data_5WIU
# 
_entry.id   5WIU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5WIU         
WWPDB D_1000229114 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          5WIV 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5WIU 
_pdbx_database_status.recvd_initial_deposition_date   2017-07-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Wacker, D.'            1  ? 
'Wang, S.'              2  ? 
'Levit, A.'             3  ? 
'Che, T.'               4  ? 
'Betz, R.M.'            5  ? 
'McCorvy, J.D.'         6  ? 
'Venkatakrishnan, A.J.' 7  ? 
'Huang, X.-P.'          8  ? 
'Dror, R.O.'            9  ? 
'Shoichet, B.K.'        10 ? 
'Roth, B.L.'            11 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            358 
_citation.language                  ? 
_citation.page_first                381 
_citation.page_last                 386 
_citation.title                     'D4 dopamine receptor high-resolution structures enable the discovery of selective agonists.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aan5468 
_citation.pdbx_database_id_PubMed   29051383 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wang, S.'              1  ? 
primary 'Wacker, D.'            2  ? 
primary 'Levit, A.'             3  ? 
primary 'Che, T.'               4  ? 
primary 'Betz, R.M.'            5  ? 
primary 'McCorvy, J.D.'         6  ? 
primary 'Venkatakrishnan, A.J.' 7  ? 
primary 'Huang, X.P.'           8  ? 
primary 'Dror, R.O.'            9  ? 
primary 'Shoichet, B.K.'        10 ? 
primary 'Roth, B.L.'            11 ? 
# 
_cell.length_a           67.688 
_cell.length_b           164.047 
_cell.length_c           84.129 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           5WIU 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.entry_id                         5WIU 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'D(4) dopamine receptor, soluble cytochrome b562 chimera' 45306.602 1  ? ? ? ? 
2 non-polymer syn Nemonapride                                               387.903   1  ? ? ? ? 
3 non-polymer syn 'PHOSPHATE ION'                                           94.971    3  ? ? ? ? 
4 non-polymer syn 'OLEIC ACID'                                              282.461   9  ? ? ? ? 
5 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                                   106.120   9  ? ? ? ? 
6 non-polymer syn GLYCEROL                                                  92.094    1  ? ? ? ? 
7 water       nat water                                                     18.015    98 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'D(2C) dopamine receptor, Dopamine D4 receptor, Cytochrome b-562' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GGTTMGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVATERALQTPTNSFIVSL
AAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCTASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLI
GATWLLSAAVAAPVLCGLNDVRGRDPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRADLEDNWET
LNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQA
AAEQLKTTRNAYIQKYLAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALCPACSVPPRLVSAVTWLGYVNSALNP
VIYTVFNAEFRNVFRKALRACC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GGTTMGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVATERALQTPTNSFIVSL
AAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCTASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLI
GATWLLSAAVAAPVLCGLNDVRGRDPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRADLEDNWET
LNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQA
AAEQLKTTRNAYIQKYLAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALCPACSVPPRLVSAVTWLGYVNSALNP
VIYTVFNAEFRNVFRKALRACC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLY n 
1 3   THR n 
1 4   THR n 
1 5   MET n 
1 6   GLY n 
1 7   ASN n 
1 8   ARG n 
1 9   SER n 
1 10  THR n 
1 11  ALA n 
1 12  ASP n 
1 13  ALA n 
1 14  ASP n 
1 15  GLY n 
1 16  LEU n 
1 17  LEU n 
1 18  ALA n 
1 19  GLY n 
1 20  ARG n 
1 21  GLY n 
1 22  PRO n 
1 23  ALA n 
1 24  ALA n 
1 25  GLY n 
1 26  ALA n 
1 27  SER n 
1 28  ALA n 
1 29  GLY n 
1 30  ALA n 
1 31  SER n 
1 32  ALA n 
1 33  GLY n 
1 34  LEU n 
1 35  ALA n 
1 36  GLY n 
1 37  GLN n 
1 38  GLY n 
1 39  ALA n 
1 40  ALA n 
1 41  ALA n 
1 42  LEU n 
1 43  VAL n 
1 44  GLY n 
1 45  GLY n 
1 46  VAL n 
1 47  LEU n 
1 48  LEU n 
1 49  ILE n 
1 50  GLY n 
1 51  ALA n 
1 52  VAL n 
1 53  LEU n 
1 54  ALA n 
1 55  GLY n 
1 56  ASN n 
1 57  SER n 
1 58  LEU n 
1 59  VAL n 
1 60  CYS n 
1 61  VAL n 
1 62  SER n 
1 63  VAL n 
1 64  ALA n 
1 65  THR n 
1 66  GLU n 
1 67  ARG n 
1 68  ALA n 
1 69  LEU n 
1 70  GLN n 
1 71  THR n 
1 72  PRO n 
1 73  THR n 
1 74  ASN n 
1 75  SER n 
1 76  PHE n 
1 77  ILE n 
1 78  VAL n 
1 79  SER n 
1 80  LEU n 
1 81  ALA n 
1 82  ALA n 
1 83  ALA n 
1 84  ASP n 
1 85  LEU n 
1 86  LEU n 
1 87  LEU n 
1 88  ALA n 
1 89  LEU n 
1 90  LEU n 
1 91  VAL n 
1 92  LEU n 
1 93  PRO n 
1 94  LEU n 
1 95  PHE n 
1 96  VAL n 
1 97  TYR n 
1 98  SER n 
1 99  GLU n 
1 100 VAL n 
1 101 GLN n 
1 102 GLY n 
1 103 GLY n 
1 104 ALA n 
1 105 TRP n 
1 106 LEU n 
1 107 LEU n 
1 108 SER n 
1 109 PRO n 
1 110 ARG n 
1 111 LEU n 
1 112 CYS n 
1 113 ASP n 
1 114 ALA n 
1 115 LEU n 
1 116 MET n 
1 117 ALA n 
1 118 MET n 
1 119 ASP n 
1 120 VAL n 
1 121 MET n 
1 122 LEU n 
1 123 CYS n 
1 124 THR n 
1 125 ALA n 
1 126 SER n 
1 127 ILE n 
1 128 PHE n 
1 129 ASN n 
1 130 LEU n 
1 131 CYS n 
1 132 ALA n 
1 133 ILE n 
1 134 SER n 
1 135 VAL n 
1 136 ASP n 
1 137 ARG n 
1 138 PHE n 
1 139 VAL n 
1 140 ALA n 
1 141 VAL n 
1 142 ALA n 
1 143 VAL n 
1 144 PRO n 
1 145 LEU n 
1 146 ARG n 
1 147 TYR n 
1 148 ASN n 
1 149 ARG n 
1 150 GLN n 
1 151 GLY n 
1 152 GLY n 
1 153 SER n 
1 154 ARG n 
1 155 ARG n 
1 156 GLN n 
1 157 LEU n 
1 158 LEU n 
1 159 LEU n 
1 160 ILE n 
1 161 GLY n 
1 162 ALA n 
1 163 THR n 
1 164 TRP n 
1 165 LEU n 
1 166 LEU n 
1 167 SER n 
1 168 ALA n 
1 169 ALA n 
1 170 VAL n 
1 171 ALA n 
1 172 ALA n 
1 173 PRO n 
1 174 VAL n 
1 175 LEU n 
1 176 CYS n 
1 177 GLY n 
1 178 LEU n 
1 179 ASN n 
1 180 ASP n 
1 181 VAL n 
1 182 ARG n 
1 183 GLY n 
1 184 ARG n 
1 185 ASP n 
1 186 PRO n 
1 187 ALA n 
1 188 VAL n 
1 189 CYS n 
1 190 ARG n 
1 191 LEU n 
1 192 GLU n 
1 193 ASP n 
1 194 ARG n 
1 195 ASP n 
1 196 TYR n 
1 197 VAL n 
1 198 VAL n 
1 199 TYR n 
1 200 SER n 
1 201 SER n 
1 202 VAL n 
1 203 CYS n 
1 204 SER n 
1 205 PHE n 
1 206 PHE n 
1 207 LEU n 
1 208 PRO n 
1 209 CYS n 
1 210 PRO n 
1 211 LEU n 
1 212 MET n 
1 213 LEU n 
1 214 LEU n 
1 215 LEU n 
1 216 TYR n 
1 217 TRP n 
1 218 ALA n 
1 219 THR n 
1 220 PHE n 
1 221 ARG n 
1 222 GLY n 
1 223 LEU n 
1 224 GLN n 
1 225 ARG n 
1 226 TRP n 
1 227 GLU n 
1 228 VAL n 
1 229 ALA n 
1 230 ARG n 
1 231 ARG n 
1 232 ALA n 
1 233 ASP n 
1 234 LEU n 
1 235 GLU n 
1 236 ASP n 
1 237 ASN n 
1 238 TRP n 
1 239 GLU n 
1 240 THR n 
1 241 LEU n 
1 242 ASN n 
1 243 ASP n 
1 244 ASN n 
1 245 LEU n 
1 246 LYS n 
1 247 VAL n 
1 248 ILE n 
1 249 GLU n 
1 250 LYS n 
1 251 ALA n 
1 252 ASP n 
1 253 ASN n 
1 254 ALA n 
1 255 ALA n 
1 256 GLN n 
1 257 VAL n 
1 258 LYS n 
1 259 ASP n 
1 260 ALA n 
1 261 LEU n 
1 262 THR n 
1 263 LYS n 
1 264 MET n 
1 265 ARG n 
1 266 ALA n 
1 267 ALA n 
1 268 ALA n 
1 269 LEU n 
1 270 ASP n 
1 271 ALA n 
1 272 GLN n 
1 273 LYS n 
1 274 ALA n 
1 275 THR n 
1 276 PRO n 
1 277 PRO n 
1 278 LYS n 
1 279 LEU n 
1 280 GLU n 
1 281 ASP n 
1 282 LYS n 
1 283 SER n 
1 284 PRO n 
1 285 ASP n 
1 286 SER n 
1 287 PRO n 
1 288 GLU n 
1 289 MET n 
1 290 LYS n 
1 291 ASP n 
1 292 PHE n 
1 293 ARG n 
1 294 HIS n 
1 295 GLY n 
1 296 PHE n 
1 297 ASP n 
1 298 ILE n 
1 299 LEU n 
1 300 VAL n 
1 301 GLY n 
1 302 GLN n 
1 303 ILE n 
1 304 ASP n 
1 305 ASP n 
1 306 ALA n 
1 307 LEU n 
1 308 LYS n 
1 309 LEU n 
1 310 ALA n 
1 311 ASN n 
1 312 GLU n 
1 313 GLY n 
1 314 LYS n 
1 315 VAL n 
1 316 LYS n 
1 317 GLU n 
1 318 ALA n 
1 319 GLN n 
1 320 ALA n 
1 321 ALA n 
1 322 ALA n 
1 323 GLU n 
1 324 GLN n 
1 325 LEU n 
1 326 LYS n 
1 327 THR n 
1 328 THR n 
1 329 ARG n 
1 330 ASN n 
1 331 ALA n 
1 332 TYR n 
1 333 ILE n 
1 334 GLN n 
1 335 LYS n 
1 336 TYR n 
1 337 LEU n 
1 338 ALA n 
1 339 LYS n 
1 340 ILE n 
1 341 THR n 
1 342 GLY n 
1 343 ARG n 
1 344 GLU n 
1 345 ARG n 
1 346 LYS n 
1 347 ALA n 
1 348 MET n 
1 349 ARG n 
1 350 VAL n 
1 351 LEU n 
1 352 PRO n 
1 353 VAL n 
1 354 VAL n 
1 355 VAL n 
1 356 GLY n 
1 357 ALA n 
1 358 PHE n 
1 359 LEU n 
1 360 LEU n 
1 361 CYS n 
1 362 TRP n 
1 363 THR n 
1 364 PRO n 
1 365 PHE n 
1 366 PHE n 
1 367 VAL n 
1 368 VAL n 
1 369 HIS n 
1 370 ILE n 
1 371 THR n 
1 372 GLN n 
1 373 ALA n 
1 374 LEU n 
1 375 CYS n 
1 376 PRO n 
1 377 ALA n 
1 378 CYS n 
1 379 SER n 
1 380 VAL n 
1 381 PRO n 
1 382 PRO n 
1 383 ARG n 
1 384 LEU n 
1 385 VAL n 
1 386 SER n 
1 387 ALA n 
1 388 VAL n 
1 389 THR n 
1 390 TRP n 
1 391 LEU n 
1 392 GLY n 
1 393 TYR n 
1 394 VAL n 
1 395 ASN n 
1 396 SER n 
1 397 ALA n 
1 398 LEU n 
1 399 ASN n 
1 400 PRO n 
1 401 VAL n 
1 402 ILE n 
1 403 TYR n 
1 404 THR n 
1 405 VAL n 
1 406 PHE n 
1 407 ASN n 
1 408 ALA n 
1 409 GLU n 
1 410 PHE n 
1 411 ARG n 
1 412 ASN n 
1 413 VAL n 
1 414 PHE n 
1 415 ARG n 
1 416 LYS n 
1 417 ALA n 
1 418 LEU n 
1 419 ARG n 
1 420 ALA n 
1 421 CYS n 
1 422 CYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   232 Human ? DRD4 ? ? ? ? ? ? 'Homo sapiens'     9606 ? ? ? ? ? ? ? ? Insecta 50557 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? baculovirus ? ? ? pFastBac1-HM ? ? 
1 2 sample 'Biological sequence' 233 337 ?     ? cybC ? ? ? ? ? ? 'Escherichia coli' 562  ? ? ? ? ? ? ? ? Insecta 50557 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? baculovirus ? ? ? pFastBac1-HM ? ? 
1 3 sample 'Biological sequence' 338 422 Human ? DRD4 ? ? ? ? ? ? 'Homo sapiens'     9606 ? ? ? ? ? ? ? ? Insecta 50557 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? baculovirus ? ? ? pFastBac1-HM ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DRD4_HUMAN P21917 ? 1 
;MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVATERALQTPTNSFIVSLAAAD
LLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCTASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATW
LLSAAVAAPVLCGLNDVRGRDPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRA
;
1   
2 UNP C562_ECOLX P0ABE7 ? 1 
;DLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANE
GKVKEAQAAAEQLKTTRNAYHQKYR
;
24  
3 UNP DRD4_HUMAN P21917 ? 1 
;AKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALCPACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKA
LRACC
;
383 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5WIU A 5   ? 232 ? P21917 1   ? 228 ? 1    1001 
2 2 5WIU A 233 ? 337 ? P0ABE7 24  ? 128 ? 1002 1106 
3 3 5WIU A 338 ? 422 ? P21917 383 ? 467 ? 383  467  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5WIU GLY A 1   ? UNP P21917 ?   ?   'expression tag'      -3   1 
1 5WIU GLY A 2   ? UNP P21917 ?   ?   'expression tag'      -2   2 
1 5WIU THR A 3   ? UNP P21917 ?   ?   'expression tag'      -1   3 
1 5WIU THR A 4   ? UNP P21917 ?   ?   'expression tag'      0    4 
2 5WIU TRP A 238 ? UNP P0ABE7 MET 29  'engineered mutation' 1007 5 
2 5WIU ILE A 333 ? UNP P0ABE7 HIS 124 'engineered mutation' 1102 6 
2 5WIU LEU A 337 ? UNP P0ABE7 ARG 128 'engineered mutation' 1106 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                 ? 'C3 H7 N O2'       89.093  
AQD non-polymer         . Nemonapride             
'N-[(2R,3R)-1-benzyl-2-methylpyrrolidin-3-yl]-5-chloro-2-methoxy-4-(methylamino)benzamide' 'C21 H26 Cl N3 O2' 387.903 
ARG 'L-peptide linking' y ARGININE                ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE              ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE               ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                 ? 'C2 H5 N O2'       75.067  
GOL non-polymer         . GLYCEROL                'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'         92.094  
HIS 'L-peptide linking' y HISTIDINE               ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                   ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                 ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                  ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE              ? 'C5 H11 N O2 S'    149.211 
OLA non-polymer         . 'OLEIC ACID'            ? 'C18 H34 O2'       282.461 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3'        106.120 
PHE 'L-peptide linking' y PHENYLALANINE           ? 'C9 H11 N O2'      165.189 
PO4 non-polymer         . 'PHOSPHATE ION'         ? 'O4 P -3'          94.971  
PRO 'L-peptide linking' y PROLINE                 ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                  ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE               ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                  ? 'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5WIU 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.57 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.20 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'LIPIDIC CUBIC PHASE' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM Tris-HCl, pH 5.8-6.2, 160-200 mM ammonium phosphate dibasic, 34% PEG400' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-11-11 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Double crystal cryo-cooled Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.033 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.033 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            41.610 
_reflns.entry_id                         5WIU 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.950 
_reflns.d_resolution_low                 30.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       33049 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.900 
_reflns.pdbx_Rmerge_I_obs                0.128 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.900 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.586 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.149 
_reflns.pdbx_Rpim_I_all                  0.073 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         128148 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.950 2.010  ? ? ? ? ? ? ? 97.800 ? ? ? ? 0.847 ? ? ? ? ? ? ? ? 3.800 ? 0.789 ? ? 0.981 0.483 ? 1  1 0.652 ? 
2.010 2.070  ? ? ? ? ? ? ? 98.600 ? ? ? ? 0.557 ? ? ? ? ? ? ? ? 3.900 ? 0.941 ? ? 0.642 0.311 ? 2  1 0.764 ? 
2.070 2.150  ? ? ? ? ? ? ? 98.400 ? ? ? ? 0.407 ? ? ? ? ? ? ? ? 3.900 ? 1.087 ? ? 0.468 0.225 ? 3  1 0.881 ? 
2.150 2.230  ? ? ? ? ? ? ? 98.300 ? ? ? ? 0.322 ? ? ? ? ? ? ? ? 3.900 ? 1.291 ? ? 0.371 0.180 ? 4  1 0.905 ? 
2.230 2.330  ? ? ? ? ? ? ? 98.500 ? ? ? ? 0.255 ? ? ? ? ? ? ? ? 3.900 ? 1.397 ? ? 0.294 0.143 ? 5  1 0.934 ? 
2.330 2.460  ? ? ? ? ? ? ? 98.600 ? ? ? ? 0.208 ? ? ? ? ? ? ? ? 3.800 ? 1.602 ? ? 0.240 0.118 ? 6  1 0.952 ? 
2.460 2.610  ? ? ? ? ? ? ? 98.300 ? ? ? ? 0.167 ? ? ? ? ? ? ? ? 3.900 ? 1.740 ? ? 0.192 0.093 ? 7  1 0.964 ? 
2.610 2.810  ? ? ? ? ? ? ? 98.600 ? ? ? ? 0.137 ? ? ? ? ? ? ? ? 4.100 ? 1.753 ? ? 0.157 0.074 ? 8  1 0.974 ? 
2.810 3.090  ? ? ? ? ? ? ? 98.000 ? ? ? ? 0.115 ? ? ? ? ? ? ? ? 4.000 ? 2.195 ? ? 0.132 0.063 ? 9  1 0.980 ? 
3.090 3.540  ? ? ? ? ? ? ? 97.400 ? ? ? ? 0.097 ? ? ? ? ? ? ? ? 3.900 ? 2.048 ? ? 0.112 0.054 ? 10 1 0.985 ? 
3.540 4.460  ? ? ? ? ? ? ? 97.700 ? ? ? ? 0.100 ? ? ? ? ? ? ? ? 3.900 ? 2.093 ? ? 0.116 0.056 ? 11 1 0.978 ? 
4.460 30.000 ? ? ? ? ? ? ? 94.600 ? ? ? ? 0.139 ? ? ? ? ? ? ? ? 3.600 ? 2.058 ? ? 0.163 0.082 ? 12 1 0.935 ? 
# 
_refine.entry_id                                 5WIU 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            1.9620 
_refine.ls_d_res_low                             25.5900 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    97.3000 
_refine.ls_number_reflns_obs                     33027 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2065 
_refine.ls_R_factor_R_work                       0.2049 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2362 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.8400 
_refine.ls_number_reflns_R_free                  1599 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               50.4734 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.2300 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB entries 3PBL & 1M6T' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                112.350 
_refine.B_iso_min                                26.890 
_refine.pdbx_overall_phase_error                 25.6900 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.9620 
_refine_hist.d_res_low                        25.5900 
_refine_hist.pdbx_number_atoms_ligand         275 
_refine_hist.number_atoms_solvent             98 
_refine_hist.number_atoms_total               3109 
_refine_hist.pdbx_number_residues_total       373 
_refine_hist.pdbx_B_iso_mean_ligand           58.49 
_refine_hist.pdbx_B_iso_mean_solvent          51.44 
_refine_hist.pdbx_number_atoms_protein        2736 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
_refine_ls_shell.R_factor_R_free                  0.3390 
_refine_ls_shell.R_factor_R_free_error            0 
_refine_ls_shell.R_factor_R_work                  0.2895 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.d_res_high                       1.9616 
_refine_ls_shell.d_res_low                        2.0249 
_refine_ls_shell.number_reflns_R_free             124 
_refine_ls_shell.number_reflns_R_work             2642 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.percent_reflns_obs               91.1 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
# 
_struct.entry_id                     5WIU 
_struct.title                        'Structure of the human D4 Dopamine receptor in complex with Nemonapride' 
_struct.pdbx_descriptor              'D(4) dopamine receptor,Soluble cytochrome b562' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5WIU 
_struct_keywords.text            'GPCR, dopamine receptor, antagonist, sodium, SIGNALING PROTEIN-ANTAGONIST complex' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN/ANTAGONIST' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
T N N 5 ? 
U N N 5 ? 
V N N 5 ? 
W N N 5 ? 
X N N 6 ? 
Y N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 38  ? GLU A 66  ? GLY A 34   GLU A 62   1 ? 29 
HELX_P HELX_P2  AA2 ARG A 67  ? GLN A 70  ? ARG A 63   GLN A 66   5 ? 4  
HELX_P HELX_P3  AA3 THR A 71  ? VAL A 91  ? THR A 67   VAL A 87   1 ? 21 
HELX_P HELX_P4  AA4 VAL A 91  ? GLN A 101 ? VAL A 87   GLN A 97   1 ? 11 
HELX_P HELX_P5  AA5 SER A 108 ? VAL A 143 ? SER A 104  VAL A 139  1 ? 36 
HELX_P HELX_P6  AA6 ARG A 154 ? CYS A 176 ? ARG A 150  CYS A 172  1 ? 23 
HELX_P HELX_P7  AA7 ASP A 193 ? PHE A 205 ? ASP A 189  PHE A 201  1 ? 13 
HELX_P HELX_P8  AA8 LEU A 207 ? ARG A 225 ? LEU A 203  ARG A 221  1 ? 19 
HELX_P HELX_P9  AA9 ARG A 230 ? LYS A 250 ? ARG A 226  LYS A 1019 1 ? 21 
HELX_P HELX_P10 AB1 ASN A 253 ? GLN A 272 ? ASN A 1022 GLN A 1041 1 ? 20 
HELX_P HELX_P11 AB2 PRO A 276 ? ASP A 281 ? PRO A 1045 ASP A 1050 1 ? 6  
HELX_P HELX_P12 AB3 GLU A 288 ? GLU A 312 ? GLU A 1057 GLU A 1081 1 ? 25 
HELX_P HELX_P13 AB4 LYS A 314 ? ILE A 333 ? LYS A 1083 ILE A 1102 1 ? 20 
HELX_P HELX_P14 AB5 ILE A 333 ? THR A 341 ? ILE A 1102 THR A 386  1 ? 9  
HELX_P HELX_P15 AB6 GLY A 342 ? MET A 348 ? GLY A 387  MET A 393  1 ? 7  
HELX_P HELX_P16 AB7 ARG A 349 ? CYS A 375 ? ARG A 394  CYS A 420  1 ? 27 
HELX_P HELX_P17 AB8 PRO A 381 ? ASN A 407 ? PRO A 426  ASN A 452  1 ? 27 
HELX_P HELX_P18 AB9 ASN A 407 ? LYS A 416 ? ASN A 452  LYS A 461  1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 112 SG ? ? ? 1_555 A CYS 189 SG ? ? A CYS 108 A CYS 185 1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf2 disulf ? ? A CYS 375 SG ? ? ? 1_555 A CYS 378 SG ? ? A CYS 420 A CYS 423 1_555 ? ? ? ? ? ? ? 2.058 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A AQD 1201 ? 12 'binding site for residue AQD A 1201' 
AC2 Software A PO4 1202 ? 7  'binding site for residue PO4 A 1202' 
AC3 Software A PO4 1203 ? 2  'binding site for residue PO4 A 1203' 
AC4 Software A PO4 1204 ? 4  'binding site for residue PO4 A 1204' 
AC5 Software A OLA 1205 ? 8  'binding site for residue OLA A 1205' 
AC6 Software A OLA 1206 ? 5  'binding site for residue OLA A 1206' 
AC7 Software A OLA 1207 ? 5  'binding site for residue OLA A 1207' 
AC8 Software A OLA 1208 ? 7  'binding site for residue OLA A 1208' 
AC9 Software A OLA 1209 ? 4  'binding site for residue OLA A 1209' 
AD1 Software A OLA 1210 ? 4  'binding site for residue OLA A 1210' 
AD2 Software A OLA 1211 ? 5  'binding site for residue OLA A 1211' 
AD3 Software A OLA 1212 ? 3  'binding site for residue OLA A 1212' 
AD4 Software A OLA 1213 ? 4  'binding site for residue OLA A 1213' 
AD5 Software A PEG 1214 ? 3  'binding site for residue PEG A 1214' 
AD6 Software A PEG 1216 ? 1  'binding site for residue PEG A 1216' 
AD7 Software A PEG 1218 ? 1  'binding site for residue PEG A 1218' 
AD8 Software A PEG 1219 ? 3  'binding site for residue PEG A 1219' 
AD9 Software A PEG 1220 ? 3  'binding site for residue PEG A 1220' 
AE1 Software A PEG 1221 ? 1  'binding site for residue PEG A 1221' 
AE2 Software A GOL 1223 ? 5  'binding site for residue GOL A 1223' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 LEU A 115 ? LEU A 111  . ? 1_555 ? 
