634 N N     . LYS E 105 ? 0.5629 0.6898 0.6713 0.0577  0.0678  0.2328  103 LYS E N     
3635 C CA    . LYS E 105 ? 0.5555 0.6387 0.6534 0.0630  0.0737  0.2183  103 LYS E CA    
3636 C C     . LYS E 105 ? 0.6482 0.6664 0.7453 0.0548  0.0759  0.2326  103 LYS E C     
3637 O O     . LYS E 105 ? 0.6622 0.6467 0.7517 0.0435  0.0777  0.2291  103 LYS E O     
3638 C CB    . LYS E 105 ? 0.5005 0.5775 0.5942 0.0836  0.0820  0.1977  103 LYS E CB    
3639 C CG    . LYS E 105 ? 0.4310 0.5595 0.5240 0.0916  0.0828  0.1789  103 LYS E CG    
3640 C CD    . LYS E 105 ? 0.4111 0.5195 0.4899 0.1062  0.0968  0.1575  103 LYS E CD    
3641 C CE    . LYS E 105 ? 0.3735 0.4867 0.4273 0.0987  0.0773  0.1287  103 LYS E CE    
3642 N NZ    . LYS E 105 ? 0.3775 0.4492 0.4055 0.1007  0.0757  0.1052  103 LYS E NZ    
3643 N N     . ASP E 106 ? 0.7264 0.7240 0.8317 0.0599  0.0761  0.2485  104 ASP E N     
3644 C CA    . ASP E 106 ? 0.8346 0.7648 0.9378 0.0522  0.0791  0.2601  104 ASP E CA    
3645 C C     . ASP E 106 ? 0.8748 0.7983 0.9728 0.0233  0.0793  0.2767  104 ASP E C     
3646 O O     . ASP E 106 ? 0.9363 0.8036 1.0297 0.0072  0.0853  0.2766  104 ASP E O     
3647 C CB    . ASP E 106 ? 0.9257 0.8396 1.0380 0.0668  0.0785  0.2764  104 ASP E CB    
3648 C CG    . ASP E 106 ? 1.0146 0.9208 1.1361 0.0900  0.0831  0.2589  104 ASP E CG    
3649 O OD1   . ASP E 106 ? 1.0524 0.9413 1.1655 0.0924  0.0886  0.2327  104 ASP E OD1   
3650 O OD2   . ASP E 106 ? 1.0739 0.9902 1.2093 0.1046  0.0814  0.2718  104 ASP E OD2   
3651 N N     . ALA E 107 ? 0.8241 0.8027 0.9224 0.0127  0.0750  0.2876  105 ALA E N     
3652 C CA    . ALA E 107 ? 0.8486 0.8278 0.9421 -0.0194 0.0789  0.2992  105 ALA E CA    
3653 C C     . ALA E 107 ? 0.7917 0.7888 0.8931 -0.0368 0.0814  0.2833  105 ALA E C     
3654 O O     . ALA E 107 ? 0.8247 0.7900 0.9309 -0.0647 0.0888  0.2852  105 ALA E O     
3655 C CB    . ALA E 107 ? 0.8569 0.8888 0.9453 -0.0260 0.0750  0.3102  105 ALA E CB    
3656 N N     . LEU E 108 ? 0.7021 0.7510 0.8064 -0.0225 0.0757  0.2664  106 LEU E N     
3657 C CA    . LEU E 108 ? 0.6421 0.7171 0.7547 -0.0356 0.0761  0.2540  106 LEU E CA    
3658 C C     . LEU E 108 ? 0.6665 0.6770 0.7800 -0.0399 0.0801  0.2499  106 LEU E C     
3659 O O     . LEU E 108 ? 0.7204 0.7313 0.8448 -0.0671 0.0765  0.2329  106 LEU E O     
3660 C CB    . LEU E 108 ? 0.5375 0.6667 0.6434 -0.0125 0.0700  0.2353  106 LEU E CB    
3661 C CG    . LEU E 108 ? 0.4925 0.6808 0.5995 -0.0141 0.0647  0.2299  106 LEU E CG    
3662 C CD1   . LEU E 108 ? 0.4315 0.6468 0.5285 0.0116  0.0583  0.2067  106 LEU E CD1   
3663 C CD2   . LEU E 108 ? 0.5005 0.7284 0.6217 -0.0432 0.0667  0.2274  106 LEU E CD2   
3664 N N     . GLU E 109 ? 0.6234 0.5792 0.7210 -0.0119 0.0811  0.2412  107 GLU E N     
3665 C CA    . GLU E 109 ? 0.6301 0.5091 0.7203 -0.0143 0.0852  0.2261  107 GLU E CA    
3666 C C     . GLU E 109 ? 0.6769 0.5019 0.7774 -0.0453 0.0928  0.2352  107 GLU E C     
3667 O O     . GLU E 109 ? 0.6951 0.4802 0.7906 -0.0650 0.0912  0.2084  107 GLU E O     
3668 C CB    . GLU E 109 ? 0.6348 0.4728 0.7064 0.0193  0.0874  0.2089  107 GLU E CB    
3669 C CG    . GLU E 109 ? 0.7019 0.4578 0.7565 0.0181  0.0928  0.1838  107 GLU E CG    
3670 C CD    . GLU E 109 ? 0.7213 0.4826 0.7529 0.0127  0.0826  0.1509  107 GLU E CD    
3671 O OE1   . GLU E 109 ? 0.6793 0.5083 0.7056 0.0219  0.0716  0.1448  107 GLU E OE1   
3672 O OE2   . GLU E 109 ? 0.7607 0.4647 0.7745 -0.0015 0.0815  0.1247  107 GLU E OE2   
3673 N N     . ARG E 110 ? 0.7237 0.5526 0.8238 -0.0492 0.0946  0.2544  108 ARG E N     
3674 C CA    . ARG E 110 ? 0.8303 0.6069 0.9301 -0.0798 0.1037  0.2621  108 ARG E CA    
3675 C C     . ARG E 110 ? 0.8540 0.6669 0.9759 -0.1249 0.1073  0.2611  108 ARG E C     
3676 O O     . ARG E 110 ? 0.9203 0.6886 1.0502 -0.1587 0.1149  0.2492  108 ARG E O     
3677 C CB    . ARG E 110 ? 0.8882 0.6566 0.9758 -0.0705 0.1047  0.2861  108 ARG E CB    
3678 C CG    . ARG E 110 ? 1.0140 0.7020 1.0889 -0.0876 0.1146  0.2934  108 ARG E CG    
3679 C CD    . ARG E 110 ? 1.0958 0.7875 1.1619 -0.1206 0.1230  0.3139  108 ARG E CD    
3680 N NE    . ARG E 110 ? 1.0878 0.8412 1.1498 -0.1075 0.1166  0.3318  108 ARG E NE    
3681 C CZ    . ARG E 110 ? 1.1328 0.9048 1.1836 -0.1337 0.1242  0.3459  108 ARG E CZ    
3682 N NH1   . ARG E 110 ? 1.1974 0.9337 1.2425 -0.1759 0.1402  0.3445  108 ARG E NH1   
3683 N NH2   . ARG E 110 ? 1.1102 0.9352 1.1544 -0.1206 0.1174  0.3579  108 ARG E NH2   
3684 N N     . HIS E 111 ? 0.7954 0.6959 0.9304 -0.1288 0.1015  0.2672  109 HIS E N     
3685 C CA    . HIS E 111 ? 0.7743 0.7337 0.9374 -0.1698 0.1004  0.2548  109 HIS E CA    
3686 C C     . HIS E 111 ? 0.7768 0.7505 0.9421 -0.1702 0.0821  0.2056  109 HIS E C     
3687 O O     . HIS E 111 ? 0.8008 0.7975 0.9863 -0.2060 0.0780  0.1814  109 HIS E O     
3688 C CB    . HIS E 111 ? 0.6882 0.7383 0.8567 -0.1654 0.0979  0.2611  109 HIS E CB    
3689 C CG    . HIS E 111 ? 0.7000 0.7380 0.8477 -0.1720 0.1087  0.2773  109 HIS E CG    
3690 N ND1   . HIS E 111 ? 0.6610 0.7567 0.8015 -0.1643 0.1073  0.2783  109 HIS E ND1   
3691 C CD2   . HIS E 111 ? 0.7682 0.7369 0.8965 -0.1870 0.1216  0.2923  109 HIS E CD2   
3692 C CE1   . HIS E 111 ? 0.7164 0.7801 0.8348 -0.1755 0.1182  0.2956  109 HIS E CE1   
3693 N NE2   . HIS E 111 ? 0.7884 0.7763 0.8978 -0.1886 0.1272  0.3059  109 HIS E NE2   
3694 N N     . PHE E 112 ? 0.7614 0.7225 0.9045 -0.1322 0.0708  0.1897  110 PHE E N     
3695 C CA    . PHE E 112 ? 0.7782 0.7472 0.9122 -0.1303 0.0511  0.1458  110 PHE E CA    
3696 C C     . PHE E 112 ? 0.8663 0.7589 0.9913 -0.1557 0.0534  0.1254  110 PHE E C     
3697 O O     . PHE E 112 ? 0.8828 0.7941 1.0099 -0.1748 0.0362  0.0897  110 PHE E O     
3698 C CB    . PHE E 112 ? 0.7305 0.6926 0.8331 -0.0856 0.0431  0.1351  110 PHE E CB    
3699 C CG    . PHE E 112 ? 0.7470 0.7171 0.8301 -0.0799 0.0209  0.0942  110 PHE E CG    
3700 C CD1   . PHE E 112 ? 0.7323 0.7856 0.8279 -0.0745 0.0027  0.0792  110 PHE E CD1   
3701 C CD2   . PHE E 112 ? 0.8024 0.6949 0.8523 -0.0791 0.0182  0.0710  110 PHE E CD2   
3702 C CE1   . PHE E 112 ? 0.7555 0.8151 0.8299 -0.0654 -0.0217 0.0449  110 PHE E CE1   
3703 C CE2   . PHE E 112 ? 0.8230 0.7204 0.8458 -0.0742 -0.0050 0.0352  110 PHE E CE2   
3704 C CZ    . PHE E 112 ? 0.7996 0.7809 0.8341 -0.0659 -0.0269 0.0237  110 PHE E CZ    
3705 N N     . GLY E 113 ? 0.9258 0.7328 1.0409 -0.1559 0.0739  0.1466  111 GLY E N     
3706 C CA    . GLY E 113 ? 1.0297 0.7568 1.1358 -0.1842 0.0824  0.1279  111 GLY E CA    
3707 C C     . GLY E 113 ? 1.0857 0.8342 1.2185 -0.2370 0.0862  0.1210  111 GLY E C     
3708 O O     . GLY E 113 ? 1.1473 0.8545 1.2745 -0.2686 0.0864  0.0909  111 GLY E O     
3709 N N     . GLU E 114 ? 1.0595 0.8718 1.2196 -0.2503 0.0915  0.1460  112 GLU E N     
3710 C CA    . GLU E 114 ? 1.0893 0.9276 1.2780 -0.3035 0.1003  0.1400  112 GLU E CA    
3711 C C     . GLU E 114 ? 1.0230 0.9713 1.2435 -0.3191 0.0771  0.1060  112 GLU E C     
3712 O O     . GLU E 114 ? 1.0539 1.0263 1.3015 -0.3662 0.0786  0.0826  112 GLU E O     
3713 C CB    . GLU E 114 ? 1.1128 0.9511 1.3092 -0.3135 0.1238  0.1875  112 GLU E CB    
3714 C CG    . GLU E 114 ? 1.1839 0.9200 1.3476 -0.2931 0.1427  0.2237  112 GLU E CG    
3715 C CD    . GLU E 114 ? 1.2269 0.9747 1.3644 -0.2864 0.1523  0.2556  112 GLU E CD    
3716 O OE1   . GLU E 114 ? 1.1821 1.0138 1.3373 -0.2886 0.1506  0.2592  112 GLU E OE1   
3717 O OE2   . GLU E 114 ? 1.3095 0.9837 1.4092 -0.2778 0.1586  0.2751  112 GLU E OE2   
3718 N N     . GLN E 115 ? 0.9412 0.9570 1.1615 -0.2806 0.0568  0.1013  113 GLN E N     
3719 C CA    . GLN E 115 ? 0.9359 1.0580 1.1905 -0.2877 0.0342  0.0714  113 GLN E CA    
3720 C C     . GLN E 115 ? 0.8865 1.0380 1.1193 -0.2359 0.0109  0.0614  113 GLN E C     
3721 O O     . GLN E 115 ? 0.8656 1.0494 1.0954 -0.2064 0.0164  0.0842  113 GLN E O     
3722 C CB    . GLN E 115 ? 0.9343 1.1329 1.2295 -0.3104 0.0494  0.0892  113 GLN E CB    
3723 N N     . ASN E 116 ? 0.8714 1.0061 1.0830 -0.2272 -0.0135 0.0271  114 ASN E N     
3724 C CA    . ASN E 116 ? 0.8112 0.9675 0.9954 -0.1805 -0.0355 0.0154  114 ASN E CA    
3725 C C     . ASN E 116 ? 0.7434 1.0109 0.9664 -0.1692 -0.0480 0.0116  114 ASN E C     
3726 O O     . ASN E 116 ? 0.6832 0.9721 0.8925 -0.1312 -0.0464 0.0243  114 ASN E O     
3727 C CB    . ASN E 116 ? 0.8445 0.9640 0.9944 -0.1794 -0.0612 -0.0215 114 ASN E CB    
3728 C CG    . ASN E 116 ? 0.9112 0.9155 1.0199 -0.1885 -0.0447 -0.0213 114 ASN E CG    
3729 O OD1   . ASN E 116 ? 0.9498 0.9045 1.0652 -0.2002 -0.0156 0.0056  114 ASN E OD1   
3730 N ND2   . ASN E 116 ? 0.9389 0.8972 1.0022 -0.1819 -0.0626 -0.0510 114 ASN E ND2   
3731 N N     . LYS E 117 ? 0.7295 1.0694 1.0038 -0.2029 -0.0587 -0.0089 115 LYS E N     
3732 C CA    . LYS E 117 ? 0.6770 1.1286 1.0007 -0.1957 -0.0682 -0.0164 115 LYS E CA    
3733 C C     . LYS E 117 ? 0.7005 1.1935 1.0694 -0.2297 -0.0373 0.0051  115 LYS E C     
3734 O O     . LYS E 117 ? 0.7655 1.2957 1.1801 -0.2756 -0.0334 -0.0097 115 LYS E O     
3735 C CB    . LYS E 117 ? 0.6451 1.1623 1.0033 -0.2088 -0.1030 -0.0574 115 LYS E CB    
3736 C CG    . LYS E 117 ? 0.5504 1.1310 0.9105 -0.1621 -0.1332 -0.0723 115 LYS E CG    
3737 C CD    . LYS E 117 ? 0.5216 1.0315 0.8107 -0.1297 -0.1593 -0.0847 115 LYS E CD    
3738 C CE    . LYS E 117 ? 0.4597 1.0342 0.7530 -0.0919 -0.1980 -0.1060 115 LYS E CE    
3739 N NZ    . LYS E 117 ? 0.4664 0.9665 0.6808 -0.0638 -0.2235 -0.1182 115 LYS E NZ    
3740 N N     . PRO E 118 ? 0.6390 1.1267 0.9938 -0.2115 -0.0141 0.0383  116 PRO E N     
3741 C CA    . PRO E 118 ? 0.5999 1.1208 0.9861 -0.2449 0.0161  0.0608  116 PRO E CA    
3742 C C     . PRO E 118 ? 0.5272 1.1304 0.9545 -0.2374 0.0151  0.0410  116 PRO E C     
3743 O O     . PRO E 118 ? 0.4700 1.1119 0.8999 -0.1996 -0.0044 0.0237  116 PRO E O     
3744 C CB    . PRO E 118 ? 0.5753 1.0492 0.9172 -0.2181 0.0351  0.1002  116 PRO E CB    
3745 C CG    . PRO E 118 ? 0.5187 0.9936 0.8319 -0.1664 0.0157  0.0891  116 PRO E CG    
3746 C CD    . PRO E 118 ? 0.5673 1.0257 0.8760 -0.1614 -0.0142 0.0543  116 PRO E CD    
3747 N N     . SER E 119 ? 0.5420 1.1462 0.9907 -0.2665 0.0381  0.0439  117 SER E N     
3748 C CA    . SER E 119 ? 0.5531 1.2134 1.0381 -0.2588 0.0407  0.0260  117 SER E CA    
3749 C C     . SER E 119 ? 0.5423 1.1991 0.9969 -0.2215 0.0524  0.0399  117 SER E C     
3750 O O     . SER E 119 ? 0.5449 1.1553 0.9504 -0.2069 0.0618  0.0649  117 SER E O     
3751 C CB    . SER E 119 ? 0.6033 1.2627 1.1176 -0.3023 0.0649  0.0269  117 SER E CB    
3752 O OG    . SER E 119 ? 0.6155 1.2254 1.0929 -0.3069 0.0952  0.0583  117 SER E OG    
3753 N N     . SER E 120 ? 0.4890 1.2013 1.0619 0.0091  0.0130  0.2188  118 SER E N     
3754 C CA    . SER E 120 ? 0.4833 1.2369 1.0482 0.0297  0.0390  0.2000  118 SER E CA    
3755 C C     . SER E 120 ? 0.5072 1.2998 1.0301 0.0120  0.0736  0.2188  118 SER E C     
3756 O O     . SER E 120 ? 0.5091 1.3149 0.9885 0.0218  0.0912  0.2101  118 SER E O     
3757 C CB    . SER E 120 ? 0.4956 1.3023 1.1421 0.0554  0.0520  0.1666  118 SER E CB    
3758 O OG    . SER E 120 ? 0.4860 1.2601 1.1789 0.0644  0.0113  0.1566  118 SER E OG    
3759 N N     . GLN E 121 ? 0.5323 1.3399 1.0604 -0.0159 0.0805  0.2451  119 GLN E N     
3760 C CA    . GLN E 121 ? 0.5539 1.3889 1.0336 -0.0424 0.1036  0.2694  119 GLN E CA    
3761 C C     . GLN E 121 ? 0.5252 1.3075 0.9491 -0.0584 0.0701  0.2996  119 GLN E C     
3762 O O     . GLN E 121 ? 0.5311 1.3211 0.9017 -0.0706 0.0777  0.3121  119 GLN E O     
3763 C CB    . GLN E 121 ? 0.5851 1.4616 1.0978 -0.0694 0.1244  0.2827  119 GLN E CB    
3764 C CG    . GLN E 121 ? 0.5982 1.5333 1.1898 -0.0560 0.1583  0.2455  119 GLN E CG    
3765 C CD    . GLN E 121 ? 0.6148 1.5883 1.2024 -0.0366 0.1975  0.2084  119 GLN E CD    
3766 O OE1   . GLN E 121 ? 0.6479 1.6232 1.1596 -0.0499 0.2195  0.2151  119 GLN E OE1   
3767 N NE2   . GLN E 121 ? 0.5968 1.5958 1.2656 -0.0048 0.2023  0.1670  119 GLN E NE2   
3768 N N     . GLU E 122 ? 0.4963 1.2210 0.9317 -0.0605 0.0336  0.3072  120 GLU E N     
3769 C CA    . GLU E 122 ? 0.4759 1.1462 0.8738 -0.0722 0.0026  0.3224  120 GLU E CA    
3770 C C     . GLU E 122 ? 0.4827 1.1364 0.8476 -0.0568 0.0005  0.3013  120 GLU E C     
3771 O O     . GLU E 122 ? 0.4946 1.1327 0.8308 -0.0685 -0.0142 0.3128  120 GLU E O     
3772 C CB    . GLU E 122 ? 0.4279 1.0318 0.8393 -0.0755 -0.0255 0.3187  120 GLU E CB    
3773 N N     . ILE E 123 ? 0.4895 1.1467 0.8635 -0.0314 0.0106  0.2701  121 ILE E N     
3774 C CA    . ILE E 123 ? 0.5196 1.1662 0.8591 -0.0153 0.0098  0.2489  121 ILE E CA    
3775 C C     . ILE E 123 ? 0.6246 1.3272 0.9303 -0.0157 0.0376  0.2585  121 ILE E C     
3776 O O     . ILE E 123 ? 0.6900 1.3773 0.9533 -0.0173 0.0296  0.2570  121 ILE E O     
3777 C CB    . ILE E 123 ? 0.4861 1.1247 0.8438 0.0111  0.0085  0.2171  121 ILE E CB    
3778 C CG1   . ILE E 123 ? 0.4594 1.0301 0.8256 0.0014  -0.0229 0.2073  121 ILE E CG1   
3779 C CG2   . ILE E 123 ? 0.4855 1.1310 0.8047 0.0326  0.0145  0.1957  121 ILE E CG2   
3780 C CD1   . ILE E 123 ? 0.2354 0.7983 0.6255 0.0204  -0.0362 0.1859  121 ILE E CD1   
3781 N N     . MET E 124 ? 0.6621 1.4177 0.9763 -0.0184 0.0722  0.2625  122 MET E N     
3782 C CA    . MET E 124 ? 0.7372 1.5247 0.9923 -0.0279 0.1059  0.2654  122 MET E CA    
3783 C C     . MET E 124 ? 0.7667 1.5368 0.9756 -0.0681 0.0897  0.3069  122 MET E C     
3784 O O     . MET E 124 ? 0.8377 1.5868 0.9675 -0.0784 0.0942  0.3106  122 MET E O     
3785 C CB    . MET E 124 ? 0.7953 1.6327 1.0714 -0.0270 0.1498  0.2471  122 MET E CB    
3786 C CG    . MET E 124 ? 0.8927 1.7441 1.0982 -0.0295 0.1899  0.2275  122 MET E CG    
3787 S SD    . MET E 124 ? 0.9173 1.7333 1.0698 0.0083  0.1815  0.1979  122 MET E SD    
3788 C CE    . MET E 124 ? 1.0103 1.7918 1.0374 -0.0233 0.1954  0.2086  122 MET E CE    
3789 N N     . ARG E 125 ? 0.7301 1.4895 0.9775 -0.0904 0.0627  0.3355  123 ARG E N     
3790 C CA    . ARG E 125 ? 0.7691 1.5028 0.9810 -0.1296 0.0349  0.3768  123 ARG E CA    
3791 C C     . ARG E 125 ? 0.7064 1.3788 0.8995 -0.1236 -0.0078 0.3729  123 ARG E C     
3792 O O     . ARG E 125 ? 0.7657 1.3945 0.9008 -0.1451 -0.0334 0.3915  123 ARG E O     
3793 C CB    . ARG E 125 ? 0.8094 1.5379 1.0708 -0.1484 0.0110  0.4012  123 ARG E CB    
3794 N N     . MET E 126 ? 0.6121 1.2658 0.8488 -0.0949 -0.0216 0.3410  124 MET E N     
3795 C CA    . MET E 126 ? 0.5553 1.1465 0.7810 -0.0877 -0.0590 0.3203  124 MET E CA    
3796 C C     . MET E 126 ? 0.5494 1.1166 0.7032 -0.0673 -0.0458 0.2910  124 MET E C     
3797 O O     . MET E 126 ? 0.5469 1.0672 0.6660 -0.0723 -0.0741 0.2871  124 MET E O     
3798 C CB    . MET E 126 ? 0.5108 1.0687 0.7855 -0.0749 -0.0699 0.2890  124 MET E CB    
3799 C CG    . MET E 126 ? 0.5686 1.0933 0.8739 -0.0879 -0.0772 0.2995  124 MET E CG    
3800 S SD    . MET E 126 ? 0.6068 1.0622 0.9221 -0.0756 -0.0779 0.2504  124 MET E SD    
3801 C CE    . MET E 126 ? 0.6436 1.0820 0.9865 -0.0896 -0.0852 0.2736  124 MET E CE    
3802 N N     . ALA E 127 ? 0.5612 1.1583 0.6983 -0.0435 -0.0073 0.2686  125 ALA E N     
3803 C CA    . ALA E 127 ? 0.6039 1.1791 0.6703 -0.0239 0.0070  0.2405  125 ALA E CA    
3804 C C     . ALA E 127 ? 0.6995 1.2617 0.6893 -0.0456 0.0084  0.2624  125 ALA E C     
3805 O O     . ALA E 127 ? 0.7521 1.2697 0.6833 -0.0399 -0.0053 0.2477  125 ALA E O     
3806 C CB    . ALA E 127 ? 0.5996 1.2139 0.6708 0.0039  0.0462  0.2149  125 ALA E CB    
3807 N N     . GLU E 128 ? 0.7399 1.3358 0.7231 -0.0759 0.0228  0.2983  126 GLU E N     
3808 C CA    . GLU E 128 ? 0.8536 1.4250 0.7482 -0.1095 0.0186  0.3251  126 GLU E CA    
3809 C C     . GLU E 128 ? 0.8973 1.4042 0.7911 -0.1314 -0.0470 0.3516  126 GLU E C     
3810 O O     . GLU E 128 ? 0.9874 1.4411 0.8083 -0.1449 -0.0737 0.3590  126 GLU E O     
3811 C CB    . GLU E 128 ? 0.9221 1.5428 0.8057 -0.1423 0.0570  0.3475  126 GLU E CB    
3812 C CG    . GLU E 128 ? 1.0389 1.6218 0.8197 -0.1725 0.0698  0.3471  126 GLU E CG    
3813 C CD    . GLU E 128 ? 1.0691 1.6906 0.8255 -0.1581 0.1343  0.3061  126 GLU E CD    
3814 O OE1   . GLU E 128 ? 1.0014 1.6829 0.8323 -0.1254 0.1652  0.2796  126 GLU E OE1   
3815 O OE2   . GLU E 128 ? 1.1597 1.7448 0.8259 -0.1795 0.1505  0.2983  126 GLU E OE2   
3816 N N     . GLU E 129 ? 0.8560 1.3641 0.8352 -0.1351 -0.0773 0.3637  127 GLU E N     
3817 C CA    . GLU E 129 ? 0.8917 1.3411 0.8936 -0.1517 -0.1437 0.3808  127 GLU E CA    
3818 C C     . GLU E 129 ? 0.8692 1.2721 0.8793 -0.1255 -0.1725 0.3405  127 GLU E C     
3819 O O     . GLU E 129 ? 0.9056 1.2482 0.9105 -0.1368 -0.2225 0.3431  127 GLU E O     
3820 C CB    . GLU E 129 ? 0.8619 1.3285 0.9617 -0.1587 -0.1637 0.3940  127 GLU E CB    
3821 C CG    . GLU E 129 ? 0.8793 1.2836 1.0441 -0.1580 -0.2176 0.3750  127 GLU E CG    
3822 C CD    . GLU E 129 ? 0.8645 1.2689 1.1117 -0.1612 -0.2163 0.3704  127 GLU E CD    
3823 O OE1   . GLU E 129 ? 0.8437 1.1953 1.1352 -0.1447 -0.2255 0.3254  127 GLU E OE1   
3824 O OE2   . GLU E 129 ? 0.8762 1.3304 1.1332 -0.1795 -0.2014 0.4086  127 GLU E OE2   