2  AC1 12 ASP A 119 ? ASP A 115  . ? 1_555 ? 
3  AC1 12 THR A 124 ? THR A 120  . ? 1_555 ? 
4  AC1 12 LEU A 191 ? LEU A 187  . ? 1_555 ? 
5  AC1 12 VAL A 197 ? VAL A 193  . ? 1_555 ? 
6  AC1 12 SER A 200 ? SER A 196  . ? 1_555 ? 
7  AC1 12 SER A 204 ? SER A 200  . ? 1_555 ? 
8  AC1 12 PHE A 365 ? PHE A 410  . ? 1_555 ? 
9  AC1 12 PHE A 366 ? PHE A 411  . ? 1_555 ? 
10 AC1 12 THR A 389 ? THR A 434  . ? 1_555 ? 
11 AC1 12 TYR A 393 ? TYR A 438  . ? 1_555 ? 
12 AC1 12 HOH Y .   ? HOH A 1326 . ? 1_555 ? 
13 AC2 7  TYR A 147 ? TYR A 143  . ? 1_555 ? 
14 AC2 7  GLY A 152 ? GLY A 148  . ? 1_555 ? 
15 AC2 7  SER A 153 ? SER A 149  . ? 1_555 ? 
16 AC2 7  ARG A 155 ? ARG A 151  . ? 1_555 ? 
17 AC2 7  GLN A 156 ? GLN A 152  . ? 1_555 ? 
18 AC2 7  GOL X .   ? GOL A 1223 . ? 1_555 ? 
19 AC2 7  HOH Y .   ? HOH A 1352 . ? 1_555 ? 
20 AC3 2  ARG A 345 ? ARG A 390  . ? 3_554 ? 
21 AC3 2  ARG A 345 ? ARG A 390  . ? 1_555 ? 
22 AC4 4  LEU A 89  ? LEU A 85   . ? 3_454 ? 
23 AC4 4  LEU A 89  ? LEU A 85   . ? 1_555 ? 
24 AC4 4  HOH Y .   ? HOH A 1379 . ? 1_555 ? 
25 AC4 4  HOH Y .   ? HOH A 1379 . ? 3_454 ? 
26 AC5 8  VAL A 63  ? VAL A 59   . ? 1_555 ? 
27 AC5 8  THR A 71  ? THR A 67   . ? 1_555 ? 
28 AC5 8  ASN A 74  ? ASN A 70   . ? 1_555 ? 
29 AC5 8  SER A 75  ? SER A 71   . ? 1_555 ? 
30 AC5 8  SER A 79  ? SER A 75   . ? 1_555 ? 
31 AC5 8  LEU A 157 ? LEU A 153  . ? 1_555 ? 
32 AC5 8  TRP A 164 ? TRP A 160  . ? 1_555 ? 
33 AC5 8  PEG V .   ? PEG A 1221 . ? 1_555 ? 
34 AC6 5  LEU A 48  ? LEU A 44   . ? 1_555 ? 
35 AC6 5  ALA A 51  ? ALA A 47   . ? 1_555 ? 
36 AC6 5  GLU A 99  ? GLU A 95   . ? 1_555 ? 
37 AC6 5  TRP A 390 ? TRP A 435  . ? 1_555 ? 
38 AC6 5  OLA H .   ? OLA A 1207 . ? 1_555 ? 
39 AC7 5  ARG A 383 ? ARG A 428  . ? 1_555 ? 
40 AC7 5  SER A 386 ? SER A 431  . ? 1_555 ? 
41 AC7 5  ALA A 387 ? ALA A 432  . ? 1_555 ? 
42 AC7 5  OLA G .   ? OLA A 1206 . ? 1_555 ? 
43 AC7 5  HOH Y .   ? HOH A 1316 . ? 1_555 ? 
44 AC8 7  PHE A 128 ? PHE A 124  . ? 1_555 ? 
45 AC8 7  ASP A 136 ? ASP A 132  . ? 4_555 ? 
46 AC8 7  ARG A 155 ? ARG A 151  . ? 4_555 ? 
47 AC8 7  LEU A 159 ? LEU A 155  . ? 4_555 ? 
48 AC8 7  LEU A 166 ? LEU A 162  . ? 1_555 ? 
49 AC8 7  TYR A 199 ? TYR A 195  . ? 1_555 ? 
50 AC8 7  HOH Y .   ? HOH A 1367 . ? 4_555 ? 
51 AC9 4  LEU A 58  ? LEU A 54   . ? 1_555 ? 
52 AC9 4  SER A 62  ? SER A 58   . ? 1_555 ? 
53 AC9 4  PRO A 400 ? PRO A 445  . ? 1_555 ? 
54 AC9 4  THR A 404 ? THR A 449  . ? 1_555 ? 
55 AD1 4  LEU A 213 ? LEU A 209  . ? 1_555 ? 
56 AD1 4  PHE A 220 ? PHE A 216  . ? 1_555 ? 
57 AD1 4  GLN A 224 ? GLN A 220  . ? 1_555 ? 
58 AD1 4  ARG A 345 ? ARG A 390  . ? 1_555 ? 
59 AD2 5  PHE A 138 ? PHE A 134  . ? 1_555 ? 
60 AD2 5  ALA A 142 ? ALA A 138  . ? 1_555 ? 
61 AD2 5  ASP A 195 ? ASP A 191  . ? 4_555 ? 
62 AD2 5  CYS A 203 ? CYS A 199  . ? 4_555 ? 
63 AD2 5  HOH Y .   ? HOH A 1365 . ? 1_555 ? 
64 AD3 3  GLY A 356 ? GLY A 401  . ? 1_555 ? 
65 AD3 3  ALA A 357 ? ALA A 402  . ? 1_555 ? 
66 AD3 3  PHE A 406 ? PHE A 451  . ? 1_555 ? 
67 AD4 4  PHE A 206 ? PHE A 202  . ? 1_555 ? 
68 AD4 4  THR A 371 ? THR A 416  . ? 1_555 ? 
69 AD4 4  ARG A 383 ? ARG A 428  . ? 3_554 ? 
70 AD4 4  GLU A 312 ? GLU A 1081 . ? 5_555 ? 
71 AD5 3  LEU A 384 ? LEU A 429  . ? 1_555 ? 
72 AD5 3  HOH Y .   ? HOH A 1301 . ? 3_554 ? 
73 AD5 3  HOH Y .   ? HOH A 1301 . ? 1_555 ? 
74 AD6 1  MET A 118 ? MET A 114  . ? 1_555 ? 
75 AD7 1  SER A 57  ? SER A 53   . ? 3_454 ? 
76 AD8 3  TYR A 97  ? TYR A 93   . ? 3_454 ? 
77 AD8 3  LEU A 107 ? LEU A 103  . ? 3_454 ? 
78 AD8 3  SER A 108 ? SER A 104  . ? 1_555 ? 
79 AD9 3  SER A 108 ? SER A 104  . ? 1_555 ? 
80 AD9 3  ARG A 110 ? ARG A 106  . ? 1_555 ? 
81 AD9 3  HOH Y .   ? HOH A 1369 . ? 1_555 ? 
82 AE1 1  OLA F .   ? OLA A 1205 . ? 1_555 ? 
83 AE2 5  ARG A 137 ? ARG A 133  . ? 1_555 ? 
84 AE2 5  ALA A 140 ? ALA A 136  . ? 1_555 ? 
85 AE2 5  ARG A 155 ? ARG A 151  . ? 1_555 ? 
86 AE2 5  PO4 C .   ? PO4 A 1202 . ? 1_555 ? 
87 AE2 5  HOH Y .   ? HOH A 1367 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5WIU 
_atom_sites.fract_transf_matrix[1][1]   0.014774 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006096 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011887 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 38  ? -20.681 20.730  -35.850 1.00 70.19  ? 34   GLY A N   1 
ATOM   2    C  CA  . GLY A 1 38  ? -21.957 20.459  -35.211 1.00 64.51  ? 34   GLY A CA  1 
ATOM   3    C  C   . GLY A 1 38  ? -22.617 19.194  -35.727 1.00 58.62  ? 34   GLY A C   1 
ATOM   4    O  O   . GLY A 1 38  ? -23.111 18.385  -34.948 1.00 58.07  ? 34   GLY A O   1 
ATOM   5    N  N   . ALA A 1 39  ? -22.630 19.026  -37.046 1.00 59.19  ? 35   ALA A N   1 
ATOM   6    C  CA  . ALA A 1 39  ? -23.227 17.847  -37.662 1.00 58.66  ? 35   ALA A CA  1 
ATOM   7    C  C   . ALA A 1 39  ? -22.484 16.575  -37.266 1.00 59.08  ? 35   ALA A C   1 
ATOM   8    O  O   . ALA A 1 39  ? -23.094 15.521  -37.079 1.00 60.48  ? 35   ALA A O   1 
ATOM   9    C  CB  . ALA A 1 39  ? -23.259 17.999  -39.183 1.00 61.35  ? 35   ALA A CB  1 
ATOM   10   N  N   . ALA A 1 40  ? -21.167 16.679  -37.115 1.00 57.82  ? 36   ALA A N   1 
ATOM   11   C  CA  . ALA A 1 40  ? -20.349 15.533  -36.742 1.00 54.09  ? 36   ALA A CA  1 
ATOM   12   C  C   . ALA A 1 40  ? -20.617 15.112  -35.308 1.00 54.30  ? 36   ALA A C   1 
ATOM   13   O  O   . ALA A 1 40  ? -20.604 13.924  -34.987 1.00 59.26  ? 36   ALA A O   1 
ATOM   14   C  CB  . ALA A 1 40  ? -18.879 15.850  -36.935 1.00 55.56  ? 36   ALA A CB  1 
ATOM   15   N  N   . ALA A 1 41  ? -20.859 16.084  -34.437 1.00 54.36  ? 37   ALA A N   1 
ATOM   16   C  CA  . ALA A 1 41  ? -21.179 15.783  -33.044 1.00 54.38  ? 37   ALA A CA  1 
ATOM   17   C  C   . ALA A 1 41  ? -22.522 15.075  -32.978 1.00 51.99  ? 37   ALA A C   1 
ATOM   18   O  O   . ALA A 1 41  ? -22.714 14.122  -32.222 1.00 50.91  ? 37   ALA A O   1 
ATOM   19   C  CB  . ALA A 1 41  ? -21.205 17.057  -32.212 1.00 54.24  ? 37   ALA A CB  1 
ATOM   20   N  N   . LEU A 1 42  ? -23.450 15.556  -33.792 1.00 52.31  ? 38   LEU A N   1 
ATOM   21   C  CA  . LEU A 1 42  ? -24.785 14.983  -33.853 1.00 52.81  ? 38   LEU A CA  1 
ATOM   22   C  C   . LEU A 1 42  ? -24.756 13.558  -34.393 1.00 51.54  ? 38   LEU A C   1 
ATOM   23   O  O   . LEU A 1 42  ? -25.307 12.650  -33.778 1.00 51.61  ? 38   LEU A O   1 
ATOM   24   C  CB  . LEU A 1 42  ? -25.692 15.859  -34.709 1.00 52.36  ? 38   LEU A CB  1 
ATOM   25   C  CG  . LEU A 1 42  ? -27.107 15.326  -34.925 1.00 53.50  ? 38   LEU A CG  1 
ATOM   26   C  CD1 . LEU A 1 42  ? -27.740 14.903  -33.602 1.00 53.67  ? 38   LEU A CD1 1 
ATOM   27   C  CD2 . LEU A 1 42  ? -27.940 16.395  -35.595 1.00 54.69  ? 38   LEU A CD2 1 
ATOM   28   N  N   . VAL A 1 43  ? -24.111 13.363  -35.539 1.00 53.35  ? 39   VAL A N   1 
ATOM   29   C  CA  . VAL A 1 43  ? -24.027 12.037  -36.147 1.00 51.74  ? 39   VAL A CA  1 
ATOM   30   C  C   . VAL A 1 43  ? -23.284 11.055  -35.250 1.00 52.50  ? 39   VAL A C   1 
ATOM   31   O  O   . VAL A 1 43  ? -23.807 9.991   -34.900 1.00 53.81  ? 39   VAL A O   1 
ATOM   32   C  CB  . VAL A 1 43  ? -23.340 12.098  -37.523 1.00 55.63  ? 39   VAL A CB  1 
ATOM   33   C  CG1 . VAL A 1 43  ? -23.012 10.698  -38.015 1.00 57.00  ? 39   VAL A CG1 1 
ATOM   34   C  CG2 . VAL A 1 43  ? -24.232 12.811  -38.518 1.00 54.49  ? 39   VAL A CG2 1 
ATOM   35   N  N   . GLY A 1 44  ? -22.069 11.417  -34.859 1.00 51.86  ? 40   GLY A N   1 
ATOM   36   C  CA  . GLY A 1 44  ? -21.281 10.581  -33.966 1.00 49.15  ? 40   GLY A CA  1 
ATOM   37   C  C   . GLY A 1 44  ? -21.989 10.324  -32.649 1.00 47.20  ? 40   GLY A C   1 
ATOM   38   O  O   . GLY A 1 44  ? -21.926 9.220   -32.107 1.00 47.26  ? 40   GLY A O   1 
ATOM   39   N  N   . GLY A 1 45  ? -22.670 11.347  -32.142 1.00 44.35  ? 41   GLY A N   1 
ATOM   40   C  CA  . GLY A 1 45  ? -23.358 11.248  -30.871 1.00 45.41  ? 41   GLY A CA  1 
ATOM   41   C  C   . GLY A 1 45  ? -24.517 10.275  -30.917 1.00 44.68  ? 41   GLY A C   1 
ATOM   42   O  O   . GLY A 1 45  ? -24.666 9.428   -30.041 1.00 45.52  ? 41   GLY A O   1 
ATOM   43   N  N   . VAL A 1 46  ? -25.339 10.394  -31.952 1.00 46.61  ? 42   VAL A N   1 
ATOM   44   C  CA  . VAL A 1 46  ? -26.482 9.507   -32.107 1.00 46.29  ? 42   VAL A CA  1 
ATOM   45   C  C   . VAL A 1 46  ? -26.003 8.071   -32.266 1.00 46.17  ? 42   VAL A C   1 
ATOM   46   O  O   . VAL A 1 46  ? -26.536 7.151   -31.638 1.00 47.79  ? 42   VAL A O   1 
ATOM   47   C  CB  . VAL A 1 46  ? -27.361 9.933   -33.311 1.00 49.44  ? 42   VAL A CB  1 
ATOM   48   C  CG1 . VAL A 1 46  ? -28.311 8.834   -33.704 1.00 51.10  ? 42   VAL A CG1 1 
ATOM   49   C  CG2 . VAL A 1 46  ? -28.123 11.205  -32.984 1.00 49.70  ? 42   VAL A CG2 1 
ATOM   50   N  N   . LEU A 1 47  ? -24.971 7.876   -33.078 1.00 47.83  ? 43   LEU A N   1 
ATOM   51   C  CA  . LEU A 1 47  ? -24.416 6.541   -33.268 1.00 44.26  ? 43   LEU A CA  1 
ATOM   52   C  C   . LEU A 1 47  ? -23.861 6.000   -31.961 1.00 46.14  ? 43   LEU A C   1 
ATOM   53   O  O   . LEU A 1 47  ? -24.075 4.829   -31.620 1.00 45.92  ? 43   LEU A O   1 
ATOM   54   C  CB  . LEU A 1 47  ? -23.325 6.553   -34.334 1.00 45.41  ? 43   LEU A CB  1 
ATOM   55   C  CG  . LEU A 1 47  ? -23.840 6.689   -35.762 1.00 47.94  ? 43   LEU A CG  1 
ATOM   56   C  CD1 . LEU A 1 47  ? -22.671 6.753   -36.731 1.00 52.33  ? 43   LEU A CD1 1 
ATOM   57   C  CD2 . LEU A 1 47  ? -24.773 5.542   -36.125 1.00 49.57  ? 43   LEU A CD2 1 
ATOM   58   N  N   . LEU A 1 48  ? -23.166 6.856   -31.217 1.00 40.84  ? 44   LEU A N   1 
ATOM   59   C  CA  . LEU A 1 48  ? -22.591 6.429   -29.955 1.00 40.84  ? 44   LEU A CA  1 
ATOM   60   C  C   . LEU A 1 48  ? -23.676 5.980   -28.982 1.00 42.17  ? 44   LEU A C   1 
ATOM   61   O  O   . LEU A 1 48  ? -23.582 4.898   -28.400 1.00 42.12  ? 44   LEU A O   1 
ATOM   62   C  CB  . LEU A 1 48  ? -21.763 7.546   -29.336 1.00 41.25  ? 44   LEU A CB  1 
ATOM   63   C  CG  . LEU A 1 48  ? -21.182 7.208   -27.969 1.00 40.48  ? 44   LEU A CG  1 
ATOM   64   C  CD1 . LEU A 1 48  ? -20.236 6.042   -28.083 1.00 42.98  ? 44   LEU A CD1 1 
ATOM   65   C  CD2 . LEU A 1 48  ? -20.490 8.427   -27.369 1.00 40.48  ? 44   LEU A CD2 1 
ATOM   66   N  N   . ILE A 1 49  ? -24.705 6.808   -28.810 1.00 40.02  ? 45   ILE A N   1 
ATOM   67   C  CA  . ILE A 1 49  ? -25.791 6.497   -27.882 1.00 39.43  ? 45   ILE A CA  1 
ATOM   68   C  C   . ILE A 1 49  ? -26.496 5.195   -28.290 1.00 39.81  ? 45   ILE A C   1 
ATOM   69   O  O   . ILE A 1 49  ? -26.757 4.324   -27.453 1.00 40.14  ? 45   ILE A O   1 
ATOM   70   C  CB  . ILE A 1 49  ? -26.800 7.677   -27.809 1.00 40.81  ? 45   ILE A CB  1 
ATOM   71   C  CG1 . ILE A 1 49  ? -26.142 8.869   -27.085 1.00 39.89  ? 45   ILE A CG1 1 
ATOM   72   C  CG2 . ILE A 1 49  ? -28.076 7.239   -27.091 1.00 43.38  ? 45   ILE A CG2 1 
ATOM   73   C  CD1 . ILE A 1 49  ? -26.943 10.194  -27.125 1.00 41.32  ? 45   ILE A CD1 1 
ATOM   74   N  N   . GLY A 1 50  ? -26.768 5.055   -29.583 1.00 42.49  ? 46   GLY A N   1 
ATOM   75   C  CA  . GLY A 1 50  ? -27.353 3.831   -30.106 1.00 41.72  ? 46   GLY A CA  1 
ATOM   76   C  C   . GLY A 1 50  ? -26.508 2.602   -29.804 1.00 43.08  ? 46   GLY A C   1 
ATOM   77   O  O   . GLY A 1 50  ? -27.010 1.570   -29.344 1.00 43.72  ? 46   GLY A O   1 
ATOM   78   N  N   . ALA A 1 51  ? -25.208 2.706   -30.050 1.00 43.13  ? 47   ALA A N   1 
ATOM   79   C  CA  . ALA A 1 51  ? -24.316 1.566   -29.847 1.00 42.28  ? 47   ALA A CA  1 
ATOM   80   C  C   . ALA A 1 51  ? -24.219 1.184   -28.375 1.00 41.79  ? 47   ALA A C   1 
ATOM   81   O  O   . ALA A 1 51  ? -24.179 -0.003  -28.035 1.00 43.23  ? 47   ALA A O   1 
ATOM   82   C  CB  . ALA A 1 51  ? -22.928 1.867   -30.407 1.00 45.17  ? 47   ALA A CB  1 
ATOM   83   N  N   . VAL A 1 52  ? -24.174 2.179   -27.496 1.00 39.57  ? 48   VAL A N   1 
ATOM   84   C  CA  . VAL A 1 52  ? -24.081 1.884   -26.076 1.00 40.39  ? 48   VAL A CA  1 
ATOM   85   C  C   . VAL A 1 52  ? -25.354 1.184   -25.604 1.00 42.36  ? 48   VAL A C   1 
ATOM   86   O  O   . VAL A 1 52  ? -25.285 0.184   -24.884 1.00 39.72  ? 48   VAL A O   1 
ATOM   87   C  CB  . VAL A 1 52  ? -23.852 3.142   -25.222 1.00 38.44  ? 48   VAL A CB  1 
ATOM   88   C  CG1 . VAL A 1 52  ? -23.920 2.780   -23.740 1.00 39.63  ? 48   VAL A CG1 1 
ATOM   89   C  CG2 . VAL A 1 52  ? -22.499 3.771   -25.543 1.00 37.57  ? 48   VAL A CG2 1 
ATOM   90   N  N   . LEU A 1 53  ? -26.506 1.715   -26.013 1.00 41.57  ? 49   LEU A N   1 
ATOM   91   C  CA  . LEU A 1 53  ? -27.776 1.183   -25.548 1.00 39.98  ? 49   LEU A CA  1 
ATOM   92   C  C   . LEU A 1 53  ? -27.949 -0.240  -26.053 1.00 40.36  ? 49   LEU A C   1 
ATOM   93   O  O   . LEU A 1 53  ? -28.269 -1.140  -25.286 1.00 42.80  ? 49   LEU A O   1 
ATOM   94   C  CB  . LEU A 1 53  ? -28.957 2.071   -25.994 1.00 39.37  ? 49   LEU A CB  1 
ATOM   95   C  CG  . LEU A 1 53  ? -29.073 3.438   -25.309 1.00 43.37  ? 49   LEU A CG  1 
ATOM   96   C  CD1 . LEU A 1 53  ? -30.158 4.301   -25.952 1.00 45.00  ? 49   LEU A CD1 1 
ATOM   97   C  CD2 . LEU A 1 53  ? -29.304 3.305   -23.804 1.00 40.46  ? 49   LEU A CD2 1 
ATOM   98   N  N   . ALA A 1 54  ? -27.719 -0.455  -27.343 1.00 43.32  ? 50   ALA A N   1 
ATOM   99   C  CA  . ALA A 1 54  ? -27.942 -1.779  -27.917 1.00 45.08  ? 50   ALA A CA  1 
ATOM   100  C  C   . ALA A 1 54  ? -26.987 -2.820  -27.365 1.00 45.15  ? 50   ALA A C   1 
ATOM   101  O  O   . ALA A 1 54  ? -27.407 -3.920  -26.993 1.00 45.77  ? 50   ALA A O   1 
ATOM   102  C  CB  . ALA A 1 54  ? -27.830 -1.730  -29.432 1.00 46.64  ? 50   ALA A CB  1 
ATOM   103  N  N   . GLY A 1 55  ? -25.700 -2.484  -27.343 1.00 44.24  ? 51   GLY A N   1 
ATOM   104  C  CA  . GLY A 1 55  ? -24.677 -3.420  -26.914 1.00 42.03  ? 51   GLY A CA  1 
ATOM   105  C  C   . GLY A 1 55  ? -24.865 -3.827  -25.468 1.00 43.62  ? 51   GLY A C   1 
ATOM   106  O  O   . GLY A 1 55  ? -24.885 -5.009  -25.145 1.00 44.82  ? 51   GLY A O   1 
ATOM   107  N  N   . ASN A 1 56  ? -25.022 -2.848  -24.587 1.00 39.71  ? 52   ASN A N   1 
ATOM   108  C  CA  . ASN A 1 56  ? -25.158 -3.163  -23.174 1.00 38.02  ? 52   ASN A CA  1 
ATOM   109  C  C   . ASN A 1 56  ? -26.488 -3.800  -22.785 1.00 39.72  ? 52   ASN A C   1 
ATOM   110  O  O   . ASN A 1 56  ? -26.551 -4.543  -21.806 1.00 41.22  ? 52   ASN A O   1 
ATOM   111  C  CB  . ASN A 1 56  ? -24.919 -1.918  -22.352 1.00 37.09  ? 52   ASN A CB  1 
ATOM   112  C  CG  . ASN A 1 56  ? -23.470 -1.519  -22.380 1.00 38.12  ? 52   ASN A CG  1 
ATOM   113  O  OD1 . ASN A 1 56  ? -22.654 -2.123  -21.688 1.00 40.15  ? 52   ASN A OD1 1 
ATOM   114  N  ND2 . ASN A 1 56  ? -23.125 -0.561  -23.227 1.00 38.07  ? 52   ASN A ND2 1 
ATOM   115  N  N   . SER A 1 57  ? -27.559 -3.509  -23.511 1.00 42.83  ? 53   SER A N   1 
ATOM   116  C  CA  A SER A 1 57  ? -28.824 -4.180  -23.240 0.49 44.42  ? 53   SER A CA  1 
ATOM   117  C  CA  B SER A 1 57  ? -28.816 -4.184  -23.211 0.51 44.60  ? 53   SER A CA  1 
ATOM   118  C  C   . SER A 1 57  ? -28.696 -5.650  -23.603 1.00 46.87  ? 53   SER A C   1 
ATOM   119  O  O   . SER A 1 57  ? -29.193 -6.525  -22.895 1.00 47.44  ? 53   SER A O   1 
ATOM   120  C  CB  A SER A 1 57  ? -29.972 -3.532  -24.014 0.49 44.60  ? 53   SER A CB  1 
ATOM   121  C  CB  B SER A 1 57  ? -30.004 -3.526  -23.921 0.51 44.48  ? 53   SER A CB  1 
ATOM   122  O  OG  A SER A 1 57  ? -30.189 -2.205  -23.567 0.49 43.14  ? 53   SER A OG  1 
ATOM   123  O  OG  B SER A 1 57  ? -29.965 -3.720  -25.320 0.51 47.94  ? 53   SER A OG  1 
ATOM   124  N  N   . LEU A 1 58  ? -28.019 -5.915  -24.718 1.00 49.85  ? 54   LEU A N   1 
ATOM   125  C  CA  . LEU A 1 58  ? -27.860 -7.287  -25.203 1.00 50.60  ? 54   LEU A CA  1 
ATOM   126  C  C   . LEU A 1 58  ? -27.040 -8.113  -24.219 1.00 48.85  ? 54   LEU A C   1 
ATOM   127  O  O   . LEU A 1 58  ? -27.245 -9.317  -24.096 1.00 50.20  ? 54   LEU A O   1 
ATOM   128  C  CB  . LEU A 1 58  ? -27.209 -7.311  -26.595 1.00 50.17  ? 54   LEU A CB  1 
ATOM   129  C  CG  . LEU A 1 58  ? -28.106 -7.063  -27.808 1.00 51.87  ? 54   LEU A CG  1 
ATOM   130  C  CD1 . LEU A 1 58  ? -27.286 -6.537  -28.979 1.00 54.80  ? 54   LEU A CD1 1 
ATOM   131  C  CD2 . LEU A 1 58  ? -28.853 -8.333  -28.212 1.00 54.77  ? 54   LEU A CD2 1 
ATOM   132  N  N   . VAL A 1 59  ? -26.114 -7.462  -23.530 1.00 45.79  ? 55   VAL A N   1 
ATOM   133  C  CA  . VAL A 1 59  ? -25.349 -8.098  -22.465 1.00 46.82  ? 55   VAL A CA  1 
ATOM   134  C  C   . VAL A 1 59  ? -26.233 -8.410  -21.265 1.00 48.87  ? 55   VAL A C   1 
ATOM   135  O  O   . VAL A 1 59  ? -26.201 -9.524  -20.739 1.00 48.53  ? 55   VAL A O   1 
ATOM   136  C  CB  . VAL A 1 59  ? -24.159 -7.205  -22.018 1.00 46.99  ? 55   VAL A CB  1 
ATOM   137  C  CG1 . VAL A 1 59  ? -23.599 -7.649  -20.665 1.00 46.78  ? 55   VAL A CG1 1 
ATOM   138  C  CG2 . VAL A 1 59  ? -23.073 -7.205  -23.084 1.00 45.24  ? 55   VAL A CG2 1 
ATOM   139  N  N   . CYS A 1 60  ? -27.037 -7.434  -20.847 1.00 48.34  ? 56   CYS A N   1 
ATOM   140  C  CA  . CYS A 1 60  ? -27.894 -7.601  -19.671 1.00 50.44  ? 56   CYS A CA  1 
ATOM   141  C  C   . CYS A 1 60  ? -28.908 -8.716  -19.875 1.00 47.88  ? 56   CYS A C   1 
ATOM   142  O  O   . CYS A 1 60  ? -29.114 -9.553  -19.000 1.00 50.67  ? 56   CYS A O   1 
ATOM   143  C  CB  . CYS A 1 60  ? -28.625 -6.299  -19.338 1.00 50.13  ? 56   CYS A CB  1 
ATOM   144  S  SG  . CYS A 1 60  ? -27.578 -5.077  -18.517 1.00 51.04  ? 56   CYS A SG  1 
ATOM   145  N  N   . VAL A 1 61  ? -29.539 -8.719  -21.037 1.00 52.85  ? 57   VAL A N   1 
ATOM   146  C  CA  . VAL A 1 61  ? -30.548 -9.716  -21.347 1.00 53.45  ? 57   VAL A CA  1 
ATOM   147  C  C   . VAL A 1 61  ? -29.909 -11.094 -21.507 1.00 57.24  ? 57   VAL A C   1 
ATOM   148  O  O   . VAL A 1 61  ? -30.515 -12.106 -21.155 1.00 57.18  ? 57   VAL A O   1 
ATOM   149  C  CB  . VAL A 1 61  ? -31.332 -9.327  -22.616 1.00 54.69  ? 57   VAL A CB  1 
ATOM   150  C  CG1 . VAL A 1 61  ? -32.347 -10.393 -22.988 1.00 57.95  ? 57   VAL A CG1 1 
ATOM   151  C  CG2 . VAL A 1 61  ? -32.042 -7.994  -22.399 1.00 55.52  ? 57   VAL A CG2 1 
ATOM   152  N  N   . SER A 1 62  ? -28.680 -11.138 -22.013 1.00 54.97  ? 58   SER A N   1 
ATOM   153  C  CA  A SER A 1 62  ? -28.018 -12.417 -22.217 0.80 53.84  ? 58   SER A CA  1 
ATOM   154  C  CA  B SER A 1 62  ? -27.976 -12.401 -22.215 0.20 53.10  ? 58   SER A CA  1 
ATOM   155  C  C   . SER A 1 62  ? -27.681 -13.073 -20.886 1.00 55.10  ? 58   SER A C   1 
ATOM   156  O  O   . SER A 1 62  ? -27.868 -14.285 -20.732 1.00 57.59  ? 58   SER A O   1 
ATOM   157  C  CB  A SER A 1 62  ? -26.766 -12.260 -23.075 0.80 50.37  ? 58   SER A CB  1 
ATOM   158  C  CB  B SER A 1 62  ? -26.672 -12.187 -22.988 0.20 49.88  ? 58   SER A CB  1 
ATOM   159  O  OG  A SER A 1 62  ? -27.114 -12.006 -24.427 0.80 50.28  ? 58   SER A OG  1 
ATOM   160  O  OG  B SER A 1 62  ? -25.733 -11.447 -22.223 0.20 49.07  ? 58   SER A OG  1 
ATOM   161  N  N   . VAL A 1 63  ? -27.218 -12.289 -19.919 1.00 53.22  ? 59   VAL A N   1 
ATOM   162  C  CA  . VAL A 1 63  ? -26.944 -12.855 -18.602 1.00 54.83  ? 59   VAL A CA  1 
ATOM   163  C  C   . VAL A 1 63  ? -28.283 -13.291 -17.988 1.00 59.12  ? 59   VAL A C   1 
ATOM   164  O  O   . VAL A 1 63  ? -28.347 -14.261 -17.231 1.00 59.41  ? 59   VAL A O   1 
ATOM   165  C  CB  . VAL A 1 63  ? -26.201 -11.867 -17.678 1.00 52.16  ? 59   VAL A CB  1 
ATOM   166  C  CG1 . VAL A 1 63  ? -26.010 -12.455 -16.284 1.00 50.01  ? 59   VAL A CG1 1 
ATOM   167  C  CG2 . VAL A 1 63  ? -24.841 -11.492 -18.272 1.00 52.26  ? 59   VAL A CG2 1 
ATOM   168  N  N   . ALA A 1 64  ? -29.358 -12.604 -18.364 1.00 59.68  ? 60   ALA A N   1 
ATOM   169  C  CA  . ALA A 1 64  ? -30.703 -12.958 -17.906 1.00 59.60  ? 60   ALA A CA  1 
ATOM   170  C  C   . ALA A 1 64  ? -31.240 -14.256 -18.520 1.00 63.85  ? 60   ALA A C   1 
ATOM   171  O  O   . ALA A 1 64  ? -31.827 -15.081 -17.823 1.00 65.82  ? 60   ALA A O   1 
ATOM   172  C  CB  . ALA A 1 64  ? -31.666 -11.815 -18.201 1.00 60.49  ? 60   ALA A CB  1 
ATOM   173  N  N   . THR A 1 65  ? -31.063 -14.424 -19.827 1.00 59.97  ? 61   THR A N   1 
ATOM   174  C  CA  . THR A 1 65  ? -31.642 -15.551 -20.532 1.00 64.39  ? 61   THR A CA  1 
ATOM   175  C  C   . THR A 1 65  ? -30.835 -16.851 -20.352 1.00 66.88  ? 61   THR A C   1 
ATOM   176  O  O   . THR A 1 65  ? -31.415 -17.933 -20.326 1.00 69.61  ? 61   THR A O   1 
ATOM   177  C  CB  . THR A 1 65  ? -31.789 -15.253 -22.054 1.00 65.87  ? 61   THR A CB  1 
ATOM   178  O  OG1 . THR A 1 65  ? -30.524 -14.886 -22.606 1.00 66.69  ? 61   THR A OG1 1 
ATOM   179  C  CG2 . THR A 1 65  ? -32.763 -14.116 -22.308 1.00 64.54  ? 61   THR A CG2 1 
ATOM   180  N  N   . GLU A 1 66  ? -29.514 -16.750 -20.207 1.00 63.95  ? 62   GLU A N   1 
ATOM   181  C  CA  . GLU A 1 66  ? -28.647 -17.933 -20.296 1.00 61.06  ? 62   GLU A CA  1 
ATOM   182  C  C   . GLU A 1 66  ? -28.028 -18.390 -18.970 1.00 60.11  ? 62   GLU A C   1 
ATOM   183  O  O   . GLU A 1 66  ? -27.342 -17.629 -18.293 1.00 59.48  ? 62   GLU A O   1 
ATOM   184  C  CB  . GLU A 1 66  ? -27.529 -17.668 -21.306 1.00 57.93  ? 62   GLU A CB  1 
ATOM   185  N  N   . ARG A 1 67  ? -28.245 -19.655 -18.619 1.00 59.02  ? 63   ARG A N   1 
ATOM   186  C  CA  . ARG A 1 67  ? -27.758 -20.191 -17.348 1.00 58.04  ? 63   ARG A CA  1 
ATOM   187  C  C   . ARG A 1 67  ? -26.231 -20.255 -17.313 1.00 58.93  ? 63   ARG A C   1 
ATOM   188  O  O   . ARG A 1 67  ? -25.616 -20.083 -16.255 1.00 59.43  ? 63   ARG A O   1 
ATOM   189  C  CB  . ARG A 1 67  ? -28.356 -21.581 -17.087 1.00 59.99  ? 63   ARG A CB  1 
ATOM   190  N  N   . ALA A 1 68  ? -25.621 -20.471 -18.476 1.00 57.29  ? 64   ALA A N   1 
ATOM   191  C  CA  . ALA A 1 68  ? -24.165 -20.552 -18.569 1.00 58.40  ? 64   ALA A CA  1 
ATOM   192  C  C   . ALA A 1 68  ? -23.473 -19.204 -18.345 1.00 57.25  ? 64   ALA A C   1 
ATOM   193  O  O   . ALA A 1 68  ? -22.267 -19.161 -18.137 1.00 55.62  ? 64   ALA A O   1 
ATOM   194  C  CB  . ALA A 1 68  ? -23.758 -21.124 -19.918 1.00 58.35  ? 64   ALA A CB  1 
ATOM   195  N  N   . LEU A 1 69  ? -24.219 -18.104 -18.398 1.00 55.69  ? 65   LEU A N   1 
ATOM   196  C  CA  . LEU A 1 69  ? -23.612 -16.790 -18.147 1.00 52.20  ? 65   LEU A CA  1 
ATOM   197  C  C   . LEU A 1 69  ? -23.880 -16.307 -16.728 1.00 52.72  ? 65   LEU A C   1 
ATOM   198  O  O   . LEU A 1 69  ? -23.402 -15.245 -16.325 1.00 52.60  ? 65   LEU A O   1 
ATOM   199  C  CB  . LEU A 1 69  ? -24.112 -15.752 -19.144 1.00 50.26  ? 65   LEU A CB  1 
ATOM   200  C  CG  . LEU A 1 69  ? -23.712 -15.957 -20.603 1.00 51.66  ? 65   LEU A CG  1 
ATOM   201  C  CD1 . LEU A 1 69  ? -24.436 -14.965 -21.505 1.00 49.92  ? 65   LEU A CD1 1 
ATOM   202  C  CD2 . LEU A 1 69  ? -22.204 -15.868 -20.772 1.00 50.44  ? 65   LEU A CD2 1 
ATOM   203  N  N   . GLN A 1 70  ? -24.632 -17.092 -15.964 1.00 55.75  ? 66   GLN A N   1 
ATOM   204  C  CA  . GLN A 1 70  ? -24.960 -16.711 -14.596 1.00 57.43  ? 66   GLN A CA  1 
ATOM   205  C  C   . GLN A 1 70  ? -23.874 -17.178 -13.654 1.00 57.81  ? 66   GLN A C   1 
ATOM   206  O  O   . GLN A 1 70  ? -23.958 -18.258 -13.062 1.00 62.26  ? 66   GLN A O   1 
ATOM   207  C  CB  . GLN A 1 70  ? -26.324 -17.269 -14.189 1.00 59.47  ? 66   GLN A CB  1 
ATOM   208  C  CG  . GLN A 1 70  ? -27.446 -16.497 -14.830 1.00 57.18  ? 66   GLN A CG  1 
ATOM   209  C  CD  . GLN A 1 70  ? -28.776 -17.216 -14.823 1.00 59.90  ? 66   GLN A CD  1 
ATOM   210  O  OE1 . GLN A 1 70  ? -28.952 -18.246 -14.164 1.00 60.83  ? 66   GLN A OE1 1 
ATOM   211  N  NE2 . GLN A 1 70  ? -29.729 -16.672 -15.565 1.00 61.21  ? 66   GLN A NE2 1 
ATOM   212  N  N   . THR A 1 71  ? -22.837 -16.351 -13.556 1.00 52.48  ? 67   THR A N   1 
ATOM   213  C  CA  . THR A 1 71  ? -21.653 -16.623 -12.757 1.00 51.73  ? 67   THR A CA  1 
ATOM   214  C  C   . THR A 1 71  ? -21.326 -15.406 -11.894 1.00 52.14  ? 67   THR A C   1 
ATOM   215  O  O   . THR A 1 71  ? -21.801 -14.302 -12.184 1.00 50.35  ? 67   THR A O   1 
ATOM   216  C  CB  . THR A 1 71  ? -20.447 -16.942 -13.651 1.00 53.89  ? 67   THR A CB  1 
ATOM   217  O  OG1 . THR A 1 71  ? -20.031 -15.741 -14.315 1.00 51.55  ? 67   THR A OG1 1 
ATOM   218  C  CG2 . THR A 1 71  ? -20.799 -18.012 -14.676 1.00 50.96  ? 67   THR A CG2 1 
ATOM   219  N  N   . PRO A 1 72  ? -20.510 -15.590 -10.838 1.00 48.13  ? 68   PRO A N   1 
ATOM   220  C  CA  . PRO A 1 72  ? -20.120 -14.459 -9.982  1.00 47.69  ? 68   PRO A CA  1 
ATOM   221  C  C   . PRO A 1 72  ? -19.454 -13.312 -10.729 1.00 48.45  ? 68   PRO A C   1 
ATOM   222  O  O   . PRO A 1 72  ? -19.776 -12.143 -10.484 1.00 47.37  ? 68   PRO A O   1 
ATOM   223  C  CB  . PRO A 1 72  ? -19.126 -15.091 -9.010  1.00 49.08  ? 68   PRO A CB  1 
ATOM   224  C  CG  . PRO A 1 72  ? -19.573 -16.499 -8.907  1.00 51.64  ? 68   PRO A CG  1 
ATOM   225  C  CD  . PRO A 1 72  ? -20.044 -16.873 -10.283 1.00 51.18  ? 68   PRO A CD  1 
ATOM   226  N  N   . THR A 1 73  ? -18.516 -13.641 -11.611 1.00 44.27  ? 69   THR A N   1 
ATOM   227  C  CA  . THR A 1 73  ? -17.872 -12.628 -12.426 1.00 44.98  ? 69   THR A CA  1 
ATOM   228  C  C   . THR A 1 73  ? -18.915 -11.829 -13.204 1.00 43.20  ? 69   THR A C   1 
ATOM   229  O  O   . THR A 1 73  ? -18.823 -10.607 -13.311 1.00 42.53  ? 69   THR A O   1 
ATOM   230  C  CB  . THR A 1 73  ? -16.862 -13.243 -13.418 1.00 48.16  ? 69   THR A CB  1 
ATOM   231  O  OG1 . THR A 1 73  ? -15.795 -13.883 -12.697 1.00 49.51  ? 69   THR A OG1 1 
ATOM   232  C  CG2 . THR A 1 73  ? -16.291 -12.168 -14.334 1.00 41.94  ? 69   THR A CG2 1 
ATOM   233  N  N   . ASN A 1 74  ? -19.920 -12.513 -13.735 1.00 43.97  ? 70   ASN A N   1 
ATOM   234  C  CA  . ASN A 1 74  ? -20.846 -11.830 -14.626 1.00 44.67  ? 70   ASN A CA  1 
ATOM   235  C  C   . ASN A 1 74  ? -21.852 -10.946 -13.897 1.00 42.38  ? 70   ASN A C   1 
ATOM   236  O  O   . ASN A 1 74  ? -22.499 -10.123 -14.522 1.00 43.46  ? 70   ASN A O   1 
ATOM   237  C  CB  . ASN A 1 74  ? -21.539 -12.847 -15.534 1.00 43.48  ? 70   ASN A CB  1 
ATOM   238  C  CG  . ASN A 1 74  ? -20.636 -13.288 -16.676 1.00 45.39  ? 70   ASN A CG  1 
ATOM   239  O  OD1 . ASN A 1 74  ? -19.523 -12.773 -16.828 1.00 45.66  ? 70   ASN A OD1 1 
ATOM   240  N  ND2 . ASN A 1 74  ? -21.087 -14.253 -17.461 1.00 43.32  ? 70   ASN A ND2 1 
ATOM   241  N  N   . SER A 1 75  ? -21.971 -11.089 -12.582 1.00 42.46  ? 71   SER A N   1 
ATOM   242  C  CA  A SER A 1 75  ? -22.758 -10.140 -11.804 0.47 42.20  ? 71   SER A CA  1 
ATOM   243  C  CA  B SER A 1 75  ? -22.759 -10.133 -11.805 0.53 42.21  ? 71   SER A CA  1 
ATOM   244  C  C   . SER A 1 75  ? -22.151 -8.749  -11.946 1.00 41.37  ? 71   SER A C   1 
ATOM   245  O  O   . SER A 1 75  ? -22.863 -7.758  -12.110 1.00 40.01  ? 71   SER A O   1 
ATOM   246  C  CB  A SER A 1 75  ? -22.814 -10.548 -10.331 0.47 42.40  ? 71   SER A CB  1 
ATOM   247  C  CB  B SER A 1 75  ? -22.818 -10.512 -10.329 0.53 42.62  ? 71   SER A CB  1 
ATOM   248  O  OG  A SER A 1 75  ? -21.528 -10.444 -9.729  0.47 42.69  ? 71   SER A OG  1 
ATOM   249  O  OG  B SER A 1 75  ? -23.410 -11.774 -10.136 0.53 42.64  ? 71   SER A OG  1 
ATOM   250  N  N   . PHE A 1 76  ? -20.822 -8.677  -11.883 1.00 36.45  ? 72   PHE A N   1 
ATOM   251  C  CA  . PHE A 1 76  ? -20.143 -7.386  -12.030 1.00 34.60  ? 72   PHE A CA  1 
ATOM   252  C  C   . PHE A 1 76  ? -20.241 -6.858  -13.447 1.00 34.24  ? 72   PHE A C   1 
ATOM   253  O  O   . PHE A 1 76  ? -20.278 -5.640  -13.671 1.00 34.44  ? 72   PHE A O   1 
ATOM   254  C  CB  . PHE A 1 76  ? -18.670 -7.503  -11.651 1.00 35.24  ? 72   PHE A CB  1 
ATOM   255  C  CG  . PHE A 1 76  ? -18.454 -7.923  -10.237 1.00 35.44  ? 72   PHE A CG  1 
ATOM   256  C  CD1 . PHE A 1 76  ? -18.545 -7.004  -9.205  1.00 38.81  ? 72   PHE A CD1 1 
ATOM   257  C  CD2 . PHE A 1 76  ? -18.214 -9.242  -9.932  1.00 36.77  ? 72   PHE A CD2 1 
ATOM   258  C  CE1 . PHE A 1 76  ? -18.366 -7.396  -7.888  1.00 37.78  ? 72   PHE A CE1 1 
ATOM   259  C  CE2 . PHE A 1 76  ? -18.025 -9.632  -8.627  1.00 37.13  ? 72   PHE A CE2 1 
ATOM   260  C  CZ  . PHE A 1 76  ? -18.100 -8.714  -7.605  1.00 38.77  ? 72   PHE A CZ  1 
ATOM   261  N  N   . ILE A 1 77  ? -20.246 -7.773  -14.407 1.00 37.27  ? 73   ILE A N   1 
ATOM   262  C  CA  . ILE A 1 77  ? -20.333 -7.384  -15.795 1.00 36.75  ? 73   ILE A CA  1 
ATOM   263  C  C   . ILE A 1 77  ? -21.696 -6.767  -16.059 1.00 39.98  ? 73   ILE A C   1 