3825 N N     . LEU E 130 ? 0.8326 1.2544 0.8573 -0.0924 -0.1402 0.2968  128 LEU E N     
3826 C CA    . LEU E 130 ? 0.8032 1.1865 0.8365 -0.0722 -0.1602 0.2538  128 LEU E CA    
3827 C C     . LEU E 130 ? 0.8067 1.1762 0.7524 -0.0562 -0.1375 0.2344  128 LEU E C     
3828 O O     . LEU E 130 ? 0.8735 1.2094 0.8183 -0.0422 -0.1539 0.1994  128 LEU E O     
3829 C CB    . LEU E 130 ? 0.3711 0.7703 0.4740 -0.0552 -0.1469 0.2158  128 LEU E CB    
3830 C CG    . LEU E 130 ? 0.3307 0.7352 0.5212 -0.0697 -0.1651 0.2226  128 LEU E CG    
3831 C CD1   . LEU E 130 ? 0.2753 0.6842 0.4963 -0.0585 -0.1383 0.1859  128 LEU E CD1   
3832 C CD2   . LEU E 130 ? 0.3486 0.6878 0.5760 -0.0773 -0.2031 0.2011  128 LEU E CD2   
3833 N N     . ASN E 131 ? 0.7201 1.1168 0.5965 -0.0599 -0.0979 0.2516  129 ASN E N     
3834 C CA    . ASN E 131 ? 0.7326 1.1178 0.5227 -0.0458 -0.0726 0.2314  129 ASN E CA    
3835 C C     . ASN E 131 ? 0.6580 1.0480 0.4674 -0.0098 -0.0520 0.1837  129 ASN E C     
3836 O O     . ASN E 131 ? 0.6627 1.0152 0.4359 0.0036  -0.0624 0.1557  129 ASN E O     
3837 C CB    . ASN E 131 ? 0.8013 1.1231 0.5301 -0.0604 -0.1161 0.2394  129 ASN E CB    
3838 C CG    . ASN E 131 ? 0.8601 1.1596 0.4934 -0.0532 -0.0854 0.2208  129 ASN E CG    
3839 O OD1   . ASN E 131 ? 0.8796 1.2155 0.4861 -0.0473 -0.0319 0.2120  129 ASN E OD1   
3840 N ND2   . ASN E 131 ? 0.8926 1.1279 0.4876 -0.0519 -0.1200 0.2084  129 ASN E ND2   
3841 N N     . LEU E 132 ? 0.6026 1.0337 0.4678 0.0024  -0.0276 0.1760  130 LEU E N     
3842 C CA    . LEU E 132 ? 0.6048 1.0332 0.4807 0.0302  -0.0132 0.1366  130 LEU E CA    
3843 C C     . LEU E 132 ? 0.6061 1.0843 0.4875 0.0467  0.0277  0.1342  130 LEU E C     
3844 O O     . LEU E 132 ? 0.6801 1.2048 0.5818 0.0336  0.0471  0.1606  130 LEU E O     
3845 C CB    . LEU E 132 ? 0.5761 0.9909 0.5224 0.0258  -0.0360 0.1227  130 LEU E CB    
3846 C CG    . LEU E 132 ? 0.5654 0.9354 0.5276 0.0143  -0.0710 0.1027  130 LEU E CG    
3847 C CD1   . LEU E 132 ? 0.3008 0.6710 0.3399 -0.0003 -0.0851 0.0927  130 LEU E CD1   
3848 C CD2   . LEU E 132 ? 0.3641 0.6978 0.2745 0.0288  -0.0679 0.0628  130 LEU E CD2   
3849 N N     . GLU E 133 ? 0.5378 1.0051 0.4060 0.0740  0.0384  0.0997  131 GLU E N     
3850 C CA    . GLU E 133 ? 0.5814 1.0933 0.4757 0.0950  0.0687  0.0891  131 GLU E CA    
3851 C C     . GLU E 133 ? 0.5585 1.0990 0.5388 0.0903  0.0604  0.1028  131 GLU E C     
3852 O O     . GLU E 133 ? 0.5373 1.0512 0.5464 0.0748  0.0316  0.1105  131 GLU E O     
3853 C CB    . GLU E 133 ? 0.6185 1.0988 0.4814 0.1257  0.0692  0.0491  131 GLU E CB    
3854 C CG    . GLU E 133 ? 0.7108 1.1825 0.4962 0.1371  0.0908  0.0320  131 GLU E CG    
3855 C CD    . GLU E 133 ? 0.7840 1.2145 0.5502 0.1656  0.0848  -0.0072 131 GLU E CD    
3856 O OE1   . GLU E 133 ? 0.7745 1.1783 0.5575 0.1743  0.0603  -0.0193 131 GLU E OE1   
3857 O OE2   . GLU E 133 ? 0.8520 1.2639 0.5872 0.1718  0.0997  -0.0245 131 GLU E OE2   
3858 N N     . LYS E 134 ? 0.5728 1.2783 0.5466 0.1551  0.1012  0.0664  132 LYS E N     
3859 C CA    . LYS E 134 ? 0.5365 1.2443 0.5666 0.1530  0.0996  0.0860  132 LYS E CA    
3860 C C     . LYS E 134 ? 0.5135 1.1701 0.5562 0.1585  0.0907  0.0619  132 LYS E C     
3861 O O     . LYS E 134 ? 0.3078 0.9487 0.3917 0.1427  0.0797  0.0769  132 LYS E O     
3862 C CB    . LYS E 134 ? 0.4061 1.1506 0.4455 0.1690  0.1163  0.0953  132 LYS E CB    
3863 N N     . GLU E 135 ? 0.5428 1.1649 0.5457 0.1788  0.0947  0.0238  133 GLU E N     
3864 C CA    . GLU E 135 ? 0.5034 1.0765 0.5171 0.1857  0.0850  0.0015  133 GLU E CA    
3865 C C     . GLU E 135 ? 0.4215 0.9730 0.4485 0.1653  0.0657  0.0023  133 GLU E C     
3866 O O     . GLU E 135 ? 0.3558 0.8839 0.4218 0.1561  0.0536  0.0079  133 GLU E O     
3867 C CB    . GLU E 135 ? 0.5831 1.1100 0.5407 0.2101  0.0924  -0.0388 133 GLU E CB    
3868 C CG    . GLU E 135 ? 0.6158 1.0887 0.5823 0.2203  0.0825  -0.0601 133 GLU E CG    
3869 C CD    . GLU E 135 ? 0.6349 1.1222 0.6519 0.2322  0.0886  -0.0424 133 GLU E CD    
3870 O OE1   . GLU E 135 ? 0.6302 1.0791 0.6593 0.2393  0.0802  -0.0536 133 GLU E OE1   
3871 O OE2   . GLU E 135 ? 0.6449 1.1843 0.6879 0.2321  0.1006  -0.0148 133 GLU E OE2   
3872 N N     . VAL E 136 ? 0.4469 0.9961 0.4381 0.1525  0.0587  0.0006  134 VAL E N     
3873 C CA    . VAL E 136 ? 0.4289 0.9410 0.4289 0.1315  0.0359  0.0052  134 VAL E CA    
3874 C C     . VAL E 136 ? 0.4164 0.9390 0.4733 0.1188  0.0333  0.0386  134 VAL E C     
3875 O O     . VAL E 136 ? 0.4160 0.8982 0.4924 0.1105  0.0204  0.0373  134 VAL E O     
3876 C CB    . VAL E 136 ? 0.4202 0.9375 0.3742 0.1169  0.0266  0.0072  134 VAL E CB    
3877 C CG1   . VAL E 136 ? 0.4800 0.9687 0.3634 0.1223  0.0266  -0.0305 134 VAL E CG1   
3878 C CG2   . VAL E 136 ? 0.4243 1.0021 0.3845 0.1104  0.0367  0.0418  134 VAL E CG2   
3879 N N     . VAL E 137 ? 0.3632 0.9349 0.4416 0.1156  0.0459  0.0689  135 VAL E N     
3880 C CA    . VAL E 137 ? 0.2293 0.7896 0.3488 0.0987  0.0423  0.0992  135 VAL E CA    
3881 C C     . VAL E 137 ? 0.3411 0.8788 0.4879 0.0949  0.0395  0.0927  135 VAL E C     
3882 O O     . VAL E 137 ? 0.3392 0.8481 0.5123 0.0806  0.0311  0.1017  135 VAL E O     
3883 C CB    . VAL E 137 ? 0.2472 0.8508 0.3729 0.0898  0.0518  0.1358  135 VAL E CB    
3884 C CG1   . VAL E 137 ? 0.2383 0.8247 0.4028 0.0712  0.0489  0.1676  135 VAL E CG1   
3885 C CG2   . VAL E 137 ? 0.2609 0.8941 0.3580 0.0912  0.0525  0.1455  135 VAL E CG2   
3886 N N     . ARG E 138 ? 0.3291 0.8837 0.4701 0.1084  0.0471  0.0794  136 ARG E N     
3887 C CA    . ARG E 138 ? 0.2940 0.8381 0.4634 0.1041  0.0430  0.0789  136 ARG E CA    
3888 C C     . ARG E 138 ? 0.2593 0.7520 0.4308 0.1028  0.0279  0.0556  136 ARG E C     
3889 O O     . ARG E 138 ? 0.2496 0.7250 0.4477 0.0843  0.0173  0.0641  136 ARG E O     
3890 C CB    . ARG E 138 ? 0.3130 0.8872 0.4758 0.1261  0.0563  0.0728  136 ARG E CB    
3891 C CG    . ARG E 138 ? 0.2927 0.8778 0.4913 0.1203  0.0535  0.0851  136 ARG E CG    
3892 C CD    . ARG E 138 ? 0.3209 0.9309 0.5127 0.1507  0.0688  0.0786  136 ARG E CD    
3893 N NE    . ARG E 138 ? 0.3607 0.9268 0.5295 0.1745  0.0681  0.0446  136 ARG E NE    
3894 C CZ    . ARG E 138 ? 0.3905 0.9236 0.5763 0.1708  0.0546  0.0359  136 ARG E CZ    
3895 N NH1   . ARG E 138 ? 0.3716 0.9125 0.5951 0.1436  0.0411  0.0563  136 ARG E NH1   
3896 N NH2   . ARG E 138 ? 0.4313 0.9224 0.5926 0.1926  0.0536  0.0072  136 ARG E NH2   
3897 N N     . VAL E 139 ? 0.2504 0.7212 0.3913 0.1204  0.0256  0.0266  137 VAL E N     
3898 C CA    . VAL E 139 ? 0.2524 0.6755 0.3919 0.1183  0.0096  0.0060  137 VAL E CA    
3899 C C     . VAL E 139 ? 0.2341 0.6315 0.3805 0.0999  -0.0011 0.0151  137 VAL E C     
3900 O O     . VAL E 139 ? 0.2434 0.6016 0.3971 0.0898  -0.0129 0.0080  137 VAL E O     
3901 C CB    . VAL E 139 ? 0.3057 0.7101 0.4059 0.1382  0.0077  -0.0255 137 VAL E CB    
3902 C CG1   . VAL E 139 ? 0.3244 0.6812 0.4263 0.1369  -0.0082 -0.0436 137 VAL E CG1   
3903 C CG2   . VAL E 139 ? 0.3612 0.7929 0.4439 0.1645  0.0266  -0.0340 137 VAL E CG2   
3904 N N     . TRP E 140 ? 0.2313 0.6417 0.3693 0.0956  0.0044  0.0324  138 TRP E N     
3905 C CA    . TRP E 140 ? 0.2370 0.6135 0.3785 0.0839  -0.0006 0.0455  138 TRP E CA    
3906 C C     . TRP E 140 ? 0.2583 0.6061 0.4234 0.0671  -0.0020 0.0570  138 TRP E C     
3907 O O     . TRP E 140 ? 0.2596 0.5583 0.4208 0.0605  -0.0089 0.0482  138 TRP E O     
3908 C CB    . TRP E 140 ? 0.2579 0.6622 0.3936 0.0849  0.0073  0.0710  138 TRP E CB    
3909 C CG    . TRP E 140 ? 0.2869 0.6597 0.4243 0.0834  0.0054  0.0855  138 TRP E CG    
3910 C CD1   . TRP E 140 ? 0.3071 0.6797 0.4294 0.0891  -0.0010 0.0831  138 TRP E CD1   
3911 C CD2   . TRP E 140 ? 0.3057 0.6418 0.4590 0.0773  0.0118  0.1070  138 TRP E CD2   
3912 N NE1   . TRP E 140 ? 0.3243 0.6715 0.4587 0.0932  0.0040  0.1043  138 TRP E NE1   
3913 C CE2   . TRP E 140 ? 0.3368 0.6523 0.4858 0.0877  0.0132  0.1165  138 TRP E CE2   
3914 C CE3   . TRP E 140 ? 0.2970 0.6128 0.4643 0.0625  0.0163  0.1206  138 TRP E CE3   
3915 C CZ2   . TRP E 140 ? 0.3649 0.6320 0.5201 0.0913  0.0236  0.1359  138 TRP E CZ2   
3916 C CZ3   . TRP E 140 ? 0.3302 0.5892 0.4970 0.0583  0.0226  0.1375  138 TRP E CZ3   
3917 C CH2   . TRP E 140 ? 0.3703 0.6012 0.5297 0.0763  0.0284  0.1435  138 TRP E CH2   
3918 N N     . PHE E 141 ? 0.3149 0.6932 0.4999 0.0569  0.0041  0.0774  139 PHE E N     
3919 C CA    . PHE E 141 ? 0.3660 0.7140 0.5655 0.0315  -0.0010 0.0895  139 PHE E CA    
3920 C C     . PHE E 141 ? 0.3930 0.7245 0.5971 0.0246  -0.0136 0.0694  139 PHE E C     
3921 O O     . PHE E 141 ? 0.4014 0.6821 0.5991 0.0033  -0.0220 0.0671  139 PHE E O     
3922 C CB    . PHE E 141 ? 0.3731 0.7698 0.5948 0.0165  0.0049  0.1199  139 PHE E CB    
3923 C CG    . PHE E 141 ? 0.4165 0.8088 0.6343 0.0113  0.0137  0.1479  139 PHE E CG    
3924 C CD1   . PHE E 141 ? 0.4631 0.7937 0.6753 -0.0121 0.0116  0.1646  139 PHE E CD1   
3925 C CD2   . PHE E 141 ? 0.4150 0.8593 0.6294 0.0292  0.0243  0.1582  139 PHE E CD2   
3926 C CE1   . PHE E 141 ? 0.4887 0.8091 0.6981 -0.0139 0.0204  0.1942  139 PHE E CE1   
3927 C CE2   . PHE E 141 ? 0.4320 0.8772 0.6456 0.0244  0.0312  0.1894  139 PHE E CE2   
3928 C CZ    . PHE E 141 ? 0.4690 0.8520 0.6832 0.0046  0.0295  0.2089  139 PHE E CZ    
3929 N N     . CYS E 142 ? 0.4197 0.7893 0.6304 0.0429  -0.0144 0.0552  140 CYS E N     
3930 C CA    . CYS E 142 ? 0.4166 0.7736 0.6338 0.0402  -0.0271 0.0396  140 CYS E CA    
3931 C C     . CYS E 142 ? 0.3904 0.6843 0.5831 0.0376  -0.0365 0.0186  140 CYS E C     
3932 O O     . CYS E 142 ? 0.3874 0.6454 0.5774 0.0166  -0.0468 0.0161  140 CYS E O     
3933 C CB    . CYS E 142 ? 0.4485 0.8410 0.6692 0.0679  -0.0218 0.0283  140 CYS E CB    
3934 S SG    . CYS E 142 ? 0.4882 0.9400 0.7259 0.0739  -0.0052 0.0518  140 CYS E SG    
3935 N N     . ASN E 143 ? 0.3317 0.6153 0.5033 0.0561  -0.0336 0.0051  141 ASN E N     
3936 C CA    . ASN E 143 ? 0.3000 0.5374 0.4521 0.0543  -0.0410 -0.0090 141 ASN E CA    
3937 C C     . ASN E 143 ? 0.3126 0.5096 0.4584 0.0413  -0.0357 0.0024  141 ASN E C     
3938 O O     . ASN E 143 ? 0.3260 0.4810 0.4584 0.0347  -0.0401 -0.0076 141 ASN E O     
3939 C CB    . ASN E 143 ? 0.2778 0.5230 0.4098 0.0703  -0.0407 -0.0178 141 ASN E CB    
3940 C CG    . ASN E 143 ? 0.2874 0.5446 0.4097 0.0825  -0.0463 -0.0362 141 ASN E CG    
3941 O OD1   . ASN E 143 ? 0.2846 0.5359 0.4174 0.0831  -0.0528 -0.0444 141 ASN E OD1   
3942 N ND2   . ASN E 143 ? 0.2985 0.5689 0.3964 0.0921  -0.0437 -0.0418 141 ASN E ND2   
3943 N N     . ARG E 144 ? 0.3103 0.5149 0.4615 0.0392  -0.0243 0.0237  142 ARG E N     
3944 C CA    . ARG E 144 ? 0.3389 0.4901 0.4789 0.0289  -0.0166 0.0352  142 ARG E CA    
3945 C C     . ARG E 144 ? 0.3859 0.4976 0.5191 -0.0001 -0.0251 0.0299  142 ARG E C     
3946 O O     . ARG E 144 ? 0.4263 0.4736 0.5336 -0.0082 -0.0226 0.0219  142 ARG E O     
3947 C CB    . ARG E 144 ? 0.3536 0.5198 0.5015 0.0305  -0.0046 0.0631  142 ARG E CB    
3948 C CG    . ARG E 144 ? 0.4161 0.5156 0.5480 0.0268  0.0070  0.0775  142 ARG E CG    
3949 C CD    . ARG E 144 ? 0.4133 0.4818 0.5308 0.0509  0.0161  0.0723  142 ARG E CD    
3950 N NE    . ARG E 144 ? 0.4563 0.4552 0.5564 0.0559  0.0331  0.0879  142 ARG E NE    
3951 C CZ    . ARG E 144 ? 0.5394 0.4558 0.6082 0.0435  0.0374  0.0742  142 ARG E CZ    
3952 N NH1   . ARG E 144 ? 0.5599 0.4655 0.6166 0.0222  0.0232  0.0479  142 ARG E NH1   
3953 N NH2   . ARG E 144 ? 0.6298 0.4704 0.6749 0.0525  0.0565  0.0873  142 ARG E NH2   
3954 N N     . ARG E 145 ? 0.3812 0.5340 0.5352 -0.0164 -0.0345 0.0360  143 ARG E N     
3955 C CA    . ARG E 145 ? 0.3958 0.5247 0.5448 -0.0511 -0.0477 0.0360  143 ARG E CA    
3956 C C     . ARG E 145 ? 0.4044 0.5102 0.5396 -0.0528 -0.0592 0.0125  143 ARG E C     
3957 O O     . ARG E 145 ? 0.4200 0.4689 0.5262 -0.0777 -0.0648 0.0047  143 ARG E O     
3958 C CB    . ARG E 145 ? 0.2478 0.4486 0.4321 -0.0646 -0.0553 0.0556  143 ARG E CB    
3959 C CG    . ARG E 145 ? 0.2791 0.4887 0.4705 -0.0882 -0.0512 0.0848  143 ARG E CG    
3960 C CD    . ARG E 145 ? 0.3279 0.6281 0.5609 -0.0973 -0.0568 0.1083  143 ARG E CD    
3961 N NE    . ARG E 145 ? 0.3464 0.7118 0.6012 -0.0664 -0.0405 0.1198  143 ARG E NE    
3962 C CZ    . ARG E 145 ? 0.3742 0.8267 0.6639 -0.0522 -0.0364 0.1331  143 ARG E CZ    
3963 N NH1   . ARG E 145 ? 0.3968 0.8821 0.7074 -0.0633 -0.0480 0.1395  143 ARG E NH1   
3964 N NH2   . ARG E 145 ? 0.3679 0.8709 0.6655 -0.0242 -0.0186 0.1400  143 ARG E NH2   
3965 N N     . GLN E 146 ? 0.4057 0.5500 0.5555 -0.0284 -0.0630 0.0010  144 GLN E N     
3966 C CA    . GLN E 146 ? 0.4440 0.5702 0.5828 -0.0294 -0.0749 -0.0176 144 GLN E CA    
3967 C C     . GLN E 146 ? 0.5352 0.6020 0.6398 -0.0262 -0.0678 -0.0307 144 GLN E C     
3968 O O     . GLN E 146 ? 0.5547 0.5944 0.6409 -0.0379 -0.0765 -0.0433 144 GLN E O     
3969 C CB    . GLN E 146 ? 0.3791 0.5461 0.5343 -0.0026 -0.0787 -0.0258 144 GLN E CB    
3970 C CG    . GLN E 146 ? 0.3640 0.5873 0.5519 0.0014  -0.0834 -0.0146 144 GLN E CG    
3971 C CD    . GLN E 146 ? 0.3944 0.6244 0.5936 -0.0181 -0.1012 -0.0109 144 GLN E CD    
3972 O OE1   . GLN E 146 ? 0.3911 0.6150 0.5874 -0.0080 -0.1095 -0.0206 144 GLN E OE1   
3973 N NE2   . GLN E 146 ? 0.4325 0.6737 0.6405 -0.0504 -0.1081 0.0071  144 GLN E NE2   
3974 N N     . ARG E 147 ? 0.6025 0.6547 0.6994 -0.0087 -0.0508 -0.0246 145 ARG E N     
3975 C CA    . ARG E 147 ? 0.6402 0.6467 0.7104 0.0027  -0.0390 -0.0312 145 ARG E CA    
3976 C C     . ARG E 147 ? 0.7144 0.6477 0.7487 -0.0181 -0.0324 -0.0358 145 ARG E C     
3977 O O     . ARG E 147 ? 0.7648 0.6570 0.7698 -0.0143 -0.0258 -0.0485 145 ARG E O     
3978 C CB    . ARG E 147 ? 0.6535 0.6760 0.7318 0.0296  -0.0227 -0.0158 145 ARG E CB    
3979 C CG    . ARG E 147 ? 0.7020 0.6804 0.7591 0.0469  -0.0033 -0.0114 145 ARG E CG    
3980 C CD    . ARG E 147 ? 0.6936 0.7153 0.7689 0.0745  0.0065  0.0089  145 ARG E CD    
3981 N NE    . ARG E 147 ? 0.7501 0.7380 0.8138 0.0982  0.0299  0.0228  145 ARG E NE    
3982 C CZ    . ARG E 147 ? 0.7543 0.7852 0.8338 0.1240  0.0385  0.0439  145 ARG E CZ    
3983 N NH1   . ARG E 147 ? 0.6923 0.7939 0.7916 0.1221  0.0225  0.0498  145 ARG E NH1   
3984 N NH2   . ARG E 147 ? 0.8192 0.8214 0.8919 0.1514  0.0636  0.0607  145 ARG E NH2   
3985 N N     . GLU E 148 ? 0.7378 0.6514 0.7684 -0.0422 -0.0338 -0.0256 146 GLU E N     
3986 C CA    . GLU E 148 ? 0.7984 0.6319 0.7831 -0.0726 -0.0326 -0.0331 146 GLU E CA    
3987 C C     . GLU E 148 ? 0.7577 0.5957 0.7314 -0.1070 -0.0555 -0.0456 146 GLU E C     
3988 O O     . GLU E 148 ? 0.8200 0.5911 0.7463 -0.1403 -0.0587 -0.0546 146 GLU E O     
3989 C CB    . GLU E 148 ? 0.8737 0.6809 0.8542 -0.0943 -0.0298 -0.0142 146 GLU E CB    
3990 C CG    . GLU E 148 ? 0.9324 0.7150 0.9131 -0.0630 -0.0055 0.0010  146 GLU E CG    
3991 C CD    . GLU E 148 ? 1.0679 0.7505 0.9963 -0.0487 0.0175  -0.0100 146 GLU E CD    
3992 O OE1   . GLU E 148 ? 1.1431 0.7613 1.0236 -0.0723 0.0144  -0.0316 146 GLU E OE1   
3993 O OE2   . GLU E 148 ? 1.1024 0.7720 1.0357 -0.0122 0.0401  0.0044  146 GLU E OE2   
3994 N N     . LYS E 149 ? 0.6399 0.5508 0.6518 -0.1005 -0.0716 -0.0452 147 LYS E N     
3995 C CA    . LYS E 149 ? 0.6012 0.5291 0.6115 -0.1276 -0.0942 -0.0508 147 LYS E CA    
3996 C C     . LYS E 149 ? 0.5691 0.4846 0.5616 -0.1137 -0.0945 -0.0690 147 LYS E C     
3997 O O     . LYS E 149 ? 0.5397 0.4904 0.5444 -0.1205 -0.1080 -0.0692 147 LYS E O     
3998 C CB    . LYS E 149 ? 0.5344 0.5484 0.5996 -0.1251 -0.1098 -0.0341 147 LYS E CB    
3999 C CG    . LYS E 149 ? 0.5447 0.5855 0.6162 -0.1572 -0.1270 -0.0223 147 LYS E CG    
4000 C CD    . LYS E 149 ? 0.5645 0.6298 0.6524 -0.1827 -0.1310 0.0021  147 LYS E CD    
4001 C CE    . LYS E 149 ? 0.6201 0.6904 0.6936 -0.2101 -0.1399 0.0140  147 LYS E CE    
4002 N NZ    . LYS E 149 ? 0.6875 0.6802 0.7000 -0.2288 -0.1372 -0.0044 147 LYS E NZ    
4003 N N     . ARG E 150 ? 0.5859 0.4631 0.5550 -0.0880 -0.0730 -0.0783 148 ARG E N     
4004 C CA    A ARG E 150 ? 0.6021 0.4770 0.5573 -0.0726 -0.0700 -0.0903 148 ARG E CA    
4005 C CA    B ARG E 150 ? 0.6017 0.4778 0.5574 -0.0738 -0.0711 -0.0904 148 ARG E CA    
4006 C C     . ARG E 150 ? 0.6342 0.4402 0.5293 -0.0933 -0.0635 -0.1064 148 ARG E C     
4007 O O     . ARG E 150 ? 0.7343 0.4866 0.5966 -0.1124 -0.0559 -0.1086 148 ARG E O     
4008 C CB    A ARG E 150 ? 0.5626 0.4486 0.5292 -0.0324 -0.0491 -0.0850 148 ARG E CB    
4009 C CB    B ARG E 150 ? 0.5553 0.4489 0.5260 -0.0334 -0.0524 -0.0850 148 ARG E CB    
4010 C CG    A ARG E 150 ? 0.5395 0.4909 0.5518 -0.0134 -0.0567 -0.0737 148 ARG E CG    
4011 C CG    B ARG E 150 ? 0.5380 0.4929 0.5546 -0.0171 -0.0593 -0.0727 148 ARG E CG    
4012 C CD    A ARG E 150 ? 0.2645 0.2283 0.2822 0.0181  -0.0384 -0.0639 148 ARG E CD    
4013 C CD    B ARG E 150 ? 0.5053 0.4914 0.5335 0.0108  -0.0529 -0.0679 148 ARG E CD    
4014 N NE    A ARG E 150 ? 0.5035 0.5239 0.5523 0.0307  -0.0469 -0.0552 148 ARG E NE    