ATOM   264  O  O   . ILE A 1 77  ? -21.809 -5.796  -16.808 1.00 38.22  ? 73   ILE A O   1 
ATOM   265  C  CB  . ILE A 1 77  ? -20.091 -8.573  -16.709 1.00 39.82  ? 73   ILE A CB  1 
ATOM   266  C  CG1 . ILE A 1 77  ? -18.610 -8.971  -16.633 1.00 40.88  ? 73   ILE A CG1 1 
ATOM   267  C  CG2 . ILE A 1 77  ? -20.457 -8.239  -18.135 1.00 36.53  ? 73   ILE A CG2 1 
ATOM   268  C  CD1 . ILE A 1 77  ? -18.234 -9.983  -17.690 1.00 47.65  ? 73   ILE A CD1 1 
ATOM   269  N  N   . VAL A 1 78  ? -22.729 -7.323  -15.434 1.00 37.46  ? 74   VAL A N   1 
ATOM   270  C  CA  . VAL A 1 78  ? -24.044 -6.707  -15.522 1.00 38.55  ? 74   VAL A CA  1 
ATOM   271  C  C   . VAL A 1 78  ? -24.039 -5.297  -14.897 1.00 37.56  ? 74   VAL A C   1 
ATOM   272  O  O   . VAL A 1 78  ? -24.578 -4.371  -15.474 1.00 37.79  ? 74   VAL A O   1 
ATOM   273  C  CB  . VAL A 1 78  ? -25.118 -7.558  -14.847 1.00 38.44  ? 74   VAL A CB  1 
ATOM   274  C  CG1 . VAL A 1 78  ? -26.413 -6.753  -14.710 1.00 42.15  ? 74   VAL A CG1 1 
ATOM   275  C  CG2 . VAL A 1 78  ? -25.365 -8.835  -15.654 1.00 38.79  ? 74   VAL A CG2 1 
ATOM   276  N  N   . SER A 1 79  ? -23.452 -5.163  -13.714 1.00 34.74  ? 75   SER A N   1 
ATOM   277  C  CA  . SER A 1 79  ? -23.289 -3.868  -13.048 1.00 36.11  ? 75   SER A CA  1 
ATOM   278  C  C   . SER A 1 79  ? -22.614 -2.812  -13.940 1.00 36.18  ? 75   SER A C   1 
ATOM   279  O  O   . SER A 1 79  ? -23.059 -1.653  -14.020 1.00 35.10  ? 75   SER A O   1 
ATOM   280  C  CB  . SER A 1 79  ? -22.485 -4.048  -11.753 1.00 37.91  ? 75   SER A CB  1 
ATOM   281  O  OG  . SER A 1 79  ? -22.276 -2.804  -11.098 1.00 36.99  ? 75   SER A OG  1 
ATOM   282  N  N   . LEU A 1 80  ? -21.539 -3.214  -14.609 1.00 35.40  ? 76   LEU A N   1 
ATOM   283  C  CA  . LEU A 1 80  ? -20.850 -2.343  -15.569 1.00 33.15  ? 76   LEU A CA  1 
ATOM   284  C  C   . LEU A 1 80  ? -21.723 -1.964  -16.739 1.00 34.36  ? 76   LEU A C   1 
ATOM   285  O  O   . LEU A 1 80  ? -21.654 -0.849  -17.250 1.00 35.29  ? 76   LEU A O   1 
ATOM   286  C  CB  . LEU A 1 80  ? -19.605 -3.037  -16.119 1.00 33.97  ? 76   LEU A CB  1 
ATOM   287  C  CG  . LEU A 1 80  ? -18.422 -3.083  -15.160 1.00 37.81  ? 76   LEU A CG  1 
ATOM   288  C  CD1 . LEU A 1 80  ? -17.392 -4.108  -15.650 1.00 40.99  ? 76   LEU A CD1 1 
ATOM   289  C  CD2 . LEU A 1 80  ? -17.799 -1.701  -15.085 1.00 35.59  ? 76   LEU A CD2 1 
ATOM   290  N  N   . ALA A 1 81  ? -22.510 -2.927  -17.200 1.00 34.49  ? 77   ALA A N   1 
ATOM   291  C  CA  . ALA A 1 81  ? -23.408 -2.685  -18.306 1.00 35.55  ? 77   ALA A CA  1 
ATOM   292  C  C   . ALA A 1 81  ? -24.454 -1.638  -17.897 1.00 36.94  ? 77   ALA A C   1 
ATOM   293  O  O   . ALA A 1 81  ? -24.807 -0.764  -18.688 1.00 36.06  ? 77   ALA A O   1 
ATOM   294  C  CB  . ALA A 1 81  ? -24.081 -4.011  -18.764 1.00 36.45  ? 77   ALA A CB  1 
ATOM   295  N  N   . ALA A 1 82  ? -24.914 -1.735  -16.650 1.00 34.75  ? 78   ALA A N   1 
ATOM   296  C  CA  . ALA A 1 82  ? -25.887 -0.799  -16.092 1.00 36.85  ? 78   ALA A CA  1 
ATOM   297  C  C   . ALA A 1 82  ? -25.335 0.622   -16.076 1.00 40.11  ? 78   ALA A C   1 
ATOM   298  O  O   . ALA A 1 82  ? -26.016 1.569   -16.440 1.00 38.92  ? 78   ALA A O   1 
ATOM   299  C  CB  . ALA A 1 82  ? -26.277 -1.225  -14.681 1.00 35.94  ? 78   ALA A CB  1 
ATOM   300  N  N   . ALA A 1 83  ? -24.090 0.752   -15.638 1.00 34.93  ? 79   ALA A N   1 
ATOM   301  C  CA  . ALA A 1 83  ? -23.400 2.035   -15.602 1.00 35.78  ? 79   ALA A CA  1 
ATOM   302  C  C   . ALA A 1 83  ? -23.342 2.660   -16.984 1.00 37.47  ? 79   ALA A C   1 
ATOM   303  O  O   . ALA A 1 83  ? -23.535 3.873   -17.135 1.00 37.75  ? 79   ALA A O   1 
ATOM   304  C  CB  . ALA A 1 83  ? -21.993 1.859   -15.034 1.00 35.36  ? 79   ALA A CB  1 
ATOM   305  N  N   . ASP A 1 84  ? -23.109 1.834   -18.002 1.00 35.83  ? 80   ASP A N   1 
ATOM   306  C  CA  . ASP A 1 84  ? -23.044 2.357   -19.359 1.00 35.31  ? 80   ASP A CA  1 
ATOM   307  C  C   . ASP A 1 84  ? -24.427 2.694   -19.929 1.00 36.74  ? 80   ASP A C   1 
ATOM   308  O  O   . ASP A 1 84  ? -24.595 3.683   -20.650 1.00 36.34  ? 80   ASP A O   1 
ATOM   309  C  CB  . ASP A 1 84  ? -22.285 1.371   -20.237 1.00 36.48  ? 80   ASP A CB  1 
ATOM   310  C  CG  . ASP A 1 84  ? -20.765 1.379   -19.920 1.00 43.72  ? 80   ASP A CG  1 
ATOM   311  O  OD1 . ASP A 1 84  ? -20.257 2.420   -19.430 1.00 41.74  ? 80   ASP A OD1 1 
ATOM   312  O  OD2 . ASP A 1 84  ? -20.087 0.361   -20.154 1.00 45.82  ? 80   ASP A OD2 1 
ATOM   313  N  N   . LEU A 1 85  ? -25.425 1.905   -19.569 1.00 36.24  ? 81   LEU A N   1 
ATOM   314  C  CA  . LEU A 1 85  ? -26.787 2.217   -19.964 1.00 36.20  ? 81   LEU A CA  1 
ATOM   315  C  C   . LEU A 1 85  ? -27.237 3.521   -19.344 1.00 36.63  ? 81   LEU A C   1 
ATOM   316  O  O   . LEU A 1 85  ? -27.827 4.349   -20.020 1.00 38.24  ? 81   LEU A O   1 
ATOM   317  C  CB  . LEU A 1 85  ? -27.746 1.096   -19.558 1.00 38.31  ? 81   LEU A CB  1 
ATOM   318  C  CG  . LEU A 1 85  ? -27.642 -0.183  -20.398 1.00 37.45  ? 81   LEU A CG  1 
ATOM   319  C  CD1 . LEU A 1 85  ? -28.584 -1.256  -19.835 1.00 41.12  ? 81   LEU A CD1 1 
ATOM   320  C  CD2 . LEU A 1 85  ? -27.972 0.093   -21.870 1.00 38.55  ? 81   LEU A CD2 1 
ATOM   321  N  N   . LEU A 1 86  ? -26.977 3.684   -18.050 1.00 34.15  ? 82   LEU A N   1 
ATOM   322  C  CA  . LEU A 1 86  ? -27.342 4.907   -17.362 1.00 36.77  ? 82   LEU A CA  1 
ATOM   323  C  C   . LEU A 1 86  ? -26.624 6.107   -17.973 1.00 37.34  ? 82   LEU A C   1 
ATOM   324  O  O   . LEU A 1 86  ? -27.178 7.201   -18.039 1.00 38.12  ? 82   LEU A O   1 
ATOM   325  C  CB  . LEU A 1 86  ? -27.027 4.784   -15.873 1.00 34.13  ? 82   LEU A CB  1 
ATOM   326  C  CG  . LEU A 1 86  ? -28.038 3.911   -15.136 1.00 37.75  ? 82   LEU A CG  1 
ATOM   327  C  CD1 . LEU A 1 86  ? -27.580 3.603   -13.702 1.00 37.05  ? 82   LEU A CD1 1 
ATOM   328  C  CD2 . LEU A 1 86  ? -29.432 4.571   -15.169 1.00 38.12  ? 82   LEU A CD2 1 
ATOM   329  N  N   . LEU A 1 87  ? -25.393 5.905   -18.428 1.00 33.82  ? 83   LEU A N   1 
ATOM   330  C  CA  . LEU A 1 87  ? -24.651 6.975   -19.071 1.00 35.14  ? 83   LEU A CA  1 
ATOM   331  C  C   . LEU A 1 87  ? -25.325 7.404   -20.371 1.00 35.66  ? 83   LEU A C   1 
ATOM   332  O  O   . LEU A 1 87  ? -25.536 8.597   -20.609 1.00 35.89  ? 83   LEU A O   1 
ATOM   333  C  CB  . LEU A 1 87  ? -23.196 6.550   -19.338 1.00 34.04  ? 83   LEU A CB  1 
ATOM   334  C  CG  . LEU A 1 87  ? -22.282 7.633   -19.929 1.00 35.01  ? 83   LEU A CG  1 
ATOM   335  C  CD1 . LEU A 1 87  ? -21.901 8.708   -18.881 1.00 35.10  ? 83   LEU A CD1 1 
ATOM   336  C  CD2 . LEU A 1 87  ? -21.019 7.010   -20.544 1.00 37.00  ? 83   LEU A CD2 1 
ATOM   337  N  N   . ALA A 1 88  ? -25.675 6.431   -21.203 1.00 36.72  ? 84   ALA A N   1 
ATOM   338  C  CA  . ALA A 1 88  ? -26.345 6.702   -22.475 1.00 37.22  ? 84   ALA A CA  1 
ATOM   339  C  C   . ALA A 1 88  ? -27.712 7.369   -22.311 1.00 37.21  ? 84   ALA A C   1 
ATOM   340  O  O   . ALA A 1 88  ? -28.127 8.157   -23.164 1.00 38.70  ? 84   ALA A O   1 
ATOM   341  C  CB  . ALA A 1 88  ? -26.496 5.414   -23.275 1.00 36.78  ? 84   ALA A CB  1 
ATOM   342  N  N   . LEU A 1 89  ? -28.410 7.056   -21.227 1.00 37.06  ? 85   LEU A N   1 
ATOM   343  C  CA  . LEU A 1 89  ? -29.736 7.629   -20.987 1.00 40.36  ? 85   LEU A CA  1 
ATOM   344  C  C   . LEU A 1 89  ? -29.722 9.000   -20.304 1.00 42.34  ? 85   LEU A C   1 
ATOM   345  O  O   . LEU A 1 89  ? -30.546 9.865   -20.623 1.00 42.20  ? 85   LEU A O   1 
ATOM   346  C  CB  . LEU A 1 89  ? -30.565 6.665   -20.138 1.00 41.40  ? 85   LEU A CB  1 
ATOM   347  C  CG  . LEU A 1 89  ? -30.889 5.291   -20.725 1.00 40.53  ? 85   LEU A CG  1 
ATOM   348  C  CD1 . LEU A 1 89  ? -31.629 4.462   -19.687 1.00 40.37  ? 85   LEU A CD1 1 
ATOM   349  C  CD2 . LEU A 1 89  ? -31.712 5.434   -21.987 1.00 40.60  ? 85   LEU A CD2 1 
ATOM   350  N  N   . LEU A 1 90  ? -28.805 9.185   -19.356 1.00 39.15  ? 86   LEU A N   1 
ATOM   351  C  CA  . LEU A 1 90  ? -28.845 10.350  -18.474 1.00 39.97  ? 86   LEU A CA  1 
ATOM   352  C  C   . LEU A 1 90  ? -27.801 11.415  -18.781 1.00 40.61  ? 86   LEU A C   1 
ATOM   353  O  O   . LEU A 1 90  ? -27.985 12.566  -18.419 1.00 42.18  ? 86   LEU A O   1 
ATOM   354  C  CB  . LEU A 1 90  ? -28.672 9.915   -17.016 1.00 37.29  ? 86   LEU A CB  1 
ATOM   355  C  CG  . LEU A 1 90  ? -29.725 8.965   -16.435 1.00 38.70  ? 86   LEU A CG  1 
ATOM   356  C  CD1 . LEU A 1 90  ? -29.463 8.717   -14.962 1.00 40.26  ? 86   LEU A CD1 1 
ATOM   357  C  CD2 . LEU A 1 90  ? -31.134 9.507   -16.648 1.00 42.22  ? 86   LEU A CD2 1 
ATOM   358  N  N   . VAL A 1 91  ? -26.705 11.045  -19.431 1.00 37.77  ? 87   VAL A N   1 
ATOM   359  C  CA  . VAL A 1 91  ? -25.603 11.980  -19.624 1.00 37.60  ? 87   VAL A CA  1 
ATOM   360  C  C   . VAL A 1 91  ? -25.332 12.302  -21.089 1.00 39.83  ? 87   VAL A C   1 
ATOM   361  O  O   . VAL A 1 91  ? -25.240 13.486  -21.470 1.00 39.55  ? 87   VAL A O   1 
ATOM   362  C  CB  . VAL A 1 91  ? -24.304 11.432  -18.977 1.00 37.65  ? 87   VAL A CB  1 
ATOM   363  C  CG1 . VAL A 1 91  ? -23.097 12.316  -19.317 1.00 38.54  ? 87   VAL A CG1 1 
ATOM   364  C  CG2 . VAL A 1 91  ? -24.473 11.324  -17.476 1.00 37.39  ? 87   VAL A CG2 1 
ATOM   365  N  N   . LEU A 1 92  ? -25.180 11.262  -21.908 1.00 36.93  ? 88   LEU A N   1 
ATOM   366  C  CA  . LEU A 1 92  ? -24.820 11.461  -23.316 1.00 39.25  ? 88   LEU A CA  1 
ATOM   367  C  C   . LEU A 1 92  ? -25.765 12.363  -24.141 1.00 38.97  ? 88   LEU A C   1 
ATOM   368  O  O   . LEU A 1 92  ? -25.298 13.112  -25.000 1.00 41.41  ? 88   LEU A O   1 
ATOM   369  C  CB  . LEU A 1 92  ? -24.683 10.109  -24.013 1.00 38.14  ? 88   LEU A CB  1 
ATOM   370  C  CG  . LEU A 1 92  ? -23.576 9.212   -23.450 1.00 37.34  ? 88   LEU A CG  1 
ATOM   371  C  CD1 . LEU A 1 92  ? -23.354 8.006   -24.342 1.00 37.31  ? 88   LEU A CD1 1 
ATOM   372  C  CD2 . LEU A 1 92  ? -22.282 9.993   -23.257 1.00 37.95  ? 88   LEU A CD2 1 
ATOM   373  N  N   . PRO A 1 93  ? -27.091 12.285  -23.920 1.00 42.09  ? 89   PRO A N   1 
ATOM   374  C  CA  . PRO A 1 93  ? -27.922 13.169  -24.755 1.00 40.89  ? 89   PRO A CA  1 
ATOM   375  C  C   . PRO A 1 93  ? -27.609 14.667  -24.589 1.00 42.64  ? 89   PRO A C   1 
ATOM   376  O  O   . PRO A 1 93  ? -27.402 15.377  -25.581 1.00 41.99  ? 89   PRO A O   1 
ATOM   377  C  CB  . PRO A 1 93  ? -29.341 12.851  -24.280 1.00 40.83  ? 89   PRO A CB  1 
ATOM   378  C  CG  . PRO A 1 93  ? -29.262 11.429  -23.863 1.00 39.57  ? 89   PRO A CG  1 
ATOM   379  C  CD  . PRO A 1 93  ? -27.907 11.297  -23.196 1.00 38.05  ? 89   PRO A CD  1 
ATOM   380  N  N   . LEU A 1 94  ? -27.561 15.136  -23.350 1.00 42.65  ? 90   LEU A N   1 
ATOM   381  C  CA  . LEU A 1 94  ? -27.254 16.533  -23.093 1.00 42.93  ? 90   LEU A CA  1 
ATOM   382  C  C   . LEU A 1 94  ? -25.788 16.825  -23.391 1.00 41.76  ? 90   LEU A C   1 
ATOM   383  O  O   . LEU A 1 94  ? -25.431 17.949  -23.734 1.00 43.38  ? 90   LEU A O   1 
ATOM   384  C  CB  . LEU A 1 94  ? -27.611 16.894  -21.654 1.00 44.79  ? 90   LEU A CB  1 
ATOM   385  C  CG  . LEU A 1 94  ? -29.113 17.179  -21.525 1.00 45.46  ? 90   LEU A CG  1 
ATOM   386  C  CD1 . LEU A 1 94  ? -29.517 17.408  -20.093 1.00 50.17  ? 90   LEU A CD1 1 
ATOM   387  C  CD2 . LEU A 1 94  ? -29.481 18.389  -22.363 1.00 43.58  ? 90   LEU A CD2 1 
ATOM   388  N  N   . PHE A 1 95  ? -24.936 15.810  -23.296 1.00 43.25  ? 91   PHE A N   1 
ATOM   389  C  CA  . PHE A 1 95  ? -23.563 15.998  -23.741 1.00 41.21  ? 91   PHE A CA  1 
ATOM   390  C  C   . PHE A 1 95  ? -23.500 16.249  -25.245 1.00 42.76  ? 91   PHE A C   1 
ATOM   391  O  O   . PHE A 1 95  ? -22.838 17.189  -25.702 1.00 43.15  ? 91   PHE A O   1 
ATOM   392  C  CB  . PHE A 1 95  ? -22.693 14.790  -23.392 1.00 42.83  ? 91   PHE A CB  1 
ATOM   393  C  CG  . PHE A 1 95  ? -21.383 14.788  -24.095 1.00 40.57  ? 91   PHE A CG  1 
ATOM   394  C  CD1 . PHE A 1 95  ? -20.420 15.731  -23.782 1.00 42.38  ? 91   PHE A CD1 1 
ATOM   395  C  CD2 . PHE A 1 95  ? -21.115 13.852  -25.078 1.00 40.75  ? 91   PHE A CD2 1 
ATOM   396  C  CE1 . PHE A 1 95  ? -19.195 15.738  -24.437 1.00 43.49  ? 91   PHE A CE1 1 
ATOM   397  C  CE2 . PHE A 1 95  ? -19.900 13.840  -25.732 1.00 40.76  ? 91   PHE A CE2 1 
ATOM   398  C  CZ  . PHE A 1 95  ? -18.933 14.788  -25.414 1.00 42.96  ? 91   PHE A CZ  1 
ATOM   399  N  N   . VAL A 1 96  ? -24.191 15.413  -26.012 1.00 42.21  ? 92   VAL A N   1 
ATOM   400  C  CA  . VAL A 1 96  ? -24.235 15.586  -27.463 1.00 43.12  ? 92   VAL A CA  1 
ATOM   401  C  C   . VAL A 1 96  ? -24.856 16.935  -27.851 1.00 48.31  ? 92   VAL A C   1 
ATOM   402  O  O   . VAL A 1 96  ? -24.342 17.642  -28.724 1.00 47.43  ? 92   VAL A O   1 
ATOM   403  C  CB  . VAL A 1 96  ? -25.015 14.443  -28.138 1.00 45.23  ? 92   VAL A CB  1 
ATOM   404  C  CG1 . VAL A 1 96  ? -25.256 14.743  -29.618 1.00 45.50  ? 92   VAL A CG1 1 
ATOM   405  C  CG2 . VAL A 1 96  ? -24.249 13.152  -27.979 1.00 43.68  ? 92   VAL A CG2 1 
ATOM   406  N  N   . TYR A 1 97  ? -25.955 17.286  -27.187 1.00 48.32  ? 93   TYR A N   1 
ATOM   407  C  CA  . TYR A 1 97  ? -26.600 18.566  -27.410 1.00 50.03  ? 93   TYR A CA  1 
ATOM   408  C  C   . TYR A 1 97  ? -25.623 19.712  -27.184 1.00 48.25  ? 93   TYR A C   1 
ATOM   409  O  O   . TYR A 1 97  ? -25.566 20.665  -27.967 1.00 50.36  ? 93   TYR A O   1 
ATOM   410  C  CB  . TYR A 1 97  ? -27.804 18.720  -26.491 1.00 51.62  ? 93   TYR A CB  1 
ATOM   411  C  CG  . TYR A 1 97  ? -28.481 20.048  -26.653 1.00 53.11  ? 93   TYR A CG  1 
ATOM   412  C  CD1 . TYR A 1 97  ? -29.307 20.291  -27.734 1.00 52.66  ? 93   TYR A CD1 1 
ATOM   413  C  CD2 . TYR A 1 97  ? -28.285 21.065  -25.730 1.00 55.01  ? 93   TYR A CD2 1 
ATOM   414  C  CE1 . TYR A 1 97  ? -29.924 21.505  -27.891 1.00 57.07  ? 93   TYR A CE1 1 
ATOM   415  C  CE2 . TYR A 1 97  ? -28.900 22.280  -25.879 1.00 55.52  ? 93   TYR A CE2 1 
ATOM   416  C  CZ  . TYR A 1 97  ? -29.716 22.497  -26.960 1.00 59.13  ? 93   TYR A CZ  1 
ATOM   417  O  OH  . TYR A 1 97  ? -30.339 23.714  -27.107 1.00 66.85  ? 93   TYR A OH  1 
ATOM   418  N  N   . SER A 1 98  ? -24.871 19.613  -26.096 1.00 49.18  ? 94   SER A N   1 
ATOM   419  C  CA  . SER A 1 98  ? -23.864 20.596  -25.757 1.00 52.06  ? 94   SER A CA  1 
ATOM   420  C  C   . SER A 1 98  ? -22.849 20.734  -26.883 1.00 50.56  ? 94   SER A C   1 
ATOM   421  O  O   . SER A 1 98  ? -22.549 21.844  -27.321 1.00 53.22  ? 94   SER A O   1 
ATOM   422  C  CB  . SER A 1 98  ? -23.170 20.209  -24.452 1.00 53.95  ? 94   SER A CB  1 
ATOM   423  O  OG  . SER A 1 98  ? -22.422 21.289  -23.932 1.00 59.31  ? 94   SER A OG  1 
ATOM   424  N  N   . GLU A 1 99  ? -22.343 19.598  -27.357 1.00 53.79  ? 95   GLU A N   1 
ATOM   425  C  CA  . GLU A 1 99  ? -21.345 19.551  -28.426 1.00 52.10  ? 95   GLU A CA  1 
ATOM   426  C  C   . GLU A 1 99  ? -21.857 20.129  -29.751 1.00 53.69  ? 95   GLU A C   1 
ATOM   427  O  O   . GLU A 1 99  ? -21.112 20.776  -30.489 1.00 53.62  ? 95   GLU A O   1 
ATOM   428  C  CB  . GLU A 1 99  ? -20.876 18.109  -28.626 1.00 49.88  ? 95   GLU A CB  1 
ATOM   429  C  CG  . GLU A 1 99  ? -20.062 17.588  -27.449 1.00 50.64  ? 95   GLU A CG  1 
ATOM   430  C  CD  . GLU A 1 99  ? -18.712 18.276  -27.355 1.00 54.31  ? 95   GLU A CD  1 
ATOM   431  O  OE1 . GLU A 1 99  ? -17.836 17.984  -28.203 1.00 54.62  ? 95   GLU A OE1 1 
ATOM   432  O  OE2 . GLU A 1 99  ? -18.543 19.148  -26.474 1.00 56.03  ? 95   GLU A OE2 1 
ATOM   433  N  N   . VAL A 1 100 ? -23.129 19.893  -30.052 1.00 52.20  ? 96   VAL A N   1 
ATOM   434  C  CA  . VAL A 1 100 ? -23.743 20.490  -31.232 1.00 53.35  ? 96   VAL A CA  1 
ATOM   435  C  C   . VAL A 1 100 ? -23.808 22.013  -31.073 1.00 56.34  ? 96   VAL A C   1 
ATOM   436  O  O   . VAL A 1 100 ? -23.647 22.748  -32.039 1.00 59.23  ? 96   VAL A O   1 
ATOM   437  C  CB  . VAL A 1 100 ? -25.150 19.917  -31.486 1.00 52.81  ? 96   VAL A CB  1 
ATOM   438  C  CG1 . VAL A 1 100 ? -25.846 20.658  -32.628 1.00 56.17  ? 96   VAL A CG1 1 
ATOM   439  C  CG2 . VAL A 1 100 ? -25.067 18.427  -31.778 1.00 50.71  ? 96   VAL A CG2 1 
ATOM   440  N  N   . GLN A 1 101 ? -24.009 22.483  -29.845 1.00 57.45  ? 97   GLN A N   1 
ATOM   441  C  CA  . GLN A 1 101 ? -24.033 23.918  -29.557 1.00 57.09  ? 97   GLN A CA  1 
ATOM   442  C  C   . GLN A 1 101 ? -22.624 24.461  -29.311 1.00 54.51  ? 97   GLN A C   1 
ATOM   443  O  O   . GLN A 1 101 ? -22.451 25.527  -28.708 1.00 54.97  ? 97   GLN A O   1 
ATOM   444  C  CB  . GLN A 1 101 ? -24.928 24.212  -28.348 1.00 65.05  ? 97   GLN A CB  1 
ATOM   445  N  N   . GLY A 1 102 ? -21.623 23.716  -29.773 1.00 57.65  ? 98   GLY A N   1 
ATOM   446  C  CA  . GLY A 1 102 ? -20.237 24.145  -29.699 1.00 60.96  ? 98   GLY A CA  1 
ATOM   447  C  C   . GLY A 1 102 ? -19.668 24.226  -28.292 1.00 62.20  ? 98   GLY A C   1 
ATOM   448  O  O   . GLY A 1 102 ? -18.771 25.029  -28.030 1.00 62.16  ? 98   GLY A O   1 
ATOM   449  N  N   . GLY A 1 103 ? -20.183 23.397  -27.389 1.00 61.56  ? 99   GLY A N   1 
ATOM   450  C  CA  . GLY A 1 103 ? -19.719 23.385  -26.012 1.00 58.89  ? 99   GLY A CA  1 
ATOM   451  C  C   . GLY A 1 103 ? -20.507 24.302  -25.092 1.00 58.62  ? 99   GLY A C   1 
ATOM   452  O  O   . GLY A 1 103 ? -20.343 24.260  -23.873 1.00 60.67  ? 99   GLY A O   1 
ATOM   453  N  N   . ALA A 1 104 ? -21.366 25.137  -25.668 1.00 58.68  ? 100  ALA A N   1 
ATOM   454  C  CA  . ALA A 1 104 ? -22.148 26.075  -24.869 1.00 60.57  ? 100  ALA A CA  1 
ATOM   455  C  C   . ALA A 1 104 ? -23.181 25.332  -24.033 1.00 58.49  ? 100  ALA A C   1 
ATOM   456  O  O   . ALA A 1 104 ? -23.663 24.270  -24.426 1.00 57.71  ? 100  ALA A O   1 
ATOM   457  C  CB  . ALA A 1 104 ? -22.824 27.105  -25.755 1.00 62.73  ? 100  ALA A CB  1 
ATOM   458  N  N   . TRP A 1 105 ? -23.495 25.895  -22.870 1.00 54.64  ? 101  TRP A N   1 
ATOM   459  C  CA  . TRP A 1 105 ? -24.527 25.363  -21.987 1.00 53.05  ? 101  TRP A CA  1 
ATOM   460  C  C   . TRP A 1 105 ? -25.572 26.447  -21.776 1.00 56.16  ? 101  TRP A C   1 
ATOM   461  O  O   . TRP A 1 105 ? -25.292 27.505  -21.194 1.00 56.71  ? 101  TRP A O   1 
ATOM   462  C  CB  . TRP A 1 105 ? -23.939 24.906  -20.655 1.00 49.63  ? 101  TRP A CB  1 
ATOM   463  C  CG  . TRP A 1 105 ? -24.961 24.357  -19.715 1.00 49.85  ? 101  TRP A CG  1 
ATOM   464  C  CD1 . TRP A 1 105 ? -25.519 24.985  -18.639 1.00 51.02  ? 101  TRP A CD1 1 
ATOM   465  C  CD2 . TRP A 1 105 ? -25.559 23.061  -19.777 1.00 51.13  ? 101  TRP A CD2 1 
ATOM   466  N  NE1 . TRP A 1 105 ? -26.414 24.150  -18.017 1.00 51.91  ? 101  TRP A NE1 1 
ATOM   467  C  CE2 . TRP A 1 105 ? -26.455 22.961  -18.696 1.00 52.21  ? 101  TRP A CE2 1 
ATOM   468  C  CE3 . TRP A 1 105 ? -25.409 21.964  -20.631 1.00 52.61  ? 101  TRP A CE3 1 
ATOM   469  C  CZ2 . TRP A 1 105 ? -27.203 21.814  -18.453 1.00 50.81  ? 101  TRP A CZ2 1 
ATOM   470  C  CZ3 . TRP A 1 105 ? -26.155 20.829  -20.386 1.00 49.81  ? 101  TRP A CZ3 1 
ATOM   471  C  CH2 . TRP A 1 105 ? -27.044 20.768  -19.310 1.00 50.30  ? 101  TRP A CH2 1 
ATOM   472  N  N   . LEU A 1 106 ? -26.774 26.196  -22.272 1.00 55.83  ? 102  LEU A N   1 
ATOM   473  C  CA  . LEU A 1 106 ? -27.784 27.236  -22.302 1.00 57.51  ? 102  LEU A CA  1 
ATOM   474  C  C   . LEU A 1 106 ? -28.873 26.985  -21.265 1.00 59.39  ? 102  LEU A C   1 
ATOM   475  O  O   . LEU A 1 106 ? -29.809 27.773  -21.132 1.00 61.05  ? 102  LEU A O   1 
ATOM   476  C  CB  . LEU A 1 106 ? -28.385 27.335  -23.707 1.00 58.64  ? 102  LEU A CB  1 
ATOM   477  N  N   . LEU A 1 107 ? -28.736 25.890  -20.526 1.00 56.37  ? 103  LEU A N   1 
ATOM   478  C  CA  . LEU A 1 107 ? -29.730 25.500  -19.535 1.00 54.38  ? 103  LEU A CA  1 
ATOM   479  C  C   . LEU A 1 107 ? -29.279 25.928  -18.135 1.00 55.35  ? 103  LEU A C   1 
ATOM   480  O  O   . LEU A 1 107 ? -28.288 26.638  -17.994 1.00 54.37  ? 103  LEU A O   1 
ATOM   481  C  CB  . LEU A 1 107 ? -29.978 23.992  -19.616 1.00 53.30  ? 103  LEU A CB  1 
ATOM   482  C  CG  . LEU A 1 107 ? -30.281 23.506  -21.042 1.00 52.46  ? 103  LEU A CG  1 
ATOM   483  C  CD1 . LEU A 1 107 ? -30.503 22.013  -21.070 1.00 54.52  ? 103  LEU A CD1 1 
ATOM   484  C  CD2 . LEU A 1 107 ? -31.481 24.245  -21.648 1.00 53.94  ? 103  LEU A CD2 1 
ATOM   485  N  N   . SER A 1 108 ? -30.002 25.516  -17.102 1.00 52.95  ? 104  SER A N   1 
ATOM   486  C  CA  . SER A 1 108 ? -29.753 26.062  -15.772 1.00 51.68  ? 104  SER A CA  1 
ATOM   487  C  C   . SER A 1 108 ? -28.478 25.506  -15.156 1.00 48.90  ? 104  SER A C   1 
ATOM   488  O  O   . SER A 1 108 ? -28.049 24.412  -15.500 1.00 48.83  ? 104  SER A O   1 
ATOM   489  C  CB  . SER A 1 108 ? -30.944 25.794  -14.851 1.00 53.11  ? 104  SER A CB  1 
ATOM   490  O  OG  . SER A 1 108 ? -30.951 24.459  -14.406 1.00 51.52  ? 104  SER A OG  1 
ATOM   491  N  N   . PRO A 1 109 ? -27.846 26.285  -14.264 1.00 50.80  ? 105  PRO A N   1 
ATOM   492  C  CA  . PRO A 1 109 ? -26.653 25.804  -13.568 1.00 48.81  ? 105  PRO A CA  1 
ATOM   493  C  C   . PRO A 1 109 ? -26.955 24.647  -12.628 1.00 49.18  ? 105  PRO A C   1 
ATOM   494  O  O   . PRO A 1 109 ? -26.073 23.807  -12.425 1.00 48.28  ? 105  PRO A O   1 
ATOM   495  C  CB  . PRO A 1 109 ? -26.172 27.036  -12.798 1.00 51.85  ? 105  PRO A CB  1 
ATOM   496  C  CG  . PRO A 1 109 ? -27.352 27.905  -12.681 1.00 51.81  ? 105  PRO A CG  1 
ATOM   497  C  CD  . PRO A 1 109 ? -28.156 27.682  -13.921 1.00 52.50  ? 105  PRO A CD  1 
ATOM   498  N  N   . ARG A 1 110 ? -28.168 24.576  -12.082 1.00 46.24  ? 106  ARG A N   1 
ATOM   499  C  CA  . ARG A 1 110 ? -28.529 23.450  -11.213 1.00 45.70  ? 106  ARG A CA  1 
ATOM   500  C  C   . ARG A 1 110 ? -28.647 22.146  -12.016 1.00 45.00  ? 106  ARG A C   1 
ATOM   501  O  O   . ARG A 1 110 ? -28.300 21.061  -11.524 1.00 45.08  ? 106  ARG A O   1 
ATOM   502  C  CB  . ARG A 1 110 ? -29.841 23.723  -10.455 1.00 48.99  ? 106  ARG A CB  1 
ATOM   503  C  CG  . ARG A 1 110 ? -29.733 24.724  -9.286  1.00 57.03  ? 106  ARG A CG  1 
ATOM   504  C  CD  . ARG A 1 110 ? -28.470 24.486  -8.439  1.00 62.39  ? 106  ARG A CD  1 
ATOM   505  N  NE  . ARG A 1 110 ? -28.398 23.108  -7.957  1.00 66.07  ? 106  ARG A NE  1 
ATOM   506  C  CZ  . ARG A 1 110 ? -27.363 22.575  -7.307  1.00 63.02  ? 106  ARG A CZ  1 
ATOM   507  N  NH1 . ARG A 1 110 ? -26.273 23.285  -7.039  1.00 66.22  ? 106  ARG A NH1 1 
ATOM   508  N  NH2 . ARG A 1 110 ? -27.422 21.312  -6.922  1.00 50.23  ? 106  ARG A NH2 1 
ATOM   509  N  N   . LEU A 1 111 ? -29.146 22.237  -13.246 1.00 44.45  ? 107  LEU A N   1 
ATOM   510  C  CA  . LEU A 1 111 ? -29.180 21.046  -14.094 1.00 43.90  ? 107  LEU A CA  1 
ATOM   511  C  C   . LEU A 1 111 ? -27.749 20.630  -14.438 1.00 43.34  ? 107  LEU A C   1 
ATOM   512  O  O   . LEU A 1 111 ? -27.427 19.450  -14.435 1.00 41.34  ? 107  LEU A O   1 
ATOM   513  C  CB  . LEU A 1 111 ? -29.976 21.287  -15.365 1.00 43.03  ? 107  LEU A CB  1 
ATOM   514  C  CG  . LEU A 1 111 ? -30.081 20.124  -16.354 1.00 41.95  ? 107  LEU A CG  1 
ATOM   515  C  CD1 . LEU A 1 111 ? -30.688 18.898  -15.705 1.00 41.60  ? 107  LEU A CD1 1 
ATOM   516  C  CD2 . LEU A 1 111 ? -30.880 20.534  -17.582 1.00 44.64  ? 107  LEU A CD2 1 
ATOM   517  N  N   . CYS A 1 112 ? -26.900 21.610  -14.740 1.00 42.54  ? 108  CYS A N   1 
ATOM   518  C  CA  . CYS A 1 112 ? -25.482 21.318  -14.973 1.00 41.10  ? 108  CYS A CA  1 
ATOM   519  C  C   . CYS A 1 112 ? -24.869 20.576  -13.797 1.00 41.40  ? 108  CYS A C   1 
ATOM   520  O  O   . CYS A 1 112 ? -24.211 19.542  -13.987 1.00 41.70  ? 108  CYS A O   1 
ATOM   521  C  CB  . CYS A 1 112 ? -24.690 22.602  -15.251 1.00 42.18  ? 108  CYS A CB  1 
ATOM   522  S  SG  . CYS A 1 112 ? -22.918 22.257  -15.424 1.00 45.58  ? 108  CYS A SG  1 
ATOM   523  N  N   . ASP A 1 113 ? -25.093 21.077  -12.582 1.00 41.66  ? 109  ASP A N   1 
ATOM   524  C  CA  . ASP A 1 113 ? -24.598 20.386  -11.375 1.00 40.39  ? 109  ASP A CA  1 
ATOM   525  C  C   . ASP A 1 113 ? -25.104 18.934  -11.278 1.00 42.07  ? 109  ASP A C   1 
ATOM   526  O  O   . ASP A 1 113 ? -24.340 18.013  -10.941 1.00 39.45  ? 109  ASP A O   1 
ATOM   527  C  CB  . ASP A 1 113 ? -25.000 21.133  -10.104 1.00 43.42  ? 109  ASP A CB  1 
ATOM   528  C  CG  . ASP A 1 113 ? -24.294 22.483  -9.953  1.00 45.65  ? 109  ASP A CG  1 
ATOM   529  O  OD1 . ASP A 1 113 ? -23.179 22.659  -10.478 1.00 45.09  ? 109  ASP A OD1 1 
ATOM   530  O  OD2 . ASP A 1 113 ? -24.858 23.369  -9.284  1.00 46.15  ? 109  ASP A OD2 1 
ATOM   531  N  N   . ALA A 1 114 ? -26.394 18.742  -11.545 1.00 38.42  ? 110  ALA A N   1 
ATOM   532  C  CA  . ALA A 1 114 ? -26.976 17.401  -11.586 1.00 37.94  ? 110  ALA A CA  1 
ATOM   533  C  C   . ALA A 1 114 ? -26.263 16.498  -12.600 1.00 37.32  ? 110  ALA A C   1 
ATOM   534  O  O   . ALA A 1 114 ? -25.889 15.358  -12.286 1.00 37.83  ? 110  ALA A O   1 
ATOM   535  C  CB  . ALA A 1 114 ? -28.467 17.492  -11.907 1.00 37.52  ? 110  ALA A CB  1 
ATOM   536  N  N   . LEU A 1 115 ? -26.058 17.015  -13.805 1.00 38.64  ? 111  LEU A N   1 
ATOM   537  C  CA  . LEU A 1 115 ? -25.434 16.246  -14.873 1.00 37.89  ? 111  LEU A CA  1 
ATOM   538  C  C   . LEU A 1 115 ? -24.009 15.854  -14.540 1.00 37.73  ? 111  LEU A C   1 
ATOM   539  O  O   . LEU A 1 115 ? -23.599 14.721  -14.780 1.00 36.72  ? 111  LEU A O   1 
ATOM   540  C  CB  . LEU A 1 115 ? -25.432 17.040  -16.168 1.00 38.07  ? 111  LEU A CB  1 
ATOM   541  C  CG  . LEU A 1 115 ? -26.607 16.753  -17.091 1.00 46.20  ? 111  LEU A CG  1 
ATOM   542  C  CD1 . LEU A 1 115 ? -26.539 17.728  -18.239 1.00 44.90  ? 111  LEU A CD1 1 
ATOM   543  C  CD2 . LEU A 1 115 ? -26.546 15.321  -17.599 1.00 42.51  ? 111  LEU A CD2 1 
ATOM   544  N  N   . MET A 1 116 ? -23.263 16.811  -14.001 1.00 36.14  ? 112  MET A N   1 
ATOM   545  C  CA  . MET A 1 116 ? -21.875 16.578  -13.654 1.00 36.96  ? 112  MET A CA  1 
ATOM   546  C  C   . MET A 1 116 ? -21.753 15.557  -12.519 1.00 37.33  ? 112  MET A C   1 
ATOM   547  O  O   . MET A 1 116 ? -20.844 14.721  -12.539 1.00 36.53  ? 112  MET A O   1 
ATOM   548  C  CB  . MET A 1 116 ? -21.196 17.889  -13.282 1.00 35.97  ? 112  MET A CB  1 
ATOM   549  C  CG  . MET A 1 116 ? -21.055 18.819  -14.473 1.00 37.05  ? 112  MET A CG  1 
ATOM   550  S  SD  . MET A 1 116 ? -19.992 20.244  -14.191 1.00 40.27  ? 112  MET A SD  1 
ATOM   551  C  CE  . MET A 1 116 ? -20.727 21.003  -12.734 1.00 41.71  ? 112  MET A CE  1 
ATOM   552  N  N   . ALA A 1 117 ? -22.651 15.616  -11.534 1.00 32.05  ? 113  ALA A N   1 
ATOM   553  C  CA  . ALA A 1 117 ? -22.602 14.641  -10.445 1.00 31.50  ? 113  ALA A CA  1 
ATOM   554  C  C   . ALA A 1 117 ? -22.827 13.225  -10.992 1.00 32.41  ? 113  ALA A C   1 
ATOM   555  O  O   . ALA A 1 117 ? -22.138 12.270  -10.599 1.00 31.96  ? 113  ALA A O   1 
ATOM   556  C  CB  . ALA A 1 117 ? -23.617 14.969  -9.377  1.00 32.88  ? 113  ALA A CB  1 
ATOM   557  N  N   . MET A 1 118 ? -23.786 13.094  -11.899 1.00 37.52  ? 114  MET A N   1 
ATOM   558  C  CA  . MET A 1 118 ? -24.052 11.805  -12.547 1.00 36.01  ? 114  MET A CA  1 
ATOM   559  C  C   . MET A 1 118 ? -22.854 11.343  -13.376 1.00 35.10  ? 114  MET A C   1 
ATOM   560  O  O   . MET A 1 118 ? -22.445 10.182  -13.310 1.00 36.72  ? 114  MET A O   1 
ATOM   561  C  CB  . MET A 1 118 ? -25.299 11.900  -13.428 1.00 35.71  ? 114  MET A CB  1 
ATOM   562  C  CG  . MET A 1 118 ? -25.745 10.564  -14.002 1.00 38.77  ? 114  MET A CG  1 
ATOM   563  S  SD  . MET A 1 118 ? -26.203 9.372   -12.711 1.00 48.67  ? 114  MET A SD  1 
ATOM   564  C  CE  . MET A 1 118 ? -27.605 10.202  -11.971 1.00 52.91  ? 114  MET A CE  1 
ATOM   565  N  N   . ASP A 1 119 ? -22.310 12.261  -14.164 1.00 35.08  ? 115  ASP A N   1 
ATOM   566  C  CA  . ASP A 1 119 ? -21.098 12.030  -14.944 1.00 34.14  ? 115  ASP A CA  1 
ATOM   567  C  C   . ASP A 1 119 ? -19.996 11.443  -14.057 1.00 35.80  ? 115  ASP A C   1 
ATOM   568  O  O   . ASP A 1 119 ? -19.447 10.378  -14.347 1.00 32.84  ? 115  ASP A O   1 
ATOM   569  C  CB  . ASP A 1 119 ? -20.649 13.357  -15.567 1.00 33.12  ? 115  ASP A CB  1 
ATOM   570  C  CG  . ASP A 1 119 ? -19.841 13.196  -16.848 1.00 36.74  ? 115  ASP A CG  1 
ATOM   571  O  OD1 . ASP A 1 119 ? -19.953 12.162  -17.536 1.00 36.29  ? 115  ASP A OD1 1 
ATOM   572  O  OD2 . ASP A 1 119 ? -19.082 14.142  -17.175 1.00 37.90  ? 115  ASP A OD2 1 