4015 N NE    B ARG E 150 ? 0.4900 0.5255 0.5479 0.0213  -0.0610 -0.0605 148 ARG E NE    
4016 C CZ    A ARG E 150 ? 0.2060 0.2533 0.2643 0.0519  -0.0368 -0.0411 148 ARG E CZ    
4017 C CZ    B ARG E 150 ? 0.1762 0.2379 0.2501 0.0147  -0.0787 -0.0654 148 ARG E CZ    
4018 N NH1   A ARG E 150 ? 0.2335 0.2626 0.2817 0.0692  -0.0156 -0.0303 148 ARG E NH1   
4019 N NH1   B ARG E 150 ? 0.1805 0.2338 0.2525 -0.0035 -0.0931 -0.0724 148 ARG E NH1   
4020 N NH2   A ARG E 150 ? 0.1751 0.2672 0.2500 0.0562  -0.0471 -0.0365 148 ARG E NH2   
4021 N NH2   B ARG E 150 ? 0.1552 0.2508 0.2441 0.0276  -0.0807 -0.0619 148 ARG E NH2   
4022 N N     . VAL E 151 ? 0.5965 0.4122 0.4806 -0.0857 -0.0632 -0.1145 149 VAL E N     
4023 C CA    . VAL E 151 ? 0.6603 0.4312 0.4976 -0.0916 -0.0487 -0.1250 149 VAL E CA    
4024 C C     . VAL E 151 ? 0.7413 0.4462 0.5346 -0.0623 -0.0143 -0.1346 149 VAL E C     
4025 O O     . VAL E 151 ? 0.8220 0.4686 0.5712 -0.0633 0.0047  -0.1418 149 VAL E O     
4026 C CB    . VAL E 151 ? 0.6355 0.4509 0.4827 -0.0946 -0.0607 -0.1244 149 VAL E CB    
4027 C CG1   . VAL E 151 ? 0.7295 0.4989 0.5207 -0.0887 -0.0406 -0.1377 149 VAL E CG1   
4028 C CG2   . VAL E 151 ? 0.6356 0.4845 0.5045 -0.1176 -0.0795 -0.1141 149 VAL E CG2   
4029 N N     . LYS E 152 ? 0.7192 0.4690 0.5535 -0.0248 -0.0036 -0.1202 150 LYS E N     
4030 C CA    . LYS E 152 ? 0.7718 0.4972 0.5938 0.0165  0.0324  -0.1137 150 LYS E CA    
4031 C C     . LYS E 152 ? 0.7761 0.5495 0.6511 0.0430  0.0357  -0.0901 150 LYS E C     
4032 O O     . LYS E 152 ? 0.7254 0.5726 0.6458 0.0445  0.0164  -0.0796 150 LYS E O     
4033 C CB    . LYS E 152 ? 0.7405 0.4959 0.5558 0.0366  0.0437  -0.1131 150 LYS E CB    
4034 C CG    . LYS E 152 ? 0.8096 0.5155 0.5628 0.0152  0.0473  -0.1358 150 LYS E CG    
4035 C CD    . LYS E 152 ? 0.9303 0.5408 0.6226 0.0201  0.0767  -0.1490 150 LYS E CD    
4036 C CE    . LYS E 152 ? 0.9772 0.5652 0.6268 -0.0142 0.0663  -0.1640 150 LYS E CE    
4037 N NZ    . LYS E 152 ? 1.0668 0.5755 0.6684 -0.0223 0.0814  -0.1715 150 LYS E NZ    
4038 O OXT   . LYS E 152 ? 0.8501 0.5860 0.7192 0.0620  0.0574  -0.0806 150 LYS E OXT   
4039 N N     . ASP F 4   ? 0.8950 1.2496 1.1730 0.3799  0.0549  -0.0711 2   ASP F N     
4040 C CA    . ASP F 4   ? 0.9327 1.2813 1.2139 0.3890  0.0622  -0.0905 2   ASP F CA    
4041 C C     . ASP F 4   ? 0.9694 1.2813 1.2734 0.3945  0.0627  -0.0900 2   ASP F C     
4042 O O     . ASP F 4   ? 0.9749 1.2680 1.3107 0.4007  0.0645  -0.0765 2   ASP F O     
4043 C CB    . ASP F 4   ? 0.9498 1.3129 1.2429 0.4011  0.0711  -0.0955 2   ASP F CB    
4044 C CG    . ASP F 4   ? 0.9639 1.3334 1.2466 0.4060  0.0779  -0.1194 2   ASP F CG    
4045 O OD1   . ASP F 4   ? 0.9522 1.3461 1.2092 0.3980  0.0770  -0.1310 2   ASP F OD1   
4046 O OD2   . ASP F 4   ? 0.9830 1.3327 1.2844 0.4171  0.0843  -0.1271 2   ASP F OD2   
4047 N N     . SER F 5   ? 0.9899 1.2919 1.2780 0.3918  0.0605  -0.1064 3   SER F N     
4048 C CA    . SER F 5   ? 1.0175 1.2843 1.3215 0.3959  0.0597  -0.1107 3   SER F CA    
4049 C C     . SER F 5   ? 1.0881 1.3501 1.3872 0.4051  0.0657  -0.1374 3   SER F C     
4050 O O     . SER F 5   ? 1.1022 1.3896 1.3777 0.4042  0.0680  -0.1538 3   SER F O     
4051 C CB    . SER F 5   ? 0.9689 1.2259 1.2542 0.3838  0.0487  -0.1094 3   SER F CB    
4052 O OG    . SER F 5   ? 0.9281 1.1921 1.2132 0.3736  0.0428  -0.0864 3   SER F OG    
4053 N N     . PRO F 6   ? 1.1356 1.3646 1.4572 0.4131  0.0686  -0.1430 4   PRO F N     
4054 C CA    . PRO F 6   ? 1.1711 1.3940 1.4872 0.4214  0.0733  -0.1709 4   PRO F CA    
4055 C C     . PRO F 6   ? 1.2045 1.4411 1.4807 0.4133  0.0659  -0.1971 4   PRO F C     
4056 O O     . PRO F 6   ? 1.1995 1.4447 1.4637 0.4175  0.0702  -0.2200 4   PRO F O     
4057 C CB    . PRO F 6   ? 1.1695 1.3505 1.5148 0.4280  0.0751  -0.1704 4   PRO F CB    
4058 C CG    . PRO F 6   ? 1.1578 1.3283 1.5364 0.4278  0.0787  -0.1368 4   PRO F CG    
4059 C CD    . PRO F 6   ? 1.1354 1.3318 1.4934 0.4151  0.0697  -0.1229 4   PRO F CD    
4060 N N     . GLU F 7   ? 1.2356 1.4748 1.4915 0.4014  0.0555  -0.1937 5   GLU F N     
4061 C CA    . GLU F 7   ? 1.2245 1.4807 1.4430 0.3927  0.0504  -0.2158 5   GLU F CA    
4062 C C     . GLU F 7   ? 1.1539 1.4498 1.3525 0.3867  0.0556  -0.2120 5   GLU F C     
4063 O O     . GLU F 7   ? 1.1740 1.4872 1.3486 0.3832  0.0586  -0.2312 5   GLU F O     
4064 C CB    . GLU F 7   ? 1.1945 1.4384 1.3994 0.3823  0.0383  -0.2136 5   GLU F CB    
4065 C CG    . GLU F 7   ? 1.1991 1.4016 1.4262 0.3857  0.0316  -0.2153 5   GLU F CG    
4066 C CD    . GLU F 7   ? 1.1988 1.3852 1.4554 0.3858  0.0317  -0.1826 5   GLU F CD    
4067 O OE1   . GLU F 7   ? 1.1789 1.3870 1.4313 0.3801  0.0325  -0.1606 5   GLU F OE1   
4068 O OE2   . GLU F 7   ? 1.2264 1.3783 1.5105 0.3903  0.0315  -0.1785 5   GLU F OE2   
4069 N N     . ILE F 8   ? 1.0117 1.3213 1.2205 0.3841  0.0565  -0.1872 6   ILE F N     
4070 C CA    . ILE F 8   ? 0.9178 1.2632 1.1125 0.3779  0.0608  -0.1838 6   ILE F CA    
4071 C C     . ILE F 8   ? 0.9035 1.2593 1.1058 0.3878  0.0710  -0.1944 6   ILE F C     
4072 O O     . ILE F 8   ? 0.9150 1.2961 1.0999 0.3830  0.0755  -0.2046 6   ILE F O     
4073 C CB    . ILE F 8   ? 0.8638 1.2184 1.0683 0.3726  0.0576  -0.1568 6   ILE F CB    
4074 C CG1   . ILE F 8   ? 0.7907 1.1388 0.9830 0.3605  0.0478  -0.1472 6   ILE F CG1   
4075 C CG2   . ILE F 8   ? 0.8695 1.2585 1.0643 0.3674  0.0618  -0.1551 6   ILE F CG2   
4076 C CD1   . ILE F 8   ? 0.7289 1.0865 0.9263 0.3530  0.0439  -0.1227 6   ILE F CD1   
4077 N N     . ARG F 9   ? 0.8761 1.2118 1.1065 0.4014  0.0757  -0.1913 7   ARG F N     
4078 C CA    . ARG F 9   ? 0.8434 1.1873 1.0830 0.4119  0.0858  -0.2007 7   ARG F CA    
4079 C C     . ARG F 9   ? 0.8580 1.2042 1.0766 0.4117  0.0884  -0.2290 7   ARG F C     
4080 O O     . ARG F 9   ? 0.8568 1.2262 1.0639 0.4108  0.0946  -0.2380 7   ARG F O     
4081 C CB    . ARG F 9   ? 0.8256 1.1437 1.1019 0.4259  0.0912  -0.1914 7   ARG F CB    
4082 N N     . GLU F 10  ? 0.8795 1.2015 1.0928 0.4117  0.0833  -0.2437 8   GLU F N     
4083 C CA    . GLU F 10  ? 0.9389 1.2627 1.1290 0.4100  0.0843  -0.2714 8   GLU F CA    
4084 C C     . GLU F 10  ? 0.9542 1.3057 1.1108 0.3955  0.0835  -0.2752 8   GLU F C     
4085 O O     . GLU F 10  ? 0.9670 1.3284 1.1039 0.3933  0.0880  -0.2933 8   GLU F O     
4086 C CB    . GLU F 10  ? 0.9545 1.2461 1.1454 0.4115  0.0766  -0.2869 8   GLU F CB    
4087 N N     . LEU F 11  ? 0.9440 1.3073 1.0952 0.3852  0.0787  -0.2573 9   LEU F N     
4088 C CA    . LEU F 11  ? 0.9337 1.3213 1.0570 0.3701  0.0792  -0.2583 9   LEU F CA    
4089 C C     . LEU F 11  ? 0.9588 1.3755 1.0819 0.3674  0.0879  -0.2547 9   LEU F C     
4090 O O     . LEU F 11  ? 0.9439 1.3759 1.0473 0.3594  0.0935  -0.2651 9   LEU F O     
4091 C CB    . LEU F 11  ? 0.8725 1.2609 0.9925 0.3597  0.0709  -0.2408 9   LEU F CB    
4092 C CG    . LEU F 11  ? 0.8380 1.2301 0.9291 0.3455  0.0672  -0.2467 9   LEU F CG    
4093 C CD1   . LEU F 11  ? 0.8432 1.2125 0.9213 0.3494  0.0640  -0.2684 9   LEU F CD1   
4094 C CD2   . LEU F 11  ? 0.8039 1.1936 0.8975 0.3378  0.0586  -0.2277 9   LEU F CD2   
4095 N N     . GLU F 12  ? 1.0073 1.4313 1.1526 0.3735  0.0895  -0.2395 10  GLU F N     
4096 C CA    . GLU F 12  ? 1.0368 1.4872 1.1840 0.3719  0.0967  -0.2378 10  GLU F CA    
4097 C C     . GLU F 12  ? 1.0738 1.5252 1.2187 0.3799  0.1057  -0.2564 10  GLU F C     
4098 O O     . GLU F 12  ? 1.1061 1.5766 1.2381 0.3728  0.1120  -0.2639 10  GLU F O     
4099 C CB    . GLU F 12  ? 1.0493 1.5049 1.2201 0.3787  0.0957  -0.2192 10  GLU F CB    
4100 C CG    . GLU F 12  ? 1.0356 1.4953 1.2074 0.3695  0.0873  -0.1997 10  GLU F CG    
4101 C CD    . GLU F 12  ? 1.0606 1.5295 1.2513 0.3752  0.0870  -0.1830 10  GLU F CD    
4102 O OE1   . GLU F 12  ? 1.0929 1.5489 1.3037 0.3895  0.0903  -0.1792 10  GLU F OE1   
4103 O OE2   . GLU F 12  ? 1.0517 1.5402 1.2377 0.3653  0.0835  -0.1741 10  GLU F OE2   
4104 N N     . LYS F 13  ? 1.0641 1.4938 1.2232 0.3943  0.1070  -0.2636 11  LYS F N     
4105 C CA    . LYS F 13  ? 1.0912 1.5208 1.2502 0.4030  0.1154  -0.2811 11  LYS F CA    
4106 C C     . LYS F 13  ? 1.0901 1.5237 1.2202 0.3944  0.1175  -0.2996 11  LYS F C     
4107 O O     . LYS F 13  ? 1.1066 1.5562 1.2283 0.3930  0.1257  -0.3079 11  LYS F O     
4108 C CB    . LYS F 13  ? 1.1244 1.5257 1.3049 0.4185  0.1158  -0.2863 11  LYS F CB    
4109 N N     . PHE F 14  ? 1.0641 1.4829 1.1788 0.3884  0.1105  -0.3053 12  PHE F N     
4110 C CA    . PHE F 14  ? 1.0392 1.4606 1.1245 0.3802  0.1125  -0.3212 12  PHE F CA    
4111 C C     . PHE F 14  ? 0.9875 1.4349 1.0573 0.3651  0.1178  -0.3126 12  PHE F C     
4112 O O     . PHE F 14  ? 0.9880 1.4460 1.0428 0.3615  0.1262  -0.3217 12  PHE F O     
4113 C CB    . PHE F 14  ? 1.0274 1.4268 1.1000 0.3772  0.1027  -0.3283 12  PHE F CB    
4114 C CG    . PHE F 14  ? 1.0427 1.4416 1.0841 0.3705  0.1040  -0.3448 12  PHE F CG    
4115 C CD1   . PHE F 14  ? 1.0385 1.4548 1.0565 0.3557  0.1081  -0.3382 12  PHE F CD1   
4116 C CD2   . PHE F 14  ? 1.0722 1.4522 1.1088 0.3789  0.1013  -0.3662 12  PHE F CD2   
4117 C CE1   . PHE F 14  ? 1.0618 1.4766 1.0509 0.3503  0.1105  -0.3502 12  PHE F CE1   
4118 C CE2   . PHE F 14  ? 1.0968 1.4771 1.1031 0.3735  0.1020  -0.3803 12  PHE F CE2   
4119 C CZ    . PHE F 14  ? 1.0896 1.4873 1.0714 0.3595  0.1071  -0.3711 12  PHE F CZ    
4120 N N     . ALA F 15  ? 0.9436 1.4001 1.0185 0.3560  0.1134  -0.2946 13  ALA F N     
4121 C CA    . ALA F 15  ? 0.9141 1.3931 0.9789 0.3406  0.1184  -0.2862 13  ALA F CA    
4122 C C     . ALA F 15  ? 0.9493 1.4481 1.0245 0.3425  0.1280  -0.2866 13  ALA F C     
4123 O O     . ALA F 15  ? 0.9944 1.5064 1.0583 0.3332  0.1366  -0.2895 13  ALA F O     
4124 C CB    . ALA F 15  ? 0.8401 1.3242 0.9120 0.3315  0.1108  -0.2676 13  ALA F CB    
4125 N N     . ASN F 16  ? 0.9071 1.4075 1.0048 0.3547  0.1274  -0.2830 14  ASN F N     
4126 C CA    . ASN F 16  ? 0.8833 1.4021 0.9911 0.3579  0.1360  -0.2848 14  ASN F CA    
4127 C C     . ASN F 16  ? 0.8899 1.4051 0.9869 0.3637  0.1450  -0.3027 14  ASN F C     
4128 O O     . ASN F 16  ? 0.8907 1.4215 0.9833 0.3588  0.1542  -0.3064 14  ASN F O     
4129 C CB    . ASN F 16  ? 0.8977 1.4178 1.0308 0.3705  0.1334  -0.2758 14  ASN F CB    
4130 C CG    . ASN F 16  ? 0.8835 1.4091 1.0262 0.3648  0.1248  -0.2572 14  ASN F CG    
4131 O OD1   . ASN F 16  ? 0.8863 1.3994 1.0429 0.3739  0.1190  -0.2477 14  ASN F OD1   
4132 N ND2   . ASN F 16  ? 0.8668 1.4099 1.0032 0.3497  0.1245  -0.2513 14  ASN F ND2   
4133 N N     . GLU F 17  ? 0.8982 1.3920 0.9917 0.3743  0.1424  -0.3145 15  GLU F N     
4134 C CA    . GLU F 17  ? 0.9271 1.4164 1.0085 0.3800  0.1497  -0.3328 15  GLU F CA    
4135 C C     . GLU F 17  ? 0.9334 1.4273 0.9870 0.3671  0.1542  -0.3378 15  GLU F C     
4136 O O     . GLU F 17  ? 0.9529 1.4537 0.9962 0.3676  0.1638  -0.3473 15  GLU F O     
4137 C CB    . GLU F 17  ? 0.9405 1.4041 1.0258 0.3932  0.1446  -0.3455 15  GLU F CB    
4138 N N     . PHE F 18  ? 0.9204 1.4099 0.9616 0.3560  0.1480  -0.3306 16  PHE F N     
4139 C CA    . PHE F 18  ? 0.9125 1.4063 0.9283 0.3430  0.1536  -0.3314 16  PHE F CA    
4140 C C     . PHE F 18  ? 0.9243 1.4402 0.9447 0.3330  0.1645  -0.3224 16  PHE F C     
4141 O O     . PHE F 18  ? 0.9484 1.4688 0.9524 0.3271  0.1749  -0.3260 16  PHE F O     
4142 C CB    . PHE F 18  ? 0.8524 1.3368 0.8565 0.3331  0.1446  -0.3236 16  PHE F CB    
4143 C CG    . PHE F 18  ? 0.8248 1.3120 0.8032 0.3196  0.1509  -0.3214 16  PHE F CG    
4144 C CD1   . PHE F 18  ? 0.8316 1.3080 0.7849 0.3223  0.1530  -0.3348 16  PHE F CD1   
4145 C CD2   . PHE F 18  ? 0.8015 1.3019 0.7819 0.3046  0.1555  -0.3059 16  PHE F CD2   
4146 C CE1   . PHE F 18  ? 0.8298 1.3080 0.7590 0.3110  0.1599  -0.3306 16  PHE F CE1   
4147 C CE2   . PHE F 18  ? 0.7967 1.2974 0.7554 0.2927  0.1632  -0.3023 16  PHE F CE2   
4148 C CZ    . PHE F 18  ? 0.8090 1.2986 0.7415 0.2962  0.1659  -0.3136 16  PHE F CZ    
4149 N N     . LYS F 19  ? 0.9073 1.4362 0.9506 0.3315  0.1625  -0.3106 17  LYS F N     
4150 C CA    . LYS F 19  ? 0.8987 1.4479 0.9501 0.3216  0.1715  -0.3031 17  LYS F CA    
4151 C C     . LYS F 19  ? 0.9534 1.5111 1.0073 0.3286  0.1833  -0.3133 17  LYS F C     
4152 O O     . LYS F 19  ? 0.9867 1.5528 1.0335 0.3205  0.1950  -0.3136 17  LYS F O     
4153 C CB    . LYS F 19  ? 0.8617 1.4225 0.9368 0.3201  0.1642  -0.2902 17  LYS F CB    
4154 C CG    . LYS F 19  ? 0.8453 1.4265 0.9315 0.3086  0.1710  -0.2829 17  LYS F CG    
4155 C CD    . LYS F 19  ? 0.8293 1.4100 0.9031 0.2914  0.1748  -0.2764 17  LYS F CD    
4156 C CE    . LYS F 19  ? 0.7973 1.3937 0.8892 0.2801  0.1731  -0.2649 17  LYS F CE    
4157 N NZ    . LYS F 19  ? 0.7949 1.4090 0.9069 0.2847  0.1778  -0.2676 17  LYS F NZ    
4158 N N     . VAL F 20  ? 0.9568 1.5115 1.0219 0.3439  0.1813  -0.3210 18  VAL F N     
4159 C CA    . VAL F 20  ? 0.9545 1.5173 1.0229 0.3513  0.1922  -0.3307 18  VAL F CA    
4160 C C     . VAL F 20  ? 0.9778 1.5319 1.0212 0.3515  0.2002  -0.3430 18  VAL F C     
4161 O O     . VAL F 20  ? 0.9990 1.5628 1.0369 0.3477  0.2128  -0.3453 18  VAL F O     
4162 C CB    . VAL F 20  ? 0.9334 1.4929 1.0199 0.3681  0.1884  -0.3354 18  VAL F CB    
4163 C CG1   . VAL F 20  ? 0.8916 1.4676 1.0025 0.3683  0.1857  -0.3234 18  VAL F CG1   
4164 C CG2   . VAL F 20  ? 0.9244 1.4622 1.0093 0.3765  0.1779  -0.3385 18  VAL F CG2   
4165 N N     . ARG F 21  ? 0.9706 1.5060 0.9987 0.3566  0.1932  -0.3513 19  ARG F N     
4166 C CA    . ARG F 21  ? 1.0080 1.5351 1.0104 0.3582  0.1991  -0.3640 19  ARG F CA    
4167 C C     . ARG F 21  ? 0.9975 1.5297 0.9809 0.3435  0.2074  -0.3562 19  ARG F C     
4168 O O     . ARG F 21  ? 1.0380 1.5705 1.0031 0.3439  0.2178  -0.3630 19  ARG F O     
4169 C CB    . ARG F 21  ? 1.0302 1.5361 1.0218 0.3660  0.1878  -0.3751 19  ARG F CB    
4170 C CG    . ARG F 21  ? 1.0444 1.5411 1.0566 0.3815  0.1817  -0.3835 19  ARG F CG    
4171 C CD    . ARG F 21  ? 0.9377 1.4333 0.9474 0.3935  0.1889  -0.4002 19  ARG F CD    
4172 N NE    . ARG F 21  ? 0.9650 1.4586 0.9455 0.3910  0.1942  -0.4107 19  ARG F NE    
4173 C CZ    . ARG F 21  ? 1.0024 1.5005 0.9756 0.3980  0.2035  -0.4225 19  ARG F CZ    
4174 N NH1   . ARG F 21  ? 1.0028 1.5071 0.9961 0.4074  0.2084  -0.4257 19  ARG F NH1   
4175 N NH2   . ARG F 21  ? 1.0213 1.5179 0.9667 0.3964  0.2081  -0.4305 19  ARG F NH2   
4176 N N     . ARG F 22  ? 0.9379 1.4737 0.9260 0.3309  0.2037  -0.3415 20  ARG F N     
4177 C CA    . ARG F 22  ? 0.9060 1.4457 0.8800 0.3165  0.2132  -0.3324 20  ARG F CA    
4178 C C     . ARG F 22  ? 0.9019 1.4572 0.8861 0.3128  0.2292  -0.3295 20  ARG F C     
4179 O O     . ARG F 22  ? 0.9114 1.4668 0.8798 0.3081  0.2426  -0.3292 20  ARG F O     
4180 C CB    . ARG F 22  ? 0.8510 1.3904 0.8309 0.3041  0.2051  -0.3176 20  ARG F CB    
4181 C CG    . ARG F 22  ? 0.8380 1.3801 0.8075 0.2884  0.2153  -0.3063 20  ARG F CG    
4182 C CD    . ARG F 22  ? 0.8067 1.3540 0.7923 0.2764  0.2084  -0.2915 20  ARG F CD    
4183 N NE    . ARG F 22  ? 0.7905 1.3552 0.8029 0.2722  0.2137  -0.2857 20  ARG F NE    
4184 C CZ    . ARG F 22  ? 0.7969 1.3694 0.8146 0.2614  0.2274  -0.2791 20  ARG F CZ    
4185 N NH1   . ARG F 22  ? 0.8221 1.3861 0.8197 0.2541  0.2385  -0.2758 20  ARG F NH1   
4186 N NH2   . ARG F 22  ? 0.7780 1.3664 0.8219 0.2586  0.2305  -0.2758 20  ARG F NH2   
4187 N N     . ILE F 23  ? 0.8780 1.4466 0.8890 0.3154  0.2284  -0.3271 21  ILE F N     
4188 C CA    . ILE F 23  ? 0.8997 1.4834 0.9232 0.3123  0.2429  -0.3255 21  ILE F CA    
4189 C C     . ILE F 23  ? 0.9508 1.5341 0.9661 0.3241  0.2525  -0.3390 21  ILE F C     
4190 O O     . ILE F 23  ? 0.9687 1.5567 0.9780 0.3210  0.2683  -0.3395 21  ILE F O     
4191 C CB    . ILE F 23  ? 0.8108 1.4098 0.8649 0.3116  0.2375  -0.3192 21  ILE F CB    
4192 C CG1   . ILE F 23  ? 0.7758 1.3763 0.8371 0.2989  0.2291  -0.3058 21  ILE F CG1   
4193 C CG2   . ILE F 23  ? 0.8192 1.4340 0.8879 0.3100  0.2519  -0.3200 21  ILE F CG2   
4194 C CD1   . ILE F 23  ? 0.7508 1.3664 0.8397 0.2988  0.2215  -0.2998 21  ILE F CD1   
4195 N N     . LYS F 24  ? 0.9654 1.5423 0.9813 0.3381  0.2439  -0.3499 22  LYS F N     
4196 C CA    . LYS F 24  ? 0.9923 1.5683 1.0010 0.3501  0.2518  -0.3638 22  LYS F CA    
4197 C C     . LYS F 24  ? 1.0200 1.5876 0.9987 0.3489  0.2609  -0.3694 22  LYS F C     
4198 O O     . LYS F 24  ? 1.0600 1.6318 1.0324 0.3543  0.2733  -0.3767 22  LYS F O     
4199 C CB    . LYS F 24  ? 0.9303 1.4968 0.9446 0.3649  0.2402  -0.3745 22  LYS F CB    
4200 N N     . LEU F 25  ? 1.0039 1.5604 0.9634 0.3424  0.2552  -0.3657 23  LEU F N     
4201 C CA    . LEU F 25  ? 1.0203 1.5699 0.9497 0.3410  0.2638  -0.3689 23  LEU F CA    
4202 C C     . LEU F 25  ? 1.0058 1.5623 0.9325 0.3278  0.2799  -0.3554 23  LEU F C     
4203 O O     . LEU F 25  ? 1.0180 1.5693 0.9199 0.3264  0.2893  -0.3553 23  LEU F O     
4204 C CB    . LEU F 25  ? 1.0224 1.5565 0.9310 0.3412  0.2503  -0.3721 23  LEU F CB    
4205 C CG    . LEU F 25  ? 1.0507 1.5731 0.9511 0.3558  0.2385  -0.3904 23  LEU F CG    