ATOM   573  N  N   . VAL A 1 120 ? -19.688 12.133  -12.963 1.00 31.28  ? 116  VAL A N   1 
ATOM   574  C  CA  . VAL A 1 120 ? -18.626 11.683  -12.064 1.00 31.10  ? 116  VAL A CA  1 
ATOM   575  C  C   . VAL A 1 120 ? -18.982 10.322  -11.452 1.00 30.33  ? 116  VAL A C   1 
ATOM   576  O  O   . VAL A 1 120 ? -18.138 9.421   -11.368 1.00 28.95  ? 116  VAL A O   1 
ATOM   577  C  CB  . VAL A 1 120 ? -18.364 12.707  -10.940 1.00 32.21  ? 116  VAL A CB  1 
ATOM   578  C  CG1 . VAL A 1 120 ? -17.444 12.100  -9.875  1.00 32.26  ? 116  VAL A CG1 1 
ATOM   579  C  CG2 . VAL A 1 120 ? -17.754 13.970  -11.523 1.00 30.65  ? 116  VAL A CG2 1 
ATOM   580  N  N   . MET A 1 121 ? -20.231 10.162  -11.036 1.00 34.01  ? 117  MET A N   1 
ATOM   581  C  CA  . MET A 1 121 ? -20.619 8.923   -10.370 1.00 33.52  ? 117  MET A CA  1 
ATOM   582  C  C   . MET A 1 121 ? -20.507 7.712   -11.300 1.00 32.08  ? 117  MET A C   1 
ATOM   583  O  O   . MET A 1 121 ? -20.047 6.641   -10.884 1.00 31.62  ? 117  MET A O   1 
ATOM   584  C  CB  . MET A 1 121 ? -22.053 9.007   -9.820  1.00 32.53  ? 117  MET A CB  1 
ATOM   585  C  CG  . MET A 1 121 ? -22.434 7.758   -8.985  1.00 34.58  ? 117  MET A CG  1 
ATOM   586  S  SD  . MET A 1 121 ? -24.118 7.825   -8.387  1.00 39.63  ? 117  MET A SD  1 
ATOM   587  C  CE  . MET A 1 121 ? -24.979 7.723   -9.956  1.00 43.35  ? 117  MET A CE  1 
ATOM   588  N  N   . LEU A 1 122 ? -20.954 7.863   -12.543 1.00 32.60  ? 118  LEU A N   1 
ATOM   589  C  CA  . LEU A 1 122 ? -21.043 6.712   -13.446 1.00 30.80  ? 118  LEU A CA  1 
ATOM   590  C  C   . LEU A 1 122 ? -19.651 6.305   -13.917 1.00 32.71  ? 118  LEU A C   1 
ATOM   591  O  O   . LEU A 1 122 ? -19.353 5.114   -14.077 1.00 33.43  ? 118  LEU A O   1 
ATOM   592  C  CB  . LEU A 1 122 ? -21.949 7.015   -14.643 1.00 30.83  ? 118  LEU A CB  1 
ATOM   593  C  CG  . LEU A 1 122 ? -23.450 7.168   -14.325 1.00 32.57  ? 118  LEU A CG  1 
ATOM   594  C  CD1 . LEU A 1 122 ? -24.242 7.610   -15.551 1.00 34.16  ? 118  LEU A CD1 1 
ATOM   595  C  CD2 . LEU A 1 122 ? -24.008 5.865   -13.762 1.00 33.96  ? 118  LEU A CD2 1 
ATOM   596  N  N   . CYS A 1 123 ? -18.797 7.295   -14.127 1.00 34.02  ? 119  CYS A N   1 
ATOM   597  C  CA  . CYS A 1 123 ? -17.404 7.022   -14.460 1.00 33.03  ? 119  CYS A CA  1 
ATOM   598  C  C   . CYS A 1 123 ? -16.737 6.297   -13.295 1.00 32.15  ? 119  CYS A C   1 
ATOM   599  O  O   . CYS A 1 123 ? -16.070 5.276   -13.473 1.00 32.21  ? 119  CYS A O   1 
ATOM   600  C  CB  . CYS A 1 123 ? -16.667 8.327   -14.789 1.00 33.15  ? 119  CYS A CB  1 
ATOM   601  S  SG  . CYS A 1 123 ? -14.939 8.074   -15.260 1.00 34.65  ? 119  CYS A SG  1 
ATOM   602  N  N   . THR A 1 124 ? -16.932 6.821   -12.095 1.00 28.45  ? 120  THR A N   1 
ATOM   603  C  CA  . THR A 1 124 ? -16.359 6.228   -10.901 1.00 30.11  ? 120  THR A CA  1 
ATOM   604  C  C   . THR A 1 124 ? -16.911 4.814   -10.650 1.00 30.65  ? 120  THR A C   1 
ATOM   605  O  O   . THR A 1 124 ? -16.152 3.893   -10.318 1.00 29.16  ? 120  THR A O   1 
ATOM   606  C  CB  . THR A 1 124 ? -16.607 7.131   -9.688  1.00 31.30  ? 120  THR A CB  1 
ATOM   607  O  OG1 . THR A 1 124 ? -16.029 8.432   -9.953  1.00 31.34  ? 120  THR A OG1 1 
ATOM   608  C  CG2 . THR A 1 124 ? -15.968 6.542   -8.447  1.00 30.98  ? 120  THR A CG2 1 
ATOM   609  N  N   . ALA A 1 125 ? -18.214 4.633   -10.844 1.00 31.24  ? 121  ALA A N   1 
ATOM   610  C  CA  . ALA A 1 125 ? -18.814 3.322   -10.644 1.00 32.16  ? 121  ALA A CA  1 
ATOM   611  C  C   . ALA A 1 125 ? -18.180 2.273   -11.570 1.00 31.93  ? 121  ALA A C   1 
ATOM   612  O  O   . ALA A 1 125 ? -17.951 1.126   -11.162 1.00 30.65  ? 121  ALA A O   1 
ATOM   613  C  CB  . ALA A 1 125 ? -20.354 3.390   -10.854 1.00 31.90  ? 121  ALA A CB  1 
ATOM   614  N  N   . SER A 1 126 ? -17.895 2.660   -12.806 1.00 33.15  ? 122  SER A N   1 
ATOM   615  C  CA  . SER A 1 126 ? -17.322 1.721   -13.754 1.00 33.89  ? 122  SER A CA  1 
ATOM   616  C  C   . SER A 1 126 ? -15.972 1.245   -13.253 1.00 33.55  ? 122  SER A C   1 
ATOM   617  O  O   . SER A 1 126 ? -15.707 0.035   -13.210 1.00 33.21  ? 122  SER A O   1 
ATOM   618  C  CB  . SER A 1 126 ? -17.197 2.351   -15.139 1.00 33.86  ? 122  SER A CB  1 
ATOM   619  O  OG  . SER A 1 126 ? -18.496 2.595   -15.675 1.00 36.83  ? 122  SER A OG  1 
ATOM   620  N  N   . ILE A 1 127 ? -15.143 2.203   -12.853 1.00 32.06  ? 123  ILE A N   1 
ATOM   621  C  CA  . ILE A 1 127 ? -13.809 1.903   -12.343 1.00 31.73  ? 123  ILE A CA  1 
ATOM   622  C  C   . ILE A 1 127 ? -13.875 1.090   -11.067 1.00 33.05  ? 123  ILE A C   1 
ATOM   623  O  O   . ILE A 1 127 ? -13.147 0.102   -10.922 1.00 32.91  ? 123  ILE A O   1 
ATOM   624  C  CB  . ILE A 1 127 ? -12.989 3.198   -12.083 1.00 32.09  ? 123  ILE A CB  1 
ATOM   625  C  CG1 . ILE A 1 127 ? -13.149 4.127   -13.280 1.00 36.35  ? 123  ILE A CG1 1 
ATOM   626  C  CG2 . ILE A 1 127 ? -11.531 2.839   -11.835 1.00 33.41  ? 123  ILE A CG2 1 
ATOM   627  C  CD1 . ILE A 1 127 ? -12.536 5.525   -13.203 1.00 37.41  ? 123  ILE A CD1 1 
ATOM   628  N  N   . PHE A 1 128 ? -14.740 1.492   -10.141 1.00 29.09  ? 124  PHE A N   1 
ATOM   629  C  CA  . PHE A 1 128 ? -14.852 0.792   -8.870  1.00 29.97  ? 124  PHE A CA  1 
ATOM   630  C  C   . PHE A 1 128 ? -15.362 -0.642  -9.095  1.00 31.33  ? 124  PHE A C   1 
ATOM   631  O  O   . PHE A 1 128 ? -14.974 -1.559  -8.361  1.00 32.19  ? 124  PHE A O   1 
ATOM   632  C  CB  . PHE A 1 128 ? -15.763 1.534   -7.880  1.00 30.41  ? 124  PHE A CB  1 
ATOM   633  C  CG  . PHE A 1 128 ? -15.117 2.751   -7.235  1.00 32.28  ? 124  PHE A CG  1 
ATOM   634  C  CD1 . PHE A 1 128 ? -13.853 3.177   -7.618  1.00 29.80  ? 124  PHE A CD1 1 
ATOM   635  C  CD2 . PHE A 1 128 ? -15.774 3.450   -6.235  1.00 33.16  ? 124  PHE A CD2 1 
ATOM   636  C  CE1 . PHE A 1 128 ? -13.249 4.303   -7.026  1.00 30.43  ? 124  PHE A CE1 1 
ATOM   637  C  CE2 . PHE A 1 128 ? -15.187 4.591   -5.632  1.00 33.45  ? 124  PHE A CE2 1 
ATOM   638  C  CZ  . PHE A 1 128 ? -13.918 5.009   -6.024  1.00 31.02  ? 124  PHE A CZ  1 
ATOM   639  N  N   . ASN A 1 129 ? -16.188 -0.853  -10.117 1.00 30.70  ? 125  ASN A N   1 
ATOM   640  C  CA  . ASN A 1 129 ? -16.598 -2.218  -10.429 1.00 32.90  ? 125  ASN A CA  1 
ATOM   641  C  C   . ASN A 1 129 ? -15.483 -3.063  -11.036 1.00 33.17  ? 125  ASN A C   1 
ATOM   642  O  O   . ASN A 1 129 ? -15.404 -4.247  -10.744 1.00 33.77  ? 125  ASN A O   1 
ATOM   643  C  CB  . ASN A 1 129 ? -17.799 -2.227  -11.353 1.00 34.03  ? 125  ASN A CB  1 
ATOM   644  C  CG  . ASN A 1 129 ? -19.108 -2.135  -10.584 1.00 37.52  ? 125  ASN A CG  1 
ATOM   645  O  OD1 . ASN A 1 129 ? -19.659 -3.146  -10.119 1.00 37.38  ? 125  ASN A OD1 1 
ATOM   646  N  ND2 . ASN A 1 129 ? -19.596 -0.916  -10.415 1.00 38.97  ? 125  ASN A ND2 1 
ATOM   647  N  N   . LEU A 1 130 ? -14.622 -2.476  -11.865 1.00 33.28  ? 126  LEU A N   1 
ATOM   648  C  CA  . LEU A 1 130 ? -13.455 -3.226  -12.356 1.00 34.28  ? 126  LEU A CA  1 
ATOM   649  C  C   . LEU A 1 130 ? -12.579 -3.593  -11.187 1.00 34.17  ? 126  LEU A C   1 
ATOM   650  O  O   . LEU A 1 130 ? -12.034 -4.700  -11.136 1.00 37.87  ? 126  LEU A O   1 
ATOM   651  C  CB  . LEU A 1 130 ? -12.653 -2.431  -13.382 1.00 34.18  ? 126  LEU A CB  1 
ATOM   652  C  CG  . LEU A 1 130 ? -13.433 -2.253  -14.677 1.00 31.93  ? 126  LEU A CG  1 
ATOM   653  C  CD1 . LEU A 1 130 ? -12.676 -1.300  -15.600 1.00 33.91  ? 126  LEU A CD1 1 
ATOM   654  C  CD2 . LEU A 1 130 ? -13.617 -3.602  -15.344 1.00 32.51  ? 126  LEU A CD2 1 
ATOM   655  N  N   . CYS A 1 131 ? -12.449 -2.669  -10.240 1.00 32.87  ? 127  CYS A N   1 
ATOM   656  C  CA  A CYS A 1 131 ? -11.751 -2.936  -8.982  0.53 34.98  ? 127  CYS A CA  1 
ATOM   657  C  CA  B CYS A 1 131 ? -11.707 -2.963  -9.023  0.47 34.69  ? 127  CYS A CA  1 
ATOM   658  C  C   . CYS A 1 131 ? -12.374 -4.082  -8.209  1.00 37.18  ? 127  CYS A C   1 
ATOM   659  O  O   . CYS A 1 131 ? -11.683 -4.974  -7.723  1.00 36.61  ? 127  CYS A O   1 
ATOM   660  C  CB  A CYS A 1 131 ? -11.749 -1.703  -8.091  0.53 35.38  ? 127  CYS A CB  1 
ATOM   661  C  CB  B CYS A 1 131 ? -11.554 -1.709  -8.169  0.47 36.03  ? 127  CYS A CB  1 
ATOM   662  S  SG  A CYS A 1 131 ? -10.527 -0.505  -8.543  0.53 32.18  ? 127  CYS A SG  1 
ATOM   663  S  SG  B CYS A 1 131 ? -10.187 -1.808  -7.001  0.47 41.62  ? 127  CYS A SG  1 
ATOM   664  N  N   . ALA A 1 132 ? -13.698 -4.029  -8.067  1.00 31.91  ? 128  ALA A N   1 
ATOM   665  C  CA  . ALA A 1 132 ? -14.439 -5.057  -7.332  1.00 34.76  ? 128  ALA A CA  1 
ATOM   666  C  C   . ALA A 1 132 ? -14.257 -6.459  -7.922  1.00 34.93  ? 128  ALA A C   1 
ATOM   667  O  O   . ALA A 1 132 ? -14.183 -7.435  -7.186  1.00 35.26  ? 128  ALA A O   1 
ATOM   668  C  CB  . ALA A 1 132 ? -15.930 -4.715  -7.286  1.00 33.17  ? 128  ALA A CB  1 
ATOM   669  N  N   . ILE A 1 133 ? -14.220 -6.554  -9.245  1.00 34.36  ? 129  ILE A N   1 
ATOM   670  C  CA  . ILE A 1 133 ? -13.965 -7.829  -9.899  1.00 33.24  ? 129  ILE A CA  1 
ATOM   671  C  C   . ILE A 1 133 ? -12.626 -8.376  -9.451  1.00 34.59  ? 129  ILE A C   1 
ATOM   672  O  O   . ILE A 1 133 ? -12.511 -9.562  -9.127  1.00 37.36  ? 129  ILE A O   1 
ATOM   673  C  CB  . ILE A 1 133 ? -13.968 -7.707  -11.428 1.00 35.39  ? 129  ILE A CB  1 
ATOM   674  C  CG1 . ILE A 1 133 ? -15.387 -7.407  -11.915 1.00 34.49  ? 129  ILE A CG1 1 
ATOM   675  C  CG2 . ILE A 1 133 ? -13.456 -9.000  -12.071 1.00 35.34  ? 129  ILE A CG2 1 
ATOM   676  C  CD1 . ILE A 1 133 ? -15.478 -6.978  -13.362 1.00 33.54  ? 129  ILE A CD1 1 
ATOM   677  N  N   . SER A 1 134 ? -11.616 -7.512  -9.407  1.00 34.97  ? 130  SER A N   1 
ATOM   678  C  CA  . SER A 1 134 ? -10.280 -7.986  -9.057  1.00 36.43  ? 130  SER A CA  1 
ATOM   679  C  C   . SER A 1 134 ? -10.257 -8.429  -7.596  1.00 37.55  ? 130  SER A C   1 
ATOM   680  O  O   . SER A 1 134 ? -9.638  -9.427  -7.266  1.00 37.43  ? 130  SER A O   1 
ATOM   681  C  CB  . SER A 1 134 ? -9.217  -6.913  -9.301  1.00 34.50  ? 130  SER A CB  1 
ATOM   682  O  OG  . SER A 1 134 ? -9.331  -5.870  -8.352  1.00 35.68  ? 130  SER A OG  1 
ATOM   683  N  N   . VAL A 1 135 ? -10.940 -7.689  -6.724  1.00 33.35  ? 131  VAL A N   1 
ATOM   684  C  CA  . VAL A 1 135 ? -11.031 -8.089  -5.313  1.00 33.43  ? 131  VAL A CA  1 
ATOM   685  C  C   . VAL A 1 135 ? -11.763 -9.445  -5.161  1.00 34.90  ? 131  VAL A C   1 
ATOM   686  O  O   . VAL A 1 135 ? -11.311 -10.340 -4.432  1.00 36.20  ? 131  VAL A O   1 
ATOM   687  C  CB  . VAL A 1 135 ? -11.744 -7.001  -4.483  1.00 34.22  ? 131  VAL A CB  1 
ATOM   688  C  CG1 . VAL A 1 135 ? -12.135 -7.534  -3.117  1.00 34.75  ? 131  VAL A CG1 1 
ATOM   689  C  CG2 . VAL A 1 135 ? -10.835 -5.773  -4.346  1.00 33.17  ? 131  VAL A CG2 1 
ATOM   690  N  N   . ASP A 1 136 ? -12.872 -9.591  -5.882  1.00 36.14  ? 132  ASP A N   1 
ATOM   691  C  CA  . ASP A 1 136 ? -13.708 -10.800 -5.846  1.00 37.62  ? 132  ASP A CA  1 
ATOM   692  C  C   . ASP A 1 136 ? -12.974 -12.038 -6.378  1.00 38.33  ? 132  ASP A C   1 
ATOM   693  O  O   . ASP A 1 136 ? -13.030 -13.118 -5.777  1.00 37.69  ? 132  ASP A O   1 
ATOM   694  C  CB  . ASP A 1 136 ? -14.992 -10.568 -6.663  1.00 39.43  ? 132  ASP A CB  1 
ATOM   695  C  CG  . ASP A 1 136 ? -15.893 -11.792 -6.714  1.00 41.93  ? 132  ASP A CG  1 
ATOM   696  O  OD1 . ASP A 1 136 ? -16.576 -12.046 -5.691  1.00 44.41  ? 132  ASP A OD1 1 
ATOM   697  O  OD2 . ASP A 1 136 ? -15.952 -12.472 -7.775  1.00 42.59  ? 132  ASP A OD2 1 
ATOM   698  N  N   . ARG A 1 137 ? -12.309 -11.880 -7.515  1.00 36.67  ? 133  ARG A N   1 
ATOM   699  C  CA  . ARG A 1 137 ? -11.602 -12.991 -8.115  1.00 38.50  ? 133  ARG A CA  1 
ATOM   700  C  C   . ARG A 1 137 ? -10.373 -13.352 -7.272  1.00 37.70  ? 133  ARG A C   1 
ATOM   701  O  O   . ARG A 1 137 ? -10.041 -14.522 -7.161  1.00 38.79  ? 133  ARG A O   1 
ATOM   702  C  CB  . ARG A 1 137 ? -11.224 -12.682 -9.565  1.00 38.63  ? 133  ARG A CB  1 
ATOM   703  C  CG  . ARG A 1 137 ? -12.425 -12.715 -10.550 1.00 38.34  ? 133  ARG A CG  1 
ATOM   704  C  CD  . ARG A 1 137 ? -13.198 -14.068 -10.529 1.00 39.54  ? 133  ARG A CD  1 
ATOM   705  N  NE  . ARG A 1 137 ? -14.251 -14.097 -9.506  1.00 41.59  ? 133  ARG A NE  1 
ATOM   706  C  CZ  . ARG A 1 137 ? -14.835 -15.199 -9.041  1.00 43.87  ? 133  ARG A CZ  1 
ATOM   707  N  NH1 . ARG A 1 137 ? -14.485 -16.402 -9.486  1.00 44.83  ? 133  ARG A NH1 1 
ATOM   708  N  NH2 . ARG A 1 137 ? -15.766 -15.099 -8.105  1.00 43.60  ? 133  ARG A NH2 1 
ATOM   709  N  N   . PHE A 1 138 ? -9.715  -12.367 -6.659  1.00 38.45  ? 134  PHE A N   1 
ATOM   710  C  CA  . PHE A 1 138 ? -8.578  -12.690 -5.798  1.00 39.11  ? 134  PHE A CA  1 
ATOM   711  C  C   . PHE A 1 138 ? -9.021  -13.525 -4.598  1.00 40.69  ? 134  PHE A C   1 
ATOM   712  O  O   . PHE A 1 138 ? -8.393  -14.537 -4.265  1.00 40.10  ? 134  PHE A O   1 
ATOM   713  C  CB  . PHE A 1 138 ? -7.838  -11.445 -5.291  1.00 38.26  ? 134  PHE A CB  1 
ATOM   714  C  CG  . PHE A 1 138 ? -6.696  -11.785 -4.371  1.00 40.25  ? 134  PHE A CG  1 
ATOM   715  C  CD1 . PHE A 1 138 ? -5.560  -12.408 -4.865  1.00 46.33  ? 134  PHE A CD1 1 
ATOM   716  C  CD2 . PHE A 1 138 ? -6.780  -11.549 -3.010  1.00 39.05  ? 134  PHE A CD2 1 
ATOM   717  C  CE1 . PHE A 1 138 ? -4.507  -12.769 -4.017  1.00 46.35  ? 134  PHE A CE1 1 
ATOM   718  C  CE2 . PHE A 1 138 ? -5.728  -11.906 -2.157  1.00 42.11  ? 134  PHE A CE2 1 
ATOM   719  C  CZ  . PHE A 1 138 ? -4.595  -12.512 -2.667  1.00 40.43  ? 134  PHE A CZ  1 
ATOM   720  N  N   . VAL A 1 139 ? -10.101 -13.097 -3.953  1.00 39.98  ? 135  VAL A N   1 
ATOM   721  C  CA  . VAL A 1 139 ? -10.660 -13.835 -2.822  1.00 39.26  ? 135  VAL A CA  1 
ATOM   722  C  C   . VAL A 1 139 ? -11.134 -15.230 -3.232  1.00 39.41  ? 135  VAL A C   1 
ATOM   723  O  O   . VAL A 1 139 ? -10.969 -16.174 -2.476  1.00 40.97  ? 135  VAL A O   1 
ATOM   724  C  CB  . VAL A 1 139 ? -11.825 -13.045 -2.168  1.00 39.62  ? 135  VAL A CB  1 
ATOM   725  C  CG1 . VAL A 1 139 ? -12.656 -13.929 -1.205  1.00 39.00  ? 135  VAL A CG1 1 
ATOM   726  C  CG2 . VAL A 1 139 ? -11.280 -11.810 -1.447  1.00 37.49  ? 135  VAL A CG2 1 
ATOM   727  N  N   . ALA A 1 140 ? -11.720 -15.365 -4.420  1.00 40.97  ? 136  ALA A N   1 
ATOM   728  C  CA  . ALA A 1 140 ? -12.205 -16.671 -4.876  1.00 43.54  ? 136  ALA A CA  1 
ATOM   729  C  C   . ALA A 1 140 ? -11.040 -17.623 -5.042  1.00 41.29  ? 136  ALA A C   1 
ATOM   730  O  O   . ALA A 1 140 ? -11.112 -18.794 -4.673  1.00 42.91  ? 136  ALA A O   1 
ATOM   731  C  CB  . ALA A 1 140 ? -12.979 -16.545 -6.188  1.00 42.42  ? 136  ALA A CB  1 
ATOM   732  N  N   . VAL A 1 141 ? -9.948  -17.099 -5.586  1.00 43.63  ? 137  VAL A N   1 
ATOM   733  C  CA  . VAL A 1 141 ? -8.760  -17.910 -5.840  1.00 44.11  ? 137  VAL A CA  1 
ATOM   734  C  C   . VAL A 1 141 ? -8.001  -18.181 -4.544  1.00 42.88  ? 137  VAL A C   1 
ATOM   735  O  O   . VAL A 1 141 ? -7.569  -19.306 -4.300  1.00 42.79  ? 137  VAL A O   1 
ATOM   736  C  CB  . VAL A 1 141 ? -7.825  -17.229 -6.870  1.00 44.88  ? 137  VAL A CB  1 
ATOM   737  C  CG1 . VAL A 1 141 ? -6.528  -18.028 -7.029  1.00 47.65  ? 137  VAL A CG1 1 
ATOM   738  C  CG2 . VAL A 1 141 ? -8.537  -17.106 -8.208  1.00 46.21  ? 137  VAL A CG2 1 
ATOM   739  N  N   . ALA A 1 142 ? -7.854  -17.163 -3.699  1.00 42.85  ? 138  ALA A N   1 
ATOM   740  C  CA  . ALA A 1 142 ? -7.033  -17.301 -2.489  1.00 43.44  ? 138  ALA A CA  1 
ATOM   741  C  C   . ALA A 1 142 ? -7.747  -18.009 -1.332  1.00 42.91  ? 138  ALA A C   1 
ATOM   742  O  O   . ALA A 1 142 ? -7.097  -18.595 -0.476  1.00 43.49  ? 138  ALA A O   1 
ATOM   743  C  CB  . ALA A 1 142 ? -6.544  -15.937 -2.031  1.00 41.06  ? 138  ALA A CB  1 
ATOM   744  N  N   . VAL A 1 143 ? -9.076  -17.949 -1.307  1.00 44.32  ? 139  VAL A N   1 
ATOM   745  C  CA  . VAL A 1 143 ? -9.852  -18.521 -0.205  1.00 44.77  ? 139  VAL A CA  1 
ATOM   746  C  C   . VAL A 1 143 ? -10.896 -19.518 -0.707  1.00 47.72  ? 139  VAL A C   1 
ATOM   747  O  O   . VAL A 1 143 ? -12.073 -19.188 -0.831  1.00 46.41  ? 139  VAL A O   1 
ATOM   748  C  CB  . VAL A 1 143 ? -10.572 -17.418 0.626   1.00 46.89  ? 139  VAL A CB  1 
ATOM   749  C  CG1 . VAL A 1 143 ? -11.165 -18.002 1.916   1.00 43.31  ? 139  VAL A CG1 1 
ATOM   750  C  CG2 . VAL A 1 143 ? -9.617  -16.266 0.932   1.00 42.25  ? 139  VAL A CG2 1 
ATOM   751  N  N   . PRO A 1 144 ? -10.457 -20.747 -1.003  1.00 53.37  ? 140  PRO A N   1 
ATOM   752  C  CA  . PRO A 1 144 ? -11.354 -21.857 -1.351  1.00 56.49  ? 140  PRO A CA  1 
ATOM   753  C  C   . PRO A 1 144 ? -12.391 -22.127 -0.264  1.00 52.09  ? 140  PRO A C   1 
ATOM   754  O  O   . PRO A 1 144 ? -12.013 -22.507 0.848   1.00 52.12  ? 140  PRO A O   1 
ATOM   755  C  CB  . PRO A 1 144 ? -10.396 -23.057 -1.477  1.00 60.23  ? 140  PRO A CB  1 
ATOM   756  C  CG  . PRO A 1 144 ? -9.056  -22.441 -1.765  1.00 59.51  ? 140  PRO A CG  1 
ATOM   757  C  CD  . PRO A 1 144 ? -9.041  -21.158 -0.992  1.00 55.52  ? 140  PRO A CD  1 
ATOM   758  N  N   . LEU A 1 145 ? -13.673 -21.961 -0.571  1.00 54.02  ? 141  LEU A N   1 
ATOM   759  C  CA  . LEU A 1 145 ? -14.710 -22.287 0.406   1.00 54.37  ? 141  LEU A CA  1 
ATOM   760  C  C   . LEU A 1 145 ? -15.670 -23.352 -0.110  1.00 55.96  ? 141  LEU A C   1 
ATOM   761  O  O   . LEU A 1 145 ? -15.917 -23.447 -1.307  1.00 57.10  ? 141  LEU A O   1 
ATOM   762  C  CB  . LEU A 1 145 ? -15.495 -21.035 0.784   1.00 51.53  ? 141  LEU A CB  1 
ATOM   763  C  CG  . LEU A 1 145 ? -14.739 -19.925 1.516   1.00 49.18  ? 141  LEU A CG  1 
ATOM   764  C  CD1 . LEU A 1 145 ? -15.695 -18.797 1.823   1.00 48.66  ? 141  LEU A CD1 1 
ATOM   765  C  CD2 . LEU A 1 145 ? -14.130 -20.467 2.780   1.00 51.00  ? 141  LEU A CD2 1 
ATOM   766  N  N   . ARG A 1 146 ? -16.218 -24.135 0.808   1.00 59.45  ? 142  ARG A N   1 
ATOM   767  C  CA  . ARG A 1 146 ? -17.209 -25.145 0.481   1.00 62.64  ? 142  ARG A CA  1 
ATOM   768  C  C   . ARG A 1 146 ? -18.425 -24.971 1.380   1.00 63.70  ? 142  ARG A C   1 
ATOM   769  O  O   . ARG A 1 146 ? -18.314 -25.054 2.601   1.00 65.58  ? 142  ARG A O   1 
ATOM   770  C  CB  . ARG A 1 146 ? -16.622 -26.558 0.641   1.00 61.67  ? 142  ARG A CB  1 
ATOM   771  C  CG  . ARG A 1 146 ? -17.549 -27.685 0.201   1.00 64.36  ? 142  ARG A CG  1 
ATOM   772  C  CD  . ARG A 1 146 ? -16.897 -29.066 0.379   1.00 65.15  ? 142  ARG A CD  1 
ATOM   773  N  NE  . ARG A 1 146 ? -17.562 -29.897 1.390   1.00 70.64  ? 142  ARG A NE  1 
ATOM   774  C  CZ  . ARG A 1 146 ? -17.432 -31.222 1.484   1.00 78.98  ? 142  ARG A CZ  1 
ATOM   775  N  NH1 . ARG A 1 146 ? -18.072 -31.900 2.436   1.00 81.99  ? 142  ARG A NH1 1 
ATOM   776  N  NH2 . ARG A 1 146 ? -16.665 -31.885 0.624   1.00 81.74  ? 142  ARG A NH2 1 
ATOM   777  N  N   . TYR A 1 147 ? -19.584 -24.737 0.776   1.00 57.56  ? 143  TYR A N   1 
ATOM   778  C  CA  . TYR A 1 147 ? -20.800 -24.491 1.544   1.00 58.54  ? 143  TYR A CA  1 
ATOM   779  C  C   . TYR A 1 147 ? -21.614 -25.743 1.767   1.00 59.80  ? 143  TYR A C   1 
ATOM   780  O  O   . TYR A 1 147 ? -21.648 -26.623 0.909   1.00 62.16  ? 143  TYR A O   1 
ATOM   781  C  CB  . TYR A 1 147 ? -21.679 -23.455 0.846   1.00 56.92  ? 143  TYR A CB  1 
ATOM   782  C  CG  . TYR A 1 147 ? -20.997 -22.146 0.509   1.00 55.12  ? 143  TYR A CG  1 
ATOM   783  C  CD1 . TYR A 1 147 ? -19.908 -21.684 1.238   1.00 52.97  ? 143  TYR A CD1 1 
ATOM   784  C  CD2 . TYR A 1 147 ? -21.467 -21.363 -0.530  1.00 51.27  ? 143  TYR A CD2 1 
ATOM   785  C  CE1 . TYR A 1 147 ? -19.297 -20.476 0.918   1.00 52.00  ? 143  TYR A CE1 1 
ATOM   786  C  CE2 . TYR A 1 147 ? -20.873 -20.167 -0.854  1.00 52.07  ? 143  TYR A CE2 1 
ATOM   787  C  CZ  . TYR A 1 147 ? -19.790 -19.723 -0.134  1.00 51.76  ? 143  TYR A CZ  1 
ATOM   788  O  OH  . TYR A 1 147 ? -19.221 -18.517 -0.485  1.00 51.18  ? 143  TYR A OH  1 
ATOM   789  N  N   . ASN A 1 148 ? -22.270 -25.819 2.923   1.00 61.12  ? 144  ASN A N   1 
ATOM   790  C  CA  . ASN A 1 148 ? -23.226 -26.889 3.200   1.00 64.53  ? 144  ASN A CA  1 
ATOM   791  C  C   . ASN A 1 148 ? -24.445 -26.756 2.293   1.00 66.96  ? 144  ASN A C   1 
ATOM   792  O  O   . ASN A 1 148 ? -24.920 -27.734 1.715   1.00 66.49  ? 144  ASN A O   1 
ATOM   793  C  CB  . ASN A 1 148 ? -23.679 -26.859 4.663   1.00 64.64  ? 144  ASN A CB  1 
ATOM   794  C  CG  . ASN A 1 148 ? -22.584 -27.246 5.632   1.00 65.93  ? 144  ASN A CG  1 
ATOM   795  O  OD1 . ASN A 1 148 ? -21.750 -28.107 5.344   1.00 69.19  ? 144  ASN A OD1 1 
ATOM   796  N  ND2 . ASN A 1 148 ? -22.588 -26.615 6.805   1.00 66.29  ? 144  ASN A ND2 1 
ATOM   797  N  N   . ARG A 1 149 ? -24.946 -25.527 2.192   1.00 64.77  ? 145  ARG A N   1 
ATOM   798  C  CA  . ARG A 1 149 ? -26.143 -25.217 1.420   1.00 64.62  ? 145  ARG A CA  1 
ATOM   799  C  C   . ARG A 1 149 ? -25.825 -24.879 -0.026  1.00 62.93  ? 145  ARG A C   1 
ATOM   800  O  O   . ARG A 1 149 ? -24.800 -24.263 -0.323  1.00 62.28  ? 145  ARG A O   1 
ATOM   801  C  CB  . ARG A 1 149 ? -26.905 -24.049 2.051   1.00 65.42  ? 145  ARG A CB  1 
ATOM   802  C  CG  . ARG A 1 149 ? -27.493 -24.340 3.420   1.00 71.53  ? 145  ARG A CG  1 
ATOM   803  C  CD  . ARG A 1 149 ? -28.220 -23.114 3.980   1.00 78.37  ? 145  ARG A CD  1 
ATOM   804  N  NE  . ARG A 1 149 ? -29.399 -22.735 3.194   1.00 84.38  ? 145  ARG A NE  1 
ATOM   805  C  CZ  . ARG A 1 149 ? -29.495 -21.618 2.476   1.00 82.44  ? 145  ARG A CZ  1 
ATOM   806  N  NH1 . ARG A 1 149 ? -28.485 -20.756 2.444   1.00 80.05  ? 145  ARG A NH1 1 
ATOM   807  N  NH2 . ARG A 1 149 ? -30.603 -21.354 1.792   1.00 80.67  ? 145  ARG A NH2 1 
ATOM   808  N  N   . GLN A 1 150 ? -26.723 -25.274 -0.920  1.00 71.04  ? 146  GLN A N   1 
ATOM   809  C  CA  . GLN A 1 150 ? -26.581 -24.978 -2.339  1.00 70.78  ? 146  GLN A CA  1 
ATOM   810  C  C   . GLN A 1 150 ? -26.757 -23.488 -2.605  1.00 65.73  ? 146  GLN A C   1 
ATOM   811  O  O   . GLN A 1 150 ? -27.413 -22.775 -1.841  1.00 66.50  ? 146  GLN A O   1 
ATOM   812  C  CB  . GLN A 1 150 ? -27.593 -25.792 -3.155  1.00 74.35  ? 146  GLN A CB  1 
ATOM   813  N  N   . GLY A 1 151 ? -26.159 -23.013 -3.690  1.00 60.79  ? 147  GLY A N   1 
ATOM   814  C  CA  . GLY A 1 151 ? -26.295 -21.629 -4.054  1.00 63.22  ? 147  GLY A CA  1 
ATOM   815  C  C   . GLY A 1 151 ? -25.106 -20.826 -3.574  1.00 64.14  ? 147  GLY A C   1 
ATOM   816  O  O   . GLY A 1 151 ? -24.272 -21.323 -2.813  1.00 66.48  ? 147  GLY A O   1 
ATOM   817  N  N   . GLY A 1 152 ? -25.036 -19.585 -4.033  1.00 57.49  ? 148  GLY A N   1 
ATOM   818  C  CA  . GLY A 1 152 ? -23.972 -18.675 -3.658  1.00 59.38  ? 148  GLY A CA  1 
ATOM   819  C  C   . GLY A 1 152 ? -24.336 -17.886 -2.416  1.00 56.43  ? 148  GLY A C   1 
ATOM   820  O  O   . GLY A 1 152 ? -25.450 -17.986 -1.899  1.00 53.68  ? 148  GLY A O   1 
ATOM   821  N  N   . SER A 1 153 ? -23.391 -17.092 -1.932  1.00 50.15  ? 149  SER A N   1 
ATOM   822  C  CA  . SER A 1 153 ? -23.604 -16.331 -0.706  1.00 48.87  ? 149  SER A CA  1 
ATOM   823  C  C   . SER A 1 153 ? -24.196 -14.965 -1.001  1.00 43.77  ? 149  SER A C   1 
ATOM   824  O  O   . SER A 1 153 ? -24.590 -14.251 -0.083  1.00 48.40  ? 149  SER A O   1 
ATOM   825  C  CB  . SER A 1 153 ? -22.290 -16.157 0.056   1.00 46.40  ? 149  SER A CB  1 
ATOM   826  O  OG  . SER A 1 153 ? -21.393 -15.406 -0.723  1.00 45.06  ? 149  SER A OG  1 
ATOM   827  N  N   . ARG A 1 154 ? -24.233 -14.612 -2.285  1.00 46.00  ? 150  ARG A N   1 
ATOM   828  C  CA  . ARG A 1 154 ? -24.623 -13.280 -2.759  1.00 43.23  ? 150  ARG A CA  1 
ATOM   829  C  C   . ARG A 1 154 ? -23.657 -12.196 -2.302  1.00 45.22  ? 150  ARG A C   1 
ATOM   830  O  O   . ARG A 1 154 ? -23.977 -11.003 -2.340  1.00 42.49  ? 150  ARG A O   1 
ATOM   831  C  CB  . ARG A 1 154 ? -26.041 -12.940 -2.321  1.00 45.72  ? 150  ARG A CB  1 
ATOM   832  C  CG  . ARG A 1 154 ? -27.070 -13.971 -2.794  1.00 48.86  ? 150  ARG A CG  1 
ATOM   833  C  CD  . ARG A 1 154 ? -28.469 -13.585 -2.371  1.00 54.35  ? 150  ARG A CD  1 
ATOM   834  N  N   . ARG A 1 155 ? -22.456 -12.598 -1.897  1.00 42.48  ? 151  ARG A N   1 
ATOM   835  C  CA  . ARG A 1 155 ? -21.459 -11.596 -1.537  1.00 40.95  ? 151  ARG A CA  1 
ATOM   836  C  C   . ARG A 1 155 ? -21.071 -10.692 -2.710  1.00 39.88  ? 151  ARG A C   1 
ATOM   837  O  O   . ARG A 1 155 ? -20.608 -9.588  -2.491  1.00 39.75  ? 151  ARG A O   1 
ATOM   838  C  CB  . ARG A 1 155 ? -20.223 -12.261 -0.941  1.00 40.92  ? 151  ARG A CB  1 
ATOM   839  C  CG  . ARG A 1 155 ? -19.456 -13.163 -1.871  1.00 41.93  ? 151  ARG A CG  1 
ATOM   840  C  CD  . ARG A 1 155 ? -18.309 -13.830 -1.081  1.00 44.66  ? 151  ARG A CD  1 
ATOM   841  N  NE  . ARG A 1 155 ? -17.663 -14.914 -1.813  1.00 43.52  ? 151  ARG A NE  1 
ATOM   842  C  CZ  . ARG A 1 155 ? -16.571 -15.547 -1.396  1.00 46.83  ? 151  ARG A CZ  1 
ATOM   843  N  NH1 . ARG A 1 155 ? -15.979 -15.194 -0.255  1.00 43.07  ? 151  ARG A NH1 1 
ATOM   844  N  NH2 . ARG A 1 155 ? -16.054 -16.518 -2.138  1.00 47.15  ? 151  ARG A NH2 1 
ATOM   845  N  N   . GLN A 1 156 ? -21.248 -11.151 -3.946  1.00 37.63  ? 152  GLN A N   1 
ATOM   846  C  CA  . GLN A 1 156 ? -20.989 -10.280 -5.088  1.00 38.57  ? 152  GLN A CA  1 
ATOM   847  C  C   . GLN A 1 156 ? -22.016 -9.147  -5.134  1.00 38.00  ? 152  GLN A C   1 
ATOM   848  O  O   . GLN A 1 156 ? -21.670 -7.999  -5.386  1.00 38.16  ? 152  GLN A O   1 
ATOM   849  C  CB  . GLN A 1 156 ? -20.999 -11.050 -6.414  1.00 40.18  ? 152  GLN A CB  1 
ATOM   850  C  CG  . GLN A 1 156 ? -19.773 -11.953 -6.634  1.00 41.28  ? 152  GLN A CG  1 
ATOM   851  C  CD  . GLN A 1 156 ? -19.840 -13.215 -5.795  1.00 43.57  ? 152  GLN A CD  1 
ATOM   852  O  OE1 . GLN A 1 156 ? -20.921 -13.726 -5.537  1.00 42.62  ? 152  GLN A OE1 1 
ATOM   853  N  NE2 . GLN A 1 156 ? -18.693 -13.712 -5.358  1.00 41.83  ? 152  GLN A NE2 1 
ATOM   854  N  N   . LEU A 1 157 ? -23.278 -9.472  -4.894  1.00 37.58  ? 153  LEU A N   1 
ATOM   855  C  CA  A LEU A 1 157 ? -24.316 -8.447  -4.889  0.46 37.16  ? 153  LEU A CA  1 
ATOM   856  C  CA  B LEU A 1 157 ? -24.326 -8.458  -4.874  0.54 37.19  ? 153  LEU A CA  1 
ATOM   857  C  C   . LEU A 1 157 ? -24.045 -7.398  -3.822  1.00 37.17  ? 153  LEU A C   1 
ATOM   858  O  O   . LEU A 1 157 ? -24.222 -6.212  -4.061  1.00 37.10  ? 153  LEU A O   1 
ATOM   859  C  CB  A LEU A 1 157 ? -25.686 -9.064  -4.668  0.46 38.39  ? 153  LEU A CB  1 
ATOM   860  C  CB  B LEU A 1 157 ? -25.680 -9.091  -4.609  0.54 38.64  ? 153  LEU A CB  1 
ATOM   861  C  CG  A LEU A 1 157 ? -26.261 -9.773  -5.892  0.46 40.85  ? 153  LEU A CG  1 
ATOM   862  C  CG  B LEU A 1 157 ? -26.820 -8.150  -4.237  0.54 37.71  ? 153  LEU A CG  1 
ATOM   863  C  CD1 A LEU A 1 157 ? -27.554 -10.491 -5.542  0.46 41.25  ? 153  LEU A CD1 1 
ATOM   864  C  CD1 B LEU A 1 157 ? -27.148 -7.274  -5.417  0.54 40.16  ? 153  LEU A CD1 1 
ATOM   865  C  CD2 A LEU A 1 157 ? -26.487 -8.760  -7.012  0.46 39.16  ? 153  LEU A CD2 1 
ATOM   866  C  CD2 B LEU A 1 157 ? -28.044 -8.950  -3.804  0.54 37.30  ? 153  LEU A CD2 1 
ATOM   867  N  N   . LEU A 1 158 ? -23.629 -7.851  -2.646  1.00 35.67  ? 154  LEU A N   1 
ATOM   868  C  CA  . LEU A 1 158 ? -23.331 -6.948  -1.550  1.00 34.30  ? 154  LEU A CA  1 
ATOM   869  C  C   . LEU A 1 158 ? -22.142 -6.064  -1.925  1.00 34.49  ? 154  LEU A C   1 
ATOM   870  O  O   . LEU A 1 158 ? -22.173 -4.848  -1.723  1.00 33.88  ? 154  LEU A O   1 
ATOM   871  C  CB  . LEU A 1 158 ? -23.069 -7.745  -0.277  1.00 34.35  ? 154  LEU A CB  1 
ATOM   872  C  CG  . LEU A 1 158 ? -24.296 -8.507  0.214   1.00 34.74  ? 154  LEU A CG  1 
ATOM   873  C  CD1 . LEU A 1 158 ? -23.922 -9.480  1.319   1.00 35.89  ? 154  LEU A CD1 1 
ATOM   874  C  CD2 . LEU A 1 158 ? -25.357 -7.519  0.699   1.00 35.13  ? 154  LEU A CD2 1 
ATOM   875  N  N   . LEU A 1 159 ? -21.119 -6.666  -2.522  1.00 34.66  ? 155  LEU A N   1 
ATOM   876  C  CA  . LEU A 1 159 ? -19.961 -5.894  -2.967  1.00 35.22  ? 155  LEU A CA  1 
ATOM   877  C  C   . LEU A 1 159 ? -20.359 -4.875  -4.043  1.00 34.47  ? 155  LEU A C   1 
ATOM   878  O  O   . LEU A 1 159 ? -19.962 -3.723  -3.973  1.00 35.29  ? 155  LEU A O   1 
ATOM   879  C  CB  . LEU A 1 159 ? -18.859 -6.824  -3.486  1.00 35.73  ? 155  LEU A CB  1 
ATOM   880  C  CG  . LEU A 1 159 ? -17.572 -6.148  -3.964  1.00 37.58  ? 155  LEU A CG  1 
ATOM   881  C  CD1 . LEU A 1 159 ? -16.959 -5.308  -2.847  1.00 35.21  ? 155  LEU A CD1 1 
ATOM   882  C  CD2 . LEU A 1 159 ? -16.591 -7.214  -4.454  1.00 37.40  ? 155  LEU A CD2 1 
ATOM   883  N  N   . ILE A 1 160 ? -21.165 -5.296  -5.016  1.00 37.33  ? 156  ILE A N   1 
ATOM   884  C  CA  . ILE A 1 160 ? -21.651 -4.383  -6.054  1.00 36.84  ? 156  ILE A CA  1 
ATOM   885  C  C   . ILE A 1 160 ? -22.418 -3.202  -5.442  1.00 34.92  ? 156  ILE A C   1 
ATOM   886  O  O   . ILE A 1 160 ? -22.189 -2.055  -5.810  1.00 35.20  ? 156  ILE A O   1 
ATOM   887  C  CB  . ILE A 1 160 ? -22.538 -5.125  -7.072  1.00 36.02  ? 156  ILE A CB  1 
ATOM   888  C  CG1 . ILE A 1 160 ? -21.660 -6.014  -7.968  1.00 36.58  ? 156  ILE A CG1 1 
ATOM   889  C  CG2 . ILE A 1 160 ? -23.312 -4.128  -7.940  1.00 34.00  ? 156  ILE A CG2 1 
ATOM   890  C  CD1 . ILE A 1 160 ? -22.461 -7.095  -8.757  1.00 35.45  ? 156  ILE A CD1 1 
ATOM   891  N  N   . GLY A 1 161 ? -23.305 -3.483  -4.496  1.00 33.46  ? 157  GLY A N   1 
ATOM   892  C  CA  . GLY A 1 161 ? -24.001 -2.419  -3.792  1.00 35.30  ? 157  GLY A CA  1 
ATOM   893  C  C   . GLY A 1 161 ? -23.023 -1.450  -3.121  1.00 34.48  ? 157  GLY A C   1 
ATOM   894  O  O   . GLY A 1 161 ? -23.185 -0.239  -3.191  1.00 33.12  ? 157  GLY A O   1 
ATOM   895  N  N   . ALA A 1 162 ? -22.005 -1.987  -2.462  1.00 33.24  ? 158  ALA A N   1 
ATOM   896  C  CA  . ALA A 1 162 ? -21.020 -1.128  -1.813  1.00 32.94  ? 158  ALA A CA  1 
ATOM   897  C  C   . ALA A 1 162 ? -20.314 -0.258  -2.837  1.00 32.29  ? 158  ALA A C   1 
ATOM   898  O  O   . ALA A 1 162 ? -20.061 0.914   -2.588  1.00 33.44  ? 158  ALA A O   1 
ATOM   899  C  CB  . ALA A 1 162 ? -20.023 -1.952  -1.043  1.00 31.97  ? 158  ALA A CB  1 
ATOM   900  N  N   . THR A 1 163 ? -20.032 -0.836  -3.997  1.00 33.16  ? 159  THR A N   1 
ATOM   901  C  CA  . THR A 1 163 ? -19.344 -0.143  -5.080  1.00 33.92  ? 159  THR A CA  1 
ATOM   902  C  C   . THR A 1 163 ? -20.121 1.087   -5.552  1.00 36.09  ? 159  THR A C   1 
ATOM   903  O  O   . THR A 1 163 ? -19.536 2.148   -5.815  1.00 33.71  ? 159  THR A O   1 
ATOM   904  C  CB  . THR A 1 163 ? -19.126 -1.103  -6.275  1.00 36.53  ? 159  THR A CB  1 
ATOM   905  O  OG1 . THR A 1 163 ? -18.030 -1.989  -5.982  1.00 38.38  ? 159  THR A OG1 1 
ATOM   906  C  CG2 . THR A 1 163 ? -18.800 -0.353  -7.501  1.00 39.49  ? 159  THR A CG2 1 
ATOM   907  N  N   . TRP A 1 164 ? -21.438 0.938   -5.674  1.00 34.12  ? 160  TRP A N   1 
ATOM   908  C  CA  . TRP A 1 164 ? -22.273 2.030   -6.143  1.00 33.46  ? 160  TRP A CA  1 
ATOM   909  C  C   . TRP A 1 164 ? -22.430 3.094   -5.071  1.00 34.20  ? 160  TRP A C   1 
ATOM   910  O  O   . TRP A 1 164 ? -22.455 4.274   -5.371  1.00 34.55  ? 160  TRP A O   1 
ATOM   911  C  CB  . TRP A 1 164 ? -23.646 1.510   -6.596  1.00 34.51  ? 160  TRP A CB  1 
ATOM   912  C  CG  . TRP A 1 164 ? -23.579 0.930   -7.968  1.00 34.28  ? 160  TRP A CG  1 
ATOM   913  C  CD1 . TRP A 1 164 ? -23.312 -0.370  -8.306  1.00 35.76  ? 160  TRP A CD1 1 
ATOM   914  C  CD2 . TRP A 1 164 ? -23.749 1.637   -9.199  1.00 34.90  ? 160  TRP A CD2 1 
ATOM   915  N  NE1 . TRP A 1 164 ? -23.324 -0.515  -9.676  1.00 34.16  ? 160  TRP A NE1 1 
ATOM   916  C  CE2 . TRP A 1 164 ? -23.596 0.703   -10.245 1.00 34.80  ? 160  TRP A CE2 1 
ATOM   917  C  CE3 . TRP A 1 164 ? -24.023 2.978   -9.518  1.00 38.49  ? 160  TRP A CE3 1 
ATOM   918  C  CZ2 . TRP A 1 164 ? -23.703 1.064   -11.587 1.00 35.87  ? 160  TRP A CZ2 1 
ATOM   919  C  CZ3 . TRP A 1 164 ? -24.131 3.336   -10.854 1.00 37.51  ? 160  TRP A CZ3 1 
ATOM   920  C  CH2 . TRP A 1 164 ? -23.969 2.386   -11.871 1.00 37.20  ? 160  TRP A CH2 1 
ATOM   921  N  N   . LEU A 1 165 ? -22.526 2.679   -3.820  1.00 30.64  ? 161  LEU A N   1 
ATOM   922  C  CA  . LEU A 1 165 ? -22.657 3.650   -2.756  1.00 31.22  ? 161  LEU A CA  1 
ATOM   923  C  C   . LEU A 1 165 ? -21.359 4.466   -2.631  1.00 33.86  ? 161  LEU A C   1 
ATOM   924  O  O   . LEU A 1 165 ? -21.403 5.669   -2.416  1.00 33.12  ? 161  LEU A O   1 
ATOM   925  C  CB  . LEU A 1 165 ? -22.988 2.959   -1.450  1.00 31.40  ? 161  LEU A CB  1 
ATOM   926  C  CG  . LEU A 1 165 ? -24.441 2.459   -1.314  1.00 34.10  ? 161  LEU A CG  1 
ATOM   927  C  CD1 . LEU A 1 165 ? -24.621 1.933   0.069   1.00 33.58  ? 161  LEU A CD1 1 
ATOM   928  C  CD2 . LEU A 1 165 ? -25.438 3.572   -1.588  1.00 34.89  ? 161  LEU A CD2 1 
ATOM   929  N  N   . LEU A 1 166 ? -20.219 3.809   -2.790  1.00 31.61  ? 162  LEU A N   1 
ATOM   930  C  CA  A LEU A 1 166 ? -18.918 4.488   -2.749  0.51 32.38  ? 162  LEU A CA  1 
ATOM   931  C  CA  B LEU A 1 166 ? -18.938 4.517   -2.704  0.49 32.07  ? 162  LEU A CA  1 
ATOM   932  C  C   . LEU A 1 166 ? -18.781 5.508   -3.860  0.92 31.86  ? 162  LEU A C   1 
ATOM   933  O  O   . LEU A 1 166 ? -18.269 6.608   -3.662  0.95 33.47  ? 162  LEU A O   1 
ATOM   934  C  CB  A LEU A 1 166 ? -17.788 3.471   -2.864  0.51 31.72  ? 162  LEU A CB  1 
ATOM   935  C  CB  B LEU A 1 166 ? -17.766 3.523   -2.683  0.49 32.11  ? 162  LEU A CB  1 
ATOM   936  C  CG  A LEU A 1 166 ? -17.577 2.650   -1.606  0.51 33.04  ? 162  LEU A CG  1 
ATOM   937  C  CG  B LEU A 1 166 ? -16.371 4.102   -2.411  0.49 33.16  ? 162  LEU A CG  1 
ATOM   938  C  CD1 A LEU A 1 166 ? -16.504 1.614   -1.863  0.51 34.06  ? 162  LEU A CD1 1 
ATOM   939  C  CD1 B LEU A 1 166 ? -16.384 4.966   -1.163  0.49 35.38  ? 162  LEU A CD1 1 
ATOM   940  C  CD2 A LEU A 1 166 ? -17.204 3.580   -0.463  0.51 32.93  ? 162  LEU A CD2 1 
ATOM   941  C  CD2 B LEU A 1 166 ? -15.300 2.994   -2.302  0.49 32.07  ? 162  LEU A CD2 1 
ATOM   942  N  N   . SER A 1 167 ? -19.221 5.119   -5.054  1.00 32.43  ? 163  SER A N   1 
ATOM   943  C  CA  . SER A 1 167 ? -19.184 6.019   -6.206  1.00 32.45  ? 163  SER A CA  1 
ATOM   944  C  C   . SER A 1 167 ? -20.050 7.252   -5.972  1.00 34.80  ? 163  SER A C   1 
ATOM   945  O  O   . SER A 1 167 ? -19.661 8.382   -6.306  1.00 35.70  ? 163  SER A O   1 
ATOM   946  C  CB  . SER A 1 167 ? -19.649 5.296   -7.462  1.00 31.36  ? 163  SER A CB  1 
ATOM   947  O  OG  . SER A 1 167 ? -18.936 4.082   -7.594  1.00 34.44  ? 163  SER A OG  1 
ATOM   948  N  N   . ALA A 1 168 ? -21.221 7.031   -5.384  1.00 33.30  ? 164  ALA A N   1 
ATOM   949  C  CA  . ALA A 1 168 ? -22.113 8.131   -5.050  1.00 33.41  ? 164  ALA A CA  1 
ATOM   950  C  C   . ALA A 1 168 ? -21.450 9.031   -4.017  1.00 33.99  ? 164  ALA A C   1 
ATOM   951  O  O   . ALA A 1 168 ? -21.591 10.248  -4.076  1.00 34.44  ? 164  ALA A O   1 
ATOM   952  C  CB  . ALA A 1 168 ? -23.447 7.606   -4.528  1.00 34.06  ? 164  ALA A CB  1 
ATOM   953  N  N   . ALA A 1 169 ? -20.718 8.430   -3.076  1.00 32.75  ? 165  ALA A N   1 
ATOM   954  C  CA  . ALA A 1 169 ? -20.044 9.213   -2.039  1.00 34.16  ? 165  ALA A CA  1 
ATOM   955  C  C   . ALA A 1 169 ? -18.976 10.165  -2.633  1.00 34.57  ? 165  ALA A C   1 
ATOM   956  O  O   . ALA A 1 169 ? -18.845 11.312  -2.205  1.00 35.55  ? 165  ALA A O   1 
ATOM   957  C  CB  . ALA A 1 169 ? -19.415 8.283   -0.992  1.00 31.45  ? 165  ALA A CB  1 
ATOM   958  N  N   . VAL A 1 170 ? -18.227 9.677   -3.611  1.00 32.65  ? 166  VAL A N   1 
ATOM   959  C  CA  . VAL A 1 170 ? -17.258 10.492  -4.316  1.00 33.73  ? 166  VAL A CA  1 
ATOM   960  C  C   . VAL A 1 170 ? -17.961 11.637  -5.056  1.00 34.38  ? 166  VAL A C   1 
ATOM   961  O  O   . VAL A 1 170 ? -17.519 12.792  -4.995  1.00 34.09  ? 166  VAL A O   1 
ATOM   962  C  CB  . VAL A 1 170 ? -16.425 9.651   -5.313  1.00 32.58  ? 166  VAL A CB  1 
ATOM   963  C  CG1 . VAL A 1 170 ? -15.484 10.554  -6.135  1.00 32.59  ? 166  VAL A CG1 1 
ATOM   964  C  CG2 . VAL A 1 170 ? -15.627 8.563   -4.568  1.00 31.05  ? 166  VAL A CG2 1 
ATOM   965  N  N   . ALA A 1 171 ? -19.064 11.329  -5.724  1.00 31.17  ? 167  ALA A N   1 
ATOM   966  C  CA  . ALA A 1 171 ? -19.738 12.310  -6.575  1.00 32.15  ? 167  ALA A CA  1 
ATOM   967  C  C   . ALA A 1 171 ? -20.602 13.319  -5.824  1.00 31.90  ? 167  ALA A C   1 
ATOM   968  O  O   . ALA A 1 171 ? -20.919 14.375  -6.363  1.00 33.25  ? 167  ALA A O   1 
ATOM   969  C  CB  . ALA A 1 171 ? -20.605 11.581  -7.619  1.00 32.63  ? 167  ALA A CB  1 
ATOM   970  N  N   . ALA A 1 172 ? -21.008 12.987  -4.603  1.00 35.27  ? 168  ALA A N   1 
ATOM   971  C  CA  . ALA A 1 172 ? -22.039 13.742  -3.891  1.00 34.79  ? 168  ALA A CA  1 
ATOM   972  C  C   . ALA A 1 172 ? -21.784 15.271  -3.746  1.00 34.79  ? 168  ALA A C   1 
ATOM   973  O  O   . ALA A 1 172 ? -22.736 16.051  -3.852  1.00 36.06  ? 168  ALA A O   1 
ATOM   974  C  CB  . ALA A 1 172 ? -22.268 13.122  -2.512  1.00 33.90  ? 168  ALA A CB  1 
ATOM   975  N  N   . PRO A 1 173 ? -20.523 15.699  -3.504  1.00 35.95  ? 169  PRO A N   1 
ATOM   976  C  CA  . PRO A 1 173 ? -20.337 17.152  -3.355  1.00 36.58  ? 169  PRO A CA  1 
ATOM   977  C  C   . PRO A 1 173 ? -20.678 17.942  -4.618  1.00 37.70  ? 169  PRO A C   1 
ATOM   978  O  O   . PRO A 1 173 ? -21.006 19.115  -4.504  1.00 38.89  ? 169  PRO A O   1 
ATOM   979  C  CB  . PRO A 1 173 ? -18.838 17.286  -3.022  1.00 35.38  ? 169  PRO A CB  1 
ATOM   980  C  CG  . PRO A 1 173 ? -18.472 15.962  -2.399  1.00 37.01  ? 169  PRO A CG  1 
ATOM   981  C  CD  . PRO A 1 173 ? -19.279 14.964  -3.190  1.00 36.11  ? 169  PRO A CD  1 
ATOM   982  N  N   . VAL A 1 174 ? -20.612 17.315  -5.789  1.00 34.71  ? 170  VAL A N   1 
ATOM   983  C  CA  . VAL A 1 174 ? -20.899 18.022  -7.027  1.00 34.90  ? 170  VAL A CA  1 
ATOM   984  C  C   . VAL A 1 174 ? -22.339 18.547  -7.045  1.00 36.59  ? 170  VAL A C   1 
ATOM   985  O  O   . VAL A 1 174 ? -22.583 19.661  -7.510  1.00 36.09  ? 170  VAL A O   1 
ATOM   986  C  CB  . VAL A 1 174 ? -20.653 17.135  -8.249  1.00 36.20  ? 170  VAL A CB  1 
ATOM   987  C  CG1 . VAL A 1 174 ? -21.078 17.847  -9.521  1.00 37.56  ? 170  VAL A CG1 1 
ATOM   988  C  CG2 . VAL A 1 174 ? -19.164 16.757  -8.332  1.00 35.52  ? 170  VAL A CG2 1 
ATOM   989  N  N   . LEU A 1 175 ? -23.270 17.764  -6.502  1.00 40.91  ? 171  LEU A N   1 
ATOM   990  C  CA  . LEU A 1 175 ? -24.671 18.181  -6.391  1.00 40.78  ? 171  LEU A CA  1 
ATOM   991  C  C   . LEU A 1 175 ? -24.887 19.439  -5.551  1.00 42.40  ? 171  LEU A C   1 
ATOM   992  O  O   . LEU A 1 175 ? -25.878 20.148  -5.737  1.00 45.40  ? 171  LEU A O   1 
ATOM   993  C  CB  . LEU A 1 175 ? -25.518 17.048  -5.796  1.00 41.33  ? 171  LEU A CB  1 
ATOM   994  C  CG  . LEU A 1 175 ? -26.028 15.972  -6.749  1.00 44.08  ? 171  LEU A CG  1 
ATOM   995  C  CD1 . LEU A 1 175 ? -26.859 14.944  -5.984  1.00 45.67  ? 171  LEU A CD1 1 
ATOM   996  C  CD2 . LEU A 1 175 ? -26.860 16.610  -7.842  1.00 44.64  ? 171  LEU A CD2 1 
ATOM   997  N  N   . CYS A 1 176 ? -23.987 19.720  -4.615  1.00 48.27  ? 172  CYS A N   1 
ATOM   998  C  CA  . CYS A 1 176 ? -24.178 20.865  -3.717  1.00 47.97  ? 172  CYS A CA  1 
ATOM   999  C  C   . CYS A 1 176 ? -23.756 22.186  -4.372  1.00 52.44  ? 172  CYS A C   1 
ATOM   1000 O  O   . CYS A 1 176 ? -23.944 23.263  -3.790  1.00 51.73  ? 172  CYS A O   1 
ATOM   1001 C  CB  . CYS A 1 176 ? -23.397 20.675  -2.417  1.00 50.74  ? 172  CYS A CB  1 
ATOM   1002 S  SG  . CYS A 1 176 ? -23.870 19.211  -1.456  1.00 48.22  ? 172  CYS A SG  1 
ATOM   1003 N  N   . GLY A 1 177 ? -23.177 22.104  -5.568  1.00 49.59  ? 173  GLY A N   1 
ATOM   1004 C  CA  . GLY A 1 177 ? -22.755 23.297  -6.287  1.00 50.26  ? 173  GLY A CA  1 
ATOM   1005 C  C   . GLY A 1 177 ? -21.329 23.703  -5.968  1.00 50.25  ? 173  GLY A C   1 
ATOM   1006 O  O   . GLY A 1 177 ? -21.058 24.325  -4.938  1.00 50.88  ? 173  GLY A O   1 
ATOM   1007 N  N   . LEU A 1 178 ? -20.412 23.360  -6.864  1.00 48.96  ? 174  LEU A N   1 
ATOM   1008 C  CA  . LEU A 1 178 ? -18.998 23.636  -6.639  1.00 49.68  ? 174  LEU A CA  1 
ATOM   1009 C  C   . LEU A 1 178 ? -18.453 24.781  -7.503  1.00 52.09  ? 174  LEU A C   1 
ATOM   1010 O  O   . LEU A 1 178 ? -17.358 25.286  -7.247  1.00 53.03  ? 174  LEU A O   1 
ATOM   1011 C  CB  . LEU A 1 178 ? -18.179 22.371  -6.886  1.00 48.33  ? 174  LEU A CB  1 
ATOM   1012 C  CG  . LEU A 1 178 ? -18.546 21.159  -6.030  1.00 47.42  ? 174  LEU A CG  1 
ATOM   1013 C  CD1 . LEU A 1 178 ? -17.638 19.969  -6.354  1.00 44.47  ? 174  LEU A CD1 1 
ATOM   1014 C  CD2 . LEU A 1 178 ? -18.492 21.506  -4.546  1.00 47.21  ? 174  LEU A CD2 1 
ATOM   1015 N  N   . ASN A 1 179 ? -19.205 25.188  -8.522  1.00 54.28  ? 175  ASN A N   1 
ATOM   1016 C  CA  . ASN A 1 179 ? -18.742 26.255  -9.408  1.00 55.84  ? 175  ASN A CA  1 
ATOM   1017 C  C   . ASN A 1 179 ? -19.025 27.634  -8.827  1.00 61.26  ? 175  ASN A C   1 
ATOM   1018 O  O   . ASN A 1 179 ? -19.893 27.784  -7.961  1.00 59.05  ? 175  ASN A O   1 
ATOM   1019 C  CB  . ASN A 1 179 ? -19.384 26.129  -10.793 1.00 56.48  ? 175  ASN A CB  1 
ATOM   1020 C  CG  . ASN A 1 179 ? -18.916 24.890  -11.551 1.00 57.44  ? 175  ASN A CG  1 
ATOM   1021 O  OD1 . ASN A 1 179 ? -17.894 24.277  -11.211 1.00 58.24  ? 175  ASN A OD1 1 
ATOM   1022 N  ND2 . ASN A 1 179 ? -19.663 24.516  -12.586 1.00 53.02  ? 175  ASN A ND2 1 
ATOM   1023 N  N   . ASP A 1 180 ? -18.289 28.632  -9.318  1.00 63.24  ? 176  ASP A N   1 
ATOM   1024 C  CA  . ASP A 1 180 ? -18.362 30.004  -8.818  1.00 63.98  ? 176  ASP A CA  1 
ATOM   1025 C  C   . ASP A 1 180 ? -19.793 30.536  -8.747  1.00 69.76  ? 176  ASP A C   1 
ATOM   1026 O  O   . ASP A 1 180 ? -20.341 30.728  -7.659  1.00 73.59  ? 176  ASP A O   1 
ATOM   1027 C  CB  . ASP A 1 180 ? -17.509 30.924  -9.699  1.00 59.29  ? 176  ASP A CB  1 
ATOM   1028 N  N   . PRO A 1 186 ? -20.168 30.132  -16.463 1.00 71.90  ? 182  PRO A N   1 
ATOM   1029 C  CA  . PRO A 1 186 ? -21.547 29.704  -16.182 1.00 72.27  ? 182  PRO A CA  1 
ATOM   1030 C  C   . PRO A 1 186 ? -22.365 29.501  -17.469 1.00 69.92  ? 182  PRO A C   1 
ATOM   1031 O  O   . PRO A 1 186 ? -23.503 29.030  -17.419 1.00 69.90  ? 182  PRO A O   1 
ATOM   1032 C  CB  . PRO A 1 186 ? -22.103 30.856  -15.349 1.00 73.33  ? 182  PRO A CB  1 
ATOM   1033 C  CG  . PRO A 1 186 ? -21.354 32.072  -15.846 1.00 73.32  ? 182  PRO A CG  1 
ATOM   1034 C  CD  . PRO A 1 186 ? -19.983 31.596  -16.317 1.00 71.37  ? 182  PRO A CD  1 
ATOM   1035 N  N   . ALA A 1 187 ? -21.774 29.877  -18.601 1.00 69.02  ? 183  ALA A N   1 
ATOM   1036 C  CA  . ALA A 1 187 ? -22.361 29.626  -19.909 1.00 62.45  ? 183  ALA A CA  1 
ATOM   1037 C  C   . ALA A 1 187 ? -21.838 28.302  -20.471 1.00 59.14  ? 183  ALA A C   1 
ATOM   1038 O  O   . ALA A 1 187 ? -22.056 27.964  -21.637 1.00 57.25  ? 183  ALA A O   1 
ATOM   1039 C  CB  . ALA A 1 187 ? -22.049 30.778  -20.860 1.00 64.14  ? 183  ALA A CB  1 
ATOM   1040 N  N   . VAL A 1 188 ? -21.121 27.566  -19.633 1.00 53.33  ? 184  VAL A N   1 
ATOM   1041 C  CA  . VAL A 1 188 ? -20.535 26.290  -20.023 1.00 53.44  ? 184  VAL A CA  1 
ATOM   1042 C  C   . VAL A 1 188 ? -20.726 25.327  -18.862 1.00 54.79  ? 184  VAL A C   1 
ATOM   1043 O  O   . VAL A 1 188 ? -20.917 25.752  -17.722 1.00 56.80  ? 184  VAL A O   1 
ATOM   1044 C  CB  . VAL A 1 188 ? -19.038 26.410  -20.354 1.00 55.46  ? 184  VAL A CB  1 
ATOM   1045 C  CG1 . VAL A 1 188 ? -18.806 27.377  -21.521 1.00 55.52  ? 184  VAL A CG1 1 
ATOM   1046 C  CG2 . VAL A 1 188 ? -18.269 26.860  -19.120 1.00 59.15  ? 184  VAL A CG2 1 
ATOM   1047 N  N   . CYS A 1 189 ? -20.689 24.034  -19.138 1.00 48.17  ? 185  CYS A N   1 
ATOM   1048 C  CA  . CYS A 1 189 ? -20.890 23.058  -18.077 1.00 47.50  ? 185  CYS A CA  1 
ATOM   1049 C  C   . CYS A 1 189 ? -19.600 22.311  -17.793 1.00 46.34  ? 185  CYS A C   1 
ATOM   1050 O  O   . CYS A 1 189 ? -19.279 21.345  -18.469 1.00 47.39  ? 185  CYS A O   1 
ATOM   1051 C  CB  . CYS A 1 189 ? -22.007 22.079  -18.434 1.00 48.09  ? 185  CYS A CB  1 
ATOM   1052 S  SG  . CYS A 1 189 ? -22.494 21.040  -17.019 1.00 50.16  ? 185  CYS A SG  1 
ATOM   1053 N  N   . ARG A 1 190 ? -18.856 22.787  -16.799 1.00 47.98  ? 186  ARG A N   1 
ATOM   1054 C  CA  . ARG A 1 190 ? -17.571 22.199  -16.430 1.00 45.86  ? 186  ARG A CA  1 
ATOM   1055 C  C   . ARG A 1 190 ? -17.411 22.164  -14.917 1.00 45.23  ? 186  ARG A C   1 
ATOM   1056 O  O   . ARG A 1 190 ? -18.018 22.964  -14.203 1.00 45.79  ? 186  ARG A O   1 
ATOM   1057 C  CB  . ARG A 1 190 ? -16.415 23.001  -17.033 1.00 48.16  ? 186  ARG A CB  1 
ATOM   1058 C  CG  . ARG A 1 190 ? -16.403 23.099  -18.534 1.00 52.31  ? 186  ARG A CG  1 
ATOM   1059 C  CD  . ARG A 1 190 ? -15.049 23.613  -19.036 1.00 56.91  ? 186  ARG A CD  1 
ATOM   1060 N  NE  . ARG A 1 190 ? -15.167 24.295  -20.318 1.00 56.01  ? 186  ARG A NE  1 
ATOM   1061 C  CZ  . ARG A 1 190 ? -15.054 25.606  -20.498 1.00 56.22  ? 186  ARG A CZ  1 
ATOM   1062 N  NH1 . ARG A 1 190 ? -14.775 26.420  -19.482 1.00 50.97  ? 186  ARG A NH1 1 
ATOM   1063 N  NH2 . ARG A 1 190 ? -15.191 26.105  -21.716 1.00 58.73  ? 186  ARG A NH2 1 
ATOM   1064 N  N   . LEU A 1 191 ? -16.586 21.239  -14.432 1.00 40.57  ? 187  LEU A N   1 
ATOM   1065 C  CA  . LEU A 1 191 ? -16.215 21.221  -13.028 1.00 41.78  ? 187  LEU A CA  1 
ATOM   1066 C  C   . LEU A 1 191 ? -15.096 22.221  -12.826 1.00 43.58  ? 187  LEU A C   1 
ATOM   1067 O  O   . LEU A 1 191 ? -13.955 21.957  -13.203 1.00 44.51  ? 187  LEU A O   1 
ATOM   1068 C  CB  . LEU A 1 191 ? -15.761 19.828  -12.575 1.00 42.26  ? 187  LEU A CB  1 
ATOM   1069 C  CG  . LEU A 1 191 ? -16.818 18.756  -12.374 1.00 45.44  ? 187  LEU A CG  1 
ATOM   1070 C  CD1 . LEU A 1 191 ? -16.178 17.449  -11.967 1.00 41.71  ? 187  LEU A CD1 1 
ATOM   1071 C  CD2 . LEU A 1 191 ? -17.815 19.212  -11.319 1.00 48.77  ? 187  LEU A CD2 1 
ATOM   1072 N  N   . GLU A 1 192 ? -15.418 23.370  -12.250 1.00 44.43  ? 188  GLU A N   1 
ATOM   1073 C  CA  . GLU A 1 192 ? -14.440 24.438  -12.126 1.00 47.44  ? 188  GLU A CA  1 
ATOM   1074 C  C   . GLU A 1 192 ? -13.669 24.337  -10.815 1.00 50.77  ? 188  GLU A C   1 
ATOM   1075 O  O   . GLU A 1 192 ? -12.655 25.004  -10.647 1.00 53.95  ? 188  GLU A O   1 
ATOM   1076 C  CB  . GLU A 1 192 ? -15.127 25.805  -12.245 1.00 51.10  ? 188  GLU A CB  1 
ATOM   1077 C  CG  . GLU A 1 192 ? -15.949 25.985  -13.522 1.00 54.37  ? 188  GLU A CG  1 
ATOM   1078 C  CD  . GLU A 1 192 ? -16.906 27.182  -13.475 1.00 61.04  ? 188  GLU A CD  1 
ATOM   1079 O  OE1 . GLU A 1 192 ? -17.005 27.863  -12.422 1.00 61.99  ? 188  GLU A OE1 1 
ATOM   1080 O  OE2 . GLU A 1 192 ? -17.572 27.445  -14.503 1.00 62.30  ? 188  GLU A OE2 1 
ATOM   1081 N  N   . ASP A 1 193 ? -14.139 23.508  -9.885  1.00 44.24  ? 189  ASP A N   1 
ATOM   1082 C  CA  . ASP A 1 193 ? -13.460 23.389  -8.594  1.00 42.71  ? 189  ASP A CA  1 
ATOM   1083 C  C   . ASP A 1 193 ? -12.197 22.552  -8.736  1.00 41.30  ? 189  ASP A C   1 
ATOM   1084 O  O   . ASP A 1 193 ? -12.258 21.335  -8.897  1.00 40.35  ? 189  ASP A O   1 
ATOM   1085 C  CB  . ASP A 1 193 ? -14.384 22.782  -7.539  1.00 45.94  ? 189  ASP A CB  1 
ATOM   1086 C  CG  . ASP A 1 193 ? -13.798 22.856  -6.141  1.00 49.30  ? 189  ASP A CG  1 
ATOM   1087 O  OD1 . ASP A 1 193 ? -12.628 22.475  -5.930  1.00 45.24  ? 189  ASP A OD1 1 
ATOM   1088 O  OD2 . ASP A 1 193 ? -14.496 23.361  -5.243  1.00 58.65  ? 189  ASP A OD2 1 
ATOM   1089 N  N   . ARG A 1 194 ? -11.047 23.209  -8.660  1.00 40.76  ? 190  ARG A N   1 
ATOM   1090 C  CA  . ARG A 1 194 ? -9.799  22.513  -8.910  1.00 42.02  ? 190  ARG A CA  1 
ATOM   1091 C  C   . ARG A 1 194 ? -9.478  21.481  -7.827  1.00 40.43  ? 190  ARG A C   1 
ATOM   1092 O  O   . ARG A 1 194 ? -8.981  20.405  -8.137  1.00 40.38  ? 190  ARG A O   1 
ATOM   1093 C  CB  . ARG A 1 194 ? -8.659  23.516  -9.054  1.00 42.16  ? 190  ARG A CB  1 
ATOM   1094 C  CG  . ARG A 1 194 ? -8.788  24.403  -10.298 1.00 44.04  ? 190  ARG A CG  1 
ATOM   1095 C  CD  . ARG A 1 194 ? -7.779  25.555  -10.272 1.00 46.31  ? 190  ARG A CD  1 
ATOM   1096 N  NE  . ARG A 1 194 ? -6.431  25.076  -9.978  1.00 44.97  ? 190  ARG A NE  1 
ATOM   1097 C  CZ  . ARG A 1 194 ? -5.479  25.804  -9.402  1.00 50.65  ? 190  ARG A CZ  1 
ATOM   1098 N  NH1 . ARG A 1 194 ? -5.723  27.049  -9.026  1.00 48.76  ? 190  ARG A NH1 1 
ATOM   1099 N  NH2 . ARG A 1 194 ? -4.275  25.276  -9.185  1.00 53.51  ? 190  ARG A NH2 1 
ATOM   1100 N  N   . ASP A 1 195 ? -9.757  21.804  -6.569  1.00 38.80  ? 191  ASP A N   1 
ATOM   1101 C  CA  . ASP A 1 195 ? -9.495  20.861  -5.481  1.00 36.13  ? 191  ASP A CA  1 
ATOM   1102 C  C   . ASP A 1 195 ? -10.346 19.598  -5.669  1.00 36.52  ? 191  ASP A C   1 
ATOM   1103 O  O   . ASP A 1 195 ? -9.884  18.470  -5.452  1.00 37.07  ? 191  ASP A O   1 
ATOM   1104 C  CB  . ASP A 1 195 ? -9.797  21.486  -4.118  1.00 41.21  ? 191  ASP A CB  1 
ATOM   1105 C  CG  . ASP A 1 195 ? -8.895  22.678  -3.797  1.00 49.58  ? 191  ASP A CG  1 
ATOM   1106 O  OD1 . ASP A 1 195 ? -7.689  22.469  -3.589  1.00 51.64  ? 191  ASP A OD1 1 
ATOM   1107 O  OD2 . ASP A 1 195 ? -9.394  23.817  -3.715  1.00 53.24  ? 191  ASP A OD2 1 
ATOM   1108 N  N   . TYR A 1 196 ? -11.596 19.781  -6.070  1.00 32.86  ? 192  TYR A N   1 
ATOM   1109 C  CA  . TYR A 1 196 ? -12.449 18.607  -6.233  1.00 32.39  ? 192  TYR A CA  1 
ATOM   1110 C  C   . TYR A 1 196 ? -11.953 17.711  -7.377  1.00 33.20  ? 192  TYR A C   1 
ATOM   1111 O  O   . TYR A 1 196 ? -11.926 16.480  -7.255  1.00 32.47  ? 192  TYR A O   1 
ATOM   1112 C  CB  . TYR A 1 196 ? -13.913 19.006  -6.482  1.00 33.26  ? 192  TYR A CB  1 
ATOM   1113 C  CG  . TYR A 1 196 ? -14.754 17.763  -6.653  1.00 34.29  ? 192  TYR A CG  1 
ATOM   1114 C  CD1 . TYR A 1 196 ? -15.209 17.055  -5.550  1.00 33.20  ? 192  TYR A CD1 1 
ATOM   1115 C  CD2 . TYR A 1 196 ? -15.019 17.257  -7.915  1.00 33.27  ? 192  TYR A CD2 1 
ATOM   1116 C  CE1 . TYR A 1 196 ? -15.946 15.878  -5.711  1.00 33.69  ? 192  TYR A CE1 1 
ATOM   1117 C  CE2 . TYR A 1 196 ? -15.720 16.111  -8.081  1.00 34.26  ? 192  TYR A CE2 1 
ATOM   1118 C  CZ  . TYR A 1 196 ? -16.189 15.421  -6.990  1.00 34.88  ? 192  TYR A CZ  1 
ATOM   1119 O  OH  . TYR A 1 196 ? -16.901 14.268  -7.211  1.00 35.42  ? 192  TYR A OH  1 
ATOM   1120 N  N   . VAL A 1 197 ? -11.578 18.332  -8.490  1.00 34.89  ? 193  VAL A N   1 
ATOM   1121 C  CA  . VAL A 1 197 ? -11.135 17.587  -9.657  1.00 33.88  ? 193  VAL A CA  1 
ATOM   1122 C  C   . VAL A 1 197 ? -9.892  16.739  -9.331  1.00 33.17  ? 193  VAL A C   1 
ATOM   1123 O  O   . VAL A 1 197 ? -9.818  15.566  -9.733  1.00 33.82  ? 193  VAL A O   1 
ATOM   1124 C  CB  . VAL A 1 197 ? -10.857 18.540  -10.847 1.00 33.16  ? 193  VAL A CB  1 
ATOM   1125 C  CG1 . VAL A 1 197 ? -10.118 17.818  -11.984 1.00 34.11  ? 193  VAL A CG1 1 
ATOM   1126 C  CG2 . VAL A 1 197 ? -12.166 19.109  -11.359 1.00 34.80  ? 193  VAL A CG2 1 
ATOM   1127 N  N   . VAL A 1 198 ? -8.947  17.296  -8.575  1.00 34.92  ? 194  VAL A N   1 
ATOM   1128 C  CA  . VAL A 1 198 ? -7.769  16.523  -8.171  1.00 34.20  ? 194  VAL A CA  1 
ATOM   1129 C  C   . VAL A 1 198 ? -8.187  15.349  -7.286  1.00 34.62  ? 194  VAL A C   1 
ATOM   1130 O  O   . VAL A 1 198 ? -7.773  14.201  -7.515  1.00 33.58  ? 194  VAL A O   1 
ATOM   1131 C  CB  . VAL A 1 198 ? -6.726  17.374  -7.412  1.00 35.55  ? 194  VAL A CB  1 
ATOM   1132 C  CG1 . VAL A 1 198 ? -5.542  16.500  -7.013  1.00 35.54  ? 194  VAL A CG1 1 
ATOM   1133 C  CG2 . VAL A 1 198 ? -6.241  18.543  -8.278  1.00 36.26  ? 194  VAL A CG2 1 
ATOM   1134 N  N   . TYR A 1 199 ? -9.009  15.647  -6.288  1.00 34.90  ? 195  TYR A N   1 
ATOM   1135 C  CA  . TYR A 1 199 ? -9.569  14.637  -5.386  1.00 35.35  ? 195  TYR A CA  1 
ATOM   1136 C  C   . TYR A 1 199 ? -10.199 13.463  -6.125  1.00 37.04  ? 195  TYR A C   1 
ATOM   1137 O  O   . TYR A 1 199 ? -9.838  12.288  -5.899  1.00 33.42  ? 195  TYR A O   1 
ATOM   1138 C  CB  . TYR A 1 199 ? -10.607 15.300  -4.465  1.00 35.89  ? 195  TYR A CB  1 
ATOM   1139 C  CG  . TYR A 1 199 ? -11.592 14.343  -3.837  1.00 35.21  ? 195  TYR A CG  1 
ATOM   1140 C  CD1 . TYR A 1 199 ? -11.163 13.326  -2.978  1.00 38.62  ? 195  TYR A CD1 1 
ATOM   1141 C  CD2 . TYR A 1 199 ? -12.952 14.458  -4.095  1.00 36.62  ? 195  TYR A CD2 1 
ATOM   1142 C  CE1 . TYR A 1 199 ? -12.080 12.433  -2.400  1.00 37.02  ? 195  TYR A CE1 1 
ATOM   1143 C  CE2 . TYR A 1 199 ? -13.875 13.591  -3.517  1.00 40.39  ? 195  TYR A CE2 1 
ATOM   1144 C  CZ  . TYR A 1 199 ? -13.433 12.583  -2.673  1.00 42.13  ? 195  TYR A CZ  1 
ATOM   1145 O  OH  . TYR A 1 199 ? -14.355 11.734  -2.113  1.00 44.09  ? 195  TYR A OH  1 
ATOM   1146 N  N   . SER A 1 200 ? -11.125 13.764  -7.026  1.00 33.74  ? 196  SER A N   1 
ATOM   1147 C  CA  . SER A 1 200 ? -11.805 12.690  -7.734  1.00 34.44  ? 196  SER A CA  1 
ATOM   1148 C  C   . SER A 1 200 ? -10.903 11.993  -8.744  1.00 34.22  ? 196  SER A C   1 
ATOM   1149 O  O   . SER A 1 200 ? -11.026 10.788  -8.929  1.00 34.93  ? 196  SER A O   1 
ATOM   1150 C  CB  . SER A 1 200 ? -13.067 13.197  -8.443  1.00 36.72  ? 196  SER A CB  1 
ATOM   1151 O  OG  . SER A 1 200 ? -13.646 12.137  -9.222  1.00 36.04  ? 196  SER A OG  1 
ATOM   1152 N  N   . SER A 1 201 ? -10.010 12.726  -9.400  1.00 33.57  ? 197  SER A N   1 
ATOM   1153 C  CA  . SER A 1 201 ? -9.057  12.114  -10.328 1.00 31.60  ? 197  SER A CA  1 
ATOM   1154 C  C   . SER A 1 201 ? -8.216  11.057  -9.592  1.00 32.05  ? 197  SER A C   1 
ATOM   1155 O  O   . SER A 1 201 ? -7.969  9.976   -10.116 1.00 33.21  ? 197  SER A O   1 
ATOM   1156 C  CB  . SER A 1 201 ? -8.134  13.164  -10.959 1.00 34.02  ? 197  SER A CB  1 
ATOM   1157 O  OG  . SER A 1 201 ? -8.852  13.984  -11.878 1.00 35.78  ? 197  SER A OG  1 
ATOM   1158 N  N   . VAL A 1 202 ? -7.796  11.383  -8.380  1.00 35.05  ? 198  VAL A N   1 
ATOM   1159 C  CA  . VAL A 1 202 ? -7.049  10.451  -7.550  1.00 33.86  ? 198  VAL A CA  1 
ATOM   1160 C  C   . VAL A 1 202 ? -7.918  9.308   -7.043  1.00 34.69  ? 198  VAL A C   1 
ATOM   1161 O  O   . VAL A 1 202 ? -7.571  8.136   -7.185  1.00 34.27  ? 198  VAL A O   1 
ATOM   1162 C  CB  . VAL A 1 202 ? -6.427  11.174  -6.353  1.00 35.35  ? 198  VAL A CB  1 
ATOM   1163 C  CG1 . VAL A 1 202 ? -5.800  10.162  -5.407  1.00 34.96  ? 198  VAL A CG1 1 
ATOM   1164 C  CG2 . VAL A 1 202 ? -5.382  12.206  -6.843  1.00 36.76  ? 198  VAL A CG2 1 
ATOM   1165 N  N   . CYS A 1 203 ? -9.063  9.651   -6.463  1.00 33.37  ? 199  CYS A N   1 
ATOM   1166 C  CA  . CYS A 1 203 ? -9.897  8.646   -5.820  1.00 34.32  ? 199  CYS A CA  1 
ATOM   1167 C  C   . CYS A 1 203 ? -10.597 7.753   -6.818  1.00 34.83  ? 199  CYS A C   1 
ATOM   1168 O  O   . CYS A 1 203 ? -10.756 6.548   -6.579  1.00 33.88  ? 199  CYS A O   1 
ATOM   1169 C  CB  . CYS A 1 203 ? -10.926 9.316   -4.913  1.00 38.61  ? 199  CYS A CB  1 
ATOM   1170 S  SG  . CYS A 1 203 ? -10.169 9.777   -3.355  1.00 72.65  ? 199  CYS A SG  1 
ATOM   1171 N  N   . SER A 1 204 ? -10.985 8.324   -7.954  1.00 34.79  ? 200  SER A N   1 
ATOM   1172 C  CA  . SER A 1 204 ? -11.747 7.564   -8.934  1.00 34.51  ? 200  SER A CA  1 
ATOM   1173 C  C   . SER A 1 204 ? -10.864 6.846   -9.919  1.00 35.92  ? 200  SER A C   1 
ATOM   1174 O  O   . SER A 1 204 ? -11.314 5.882   -10.513 1.00 35.56  ? 200  SER A O   1 
ATOM   1175 C  CB  . SER A 1 204 ? -12.710 8.466   -9.711  1.00 33.60  ? 200  SER A CB  1 
ATOM   1176 O  OG  . SER A 1 204 ? -13.634 9.078   -8.833  1.00 38.37  ? 200  SER A OG  1 
ATOM   1177 N  N   . PHE A 1 205 ? -9.622  7.281   -10.104 1.00 31.69  ? 201  PHE A N   1 
ATOM   1178 C  CA  . PHE A 1 205 ? -8.814  6.699   -11.172 1.00 31.23  ? 201  PHE A CA  1 
ATOM   1179 C  C   . PHE A 1 205 ? -7.367  6.362   -10.808 1.00 31.93  ? 201  PHE A C   1 
ATOM   1180 O  O   . PHE A 1 205 ? -6.979  5.194   -10.874 1.00 32.76  ? 201  PHE A O   1 
ATOM   1181 C  CB  . PHE A 1 205 ? -8.829  7.635   -12.390 1.00 33.87  ? 201  PHE A CB  1 
ATOM   1182 C  CG  . PHE A 1 205 ? -8.137  7.075   -13.604 1.00 32.74  ? 201  PHE A CG  1 
ATOM   1183 C  CD1 . PHE A 1 205 ? -8.779  6.153   -14.415 1.00 34.92  ? 201  PHE A CD1 1 
ATOM   1184 C  CD2 . PHE A 1 205 ? -6.858  7.492   -13.942 1.00 34.68  ? 201  PHE A CD2 1 
ATOM   1185 C  CE1 . PHE A 1 205 ? -8.154  5.651   -15.534 1.00 36.37  ? 201  PHE A CE1 1 
ATOM   1186 C  CE2 . PHE A 1 205 ? -6.224  6.995   -15.064 1.00 34.46  ? 201  PHE A CE2 1 
ATOM   1187 C  CZ  . PHE A 1 205 ? -6.875  6.062   -15.855 1.00 34.68  ? 201  PHE A CZ  1 
ATOM   1188 N  N   . PHE A 1 206 ? -6.564  7.349   -10.427 1.00 35.36  ? 202  PHE A N   1 
ATOM   1189 C  CA  . PHE A 1 206 ? -5.124  7.100   -10.295 1.00 35.12  ? 202  PHE A CA  1 