4206 C CD1   . LEU F 25  ? 1.0444 1.5686 0.9724 0.3656  0.2318  -0.3965 23  LEU F CD1   
4207 C CD2   . LEU F 25  ? 1.0523 1.5599 0.9368 0.3536  0.2244  -0.3916 23  LEU F CD2   
4208 N N     . GLY F 26  ? 0.9817 1.5492 0.9338 0.3188  0.2834  -0.3442 24  GLY F N     
4209 C CA    . GLY F 26  ? 0.9922 1.5652 0.9469 0.3069  0.3004  -0.3325 24  GLY F CA    
4210 C C     . GLY F 26  ? 0.9948 1.5586 0.9349 0.2948  0.2998  -0.3208 24  GLY F C     
4211 O O     . GLY F 26  ? 1.0098 1.5725 0.9418 0.2876  0.3165  -0.3131 24  GLY F O     
4212 N N     . TYR F 27  ? 0.9746 1.5314 0.9123 0.2927  0.2819  -0.3188 25  TYR F N     
4213 C CA    . TYR F 27  ? 0.9521 1.5001 0.8771 0.2810  0.2795  -0.3074 25  TYR F CA    
4214 C C     . TYR F 27  ? 0.9015 1.4569 0.8528 0.2686  0.2765  -0.2942 25  TYR F C     
4215 O O     . TYR F 27  ? 0.8614 1.4249 0.8353 0.2713  0.2653  -0.2956 25  TYR F O     
4216 C CB    . TYR F 27  ? 0.9490 1.4838 0.8544 0.2861  0.2616  -0.3133 25  TYR F CB    
4217 C CG    . TYR F 27  ? 0.9770 1.5025 0.8509 0.2955  0.2638  -0.3246 25  TYR F CG    
4218 C CD1   . TYR F 27  ? 0.9841 1.5026 0.8318 0.2899  0.2723  -0.3183 25  TYR F CD1   
4219 C CD2   . TYR F 27  ? 0.9926 1.5160 0.8630 0.3106  0.2567  -0.3417 25  TYR F CD2   
4220 C CE1   . TYR F 27  ? 1.0084 1.5203 0.8264 0.2995  0.2730  -0.3289 25  TYR F CE1   
4221 C CE2   . TYR F 27  ? 1.0218 1.5378 0.8639 0.3197  0.2573  -0.3534 25  TYR F CE2   
4222 C CZ    . TYR F 27  ? 1.0272 1.5384 0.8426 0.3144  0.2649  -0.3470 25  TYR F CZ    
4223 O OH    . TYR F 27  ? 1.0409 1.5467 0.8274 0.3244  0.2645  -0.3590 25  TYR F OH    
4224 N N     . THR F 28  ? 0.9013 1.4539 0.8500 0.2556  0.2867  -0.2815 26  THR F N     
4225 C CA    . THR F 28  ? 0.8723 1.4296 0.8429 0.2430  0.2820  -0.2692 26  THR F CA    
4226 C C     . THR F 28  ? 0.8889 1.4351 0.8459 0.2383  0.2658  -0.2641 26  THR F C     
4227 O O     . THR F 28  ? 0.9165 1.4505 0.8456 0.2426  0.2620  -0.2682 26  THR F O     
4228 C CB    . THR F 28  ? 0.8610 1.4195 0.8399 0.2312  0.3022  -0.2579 26  THR F CB    
4229 O OG1   . THR F 28  ? 0.8219 1.3660 0.7730 0.2268  0.3107  -0.2520 26  THR F OG1   
4230 C CG2   . THR F 28  ? 0.8977 1.4659 0.8892 0.2366  0.3198  -0.2632 26  THR F CG2   
4231 N N     . GLN F 29  ? 0.8727 1.4240 0.8501 0.2299  0.2558  -0.2556 27  GLN F N     
4232 C CA    . GLN F 29  ? 0.7281 1.2696 0.6953 0.2249  0.2406  -0.2497 27  GLN F CA    
4233 C C     . GLN F 29  ? 0.9387 1.4663 0.8801 0.2168  0.2487  -0.2421 27  GLN F C     
4234 O O     . GLN F 29  ? 0.9393 1.4550 0.8587 0.2184  0.2381  -0.2431 27  GLN F O     
4235 C CB    . GLN F 29  ? 0.6889 1.2393 0.6827 0.2159  0.2313  -0.2403 27  GLN F CB    
4236 C CG    . GLN F 29  ? 0.6789 1.2383 0.6904 0.2258  0.2159  -0.2464 27  GLN F CG    
4237 C CD    . GLN F 29  ? 0.6390 1.2088 0.6756 0.2177  0.2071  -0.2372 27  GLN F CD    
4238 O OE1   . GLN F 29  ? 0.6246 1.1955 0.6679 0.2042  0.2127  -0.2274 27  GLN F OE1   
4239 N NE2   . GLN F 29  ? 0.6264 1.2032 0.6771 0.2267  0.1935  -0.2401 27  GLN F NE2   
4240 N N     . THR F 30  ? 0.7490 1.2771 0.6930 0.2086  0.2681  -0.2344 28  THR F N     
4241 C CA    . THR F 30  ? 0.9312 1.4454 0.8498 0.2023  0.2782  -0.2265 28  THR F CA    
4242 C C     . THR F 30  ? 1.0053 1.5121 0.8918 0.2141  0.2807  -0.2368 28  THR F C     
4243 O O     . THR F 30  ? 1.0426 1.5371 0.9018 0.2128  0.2777  -0.2340 28  THR F O     
4244 C CB    . THR F 30  ? 0.9105 1.4257 0.8425 0.1925  0.3009  -0.2159 28  THR F CB    
4245 O OG1   . THR F 30  ? 0.8661 1.3898 0.8306 0.1830  0.2971  -0.2087 28  THR F OG1   
4246 C CG2   . THR F 30  ? 0.9130 1.4125 0.8212 0.1848  0.3111  -0.2051 28  THR F CG2   
4247 N N     . ASN F 31  ? 1.0362 1.5505 0.9252 0.2260  0.2850  -0.2494 29  ASN F N     
4248 C CA    . ASN F 31  ? 1.1106 1.6190 0.9699 0.2379  0.2870  -0.2605 29  ASN F CA    
4249 C C     . ASN F 31  ? 1.1591 1.6596 1.0022 0.2457  0.2650  -0.2699 29  ASN F C     
4250 O O     . ASN F 31  ? 1.1912 1.6818 1.0044 0.2498  0.2626  -0.2734 29  ASN F O     
4251 C CB    . ASN F 31  ? 1.1039 1.6223 0.9718 0.2487  0.2969  -0.2718 29  ASN F CB    
4252 C CG    . ASN F 31  ? 1.0899 1.6130 0.9665 0.2434  0.3220  -0.2643 29  ASN F CG    
4253 O OD1   . ASN F 31  ? 1.0685 1.6011 0.9752 0.2380  0.3287  -0.2599 29  ASN F OD1   
4254 N ND2   . ASN F 31  ? 1.1110 1.6276 0.9618 0.2455  0.3363  -0.2631 29  ASN F ND2   
4255 N N     . VAL F 32  ? 1.1195 1.6240 0.9827 0.2487  0.2491  -0.2745 30  VAL F N     
4256 C CA    . VAL F 32  ? 0.8361 1.3310 0.6884 0.2558  0.2292  -0.2832 30  VAL F CA    
4257 C C     . VAL F 32  ? 1.2927 1.7764 1.1290 0.2456  0.2226  -0.2724 30  VAL F C     
4258 O O     . VAL F 32  ? 0.8370 1.3092 0.6503 0.2508  0.2123  -0.2791 30  VAL F O     
4259 C CB    . VAL F 32  ? 0.8108 1.3119 0.6910 0.2608  0.2158  -0.2876 30  VAL F CB    
4260 C CG1   . VAL F 32  ? 0.8212 1.3112 0.6922 0.2732  0.1993  -0.3017 30  VAL F CG1   
4261 C CG2   . VAL F 32  ? 0.8472 1.3621 0.7484 0.2664  0.2254  -0.2924 30  VAL F CG2   
4262 N N     . GLY F 33  ? 1.2895 1.7762 1.1393 0.2312  0.2278  -0.2562 31  GLY F N     
4263 C CA    . GLY F 33  ? 1.1966 1.6724 1.0319 0.2204  0.2233  -0.2443 31  GLY F CA    
4264 C C     . GLY F 33  ? 1.1990 1.6650 1.0011 0.2207  0.2330  -0.2429 31  GLY F C     
4265 O O     . GLY F 33  ? 1.1966 1.6511 0.9780 0.2178  0.2245  -0.2394 31  GLY F O     
4266 N N     . GLU F 34  ? 1.1668 1.6378 0.9640 0.2241  0.2516  -0.2446 32  GLU F N     
4267 C CA    . GLU F 34  ? 1.1836 1.6471 0.9487 0.2262  0.2619  -0.2430 32  GLU F CA    
4268 C C     . GLU F 34  ? 1.1819 1.6422 0.9223 0.2420  0.2513  -0.2607 32  GLU F C     
4269 O O     . GLU F 34  ? 1.1806 1.6319 0.8930 0.2440  0.2456  -0.2612 32  GLU F O     
4270 C CB    . GLU F 34  ? 1.2369 1.7067 1.0070 0.2242  0.2874  -0.2376 32  GLU F CB    
4271 C CG    . GLU F 34  ? 1.2234 1.6947 1.0190 0.2087  0.3004  -0.2212 32  GLU F CG    
4272 C CD    . GLU F 34  ? 1.2426 1.7168 1.0421 0.2069  0.3277  -0.2162 32  GLU F CD    
4273 O OE1   . GLU F 34  ? 1.2182 1.6928 1.0419 0.1952  0.3409  -0.2046 32  GLU F OE1   
4274 O OE2   . GLU F 34  ? 1.2713 1.7472 1.0509 0.2177  0.3363  -0.2243 32  GLU F OE2   
4275 N N     . ALA F 35  ? 1.1924 1.6599 0.9439 0.2535  0.2480  -0.2759 33  ALA F N     
4276 C CA    . ALA F 35  ? 1.2310 1.6963 0.9622 0.2693  0.2407  -0.2946 33  ALA F CA    
4277 C C     . ALA F 35  ? 1.2218 1.6779 0.9504 0.2752  0.2170  -0.3064 33  ALA F C     
4278 O O     . ALA F 35  ? 1.2461 1.7011 0.9696 0.2889  0.2093  -0.3252 33  ALA F O     
4279 C CB    . ALA F 35  ? 1.2486 1.7245 0.9938 0.2793  0.2489  -0.3061 33  ALA F CB    
4280 N N     . LEU F 36  ? 1.1936 1.6420 0.9263 0.2657  0.2055  -0.2972 34  LEU F N     
4281 C CA    . LEU F 36  ? 1.1816 1.6194 0.9125 0.2715  0.1841  -0.3090 34  LEU F CA    
4282 C C     . LEU F 36  ? 1.1754 1.6013 0.8774 0.2693  0.1760  -0.3074 34  LEU F C     
4283 O O     . LEU F 36  ? 1.1768 1.5922 0.8754 0.2746  0.1582  -0.3191 34  LEU F O     
4284 C CB    . LEU F 36  ? 1.1392 1.5766 0.8990 0.2654  0.1739  -0.3028 34  LEU F CB    
4285 C CG    . LEU F 36  ? 1.1142 1.5452 0.8748 0.2514  0.1675  -0.2863 34  LEU F CG    
4286 C CD1   . LEU F 36  ? 1.0800 1.5126 0.8701 0.2507  0.1560  -0.2850 34  LEU F CD1   
4287 C CD2   . LEU F 36  ? 1.1105 1.5471 0.8696 0.2374  0.1840  -0.2667 34  LEU F CD2   
4288 N N     . ALA F 37  ? 1.1493 1.5758 0.8320 0.2617  0.1888  -0.2933 35  ALA F N     
4289 C CA    . ALA F 37  ? 1.1619 1.5784 0.8159 0.2601  0.1822  -0.2904 35  ALA F CA    
4290 C C     . ALA F 37  ? 1.1894 1.6030 0.8224 0.2758  0.1715  -0.3120 35  ALA F C     
4291 O O     . ALA F 37  ? 1.1885 1.5934 0.8014 0.2764  0.1604  -0.3141 35  ALA F O     
4292 C CB    . ALA F 37  ? 1.1844 1.6035 0.8229 0.2517  0.2014  -0.2720 35  ALA F CB    
4293 N N     . ALA F 38  ? 1.1969 1.6179 0.8350 0.2886  0.1743  -0.3286 36  ALA F N     
4294 C CA    . ALA F 38  ? 1.1963 1.6156 0.8172 0.3039  0.1635  -0.3510 36  ALA F CA    
4295 C C     . ALA F 38  ? 1.1905 1.5972 0.8225 0.3075  0.1407  -0.3665 36  ALA F C     
4296 O O     . ALA F 38  ? 1.2289 1.6300 0.8450 0.3159  0.1278  -0.3822 36  ALA F O     
4297 C CB    . ALA F 38  ? 1.1851 1.6151 0.8107 0.3162  0.1730  -0.3645 36  ALA F CB    
4298 N N     . VAL F 39  ? 1.1429 1.5454 0.8036 0.3019  0.1354  -0.3630 37  VAL F N     
4299 C CA    . VAL F 39  ? 1.1139 1.5030 0.7899 0.3054  0.1154  -0.3766 37  VAL F CA    
4300 C C     . VAL F 39  ? 1.0485 1.4276 0.7274 0.2922  0.1072  -0.3611 37  VAL F C     
4301 O O     . VAL F 39  ? 1.0088 1.3745 0.6992 0.2940  0.0905  -0.3707 37  VAL F O     
4302 C CB    . VAL F 39  ? 1.1002 1.4910 0.8085 0.3123  0.1146  -0.3863 37  VAL F CB    
4303 C CG1   . VAL F 39  ? 1.1084 1.4836 0.8317 0.3211  0.0954  -0.4071 37  VAL F CG1   
4304 C CG2   . VAL F 39  ? 1.1148 1.5185 0.8216 0.3215  0.1281  -0.3942 37  VAL F CG2   
4305 N N     . HIS F 40  ? 1.0301 1.4140 0.6999 0.2790  0.1186  -0.3379 38  HIS F N     
4306 C CA    . HIS F 40  ? 1.0071 1.3830 0.6814 0.2654  0.1125  -0.3211 38  HIS F CA    
4307 C C     . HIS F 40  ? 1.0521 1.4236 0.6985 0.2565  0.1152  -0.3073 38  HIS F C     
4308 O O     . HIS F 40  ? 1.0175 1.3770 0.6605 0.2493  0.1034  -0.3016 38  HIS F O     
4309 C CB    . HIS F 40  ? 0.9710 1.3567 0.6701 0.2555  0.1232  -0.3035 38  HIS F CB    
4310 C CG    . HIS F 40  ? 0.9435 1.3228 0.6513 0.2421  0.1166  -0.2869 38  HIS F CG    
4311 N ND1   . HIS F 40  ? 0.9215 1.2932 0.6488 0.2438  0.1015  -0.2916 38  HIS F ND1   
4312 C CD2   . HIS F 40  ? 0.9268 1.3057 0.6277 0.2271  0.1235  -0.2655 38  HIS F CD2   
4313 C CE1   . HIS F 40  ? 0.8855 1.2537 0.6158 0.2305  0.0989  -0.2738 38  HIS F CE1   
4314 N NE2   . HIS F 40  ? 0.8852 1.2575 0.6003 0.2197  0.1118  -0.2579 38  HIS F NE2   
4315 N N     . GLY F 41  ? 1.1320 1.5121 0.7589 0.2574  0.1308  -0.3013 39  GLY F N     
4316 C CA    . GLY F 41  ? 1.1879 1.5643 0.7893 0.2501  0.1357  -0.2867 39  GLY F CA    
4317 C C     . GLY F 41  ? 1.1997 1.5788 0.8079 0.2344  0.1519  -0.2609 39  GLY F C     
4318 O O     . GLY F 41  ? 1.2380 1.6128 0.8275 0.2273  0.1578  -0.2467 39  GLY F O     
4319 N N     . SER F 42  ? 1.1713 1.5574 0.8073 0.2291  0.1590  -0.2552 40  SER F N     
4320 C CA    . SER F 42  ? 1.1827 1.5721 0.8325 0.2139  0.1734  -0.2333 40  SER F CA    
4321 C C     . SER F 42  ? 1.1972 1.5988 0.8782 0.2146  0.1798  -0.2358 40  SER F C     
4322 O O     . SER F 42  ? 1.2488 1.6527 0.9441 0.2232  0.1682  -0.2502 40  SER F O     
4323 C CB    . SER F 42  ? 1.1481 1.5264 0.8022 0.2002  0.1631  -0.2191 40  SER F CB    
4324 N N     . GLU F 43  ? 1.1262 1.5351 0.8192 0.2058  0.1983  -0.2221 41  GLU F N     
4325 C CA    . GLU F 43  ? 1.0781 1.5002 0.8002 0.2068  0.2062  -0.2247 41  GLU F CA    
4326 C C     . GLU F 43  ? 1.0068 1.4317 0.7583 0.1955  0.1999  -0.2142 41  GLU F C     
4327 O O     . GLU F 43  ? 0.9756 1.3921 0.7248 0.1844  0.1944  -0.2017 41  GLU F O     
4328 C CB    . GLU F 43  ? 1.1097 1.5387 0.8319 0.2047  0.2305  -0.2181 41  GLU F CB    
4329 C CG    . GLU F 43  ? 1.1232 1.5446 0.8360 0.1917  0.2437  -0.1992 41  GLU F CG    
4330 C CD    . GLU F 43  ? 1.1540 1.5799 0.8621 0.1927  0.2685  -0.1955 41  GLU F CD    
4331 O OE1   . GLU F 43  ? 1.1485 1.5702 0.8625 0.1807  0.2841  -0.1799 41  GLU F OE1   
4332 O OE2   . GLU F 43  ? 1.1819 1.6150 0.8814 0.2057  0.2730  -0.2085 41  GLU F OE2   
4333 N N     . PHE F 44  ? 0.9931 1.4304 0.7723 0.1990  0.2003  -0.2198 42  PHE F N     
4334 C CA    . PHE F 44  ? 0.9274 1.3714 0.7366 0.1907  0.1941  -0.2116 42  PHE F CA    
4335 C C     . PHE F 44  ? 0.9050 1.3608 0.7377 0.1829  0.2113  -0.2032 42  PHE F C     
4336 O O     . PHE F 44  ? 0.9304 1.3855 0.7544 0.1813  0.2296  -0.2001 42  PHE F O     
4337 C CB    . PHE F 44  ? 0.9066 1.3552 0.7307 0.2021  0.1782  -0.2250 42  PHE F CB    
4338 C CG    . PHE F 44  ? 0.9079 1.3433 0.7195 0.2056  0.1595  -0.2294 42  PHE F CG    
4339 C CD1   . PHE F 44  ? 0.9102 1.3334 0.7037 0.1956  0.1557  -0.2188 42  PHE F CD1   
4340 C CD2   . PHE F 44  ? 0.9117 1.3454 0.7313 0.2189  0.1463  -0.2444 42  PHE F CD2   
4341 C CE1   . PHE F 44  ? 0.9062 1.3162 0.6891 0.1986  0.1385  -0.2234 42  PHE F CE1   
4342 C CE2   . PHE F 44  ? 0.9057 1.3252 0.7162 0.2224  0.1298  -0.2496 42  PHE F CE2   
4343 C CZ    . PHE F 44  ? 0.9021 1.3101 0.6940 0.2121  0.1256  -0.2394 42  PHE F CZ    
4344 N N     . SER F 45  ? 0.8499 1.3164 0.7133 0.1787  0.2057  -0.1998 43  SER F N     
4345 C CA    . SER F 45  ? 0.6651 1.1424 0.5548 0.1704  0.2191  -0.1923 43  SER F CA    
4346 C C     . SER F 45  ? 0.8465 1.3400 0.7634 0.1782  0.2138  -0.2013 43  SER F C     
4347 O O     . SER F 45  ? 0.8387 1.3341 0.7585 0.1871  0.1979  -0.2090 43  SER F O     
4348 C CB    . SER F 45  ? 0.6329 1.1072 0.5349 0.1546  0.2171  -0.1766 43  SER F CB    
4349 O OG    . SER F 45  ? 0.6042 1.0788 0.5118 0.1544  0.1967  -0.1757 43  SER F OG    
4350 N N     . GLN F 46  ? 0.5100 1.2650 0.7924 -0.0021 0.1067  -0.1328 44  GLN F N     
4351 C CA    . GLN F 46  ? 0.5050 1.2683 0.7893 0.0353  0.1067  -0.1473 44  GLN F CA    
4352 C C     . GLN F 46  ? 0.5029 1.2406 0.7897 0.0459  0.0879  -0.1535 44  GLN F C     
4353 O O     . GLN F 46  ? 0.5257 1.2564 0.7935 0.0775  0.0876  -0.1663 44  GLN F O     
4354 C CB    . GLN F 46  ? 0.4644 1.2634 0.7903 0.0371  0.1066  -0.1413 44  GLN F CB    
4355 C CG    . GLN F 46  ? 0.4045 1.2014 0.7715 0.0080  0.0907  -0.1248 44  GLN F CG    
4356 C CD    . GLN F 46  ? 0.3575 1.1472 0.7498 0.0181  0.0721  -0.1282 44  GLN F CD    
4357 O OE1   . GLN F 46  ? 0.3026 1.0920 0.6816 0.0449  0.0690  -0.1421 44  GLN F OE1   
4358 N NE2   . GLN F 46  ? 0.3156 1.0971 0.7425 -0.0030 0.0595  -0.1152 44  GLN F NE2   
4359 N N     . THR F 47  ? 0.4671 1.1858 0.7745 0.0211  0.0728  -0.1436 45  THR F N     
4360 C CA    . THR F 47  ? 0.4605 1.1536 0.7648 0.0285  0.0587  -0.1503 45  THR F CA    
4361 C C     . THR F 47  ? 0.4605 1.1339 0.7245 0.0411  0.0650  -0.1597 45  THR F C     
4362 O O     . THR F 47  ? 0.4759 1.1400 0.7215 0.0673  0.0611  -0.1714 45  THR F O     
4363 C CB    . THR F 47  ? 0.4348 1.1023 0.7648 0.0003  0.0461  -0.1372 45  THR F CB    
4364 O OG1   . THR F 47  ? 0.4665 1.1088 0.7826 -0.0182 0.0481  -0.1297 45  THR F OG1   
4365 C CG2   . THR F 47  ? 0.4029 1.0824 0.7663 -0.0179 0.0450  -0.1217 45  THR F CG2   
4366 N N     . THR F 48  ? 0.4318 1.0972 0.6791 0.0217  0.0748  -0.1534 46  THR F N     
4367 C CA    . THR F 48  ? 0.4371 1.0646 0.6348 0.0294  0.0807  -0.1581 46  THR F CA    
4368 C C     . THR F 48  ? 0.4600 1.0684 0.6087 0.0676  0.0907  -0.1715 46  THR F C     
4369 O O     . THR F 48  ? 0.4736 1.0358 0.5829 0.0874  0.0851  -0.1761 46  THR F O     
4370 C CB    . THR F 48  ? 0.4752 1.0695 0.6480 -0.0046 0.0829  -0.1413 46  THR F CB    
4371 O OG1   . THR F 48  ? 0.2653 0.8716 0.4876 -0.0376 0.0711  -0.1272 46  THR F OG1   
4372 C CG2   . THR F 48  ? 0.3500 0.8689 0.4526 -0.0002 0.0817  -0.1393 46  THR F CG2   
4373 N N     . ILE F 49  ? 0.4557 1.0989 0.6074 0.0787  0.1062  -0.1772 47  ILE F N     
4374 C CA    . ILE F 49  ? 0.4801 1.1056 0.5926 0.1180  0.1168  -0.1906 47  ILE F CA    
4375 C C     . ILE F 49  ? 0.4546 1.0860 0.5881 0.1470  0.1015  -0.1953 47  ILE F C     
4376 O O     . ILE F 49  ? 0.4627 1.0571 0.5578 0.1769  0.0996  -0.2032 47  ILE F O     
4377 C CB    . ILE F 49  ? 0.4894 1.1403 0.6050 0.1190  0.1343  -0.1903 47  ILE F CB    
4378 C CG1   . ILE F 49  ? 0.4953 1.1387 0.5793 0.0868  0.1487  -0.1850 47  ILE F CG1   
4379 C CG2   . ILE F 49  ? 0.5337 1.1584 0.6146 0.1597  0.1447  -0.2027 47  ILE F CG2   
4380 C CD1   . ILE F 49  ? 0.5465 1.1009 0.5528 0.0834  0.1450  -0.1844 47  ILE F CD1   
4381 N N     . CYS F 50  ? 0.4178 1.0899 0.6065 0.1365  0.0887  -0.1894 48  CYS F N     
4382 C CA    . CYS F 50  ? 0.4043 1.0846 0.6088 0.1585  0.0724  -0.1938 48  CYS F CA    
4383 C C     . CYS F 50  ? 0.4089 1.0558 0.5864 0.1658  0.0614  -0.1982 48  CYS F C     
4384 O O     . CYS F 50  ? 0.4268 1.0608 0.5841 0.1963  0.0542  -0.2044 48  CYS F O     
4385 C CB    . CYS F 50  ? 0.3597 1.0761 0.6171 0.1386  0.0602  -0.1869 48  CYS F CB    
4386 S SG    . CYS F 50  ? 0.3707 1.1008 0.6446 0.1589  0.0388  -0.1931 48  CYS F SG    
4387 N N     . ARG F 51  ? 0.3914 1.0251 0.5697 0.1381  0.0603  -0.1938 49  ARG F N     
4388 C CA    . ARG F 51  ? 0.4080 1.0098 0.5595 0.1429  0.0539  -0.1971 49  ARG F CA    
4389 C C     . ARG F 51  ? 0.4513 0.9871 0.5334 0.1631  0.0578  -0.1960 49  ARG F C     
4390 O O     . ARG F 51  ? 0.4587 0.9614 0.5098 0.1802  0.0482  -0.1966 49  ARG F O     
4391 C CB    . ARG F 51  ? 0.3887 0.9739 0.5529 0.1042  0.0521  -0.1865 49  ARG F CB    
4392 C CG    . ARG F 51  ? 0.3506 0.9705 0.5721 0.0817  0.0423  -0.1842 49  ARG F CG    
4393 C CD    . ARG F 51  ? 0.2520 0.8524 0.4857 0.0561  0.0392  -0.1788 49  ARG F CD    
4394 N NE    . ARG F 51  ? 0.3296 0.9291 0.6000 0.0350  0.0292  -0.1732 49  ARG F NE    
4395 C CZ    . ARG F 51  ? 0.3149 0.9031 0.6094 0.0077  0.0294  -0.1577 49  ARG F CZ    
4396 N NH1   . ARG F 51  ? 0.3179 0.9031 0.6061 -0.0062 0.0370  -0.1470 49  ARG F NH1   