ATOM   1190 C  C   . PHE A 1 206 ? -4.776  6.210   -9.095  1.00 37.62  ? 202  PHE A C   1 
ATOM   1191 O  O   . PHE A 1 206 ? -3.713  5.620   -9.058  1.00 37.22  ? 202  PHE A O   1 
ATOM   1192 C  CB  . PHE A 1 206 ? -4.353  8.420   -10.211 1.00 34.59  ? 202  PHE A CB  1 
ATOM   1193 C  CG  . PHE A 1 206 ? -4.326  9.181   -11.509 1.00 35.38  ? 202  PHE A CG  1 
ATOM   1194 C  CD1 . PHE A 1 206 ? -3.736  8.632   -12.638 1.00 35.75  ? 202  PHE A CD1 1 
ATOM   1195 C  CD2 . PHE A 1 206 ? -4.914  10.436  -11.611 1.00 37.71  ? 202  PHE A CD2 1 
ATOM   1196 C  CE1 . PHE A 1 206 ? -3.720  9.333   -13.846 1.00 38.11  ? 202  PHE A CE1 1 
ATOM   1197 C  CE2 . PHE A 1 206 ? -4.899  11.154  -12.819 1.00 37.70  ? 202  PHE A CE2 1 
ATOM   1198 C  CZ  . PHE A 1 206 ? -4.315  10.605  -13.934 1.00 36.95  ? 202  PHE A CZ  1 
ATOM   1199 N  N   . LEU A 1 207 ? -5.669  6.125   -8.118  1.00 41.41  ? 203  LEU A N   1 
ATOM   1200 C  CA  . LEU A 1 207 ? -5.446  5.253   -6.967  1.00 41.70  ? 203  LEU A CA  1 
ATOM   1201 C  C   . LEU A 1 207 ? -6.024  3.830   -7.166  1.00 43.74  ? 203  LEU A C   1 
ATOM   1202 O  O   . LEU A 1 207 ? -5.333  2.835   -6.913  1.00 42.44  ? 203  LEU A O   1 
ATOM   1203 C  CB  . LEU A 1 207 ? -6.014  5.923   -5.711  1.00 43.01  ? 203  LEU A CB  1 
ATOM   1204 C  CG  . LEU A 1 207 ? -5.621  5.438   -4.329  1.00 45.10  ? 203  LEU A CG  1 
ATOM   1205 C  CD1 . LEU A 1 207 ? -4.109  5.208   -4.259  1.00 49.64  ? 203  LEU A CD1 1 
ATOM   1206 C  CD2 . LEU A 1 207 ? -6.061  6.473   -3.305  1.00 48.42  ? 203  LEU A CD2 1 
ATOM   1207 N  N   . PRO A 1 208 ? -7.274  3.709   -7.648  1.00 42.05  ? 204  PRO A N   1 
ATOM   1208 C  CA  . PRO A 1 208 ? -7.745  2.343   -7.913  1.00 41.41  ? 204  PRO A CA  1 
ATOM   1209 C  C   . PRO A 1 208 ? -7.022  1.590   -9.049  1.00 42.00  ? 204  PRO A C   1 
ATOM   1210 O  O   . PRO A 1 208 ? -6.909  0.348   -8.974  1.00 39.81  ? 204  PRO A O   1 
ATOM   1211 C  CB  . PRO A 1 208 ? -9.224  2.545   -8.276  1.00 42.33  ? 204  PRO A CB  1 
ATOM   1212 C  CG  . PRO A 1 208 ? -9.371  3.964   -8.589  1.00 43.89  ? 204  PRO A CG  1 
ATOM   1213 C  CD  . PRO A 1 208 ? -8.368  4.689   -7.768  1.00 42.65  ? 204  PRO A CD  1 
ATOM   1214 N  N   . CYS A 1 209 ? -6.544  2.292   -10.077 1.00 39.52  ? 205  CYS A N   1 
ATOM   1215 C  CA  . CYS A 1 209 ? -5.935  1.587   -11.198 1.00 41.08  ? 205  CYS A CA  1 
ATOM   1216 C  C   . CYS A 1 209 ? -4.697  0.753   -10.798 1.00 40.75  ? 205  CYS A C   1 
ATOM   1217 O  O   . CYS A 1 209 ? -4.640  -0.429  -11.124 1.00 41.69  ? 205  CYS A O   1 
ATOM   1218 C  CB  . CYS A 1 209 ? -5.607  2.566   -12.329 1.00 40.96  ? 205  CYS A CB  1 
ATOM   1219 S  SG  . CYS A 1 209 ? -7.099  3.077   -13.208 1.00 54.92  ? 205  CYS A SG  1 
ATOM   1220 N  N   . PRO A 1 210 ? -3.724  1.331   -10.069 1.00 41.44  ? 206  PRO A N   1 
ATOM   1221 C  CA  . PRO A 1 210 ? -2.617  0.454   -9.655  1.00 42.30  ? 206  PRO A CA  1 
ATOM   1222 C  C   . PRO A 1 210 ? -3.045  -0.688  -8.728  1.00 42.02  ? 206  PRO A C   1 
ATOM   1223 O  O   . PRO A 1 210 ? -2.510  -1.788  -8.816  1.00 43.35  ? 206  PRO A O   1 
ATOM   1224 C  CB  . PRO A 1 210 ? -1.662  1.412   -8.921  1.00 43.71  ? 206  PRO A CB  1 
ATOM   1225 C  CG  . PRO A 1 210 ? -2.495  2.597   -8.571  1.00 41.47  ? 206  PRO A CG  1 
ATOM   1226 C  CD  . PRO A 1 210 ? -3.461  2.731   -9.702  1.00 41.76  ? 206  PRO A CD  1 
ATOM   1227 N  N   . LEU A 1 211 ? -3.989  -0.425  -7.841  1.00 41.81  ? 207  LEU A N   1 
ATOM   1228 C  CA  . LEU A 1 211 ? -4.442  -1.455  -6.931  1.00 41.50  ? 207  LEU A CA  1 
ATOM   1229 C  C   . LEU A 1 211 ? -5.108  -2.595  -7.691  1.00 42.97  ? 207  LEU A C   1 
ATOM   1230 O  O   . LEU A 1 211 ? -4.818  -3.761  -7.446  1.00 44.98  ? 207  LEU A O   1 
ATOM   1231 C  CB  . LEU A 1 211 ? -5.400  -0.871  -5.895  1.00 42.96  ? 207  LEU A CB  1 
ATOM   1232 C  CG  . LEU A 1 211 ? -4.751  0.214   -5.026  1.00 49.50  ? 207  LEU A CG  1 
ATOM   1233 C  CD1 . LEU A 1 211 ? -5.721  0.706   -3.945  1.00 53.26  ? 207  LEU A CD1 1 
ATOM   1234 C  CD2 . LEU A 1 211 ? -3.418  -0.242  -4.425  1.00 50.08  ? 207  LEU A CD2 1 
ATOM   1235 N  N   . MET A 1 212 ? -5.998  -2.262  -8.614  1.00 38.09  ? 208  MET A N   1 
ATOM   1236 C  CA  . MET A 1 212 ? -6.626  -3.283  -9.437  1.00 38.06  ? 208  MET A CA  1 
ATOM   1237 C  C   . MET A 1 212 ? -5.630  -4.073  -10.309 1.00 39.38  ? 208  MET A C   1 
ATOM   1238 O  O   . MET A 1 212 ? -5.766  -5.295  -10.456 1.00 39.89  ? 208  MET A O   1 
ATOM   1239 C  CB  . MET A 1 212 ? -7.733  -2.635  -10.278 1.00 40.81  ? 208  MET A CB  1 
ATOM   1240 C  CG  . MET A 1 212 ? -7.659  -2.808  -11.773 1.00 44.41  ? 208  MET A CG  1 
ATOM   1241 S  SD  . MET A 1 212 ? -9.067  -1.953  -12.543 1.00 44.37  ? 208  MET A SD  1 
ATOM   1242 C  CE  . MET A 1 212 ? -9.064  -0.362  -11.728 1.00 46.99  ? 208  MET A CE  1 
ATOM   1243 N  N   . LEU A 1 213 ? -4.619  -3.405  -10.854 1.00 34.79  ? 209  LEU A N   1 
ATOM   1244 C  CA  . LEU A 1 213 ? -3.609  -4.099  -11.656 1.00 37.20  ? 209  LEU A CA  1 
ATOM   1245 C  C   . LEU A 1 213 ? -2.802  -5.087  -10.804 1.00 37.92  ? 209  LEU A C   1 
ATOM   1246 O  O   . LEU A 1 213 ? -2.481  -6.182  -11.264 1.00 39.79  ? 209  LEU A O   1 
ATOM   1247 C  CB  . LEU A 1 213 ? -2.676  -3.097  -12.344 1.00 38.69  ? 209  LEU A CB  1 
ATOM   1248 C  CG  . LEU A 1 213 ? -3.392  -2.253  -13.401 1.00 42.28  ? 209  LEU A CG  1 
ATOM   1249 C  CD1 . LEU A 1 213 ? -2.473  -1.172  -13.921 1.00 42.85  ? 209  LEU A CD1 1 
ATOM   1250 C  CD2 . LEU A 1 213 ? -3.911  -3.105  -14.547 1.00 43.44  ? 209  LEU A CD2 1 
ATOM   1251 N  N   . LEU A 1 214 ? -2.496  -4.717  -9.561  1.00 38.89  ? 210  LEU A N   1 
ATOM   1252 C  CA  A LEU A 1 214 ? -1.787  -5.617  -8.652  0.48 39.76  ? 210  LEU A CA  1 
ATOM   1253 C  CA  B LEU A 1 214 ? -1.773  -5.625  -8.672  0.52 39.73  ? 210  LEU A CA  1 
ATOM   1254 C  C   . LEU A 1 214 ? -2.628  -6.844  -8.293  1.00 40.47  ? 210  LEU A C   1 
ATOM   1255 O  O   . LEU A 1 214 ? -2.119  -7.983  -8.203  1.00 40.59  ? 210  LEU A O   1 
ATOM   1256 C  CB  A LEU A 1 214 ? -1.387  -4.878  -7.378  0.48 39.35  ? 210  LEU A CB  1 
ATOM   1257 C  CB  B LEU A 1 214 ? -1.309  -4.883  -7.416  0.52 39.56  ? 210  LEU A CB  1 
ATOM   1258 C  CG  A LEU A 1 214 ? -0.899  -5.766  -6.235  0.48 40.37  ? 210  LEU A CG  1 
ATOM   1259 C  CG  B LEU A 1 214 ? -0.166  -3.876  -7.615  0.52 39.58  ? 210  LEU A CG  1 
ATOM   1260 C  CD1 A LEU A 1 214 ? 0.424   -6.439  -6.592  0.48 41.25  ? 210  LEU A CD1 1 
ATOM   1261 C  CD1 B LEU A 1 214 ? 0.078   -3.079  -6.348  0.52 41.14  ? 210  LEU A CD1 1 
ATOM   1262 C  CD2 A LEU A 1 214 ? -0.767  -4.959  -4.953  0.48 40.70  ? 210  LEU A CD2 1 
ATOM   1263 C  CD2 B LEU A 1 214 ? 1.112   -4.580  -8.047  0.52 40.61  ? 210  LEU A CD2 1 
ATOM   1264 N  N   . LEU A 1 215 ? -3.917  -6.622  -8.072  1.00 36.97  ? 211  LEU A N   1 
ATOM   1265 C  CA  . LEU A 1 215 ? -4.803  -7.720  -7.696  1.00 39.90  ? 211  LEU A CA  1 
ATOM   1266 C  C   . LEU A 1 215 ? -5.051  -8.674  -8.855  1.00 40.87  ? 211  LEU A C   1 
ATOM   1267 O  O   . LEU A 1 215 ? -5.075  -9.889  -8.648  1.00 41.62  ? 211  LEU A O   1 
ATOM   1268 C  CB  . LEU A 1 215 ? -6.132  -7.182  -7.160  1.00 38.76  ? 211  LEU A CB  1 
ATOM   1269 C  CG  . LEU A 1 215 ? -6.045  -6.691  -5.718  1.00 40.48  ? 211  LEU A CG  1 
ATOM   1270 C  CD1 . LEU A 1 215 ? -7.363  -6.090  -5.262  1.00 42.62  ? 211  LEU A CD1 1 
ATOM   1271 C  CD2 . LEU A 1 215 ? -5.652  -7.870  -4.819  1.00 42.33  ? 211  LEU A CD2 1 
ATOM   1272 N  N   . TYR A 1 216 ? -5.254  -8.148  -10.063 1.00 38.81  ? 212  TYR A N   1 
ATOM   1273 C  CA  . TYR A 1 216 ? -5.428  -9.022  -11.222 1.00 39.41  ? 212  TYR A CA  1 
ATOM   1274 C  C   . TYR A 1 216 ? -4.172  -9.872  -11.389 1.00 43.18  ? 212  TYR A C   1 
ATOM   1275 O  O   . TYR A 1 216 ? -4.263  -11.079 -11.639 1.00 41.19  ? 212  TYR A O   1 
ATOM   1276 C  CB  . TYR A 1 216 ? -5.724  -8.224  -12.493 1.00 39.47  ? 212  TYR A CB  1 
ATOM   1277 C  CG  . TYR A 1 216 ? -7.180  -7.793  -12.609 1.00 39.74  ? 212  TYR A CG  1 
ATOM   1278 C  CD1 . TYR A 1 216 ? -8.200  -8.739  -12.693 1.00 42.47  ? 212  TYR A CD1 1 
ATOM   1279 C  CD2 . TYR A 1 216 ? -7.533  -6.446  -12.624 1.00 37.54  ? 212  TYR A CD2 1 
ATOM   1280 C  CE1 . TYR A 1 216 ? -9.524  -8.358  -12.794 1.00 40.12  ? 212  TYR A CE1 1 
ATOM   1281 C  CE2 . TYR A 1 216 ? -8.859  -6.054  -12.717 1.00 40.38  ? 212  TYR A CE2 1 
ATOM   1282 C  CZ  . TYR A 1 216 ? -9.849  -7.021  -12.798 1.00 41.68  ? 212  TYR A CZ  1 
ATOM   1283 O  OH  . TYR A 1 216 ? -11.167 -6.640  -12.891 1.00 39.10  ? 212  TYR A OH  1 
ATOM   1284 N  N   . TRP A 1 217 ? -3.003  -9.254  -11.202 1.00 40.29  ? 213  TRP A N   1 
ATOM   1285 C  CA  . TRP A 1 217 ? -1.732  -9.981  -11.339 1.00 41.90  ? 213  TRP A CA  1 
ATOM   1286 C  C   . TRP A 1 217 ? -1.563  -11.118 -10.318 1.00 44.36  ? 213  TRP A C   1 
ATOM   1287 O  O   . TRP A 1 217 ? -1.179  -12.246 -10.678 1.00 46.08  ? 213  TRP A O   1 
ATOM   1288 C  CB  . TRP A 1 217 ? -0.555  -9.015  -11.231 1.00 41.84  ? 213  TRP A CB  1 
ATOM   1289 C  CG  . TRP A 1 217 ? 0.767   -9.720  -11.125 1.00 51.26  ? 213  TRP A CG  1 
ATOM   1290 C  CD1 . TRP A 1 217 ? 1.513   -10.231 -12.149 1.00 49.59  ? 213  TRP A CD1 1 
ATOM   1291 C  CD2 . TRP A 1 217 ? 1.498   -9.991  -9.920  1.00 56.56  ? 213  TRP A CD2 1 
ATOM   1292 N  NE1 . TRP A 1 217 ? 2.666   -10.800 -11.657 1.00 49.44  ? 213  TRP A NE1 1 
ATOM   1293 C  CE2 . TRP A 1 217 ? 2.678   -10.670 -10.293 1.00 54.55  ? 213  TRP A CE2 1 
ATOM   1294 C  CE3 . TRP A 1 217 ? 1.265   -9.731  -8.563  1.00 56.80  ? 213  TRP A CE3 1 
ATOM   1295 C  CZ2 . TRP A 1 217 ? 3.625   -11.089 -9.352  1.00 54.43  ? 213  TRP A CZ2 1 
ATOM   1296 C  CZ3 . TRP A 1 217 ? 2.211   -10.149 -7.629  1.00 53.92  ? 213  TRP A CZ3 1 
ATOM   1297 C  CH2 . TRP A 1 217 ? 3.374   -10.815 -8.031  1.00 52.20  ? 213  TRP A CH2 1 
ATOM   1298 N  N   . ALA A 1 218 ? -1.844  -10.827 -9.053  1.00 40.73  ? 214  ALA A N   1 
ATOM   1299 C  CA  . ALA A 1 218 ? -1.805  -11.839 -8.001  1.00 41.17  ? 214  ALA A CA  1 
ATOM   1300 C  C   . ALA A 1 218 ? -2.780  -12.988 -8.276  1.00 42.62  ? 214  ALA A C   1 
ATOM   1301 O  O   . ALA A 1 218 ? -2.453  -14.144 -8.048  1.00 45.51  ? 214  ALA A O   1 
ATOM   1302 C  CB  . ALA A 1 218 ? -2.114  -11.212 -6.659  1.00 39.55  ? 214  ALA A CB  1 
ATOM   1303 N  N   . THR A 1 219 ? -3.975  -12.651 -8.754  1.00 40.72  ? 215  THR A N   1 
ATOM   1304 C  CA  . THR A 1 219 ? -5.009  -13.632 -9.054  1.00 43.83  ? 215  THR A CA  1 
ATOM   1305 C  C   . THR A 1 219 ? -4.576  -14.600 -10.147 1.00 43.17  ? 215  THR A C   1 
ATOM   1306 O  O   . THR A 1 219 ? -4.698  -15.817 -9.994  1.00 42.16  ? 215  THR A O   1 
ATOM   1307 C  CB  . THR A 1 219 ? -6.315  -12.957 -9.490  1.00 42.49  ? 215  THR A CB  1 
ATOM   1308 O  OG1 . THR A 1 219 ? -6.835  -12.196 -8.399  1.00 42.29  ? 215  THR A OG1 1 
ATOM   1309 C  CG2 . THR A 1 219 ? -7.348  -14.013 -9.901  1.00 43.75  ? 215  THR A CG2 1 
ATOM   1310 N  N   . PHE A 1 220 ? -4.072  -14.065 -11.251 1.00 44.56  ? 216  PHE A N   1 
ATOM   1311 C  CA  . PHE A 1 220 ? -3.601  -14.919 -12.336 1.00 46.36  ? 216  PHE A CA  1 
ATOM   1312 C  C   . PHE A 1 220 ? -2.434  -15.782 -11.886 1.00 47.07  ? 216  PHE A C   1 
ATOM   1313 O  O   . PHE A 1 220 ? -2.342  -16.961 -12.241 1.00 48.22  ? 216  PHE A O   1 
ATOM   1314 C  CB  . PHE A 1 220 ? -3.217  -14.076 -13.546 1.00 46.27  ? 216  PHE A CB  1 
ATOM   1315 C  CG  . PHE A 1 220 ? -4.391  -13.676 -14.384 1.00 44.90  ? 216  PHE A CG  1 
ATOM   1316 C  CD1 . PHE A 1 220 ? -4.941  -14.572 -15.294 1.00 48.27  ? 216  PHE A CD1 1 
ATOM   1317 C  CD2 . PHE A 1 220 ? -4.952  -12.414 -14.269 1.00 48.01  ? 216  PHE A CD2 1 
ATOM   1318 C  CE1 . PHE A 1 220 ? -6.027  -14.217 -16.074 1.00 49.73  ? 216  PHE A CE1 1 
ATOM   1319 C  CE2 . PHE A 1 220 ? -6.043  -12.046 -15.047 1.00 47.45  ? 216  PHE A CE2 1 
ATOM   1320 C  CZ  . PHE A 1 220 ? -6.581  -12.953 -15.951 1.00 50.15  ? 216  PHE A CZ  1 
ATOM   1321 N  N   . ARG A 1 221 ? -1.545  -15.205 -11.090 1.00 45.38  ? 217  ARG A N   1 
ATOM   1322 C  CA  . ARG A 1 221 ? -0.402  -15.966 -10.595 1.00 47.60  ? 217  ARG A CA  1 
ATOM   1323 C  C   . ARG A 1 221 ? -0.887  -17.049 -9.625  1.00 47.94  ? 217  ARG A C   1 
ATOM   1324 O  O   . ARG A 1 221 ? -0.401  -18.190 -9.650  1.00 46.50  ? 217  ARG A O   1 
ATOM   1325 C  CB  . ARG A 1 221 ? 0.614   -15.037 -9.927  1.00 46.26  ? 217  ARG A CB  1 
ATOM   1326 C  CG  . ARG A 1 221 ? 2.000   -15.642 -9.768  1.00 51.59  ? 217  ARG A CG  1 
ATOM   1327 N  N   . GLY A 1 222 ? -1.869  -16.692 -8.800  1.00 50.20  ? 218  GLY A N   1 
ATOM   1328 C  CA  . GLY A 1 222 ? -2.485  -17.620 -7.868  1.00 47.98  ? 218  GLY A CA  1 
ATOM   1329 C  C   . GLY A 1 222 ? -3.088  -18.844 -8.542  1.00 49.83  ? 218  GLY A C   1 
ATOM   1330 O  O   . GLY A 1 222 ? -2.913  -19.972 -8.079  1.00 50.06  ? 218  GLY A O   1 
ATOM   1331 N  N   . LEU A 1 223 ? -3.799  -18.627 -9.640  1.00 50.80  ? 219  LEU A N   1 
ATOM   1332 C  CA  . LEU A 1 223 ? -4.394  -19.736 -10.368 1.00 51.81  ? 219  LEU A CA  1 
ATOM   1333 C  C   . LEU A 1 223 ? -3.358  -20.638 -11.023 1.00 51.36  ? 219  LEU A C   1 
ATOM   1334 O  O   . LEU A 1 223 ? -3.484  -21.869 -10.981 1.00 51.85  ? 219  LEU A O   1 
ATOM   1335 C  CB  . LEU A 1 223 ? -5.365  -19.229 -11.432 1.00 51.54  ? 219  LEU A CB  1 
ATOM   1336 C  CG  . LEU A 1 223 ? -6.690  -18.697 -10.897 1.00 49.53  ? 219  LEU A CG  1 
ATOM   1337 C  CD1 . LEU A 1 223 ? -7.460  -17.961 -11.975 1.00 48.63  ? 219  LEU A CD1 1 
ATOM   1338 C  CD2 . LEU A 1 223 ? -7.499  -19.848 -10.319 1.00 50.01  ? 219  LEU A CD2 1 
ATOM   1339 N  N   . GLN A 1 224 ? -2.343  -20.029 -11.631 1.00 50.58  ? 220  GLN A N   1 
ATOM   1340 C  CA  . GLN A 1 224 ? -1.268  -20.783 -12.258 1.00 51.75  ? 220  GLN A CA  1 
ATOM   1341 C  C   . GLN A 1 224 ? -0.696  -21.841 -11.324 1.00 52.62  ? 220  GLN A C   1 
ATOM   1342 O  O   . GLN A 1 224 ? -0.393  -22.962 -11.743 1.00 50.92  ? 220  GLN A O   1 
ATOM   1343 C  CB  . GLN A 1 224 ? -0.156  -19.854 -12.700 1.00 52.92  ? 220  GLN A CB  1 
ATOM   1344 C  CG  . GLN A 1 224 ? -0.393  -19.228 -14.040 1.00 57.74  ? 220  GLN A CG  1 
ATOM   1345 C  CD  . GLN A 1 224 ? 0.858   -19.244 -14.893 1.00 62.27  ? 220  GLN A CD  1 
ATOM   1346 O  OE1 . GLN A 1 224 ? 1.887   -19.779 -14.486 1.00 60.59  ? 220  GLN A OE1 1 
ATOM   1347 N  NE2 . GLN A 1 224 ? 0.773   -18.667 -16.087 1.00 66.93  ? 220  GLN A NE2 1 
ATOM   1348 N  N   . ARG A 1 225 ? -0.570  -21.480 -10.052 1.00 54.35  ? 221  ARG A N   1 
ATOM   1349 C  CA  . ARG A 1 225 ? -0.030  -22.383 -9.041  1.00 54.61  ? 221  ARG A CA  1 
ATOM   1350 C  C   . ARG A 1 225 ? -0.892  -23.633 -8.850  1.00 53.42  ? 221  ARG A C   1 
ATOM   1351 O  O   . ARG A 1 225 ? -0.409  -24.661 -8.373  1.00 56.22  ? 221  ARG A O   1 
ATOM   1352 C  CB  . ARG A 1 225 ? 0.127   -21.636 -7.710  1.00 59.21  ? 221  ARG A CB  1 
ATOM   1353 C  CG  . ARG A 1 225 ? 1.559   -21.545 -7.199  1.00 64.30  ? 221  ARG A CG  1 
ATOM   1354 C  CD  . ARG A 1 225 ? 1.972   -20.107 -6.935  1.00 64.58  ? 221  ARG A CD  1 
ATOM   1355 N  NE  . ARG A 1 225 ? 1.029   -19.419 -6.057  1.00 68.03  ? 221  ARG A NE  1 
ATOM   1356 C  CZ  . ARG A 1 225 ? 1.068   -18.115 -5.796  1.00 70.01  ? 221  ARG A CZ  1 
ATOM   1357 N  NH1 . ARG A 1 225 ? 2.010   -17.354 -6.341  1.00 69.14  ? 221  ARG A NH1 1 
ATOM   1358 N  NH2 . ARG A 1 225 ? 0.165   -17.566 -4.992  1.00 71.83  ? 221  ARG A NH2 1 
ATOM   1359 N  N   . TRP A 1 226 ? -2.163  -23.554 -9.232  1.00 55.52  ? 222  TRP A N   1 
ATOM   1360 C  CA  . TRP A 1 226 ? -3.063  -24.707 -9.107  1.00 55.05  ? 222  TRP A CA  1 
ATOM   1361 C  C   . TRP A 1 226 ? -3.064  -25.631 -10.316 1.00 55.82  ? 222  TRP A C   1 
ATOM   1362 O  O   . TRP A 1 226 ? -3.642  -26.712 -10.267 1.00 55.41  ? 222  TRP A O   1 
ATOM   1363 C  CB  . TRP A 1 226 ? -4.493  -24.237 -8.850  1.00 57.85  ? 222  TRP A CB  1 
ATOM   1364 C  CG  . TRP A 1 226 ? -4.680  -23.736 -7.469  1.00 64.79  ? 222  TRP A CG  1 
ATOM   1365 C  CD1 . TRP A 1 226 ? -4.530  -22.455 -7.039  1.00 64.45  ? 222  TRP A CD1 1 
ATOM   1366 C  CD2 . TRP A 1 226 ? -5.026  -24.512 -6.316  1.00 67.50  ? 222  TRP A CD2 1 
ATOM   1367 N  NE1 . TRP A 1 226 ? -4.772  -22.378 -5.690  1.00 66.77  ? 222  TRP A NE1 1 
ATOM   1368 C  CE2 . TRP A 1 226 ? -5.080  -23.628 -5.222  1.00 68.26  ? 222  TRP A CE2 1 
ATOM   1369 C  CE3 . TRP A 1 226 ? -5.302  -25.866 -6.104  1.00 68.10  ? 222  TRP A CE3 1 
ATOM   1370 C  CZ2 . TRP A 1 226 ? -5.398  -24.051 -3.933  1.00 68.43  ? 222  TRP A CZ2 1 
ATOM   1371 C  CZ3 . TRP A 1 226 ? -5.614  -26.287 -4.819  1.00 69.86  ? 222  TRP A CZ3 1 
ATOM   1372 C  CH2 . TRP A 1 226 ? -5.664  -25.378 -3.753  1.00 67.96  ? 222  TRP A CH2 1 
ATOM   1373 N  N   . GLU A 1 227 ? -2.423  -25.213 -11.399 1.00 53.35  ? 223  GLU A N   1 
ATOM   1374 C  CA  . GLU A 1 227 ? -2.490  -25.962 -12.648 1.00 51.98  ? 223  GLU A CA  1 
ATOM   1375 C  C   . GLU A 1 227 ? -1.482  -27.110 -12.710 1.00 54.41  ? 223  GLU A C   1 
ATOM   1376 O  O   . GLU A 1 227 ? -0.276  -26.901 -12.569 1.00 52.63  ? 223  GLU A O   1 
ATOM   1377 C  CB  . GLU A 1 227 ? -2.313  -24.994 -13.826 1.00 50.06  ? 223  GLU A CB  1 
ATOM   1378 C  CG  . GLU A 1 227 ? -3.461  -24.000 -13.906 1.00 50.18  ? 223  GLU A CG  1 
ATOM   1379 C  CD  . GLU A 1 227 ? -3.305  -22.916 -14.979 1.00 51.68  ? 223  GLU A CD  1 
ATOM   1380 O  OE1 . GLU A 1 227 ? -2.354  -22.960 -15.787 1.00 51.83  ? 223  GLU A OE1 1 
ATOM   1381 O  OE2 . GLU A 1 227 ? -4.169  -22.026 -15.024 1.00 51.38  ? 223  GLU A OE2 1 
ATOM   1382 N  N   . VAL A 1 228 ? -1.978  -28.338 -12.903 1.00 50.99  ? 224  VAL A N   1 
ATOM   1383 C  CA  . VAL A 1 228 ? -1.084  -29.481 -12.944 1.00 52.37  ? 224  VAL A CA  1 
ATOM   1384 C  C   . VAL A 1 228 ? -0.264  -29.429 -14.218 1.00 52.66  ? 224  VAL A C   1 
ATOM   1385 O  O   . VAL A 1 228 ? -0.709  -28.897 -15.233 1.00 52.13  ? 224  VAL A O   1 
ATOM   1386 C  CB  . VAL A 1 228 ? -1.841  -30.874 -12.869 1.00 56.02  ? 224  VAL A CB  1 
ATOM   1387 C  CG1 . VAL A 1 228 ? -2.768  -30.928 -11.661 1.00 57.43  ? 224  VAL A CG1 1 
ATOM   1388 C  CG2 . VAL A 1 228 ? -2.636  -31.118 -14.138 1.00 54.30  ? 224  VAL A CG2 1 
ATOM   1389 N  N   . ALA A 1 229 ? 0.934   -29.992 -14.154 1.00 50.22  ? 225  ALA A N   1 
ATOM   1390 C  CA  . ALA A 1 229 ? 1.790   -30.145 -15.324 1.00 51.32  ? 225  ALA A CA  1 
ATOM   1391 C  C   . ALA A 1 229 ? 1.170   -31.045 -16.391 1.00 52.95  ? 225  ALA A C   1 
ATOM   1392 O  O   . ALA A 1 229 ? 1.183   -30.717 -17.579 1.00 52.95  ? 225  ALA A O   1 
ATOM   1393 C  CB  . ALA A 1 229 ? 3.151   -30.698 -14.906 1.00 52.92  ? 225  ALA A CB  1 
ATOM   1394 N  N   . ARG A 1 230 ? 0.633   -32.183 -15.975 1.00 54.12  ? 226  ARG A N   1 
ATOM   1395 C  CA  . ARG A 1 230 ? 0.060   -33.122 -16.935 1.00 56.00  ? 226  ARG A CA  1 
ATOM   1396 C  C   . ARG A 1 230 ? -1.409  -32.792 -17.244 1.00 54.97  ? 226  ARG A C   1 
ATOM   1397 O  O   . ARG A 1 230 ? -2.314  -33.567 -16.943 1.00 56.01  ? 226  ARG A O   1 
ATOM   1398 C  CB  . ARG A 1 230 ? 0.226   -34.545 -16.425 1.00 58.54  ? 226  ARG A CB  1 
ATOM   1399 C  CG  . ARG A 1 230 ? 1.708   -34.939 -16.352 1.00 59.95  ? 226  ARG A CG  1 
ATOM   1400 C  CD  . ARG A 1 230 ? 1.935   -36.354 -15.912 1.00 62.67  ? 226  ARG A CD  1 
ATOM   1401 N  NE  . ARG A 1 230 ? 3.363   -36.663 -15.866 1.00 64.05  ? 226  ARG A NE  1 
ATOM   1402 C  CZ  . ARG A 1 230 ? 4.095   -36.993 -16.925 1.00 65.65  ? 226  ARG A CZ  1 
ATOM   1403 N  NH1 . ARG A 1 230 ? 3.538   -37.078 -18.125 1.00 66.11  ? 226  ARG A NH1 1 
ATOM   1404 N  NH2 . ARG A 1 230 ? 5.388   -37.264 -16.784 1.00 67.00  ? 226  ARG A NH2 1 
ATOM   1405 N  N   . ARG A 1 231 ? -1.599  -31.640 -17.883 1.00 54.89  ? 227  ARG A N   1 
ATOM   1406 C  CA  A ARG A 1 231 ? -2.925  -31.111 -18.198 0.51 53.70  ? 227  ARG A CA  1 
ATOM   1407 C  CA  B ARG A 1 231 ? -2.922  -31.111 -18.205 0.49 53.70  ? 227  ARG A CA  1 
ATOM   1408 C  C   . ARG A 1 231 ? -3.752  -32.046 -19.081 1.00 55.69  ? 227  ARG A C   1 
ATOM   1409 O  O   . ARG A 1 231 ? -4.926  -32.283 -18.805 1.00 55.78  ? 227  ARG A O   1 
ATOM   1410 C  CB  A ARG A 1 231 ? -2.799  -29.749 -18.887 0.51 51.73  ? 227  ARG A CB  1 
ATOM   1411 C  CB  B ARG A 1 231 ? -2.779  -29.757 -18.904 0.49 51.76  ? 227  ARG A CB  1 
ATOM   1412 C  CG  A ARG A 1 231 ? -4.131  -29.058 -19.157 0.51 50.37  ? 227  ARG A CG  1 
ATOM   1413 C  CG  B ARG A 1 231 ? -4.086  -29.122 -19.345 0.49 50.60  ? 227  ARG A CG  1 
ATOM   1414 C  CD  A ARG A 1 231 ? -4.030  -28.000 -20.256 0.51 49.31  ? 227  ARG A CD  1 
ATOM   1415 C  CD  B ARG A 1 231 ? -3.873  -27.681 -19.804 0.49 48.55  ? 227  ARG A CD  1 
ATOM   1416 N  NE  A ARG A 1 231 ? -3.528  -28.558 -21.510 0.51 51.21  ? 227  ARG A NE  1 
ATOM   1417 N  NE  B ARG A 1 231 ? -3.089  -26.946 -18.820 0.49 47.03  ? 227  ARG A NE  1 
ATOM   1418 C  CZ  A ARG A 1 231 ? -4.291  -29.135 -22.435 0.51 52.68  ? 227  ARG A CZ  1 
ATOM   1419 C  CZ  B ARG A 1 231 ? -3.040  -25.623 -18.706 0.49 44.98  ? 227  ARG A CZ  1 
ATOM   1420 N  NH1 A ARG A 1 231 ? -5.602  -29.231 -22.256 0.51 52.47  ? 227  ARG A NH1 1 
ATOM   1421 N  NH1 B ARG A 1 231 ? -3.741  -24.837 -19.514 0.49 44.91  ? 227  ARG A NH1 1 
ATOM   1422 N  NH2 A ARG A 1 231 ? -3.745  -29.617 -23.541 0.51 54.52  ? 227  ARG A NH2 1 
ATOM   1423 N  NH2 B ARG A 1 231 ? -2.291  -25.085 -17.762 0.49 43.97  ? 227  ARG A NH2 1 
ATOM   1424 N  N   . ALA A 1 232 ? -3.143  -32.546 -20.151 1.00 56.87  ? 1001 ALA A N   1 
ATOM   1425 C  CA  . ALA A 1 232 ? -3.850  -33.366 -21.116 1.00 57.14  ? 1001 ALA A CA  1 
ATOM   1426 C  C   . ALA A 1 232 ? -4.368  -34.638 -20.458 1.00 54.26  ? 1001 ALA A C   1 
ATOM   1427 O  O   . ALA A 1 232 ? -5.499  -35.035 -20.698 1.00 53.10  ? 1001 ALA A O   1 
ATOM   1428 C  CB  . ALA A 1 232 ? -2.947  -33.694 -22.298 1.00 60.59  ? 1001 ALA A CB  1 
ATOM   1429 N  N   . ASP A 1 233 ? -3.555  -35.259 -19.609 1.00 53.47  ? 1002 ASP A N   1 
ATOM   1430 C  CA  . ASP A 1 233 ? -3.989  -36.473 -18.898 1.00 51.20  ? 1002 ASP A CA  1 
ATOM   1431 C  C   . ASP A 1 233 ? -5.222  -36.178 -18.046 1.00 48.58  ? 1002 ASP A C   1 
ATOM   1432 O  O   . ASP A 1 233 ? -6.155  -36.970 -18.015 1.00 47.03  ? 1002 ASP A O   1 
ATOM   1433 C  CB  . ASP A 1 233 ? -2.885  -37.034 -17.996 1.00 51.57  ? 1002 ASP A CB  1 
ATOM   1434 C  CG  . ASP A 1 233 ? -1.730  -37.644 -18.777 1.00 54.62  ? 1002 ASP A CG  1 
ATOM   1435 O  OD1 . ASP A 1 233 ? -1.903  -37.974 -19.966 1.00 56.13  ? 1002 ASP A OD1 1 
ATOM   1436 O  OD2 . ASP A 1 233 ? -0.631  -37.781 -18.197 1.00 56.09  ? 1002 ASP A OD2 1 
ATOM   1437 N  N   . LEU A 1 234 ? -5.237  -35.034 -17.355 1.00 49.79  ? 1003 LEU A N   1 
ATOM   1438 C  CA  . LEU A 1 234 ? -6.377  -34.754 -16.483 1.00 48.72  ? 1003 LEU A CA  1 
ATOM   1439 C  C   . LEU A 1 234 ? -7.608  -34.382 -17.300 1.00 47.98  ? 1003 LEU A C   1 
ATOM   1440 O  O   . LEU A 1 234 ? -8.726  -34.777 -16.952 1.00 47.07  ? 1003 LEU A O   1 
ATOM   1441 C  CB  . LEU A 1 234 ? -6.047  -33.670 -15.459 1.00 49.18  ? 1003 LEU A CB  1 
ATOM   1442 C  CG  . LEU A 1 234 ? -7.106  -33.430 -14.378 1.00 48.54  ? 1003 LEU A CG  1 
ATOM   1443 C  CD1 . LEU A 1 234 ? -7.370  -34.684 -13.540 1.00 48.09  ? 1003 LEU A CD1 1 
ATOM   1444 C  CD2 . LEU A 1 234 ? -6.647  -32.290 -13.485 1.00 49.43  ? 1003 LEU A CD2 1 
ATOM   1445 N  N   . GLU A 1 235 ? -7.404  -33.692 -18.413 1.00 52.14  ? 1004 GLU A N   1 
ATOM   1446 C  CA  . GLU A 1 235 ? -8.491  -33.430 -19.348 1.00 51.93  ? 1004 GLU A CA  1 
ATOM   1447 C  C   . GLU A 1 235 ? -9.082  -34.734 -19.884 1.00 51.15  ? 1004 GLU A C   1 
ATOM   1448 O  O   . GLU A 1 235 ? -10.300 -34.848 -20.038 1.00 50.52  ? 1004 GLU A O   1 
ATOM   1449 C  CB  . GLU A 1 235 ? -8.005  -32.561 -20.505 1.00 53.57  ? 1004 GLU A CB  1 
ATOM   1450 C  CG  . GLU A 1 235 ? -7.873  -31.083 -20.151 1.00 55.18  ? 1004 GLU A CG  1 
ATOM   1451 C  CD  . GLU A 1 235 ? -9.215  -30.367 -20.091 1.00 56.12  ? 1004 GLU A CD  1 
ATOM   1452 O  OE1 . GLU A 1 235 ? -10.247 -31.004 -20.349 1.00 55.49  ? 1004 GLU A OE1 1 
ATOM   1453 O  OE2 . GLU A 1 235 ? -9.240  -29.156 -19.789 1.00 57.91  ? 1004 GLU A OE2 1 
ATOM   1454 N  N   . ASP A 1 236 ? -8.223  -35.711 -20.161 1.00 50.49  ? 1005 ASP A N   1 
ATOM   1455 C  CA  . ASP A 1 236 ? -8.694  -37.035 -20.593 1.00 49.91  ? 1005 ASP A CA  1 
ATOM   1456 C  C   . ASP A 1 236 ? -9.576  -37.707 -19.546 1.00 48.65  ? 1005 ASP A C   1 
ATOM   1457 O  O   . ASP A 1 236 ? -10.615 -38.260 -19.879 1.00 47.87  ? 1005 ASP A O   1 
ATOM   1458 C  CB  . ASP A 1 236 ? -7.520  -37.955 -20.920 1.00 50.91  ? 1005 ASP A CB  1 
ATOM   1459 C  CG  . ASP A 1 236 ? -6.913  -37.664 -22.275 1.00 54.10  ? 1005 ASP A CG  1 
ATOM   1460 O  OD1 . ASP A 1 236 ? -7.617  -37.112 -23.151 1.00 57.97  ? 1005 ASP A OD1 1 
ATOM   1461 O  OD2 . ASP A 1 236 ? -5.715  -37.960 -22.458 1.00 56.37  ? 1005 ASP A OD2 1 
ATOM   1462 N  N   . ASN A 1 237 ? -9.137  -37.668 -18.290 1.00 49.16  ? 1006 ASN A N   1 
ATOM   1463 C  CA  . ASN A 1 237 ? -9.902  -38.218 -17.177 1.00 47.21  ? 1006 ASN A CA  1 
ATOM   1464 C  C   . ASN A 1 237 ? -11.257 -37.547 -17.036 1.00 46.51  ? 1006 ASN A C   1 
ATOM   1465 O  O   . ASN A 1 237 ? -12.275 -38.213 -16.829 1.00 45.74  ? 1006 ASN A O   1 
ATOM   1466 C  CB  . ASN A 1 237 ? -9.129  -38.082 -15.865 1.00 48.20  ? 1006 ASN A CB  1 
ATOM   1467 C  CG  . ASN A 1 237 ? -7.819  -38.848 -15.875 1.00 53.78  ? 1006 ASN A CG  1 
ATOM   1468 O  OD1 . ASN A 1 237 ? -7.662  -39.834 -16.599 1.00 52.58  ? 1006 ASN A OD1 1 
ATOM   1469 N  ND2 . ASN A 1 237 ? -6.884  -38.417 -15.050 1.00 51.37  ? 1006 ASN A ND2 1 
ATOM   1470 N  N   . TRP A 1 238 ? -11.258 -36.224 -17.158 1.00 52.20  ? 1007 TRP A N   1 
ATOM   1471 C  CA  . TRP A 1 238 ? -12.468 -35.427 -17.036 1.00 50.58  ? 1007 TRP A CA  1 
ATOM   1472 C  C   . TRP A 1 238 ? -13.436 -35.786 -18.156 1.00 51.18  ? 1007 TRP A C   1 
ATOM   1473 O  O   . TRP A 1 238 ? -14.629 -35.997 -17.924 1.00 51.57  ? 1007 TRP A O   1 
ATOM   1474 C  CB  . TRP A 1 238 ? -12.118 -33.926 -17.068 1.00 51.41  ? 1007 TRP A CB  1 
ATOM   1475 C  CG  . TRP A 1 238 ? -13.183 -33.034 -16.524 1.00 56.50  ? 1007 TRP A CG  1 
ATOM   1476 C  CD1 . TRP A 1 238 ? -14.442 -33.391 -16.133 1.00 56.99  ? 1007 TRP A CD1 1 
ATOM   1477 C  CD2 . TRP A 1 238 ? -13.082 -31.622 -16.306 1.00 58.62  ? 1007 TRP A CD2 1 
ATOM   1478 N  NE1 . TRP A 1 238 ? -15.134 -32.283 -15.689 1.00 55.43  ? 1007 TRP A NE1 1 
ATOM   1479 C  CE2 . TRP A 1 238 ? -14.322 -31.186 -15.787 1.00 58.84  ? 1007 TRP A CE2 1 
ATOM   1480 C  CE3 . TRP A 1 238 ? -12.065 -30.685 -16.503 1.00 58.71  ? 1007 TRP A CE3 1 
ATOM   1481 C  CZ2 . TRP A 1 238 ? -14.568 -29.854 -15.457 1.00 62.06  ? 1007 TRP A CZ2 1 
ATOM   1482 C  CZ3 . TRP A 1 238 ? -12.312 -29.358 -16.178 1.00 58.29  ? 1007 TRP A CZ3 1 
ATOM   1483 C  CH2 . TRP A 1 238 ? -13.555 -28.958 -15.661 1.00 62.92  ? 1007 TRP A CH2 1 
ATOM   1484 N  N   . GLU A 1 239 ? -12.904 -35.885 -19.369 1.00 51.71  ? 1008 GLU A N   1 
ATOM   1485 C  CA  . GLU A 1 239 ? -13.682 -36.298 -20.530 1.00 51.00  ? 1008 GLU A CA  1 
ATOM   1486 C  C   . GLU A 1 239 ? -14.269 -37.706 -20.377 1.00 52.02  ? 1008 GLU A C   1 
ATOM   1487 O  O   . GLU A 1 239 ? -15.420 -37.951 -20.739 1.00 50.19  ? 1008 GLU A O   1 
ATOM   1488 C  CB  . GLU A 1 239 ? -12.816 -36.237 -21.786 1.00 57.57  ? 1008 GLU A CB  1 
ATOM   1489 C  CG  . GLU A 1 239 ? -13.464 -36.839 -23.023 1.00 62.26  ? 1008 GLU A CG  1 
ATOM   1490 C  CD  . GLU A 1 239 ? -12.623 -36.642 -24.273 1.00 68.03  ? 1008 GLU A CD  1 
ATOM   1491 O  OE1 . GLU A 1 239 ? -11.707 -35.804 -24.236 1.00 69.64  ? 1008 GLU A OE1 1 
ATOM   1492 O  OE2 . GLU A 1 239 ? -12.878 -37.317 -25.294 1.00 70.30  ? 1008 GLU A OE2 1 
ATOM   1493 N  N   . THR A 1 240 ? -13.466 -38.627 -19.852 1.00 48.95  ? 1009 THR A N   1 
ATOM   1494 C  CA  . THR A 1 240 ? -13.911 -40.002 -19.657 1.00 47.85  ? 1009 THR A CA  1 
ATOM   1495 C  C   . THR A 1 240 ? -15.100 -40.044 -18.715 1.00 50.55  ? 1009 THR A C   1 
ATOM   1496 O  O   . THR A 1 240 ? -16.041 -40.821 -18.916 1.00 50.91  ? 1009 THR A O   1 
ATOM   1497 C  CB  . THR A 1 240 ? -12.790 -40.890 -19.097 1.00 49.79  ? 1009 THR A CB  1 
ATOM   1498 O  OG1 . THR A 1 240 ? -11.730 -40.974 -20.049 1.00 50.32  ? 1009 THR A OG1 1 
ATOM   1499 C  CG2 . THR A 1 240 ? -13.306 -42.292 -18.811 1.00 54.14  ? 1009 THR A CG2 1 
ATOM   1500 N  N   . LEU A 1 241 ? -15.044 -39.208 -17.681 1.00 51.52  ? 1010 LEU A N   1 
ATOM   1501 C  CA  . LEU A 1 241 ? -16.136 -39.073 -16.721 1.00 51.85  ? 1010 LEU A CA  1 
ATOM   1502 C  C   . LEU A 1 241 ? -17.407 -38.517 -17.358 1.00 50.27  ? 1010 LEU A C   1 
ATOM   1503 O  O   . LEU A 1 241 ? -18.484 -39.108 -17.238 1.00 51.13  ? 1010 LEU A O   1 
ATOM   1504 C  CB  . LEU A 1 241 ? -15.716 -38.171 -15.554 1.00 51.38  ? 1010 LEU A CB  1 
ATOM   1505 C  CG  . LEU A 1 241 ? -14.645 -38.732 -14.621 1.00 52.16  ? 1010 LEU A CG  1 
ATOM   1506 C  CD1 . LEU A 1 241 ? -14.211 -37.689 -13.596 1.00 55.70  ? 1010 LEU A CD1 1 
ATOM   1507 C  CD2 . LEU A 1 241 ? -15.146 -39.986 -13.924 1.00 54.19  ? 1010 LEU A CD2 1 
ATOM   1508 N  N   . ASN A 1 242 ? -17.286 -37.384 -18.035 1.00 54.29  ? 1011 ASN A N   1 
ATOM   1509 C  CA  . ASN A 1 242 ? -18.457 -36.722 -18.585 1.00 53.73  ? 1011 ASN A CA  1 
ATOM   1510 C  C   . ASN A 1 242 ? -19.058 -37.494 -19.756 1.00 54.51  ? 1011 ASN A C   1 
ATOM   1511 O  O   . ASN A 1 242 ? -20.270 -37.599 -19.856 1.00 56.15  ? 1011 ASN A O   1 
ATOM   1512 C  CB  . ASN A 1 242 ? -18.107 -35.297 -18.995 1.00 55.41  ? 1011 ASN A CB  1 
ATOM   1513 C  CG  . ASN A 1 242 ? -17.834 -34.414 -17.792 1.00 59.75  ? 1011 ASN A CG  1 
ATOM   1514 O  OD1 . ASN A 1 242 ? -17.519 -34.910 -16.709 1.00 61.21  ? 1011 ASN A OD1 1 
ATOM   1515 N  ND2 . ASN A 1 242 ? -17.961 -33.120 -17.967 1.00 62.35  ? 1011 ASN A ND2 1 
ATOM   1516 N  N   . ASP A 1 243 ? -18.213 -38.048 -20.623 1.00 53.30  ? 1012 ASP A N   1 
ATOM   1517 C  CA  . ASP A 1 243 ? -18.683 -38.863 -21.741 1.00 56.69  ? 1012 ASP A CA  1 
ATOM   1518 C  C   . ASP A 1 243 ? -19.440 -40.110 -21.280 1.00 56.14  ? 1012 ASP A C   1 
ATOM   1519 O  O   . ASP A 1 243 ? -20.523 -40.415 -21.784 1.00 53.40  ? 1012 ASP A O   1 
ATOM   1520 C  CB  . ASP A 1 243 ? -17.512 -39.283 -22.624 1.00 56.81  ? 1012 ASP A CB  1 
ATOM   1521 N  N   . ASN A 1 244 ? -18.871 -40.840 -20.328 1.00 51.57  ? 1013 ASN A N   1 
ATOM   1522 C  CA  . ASN A 1 244 ? -19.486 -42.089 -19.891 1.00 52.35  ? 1013 ASN A CA  1 
ATOM   1523 C  C   . ASN A 1 244 ? -20.749 -41.874 -19.075 1.00 51.79  ? 1013 ASN A C   1 
ATOM   1524 O  O   . ASN A 1 244 ? -21.589 -42.771 -18.976 1.00 52.85  ? 1013 ASN A O   1 
ATOM   1525 C  CB  . ASN A 1 244 ? -18.491 -42.925 -19.095 1.00 52.06  ? 1013 ASN A CB  1 
ATOM   1526 C  CG  . ASN A 1 244 ? -17.558 -43.699 -19.990 1.00 53.11  ? 1013 ASN A CG  1 
ATOM   1527 O  OD1 . ASN A 1 244 ? -17.969 -44.660 -20.638 1.00 55.23  ? 1013 ASN A OD1 1 
ATOM   1528 N  ND2 . ASN A 1 244 ? -16.299 -43.279 -20.049 1.00 52.73  ? 1013 ASN A ND2 1 
ATOM   1529 N  N   . LEU A 1 245 ? -20.885 -40.694 -18.487 1.00 52.24  ? 1014 LEU A N   1 
ATOM   1530 C  CA  . LEU A 1 245 ? -22.131 -40.328 -17.844 1.00 53.38  ? 1014 LEU A CA  1 
ATOM   1531 C  C   . LEU A 1 245 ? -23.236 -40.271 -18.895 1.00 55.12  ? 1014 LEU A C   1 
ATOM   1532 O  O   . LEU A 1 245 ? -24.383 -40.639 -18.633 1.00 56.95  ? 1014 LEU A O   1 
ATOM   1533 C  CB  . LEU A 1 245 ? -21.984 -38.992 -17.122 1.00 52.49  ? 1014 LEU A CB  1 
ATOM   1534 C  CG  . LEU A 1 245 ? -21.404 -39.101 -15.716 1.00 56.71  ? 1014 LEU A CG  1 
ATOM   1535 C  CD1 . LEU A 1 245 ? -20.904 -37.751 -15.210 1.00 58.25  ? 1014 LEU A CD1 1 
ATOM   1536 C  CD2 . LEU A 1 245 ? -22.483 -39.649 -14.798 1.00 59.88  ? 1014 LEU A CD2 1 
ATOM   1537 N  N   . LYS A 1 246 ? -22.877 -39.826 -20.095 1.00 55.78  ? 1015 LYS A N   1 
ATOM   1538 C  CA  . LYS A 1 246 ? -23.825 -39.739 -21.193 1.00 57.96  ? 1015 LYS A CA  1 
ATOM   1539 C  C   . LYS A 1 246 ? -24.092 -41.122 -21.772 1.00 56.47  ? 1015 LYS A C   1 
ATOM   1540 O  O   . LYS A 1 246 ? -25.191 -41.403 -22.215 1.00 57.45  ? 1015 LYS A O   1 
ATOM   1541 C  CB  . LYS A 1 246 ? -23.311 -38.779 -22.279 1.00 60.92  ? 1015 LYS A CB  1 
ATOM   1542 N  N   . VAL A 1 247 ? -23.082 -41.984 -21.766 1.00 54.03  ? 1016 VAL A N   1 
ATOM   1543 C  CA  . VAL A 1 247 ? -23.264 -43.363 -22.201 1.00 54.64  ? 1016 VAL A CA  1 
ATOM   1544 C  C   . VAL A 1 247 ? -24.260 -44.055 -21.282 1.00 56.54  ? 1016 VAL A C   1 
ATOM   1545 O  O   . VAL A 1 247 ? -25.141 -44.775 -21.740 1.00 53.93  ? 1016 VAL A O   1 
ATOM   1546 C  CB  . VAL A 1 247 ? -21.938 -44.150 -22.218 1.00 53.19  ? 1016 VAL A CB  1 
ATOM   1547 C  CG1 . VAL A 1 247 ? -22.206 -45.629 -22.452 1.00 51.04  ? 1016 VAL A CG1 1 
ATOM   1548 C  CG2 . VAL A 1 247 ? -21.016 -43.606 -23.294 1.00 56.78  ? 1016 VAL A CG2 1 
ATOM   1549 N  N   . ILE A 1 248 ? -24.131 -43.800 -19.985 1.00 52.91  ? 1017 ILE A N   1 
ATOM   1550 C  CA  . ILE A 1 248 ? -25.027 -44.372 -18.989 1.00 55.63  ? 1017 ILE A CA  1 
ATOM   1551 C  C   . ILE A 1 248 ? -26.471 -43.885 -19.149 1.00 56.02  ? 1017 ILE A C   1 
ATOM   1552 O  O   . ILE A 1 248 ? -27.417 -44.661 -19.005 1.00 54.28  ? 1017 ILE A O   1 
ATOM   1553 C  CB  . ILE A 1 248 ? -24.529 -44.064 -17.563 1.00 54.49  ? 1017 ILE A CB  1 
ATOM   1554 C  CG1 . ILE A 1 248 ? -23.222 -44.812 -17.309 1.00 52.69  ? 1017 ILE A CG1 1 
ATOM   1555 C  CG2 . ILE A 1 248 ? -25.578 -44.464 -16.514 1.00 54.53  ? 1017 ILE A CG2 1 
ATOM   1556 C  CD1 . ILE A 1 248 ? -22.559 -44.481 -15.987 1.00 53.00  ? 1017 ILE A CD1 1 
ATOM   1557 N  N   . GLU A 1 249 ? -26.651 -42.609 -19.463 1.00 59.68  ? 1018 GLU A N   1 
ATOM   1558 C  CA  . GLU A 1 249 ? -28.002 -42.083 -19.605 1.00 61.04  ? 1018 GLU A CA  1 
ATOM   1559 C  C   . GLU A 1 249 ? -28.789 -42.730 -20.747 1.00 62.96  ? 1018 GLU A C   1 
ATOM   1560 O  O   . GLU A 1 249 ? -30.003 -42.913 -20.647 1.00 67.33  ? 1018 GLU A O   1 
ATOM   1561 C  CB  . GLU A 1 249 ? -27.953 -40.576 -19.799 1.00 61.20  ? 1018 GLU A CB  1 
ATOM   1562 C  CG  . GLU A 1 249 ? -28.000 -39.810 -18.496 1.00 69.76  ? 1018 GLU A CG  1 
ATOM   1563 C  CD  . GLU A 1 249 ? -29.409 -39.666 -17.933 1.00 71.29  ? 1018 GLU A CD  1 
ATOM   1564 O  OE1 . GLU A 1 249 ? -29.874 -38.512 -17.832 1.00 72.70  ? 1018 GLU A OE1 1 
ATOM   1565 O  OE2 . GLU A 1 249 ? -30.039 -40.691 -17.572 1.00 69.40  ? 1018 GLU A OE2 1 
ATOM   1566 N  N   . LYS A 1 250 ? -28.098 -43.097 -21.819 1.00 63.71  ? 1019 LYS A N   1 
ATOM   1567 C  CA  . LYS A 1 250 ? -28.774 -43.633 -22.996 1.00 65.48  ? 1019 LYS A CA  1 
ATOM   1568 C  C   . LYS A 1 250 ? -28.474 -45.108 -23.238 1.00 62.57  ? 1019 LYS A C   1 
ATOM   1569 O  O   . LYS A 1 250 ? -28.731 -45.626 -24.328 1.00 62.93  ? 1019 LYS A O   1 
ATOM   1570 C  CB  . LYS A 1 250 ? -28.383 -42.821 -24.233 1.00 68.88  ? 1019 LYS A CB  1 
ATOM   1571 C  CG  . LYS A 1 250 ? -26.892 -42.823 -24.519 1.00 66.47  ? 1019 LYS A CG  1 
ATOM   1572 C  CD  . LYS A 1 250 ? -26.544 -41.871 -25.659 1.00 70.10  ? 1019 LYS A CD  1 
ATOM   1573 N  N   . ALA A 1 251 ? -27.948 -45.790 -22.227 1.00 54.79  ? 1020 ALA A N   1 
ATOM   1574 C  CA  . ALA A 1 251 ? -27.579 -47.194 -22.383 1.00 54.78  ? 1020 ALA A CA  1 
ATOM   1575 C  C   . ALA A 1 251 ? -28.791 -48.038 -22.717 1.00 56.50  ? 1020 ALA A C   1 
ATOM   1576 O  O   . ALA A 1 251 ? -29.904 -47.709 -22.325 1.00 56.87  ? 1020 ALA A O   1 
ATOM   1577 C  CB  . ALA A 1 251 ? -26.915 -47.718 -21.133 1.00 54.00  ? 1020 ALA A CB  1 
ATOM   1578 N  N   . ASP A 1 252 ? -28.549 -49.127 -23.442 1.00 55.66  ? 1021 ASP A N   1 
ATOM   1579 C  CA  . ASP A 1 252 ? -29.583 -50.092 -23.796 1.00 57.51  ? 1021 ASP A CA  1 
ATOM   1580 C  C   . ASP A 1 252 ? -29.707 -51.188 -22.764 1.00 56.11  ? 1021 ASP A C   1 
ATOM   1581 O  O   . ASP A 1 252 ? -30.763 -51.812 -22.634 1.00 56.78  ? 1021 ASP A O   1 
ATOM   1582 C  CB  . ASP A 1 252 ? -29.284 -50.725 -25.156 1.00 58.65  ? 1021 ASP A CB  1 
ATOM   1583 N  N   . ASN A 1 253 ? -28.621 -51.464 -22.051 1.00 50.31  ? 1022 ASN A N   1 
ATOM   1584 C  CA  . ASN A 1 253 ? -28.647 -52.575 -21.111 1.00 48.88  ? 1022 ASN A CA  1 
ATOM   1585 C  C   . ASN A 1 253 ? -27.643 -52.393 -19.982 1.00 48.13  ? 1022 ASN A C   1 
ATOM   1586 O  O   . ASN A 1 253 ? -26.874 -51.432 -19.963 1.00 49.37  ? 1022 ASN A O   1 
ATOM   1587 C  CB  . ASN A 1 253 ? -28.387 -53.904 -21.840 1.00 46.34  ? 1022 ASN A CB  1 
ATOM   1588 C  CG  . ASN A 1 253 ? -27.209 -53.827 -22.774 1.00 48.17  ? 1022 ASN A CG  1 
ATOM   1589 O  OD1 . ASN A 1 253 ? -26.075 -53.666 -22.333 1.00 47.18  ? 1022 ASN A OD1 1 
ATOM   1590 N  ND2 . ASN A 1 253 ? -27.466 -53.938 -24.076 1.00 46.69  ? 1022 ASN A ND2 1 
ATOM   1591 N  N   . ALA A 1 254 ? -27.659 -53.335 -19.048 1.00 39.84  ? 1023 ALA A N   1 
ATOM   1592 C  CA  . ALA A 1 254 ? -26.842 -53.261 -17.846 1.00 41.68  ? 1023 ALA A CA  1 
ATOM   1593 C  C   . ALA A 1 254 ? -25.361 -53.420 -18.151 1.00 42.78  ? 1023 ALA A C   1 
ATOM   1594 O  O   . ALA A 1 254 ? -24.528 -52.832 -17.459 1.00 46.85  ? 1023 ALA A O   1 
ATOM   1595 C  CB  . ALA A 1 254 ? -27.289 -54.309 -16.835 1.00 38.55  ? 1023 ALA A CB  1 
ATOM   1596 N  N   . ALA A 1 255 ? -25.029 -54.198 -19.181 1.00 41.45  ? 1024 ALA A N   1 
ATOM   1597 C  CA  . ALA A 1 255 ? -23.625 -54.419 -19.529 1.00 42.71  ? 1024 ALA A CA  1 
ATOM   1598 C  C   . ALA A 1 255 ? -22.966 -53.117 -19.948 1.00 42.86  ? 1024 ALA A C   1 
ATOM   1599 O  O   . ALA A 1 255 ? -21.864 -52.805 -19.509 1.00 43.39  ? 1024 ALA A O   1 
ATOM   1600 C  CB  . ALA A 1 255 ? -23.485 -55.457 -20.639 1.00 44.60  ? 1024 ALA A CB  1 
ATOM   1601 N  N   . GLN A 1 256 ? -23.650 -52.362 -20.799 1.00 42.68  ? 1025 GLN A N   1 
ATOM   1602 C  CA  . GLN A 1 256 ? -23.165 -51.055 -21.214 1.00 43.35  ? 1025 GLN A CA  1 
ATOM   1603 C  C   . GLN A 1 256 ? -23.019 -50.109 -20.025 1.00 49.95  ? 1025 GLN A C   1 
ATOM   1604 O  O   . GLN A 1 256 ? -22.024 -49.385 -19.938 1.00 48.09  ? 1025 GLN A O   1 
ATOM   1605 C  CB  . GLN A 1 256 ? -24.097 -50.435 -22.260 1.00 47.37  ? 1025 GLN A CB  1 
ATOM   1606 C  CG  . GLN A 1 256 ? -24.146 -51.215 -23.575 1.00 46.24  ? 1025 GLN A CG  1 
ATOM   1607 C  CD  . GLN A 1 256 ? -25.264 -50.749 -24.495 1.00 51.26  ? 1025 GLN A CD  1 
ATOM   1608 O  OE1 . GLN A 1 256 ? -25.723 -49.605 -24.408 1.00 51.66  ? 1025 GLN A OE1 1 
ATOM   1609 N  NE2 . GLN A 1 256 ? -25.694 -51.625 -25.396 1.00 53.02  ? 1025 GLN A NE2 1 
ATOM   1610 N  N   . VAL A 1 257 ? -23.999 -50.114 -19.117 1.00 42.78  ? 1026 VAL A N   1 
ATOM   1611 C  CA  . VAL A 1 257 ? -23.928 -49.262 -17.931 1.00 46.48  ? 1026 VAL A CA  1 
ATOM   1612 C  C   . VAL A 1 257 ? -22.723 -49.692 -17.090 1.00 46.22  ? 1026 VAL A C   1 
ATOM   1613 O  O   . VAL A 1 257 ? -21.929 -48.853 -16.660 1.00 44.39  ? 1026 VAL A O   1 
ATOM   1614 C  CB  . VAL A 1 257 ? -25.224 -49.305 -17.073 1.00 44.15  ? 1026 VAL A CB  1 
ATOM   1615 C  CG1 . VAL A 1 257 ? -25.021 -48.567 -15.748 1.00 41.59  ? 1026 VAL A CG1 1 
ATOM   1616 C  CG2 . VAL A 1 257 ? -26.388 -48.673 -17.826 1.00 45.79  ? 1026 VAL A CG2 1 
ATOM   1617 N  N   . LYS A 1 258 ? -22.570 -51.001 -16.892 1.00 41.53  ? 1027 LYS A N   1 
ATOM   1618 C  CA  . LYS A 1 258 ? -21.451 -51.531 -16.109 1.00 42.93  ? 1027 LYS A CA  1 
ATOM   1619 C  C   . LYS A 1 258 ? -20.090 -51.182 -16.732 1.00 43.52  ? 1027 LYS A C   1 
ATOM   1620 O  O   . LYS A 1 258 ? -19.136 -50.835 -16.020 1.00 42.74  ? 1027 LYS A O   1 
ATOM   1621 C  CB  . LYS A 1 258 ? -21.573 -53.057 -15.948 1.00 40.91  ? 1027 LYS A CB  1 
ATOM   1622 C  CG  . LYS A 1 258 ? -20.311 -53.710 -15.385 1.00 45.32  ? 1027 LYS A CG  1 
ATOM   1623 C  CD  . LYS A 1 258 ? -20.593 -55.064 -14.726 1.00 46.54  ? 1027 LYS A CD  1 
ATOM   1624 C  CE  . LYS A 1 258 ? -19.310 -55.751 -14.248 1.00 50.38  ? 1027 LYS A CE  1 
ATOM   1625 N  NZ  . LYS A 1 258 ? -19.549 -57.185 -13.809 1.00 52.15  ? 1027 LYS A NZ  1 
ATOM   1626 N  N   . ASP A 1 259 ? -19.994 -51.279 -18.053 1.00 40.46  ? 1028 ASP A N   1 
ATOM   1627 C  CA  . ASP A 1 259 ? -18.737 -50.985 -18.726 1.00 40.54  ? 1028 ASP A CA  1 
ATOM   1628 C  C   . ASP A 1 259 ? -18.395 -49.507 -18.542 1.00 44.70  ? 1028 ASP A C   1 
ATOM   1629 O  O   . ASP A 1 259 ? -17.256 -49.160 -18.236 1.00 44.37  ? 1028 ASP A O   1 
ATOM   1630 C  CB  . ASP A 1 259 ? -18.796 -51.313 -20.220 1.00 46.84  ? 1028 ASP A CB  1 
ATOM   1631 C  CG  . ASP A 1 259 ? -18.945 -52.810 -20.498 1.00 54.20  ? 1028 ASP A CG  1 
ATOM   1632 O  OD1 . ASP A 1 259 ? -18.640 -53.638 -19.606 1.00 55.04  ? 1028 ASP A OD1 1 
ATOM   1633 O  OD2 . ASP A 1 259 ? -19.379 -53.159 -21.620 1.00 56.42  ? 1028 ASP A OD2 1 
ATOM   1634 N  N   . ALA A 1 260 ? -19.396 -48.649 -18.730 1.00 43.40  ? 1029 ALA A N   1 
ATOM   1635 C  CA  . ALA A 1 260 ? -19.192 -47.205 -18.622 1.00 44.54  ? 1029 ALA A CA  1 
ATOM   1636 C  C   . ALA A 1 260 ? -18.791 -46.825 -17.204 1.00 47.28  ? 1029 ALA A C   1 
ATOM   1637 O  O   . ALA A 1 260 ? -17.851 -46.040 -17.001 1.00 48.56  ? 1029 ALA A O   1 
ATOM   1638 C  CB  . ALA A 1 260 ? -20.442 -46.453 -19.043 1.00 42.50  ? 1029 ALA A CB  1 
ATOM   1639 N  N   . LEU A 1 261 ? -19.505 -47.380 -16.226 1.00 41.12  ? 1030 LEU A N   1 
ATOM   1640 C  CA  . LEU A 1 261 ? -19.185 -47.139 -14.821 1.00 43.00  ? 1030 LEU A CA  1 
ATOM   1641 C  C   . LEU A 1 261 ? -17.763 -47.585 -14.492 1.00 43.12  ? 1030 LEU A C   1 
ATOM   1642 O  O   . LEU A 1 261 ? -17.063 -46.925 -13.727 1.00 44.01  ? 1030 LEU A O   1 
ATOM   1643 C  CB  . LEU A 1 261 ? -20.186 -47.848 -13.901 1.00 42.11  ? 1030 LEU A CB  1 
ATOM   1644 C  CG  . LEU A 1 261 ? -21.547 -47.170 -13.731 1.00 40.54  ? 1030 LEU A CG  1 
ATOM   1645 C  CD1 . LEU A 1 261 ? -22.510 -48.119 -13.042 1.00 40.35  ? 1030 LEU A CD1 1 
ATOM   1646 C  CD2 . LEU A 1 261 ? -21.412 -45.910 -12.892 1.00 40.25  ? 1030 LEU A CD2 1 
ATOM   1647 N  N   . THR A 1 262 ? -17.340 -48.701 -15.080 1.00 41.50  ? 1031 THR A N   1 
ATOM   1648 C  CA  . THR A 1 262 ? -15.997 -49.224 -14.862 1.00 42.21  ? 1031 THR A CA  1 
ATOM   1649 C  C   . THR A 1 262 ? -14.937 -48.228 -15.356 1.00 46.23  ? 1031 THR A C   1 
ATOM   1650 O  O   . THR A 1 262 ? -13.917 -48.007 -14.697 1.00 46.43  ? 1031 THR A O   1 
ATOM   1651 C  CB  . THR A 1 262 ? -15.800 -50.569 -15.575 1.00 42.67  ? 1031 THR A CB  1 
ATOM   1652 O  OG1 . THR A 1 262 ? -16.786 -51.500 -15.112 1.00 44.17  ? 1031 THR A OG1 1 
ATOM   1653 C  CG2 . THR A 1 262 ? -14.414 -51.133 -15.303 1.00 42.80  ? 1031 THR A CG2 1 
ATOM   1654 N  N   . LYS A 1 263 ? -15.196 -47.623 -16.512 1.00 45.48  ? 1032 LYS A N   1 
ATOM   1655 C  CA  . LYS A 1 263 ? -14.277 -46.641 -17.080 1.00 47.41  ? 1032 LYS A CA  1 
ATOM   1656 C  C   . LYS A 1 263 ? -14.252 -45.363 -16.227 1.00 47.89  ? 1032 LYS A C   1 
ATOM   1657 O  O   . LYS A 1 263 ? -13.206 -44.742 -16.057 1.00 49.27  ? 1032 LYS A O   1 
ATOM   1658 C  CB  . LYS A 1 263 ? -14.665 -46.314 -18.521 1.00 48.98  ? 1032 LYS A CB  1 
ATOM   1659 C  CG  . LYS A 1 263 ? -14.751 -47.518 -19.444 1.00 48.83  ? 1032 LYS A CG  1 
ATOM   1660 C  CD  . LYS A 1 263 ? -14.961 -47.059 -20.889 1.00 52.79  ? 1032 LYS A CD  1 
ATOM   1661 C  CE  . LYS A 1 263 ? -15.590 -48.147 -21.777 1.00 53.84  ? 1032 LYS A CE  1 
ATOM   1662 N  NZ  . LYS A 1 263 ? -17.086 -48.166 -21.682 1.00 53.85  ? 1032 LYS A NZ  1 
ATOM   1663 N  N   . MET A 1 264 ? -15.406 -44.983 -15.689 1.00 47.59  ? 1033 MET A N   1 
ATOM   1664 C  CA  . MET A 1 264 ? -15.506 -43.820 -14.813 1.00 46.84  ? 1033 MET A CA  1 
ATOM   1665 C  C   . MET A 1 264 ? -14.692 -44.010 -13.543 1.00 46.41  ? 1033 MET A C   1 
ATOM   1666 O  O   . MET A 1 264 ? -14.034 -43.081 -13.060 1.00 47.79  ? 1033 MET A O   1 
ATOM   1667 C  CB  . MET A 1 264 ? -16.963 -43.549 -14.453 1.00 43.76  ? 1033 MET A CB  1 
ATOM   1668 C  CG  . MET A 1 264 ? -17.796 -43.071 -15.611 1.00 44.16  ? 1033 MET A CG  1 
ATOM   1669 S  SD  . MET A 1 264 ? -19.462 -42.678 -15.082 1.00 49.10  ? 1033 MET A SD  1 
ATOM   1670 C  CE  . MET A 1 264 ? -19.145 -41.394 -13.879 1.00 54.01  ? 1033 MET A CE  1 
ATOM   1671 N  N   . ARG A 1 265 ? -14.769 -45.219 -12.994 1.00 42.18  ? 1034 ARG A N   1 
ATOM   1672 C  CA  . ARG A 1 265 ? -14.042 -45.557 -11.786 1.00 45.13  ? 1034 ARG A CA  1 
ATOM   1673 C  C   . ARG A 1 265 ? -12.554 -45.380 -12.011 1.00 46.39  ? 1034 ARG A C   1 
ATOM   1674 O  O   . ARG A 1 265 ? -11.856 -44.809 -11.177 1.00 47.49  ? 1034 ARG A O   1 
ATOM   1675 C  CB  . ARG A 1 265 ? -14.327 -46.998 -11.349 1.00 45.40  ? 1034 ARG A CB  1 
ATOM   1676 C  CG  . ARG A 1 265 ? -13.879 -47.279 -9.927  1.00 49.20  ? 1034 ARG A CG  1 
ATOM   1677 C  CD  . ARG A 1 265 ? -14.159 -48.709 -9.467  1.00 52.24  ? 1034 ARG A CD  1 
ATOM   1678 N  NE  . ARG A 1 265 ? -13.888 -48.831 -8.039  1.00 53.05  ? 1034 ARG A NE  1 
ATOM   1679 C  CZ  . ARG A 1 265 ? -12.695 -49.104 -7.519  1.00 58.08  ? 1034 ARG A CZ  1 
ATOM   1680 N  NH1 . ARG A 1 265 ? -11.655 -49.331 -8.309  1.00 58.72  ? 1034 ARG A NH1 1 
ATOM   1681 N  NH2 . ARG A 1 265 ? -12.547 -49.174 -6.203  1.00 57.85  ? 1034 ARG A NH2 1 
ATOM   1682 N  N   . ALA A 1 266 ? -12.083 -45.878 -13.148 1.00 43.99  ? 1035 ALA A N   1 
ATOM   1683 C  CA  . ALA A 1 266 ? -10.673 -45.799 -13.490 1.00 47.98  ? 1035 ALA A CA  1 
ATOM   1684 C  C   . ALA A 1 266 ? -10.231 -44.345 -13.661 1.00 46.34  ? 1035 ALA A C   1 
ATOM   1685 O  O   . ALA A 1 266 ? -9.142  -43.978 -13.231 1.00 48.01  ? 1035 ALA A O   1 
ATOM   1686 C  CB  . ALA A 1 266 ? -10.396 -46.587 -14.748 1.00 45.99  ? 1035 ALA A CB  1 
ATOM   1687 N  N   . ALA A 1 267 ? -11.084 -43.533 -14.281 1.00 45.81  ? 1036 ALA A N   1 
ATOM   1688 C  CA  . ALA A 1 267 ? -10.778 -42.122 -14.532 1.00 46.64  ? 1036 ALA A CA  1 
ATOM   1689 C  C   . ALA A 1 267 ? -10.783 -41.316 -13.239 1.00 47.25  ? 1036 ALA A C   1 
ATOM   1690 O  O   . ALA A 1 267 ? -9.956  -40.430 -13.049 1.00 49.19  ? 1036 ALA A O   1 
ATOM   1691 C  CB  . ALA A 1 267 ? -11.766 -41.531 -15.526 1.00 44.47  ? 1036 ALA A CB  1 
ATOM   1692 N  N   . ALA A 1 268 ? -11.714 -41.638 -12.348 1.00 48.19  ? 1037 ALA A N   1 
ATOM   1693 C  CA  . ALA A 1 268 ? -11.789 -40.983 -11.049 1.00 47.21  ? 1037 ALA A CA  1 
ATOM   1694 C  C   . ALA A 1 268 ? -10.524 -41.242 -10.224 1.00 52.62  ? 1037 ALA A C   1 
ATOM   1695 O  O   . ALA A 1 268 ? -9.992  -40.329 -9.584  1.00 50.90  ? 1037 ALA A O   1 
ATOM   1696 C  CB  . ALA A 1 268 ? -13.026 -41.449 -10.289 1.00 47.25  ? 1037 ALA A CB  1 
ATOM   1697 N  N   . LEU A 1 269 ? -10.042 -42.485 -10.239 1.00 49.27  ? 1038 LEU A N   1 
ATOM   1698 C  CA  . LEU A 1 269 ? -8.830  -42.826 -9.487  1.00 51.81  ? 1038 LEU A CA  1 
ATOM   1699 C  C   . LEU A 1 269 ? -7.573  -42.210 -10.090 1.00 54.10  ? 1038 LEU A C   1 
ATOM   1700 O  O   . LEU A 1 269 ? -6.641  -41.857 -9.368  1.00 55.09  ? 1038 LEU A O   1 
ATOM   1701 C  CB  . LEU A 1 269 ? -8.660  -44.337 -9.405  1.00 50.84  ? 1038 LEU A CB  1 
ATOM   1702 C  CG  . LEU A 1 269 ? -9.484  -44.957 -8.279  1.00 56.00  ? 1038 LEU A CG  1 
ATOM   1703 C  CD1 . LEU A 1 269 ? -9.947  -46.370 -8.641  1.00 58.89  ? 1038 LEU A CD1 1 
ATOM   1704 C  CD2 . LEU A 1 269 ? -8.688  -44.943 -6.984  1.00 60.60  ? 1038 LEU A CD2 1 
ATOM   1705 N  N   . ASP A 1 270 ? -7.543  -42.101 -11.414 1.00 54.19  ? 1039 ASP A N   1 
ATOM   1706 C  CA  . ASP A 1 270 ? -6.418  -41.474 -12.084 1.00 53.48  ? 1039 ASP A CA  1 
ATOM   1707 C  C   . ASP A 1 270 ? -6.391  -39.982 -11.744 1.00 52.61  ? 1039 ASP A C   1 
ATOM   1708 O  O   . ASP A 1 270 ? -5.345  -39.451 -11.381 1.00 53.03  ? 1039 ASP A O   1 
ATOM   1709 C  CB  . ASP A 1 270 ? -6.498  -41.689 -13.593 1.00 58.63  ? 1039 ASP A CB  1 
ATOM   1710 C  CG  . ASP A 1 270 ? -5.174  -41.422 -14.291 1.00 63.49  ? 1039 ASP A CG  1 
ATOM   1711 O  OD1 . ASP A 1 270 ? -4.264  -40.844 -13.654 1.00 66.55  ? 1039 ASP A OD1 1 
ATOM   1712 O  OD2 . ASP A 1 270 ? -5.041  -41.780 -15.481 1.00 63.64  ? 1039 ASP A OD2 1 
ATOM   1713 N  N   . ALA A 1 271 ? -7.550  -39.328 -11.837 1.00 51.83  ? 1040 ALA A N   1 
ATOM   1714 C  CA  . ALA A 1 271 ? -7.689  -37.898 -11.539 1.00 52.58  ? 1040 ALA A CA  1 
ATOM   1715 C  C   . ALA A 1 271 ? -7.347  -37.554 -10.091 1.00 55.23  ? 1040 ALA A C   1 
ATOM   1716 O  O   . ALA A 1 271 ? -6.824  -36.469 -9.804  1.00 54.84  ? 1040 ALA A O   1 
ATOM   1717 C  CB  . ALA A 1 271 ? -9.107  -37.427 -11.860 1.00 49.79  ? 1040 ALA A CB  1 
ATOM   1718 N  N   . GLN A 1 272 ? -7.651  -38.479 -9.184  1.00 57.05  ? 1041 GLN A N   1 
ATOM   1719 C  CA  . GLN A 1 272 ? -7.335  -38.325 -7.766  1.00 56.98  ? 1041 GLN A CA  1 
ATOM   1720 C  C   . GLN A 1 272 ? -5.834  -38.214 -7.513  1.00 57.11  ? 1041 GLN A C   1 
ATOM   1721 O  O   . GLN A 1 272 ? -5.412  -37.707 -6.480  1.00 58.45  ? 1041 GLN A O   1 
ATOM   1722 C  CB  . GLN A 1 272 ? -7.915  -39.501 -6.967  1.00 58.70  ? 1041 GLN A CB  1 
ATOM   1723 C  CG  . GLN A 1 272 ? -7.654  -39.451 -5.469  1.00 60.49  ? 1041 GLN A CG  1 
ATOM   1724 C  CD  . GLN A 1 272 ? -8.298  -40.605 -4.717  1.00 63.96  ? 1041 GLN A CD  1 
ATOM   1725 O  OE1 . GLN A 1 272 ? -8.215  -41.756 -5.139  1.00 63.68  ? 1041 GLN A OE1 1 
ATOM   1726 N  NE2 . GLN A 1 272 ? -8.935  -40.298 -3.589  1.00 62.58  ? 1041 GLN A NE2 1 
ATOM   1727 N  N   . LYS A 1 273 ? -5.026  -38.680 -8.460  1.00 57.16  ? 1042 LYS A N   1 
ATOM   1728 C  CA  . LYS A 1 273 ? -3.572  -38.688 -8.289  1.00 58.85  ? 1042 LYS A CA  1 
ATOM   1729 C  C   . LYS A 1 273 ? -2.912  -37.453 -8.908  1.00 58.92  ? 1042 LYS A C   1 
ATOM   1730 O  O   . LYS A 1 273 ? -1.695  -37.262 -8.802  1.00 59.42  ? 1042 LYS A O   1 
ATOM   1731 C  CB  . LYS A 1 273 ? -2.974  -39.963 -8.891  1.00 61.84  ? 1042 LYS A CB  1 
ATOM   1732 C  CG  . LYS A 1 273 ? -3.206  -41.209 -8.027  1.00 64.91  ? 1042 LYS A CG  1 
ATOM   1733 C  CD  . LYS A 1 273 ? -2.575  -42.461 -8.613  1.00 66.23  ? 1042 LYS A CD  1 
ATOM   1734 C  CE  . LYS A 1 273 ? -3.340  -42.958 -9.824  1.00 67.72  ? 1042 LYS A CE  1 
ATOM   1735 N  NZ  . LYS A 1 273 ? -2.909  -44.332 -10.233 1.00 69.39  ? 1042 LYS A NZ  1 
ATOM   1736 N  N   . ALA A 1 274 ? -3.718  -36.621 -9.557  1.00 59.71  ? 1043 ALA A N   1 
ATOM   1737 C  CA  . ALA A 1 274 ? -3.201  -35.425 -10.207 1.00 61.08  ? 1043 ALA A CA  1 
ATOM   1738 C  C   . ALA A 1 274 ? -3.103  -34.307 -9.188  1.00 59.84  ? 1043 ALA A C   1 
ATOM   1739 O  O   . ALA A 1 274 ? -4.073  -33.597 -8.941  1.00 64.60  ? 1043 ALA A O   1 
ATOM   1740 C  CB  . ALA A 1 274 ? -4.085  -35.019 -11.372 1.00 59.72  ? 1043 ALA A CB  1 
ATOM   1741 N  N   . THR A 1 275 ? -1.933  -34.166 -8.580  1.00 62.77  ? 1044 THR A N   1 
ATOM   1742 C  CA  . THR A 1 275 ? -1.745  -33.165 -7.539  1.00 64.82  ? 1044 THR A CA  1 
ATOM   1743 C  C   . THR A 1 275 ? -1.230  -31.853 -8.123  1.00 67.69  ? 1044 THR A C   1 
ATOM   1744 O  O   . THR A 1 275 ? -0.190  -31.823 -8.787  1.00 64.96  ? 1044 THR A O   1 
ATOM   1745 C  CB  . THR A 1 275 ? -0.774  -33.668 -6.448  1.00 66.73  ? 1044 THR A CB  1 
ATOM   1746 O  OG1 . THR A 1 275 ? -1.299  -34.865 -5.862  1.00 69.30  ? 1044 THR A OG1 1 
ATOM   1747 C  CG2 . THR A 1 275 ? -0.601  -32.629 -5.362  1.00 65.57  ? 1044 THR A CG2 1 
ATOM   1748 N  N   . PRO A 1 276 ? -1.975  -30.758 -7.891  1.00 69.00  ? 1045 PRO A N   1 
ATOM   1749 C  CA  . PRO A 1 276 ? -1.505  -29.422 -8.281  1.00 68.98  ? 1045 PRO A CA  1 
ATOM   1750 C  C   . PRO A 1 276 ? -0.238  -29.043 -7.544  1.00 68.76  ? 1045 PRO A C   1 
ATOM   1751 O  O   . PRO A 1 276 ? -0.039  -29.512 -6.425  1.00 70.19  ? 1045 PRO A O   1 
ATOM   1752 C  CB  . PRO A 1 276 ? -2.665  -28.504 -7.882  1.00 69.05  ? 1045 PRO A CB  1 
ATOM   1753 C  CG  . PRO A 1 276 ? -3.456  -29.288 -6.880  1.00 71.21  ? 1045 PRO A CG  1 
ATOM   1754 C  CD  . PRO A 1 276 ? -3.310  -30.720 -7.271  1.00 68.34  ? 1045 PRO A CD  1 
ATOM   1755 N  N   . PRO A 1 277 ? 0.609   -28.202 -8.161  1.00 68.27  ? 1046 PRO A N   1 
ATOM   1756 C  CA  . PRO A 1 277 ? 1.854   -27.738 -7.549  1.00 70.55  ? 1046 PRO A CA  1 
ATOM   1757 C  C   . PRO A 1 277 ? 1.626   -27.087 -6.182  1.00 73.61  ? 1046 PRO A C   1 
ATOM   1758 O  O   . PRO A 1 277 ? 2.512   -27.130 -5.329  1.00 77.03  ? 1046 PRO A O   1 
ATOM   1759 C  CB  . PRO A 1 277 ? 2.379   -26.721 -8.569  1.00 70.71  ? 1046 PRO A CB  1 
ATOM   1760 C  CG  . PRO A 1 277 ? 1.816   -27.193 -9.865  1.00 65.66  ? 1046 PRO A CG  1 
ATOM   1761 C  CD  . PRO A 1 277 ? 0.450   -27.688 -9.532  1.00 66.78  ? 1046 PRO A CD  1 
ATOM   1762 N  N   . LYS A 1 278 ? 0.443   -26.506 -5.982  1.00 74.61  ? 1047 LYS A N   1 
ATOM   1763 C  CA  . LYS A 1 278 ? 0.091   -25.862 -4.717  1.00 77.15  ? 1047 LYS A CA  1 
ATOM   1764 C  C   . LYS A 1 278 ? 0.160   -26.842 -3.539  1.00 79.05  ? 1047 LYS A C   1 
ATOM   1765 O  O   . LYS A 1 278 ? 0.561   -26.472 -2.434  1.00 79.97  ? 1047 LYS A O   1 
ATOM   1766 C  CB  . LYS A 1 278 ? -1.311  -25.244 -4.805  1.00 75.08  ? 1047 LYS A CB  1 
ATOM   1767 C  CG  . LYS A 1 278 ? -1.564  -24.136 -3.791  1.00 74.03  ? 1047 LYS A CG  1 
ATOM   1768 N  N   . LEU A 1 279 ? -0.225  -28.091 -3.790  1.00 83.09  ? 1048 LEU A N   1 
ATOM   1769 C  CA  . LEU A 1 279 ? -0.243  -29.124 -2.757  1.00 83.50  ? 1048 LEU A CA  1 
ATOM   1770 C  C   . LEU A 1 279 ? 0.850   -30.172 -2.962  1.00 84.59  ? 1048 LEU A C   1 
ATOM   1771 O  O   . LEU A 1 279 ? 0.913   -31.161 -2.230  1.00 86.90  ? 1048 LEU A O   1 
ATOM   1772 C  CB  . LEU A 1 279 ? -1.607  -29.822 -2.721  1.00 81.10  ? 1048 LEU A CB  1 
ATOM   1773 C  CG  . LEU A 1 279 ? -2.855  -28.946 -2.641  1.00 79.03  ? 1048 LEU A CG  1 
ATOM   1774 C  CD1 . LEU A 1 279 ? -4.108  -29.806 -2.699  1.00 76.58  ? 1048 LEU A CD1 1 
ATOM   1775 C  CD2 . LEU A 1 279 ? -2.826  -28.115 -1.377  1.00 82.30  ? 1048 LEU A CD2 1 
ATOM   1776 N  N   . GLU A 1 280 ? 1.700   -29.972 -3.963  1.00 83.69  ? 1049 GLU A N   1 
ATOM   1777 C  CA  . GLU A 1 280 ? 2.737   -30.956 -4.252  1.00 84.40  ? 1049 GLU A CA  1 
ATOM   1778 C  C   . GLU A 1 280 ? 3.805   -30.920 -3.165  1.00 87.62  ? 1049 GLU A C   1 
ATOM   1779 O  O   . GLU A 1 280 ? 4.457   -31.926 -2.880  1.00 89.16  ? 1049 GLU A O   1 
ATOM   1780 C  CB  . GLU A 1 280 ? 3.361   -30.706 -5.622  1.00 84.13  ? 1049 GLU A CB  1 
ATOM   1781 C  CG  . GLU A 1 280 ? 2.869   -31.652 -6.706  1.00 84.64  ? 1049 GLU A CG  1 
ATOM   1782 C  CD  . GLU A 1 280 ? 3.795   -31.675 -7.904  1.00 86.93  ? 1049 GLU A CD  1 
ATOM   1783 O  OE1 . GLU A 1 280 ? 4.660   -30.774 -7.998  1.00 82.84  ? 1049 GLU A OE1 1 
ATOM   1784 O  OE2 . GLU A 1 280 ? 3.661   -32.589 -8.748  1.00 89.93  ? 1049 GLU A OE2 1 
ATOM   1785 N  N   . ASP A 1 281 ? 3.974   -29.750 -2.558  1.00 90.92  ? 1050 ASP A N   1 
ATOM   1786 C  CA  . ASP A 1 281 ? 4.904   -29.597 -1.451  1.00 93.44  ? 1050 ASP A CA  1 
ATOM   1787 C  C   . ASP A 1 281 ? 4.218   -29.905 -0.119  1.00 95.21  ? 1050 ASP A C   1 
ATOM   1788 O  O   . ASP A 1 281 ? 4.768   -29.628 0.950   1.00 97.72  ? 1050 ASP A O   1 
ATOM   1789 C  CB  . ASP A 1 281 ? 5.492   -28.185 -1.419  1.00 92.50  ? 1050 ASP A CB  1 
ATOM   1790 C  CG  . ASP A 1 281 ? 6.438   -27.914 -2.579  1.00 91.53  ? 1050 ASP A CG  1 
ATOM   1791 O  OD1 . ASP A 1 281 ? 6.815   -28.877 -3.284  1.00 91.54  ? 1050 ASP A OD1 1 
ATOM   1792 O  OD2 . ASP A 1 281 ? 6.837   -26.742 -2.761  1.00 88.48  ? 1050 ASP A OD2 1 
ATOM   1793 N  N   . LYS A 1 282 ? 3.016   -30.469 -0.193  1.00 95.08  ? 1051 LYS A N   1 
ATOM   1794 C  CA  . LYS A 1 282 ? 2.253   -30.855 0.992   1.00 93.09  ? 1051 LYS A CA  1 
ATOM   1795 C  C   . LYS A 1 282 ? 2.414   -32.346 1.295   1.00 93.43  ? 1051 LYS A C   1 
ATOM   1796 O  O   . LYS A 1 282 ? 2.702   -33.149 0.403   1.00 92.83  ? 1051 LYS A O   1 
ATOM   1797 C  CB  . LYS A 1 282 ? 0.765   -30.523 0.812   1.00 89.32  ? 1051 LYS A CB  1 
ATOM   1798 C  CG  . LYS A 1 282 ? 0.264   -29.343 1.634   1.00 87.48  ? 1051 LYS A CG  1 
ATOM   1799 C  CD  . LYS A 1 282 ? 1.032   -28.069 1.321   1.00 85.94  ? 1051 LYS A CD  1 
ATOM   1800 N  N   . SER A 1 283 ? 2.215   -32.707 2.558   1.00 92.21  ? 1052 SER A N   1 
ATOM   1801 C  CA  . SER A 1 283 ? 2.328   -34.094 2.997   1.00 93.56  ? 1052 SER A CA  1 
ATOM   1802 C  C   . SER A 1 283 ? 0.961   -34.697 3.337   1.00 92.13  ? 1052 SER A C   1 
ATOM   1803 O  O   . SER A 1 283 ? 0.014   -33.966 3.638   1.00 87.84  ? 1052 SER A O   1 
ATOM   1804 C  CB  . SER A 1 283 ? 3.267   -34.175 4.204   1.00 98.25  ? 1052 SER A CB  1 
ATOM   1805 O  OG  . SER A 1 283 ? 2.568   -33.927 5.409   1.00 101.90 ? 1052 SER A OG  1 
ATOM   1806 N  N   . PRO A 1 284 ? 0.848   -36.037 3.263   1.00 93.96  ? 1053 PRO A N   1 
ATOM   1807 C  CA  . PRO A 1 284 ? -0.375  -36.736 3.676   1.00 92.71  ? 1053 PRO A CA  1 