4397 N NH2   . ARG F 51  ? 0.2187 0.7975 0.5415 -0.0049 0.0216  -0.1522 49  ARG F NH2   
4398 N N     . PHE F 52  ? 0.4901 1.0032 0.5438 0.1601  0.0712  -0.1942 50  PHE F N     
4399 C CA    . PHE F 52  ? 0.5735 1.0191 0.5600 0.1796  0.0744  -0.1955 50  PHE F CA    
4400 C C     . PHE F 52  ? 0.6751 1.1324 0.6580 0.2249  0.0743  -0.2072 50  PHE F C     
4401 O O     . PHE F 52  ? 0.7315 1.1402 0.6738 0.2466  0.0655  -0.2069 50  PHE F O     
4402 C CB    . PHE F 52  ? 0.5666 0.9836 0.5199 0.1636  0.0884  -0.1934 50  PHE F CB    
4403 C CG    . PHE F 52  ? 0.6413 0.9829 0.5229 0.1819  0.0910  -0.1970 50  PHE F CG    
4404 C CD1   . PHE F 52  ? 0.6630 0.9355 0.4992 0.1649  0.0808  -0.1859 50  PHE F CD1   
4405 C CD2   . PHE F 52  ? 0.7146 1.0540 0.5771 0.2165  0.1036  -0.2117 50  PHE F CD2   
4406 C CE1   . PHE F 52  ? 0.7440 0.9427 0.5140 0.1797  0.0807  -0.1888 50  PHE F CE1   
4407 C CE2   . PHE F 52  ? 0.7875 1.0513 0.5837 0.2342  0.1051  -0.2169 50  PHE F CE2   
4408 C CZ    . PHE F 52  ? 0.8038 0.9951 0.5522 0.2147  0.0924  -0.2053 50  PHE F CZ    
4409 N N     . GLU F 53  ? 0.6918 1.2101 0.7193 0.2371  0.0823  -0.2139 51  GLU F N     
4410 C CA    . GLU F 53  ? 0.7671 1.2938 0.8020 0.2742  0.0785  -0.2183 51  GLU F CA    
4411 C C     . GLU F 53  ? 0.7968 1.3302 0.8396 0.2920  0.0572  -0.2180 51  GLU F C     
4412 O O     . GLU F 53  ? 0.8441 1.3520 0.8625 0.3269  0.0506  -0.2209 51  GLU F O     
4413 C CB    . GLU F 53  ? 0.7716 1.3591 0.8617 0.2699  0.0854  -0.2166 51  GLU F CB    
4414 C CG    . GLU F 53  ? 0.8017 1.3828 0.8767 0.2651  0.1093  -0.2191 51  GLU F CG    
4415 C CD    . GLU F 53  ? 0.7722 1.4156 0.9024 0.2589  0.1174  -0.2156 51  GLU F CD    
4416 O OE1   . GLU F 53  ? 0.7311 1.4176 0.9099 0.2574  0.1022  -0.2108 51  GLU F OE1   
4417 O OE2   . GLU F 53  ? 0.7895 1.4359 0.9104 0.2539  0.1390  -0.2174 51  GLU F OE2   
4418 N N     . ASN F 54  ? 0.7849 1.3509 0.8603 0.2689  0.0459  -0.2150 52  ASN F N     
4419 C CA    . ASN F 54  ? 0.8132 1.3869 0.8904 0.2815  0.0265  -0.2166 52  ASN F CA    
4420 C C     . ASN F 54  ? 0.8161 1.3248 0.8414 0.2659  0.0210  -0.2089 52  ASN F C     
4421 O O     . ASN F 54  ? 0.8293 1.3341 0.8466 0.2679  0.0057  -0.2070 52  ASN F O     
4422 C CB    . ASN F 54  ? 0.7977 1.4276 0.9316 0.2587  0.0146  -0.2158 52  ASN F CB    
4423 C CG    . ASN F 54  ? 0.8251 1.4981 1.0023 0.2610  0.0153  -0.2138 52  ASN F CG    
4424 O OD1   . ASN F 54  ? 0.8421 1.5371 1.0332 0.2849  0.0034  -0.2152 52  ASN F OD1   
4425 N ND2   . ASN F 54  ? 0.8292 1.5154 1.0284 0.2359  0.0293  -0.2092 52  ASN F ND2   
4426 N N     . LEU F 55  ? 0.7742 1.2312 0.7629 0.2482  0.0327  -0.2028 53  LEU F N     
4427 C CA    . LEU F 55  ? 0.8123 1.2084 0.7569 0.2286  0.0286  -0.1919 53  LEU F CA    
4428 C C     . LEU F 55  ? 0.7985 1.2210 0.7733 0.2031  0.0225  -0.1899 53  LEU F C     
4429 O O     . LEU F 55  ? 0.8374 1.2318 0.7854 0.2008  0.0149  -0.1847 53  LEU F O     
4430 C CB    . LEU F 55  ? 0.8865 1.2267 0.7762 0.2548  0.0184  -0.1871 53  LEU F CB    
4431 C CG    . LEU F 55  ? 0.9394 1.2178 0.7792 0.2705  0.0247  -0.1859 53  LEU F CG    
4432 C CD1   . LEU F 55  ? 0.6399 0.9527 0.5029 0.2997  0.0334  -0.1991 53  LEU F CD1   
4433 C CD2   . LEU F 55  ? 0.9845 1.2011 0.7710 0.2891  0.0113  -0.1769 53  LEU F CD2   
4434 N N     . GLN F 56  ? 0.7472 1.2227 0.7775 0.1834  0.0270  -0.1943 54  GLN F N     
4435 C CA    . GLN F 56  ? 0.6833 1.1804 0.7463 0.1584  0.0229  -0.1949 54  GLN F CA    
4436 C C     . GLN F 56  ? 0.6609 1.1348 0.7293 0.1240  0.0320  -0.1842 54  GLN F C     
4437 O O     . GLN F 56  ? 0.6193 1.1273 0.7369 0.1010  0.0345  -0.1842 54  GLN F O     
4438 C CB    . GLN F 56  ? 0.6277 1.1962 0.7531 0.1580  0.0176  -0.2059 54  GLN F CB    
4439 C CG    . GLN F 56  ? 0.6444 1.2406 0.7712 0.1892  0.0042  -0.2146 54  GLN F CG    
4440 C CD    . GLN F 56  ? 0.6500 1.3055 0.8347 0.1822  -0.0044 -0.2206 54  GLN F CD    
4441 O OE1   . GLN F 56  ? 0.6563 1.3182 0.8713 0.1538  0.0009  -0.2145 54  GLN F OE1   
4442 N NE2   . GLN F 56  ? 0.6823 1.3628 0.8721 0.2026  -0.0206 -0.2268 54  GLN F NE2   
4443 N N     . LEU F 57  ? 0.6855 1.0988 0.7033 0.1203  0.0347  -0.1731 55  LEU F N     
4444 C CA    . LEU F 57  ? 0.6727 1.0572 0.6909 0.0883  0.0397  -0.1595 55  LEU F CA    
4445 C C     . LEU F 57  ? 0.7090 1.0324 0.6725 0.0895  0.0381  -0.1486 55  LEU F C     
4446 O O     . LEU F 57  ? 0.7542 1.0547 0.6768 0.1149  0.0330  -0.1511 55  LEU F O     
4447 C CB    . LEU F 57  ? 0.6723 1.0554 0.6955 0.0728  0.0456  -0.1535 55  LEU F CB    
4448 C CG    . LEU F 57  ? 0.4227 0.7901 0.4083 0.0942  0.0501  -0.1586 55  LEU F CG    
4449 C CD1   . LEU F 57  ? 0.5179 0.8163 0.4363 0.1078  0.0476  -0.1540 55  LEU F CD1   
4450 C CD2   . LEU F 57  ? 0.4928 0.8679 0.4883 0.0711  0.0573  -0.1531 55  LEU F CD2   
4451 N N     . SER F 58  ? 0.6861 0.9840 0.6520 0.0610  0.0412  -0.1342 56  SER F N     
4452 C CA    . SER F 58  ? 0.6887 0.9332 0.6100 0.0569  0.0403  -0.1209 56  SER F CA    
4453 C C     . SER F 58  ? 0.6952 0.8830 0.5555 0.0684  0.0363  -0.1151 56  SER F C     
4454 O O     . SER F 58  ? 0.6591 0.8442 0.5121 0.0727  0.0372  -0.1199 56  SER F O     
4455 C CB    . SER F 58  ? 0.6819 0.9187 0.6305 0.0225  0.0445  -0.1052 56  SER F CB    
4456 O OG    . SER F 58  ? 0.6854 0.9097 0.6394 0.0020  0.0426  -0.0953 56  SER F OG    
4457 N N     . PHE F 59  ? 0.7717 0.9120 0.5860 0.0732  0.0326  -0.1049 57  PHE F N     
4458 C CA    . PHE F 59  ? 0.8862 0.9627 0.6399 0.0836  0.0267  -0.0988 57  PHE F CA    
4459 C C     . PHE F 59  ? 0.9542 0.9982 0.6980 0.0572  0.0267  -0.0892 57  PHE F C     
4460 O O     . PHE F 59  ? 0.9890 1.0038 0.6999 0.0674  0.0254  -0.0957 57  PHE F O     
4461 C CB    . PHE F 59  ? 0.9179 0.9494 0.6291 0.0857  0.0217  -0.0848 57  PHE F CB    
4462 C CG    . PHE F 59  ? 0.9777 0.9345 0.6279 0.0904  0.0136  -0.0754 57  PHE F CG    
4463 C CD1   . PHE F 59  ? 1.0193 0.9528 0.6361 0.1243  0.0080  -0.0866 57  PHE F CD1   
4464 C CD2   . PHE F 59  ? 0.9951 0.9043 0.6246 0.0608  0.0108  -0.0553 57  PHE F CD2   
4465 C CE1   . PHE F 59  ? 1.0771 0.9357 0.6372 0.1294  0.0002  -0.0800 57  PHE F CE1   
4466 C CE2   . PHE F 59  ? 1.0601 0.8955 0.6318 0.0629  0.0012  -0.0473 57  PHE F CE2   
4467 C CZ    . PHE F 59  ? 1.1030 0.9103 0.6382 0.0977  -0.0039 -0.0608 57  PHE F CZ    
4468 N N     . LYS F 60  ? 0.9734 1.0215 0.7453 0.0232  0.0279  -0.0740 58  LYS F N     
4469 C CA    . LYS F 60  ? 1.0122 1.0310 0.7763 -0.0059 0.0238  -0.0619 58  LYS F CA    
4470 C C     . LYS F 60  ? 1.0285 1.0804 0.8134 -0.0068 0.0272  -0.0739 58  LYS F C     
4471 O O     . LYS F 60  ? 1.0751 1.0922 0.8230 -0.0132 0.0242  -0.0741 58  LYS F O     
4472 C CB    . LYS F 60  ? 0.9740 1.0007 0.7772 -0.0410 0.0234  -0.0414 58  LYS F CB    
4473 C CG    . LYS F 60  ? 0.9803 1.0086 0.7886 -0.0381 0.0281  -0.0339 58  LYS F CG    
4474 C CD    . LYS F 60  ? 0.9378 1.0305 0.8001 -0.0285 0.0383  -0.0473 58  LYS F CD    
4475 C CE    . LYS F 60  ? 0.9451 1.0375 0.8043 -0.0270 0.0456  -0.0411 58  LYS F CE    
4476 N NZ    . LYS F 60  ? 0.9090 1.0552 0.8032 -0.0122 0.0541  -0.0599 58  LYS F NZ    
4477 N N     . ASN F 61  ? 1.0054 1.1232 0.8467 -0.0018 0.0334  -0.0840 59  ASN F N     
4478 C CA    . ASN F 61  ? 0.9909 1.1460 0.8552 -0.0031 0.0375  -0.0936 59  ASN F CA    
4479 C C     . ASN F 61  ? 1.0333 1.1766 0.8558 0.0292  0.0419  -0.1108 59  ASN F C     
4480 O O     . ASN F 61  ? 1.0611 1.2052 0.8709 0.0256  0.0465  -0.1157 59  ASN F O     
4481 C CB    . ASN F 61  ? 0.9375 1.1632 0.8723 -0.0037 0.0415  -0.1005 59  ASN F CB    
4482 C CG    . ASN F 61  ? 0.9312 1.1963 0.9009 -0.0188 0.0440  -0.1015 59  ASN F CG    
4483 O OD1   . ASN F 61  ? 0.9845 1.2253 0.9254 -0.0330 0.0433  -0.0952 59  ASN F OD1   
4484 N ND2   . ASN F 61  ? 0.8790 1.2036 0.9086 -0.0179 0.0461  -0.1088 59  ASN F ND2   
4485 N N     . ALA F 62  ? 1.0443 1.1775 0.8455 0.0616  0.0409  -0.1196 60  ALA F N     
4486 C CA    . ALA F 62  ? 1.0888 1.2097 0.8562 0.0967  0.0446  -0.1353 60  ALA F CA    
4487 C C     . ALA F 62  ? 1.1583 1.2057 0.8601 0.0938  0.0433  -0.1332 60  ALA F C     
4488 O O     . ALA F 62  ? 1.2112 1.2540 0.8922 0.1076  0.0516  -0.1465 60  ALA F O     
4489 C CB    . ALA F 62  ? 1.1033 1.2250 0.8633 0.1299  0.0393  -0.1408 60  ALA F CB    
4490 N N     . CYS F 63  ? 1.1472 1.1360 0.8149 0.0756  0.0335  -0.1172 61  CYS F N     
4491 C CA    . CYS F 63  ? 1.1750 1.0879 0.7783 0.0680  0.0288  -0.1147 61  CYS F CA    
4492 C C     . CYS F 63  ? 1.1285 1.0463 0.7311 0.0388  0.0323  -0.1140 61  CYS F C     
4493 O O     . CYS F 63  ? 1.1944 1.0709 0.7466 0.0435  0.0354  -0.1246 61  CYS F O     
4494 C CB    . CYS F 63  ? 1.2126 1.0683 0.7883 0.0481  0.0158  -0.0938 61  CYS F CB    
4495 S SG    . CYS F 63  ? 1.2552 1.0896 0.8123 0.0801  0.0102  -0.0913 61  CYS F SG    
4496 N N     . LYS F 64  ? 0.9912 0.9567 0.6473 0.0083  0.0314  -0.1015 62  LYS F N     
4497 C CA    . LYS F 64  ? 0.9550 0.9327 0.6155 -0.0209 0.0326  -0.0977 62  LYS F CA    
4498 C C     . LYS F 64  ? 0.9532 0.9667 0.6127 0.0014  0.0483  -0.1189 62  LYS F C     
4499 O O     . LYS F 64  ? 1.0284 1.0123 0.6407 -0.0040 0.0529  -0.1260 62  LYS F O     
4500 C CB    . LYS F 64  ? 0.8740 0.9023 0.6037 -0.0526 0.0280  -0.0799 62  LYS F CB    
4501 C CG    . LYS F 64  ? 0.8340 0.8890 0.5811 -0.0817 0.0281  -0.0736 62  LYS F CG    
4502 C CD    . LYS F 64  ? 0.7355 0.8378 0.5581 -0.1093 0.0218  -0.0553 62  LYS F CD    
4503 C CE    . LYS F 64  ? 0.7017 0.8263 0.5413 -0.1415 0.0179  -0.0440 62  LYS F CE    
4504 N NZ    . LYS F 64  ? 0.6218 0.7869 0.5388 -0.1678 0.0096  -0.0245 62  LYS F NZ    
4505 N N     . LEU F 65  ? 0.8711 0.9492 0.5816 0.0261  0.0570  -0.1294 63  LEU F N     
4506 C CA    . LEU F 65  ? 0.8307 0.9548 0.5530 0.0459  0.0729  -0.1469 63  LEU F CA    
4507 C C     . LEU F 65  ? 0.8919 0.9730 0.5559 0.0817  0.0822  -0.1662 63  LEU F C     
4508 O O     . LEU F 65  ? 0.9135 1.0030 0.5582 0.0880  0.0973  -0.1791 63  LEU F O     
4509 C CB    . LEU F 65  ? 0.7392 0.9404 0.5319 0.0632  0.0764  -0.1523 63  LEU F CB    
4510 C CG    . LEU F 65  ? 0.6604 0.9255 0.5190 0.0339  0.0761  -0.1425 63  LEU F CG    
4511 C CD1   . LEU F 65  ? 0.6636 0.9579 0.5212 0.0256  0.0893  -0.1469 63  LEU F CD1   
4512 C CD2   . LEU F 65  ? 0.6428 0.8857 0.5130 -0.0051 0.0628  -0.1210 63  LEU F CD2   
4513 N N     . LYS F 66  ? 0.9274 0.9626 0.5635 0.1060  0.0744  -0.1683 64  LYS F N     
4514 C CA    . LYS F 66  ? 1.0260 1.0110 0.6073 0.1411  0.0811  -0.1860 64  LYS F CA    
4515 C C     . LYS F 66  ? 1.1044 1.0243 0.6183 0.1214  0.0836  -0.1895 64  LYS F C     
4516 O O     . LYS F 66  ? 1.1951 1.0969 0.6728 0.1446  0.0987  -0.2101 64  LYS F O     
4517 C CB    . LYS F 66  ? 1.0627 0.9998 0.6224 0.1636  0.0674  -0.1818 64  LYS F CB    
4518 N N     . ALA F 67  ? 1.0708 0.9557 0.5674 0.0782  0.0690  -0.1702 65  ALA F N     
4519 C CA    . ALA F 67  ? 1.1389 0.9616 0.5691 0.0532  0.0671  -0.1717 65  ALA F CA    
4520 C C     . ALA F 67  ? 1.1570 1.0254 0.5927 0.0405  0.0836  -0.1799 65  ALA F C     
4521 O O     . ALA F 67  ? 1.2540 1.0874 0.6315 0.0480  0.0961  -0.1982 65  ALA F O     
4522 C CB    . ALA F 67  ? 1.1087 0.8922 0.5299 0.0077  0.0444  -0.1451 65  ALA F CB    
4523 N N     . ILE F 68  ? 1.0569 1.0017 0.5603 0.0204  0.0844  -0.1667 66  ILE F N     
4524 C CA    . ILE F 68  ? 1.0540 1.0474 0.5675 0.0051  0.0992  -0.1700 66  ILE F CA    
4525 C C     . ILE F 68  ? 1.0884 1.1172 0.6032 0.0479  0.1257  -0.1965 66  ILE F C     
4526 O O     . ILE F 68  ? 1.1640 1.1906 0.6398 0.0464  0.1434  -0.2095 66  ILE F O     
4527 C CB    . ILE F 68  ? 0.9728 1.0390 0.5662 -0.0234 0.0921  -0.1488 66  ILE F CB    
4528 C CG1   . ILE F 68  ? 0.9505 0.9859 0.5554 -0.0574 0.0673  -0.1234 66  ILE F CG1   
4529 C CG2   . ILE F 68  ? 0.9882 1.0936 0.5842 -0.0493 0.1024  -0.1453 66  ILE F CG2   
4530 C CD1   . ILE F 68  ? 0.8719 0.9714 0.5573 -0.0832 0.0600  -0.1037 66  ILE F CD1   
4531 N N     . LEU F 69  ? 1.0624 1.1261 0.6223 0.0863  0.1290  -0.2043 67  LEU F N     
4532 C CA    . LEU F 69  ? 1.1040 1.2139 0.6816 0.1274  0.1528  -0.2263 67  LEU F CA    
4533 C C     . LEU F 69  ? 1.2278 1.2705 0.7348 0.1607  0.1651  -0.2499 67  LEU F C     
4534 O O     . LEU F 69  ? 1.2964 1.3629 0.7980 0.1821  0.1904  -0.2685 67  LEU F O     
4535 C CB    . LEU F 69  ? 1.0298 1.1980 0.6788 0.1561  0.1482  -0.2256 67  LEU F CB    
4536 C CG    . LEU F 69  ? 0.9318 1.1846 0.6589 0.1323  0.1451  -0.2114 67  LEU F CG    
4537 C CD1   . LEU F 69  ? 0.8745 1.1698 0.6598 0.1568  0.1352  -0.2110 67  LEU F CD1   
4538 C CD2   . LEU F 69  ? 0.9250 1.2407 0.6744 0.1294  0.1679  -0.2183 67  LEU F CD2   
4539 N N     . SER F 70  ? 1.2472 1.2052 0.7041 0.1646  0.1482  -0.2484 68  SER F N     
4540 C CA    . SER F 70  ? 1.3488 1.2330 0.7368 0.1958  0.1576  -0.2715 68  SER F CA    
4541 C C     . SER F 70  ? 1.4182 1.2698 0.7477 0.1702  0.1709  -0.2814 68  SER F C     
4542 O O     . SER F 70  ? 1.4470 1.2956 0.7680 0.1898  0.1917  -0.3013 68  SER F O     
4543 C CB    . SER F 70  ? 1.4080 1.2048 0.7557 0.1972  0.1328  -0.2631 68  SER F CB    
4544 O OG    . SER F 70  ? 1.4333 1.1830 0.7453 0.1468  0.1140  -0.2443 68  SER F OG    
4545 N N     . LYS F 71  ? 1.4473 1.2786 0.7467 0.1208  0.1572  -0.2646 69  LYS F N     
4546 C CA    . LYS F 71  ? 1.5192 1.3214 0.7549 0.0930  0.1670  -0.2726 69  LYS F CA    
4547 C C     . LYS F 71  ? 1.4747 1.3611 0.7425 0.0968  0.1968  -0.2821 69  LYS F C     
4548 O O     . LYS F 71  ? 1.5112 1.3908 0.7452 0.0956  0.2131  -0.2988 69  LYS F O     
4549 C CB    . LYS F 71  ? 1.5133 1.2854 0.7272 0.0339  0.1404  -0.2452 69  LYS F CB    
4550 N N     . TRP F 72  ? 1.3750 1.3519 0.7247 0.0986  0.2003  -0.2692 70  TRP F N     
4551 C CA    . TRP F 72  ? 1.3689 1.4256 0.7557 0.0991  0.2271  -0.2724 70  TRP F CA    
4552 C C     . TRP F 72  ? 1.4065 1.4705 0.8145 0.1438  0.2538  -0.2921 70  TRP F C     
4553 O O     . TRP F 72  ? 1.4813 1.5568 0.8734 0.1436  0.2808  -0.3010 70  TRP F O     
4554 C CB    . TRP F 72  ? 1.2829 1.4336 0.7638 0.0837  0.2183  -0.2510 70  TRP F CB    
4555 C CG    . TRP F 72  ? 1.2891 1.5227 0.8221 0.0866  0.2421  -0.2497 70  TRP F CG    
4556 C CD1   . TRP F 72  ? 1.3056 1.5741 0.8347 0.0487  0.2501  -0.2376 70  TRP F CD1   
4557 C CD2   . TRP F 72  ? 1.2680 1.5570 0.8695 0.1255  0.2573  -0.2559 70  TRP F CD2   
4558 N NE1   . TRP F 72  ? 1.2785 1.6210 0.8679 0.0633  0.2711  -0.2367 70  TRP F NE1   
4559 C CE2   . TRP F 72  ? 1.2496 1.6064 0.8855 0.1096  0.2753  -0.2480 70  TRP F CE2   
4560 C CE3   . TRP F 72  ? 1.2621 1.5504 0.9000 0.1692  0.2548  -0.2650 70  TRP F CE3   
4561 C CZ2   . TRP F 72  ? 1.2163 1.6390 0.9220 0.1357  0.2909  -0.2498 70  TRP F CZ2   
4562 C CZ3   . TRP F 72  ? 1.2340 1.5890 0.9414 0.1941  0.2687  -0.2662 70  TRP F CZ3   
4563 C CH2   . TRP F 72  ? 1.2116 1.6326 0.9527 0.1773  0.2867  -0.2590 70  TRP F CH2   
4564 N N     . LEU F 73  ? 1.3429 1.4043 0.7897 0.1814  0.2459  -0.2971 71  LEU F N     
4565 C CA    . LEU F 73  ? 1.3352 1.4112 0.8129 0.2239  0.2667  -0.3138 71  LEU F CA    
4566 C C     . LEU F 73  ? 1.4458 1.4590 0.8546 0.2272  0.2862  -0.3381 71  LEU F C     
4567 O O     . LEU F 73  ? 1.4528 1.4945 0.8743 0.2409  0.3164  -0.3514 71  LEU F O     
4568 C CB    . LEU F 73  ? 1.2896 1.3559 0.8029 0.2606  0.2477  -0.3126 71  LEU F CB    
4569 C CG    . LEU F 73  ? 1.3004 1.3870 0.8553 0.3075  0.2624  -0.3257 71  LEU F CG    
4570 C CD1   . LEU F 73  ? 1.2101 1.3642 0.8472 0.3285  0.2477  -0.3116 71  LEU F CD1   
4571 C CD2   . LEU F 73  ? 1.3831 1.3822 0.8858 0.3334  0.2573  -0.3417 71  LEU F CD2   
4572 N N     . GLU F 74  ? 1.5498 1.4794 0.8885 0.2146  0.2679  -0.3445 72  GLU F N     
4573 C CA    . GLU F 74  ? 1.7041 1.5774 0.9763 0.2127  0.2799  -0.3689 72  GLU F CA    
4574 C C     . GLU F 74  ? 1.7596 1.6705 1.0077 0.1808  0.3039  -0.3753 72  GLU F C     
4575 O O     . GLU F 74  ? 1.8643 1.7829 1.1024 0.1942  0.3335  -0.3983 72  GLU F O     
4576 C CB    . GLU F 74  ? 1.7437 1.5245 0.9469 0.1957  0.2480  -0.3652 72  GLU F CB    
4577 N N     . GLU F 75  ? 1.6753 1.6117 0.9134 0.1384  0.2912  -0.3545 73  GLU F N     
4578 C CA    . GLU F 75  ? 1.7425 1.7249 0.9606 0.1101  0.3029  -0.3529 73  GLU F CA    
4579 C C     . GLU F 75  ? 1.7888 1.7863 1.0311 0.1302  0.3495  -0.3403 73  GLU F C     
4580 O O     . GLU F 75  ? 1.8342 1.8350 1.0375 0.1325  0.3682  -0.3340 73  GLU F O     
4581 C CB    . GLU F 75  ? 1.7147 1.6841 0.8980 0.0906  0.2707  -0.3122 73  GLU F CB    
4582 C CG    . GLU F 75  ? 1.7549 1.6392 0.8878 0.0558  0.2376  -0.3081 73  GLU F CG    
4583 C CD    . GLU F 75  ? 1.7639 1.6302 0.8671 -0.0037 0.2177  -0.2782 73  GLU F CD    
4584 O OE1   . GLU F 75  ? 1.7398 1.6654 0.8659 -0.0242 0.2299  -0.2634 73  GLU F OE1   
4585 O OE2   . GLU F 75  ? 1.7952 1.5899 0.8581 -0.0334 0.1887  -0.2678 73  GLU F OE2   
4586 N N     . ALA F 76  ? 1.1944 1.0951 0.8104 0.1202  0.0556  -0.2317 74  ALA F N     
4587 C CA    . ALA F 76  ? 1.1883 1.0946 0.8087 0.1204  0.0809  -0.2278 74  ALA F CA    
4588 C C     . ALA F 76  ? 1.1853 1.0977 0.8045 0.1235  0.0939  -0.2239 74  ALA F C     
4589 O O     . ALA F 76  ? 1.1503 1.1013 0.8050 0.1164  0.1013  -0.2240 74  ALA F O     
4590 C CB    . ALA F 76  ? 1.1400 1.0862 0.8040 0.1092  0.0863  -0.2305 74  ALA F CB    
4591 N N     . GLU F 77  ? 1.2264 1.0984 0.8023 0.1350  0.0965  -0.2203 75  GLU F N     
4592 C CA    . GLU F 77  ? 1.2460 1.1146 0.8123 0.1406  0.1106  -0.2154 75  GLU F CA    
4593 C C     . GLU F 77  ? 1.2599 1.1059 0.8060 0.1485  0.1362  -0.2081 75  GLU F C     
4594 O O     . GLU F 77  ? 1.2485 1.0967 0.8036 0.1460  0.1454  -0.2070 75  GLU F O     
4595 C CB    . GLU F 77  ? 1.2991 1.1371 0.8308 0.1485  0.0943  -0.2167 75  GLU F CB    
4596 C CG    . GLU F 77  ? 1.3635 1.1549 0.8538 0.1556  0.0795  -0.2174 75  GLU F CG    
4597 C CD    . GLU F 77  ? 1.3890 1.1690 0.8701 0.1556  0.0514  -0.2221 75  GLU F CD    
4598 O OE1   . GLU F 77  ? 1.4258 1.1718 0.8801 0.1595  0.0354  -0.2220 75  GLU F OE1   
4599 O OE2   . GLU F 77  ? 1.3689 1.1749 0.8721 0.1515  0.0449  -0.2251 75  GLU F OE2   
4600 N N     . GLN F 78  ? 1.2786 1.1048 0.8027 0.1566  0.1475  -0.2013 76  GLN F N     
4601 C CA    . GLN F 78  ? 1.3065 1.1154 0.8205 0.1624  0.1716  -0.1907 76  GLN F CA    
4602 C C     . GLN F 78  ? 1.3295 1.1070 0.8126 0.1716  0.1745  -0.1822 76  GLN F C     
4603 O O     . GLN F 78  ? 1.3494 1.0949 0.8070 0.1801  0.1866  -0.1730 76  GLN F O     
4604 C CB    . GLN F 78  ? 1.2830 1.1310 0.8378 0.1568  0.1936  -0.1884 76  GLN F CB    
4605 C CG    . GLN F 78  ? 1.2529 1.1415 0.8402 0.1500  0.1892  -0.1923 76  GLN F CG    
4606 C CD    . GLN F 78  ? 1.2288 1.1515 0.8555 0.1450  0.2107  -0.1865 76  GLN F CD    
4607 O OE1   . GLN F 78  ? 1.2480 1.1641 0.8782 0.1471  0.2301  -0.1803 76  GLN F OE1   
4608 N NE2   . GLN F 78  ? 1.1842 1.1434 0.8419 0.1384  0.2070  -0.1880 76  GLN F NE2   
4609 N N     . ARG F 96  ? 0.9598 1.0744 1.0090 -0.0240 0.1200  -0.3509 94  ARG F N     
4610 C CA    . ARG F 96  ? 0.9832 1.0927 1.0355 -0.0263 0.1178  -0.3597 94  ARG F CA    
4611 C C     . ARG F 96  ? 1.0021 1.1254 1.0492 -0.0226 0.1081  -0.3656 94  ARG F C     
4612 O O     . ARG F 96  ? 1.0424 1.1580 1.0815 -0.0187 0.1067  -0.3683 94  ARG F O     
4613 C CB    . ARG F 96  ? 0.9855 1.0724 1.0274 -0.0226 0.1237  -0.3559 94  ARG F CB    
4614 N N     . ARG F 97  ? 0.9686 1.1117 1.0201 -0.0231 0.1023  -0.3668 95  ARG F N     
4615 C CA    . ARG F 97  ? 0.9640 1.1206 1.0104 -0.0189 0.0940  -0.3718 95  ARG F CA    
4616 C C     . ARG F 97  ? 1.0105 1.1699 1.0638 -0.0238 0.0893  -0.3840 95  ARG F C     
4617 O O     . ARG F 97  ? 1.0182 1.1766 1.0856 -0.0321 0.0900  -0.3884 95  ARG F O     
4618 C CB    . ARG F 97  ? 0.9083 1.0847 0.9559 -0.0169 0.0897  -0.3681 95  ARG F CB    
4619 C CG    . ARG F 97  ? 0.8810 1.0555 0.9197 -0.0110 0.0915  -0.3570 95  ARG F CG    
4620 C CD    . ARG F 97  ? 0.8578 1.0519 0.8952 -0.0068 0.0851  -0.3554 95  ARG F CD    
4621 N NE    . ARG F 97  ? 0.8385 1.0492 0.8868 -0.0120 0.0817  -0.3621 95  ARG F NE    
4622 C CZ    . ARG F 97  ? 0.8142 1.0360 0.8699 -0.0149 0.0821  -0.3591 95  ARG F CZ    
4623 N NH1   . ARG F 97  ? 0.8142 1.0308 0.8653 -0.0129 0.0863  -0.3499 95  ARG F NH1   
4624 N NH2   . ARG F 97  ? 0.7999 1.0371 0.8669 -0.0195 0.0781  -0.3652 95  ARG F NH2   
4625 N N     . THR F 98  ? 1.0030 1.1646 1.0462 -0.0182 0.0842  -0.3890 96  THR F N     
4626 C CA    . THR F 98  ? 1.0318 1.1949 1.0759 -0.0208 0.0778  -0.4011 96  THR F CA    
4627 C C     . THR F 98  ? 1.0546 1.2376 1.0958 -0.0172 0.0702  -0.4032 96  THR F C     
4628 O O     . THR F 98  ? 1.1180 1.3066 1.1484 -0.0084 0.0701  -0.3983 96  THR F O     
4629 C CB    . THR F 98  ? 1.0524 1.1988 1.0835 -0.0159 0.0790  -0.4057 96  THR F CB    
4630 O OG1   . THR F 98  ? 1.0621 1.2153 1.0797 -0.0058 0.0767  -0.4041 96  THR F OG1   
4631 C CG2   . THR F 98  ? 1.0604 1.1893 1.0897 -0.0149 0.0878  -0.3986 96  THR F CG2   
4632 N N     . THR F 99  ? 1.0065 1.2001 1.0587 -0.0237 0.0638  -0.4099 97  THR F N     
4633 C CA    . THR F 99  ? 1.0202 1.2330 1.0703 -0.0206 0.0563  -0.4121 97  THR F CA    
4634 C C     . THR F 99  ? 1.0530 1.2613 1.0887 -0.0156 0.0495  -0.4223 97  THR F C     
4635 O O     . THR F 99  ? 1.1440 1.3383 1.1788 -0.0194 0.0466  -0.4316 97  THR F O     
4636 C CB    . THR F 99  ? 1.0148 1.2414 1.0841 -0.0294 0.0520  -0.4138 97  THR F CB    
4637 O OG1   . THR F 99  ? 0.9968 1.2424 1.0633 -0.0256 0.0450  -0.4149 97  THR F OG1   
4638 C CG2   . THR F 99  ? 1.0315 1.2497 1.1127 -0.0384 0.0470  -0.4243 97  THR F CG2   
4639 N N     . ILE F 100 ? 0.9654 1.1840 0.9889 -0.0064 0.0474  -0.4199 98  ILE F N     
4640 C CA    . ILE F 100 ? 0.9219 1.1335 0.9286 0.0012  0.0421  -0.4221 98  ILE F CA    
4641 C C     . ILE F 100 ? 0.9146 1.1361 0.9236 -0.0020 0.0307  -0.4303 98  ILE F C     
4642 O O     . ILE F 100 ? 0.9160 1.1568 0.9361 -0.0050 0.0277  -0.4290 98  ILE F O     
4643 C CB    . ILE F 100 ? 0.8817 1.0974 0.8765 0.0134  0.0462  -0.4101 98  ILE F CB    
4644 C CG1   . ILE F 100 ? 0.8775 1.0804 0.8695 0.0170  0.0557  -0.4038 98  ILE F CG1   
4645 C CG2   . ILE F 100 ? 0.8843 1.0947 0.8610 0.0222  0.0417  -0.4120 98  ILE F CG2   
4646 C CD1   . ILE F 100 ? 0.8676 1.0746 0.8521 0.0285  0.0600  -0.3928 98  ILE F CD1   
4647 N N     . SER F 101 ? 0.9016 1.1088 0.8994 -0.0013 0.0239  -0.4391 99  SER F N     
4648 C CA    . SER F 101 ? 0.8753 1.0883 0.8738 -0.0042 0.0110  -0.4480 99  SER F CA    
4649 C C     . SER F 101 ? 0.8476 1.0766 0.8373 0.0045  0.0078  -0.4412 99  SER F C     
4650 O O     . SER F 101 ? 0.8447 1.0737 0.8216 0.0150  0.0147  -0.4311 99  SER F O     
4651 C CB    . SER F 101 ? 0.8785 1.0687 0.8611 -0.0027 0.0041  -0.4573 99  SER F CB    
4652 O OG    . SER F 101 ? 0.8527 1.0308 0.8092 0.0106  0.0083  -0.4513 99  SER F OG    
4653 N N     . ILE F 102 ? 0.8770 1.2521 0.7689 -0.1273 -0.3052 -0.1636 100 ILE F N     
4654 C CA    . ILE F 102 ? 0.8636 1.2472 0.7321 -0.1201 -0.2946 -0.1621 100 ILE F CA    
4655 C C     . ILE F 102 ? 0.9197 1.2693 0.7247 -0.1153 -0.2979 -0.1795 100 ILE F C     
4656 O O     . ILE F 102 ? 0.9286 1.2887 0.7092 -0.1063 -0.2754 -0.1822 100 ILE F O     
4657 C CB    . ILE F 102 ? 0.8624 1.2509 0.7538 -0.1257 -0.3200 -0.1502 100 ILE F CB    
4658 C CG1   . ILE F 102 ? 0.8138 1.2425 0.7686 -0.1305 -0.3112 -0.1349 100 ILE F CG1   
4659 C CG2   . ILE F 102 ? 0.7177 1.1117 0.5851 -0.1189 -0.3121 -0.1472 100 ILE F CG2   
4660 C CD1   . ILE F 102 ? 0.6791 1.1007 0.6708 -0.1412 -0.3418 -0.1334 100 ILE F CD1   
4661 N N     . ALA F 103 ? 0.9576 1.2655 0.7330 -0.1218 -0.3255 -0.1917 101 ALA F N     
4662 C CA    . ALA F 103 ? 0.9838 1.2556 0.6895 -0.1180 -0.3268 -0.2108 101 ALA F CA    
4663 C C     . ALA F 103 ? 0.9456 1.2361 0.6424 -0.1062 -0.2879 -0.2253 101 ALA F C     
4664 O O     . ALA F 103 ? 0.9636 1.2480 0.6149 -0.0972 -0.2709 -0.2369 101 ALA F O     
4665 C CB    . ALA F 103 ? 1.0387 1.2596 0.7126 -0.1310 -0.3648 -0.2205 101 ALA F CB    
4666 N N     . ALA F 104 ? 0.9073 1.2189 0.6474 -0.1059 -0.2751 -0.2248 102 ALA F N     
4667 C CA    . ALA F 104 ? 0.9113 1.2443 0.6545 -0.0942 -0.2419 -0.2382 102 ALA F CA    
4668 C C     . ALA F 104 ? 0.8991 1.2731 0.6608 -0.0852 -0.2115 -0.2269 102 ALA F C     
4669 O O     . ALA F 104 ? 0.9275 1.3141 0.6715 -0.0747 -0.1876 -0.2385 102 ALA F O     
4670 C CB    . ALA F 104 ? 0.8837 1.2219 0.6673 -0.0977 -0.2424 -0.2390 102 ALA F CB    
4671 N N     . LYS F 105 ? 0.8649 1.2603 0.6628 -0.0895 -0.2123 -0.2048 103 LYS F N     
4672 C CA    . LYS F 105 ? 0.8160 1.2476 0.6326 -0.0822 -0.1861 -0.1932 103 LYS F CA    
4673 C C     . LYS F 105 ? 0.8844 1.3115 0.6599 -0.0771 -0.1816 -0.1965 103 LYS F C     
4674 O O     . LYS F 105 ? 0.8764 1.3259 0.6505 -0.0684 -0.1568 -0.1984 103 LYS F O     
4675 C CB    . LYS F 105 ? 0.7444 1.1940 0.5998 -0.0878 -0.1902 -0.1720 103 LYS F CB    
4676 C CG    . LYS F 105 ? 0.6914 1.1474 0.5841 -0.0930 -0.1904 -0.1655 103 LYS F CG    
4677 C CD    . LYS F 105 ? 0.6318 1.1130 0.5575 -0.0959 -0.1856 -0.1469 103 LYS F CD    
4678 C CE    . LYS F 105 ? 0.5821 1.0684 0.5379 -0.1029 -0.1871 -0.1397 103 LYS F CE    
4679 N NZ    . LYS F 105 ? 0.5358 1.0524 0.5193 -0.1045 -0.1765 -0.1243 103 LYS F NZ    
4680 N N     . ASP F 106 ? 0.9518 1.3471 0.6923 -0.0830 -0.2083 -0.1963 104 ASP F N     
4681 C CA    . ASP F 106 ? 0.9969 1.3769 0.6869 -0.0793 -0.2080 -0.1987 104 ASP F CA    
4682 C C     . ASP F 106 ? 1.0264 1.3907 0.6679 -0.0714 -0.1911 -0.2201 104 ASP F C     
4683 O O     . ASP F 106 ? 1.0403 1.4082 0.6511 -0.0649 -0.1733 -0.2210 104 ASP F O     
4684 C CB    . ASP F 106 ? 1.0544 1.3948 0.7134 -0.0879 -0.2466 -0.1948 104 ASP F CB    
4685 C CG    . ASP F 106 ? 1.0323 1.3945 0.7393 -0.0930 -0.2594 -0.1742 104 ASP F CG    
4686 O OD1   . ASP F 106 ? 0.9748 1.3778 0.7212 -0.0887 -0.2346 -0.1628 104 ASP F OD1   
4687 O OD2   . ASP F 106 ? 1.0810 1.4197 0.7893 -0.1011 -0.2951 -0.1704 104 ASP F OD2   
4688 N N     . ALA F 107 ? 1.0471 1.3932 0.6811 -0.0717 -0.1956 -0.2379 105 ALA F N     
4689 C CA    . ALA F 107 ? 1.1056 1.4407 0.7003 -0.0620 -0.1751 -0.2620 105 ALA F CA    
4690 C C     . ALA F 107 ? 1.0489 1.4331 0.6853 -0.0522 -0.1398 -0.2626 105 ALA F C     
4691 O O     . ALA F 107 ? 1.0579 1.4478 0.6664 -0.0432 -0.1151 -0.2709 105 ALA F O     
4692 C CB    . ALA F 107 ? 1.1526 1.4568 0.7361 -0.0647 -0.1910 -0.2823 105 ALA F CB    
4693 N N     . LEU F 108 ? 0.9816 1.3977 0.6823 -0.0544 -0.1379 -0.2532 106 LEU F N     
4694 C CA    . LEU F 108 ? 0.6809 1.1404 0.4234 -0.0465 -0.1109 -0.2526 106 LEU F CA    
4695 C C     . LEU F 108 ? 0.7310 1.2151 0.4733 -0.0433 -0.0953 -0.2367 106 LEU F C     
4696 O O     . LEU F 108 ? 0.7228 1.2296 0.4664 -0.0350 -0.0718 -0.2429 106 LEU F O     
4697 C CB    . LEU F 108 ? 0.6198 1.0962 0.4197 -0.0509 -0.1162 -0.2415 106 LEU F CB    
4698 C CG    . LEU F 108 ? 0.6352 1.0898 0.4425 -0.0542 -0.1306 -0.2563 106 LEU F CG    
4699 C CD1   . LEU F 108 ? 0.6224 1.0811 0.4737 -0.0617 -0.1394 -0.2382 106 LEU F CD1   
4700 C CD2   . LEU F 108 ? 0.6424 1.1068 0.4524 -0.0438 -0.1142 -0.2828 106 LEU F CD2   
4701 N N     . GLU F 109 ? 0.7304 1.2107 0.4740 -0.0498 -0.1091 -0.2165 107 GLU F N     
4702 C CA    . GLU F 109 ? 0.7346 1.2332 0.4755 -0.0475 -0.0986 -0.2018 107 GLU F CA    
4703 C C     . GLU F 109 ? 0.8409 1.3180 0.5187 -0.0435 -0.0900 -0.2113 107 GLU F C     
4704 O O     . GLU F 109 ? 0.8336 1.3308 0.5090 -0.0389 -0.0716 -0.2047 107 GLU F O     
4705 C CB    . GLU F 109 ? 0.7090 1.2023 0.4608 -0.0549 -0.1179 -0.1824 107 GLU F CB    
4706 C CG    . GLU F 109 ? 0.6387 1.1637 0.4500 -0.0549 -0.1110 -0.1668 107 GLU F CG    
4707 C CD    . GLU F 109 ? 0.6062 1.1609 0.4342 -0.0492 -0.0941 -0.1554 107 GLU F CD    
4708 O OE1   . GLU F 109 ? 0.6331 1.1852 0.4280 -0.0471 -0.0896 -0.1566 107 GLU F OE1   
4709 O OE2   . GLU F 109 ? 0.5473 1.1236 0.4167 -0.0471 -0.0858 -0.1450 107 GLU F OE2   
4710 N N     . ARG F 110 ? 0.9351 1.3666 0.5567 -0.0452 -0.1031 -0.2263 108 ARG F N     
4711 C CA    . ARG F 110 ? 1.0194 1.4200 0.5687 -0.0397 -0.0898 -0.2377 108 ARG F CA    
4712 C C     . ARG F 110 ? 1.0370 1.4574 0.5928 -0.0287 -0.0554 -0.2546 108 ARG F C     
4713 O O     . ARG F 110 ? 1.0586 1.4814 0.5865 -0.0225 -0.0295 -0.2535 108 ARG F O     
4714 C CB    . ARG F 110 ? 1.0906 1.4300 0.5727 -0.0435 -0.1139 -0.2516 108 ARG F CB    
4715 C CG    . ARG F 110 ? 1.1642 1.4561 0.5547 -0.0403 -0.1077 -0.2564 108 ARG F CG    
4716 C CD    . ARG F 110 ? 1.2166 1.4434 0.5403 -0.0479 -0.1456 -0.2605 108 ARG F CD    
4717 N NE    . ARG F 110 ? 1.1427 1.3759 0.5132 -0.0590 -0.1834 -0.2461 108 ARG F NE    
4718 C CZ    . ARG F 110 ? 1.1086 1.3317 0.5024 -0.0652 -0.2063 -0.2535 108 ARG F CZ    
4719 N NH1   . ARG F 110 ? 1.1226 1.3280 0.4968 -0.0615 -0.1977 -0.2768 108 ARG F NH1   
4720 N NH2   . ARG F 110 ? 1.0513 1.2811 0.4894 -0.0751 -0.2372 -0.2379 108 ARG F NH2   
4721 N N     . HIS F 111 ? 1.0310 1.4641 0.6251 -0.0262 -0.0546 -0.2701 109 HIS F N     
4722 C CA    . HIS F 111 ? 1.0316 1.4875 0.6456 -0.0151 -0.0241 -0.2878 109 HIS F CA    
4723 C C     . HIS F 111 ? 0.9719 1.4803 0.6415 -0.0126 -0.0069 -0.2723 109 HIS F C     
4724 O O     . HIS F 111 ? 0.9624 1.4865 0.6373 -0.0032 0.0233  -0.2806 109 HIS F O     
4725 C CB    . HIS F 111 ? 1.0237 1.4792 0.6701 -0.0141 -0.0341 -0.3080 109 HIS F CB    
4726 C CG    . HIS F 111 ? 1.1274 1.5314 0.7173 -0.0118 -0.0419 -0.3320 109 HIS F CG    
4727 N ND1   . HIS F 111 ? 1.2145 1.5889 0.7452 -0.0008 -0.0157 -0.3510 109 HIS F ND1   
4728 C CD2   . HIS F 111 ? 1.1559 1.5285 0.7374 -0.0190 -0.0727 -0.3394 109 HIS F CD2   
4729 C CE1   . HIS F 111 ? 1.2849 1.6108 0.7704 -0.0006 -0.0311 -0.3714 109 HIS F CE1   
4730 N NE2   . HIS F 111 ? 1.2475 1.5727 0.7646 -0.0123 -0.0678 -0.3646 109 HIS F NE2   
4731 N N     . PHE F 112 ? 0.9484 1.4810 0.6605 -0.0201 -0.0241 -0.2500 110 PHE F N     
4732 C CA    . PHE F 112 ? 0.9102 1.4884 0.6723 -0.0174 -0.0119 -0.2361 110 PHE F CA    
4733 C C     . PHE F 112 ? 0.9498 1.5319 0.6831 -0.0149 0.0055  -0.2240 110 PHE F C     
4734 O O     . PHE F 112 ? 0.9282 1.5417 0.6897 -0.0094 0.0245  -0.2199 110 PHE F O     
4735 C CB    . PHE F 112 ? 0.8545 1.4486 0.6623 -0.0242 -0.0312 -0.2162 110 PHE F CB    
4736 C CG    . PHE F 112 ? 0.8083 1.4433 0.6642 -0.0207 -0.0223 -0.2035 110 PHE F CG    
4737 C CD1   . PHE F 112 ? 0.7728 1.4304 0.6703 -0.0161 -0.0176 -0.2126 110 PHE F CD1   
4738 C CD2   . PHE F 112 ? 0.8044 1.4520 0.6621 -0.0218 -0.0219 -0.1833 110 PHE F CD2   
4739 C CE1   . PHE F 112 ? 0.7300 1.4200 0.6660 -0.0123 -0.0130 -0.2018 110 PHE F CE1   
4740 C CE2   . PHE F 112 ? 0.7578 1.4397 0.6569 -0.0178 -0.0163 -0.1724 110 PHE F CE2   
4741 C CZ    . PHE F 112 ? 0.7207 1.4228 0.6572 -0.0129 -0.0122 -0.1815 110 PHE F CZ    
4742 N N     . GLY F 113 ? 0.9943 1.5415 0.6700 -0.0192 -0.0022 -0.2175 111 GLY F N     
4743 C CA    . GLY F 113 ? 1.0380 1.5816 0.6776 -0.0176 0.0146  -0.2056 111 GLY F CA    
4744 C C     . GLY F 113 ? 1.0754 1.6084 0.6834 -0.0079 0.0514  -0.2197 111 GLY F C     
4745 O O     . GLY F 113 ? 1.0928 1.6360 0.6929 -0.0049 0.0750  -0.2080 111 GLY F O     
4746 N N     . GLU F 114 ? 1.0847 1.5947 0.6755 -0.0023 0.0589  -0.2444 112 GLU F N     
4747 C CA    . GLU F 114 ? 1.1183 1.6148 0.6860 0.0097  0.0992  -0.2613 112 GLU F CA    
4748 C C     . GLU F 114 ? 1.0847 1.6229 0.7312 0.0166  0.1120  -0.2720 112 GLU F C     
4749 O O     . GLU F 114 ? 1.0815 1.6192 0.7512 0.0178  0.0984  -0.2917 112 GLU F O     
4750 C CB    . GLU F 114 ? 1.1670 1.6070 0.6642 0.0134  0.0993  -0.2845 112 GLU F CB    
4751 N N     . GLN F 115 ? 1.0568 1.6280 0.7450 0.0210  0.1361  -0.2586 113 GLN F N     
4752 C CA    . GLN F 115 ? 1.0029 1.6106 0.7701 0.0280  0.1471  -0.2659 113 GLN F CA    
4753 C C     . GLN F 115 ? 0.9397 1.5758 0.7544 0.0202  0.1079  -0.2641 113 GLN F C     
4754 O O     . GLN F 115 ? 0.9333 1.5588 0.7484 0.0177  0.0871  -0.2815 113 GLN F O     
4755 C CB    . GLN F 115 ? 1.0327 1.6222 0.8061 0.0404  0.1730  -0.2952 113 GLN F CB    
4756 N N     . ASN F 116 ? 0.9090 1.5782 0.7618 0.0166  0.0982  -0.2424 114 ASN F N     
4757 C CA    . ASN F 116 ? 0.8406 1.5341 0.7343 0.0106  0.0654  -0.2387 114 ASN F CA    
4758 C C     . ASN F 116 ? 0.7927 1.4957 0.7320 0.0162  0.0649  -0.2618 114 ASN F C     
4759 O O     . ASN F 116 ? 0.7854 1.4843 0.7299 0.0105  0.0390  -0.2707 114 ASN F O     
4760 C CB    . ASN F 116 ? 0.8327 1.5573 0.7573 0.0094  0.0600  -0.2142 114 ASN F CB    
4761 C CG    . ASN F 116 ? 0.9095 1.6267 0.7950 0.0036  0.0568  -0.1928 114 ASN F CG    
4762 O OD1   . ASN F 116 ? 0.9927 1.6784 0.8242 0.0015  0.0635  -0.1956 114 ASN F OD1   
4763 N ND2   . ASN F 116 ? 0.8822 1.6254 0.7926 0.0018  0.0453  -0.1724 114 ASN F ND2   
4764 N N     . LYS F 117 ? 0.7514 1.4630 0.7327 0.0275  0.0935  -0.2685 115 LYS F N     
4765 C CA    . LYS F 117 ? 0.6988 1.4173 0.7387 0.0349  0.0940  -0.2903 115 LYS F CA    
4766 C C     . LYS F 117 ? 0.7592 1.4524 0.7908 0.0440  0.1178  -0.3173 115 LYS F C     
4767 O O     . LYS F 117 ? 0.7653 1.4546 0.8285 0.0550  0.1527  -0.3169 115 LYS F O     
4768 C CB    . LYS F 117 ? 0.6188 1.3556 0.7374 0.0419  0.1036  -0.2740 115 LYS F CB    
4769 C CG    . LYS F 117 ? 0.5461 1.2984 0.6636 0.0357  0.0890  -0.2433 115 LYS F CG    
4770 C CD    . LYS F 117 ? 0.4813 1.2342 0.6763 0.0416  0.0901  -0.2247 115 LYS F CD    
4771 N N     . PRO F 118 ? 0.8150 1.4872 0.8085 0.0401  0.0996  -0.3393 116 PRO F N     
4772 C CA    . PRO F 118 ? 0.9143 1.5579 0.8961 0.0502  0.1198  -0.3675 116 PRO F CA    
4773 C C     . PRO F 118 ? 0.9120 1.5647 0.9757 0.0616  0.1247  -0.3916 116 PRO F C     
4774 O O     . PRO F 118 ? 0.8804 1.5419 0.9981 0.0564  0.0960  -0.3829 116 PRO F O     
4775 C CB    . PRO F 118 ? 0.9556 1.5700 0.8756 0.0399  0.0881  -0.3772 116 PRO F CB    
4776 C CG    . PRO F 118 ? 0.8793 1.5129 0.8189 0.0265  0.0494  -0.3629 116 PRO F CG    
4777 C CD    . PRO F 118 ? 0.7998 1.4685 0.7683 0.0261  0.0574  -0.3369 116 PRO F CD    
4778 N N     . SER F 119 ? 0.9585 1.5902 1.0333 0.0751  0.1552  -0.4111 117 SER F N     
4779 C CA    . SER F 119 ? 0.9693 1.6033 1.1339 0.0877  0.1609  -0.4323 117 SER F CA    
4780 C C     . SER F 119 ? 0.9553 1.5625 1.1222 0.0805  0.1159  -0.4507 117 SER F C     
4781 O O     . SER F 119 ? 0.9666 1.5589 1.0629 0.0693  0.0904  -0.4564 117 SER F O     
4782 C CB    . SER F 119 ? 1.0799 1.6911 1.2519 0.1034  0.2056  -0.4434 117 SER F CB    
4783 O OG    . SER F 119 ? 1.1386 1.7538 1.2865 0.1048  0.2417  -0.4145 117 SER F OG    
4784 N N     . SER F 120 ? 0.9257 1.5235 1.1790 0.0857  0.1031  -0.4567 118 SER F N     
4785 C CA    . SER F 120 ? 0.9689 1.5359 1.2313 0.0780  0.0591  -0.4709 118 SER F CA    
4786 C C     . SER F 120 ? 1.0454 1.5829 1.2535 0.0837  0.0634  -0.5059 118 SER F C     
4787 O O     . SER F 120 ? 1.0898 1.6023 1.2765 0.0725  0.0232  -0.5144 118 SER F O     
4788 C CB    . SER F 120 ? 0.9806 1.5386 1.3477 0.0841  0.0458  -0.4717 118 SER F CB    
4789 O OG    . SER F 120 ? 0.9938 1.5225 1.3681 0.0719  -0.0038 -0.4759 118 SER F OG    
4790 N N     . GLN F 121 ? 1.0648 1.6020 1.2482 0.1007  0.1109  -0.5261 119 GLN F N     
4791 C CA    . GLN F 121 ? 1.1692 1.6727 1.2891 0.1081  0.1161  -0.5617 119 GLN F CA    
4792 C C     . GLN F 121 ? 1.2031 1.6944 1.2127 0.0946  0.1063  -0.5475 119 GLN F C     
4793 O O     . GLN F 121 ? 1.3277 1.7838 1.2861 0.0882  0.0774  -0.5598 119 GLN F O     
4794 C CB    . GLN F 121 ? 1.2542 1.7455 1.3931 0.1297  0.1682  -0.5757 119 GLN F CB    
4795 C CG    . GLN F 121 ? 1.2525 1.7725 1.4987 0.1403  0.1963  -0.5626 119 GLN F CG    
4796 C CD    . GLN F 121 ? 1.2390 1.7581 1.5906 0.1426  0.1630  -0.5754 119 GLN F CD    
4797 O OE1   . GLN F 121 ? 1.2610 1.7470 1.6058 0.1387  0.1258  -0.5950 119 GLN F OE1   
4798 N NE2   . GLN F 121 ? 1.2084 1.7523 1.6548 0.1448  0.1685  -0.5531 119 GLN F NE2   
4799 N N     . GLU F 122 ? 1.1050 1.6183 1.0840 0.0892  0.1255  -0.5152 120 GLU F N     
4800 C CA    . GLU F 122 ? 1.0946 1.5920 0.9827 0.0751  0.1096  -0.4939 120 GLU F CA    
4801 C C     . GLU F 122 ? 1.0311 1.5296 0.9135 0.0559  0.0560  -0.4846 120 GLU F C     
4802 O O     . GLU F 122 ? 1.0373 1.5062 0.8581 0.0458  0.0333  -0.4756 120 GLU F O     
4803 C CB    . GLU F 122 ? 1.0760 1.5976 0.9490 0.0721  0.1341  -0.4595 120 GLU F CB    
4804 C CG    . GLU F 122 ? 1.1163 1.6368 1.0033 0.0886  0.1888  -0.4586 120 GLU F CG    
4805 C CD    . GLU F 122 ? 1.1301 1.6524 0.9673 0.0841  0.2098  -0.4260 120 GLU F CD    
4806 O OE1   . GLU F 122 ? 1.1157 1.6360 0.9045 0.0693  0.1806  -0.4073 120 GLU F OE1   
4807 O OE2   . GLU F 122 ? 1.1565 1.6801 1.0075 0.0955  0.2550  -0.4176 120 GLU F OE2   
4808 N N     . ILE F 123 ? 0.9721 1.4989 0.9197 0.0505  0.0353  -0.4833 121 ILE F N     
4809 C CA    . ILE F 123 ? 0.9300 1.4526 0.8776 0.0310  -0.0127 -0.4659 121 ILE F CA    
4810 C C     . ILE F 123 ? 0.9820 1.4614 0.9178 0.0278  -0.0407 -0.4838 121 ILE F C     
4811 O O     . ILE F 123 ? 1.0197 1.4767 0.9237 0.0134  -0.0692 -0.4625 121 ILE F O     
4812 C CB    . ILE F 123 ? 0.8700 1.4202 0.8861 0.0258  -0.0281 -0.4554 121 ILE F CB    
4813 C CG1   . ILE F 123 ? 0.5645 1.1511 0.5847 0.0256  -0.0089 -0.4263 121 ILE F CG1   
4814 C CG2   . ILE F 123 ? 0.8678 1.4004 0.8909 0.0072  -0.0724 -0.4331 121 ILE F CG2   
4815 C CD1   . ILE F 123 ? 0.5044 1.1041 0.5977 0.0239  -0.0195 -0.4050 121 ILE F CD1   
4816 N N     . MET F 124 ? 1.0054 1.4687 0.9722 0.0424  -0.0313 -0.5216 122 MET F N     
4817 C CA    . MET F 124 ? 1.0599 1.4790 1.0177 0.0403  -0.0598 -0.5390 122 MET F CA    
4818 C C     . MET F 124 ? 1.1209 1.5038 0.9960 0.0422  -0.0543 -0.5414 122 MET F C     
4819 O O     . MET F 124 ? 1.1557 1.5021 1.0060 0.0325  -0.0875 -0.5394 122 MET F O     
4820 C CB    . MET F 124 ? 1.1152 1.5220 1.1344 0.0575  -0.0514 -0.5794 122 MET F CB    
4821 C CG    . MET F 124 ? 1.0965 1.5035 1.1941 0.0475  -0.0874 -0.5713 122 MET F CG    
4822 S SD    . MET F 124 ? 1.1412 1.5356 1.3384 0.0693  -0.0693 -0.5930 122 MET F SD    
4823 C CE    . MET F 124 ? 1.1202 1.4871 1.3718 0.0507  -0.1326 -0.5842 122 MET F CE    
4824 N N     . ARG F 125 ? 1.1390 1.5252 0.9698 0.0537  -0.0138 -0.5426 123 ARG F N     
4825 C CA    . ARG F 125 ? 1.2319 1.5746 0.9744 0.0543  -0.0112 -0.5427 123 ARG F CA    
4826 C C     . ARG F 125 ? 1.2358 1.5725 0.9395 0.0333  -0.0441 -0.5075 123 ARG F C     
4827 O O     . ARG F 125 ? 1.3135 1.6047 0.9593 0.0274  -0.0653 -0.5084 123 ARG F O     
4828 C CB    . ARG F 125 ? 1.2836 1.6253 0.9861 0.0697  0.0412  -0.5450 123 ARG F CB    
4829 N N     . MET F 126 ? 1.1391 1.5180 0.8769 0.0226  -0.0483 -0.4765 124 MET F N     
4830 C CA    . MET F 126 ? 1.0797 1.4543 0.7957 0.0045  -0.0754 -0.4412 124 MET F CA    
4831 C C     . MET F 126 ? 0.9971 1.3596 0.7470 -0.0102 -0.1151 -0.4302 124 MET F C     
4832 O O     . MET F 126 ? 1.0170 1.3515 0.7378 -0.0234 -0.1412 -0.4128 124 MET F O     
4833 C CB    . MET F 126 ? 1.0347 1.4549 0.7746 0.0011  -0.0609 -0.4119 124 MET F CB    
4834 C CG    . MET F 126 ? 1.0914 1.5215 0.7996 0.0127  -0.0219 -0.4141 124 MET F CG    
4835 S SD    . MET F 126 ? 1.0323 1.5173 0.7818 0.0084  -0.0099 -0.3810 124 MET F SD    
4836 C CE    . MET F 126 ? 0.9721 1.4527 0.7328 -0.0104 -0.0506 -0.3488 124 MET F CE    
4837 N N     . ALA F 127 ? 0.9233 1.3028 0.7354 -0.0093 -0.1204 -0.4377 125 ALA F N     
4838 C CA    . ALA F 127 ? 0.9149 1.2749 0.7565 -0.0240 -0.1553 -0.4230 125 ALA F CA    
4839 C C     . ALA F 127 ? 1.0407 1.3505 0.8455 -0.0280 -0.1794 -0.4377 125 ALA F C     
4840 O O     . ALA F 127 ? 1.0304 1.3178 0.8336 -0.0454 -0.2090 -0.4150 125 ALA F O     
4841 C CB    . ALA F 127 ? 0.8491 1.2230 0.7564 -0.0205 -0.1576 -0.4327 125 ALA F CB    
4842 N N     . GLU F 128 ? 1.1625 1.4512 0.9360 -0.0121 -0.1658 -0.4750 126 GLU F N     
4843 C CA    . GLU F 128 ? 1.2849 1.5206 1.0160 -0.0147 -0.1890 -0.4911 126 GLU F CA    
4844 C C     . GLU F 128 ? 1.3584 1.5691 1.0194 -0.0243 -0.1976 -0.4747 126 GLU F C     
4845 O O     . GLU F 128 ? 1.4565 1.6313 1.0966 -0.0393 -0.2309 -0.4669 126 GLU F O     
4846 C CB    . GLU F 128 ? 1.0650 1.2795 0.7829 0.0079  -0.1683 -0.5374 126 GLU F CB    
4847 N N     . GLU F 129 ? 1.3040 1.5317 0.9309 -0.0175 -0.1700 -0.4678 127 GLU F N     
4848 C CA    . GLU F 129 ? 1.3792 1.5792 0.9406 -0.0269 -0.1808 -0.4512 127 GLU F CA    
4849 C C     . GLU F 129 ? 1.3653 1.5745 0.9541 -0.0484 -0.2116 -0.4129 127 GLU F C     
4850 O O     . GLU F 129 ? 1.4620 1.6364 1.0102 -0.0619 -0.2381 -0.4024 127 GLU F O     
4851 C CB    . GLU F 129 ? 1.3749 1.5911 0.8998 -0.0155 -0.1438 -0.4481 127 GLU F CB    
4852 C CG    . GLU F 129 ? 1.3866 1.5896 0.8674 -0.0275 -0.1566 -0.4200 127 GLU F CG    
4853 C CD    . GLU F 129 ? 1.4017 1.6235 0.8559 -0.0177 -0.1210 -0.4123 127 GLU F CD    
4854 O OE1   . GLU F 129 ? 1.3855 1.6179 0.8363 -0.0265 -0.1290 -0.3840 127 GLU F OE1   
4855 O OE2   . GLU F 129 ? 1.4408 1.6646 0.8795 -0.0012 -0.0844 -0.4339 127 GLU F OE2   
4856 N N     . LEU F 130 ? 1.2422 1.4938 0.8987 -0.0525 -0.2086 -0.3924 128 LEU F N     
4857 C CA    . LEU F 130 ? 1.2034 1.4642 0.8884 -0.0699 -0.2298 -0.3558 128 LEU F CA    
4858 C C     . LEU F 130 ? 1.1627 1.4119 0.8889 -0.0842 -0.2566 -0.3466 128 LEU F C     
4859 O O     . LEU F 130 ? 1.1604 1.4128 0.9099 -0.0992 -0.2737 -0.3166 128 LEU F O     
4860 C CB    . LEU F 130 ? 1.1659 1.4761 0.8888 -0.0656 -0.2053 -0.3343 128 LEU F CB    
4861 N N     . ASN F 131 ? 1.1393 1.3741 0.8765 -0.0794 -0.2598 -0.3716 129 ASN F N     
4862 C CA    . ASN F 131 ? 1.1300 1.3493 0.9033 -0.0945 -0.2859 -0.3626 129 ASN F CA    
4863 C C     . ASN F 131 ? 1.0604 1.3088 0.8873 -0.1014 -0.2810 -0.3325 129 ASN F C     
4864 O O     . ASN F 131 ? 1.0475 1.2890 0.8929 -0.1204 -0.3013 -0.3040 129 ASN F O     
4865 C CB    . ASN F 131 ? 1.1578 1.3443 0.9063 -0.1160 -0.3201 -0.3497 129 ASN F CB    
4866 C CG    . ASN F 131 ? 1.1619 1.3310 0.9390 -0.1324 -0.3451 -0.3475 129 ASN F CG    
4867 O OD1   . ASN F 131 ? 1.1634 1.3300 0.9657 -0.1231 -0.3401 -0.3660 129 ASN F OD1   
4868 N ND2   . ASN F 131 ? 1.1728 1.3340 0.9502 -0.1582 -0.3716 -0.3248 129 ASN F ND2   
4869 N N     . LEU F 132 ? 1.0046 1.2851 0.8544 -0.0864 -0.2532 -0.3391 130 LEU F N     
4870 C CA    . LEU F 132 ? 0.9589 1.2613 0.8522 -0.0907 -0.2465 -0.3142 130 LEU F CA    
4871 C C     . LEU F 132 ? 0.9381 1.2485 0.8652 -0.0795 -0.2367 -0.3346 130 LEU F C     
4872 O O     . LEU F 132 ? 0.9785 1.2906 0.9005 -0.0637 -0.2263 -0.3705 130 LEU F O     
4873 C CB    . LEU F 132 ? 0.9365 1.2725 0.8289 -0.0857 -0.2243 -0.2953 130 LEU F CB    
4874 C CG    . LEU F 132 ? 0.9392 1.2703 0.8160 -0.0968 -0.2361 -0.2704 130 LEU F CG    
4875 C CD1   . LEU F 132 ? 0.8954 1.2591 0.7678 -0.0881 -0.2119 -0.2602 130 LEU F CD1   
4876 C CD2   . LEU F 132 ? 0.9232 1.2437 0.8285 -0.1125 -0.2551 -0.2434 130 LEU F CD2   
4877 N N     . GLU F 133 ? 0.8741 1.1860 0.8355 -0.0873 -0.2409 -0.3123 131 GLU F N     
4878 C CA    . GLU F 133 ? 0.8350 1.1517 0.8340 -0.0781 -0.2356 -0.3269 131 GLU F CA    
4879 C C     . GLU F 133 ? 0.8138 1.1703 0.8235 -0.0603 -0.2065 -0.3410 131 GLU F C     
4880 O O     . GLU F 133 ? 0.7970 1.1779 0.7879 -0.0588 -0.1900 -0.3272 131 GLU F O     
4881 C CB    . GLU F 133 ? 0.7789 1.0801 0.8008 -0.0936 -0.2494 -0.2945 131 GLU F CB    
4882 N N     . LYS F 134 ? 0.8151 1.1785 0.8609 -0.0471 -0.2015 -0.3696 132 LYS F N     
4883 C CA    . LYS F 134 ? 0.8077 1.2121 0.8720 -0.0314 -0.1753 -0.3874 132 LYS F CA    
4884 C C     . LYS F 134 ? 0.7950 1.2161 0.8731 -0.0364 -0.1692 -0.3533 132 LYS F C     
4885 O O     . LYS F 134 ? 0.7843 1.2407 0.8545 -0.0301 -0.1479 -0.3510 132 LYS F O     
4886 C CB    . LYS F 134 ? 0.8019 1.2066 0.9161 -0.0170 -0.1750 -0.4277 132 LYS F CB    
4887 C CG    . LYS F 134 ? 0.8433 1.2188 0.9473 -0.0105 -0.1833 -0.4623 132 LYS F CG    
4888 N N     . GLU F 135 ? 0.8034 1.1955 0.8968 -0.0482 -0.1878 -0.3257 133 GLU F N     
4889 C CA    . GLU F 135 ? 0.8070 1.2037 0.9065 -0.0518 -0.1832 -0.2949 133 GLU F CA    
4890 C C     . GLU F 135 ? 0.8006 1.2107 0.8637 -0.0567 -0.1711 -0.2707 133 GLU F C     
4891 O O     . GLU F 135 ? 0.7492 1.1836 0.8134 -0.0505 -0.1545 -0.2614 133 GLU F O     
4892 C CB    . GLU F 135 ? 0.8928 1.2484 1.0014 -0.0660 -0.2067 -0.2702 133 GLU F CB    
4893 C CG    . GLU F 135 ? 0.9515 1.2943 1.1058 -0.0597 -0.2169 -0.2820 133 GLU F CG    
4894 C CD    . GLU F 135 ? 0.9372 1.2940 1.1110 -0.0520 -0.2076 -0.2723 133 GLU F CD    
4895 O OE1   . GLU F 135 ? 0.9146 1.2966 1.1298 -0.0360 -0.1979 -0.2987 133 GLU F OE1   
4896 O OE2   . GLU F 135 ? 0.9268 1.2692 1.0772 -0.0622 -0.2109 -0.2400 133 GLU F OE2   
4897 N N     . VAL F 136 ? 0.8782 1.2715 0.9141 -0.0677 -0.1812 -0.2605 134 VAL F N     
4898 C CA    . VAL F 136 ? 0.8912 1.2942 0.9031 -0.0722 -0.1733 -0.2387 134 VAL F CA    
4899 C C     . VAL F 136 ? 0.8561 1.2949 0.8552 -0.0604 -0.1508 -0.2506 134 VAL F C     
4900 O O     . VAL F 136 ? 0.8278 1.2845 0.8216 -0.0587 -0.1374 -0.2335 134 VAL F O     
4901 C CB    . VAL F 136 ? 0.9660 1.3448 0.9603 -0.0859 -0.1930 -0.2303 134 VAL F CB    
4902 C CG1   . VAL F 136 ? 0.9514 1.3436 0.9308 -0.0887 -0.1863 -0.2122 134 VAL F CG1   
4903 C CG2   . VAL F 136 ? 1.0207 1.3674 1.0276 -0.0998 -0.2157 -0.2151 134 VAL F CG2   
4904 N N     . VAL F 137 ? 0.8367 1.2852 0.8289 -0.0522 -0.1463 -0.2810 135 VAL F N     
4905 C CA    . VAL F 137 ? 0.8420 1.3222 0.8151 -0.0426 -0.1254 -0.2918 135 VAL F CA    
4906 C C     . VAL F 137 ? 0.8161 1.3319 0.8155 -0.0325 -0.1066 -0.2944 135 VAL F C     
4907 O O     . VAL F 137 ? 0.8472 1.3891 0.8357 -0.0290 -0.0906 -0.2847 135 VAL F O     
4908 C CB    . VAL F 137 ? 0.9017 1.3749 0.8498 -0.0361 -0.1244 -0.3255 135 VAL F CB    
4909 C CG1   . VAL F 137 ? 0.9206 1.4170 0.8367 -0.0279 -0.1019 -0.3321 135 VAL F CG1   
4910 C CG2   . VAL F 137 ? 0.9418 1.3749 0.8642 -0.0471 -0.1485 -0.3216 135 VAL F CG2   
4911 N N     . ARG F 138 ? 0.7429 1.2579 0.7802 -0.0284 -0.1113 -0.3066 136 ARG F N     
4912 C CA    . ARG F 138 ? 0.7017 1.2482 0.7704 -0.0196 -0.0989 -0.3097 136 ARG F CA    
4913 C C     . ARG F 138 ? 0.6409 1.1834 0.7052 -0.0237 -0.0967 -0.2727 136 ARG F C     
4914 O O     . ARG F 138 ? 0.6103 1.1834 0.6743 -0.0180 -0.0814 -0.2673 136 ARG F O     
4915 C CB    . ARG F 138 ? 0.7220 1.2586 0.8415 -0.0154 -0.1111 -0.3278 136 ARG F CB    
4916 C CG    . ARG F 138 ? 0.7239 1.2981 0.8895 -0.0053 -0.1005 -0.3388 136 ARG F CG    
4917 C CD    . ARG F 138 ? 0.7614 1.3145 0.9915 -0.0020 -0.1174 -0.3446 136 ARG F CD    
4918 N NE    . ARG F 138 ? 0.8083 1.3143 1.0289 -0.0101 -0.1344 -0.3047 136 ARG F NE    
4919 C CZ    . ARG F 138 ? 0.8522 1.3108 1.0566 -0.0209 -0.1548 -0.2900 136 ARG F CZ    
4920 N NH1   . ARG F 138 ? 0.8554 1.3031 1.0554 -0.0236 -0.1623 -0.3092 136 ARG F NH1   
4921 N NH2   . ARG F 138 ? 0.8619 1.2844 1.0528 -0.0299 -0.1684 -0.2569 136 ARG F NH2   
4922 N N     . VAL F 139 ? 0.6052 1.1089 0.6645 -0.0336 -0.1119 -0.2485 137 VAL F N     
4923 C CA    . VAL F 139 ? 0.5663 1.0616 0.6181 -0.0364 -0.1089 -0.2189 137 VAL F CA    
4924 C C     . VAL F 139 ? 0.5784 1.0932 0.6061 -0.0368 -0.0953 -0.2083 137 VAL F C     
4925 O O     . VAL F 139 ? 0.3482 0.8721 0.3750 -0.0337 -0.0858 -0.1927 137 VAL F O     
4926 C CB    . VAL F 139 ? 0.5695 1.0229 0.6172 -0.0479 -0.1275 -0.2001 137 VAL F CB    
4927 C CG1   . VAL F 139 ? 0.3953 0.8250 0.4676 -0.0492 -0.1450 -0.2089 137 VAL F CG1   
4928 C CG2   . VAL F 139 ? 0.6189 1.0606 0.6466 -0.0584 -0.1354 -0.1958 137 VAL F CG2   
4929 N N     . TRP F 140 ? 0.6052 1.1217 0.6137 -0.0409 -0.0973 -0.2164 138 TRP F N     
4930 C CA    . TRP F 140 ? 0.5850 1.1154 0.5735 -0.0419 -0.0892 -0.2062 138 TRP F CA    
4931 C C     . TRP F 140 ? 0.5801 1.1460 0.5715 -0.0324 -0.0713 -0.2091 138 TRP F C     
4932 O O     . TRP F 140 ? 0.5295 1.1048 0.5204 -0.0313 -0.0639 -0.1917 138 TRP F O     
4933 C CB    . TRP F 140 ? 0.5989 1.1182 0.5632 -0.0471 -0.0989 -0.2174 138 TRP F CB    
4934 C CG    . TRP F 140 ? 0.5840 1.1048 0.5293 -0.0514 -0.0998 -0.2035 138 TRP F CG    
4935 C CD1   . TRP F 140 ? 0.5961 1.1005 0.5394 -0.0609 -0.1128 -0.1887 138 TRP F CD1   
4936 C CD2   . TRP F 140 ? 0.5854 1.1253 0.5139 -0.0468 -0.0895 -0.2035 138 TRP F CD2   
4937 N NE1   . TRP F 140 ? 0.6150 1.1271 0.5443 -0.0619 -0.1126 -0.1811 138 TRP F NE1   
4938 C CE2   . TRP F 140 ? 0.6109 1.1410 0.5283 -0.0537 -0.0992 -0.1887 138 TRP F CE2   
4939 C CE3   . TRP F 140 ? 0.5797 1.1440 0.5015 -0.0382 -0.0742 -0.2144 138 TRP F CE3   
4940 C CZ2   . TRP F 140 ? 0.6199 1.1580 0.5183 -0.0524 -0.0967 -0.1838 138 TRP F CZ2   
4941 C CZ3   . TRP F 140 ? 0.5897 1.1613 0.4891 -0.0377 -0.0700 -0.2073 138 TRP F CZ3   
4942 C CH2   . TRP F 140 ? 0.6151 1.1711 0.5022 -0.0448 -0.0823 -0.1921 138 TRP F CH2   
4943 N N     . PHE F 141 ? 0.6560 1.2435 0.6517 -0.0253 -0.0646 -0.2329 139 PHE F N     
4944 C CA    . PHE F 141 ? 0.7103 1.3365 0.7104 -0.0173 -0.0482 -0.2362 139 PHE F CA    
4945 C C     . PHE F 141 ? 0.7582 1.3916 0.7852 -0.0129 -0.0456 -0.2225 139 PHE F C     
4946 O O     . PHE F 141 ? 0.7513 1.4075 0.7789 -0.0091 -0.0359 -0.2116 139 PHE F O     
4947 C CB    . PHE F 141 ? 0.7260 1.3739 0.7256 -0.0103 -0.0391 -0.2690 139 PHE F CB    
4948 C CG    . PHE F 141 ? 0.7782 1.4112 0.7332 -0.0113 -0.0343 -0.2794 139 PHE F CG    
4949 C CD1   . PHE F 141 ? 0.8074 1.4489 0.7321 -0.0094 -0.0200 -0.2715 139 PHE F CD1   
4950 C CD2   . PHE F 141 ? 0.8172 1.4182 0.7562 -0.0144 -0.0462 -0.2949 139 PHE F CD2   
4951 C CE1   . PHE F 141 ? 0.8787 1.4915 0.7523 -0.0099 -0.0168 -0.2789 139 PHE F CE1   
4952 C CE2   . PHE F 141 ? 0.8848 1.4620 0.7755 -0.0143 -0.0441 -0.3045 139 PHE F CE2   
4953 C CZ    . PHE F 141 ? 0.9178 1.4983 0.7728 -0.0118 -0.0290 -0.2964 139 PHE F CZ    
4954 N N     . CYS F 142 ? 0.6865 1.2927 0.7325 -0.0136 -0.0570 -0.2214 140 CYS F N     
4955 C CA    . CYS F 142 ? 0.6202 1.2130 0.6824 -0.0100 -0.0595 -0.2052 140 CYS F CA    
4956 C C     . CYS F 142 ? 0.5905 1.1707 0.6341 -0.0127 -0.0557 -0.1799 140 CYS F C     
4957 O O     . CYS F 142 ? 0.5822 1.1745 0.6274 -0.0072 -0.0482 -0.1705 140 CYS F O     
4958 C CB    . CYS F 142 ? 0.6410 1.1950 0.7209 -0.0131 -0.0775 -0.2046 140 CYS F CB    
4959 S SG    . CYS F 142 ? 0.6517 1.2186 0.7727 -0.0082 -0.0845 -0.2370 140 CYS F SG    
4960 N N     . ASN F 143 ? 0.5728 1.1301 0.6020 -0.0211 -0.0619 -0.1703 141 ASN F N     
4961 C CA    . ASN F 143 ? 0.5028 1.0558 0.5216 -0.0232 -0.0577 -0.1517 141 ASN F CA    
4962 C C     . ASN F 143 ? 0.4457 1.0273 0.4574 -0.0209 -0.0470 -0.1499 141 ASN F C     
4963 O O     . ASN F 143 ? 0.4078 0.9937 0.4192 -0.0181 -0.0414 -0.1374 141 ASN F O     
4964 C CB    . ASN F 143 ? 0.4853 1.0184 0.4951 -0.0334 -0.0667 -0.1454 141 ASN F CB    
4965 C CG    . ASN F 143 ? 0.4805 0.9840 0.4942 -0.0374 -0.0789 -0.1420 141 ASN F CG    
4966 O OD1   . ASN F 143 ? 0.4802 0.9724 0.5007 -0.0324 -0.0810 -0.1383 141 ASN F OD1   
4967 N ND2   . ASN F 143 ? 0.4766 0.9646 0.4853 -0.0473 -0.0904 -0.1423 141 ASN F ND2   
4968 N N     . ARG F 144 ? 0.4391 1.0375 0.4432 -0.0225 -0.0462 -0.1626 142 ARG F N     
4969 C CA    . ARG F 144 ? 0.4506 1.0724 0.4447 -0.0215 -0.0398 -0.1599 142 ARG F CA    
4970 C C     . ARG F 144 ? 0.4628 1.1121 0.4681 -0.0132 -0.0294 -0.1584 142 ARG F C     
4971 O O     . ARG F 144 ? 0.4623 1.1221 0.4649 -0.0119 -0.0255 -0.1461 142 ARG F O     
4972 C CB    . ARG F 144 ? 0.3497 0.9746 0.3238 -0.0250 -0.0437 -0.1753 142 ARG F CB    
4973 C CG    . ARG F 144 ? 0.4920 1.1252 0.4438 -0.0265 -0.0427 -0.1699 142 ARG F CG    
4974 C CD    . ARG F 144 ? 0.4848 1.1036 0.4348 -0.0317 -0.0502 -0.1525 142 ARG F CD    
4975 N NE    . ARG F 144 ? 0.3916 1.0112 0.3182 -0.0340 -0.0544 -0.1474 142 ARG F NE    
4976 C CZ    . ARG F 144 ? 0.5108 1.1476 0.4407 -0.0305 -0.0483 -0.1371 142 ARG F CZ    
4977 N NH1   . ARG F 144 ? 0.4645 1.1202 0.4210 -0.0239 -0.0376 -0.1316 142 ARG F NH1   
4978 N NH2   . ARG F 144 ? 0.5584 1.1887 0.4615 -0.0338 -0.0554 -0.1321 142 ARG F NH2   
4979 N N     . ARG F 145 ? 0.4758 1.1373 0.4952 -0.0077 -0.0268 -0.1715 143 ARG F N     
4980 C CA    . ARG F 145 ? 0.4715 1.1599 0.5027 0.0000  -0.0192 -0.1705 143 ARG F CA    
4981 C C     . ARG F 145 ? 0.4677 1.1264 0.5006 0.0030  -0.0224 -0.1508 143 ARG F C     
4982 O O     . ARG F 145 ? 0.4942 1.1643 0.5251 0.0066  -0.0181 -0.1403 143 ARG F O     
4983 C CB    . ARG F 145 ? 0.4775 1.1814 0.5283 0.0048  -0.0200 -0.1918 143 ARG F CB    
4984 C CG    . ARG F 145 ? 0.5021 1.2557 0.5506 0.0054  -0.0106 -0.2154 143 ARG F CG    
4985 C CD    . ARG F 145 ? 0.5143 1.2776 0.6022 0.0116  -0.0071 -0.2377 143 ARG F CD    
4986 N NE    . ARG F 145 ? 0.5452 1.2863 0.6224 0.0083  -0.0142 -0.2607 143 ARG F NE    
4987 C CZ    . ARG F 145 ? 0.5537 1.2755 0.6772 0.0129  -0.0167 -0.2726 143 ARG F CZ    
4988 N NH1   . ARG F 145 ? 0.5507 1.2726 0.7360 0.0206  -0.0140 -0.2631 143 ARG F NH1   
4989 N NH2   . ARG F 145 ? 0.5695 1.2700 0.6811 0.0095  -0.0258 -0.2934 143 ARG F NH2   
4990 N N     . GLN F 146 ? 0.4383 1.0573 0.4735 0.0010  -0.0317 -0.1457 144 GLN F N     
4991 C CA    . GLN F 146 ? 0.4204 1.0113 0.4549 0.0035  -0.0359 -0.1297 144 GLN F CA    
4992 C C     . GLN F 146 ? 0.4247 1.0229 0.4482 0.0020  -0.0297 -0.1186 144 GLN F C     
4993 O O     . GLN F 146 ? 0.4182 1.0085 0.4416 0.0065  -0.0298 -0.1084 144 GLN F O     
4994 C CB    . GLN F 146 ? 0.4237 0.9793 0.4593 -0.0003 -0.0468 -0.1273 144 GLN F CB    
4995 C CG    . GLN F 146 ? 0.4231 0.9592 0.4757 0.0016  -0.0595 -0.1331 144 GLN F CG    
4996 C CD    . GLN F 146 ? 0.4576 0.9559 0.5062 -0.0023 -0.0730 -0.1252 144 GLN F CD    
4997 O OE1   . GLN F 146 ? 0.4684 0.9606 0.5034 -0.0092 -0.0728 -0.1229 144 GLN F OE1   
4998 N NE2   . GLN F 146 ? 0.4896 0.9631 0.5503 0.0014  -0.0867 -0.1202 144 GLN F NE2   
4999 N N     . ARG F 147 ? 0.4444 1.0538 0.4608 -0.0046 -0.0279 -0.1207 145 ARG F N     
5000 C CA    . ARG F 147 ? 0.4641 1.0788 0.4746 -0.0069 -0.0265 -0.1110 145 ARG F CA    
5001 C C     . ARG F 147 ? 0.4815 1.1153 0.4915 -0.0024 -0.0220 -0.1053 145 ARG F C     
5002 O O     . ARG F 147 ? 0.4927 1.1204 0.5024 0.0003  -0.0225 -0.0953 145 ARG F O     
5003 C CB    . ARG F 147 ? 0.4583 1.0772 0.4608 -0.0155 -0.0311 -0.1151 145 ARG F CB    
5004 C CG    . ARG F 147 ? 0.4591 1.0821 0.4561 -0.0188 -0.0342 -0.1062 145 ARG F CG    
5005 C CD    . ARG F 147 ? 0.4815 1.0972 0.4700 -0.0281 -0.0443 -0.1092 145 ARG F CD    
5006 N NE    . ARG F 147 ? 0.3095 0.9285 0.2945 -0.0314 -0.0512 -0.1012 145 ARG F NE    
5007 N N     . GLU F 148 ? 0.4652 1.1254 0.4754 -0.0017 -0.0183 -0.1123 146 GLU F N     
5008 C CA    . GLU F 148 ? 0.5006 1.1845 0.5095 0.0011  -0.0147 -0.1053 146 GLU F CA    
5009 C C     . GLU F 148 ? 0.5345 1.2066 0.5488 0.0087  -0.0149 -0.0982 146 GLU F C     
5010 O O     . GLU F 148 ? 0.5635 1.2505 0.5764 0.0107  -0.0141 -0.0892 146 GLU F O     
5011 C CB    . GLU F 148 ? 0.5038 1.2264 0.5105 -0.0010 -0.0110 -0.1154 146 GLU F CB    
5012 C CG    . GLU F 148 ? 0.5214 1.2371 0.5079 -0.0092 -0.0175 -0.1200 146 GLU F CG    
5013 C CD    . GLU F 148 ? 0.5448 1.2551 0.5146 -0.0132 -0.0235 -0.1068 146 GLU F CD    
5014 O OE1   . GLU F 148 ? 0.5814 1.2711 0.5289 -0.0197 -0.0326 -0.1083 146 GLU F OE1   
5015 O OE2   . GLU F 148 ? 0.5347 1.2575 0.5115 -0.0097 -0.0212 -0.0950 146 GLU F OE2   
5016 N N     . LYS F 149 ? 0.5276 1.1679 0.5480 0.0118  -0.0202 -0.1001 147 LYS F N     
5017 C CA    . LYS F 149 ? 0.5274 1.1430 0.5572 0.0178  -0.0282 -0.0920 147 LYS F CA    
5018 C C     . LYS F 149 ? 0.5432 1.1296 0.5711 0.0199  -0.0333 -0.0832 147 LYS F C     
5019 O O     . LYS F 149 ? 0.5291 1.0906 0.5664 0.0248  -0.0428 -0.0771 147 LYS F O     
5020 C CB    . LYS F 149 ? 0.5152 1.1131 0.5608 0.0196  -0.0361 -0.0991 147 LYS F CB    
5021 N N     . ARG F 150 ? 0.5720 1.1630 0.5918 0.0162  -0.0291 -0.0830 148 ARG F N     
5022 C CA    . ARG F 150 ? 0.5681 1.1430 0.5871 0.0187  -0.0324 -0.0773 148 ARG F CA    
5023 C C     . ARG F 150 ? 0.6008 1.1757 0.6219 0.0227  -0.0362 -0.0682 148 ARG F C     
5024 O O     . ARG F 150 ? 0.6127 1.2034 0.6341 0.0218  -0.0353 -0.0643 148 ARG F O     
5025 C CB    . ARG F 150 ? 0.5276 1.1142 0.5423 0.0130  -0.0286 -0.0791 148 ARG F CB    
5026 C CG    . ARG F 150 ? 0.4946 1.0782 0.5087 0.0076  -0.0278 -0.0860 148 ARG F CG    
5027 C CD    . ARG F 150 ? 0.4747 1.0729 0.4864 0.0000  -0.0270 -0.0864 148 ARG F CD    
5028 N NE    . ARG F 150 ? 0.4505 1.0442 0.4617 -0.0063 -0.0286 -0.0909 148 ARG F NE    
5029 C CZ    . ARG F 150 ? 0.4282 1.0310 0.4379 -0.0146 -0.0312 -0.0917 148 ARG F CZ    
5030 N NH1   . ARG F 150 ? 0.4282 1.0433 0.4368 -0.0172 -0.0338 -0.0887 148 ARG F NH1   
5031 N NH2   . ARG F 150 ? 0.4284 1.0253 0.4373 -0.0213 -0.0345 -0.0947 148 ARG F NH2   
5032 N N     . VAL F 151 ? 0.6212 1.1906 0.6438 0.0279  -0.0398 -0.0662 149 VAL F N     
5033 C CA    . VAL F 151 ? 0.6493 1.2199 0.6760 0.0320  -0.0457 -0.0586 149 VAL F CA    
5034 C C     . VAL F 151 ? 0.6739 1.2643 0.6976 0.0281  -0.0442 -0.0559 149 VAL F C     
5035 O O     . VAL F 151 ? 0.6926 1.2867 0.7193 0.0280  -0.0502 -0.0480 149 VAL F O     
5036 C CB    . VAL F 151 ? 0.6534 1.2073 0.6849 0.0407  -0.0535 -0.0593 149 VAL F CB    
5037 C CG1   . VAL F 151 ? 0.6561 1.2161 0.6819 0.0418  -0.0484 -0.0663 149 VAL F CG1   
5038 C CG2   . VAL F 151 ? 0.6683 1.2216 0.7075 0.0453  -0.0624 -0.0521 149 VAL F CG2   
5039 N N     . LYS F 152 ? 0.6821 1.2836 0.7020 0.0235  -0.0392 -0.0611 150 LYS F N     
5040 C CA    . LYS F 152 ? 0.7141 1.3309 0.7345 0.0190  -0.0425 -0.0585 150 LYS F CA    
5041 C C     . LYS F 152 ? 0.7227 1.3474 0.7425 0.0143  -0.0389 -0.0642 150 LYS F C     
5042 O O     . LYS F 152 ? 0.7254 1.3582 0.7507 0.0154  -0.0418 -0.0640 150 LYS F O     
5043 C CB    . LYS F 152 ? 0.7290 1.3459 0.7575 0.0252  -0.0509 -0.0537 150 LYS F CB    
5044 O OXT   . LYS F 152 ? 0.7221 1.3458 0.7381 0.0090  -0.0345 -0.0688 150 LYS F OXT   
5045 C "C4'" . DC  G 1   ? 0.5363 1.2122 0.9547 0.0019  0.0862  0.0575  170 DC  G "C4'" 
5046 O "O4'" . DC  G 1   ? 0.5375 1.2260 0.9861 -0.0109 0.0800  0.0360  170 DC  G "O4'" 
5047 C "C3'" . DC  G 1   ? 0.5561 1.2209 0.9367 0.0106  0.0784  0.0580  170 DC  G "C3'" 
5048 O "O3'" . DC  G 1   ? 0.5752 1.2545 0.9325 0.0242  0.0760  0.0699  170 DC  G "O3'" 
5049 C "C2'" . DC  G 1   ? 0.5464 1.2338 0.9404 0.0040  0.0639  0.0342  170 DC  G "C2'" 
5050 C "C1'" . DC  G 1   ? 0.5263 1.2350 0.9649 -0.0087 0.0652  0.0215  170 DC  G "C1'" 
5051 N N1    . DC  G 1   ? 0.5022 1.2056 0.9601 -0.0214 0.0612  0.0017  170 DC  G N1    
5052 C C2    . DC  G 1   ? 0.4803 1.2100 0.9408 -0.0235 0.0467  -0.0179 170 DC  G C2    
5053 O O2    . DC  G 1   ? 0.4563 1.2140 0.9030 -0.0147 0.0369  -0.0179 170 DC  G O2    
5054 N N3    . DC  G 1   ? 0.4929 1.2168 0.9715 -0.0354 0.0440  -0.0364 170 DC  G N3    
5055 C C4    . DC  G 1   ? 0.5009 1.1941 0.9948 -0.0443 0.0553  -0.0350 170 DC  G C4    
5056 N N4    . DC  G 1   ? 0.5005 1.1886 1.0130 -0.0557 0.0530  -0.0535 170 DC  G N4    
5057 C C5    . DC  G 1   ? 0.5021 1.1689 0.9936 -0.0420 0.0699  -0.0146 170 DC  G C5    
5058 C C6    . DC  G 1   ? 0.5038 1.1768 0.9769 -0.0307 0.0723  0.0028  170 DC  G C6    
5059 P P     . DC  G 2   ? 0.6089 1.2844 0.9267 0.0351  0.0667  0.0709  171 DC  G P     
5060 O OP1   . DC  G 2   ? 0.6261 1.3079 0.9218 0.0486  0.0700  0.0881  171 DC  G OP1   
5061 O OP2   . DC  G 2   ? 0.6033 1.2398 0.9032 0.0317  0.0697  0.0707  171 DC  G OP2   
5062 O "O5'" . DC  G 2   ? 0.6051 1.3202 0.9376 0.0322  0.0497  0.0493  171 DC  G "O5'" 
5063 C "C5'" . DC  G 2   ? 0.5993 1.3306 0.9067 0.0422  0.0382  0.0473  171 DC  G "C5'" 
5064 C "C4'" . DC  G 2   ? 0.6131 1.3769 0.9381 0.0356  0.0231  0.0242  171 DC  G "C4'" 
5065 O "O4'" . DC  G 2   ? 0.6313 1.3861 0.9850 0.0207  0.0254  0.0100  171 DC  G "O4'" 
5066 C "C3'" . DC  G 2   ? 0.6228 1.3838 0.9191 0.0409  0.0117  0.0169  171 DC  G "C3'" 
5067 O "O3'" . DC  G 2   ? 0.6056 1.4072 0.8987 0.0481  -0.0004 0.0125  171 DC  G "O3'" 
5068 C "C2'" . DC  G 2   ? 0.6383 1.3921 0.9518 0.0276  0.0071  -0.0034 171 DC  G "C2'" 
5069 C "C1'" . DC  G 2   ? 0.6538 1.4189 1.0088 0.0156  0.0132  -0.0098 171 DC  G "C1'" 
5070 N N1    . DC  G 2   ? 0.6787 1.4161 1.0496 0.0029  0.0186  -0.0193 171 DC  G N1    
5071 C C2    . DC  G 2   ? 0.6925 1.4501 1.0937 -0.0096 0.0116  -0.0424 171 DC  G C2    
5072 O O2    . DC  G 2   ? 0.7118 1.5113 1.1257 -0.0104 0.0007  -0.0547 171 DC  G O2    
5073 N N3    . DC  G 2   ? 0.6789 1.4100 1.0951 -0.0208 0.0176  -0.0505 171 DC  G N3    
5074 C C4    . DC  G 2   ? 0.6618 1.3494 1.0636 -0.0195 0.0294  -0.0359 171 DC  G C4    
5075 N N4    . DC  G 2   ? 0.6605 1.3237 1.0789 -0.0304 0.0352  -0.0437 171 DC  G N4    
5076 C C5    . DC  G 2   ? 0.6646 1.3324 1.0350 -0.0072 0.0361  -0.0126 171 DC  G C5    
5077 C C6    . DC  G 2   ? 0.6723 1.3655 1.0284 0.0036  0.0306  -0.0055 171 DC  G C6    
5078 P P     . DA  G 3   ? 0.5815 1.3848 0.8399 0.0575  -0.0119 0.0099  172 DA  G P     
5079 O OP1   . DA  G 3   ? 0.5812 1.4248 0.8369 0.0675  -0.0196 0.0136  172 DA  G OP1   
5080 O OP2   . DA  G 3   ? 0.5611 1.3183 0.7856 0.0631  -0.0038 0.0236  172 DA  G OP2   
5081 O "O5'" . DA  G 3   ? 0.5782 1.3925 0.8519 0.0460  -0.0234 -0.0153 172 DA  G "O5'" 
5082 C "C5'" . DA  G 3   ? 0.5806 1.4382 0.8870 0.0382  -0.0322 -0.0324 172 DA  G "C5'" 
5083 C "C4'" . DA  G 3   ? 0.5771 1.4362 0.8962 0.0261  -0.0403 -0.0559 172 DA  G "C4'" 
5084 O "O4'" . DA  G 3   ? 0.5954 1.4212 0.9308 0.0150  -0.0296 -0.0583 172 DA  G "O4'" 
5085 C "C3'" . DA  G 3   ? 0.5416 1.3878 0.8290 0.0312  -0.0492 -0.0609 172 DA  G "C3'" 
5086 O "O3'" . DA  G 3   ? 0.4951 1.3809 0.7923 0.0276  -0.0642 -0.0807 172 DA  G "O3'" 
5087 C "C2'" . DA  G 3   ? 0.5774 1.3800 0.8646 0.0226  -0.0418 -0.0650 172 DA  G "C2'" 
5088 C "C1'" . DA  G 3   ? 0.6082 1.4155 0.9360 0.0095  -0.0342 -0.0717 172 DA  G "C1'" 
5089 N N9    . DA  G 3   ? 0.6608 1.4242 0.9924 0.0032  -0.0213 -0.0663 172 DA  G N9    
5090 C C8    . DA  G 3   ? 0.6732 1.3969 0.9802 0.0101  -0.0103 -0.0460 172 DA  G C8    
5091 N N7    . DA  G 3   ? 0.6737 1.3649 0.9921 0.0017  0.0000  -0.0452 172 DA  G N7    
5092 C C5    . DA  G 3   ? 0.6891 1.3988 1.0422 -0.0116 -0.0042 -0.0668 172 DA  G C5    
5093 C C6    . DA  G 3   ? 0.7124 1.4044 1.0929 -0.0250 0.0027  -0.0769 172 DA  G C6    
5094 N N6    . DA  G 3   ? 0.7045 1.3551 1.0812 -0.0268 0.0155  -0.0650 172 DA  G N6    
5095 N N1    . DA  G 3   ? 0.7382 1.4573 1.1506 -0.0366 -0.0037 -0.0996 172 DA  G N1    
5096 C C2    . DA  G 3   ? 0.7311 1.4935 1.1471 -0.0350 -0.0166 -0.1112 172 DA  G C2    
5097 N N3    . DA  G 3   ? 0.7241 1.5078 1.1165 -0.0227 -0.0244 -0.1029 172 DA  G N3    
5098 C C4    . DA  G 3   ? 0.6970 1.4514 1.0584 -0.0111 -0.0173 -0.0804 172 DA  G C4    
5099 P P     . DT  G 4   ? 0.4632 1.3465 0.7327 0.0316  -0.0762 -0.0903 173 DT  G P     
5100 O OP1   . DT  G 4   ? 0.4725 1.4073 0.7501 0.0325  -0.0908 -0.1030 173 DT  G OP1   
5101 O OP2   . DT  G 4   ? 0.4668 1.3147 0.6965 0.0444  -0.0709 -0.0706 173 DT  G OP2   
5102 O "O5'" . DT  G 4   ? 0.4339 1.2949 0.7184 0.0173  -0.0753 -0.1086 173 DT  G "O5'" 
5103 C "C5'" . DT  G 4   ? 0.4188 1.3061 0.7415 0.0029  -0.0787 -0.1297 173 DT  G "C5'" 
5104 C "C4'" . DT  G 4   ? 0.4255 1.2837 0.7585 -0.0091 -0.0754 -0.1440 173 DT  G "C4'" 
5105 O "O4'" . DT  G 4   ? 0.4402 1.2551 0.7736 -0.0103 -0.0600 -0.1293 173 DT  G "O4'" 
5106 C "C3'" . DT  G 4   ? 0.4277 1.2684 0.7320 -0.0056 -0.0829 -0.1501 173 DT  G "C3'" 
5107 O "O3'" . DT  G 4   ? 0.4398 1.3038 0.7631 -0.0167 -0.0927 -0.1762 173 DT  G "O3'" 
5108 C "C2'" . DT  G 4   ? 0.4373 1.2237 0.7307 -0.0066 -0.0703 -0.1396 173 DT  G "C2'" 
5109 C "C1'" . DT  G 4   ? 0.4544 1.2346 0.7796 -0.0149 -0.0577 -0.1354 173 DT  G "C1'" 
5110 N N1    . DT  G 4   ? 0.4963 1.2304 0.8079 -0.0112 -0.0433 -0.1150 173 DT  G N1    
5111 C C2    . DT  G 4   ? 0.5355 1.2452 0.8714 -0.0221 -0.0322 -0.1174 173 DT  G C2    
5112 O O2    . DT  G 4   ? 0.5522 1.2759 0.9215 -0.0349 -0.0330 -0.1358 173 DT  G O2    
5113 N N3    . DT  G 4   ? 0.5482 1.2173 0.8687 -0.0178 -0.0195 -0.0972 173 DT  G N3    
5114 C C4    . DT  G 4   ? 0.5278 1.1782 0.8111 -0.0044 -0.0168 -0.0762 173 DT  G C4    
5115 O O4    . DT  G 4   ? 0.5186 1.1335 0.7904 -0.0021 -0.0049 -0.0594 173 DT  G O4    
5116 C C5    . DT  G 4   ? 0.5110 1.1873 0.7702 0.0065  -0.0286 -0.0754 173 DT  G C5    
5117 C C7    . DT  G 4   ? 0.5063 1.1652 0.7250 0.0212  -0.0262 -0.0541 173 DT  G C7    
5118 C C6    . DT  G 4   ? 0.5037 1.2200 0.7780 0.0029  -0.0413 -0.0943 173 DT  G C6    
5119 P P     . DT  G 5   ? 0.4232 1.2724 0.7246 -0.0165 -0.1008 -0.1881 174 DT  G P     
5120 O OP1   . DT  G 5   ? 0.3914 1.2858 0.7068 -0.0228 -0.1150 -0.2111 174 DT  G OP1   
5121 O OP2   . DT  G 5   ? 0.3882 1.2116 0.6468 -0.0015 -0.1005 -0.1685 174 DT  G OP2   
5122 O "O5'" . DT  G 5   ? 0.4053 1.2171 0.7250 -0.0289 -0.0906 -0.1962 174 DT  G "O5'" 
5123 C "C5'" . DT  G 5   ? 0.4129 1.2398 0.7741 -0.0446 -0.0880 -0.2147 174 DT  G "C5'" 
5124 C "C4'" . DT  G 5   ? 0.4236 1.2069 0.7982 -0.0528 -0.0743 -0.2134 174 DT  G "C4'" 
5125 O "O4'" . DT  G 5   ? 0.4810 1.2302 0.8364 -0.0434 -0.0631 -0.1869 174 DT  G "O4'" 
5126 C "C3'" . DT  G 5   ? 0.4285 1.1853 0.7928 -0.0563 -0.0760 -0.2245 174 DT  G "C3'" 
5127 O "O3'" . DT  G 5   ? 0.4984 1.2561 0.8989 -0.0725 -0.0725 -0.2455 174 DT  G "O3'" 
5128 C "C2'" . DT  G 5   ? 0.4800 1.1868 0.8193 -0.0482 -0.0648 -0.2016 174 DT  G "C2'" 
5129 C "C1'" . DT  G 5   ? 0.4811 1.1856 0.8300 -0.0458 -0.0545 -0.1834 174 DT  G "C1'" 
5130 N N1    . DT  G 5   ? 0.4264 1.0989 0.7416 -0.0329 -0.0475 -0.1569 174 DT  G N1    
5131 C C2    . DT  G 5   ? 0.4332 1.0683 0.7533 -0.0351 -0.0328 -0.1431 174 DT  G C2    
5132 O O2    . DT  G 5   ? 0.4420 1.0686 0.7936 -0.0468 -0.0249 -0.1510 174 DT  G O2    
5133 N N3    . DT  G 5   ? 0.6004 1.2091 0.8873 -0.0233 -0.0271 -0.1194 174 DT  G N3    
5134 C C4    . DT  G 5   ? 0.5773 1.1919 0.8276 -0.0098 -0.0343 -0.1088 174 DT  G C4    
5135 O O4    . DT  G 5   ? 0.5761 1.1652 0.7983 -0.0004 -0.0277 -0.0881 174 DT  G O4    
5136 C C5    . DT  G 5   ? 0.5441 1.1976 0.7915 -0.0077 -0.0496 -0.1239 174 DT  G C5    
5137 C C7    . DT  G 5   ? 0.5164 1.1795 0.7261 0.0067  -0.0581 -0.1139 174 DT  G C7    
5138 C C6    . DT  G 5   ? 0.5348 1.2155 0.8143 -0.0193 -0.0556 -0.1469 174 DT  G C6    
5139 P P     . DC  G 6   ? 0.9367 1.5070 0.6305 0.1477  -0.3121 -0.1649 175 DC  G P     
5140 O OP1   . DC  G 6   ? 0.9512 1.5426 0.6408 0.1221  -0.3098 -0.1850 175 DC  G OP1   
5141 O OP2   . DC  G 6   ? 1.0370 1.5196 0.6180 0.1491  -0.3258 -0.1268 175 DC  G OP2   
5142 O "O5'" . DC  G 6   ? 0.8046 1.4086 0.5481 0.1338  -0.2569 -0.1712 175 DC  G "O5'" 
5143 C "C5'" . DC  G 6   ? 0.7663 1.4061 0.5404 0.1001  -0.2295 -0.1923 175 DC  G "C5'" 
5144 C "C4'" . DC  G 6   ? 0.7217 1.3854 0.5606 0.0847  -0.1983 -0.1932 175 DC  G "C4'" 
5145 O "O4'" . DC  G 6   ? 0.7250 1.3976 0.6005 0.1142  -0.2029 -0.1849 175 DC  G "O4'" 
5146 C "C3'" . DC  G 6   ? 0.7140 1.3142 0.5349 0.0666  -0.1596 -0.1789 175 DC  G "C3'" 
5147 O "O3'" . DC  G 6   ? 0.6981 1.3147 0.5589 0.0291  -0.1562 -0.1898 175 DC  G "O3'" 
5148 C "C2'" . DC  G 6   ? 0.6830 1.2544 0.5153 0.0873  -0.1412 -0.1543 175 DC  G "C2'" 
5149 C "C1'" . DC  G 6   ? 0.6826 1.3197 0.5698 0.1029  -0.1655 -0.1664 175 DC  G "C1'" 
5150 N N1    . DC  G 6   ? 0.7106 1.3214 0.6057 0.1367  -0.1713 -0.1491 175 DC  G N1    
5151 C C2    . DC  G 6   ? 0.6870 1.3285 0.6439 0.1355  -0.1568 -0.1555 175 DC  G C2    
5152 O O2    . DC  G 6   ? 0.6613 1.3511 0.6540 0.0984  -0.1388 -0.1718 175 DC  G O2    
5153 N N3    . DC  G 6   ? 0.6977 1.3080 0.6640 0.1684  -0.1677 -0.1429 175 DC  G N3    
5154 C C4    . DC  G 6   ? 0.7437 1.2847 0.6519 0.1949  -0.1976 -0.1176 175 DC  G C4    
5155 N N4    . DC  G 6   ? 0.7633 1.2596 0.6775 0.2225  -0.2182 -0.1023 175 DC  G N4    
5156 C C5    . DC  G 6   ? 0.7988 1.3061 0.6298 0.1866  -0.2125 -0.1060 175 DC  G C5    
5157 C C6    . DC  G 6   ? 0.7782 1.3272 0.6099 0.1608  -0.1956 -0.1258 175 DC  G C6    
5158 P P     . DA  G 7   ? 0.7385 1.2874 0.5987 0.0101  -0.1427 -0.1907 176 DA  G P     
5159 O OP