ATOM   1808 C  C   . PRO A 1 284 ? -0.526  -36.803 5.193   1.00 96.78  ? 1053 PRO A C   1 
ATOM   1809 O  O   . PRO A 1 284 ? -0.808  -35.779 5.816   1.00 98.88  ? 1053 PRO A O   1 
ATOM   1810 C  CB  . PRO A 1 284 ? -0.193  -38.138 3.089   1.00 92.48  ? 1053 PRO A CB  1 
ATOM   1811 C  CG  . PRO A 1 284 ? 1.279   -38.312 2.995   1.00 95.47  ? 1053 PRO A CG  1 
ATOM   1812 C  CD  . PRO A 1 284 ? 1.818   -36.957 2.640   1.00 94.93  ? 1053 PRO A CD  1 
ATOM   1813 N  N   . PRO A 1 287 ? -4.058  -33.140 5.913   1.00 91.23  ? 1056 PRO A N   1 
ATOM   1814 C  CA  . PRO A 1 287 ? -4.768  -31.861 6.036   1.00 92.82  ? 1056 PRO A CA  1 
ATOM   1815 C  C   . PRO A 1 287 ? -5.247  -31.355 4.676   1.00 89.93  ? 1056 PRO A C   1 
ATOM   1816 O  O   . PRO A 1 287 ? -6.330  -31.748 4.229   1.00 91.33  ? 1056 PRO A O   1 
ATOM   1817 C  CB  . PRO A 1 287 ? -3.714  -30.930 6.641   1.00 95.24  ? 1056 PRO A CB  1 
ATOM   1818 C  CG  . PRO A 1 287 ? -2.403  -31.560 6.291   1.00 94.16  ? 1056 PRO A CG  1 
ATOM   1819 C  CD  . PRO A 1 287 ? -2.643  -33.030 6.308   1.00 93.36  ? 1056 PRO A CD  1 
ATOM   1820 N  N   . GLU A 1 288 ? -4.449  -30.510 4.031   1.00 92.72  ? 1057 GLU A N   1 
ATOM   1821 C  CA  . GLU A 1 288 ? -4.742  -30.017 2.687   1.00 88.25  ? 1057 GLU A CA  1 
ATOM   1822 C  C   . GLU A 1 288 ? -4.951  -31.166 1.711   1.00 91.70  ? 1057 GLU A C   1 
ATOM   1823 O  O   . GLU A 1 288 ? -5.862  -31.140 0.874   1.00 91.33  ? 1057 GLU A O   1 
ATOM   1824 C  CB  . GLU A 1 288 ? -3.603  -29.126 2.191   1.00 86.74  ? 1057 GLU A CB  1 
ATOM   1825 C  CG  . GLU A 1 288 ? -3.443  -27.823 2.961   1.00 89.76  ? 1057 GLU A CG  1 
ATOM   1826 C  CD  . GLU A 1 288 ? -4.535  -26.821 2.649   1.00 92.83  ? 1057 GLU A CD  1 
ATOM   1827 O  OE1 . GLU A 1 288 ? -5.249  -27.002 1.639   1.00 90.47  ? 1057 GLU A OE1 1 
ATOM   1828 O  OE2 . GLU A 1 288 ? -4.679  -25.848 3.415   1.00 100.73 ? 1057 GLU A OE2 1 
ATOM   1829 N  N   . MET A 1 289 ? -4.093  -32.175 1.819   1.00 91.65  ? 1058 MET A N   1 
ATOM   1830 C  CA  . MET A 1 289 ? -4.160  -33.327 0.934   1.00 88.52  ? 1058 MET A CA  1 
ATOM   1831 C  C   . MET A 1 289 ? -5.405  -34.153 1.212   1.00 86.01  ? 1058 MET A C   1 
ATOM   1832 O  O   . MET A 1 289 ? -5.951  -34.783 0.310   1.00 84.73  ? 1058 MET A O   1 
ATOM   1833 C  CB  . MET A 1 289 ? -2.898  -34.183 1.075   1.00 87.72  ? 1058 MET A CB  1 
ATOM   1834 C  CG  . MET A 1 289 ? -1.672  -33.572 0.409   1.00 86.87  ? 1058 MET A CG  1 
ATOM   1835 S  SD  . MET A 1 289 ? -1.862  -33.481 -1.387  1.00 89.14  ? 1058 MET A SD  1 
ATOM   1836 C  CE  . MET A 1 289 ? -2.460  -35.126 -1.756  1.00 80.44  ? 1058 MET A CE  1 
ATOM   1837 N  N   . LYS A 1 290 ? -5.853  -34.136 2.464   1.00 86.74  ? 1059 LYS A N   1 
ATOM   1838 C  CA  . LYS A 1 290 ? -7.061  -34.855 2.858   1.00 88.16  ? 1059 LYS A CA  1 
ATOM   1839 C  C   . LYS A 1 290 ? -8.299  -34.267 2.178   1.00 85.97  ? 1059 LYS A C   1 
ATOM   1840 O  O   . LYS A 1 290 ? -9.166  -35.005 1.716   1.00 85.12  ? 1059 LYS A O   1 
ATOM   1841 C  CB  . LYS A 1 290 ? -7.225  -34.833 4.381   1.00 89.95  ? 1059 LYS A CB  1 
ATOM   1842 N  N   . ASP A 1 291 ? -8.371  -32.940 2.110   1.00 84.82  ? 1060 ASP A N   1 
ATOM   1843 C  CA  . ASP A 1 291 ? -9.481  -32.261 1.444   1.00 83.75  ? 1060 ASP A CA  1 
ATOM   1844 C  C   . ASP A 1 291 ? -9.581  -32.646 -0.031  1.00 82.93  ? 1060 ASP A C   1 
ATOM   1845 O  O   . ASP A 1 291 ? -10.657 -32.983 -0.520  1.00 80.89  ? 1060 ASP A O   1 
ATOM   1846 C  CB  . ASP A 1 291 ? -9.341  -30.735 1.561   1.00 95.68  ? 1060 ASP A CB  1 
ATOM   1847 C  CG  . ASP A 1 291 ? -9.368  -30.248 2.998   1.00 101.62 ? 1060 ASP A CG  1 
ATOM   1848 O  OD1 . ASP A 1 291 ? -10.260 -30.681 3.758   1.00 104.34 ? 1060 ASP A OD1 1 
ATOM   1849 O  OD2 . ASP A 1 291 ? -8.516  -29.406 3.362   1.00 103.96 ? 1060 ASP A OD2 1 
ATOM   1850 N  N   . PHE A 1 292 ? -8.450  -32.590 -0.731  1.00 81.95  ? 1061 PHE A N   1 
ATOM   1851 C  CA  . PHE A 1 292 ? -8.402  -32.818 -2.175  1.00 80.20  ? 1061 PHE A CA  1 
ATOM   1852 C  C   . PHE A 1 292 ? -8.932  -34.188 -2.589  1.00 81.22  ? 1061 PHE A C   1 
ATOM   1853 O  O   . PHE A 1 292 ? -9.805  -34.305 -3.453  1.00 78.83  ? 1061 PHE A O   1 
ATOM   1854 C  CB  . PHE A 1 292 ? -6.964  -32.662 -2.682  1.00 79.99  ? 1061 PHE A CB  1 
ATOM   1855 N  N   . ARG A 1 293 ? -8.390  -35.222 -1.958  1.00 77.87  ? 1062 ARG A N   1 
ATOM   1856 C  CA  . ARG A 1 293 ? -8.681  -36.595 -2.328  1.00 74.56  ? 1062 ARG A CA  1 
ATOM   1857 C  C   . ARG A 1 293 ? -10.070 -37.035 -1.873  1.00 72.84  ? 1062 ARG A C   1 
ATOM   1858 O  O   . ARG A 1 293 ? -10.702 -37.873 -2.517  1.00 72.47  ? 1062 ARG A O   1 
ATOM   1859 C  CB  . ARG A 1 293 ? -7.611  -37.519 -1.742  1.00 76.37  ? 1062 ARG A CB  1 
ATOM   1860 C  CG  . ARG A 1 293 ? -6.184  -37.059 -2.026  1.00 75.19  ? 1062 ARG A CG  1 
ATOM   1861 C  CD  . ARG A 1 293 ? -5.187  -38.173 -1.772  1.00 78.01  ? 1062 ARG A CD  1 
ATOM   1862 N  N   . HIS A 1 294 ? -10.541 -36.464 -0.768  1.00 76.30  ? 1063 HIS A N   1 
ATOM   1863 C  CA  . HIS A 1 294 ? -11.808 -36.872 -0.162  1.00 76.65  ? 1063 HIS A CA  1 
ATOM   1864 C  C   . HIS A 1 294 ? -12.988 -36.817 -1.128  1.00 73.59  ? 1063 HIS A C   1 
ATOM   1865 O  O   . HIS A 1 294 ? -13.866 -37.675 -1.085  1.00 70.21  ? 1063 HIS A O   1 
ATOM   1866 C  CB  . HIS A 1 294 ? -12.118 -36.008 1.060   1.00 76.76  ? 1063 HIS A CB  1 
ATOM   1867 C  CG  . HIS A 1 294 ? -13.529 -36.143 1.546   1.00 77.08  ? 1063 HIS A CG  1 
ATOM   1868 N  ND1 . HIS A 1 294 ? -14.083 -37.359 1.884   1.00 77.52  ? 1063 HIS A ND1 1 
ATOM   1869 C  CD2 . HIS A 1 294 ? -14.496 -35.219 1.735   1.00 79.30  ? 1063 HIS A CD2 1 
ATOM   1870 C  CE1 . HIS A 1 294 ? -15.334 -37.175 2.269   1.00 77.51  ? 1063 HIS A CE1 1 
ATOM   1871 N  NE2 . HIS A 1 294 ? -15.612 -35.889 2.188   1.00 81.18  ? 1063 HIS A NE2 1 
ATOM   1872 N  N   . GLY A 1 295 ? -13.015 -35.803 -1.988  1.00 72.31  ? 1064 GLY A N   1 
ATOM   1873 C  CA  . GLY A 1 295 ? -14.056 -35.706 -2.993  1.00 70.64  ? 1064 GLY A CA  1 
ATOM   1874 C  C   . GLY A 1 295 ? -14.049 -36.926 -3.894  1.00 67.09  ? 1064 GLY A C   1 
ATOM   1875 O  O   . GLY A 1 295 ? -15.092 -37.524 -4.150  1.00 66.58  ? 1064 GLY A O   1 
ATOM   1876 N  N   . PHE A 1 296 ? -12.861 -37.304 -4.357  1.00 61.86  ? 1065 PHE A N   1 
ATOM   1877 C  CA  . PHE A 1 296 ? -12.705 -38.443 -5.256  1.00 63.05  ? 1065 PHE A CA  1 
ATOM   1878 C  C   . PHE A 1 296 ? -13.051 -39.752 -4.555  1.00 61.75  ? 1065 PHE A C   1 
ATOM   1879 O  O   . PHE A 1 296 ? -13.463 -40.711 -5.193  1.00 61.21  ? 1065 PHE A O   1 
ATOM   1880 C  CB  . PHE A 1 296 ? -11.275 -38.517 -5.808  1.00 64.60  ? 1065 PHE A CB  1 
ATOM   1881 C  CG  . PHE A 1 296 ? -10.923 -37.399 -6.752  1.00 67.06  ? 1065 PHE A CG  1 
ATOM   1882 C  CD1 . PHE A 1 296 ? -11.506 -37.323 -8.009  1.00 64.76  ? 1065 PHE A CD1 1 
ATOM   1883 C  CD2 . PHE A 1 296 ? -9.996  -36.432 -6.388  1.00 71.74  ? 1065 PHE A CD2 1 
ATOM   1884 C  CE1 . PHE A 1 296 ? -11.185 -36.304 -8.881  1.00 63.82  ? 1065 PHE A CE1 1 
ATOM   1885 C  CE2 . PHE A 1 296 ? -9.665  -35.405 -7.258  1.00 71.29  ? 1065 PHE A CE2 1 
ATOM   1886 C  CZ  . PHE A 1 296 ? -10.262 -35.342 -8.507  1.00 69.76  ? 1065 PHE A CZ  1 
ATOM   1887 N  N   . ASP A 1 297 ? -12.864 -39.794 -3.240  1.00 62.92  ? 1066 ASP A N   1 
ATOM   1888 C  CA  . ASP A 1 297 ? -13.213 -40.979 -2.472  1.00 65.39  ? 1066 ASP A CA  1 
ATOM   1889 C  C   . ASP A 1 297 ? -14.728 -41.154 -2.416  1.00 63.10  ? 1066 ASP A C   1 
ATOM   1890 O  O   . ASP A 1 297 ? -15.234 -42.268 -2.551  1.00 61.50  ? 1066 ASP A O   1 
ATOM   1891 C  CB  . ASP A 1 297 ? -12.622 -40.898 -1.066  1.00 69.41  ? 1066 ASP A CB  1 
ATOM   1892 C  CG  . ASP A 1 297 ? -11.107 -40.944 -1.072  1.00 76.03  ? 1066 ASP A CG  1 
ATOM   1893 O  OD1 . ASP A 1 297 ? -10.547 -41.793 -1.801  1.00 75.90  ? 1066 ASP A OD1 1 
ATOM   1894 O  OD2 . ASP A 1 297 ? -10.478 -40.127 -0.357  1.00 78.65  ? 1066 ASP A OD2 1 
ATOM   1895 N  N   . ILE A 1 298 ? -15.445 -40.049 -2.226  1.00 65.90  ? 1067 ILE A N   1 
ATOM   1896 C  CA  . ILE A 1 298 ? -16.906 -40.071 -2.253  1.00 63.86  ? 1067 ILE A CA  1 
ATOM   1897 C  C   . ILE A 1 298 ? -17.411 -40.521 -3.623  1.00 63.54  ? 1067 ILE A C   1 
ATOM   1898 O  O   . ILE A 1 298 ? -18.337 -41.329 -3.721  1.00 61.92  ? 1067 ILE A O   1 
ATOM   1899 C  CB  . ILE A 1 298 ? -17.511 -38.685 -1.915  1.00 66.44  ? 1067 ILE A CB  1 
ATOM   1900 C  CG1 . ILE A 1 298 ? -17.154 -38.274 -0.482  1.00 69.78  ? 1067 ILE A CG1 1 
ATOM   1901 C  CG2 . ILE A 1 298 ? -19.020 -38.702 -2.105  1.00 62.49  ? 1067 ILE A CG2 1 
ATOM   1902 C  CD1 . ILE A 1 298 ? -17.896 -37.046 0.018   1.00 70.77  ? 1067 ILE A CD1 1 
ATOM   1903 N  N   . LEU A 1 299 ? -16.786 -40.005 -4.674  1.00 60.61  ? 1068 LEU A N   1 
ATOM   1904 C  CA  . LEU A 1 299 ? -17.163 -40.340 -6.040  1.00 59.65  ? 1068 LEU A CA  1 
ATOM   1905 C  C   . LEU A 1 299 ? -16.985 -41.826 -6.337  1.00 58.65  ? 1068 LEU A C   1 
ATOM   1906 O  O   . LEU A 1 299 ? -17.897 -42.477 -6.845  1.00 57.48  ? 1068 LEU A O   1 
ATOM   1907 C  CB  . LEU A 1 299 ? -16.345 -39.522 -7.034  1.00 60.96  ? 1068 LEU A CB  1 
ATOM   1908 C  CG  . LEU A 1 299 ? -16.900 -39.462 -8.456  1.00 59.41  ? 1068 LEU A CG  1 
ATOM   1909 C  CD1 . LEU A 1 299 ? -18.173 -38.651 -8.479  1.00 60.45  ? 1068 LEU A CD1 1 
ATOM   1910 C  CD2 . LEU A 1 299 ? -15.872 -38.886 -9.419  1.00 62.63  ? 1068 LEU A CD2 1 
ATOM   1911 N  N   . VAL A 1 300 ? -15.805 -42.358 -6.034  1.00 55.30  ? 1069 VAL A N   1 
ATOM   1912 C  CA  . VAL A 1 300 ? -15.525 -43.769 -6.290  1.00 54.87  ? 1069 VAL A CA  1 
ATOM   1913 C  C   . VAL A 1 300 ? -16.497 -44.647 -5.512  1.00 54.72  ? 1069 VAL A C   1 
ATOM   1914 O  O   . VAL A 1 300 ? -16.972 -45.659 -6.021  1.00 55.68  ? 1069 VAL A O   1 
ATOM   1915 C  CB  . VAL A 1 300 ? -14.076 -44.136 -5.921  1.00 58.55  ? 1069 VAL A CB  1 
ATOM   1916 C  CG1 . VAL A 1 300 ? -13.869 -45.634 -5.968  1.00 60.45  ? 1069 VAL A CG1 1 
ATOM   1917 C  CG2 . VAL A 1 300 ? -13.102 -43.447 -6.860  1.00 58.00  ? 1069 VAL A CG2 1 
ATOM   1918 N  N   . GLY A 1 301 ? -16.804 -44.240 -4.285  1.00 58.48  ? 1070 GLY A N   1 
ATOM   1919 C  CA  . GLY A 1 301 ? -17.738 -44.977 -3.454  1.00 59.78  ? 1070 GLY A CA  1 
ATOM   1920 C  C   . GLY A 1 301 ? -19.113 -45.043 -4.087  1.00 57.87  ? 1070 GLY A C   1 
ATOM   1921 O  O   . GLY A 1 301 ? -19.779 -46.077 -4.067  1.00 57.02  ? 1070 GLY A O   1 
ATOM   1922 N  N   . GLN A 1 302 ? -19.544 -43.930 -4.663  1.00 60.18  ? 1071 GLN A N   1 
ATOM   1923 C  CA  . GLN A 1 302 ? -20.830 -43.904 -5.335  1.00 58.55  ? 1071 GLN A CA  1 
ATOM   1924 C  C   . GLN A 1 302 ? -20.802 -44.697 -6.634  1.00 59.57  ? 1071 GLN A C   1 
ATOM   1925 O  O   . GLN A 1 302 ? -21.781 -45.369 -6.975  1.00 61.45  ? 1071 GLN A O   1 
ATOM   1926 C  CB  . GLN A 1 302 ? -21.258 -42.474 -5.615  1.00 58.46  ? 1071 GLN A CB  1 
ATOM   1927 C  CG  . GLN A 1 302 ? -21.561 -41.644 -4.387  1.00 61.64  ? 1071 GLN A CG  1 
ATOM   1928 C  CD  . GLN A 1 302 ? -21.958 -40.240 -4.759  1.00 63.56  ? 1071 GLN A CD  1 
ATOM   1929 O  OE1 . GLN A 1 302 ? -21.224 -39.544 -5.457  1.00 64.14  ? 1071 GLN A OE1 1 
ATOM   1930 N  NE2 . GLN A 1 302 ? -23.139 -39.819 -4.314  1.00 65.09  ? 1071 GLN A NE2 1 
ATOM   1931 N  N   . ILE A 1 303 ? -19.690 -44.613 -7.364  1.00 52.26  ? 1072 ILE A N   1 
ATOM   1932 C  CA  . ILE A 1 303 ? -19.528 -45.413 -8.575  1.00 50.59  ? 1072 ILE A CA  1 
ATOM   1933 C  C   . ILE A 1 303 ? -19.588 -46.899 -8.227  1.00 53.93  ? 1072 ILE A C   1 
ATOM   1934 O  O   . ILE A 1 303 ? -20.168 -47.702 -8.974  1.00 49.57  ? 1072 ILE A O   1 
ATOM   1935 C  CB  . ILE A 1 303 ? -18.201 -45.105 -9.290  1.00 54.23  ? 1072 ILE A CB  1 
ATOM   1936 C  CG1 . ILE A 1 303 ? -18.260 -43.729 -9.956  1.00 54.38  ? 1072 ILE A CG1 1 
ATOM   1937 C  CG2 . ILE A 1 303 ? -17.890 -46.171 -10.343 1.00 53.39  ? 1072 ILE A CG2 1 
ATOM   1938 C  CD1 . ILE A 1 303 ? -17.029 -43.387 -10.762 1.00 56.32  ? 1072 ILE A CD1 1 
ATOM   1939 N  N   . ASP A 1 304 ? -18.998 -47.267 -7.089  1.00 51.69  ? 1073 ASP A N   1 
ATOM   1940 C  CA  . ASP A 1 304 ? -18.977 -48.675 -6.686  1.00 54.94  ? 1073 ASP A CA  1 
ATOM   1941 C  C   . ASP A 1 304 ? -20.388 -49.165 -6.354  1.00 52.91  ? 1073 ASP A C   1 
ATOM   1942 O  O   . ASP A 1 304 ? -20.755 -50.285 -6.700  1.00 51.10  ? 1073 ASP A O   1 
ATOM   1943 C  CB  . ASP A 1 304 ? -18.051 -48.900 -5.489  1.00 58.23  ? 1073 ASP A CB  1 
ATOM   1944 C  CG  . ASP A 1 304 ? -16.584 -48.984 -5.889  1.00 63.83  ? 1073 ASP A CG  1 
ATOM   1945 O  OD1 . ASP A 1 304 ? -16.300 -49.122 -7.099  1.00 64.03  ? 1073 ASP A OD1 1 
ATOM   1946 O  OD2 . ASP A 1 304 ? -15.714 -48.932 -4.992  1.00 64.17  ? 1073 ASP A OD2 1 
ATOM   1947 N  N   . ASP A 1 305 ? -21.175 -48.322 -5.688  1.00 53.83  ? 1074 ASP A N   1 
ATOM   1948 C  CA  . ASP A 1 305 ? -22.565 -48.657 -5.405  1.00 52.32  ? 1074 ASP A CA  1 
ATOM   1949 C  C   . ASP A 1 305 ? -23.351 -48.835 -6.715  1.00 51.93  ? 1074 ASP A C   1 
ATOM   1950 O  O   . ASP A 1 305 ? -24.145 -49.773 -6.853  1.00 49.80  ? 1074 ASP A O   1 
ATOM   1951 C  CB  . ASP A 1 305 ? -23.202 -47.584 -4.516  1.00 56.93  ? 1074 ASP A CB  1 
ATOM   1952 C  CG  . ASP A 1 305 ? -22.607 -47.562 -3.113  1.00 65.09  ? 1074 ASP A CG  1 
ATOM   1953 O  OD1 . ASP A 1 305 ? -21.979 -48.572 -2.730  1.00 66.85  ? 1074 ASP A OD1 1 
ATOM   1954 O  OD2 . ASP A 1 305 ? -22.762 -46.545 -2.397  1.00 69.17  ? 1074 ASP A OD2 1 
ATOM   1955 N  N   . ALA A 1 306 ? -23.102 -47.950 -7.680  1.00 48.94  ? 1075 ALA A N   1 
ATOM   1956 C  CA  . ALA A 1 306 ? -23.744 -48.031 -8.991  1.00 47.86  ? 1075 ALA A CA  1 
ATOM   1957 C  C   . ALA A 1 306 ? -23.324 -49.280 -9.775  1.00 46.13  ? 1075 ALA A C   1 
ATOM   1958 O  O   . ALA A 1 306 ? -24.122 -49.855 -10.519 1.00 44.26  ? 1075 ALA A O   1 
ATOM   1959 C  CB  . ALA A 1 306 ? -23.441 -46.791 -9.799  1.00 45.04  ? 1075 ALA A CB  1 
ATOM   1960 N  N   . LEU A 1 307 ? -22.067 -49.685 -9.622  1.00 43.91  ? 1076 LEU A N   1 
ATOM   1961 C  CA  . LEU A 1 307 ? -21.564 -50.865 -10.318 1.00 44.08  ? 1076 LEU A CA  1 
ATOM   1962 C  C   . LEU A 1 307 ? -22.296 -52.103 -9.833  1.00 45.54  ? 1076 LEU A C   1 
ATOM   1963 O  O   . LEU A 1 307 ? -22.692 -52.940 -10.623 1.00 42.27  ? 1076 LEU A O   1 
ATOM   1964 C  CB  . LEU A 1 307 ? -20.050 -51.018 -10.113 1.00 47.97  ? 1076 LEU A CB  1 
ATOM   1965 C  CG  . LEU A 1 307 ? -19.150 -50.391 -11.189 1.00 47.68  ? 1076 LEU A CG  1 
ATOM   1966 C  CD1 . LEU A 1 307 ? -17.735 -50.187 -10.653 1.00 52.88  ? 1076 LEU A CD1 1 
ATOM   1967 C  CD2 . LEU A 1 307 ? -19.113 -51.259 -12.451 1.00 45.48  ? 1076 LEU A CD2 1 
ATOM   1968 N  N   . LYS A 1 308 ? -22.489 -52.195 -8.526  1.00 46.79  ? 1077 LYS A N   1 
ATOM   1969 C  CA  . LYS A 1 308 ? -23.214 -53.317 -7.953  1.00 49.81  ? 1077 LYS A CA  1 
ATOM   1970 C  C   . LYS A 1 308 ? -24.624 -53.416 -8.533  1.00 46.75  ? 1077 LYS A C   1 
ATOM   1971 O  O   . LYS A 1 308 ? -25.090 -54.505 -8.862  1.00 43.97  ? 1077 LYS A O   1 
ATOM   1972 C  CB  . LYS A 1 308 ? -23.272 -53.187 -6.433  1.00 51.86  ? 1077 LYS A CB  1 
ATOM   1973 C  CG  . LYS A 1 308 ? -24.048 -54.287 -5.758  1.00 55.80  ? 1077 LYS A CG  1 
ATOM   1974 C  CD  . LYS A 1 308 ? -23.928 -54.171 -4.253  1.00 60.62  ? 1077 LYS A CD  1 
ATOM   1975 C  CE  . LYS A 1 308 ? -24.904 -55.103 -3.567  1.00 65.02  ? 1077 LYS A CE  1 
ATOM   1976 N  NZ  . LYS A 1 308 ? -25.106 -56.342 -4.375  1.00 66.08  ? 1077 LYS A NZ  1 
ATOM   1977 N  N   . LEU A 1 309 ? -25.292 -52.275 -8.674  1.00 45.61  ? 1078 LEU A N   1 
ATOM   1978 C  CA  . LEU A 1 309 ? -26.633 -52.231 -9.264  1.00 43.29  ? 1078 LEU A CA  1 
ATOM   1979 C  C   . LEU A 1 309 ? -26.625 -52.691 -10.728 1.00 44.04  ? 1078 LEU A C   1 
ATOM   1980 O  O   . LEU A 1 309 ? -27.456 -53.507 -11.140 1.00 44.90  ? 1078 LEU A O   1 
ATOM   1981 C  CB  . LEU A 1 309 ? -27.217 -50.814 -9.163  1.00 43.63  ? 1078 LEU A CB  1 
ATOM   1982 C  CG  . LEU A 1 309 ? -27.465 -50.280 -7.752  1.00 45.13  ? 1078 LEU A CG  1 
ATOM   1983 C  CD1 . LEU A 1 309 ? -27.768 -48.787 -7.795  1.00 46.01  ? 1078 LEU A CD1 1 
ATOM   1984 C  CD2 . LEU A 1 309 ? -28.601 -51.032 -7.076  1.00 46.23  ? 1078 LEU A CD2 1 
ATOM   1985 N  N   . ALA A 1 310 ? -25.685 -52.159 -11.505 1.00 40.36  ? 1079 ALA A N   1 
ATOM   1986 C  CA  . ALA A 1 310 ? -25.565 -52.510 -12.916 1.00 39.27  ? 1079 ALA A CA  1 
ATOM   1987 C  C   . ALA A 1 310 ? -25.273 -53.996 -13.083 1.00 39.62  ? 1079 ALA A C   1 
ATOM   1988 O  O   . ALA A 1 310 ? -25.815 -54.655 -13.970 1.00 38.69  ? 1079 ALA A O   1 
ATOM   1989 C  CB  . ALA A 1 310 ? -24.473 -51.682 -13.578 1.00 39.98  ? 1079 ALA A CB  1 
ATOM   1990 N  N   . ASN A 1 311 ? -24.418 -54.511 -12.210 1.00 41.22  ? 1080 ASN A N   1 
ATOM   1991 C  CA  . ASN A 1 311 ? -24.016 -55.913 -12.254 1.00 43.58  ? 1080 ASN A CA  1 
ATOM   1992 C  C   . ASN A 1 311 ? -25.190 -56.860 -12.000 1.00 41.64  ? 1080 ASN A C   1 
ATOM   1993 O  O   . ASN A 1 311 ? -25.251 -57.967 -12.551 1.00 41.00  ? 1080 ASN A O   1 
ATOM   1994 C  CB  . ASN A 1 311 ? -22.906 -56.167 -11.236 1.00 46.47  ? 1080 ASN A CB  1 
ATOM   1995 C  CG  . ASN A 1 311 ? -22.223 -57.486 -11.462 1.00 50.64  ? 1080 ASN A CG  1 
ATOM   1996 O  OD1 . ASN A 1 311 ? -21.841 -57.808 -12.586 1.00 46.25  ? 1080 ASN A OD1 1 
ATOM   1997 N  ND2 . ASN A 1 311 ? -22.066 -58.265 -10.398 1.00 55.16  ? 1080 ASN A ND2 1 
ATOM   1998 N  N   . GLU A 1 312 ? -26.117 -56.411 -11.162 1.00 46.60  ? 1081 GLU A N   1 
ATOM   1999 C  CA  . GLU A 1 312 ? -27.311 -57.180 -10.846 1.00 45.84  ? 1081 GLU A CA  1 
ATOM   2000 C  C   . GLU A 1 312 ? -28.406 -56.952 -11.880 1.00 44.77  ? 1081 GLU A C   1 
ATOM   2001 O  O   . GLU A 1 312 ? -29.484 -57.510 -11.778 1.00 45.48  ? 1081 GLU A O   1 
ATOM   2002 C  CB  . GLU A 1 312 ? -27.795 -56.824 -9.436  1.00 46.94  ? 1081 GLU A CB  1 
ATOM   2003 C  CG  . GLU A 1 312 ? -26.869 -57.377 -8.359  1.00 51.09  ? 1081 GLU A CG  1 
ATOM   2004 C  CD  . GLU A 1 312 ? -26.938 -56.628 -7.042  1.00 58.34  ? 1081 GLU A CD  1 
ATOM   2005 O  OE1 . GLU A 1 312 ? -27.522 -55.516 -6.986  1.00 59.06  ? 1081 GLU A OE1 1 
ATOM   2006 O  OE2 . GLU A 1 312 ? -26.402 -57.166 -6.049  1.00 61.89  ? 1081 GLU A OE2 1 
ATOM   2007 N  N   . GLY A 1 313 ? -28.111 -56.140 -12.885 1.00 37.86  ? 1082 GLY A N   1 
ATOM   2008 C  CA  . GLY A 1 313 ? -29.044 -55.863 -13.961 1.00 39.87  ? 1082 GLY A CA  1 
ATOM   2009 C  C   . GLY A 1 313 ? -30.073 -54.787 -13.655 1.00 42.79  ? 1082 GLY A C   1 
ATOM   2010 O  O   . GLY A 1 313 ? -31.045 -54.633 -14.388 1.00 46.61  ? 1082 GLY A O   1 
ATOM   2011 N  N   . LYS A 1 314 ? -29.869 -54.042 -12.572 1.00 43.30  ? 1083 LYS A N   1 
ATOM   2012 C  CA  . LYS A 1 314 ? -30.837 -53.023 -12.173 1.00 45.18  ? 1083 LYS A CA  1 
ATOM   2013 C  C   . LYS A 1 314 ? -30.520 -51.710 -12.881 1.00 48.82  ? 1083 LYS A C   1 
ATOM   2014 O  O   . LYS A 1 314 ? -29.961 -50.801 -12.280 1.00 47.45  ? 1083 LYS A O   1 
ATOM   2015 C  CB  . LYS A 1 314 ? -30.828 -52.841 -10.655 1.00 44.77  ? 1083 LYS A CB  1 
ATOM   2016 C  CG  . LYS A 1 314 ? -31.336 -54.057 -9.889  1.00 44.76  ? 1083 LYS A CG  1 
ATOM   2017 C  CD  . LYS A 1 314 ? -31.230 -53.860 -8.385  1.00 45.25  ? 1083 LYS A CD  1 
ATOM   2018 C  CE  . LYS A 1 314 ? -31.502 -55.177 -7.654  1.00 49.44  ? 1083 LYS A CE  1 
ATOM   2019 N  NZ  . LYS A 1 314 ? -32.959 -55.416 -7.478  1.00 54.34  ? 1083 LYS A NZ  1 
ATOM   2020 N  N   . VAL A 1 315 ? -30.869 -51.628 -14.161 1.00 46.34  ? 1084 VAL A N   1 
ATOM   2021 C  CA  . VAL A 1 315 ? -30.435 -50.521 -15.019 1.00 47.68  ? 1084 VAL A CA  1 
ATOM   2022 C  C   . VAL A 1 315 ? -30.960 -49.168 -14.546 1.00 48.96  ? 1084 VAL A C   1 
ATOM   2023 O  O   . VAL A 1 315 ? -30.194 -48.223 -14.439 1.00 47.41  ? 1084 VAL A O   1 
ATOM   2024 C  CB  . VAL A 1 315 ? -30.876 -50.750 -16.484 1.00 47.96  ? 1084 VAL A CB  1 
ATOM   2025 C  CG1 . VAL A 1 315 ? -30.452 -49.603 -17.364 1.00 48.13  ? 1084 VAL A CG1 1 
ATOM   2026 C  CG2 . VAL A 1 315 ? -30.292 -52.056 -17.009 1.00 47.16  ? 1084 VAL A CG2 1 
ATOM   2027 N  N   . LYS A 1 316 ? -32.258 -49.103 -14.250 1.00 51.17  ? 1085 LYS A N   1 
ATOM   2028 C  CA  . LYS A 1 316 ? -32.918 -47.877 -13.779 1.00 54.15  ? 1085 LYS A CA  1 
ATOM   2029 C  C   . LYS A 1 316 ? -32.235 -47.337 -12.528 1.00 52.28  ? 1085 LYS A C   1 
ATOM   2030 O  O   . LYS A 1 316 ? -31.906 -46.138 -12.447 1.00 51.08  ? 1085 LYS A O   1 
ATOM   2031 C  CB  . LYS A 1 316 ? -34.395 -48.140 -13.476 1.00 55.70  ? 1085 LYS A CB  1 
ATOM   2032 C  CG  . LYS A 1 316 ? -35.373 -47.766 -14.590 1.00 62.27  ? 1085 LYS A CG  1 
ATOM   2033 C  CD  . LYS A 1 316 ? -34.891 -46.570 -15.383 1.00 66.16  ? 1085 LYS A CD  1 
ATOM   2034 C  CE  . LYS A 1 316 ? -35.786 -46.314 -16.596 1.00 68.36  ? 1085 LYS A CE  1 
ATOM   2035 N  NZ  . LYS A 1 316 ? -35.117 -45.381 -17.552 1.00 67.23  ? 1085 LYS A NZ  1 
ATOM   2036 N  N   . GLU A 1 317 ? -32.047 -48.228 -11.554 1.00 53.55  ? 1086 GLU A N   1 
ATOM   2037 C  CA  . GLU A 1 317 ? -31.403 -47.881 -10.294 1.00 53.85  ? 1086 GLU A CA  1 
ATOM   2038 C  C   . GLU A 1 317 ? -29.979 -47.402 -10.528 1.00 51.67  ? 1086 GLU A C   1 
ATOM   2039 O  O   . GLU A 1 317 ? -29.559 -46.407 -9.944  1.00 53.10  ? 1086 GLU A O   1 
ATOM   2040 C  CB  . GLU A 1 317 ? -31.394 -49.072 -9.326  1.00 51.14  ? 1086 GLU A CB  1 
ATOM   2041 C  CG  . GLU A 1 317 ? -32.729 -49.380 -8.676  1.00 52.90  ? 1086 GLU A CG  1 
ATOM   2042 C  CD  . GLU A 1 317 ? -33.436 -50.539 -9.346  1.00 62.11  ? 1086 GLU A CD  1 
ATOM   2043 O  OE1 . GLU A 1 317 ? -33.222 -50.741 -10.569 1.00 64.86  ? 1086 GLU A OE1 1 
ATOM   2044 O  OE2 . GLU A 1 317 ? -34.182 -51.267 -8.652  1.00 64.66  ? 1086 GLU A OE2 1 
ATOM   2045 N  N   . ALA A 1 318 ? -29.236 -48.119 -11.373 1.00 49.81  ? 1087 ALA A N   1 
ATOM   2046 C  CA  . ALA A 1 318 ? -27.855 -47.753 -11.662 1.00 48.48  ? 1087 ALA A CA  1 
ATOM   2047 C  C   . ALA A 1 318 ? -27.793 -46.396 -12.349 1.00 51.02  ? 1087 ALA A C   1 
ATOM   2048 O  O   . ALA A 1 318 ? -26.870 -45.619 -12.118 1.00 49.67  ? 1087 ALA A O   1 
ATOM   2049 C  CB  . ALA A 1 318 ? -27.173 -48.813 -12.522 1.00 47.56  ? 1087 ALA A CB  1 
ATOM   2050 N  N   . GLN A 1 319 ? -28.771 -46.119 -13.200 1.00 52.49  ? 1088 GLN A N   1 
ATOM   2051 C  CA  . GLN A 1 319 ? -28.805 -44.841 -13.888 1.00 55.66  ? 1088 GLN A CA  1 
ATOM   2052 C  C   . GLN A 1 319 ? -29.107 -43.717 -12.905 1.00 55.51  ? 1088 GLN A C   1 
ATOM   2053 O  O   . GLN A 1 319 ? -28.467 -42.666 -12.963 1.00 55.13  ? 1088 GLN A O   1 
ATOM   2054 C  CB  . GLN A 1 319 ? -29.821 -44.868 -15.025 1.00 56.92  ? 1088 GLN A CB  1 
ATOM   2055 C  CG  . GLN A 1 319 ? -29.343 -45.714 -16.196 1.00 56.78  ? 1088 GLN A CG  1 
ATOM   2056 C  CD  . GLN A 1 319 ? -30.378 -45.829 -17.284 1.00 57.23  ? 1088 GLN A CD  1 
ATOM   2057 O  OE1 . GLN A 1 319 ? -31.555 -46.070 -17.012 1.00 56.38  ? 1088 GLN A OE1 1 
ATOM   2058 N  NE2 . GLN A 1 319 ? -29.950 -45.650 -18.527 1.00 56.66  ? 1088 GLN A NE2 1 
ATOM   2059 N  N   . ALA A 1 320 ? -30.043 -43.938 -11.982 1.00 56.85  ? 1089 ALA A N   1 
ATOM   2060 C  CA  . ALA A 1 320 ? -30.341 -42.908 -10.974 1.00 59.38  ? 1089 ALA A CA  1 
ATOM   2061 C  C   . ALA A 1 320 ? -29.130 -42.643 -10.075 1.00 56.59  ? 1089 ALA A C   1 
ATOM   2062 O  O   . ALA A 1 320 ? -28.889 -41.513 -9.661  1.00 57.90  ? 1089 ALA A O   1 
ATOM   2063 C  CB  . ALA A 1 320 ? -31.546 -43.306 -10.136 1.00 59.74  ? 1089 ALA A CB  1 
ATOM   2064 N  N   . ALA A 1 321 ? -28.369 -43.689 -9.780  1.00 57.84  ? 1090 ALA A N   1 
ATOM   2065 C  CA  . ALA A 1 321 ? -27.165 -43.543 -8.978  1.00 57.88  ? 1090 ALA A CA  1 
ATOM   2066 C  C   . ALA A 1 321 ? -26.120 -42.747 -9.741  1.00 62.33  ? 1090 ALA A C   1 
ATOM   2067 O  O   . ALA A 1 321 ? -25.372 -41.966 -9.147  1.00 61.94  ? 1090 ALA A O   1 
ATOM   2068 C  CB  . ALA A 1 321 ? -26.608 -44.901 -8.580  1.00 55.78  ? 1090 ALA A CB  1 
ATOM   2069 N  N   . ALA A 1 322 ? -26.070 -42.942 -11.057 1.00 61.29  ? 1091 ALA A N   1 
ATOM   2070 C  CA  . ALA A 1 322 ? -25.126 -42.203 -11.889 1.00 60.97  ? 1091 ALA A CA  1 
ATOM   2071 C  C   . ALA A 1 322 ? -25.471 -40.711 -11.933 1.00 63.48  ? 1091 ALA A C   1 
ATOM   2072 O  O   . ALA A 1 322 ? -24.593 -39.875 -12.130 1.00 61.65  ? 1091 ALA A O   1 
ATOM   2073 C  CB  . ALA A 1 322 ? -25.082 -42.784 -13.297 1.00 59.51  ? 1091 ALA A CB  1 
ATOM   2074 N  N   . GLU A 1 323 ? -26.746 -40.383 -11.743 1.00 63.84  ? 1092 GLU A N   1 
ATOM   2075 C  CA  . GLU A 1 323 ? -27.180 -38.988 -11.744 1.00 70.95  ? 1092 GLU A CA  1 
ATOM   2076 C  C   . GLU A 1 323 ? -26.767 -38.293 -10.448 1.00 69.03  ? 1092 GLU A C   1 
ATOM   2077 O  O   . GLU A 1 323 ? -26.492 -37.092 -10.433 1.00 66.93  ? 1092 GLU A O   1 
ATOM   2078 C  CB  . GLU A 1 323 ? -28.697 -38.891 -11.937 1.00 75.40  ? 1092 GLU A CB  1 
ATOM   2079 N  N   . GLN A 1 324 ? -26.728 -39.061 -9.363  1.00 74.41  ? 1093 GLN A N   1 
ATOM   2080 C  CA  . GLN A 1 324 ? -26.303 -38.556 -8.060  1.00 70.36  ? 1093 GLN A CA  1 
ATOM   2081 C  C   . GLN A 1 324 ? -24.792 -38.355 -8.045  1.00 68.81  ? 1093 GLN A C   1 
ATOM   2082 O  O   . GLN A 1 324 ? -24.253 -37.649 -7.195  1.00 71.61  ? 1093 GLN A O   1 
ATOM   2083 C  CB  . GLN A 1 324 ? -26.730 -39.517 -6.942  1.00 69.00  ? 1093 GLN A CB  1 
ATOM   2084 N  N   . LEU A 1 325 ? -24.115 -38.985 -8.997  1.00 67.11  ? 1094 LEU A N   1 
ATOM   2085 C  CA  . LEU A 1 325 ? -22.679 -38.812 -9.162  1.00 67.35  ? 1094 LEU A CA  1 
ATOM   2086 C  C   . LEU A 1 325 ? -22.417 -37.450 -9.760  1.00 71.33  ? 1094 LEU A C   1 
ATOM   2087 O  O   . LEU A 1 325 ? -21.409 -36.804 -9.461  1.00 74.75  ? 1094 LEU A O   1 
ATOM   2088 C  CB  . LEU A 1 325 ? -22.092 -39.905 -10.059 1.00 66.13  ? 1094 LEU A CB  1 
ATOM   2089 C  CG  . LEU A 1 325 ? -21.848 -41.265 -9.414  1.00 68.36  ? 1094 LEU A CG  1 
ATOM   2090 C  CD1 . LEU A 1 325 ? -21.797 -42.356 -10.459 1.00 68.40  ? 1094 LEU A CD1 1 
ATOM   2091 C  CD2 . LEU A 1 325 ? -20.548 -41.217 -8.669  1.00 69.71  ? 1094 LEU A CD2 1 
ATOM   2092 N  N   . LYS A 1 326 ? -23.338 -37.016 -10.610 1.00 73.75  ? 1095 LYS A N   1 
ATOM   2093 C  CA  . LYS A 1 326 ? -23.231 -35.706 -11.233 1.00 78.48  ? 1095 LYS A CA  1 
ATOM   2094 C  C   . LYS A 1 326 ? -23.195 -34.611 -10.168 1.00 82.39  ? 1095 LYS A C   1 
ATOM   2095 O  O   . LYS A 1 326 ? -22.416 -33.666 -10.274 1.00 84.06  ? 1095 LYS A O   1 
ATOM   2096 C  CB  . LYS A 1 326 ? -24.392 -35.481 -12.202 1.00 77.76  ? 1095 LYS A CB  1 
ATOM   2097 C  CG  . LYS A 1 326 ? -24.487 -34.081 -12.766 1.00 80.20  ? 1095 LYS A CG  1 
ATOM   2098 C  CD  . LYS A 1 326 ? -25.417 -34.062 -13.970 1.00 80.77  ? 1095 LYS A CD  1 
ATOM   2099 C  CE  . LYS A 1 326 ? -25.006 -35.127 -14.985 1.00 78.38  ? 1095 LYS A CE  1 
ATOM   2100 N  NZ  . LYS A 1 326 ? -25.849 -35.085 -16.216 1.00 77.63  ? 1095 LYS A NZ  1 
ATOM   2101 N  N   . THR A 1 327 ? -24.021 -34.751 -9.130  1.00 81.24  ? 1096 THR A N   1 
ATOM   2102 C  CA  . THR A 1 327 ? -24.102 -33.740 -8.066  1.00 83.76  ? 1096 THR A CA  1 
ATOM   2103 C  C   . THR A 1 327 ? -22.842 -33.718 -7.191  1.00 79.45  ? 1096 THR A C   1 
ATOM   2104 O  O   . THR A 1 327 ? -22.390 -32.655 -6.769  1.00 77.45  ? 1096 THR A O   1 
ATOM   2105 C  CB  . THR A 1 327 ? -25.338 -33.960 -7.160  1.00 77.98  ? 1096 THR A CB  1 
ATOM   2106 N  N   . THR A 1 328 ? -22.286 -34.897 -6.923  1.00 79.53  ? 1097 THR A N   1 
ATOM   2107 C  CA  . THR A 1 328 ? -21.049 -35.024 -6.157  1.00 79.35  ? 1097 THR A CA  1 
ATOM   2108 C  C   . THR A 1 328 ? -19.900 -34.334 -6.876  1.00 80.55  ? 1097 THR A C   1 
ATOM   2109 O  O   . THR A 1 328 ? -19.142 -33.575 -6.267  1.00 79.33  ? 1097 THR A O   1 
ATOM   2110 C  CB  . THR A 1 328 ? -20.680 -36.497 -5.926  1.00 76.65  ? 1097 THR A CB  1 
ATOM   2111 O  OG1 . THR A 1 328 ? -21.756 -37.161 -5.249  1.00 78.43  ? 1097 THR A OG1 1 
ATOM   2112 C  CG2 . THR A 1 328 ? -19.402 -36.615 -5.101  1.00 75.32  ? 1097 THR A CG2 1 
ATOM   2113 N  N   . ARG A 1 329 ? -19.785 -34.607 -8.175  1.00 81.01  ? 1098 ARG A N   1 
ATOM   2114 C  CA  . ARG A 1 329 ? -18.784 -33.964 -9.019  1.00 79.98  ? 1098 ARG A CA  1 
ATOM   2115 C  C   . ARG A 1 329 ? -18.913 -32.439 -8.966  1.00 78.03  ? 1098 ARG A C   1 
ATOM   2116 O  O   . ARG A 1 329 ? -17.908 -31.730 -8.932  1.00 81.94  ? 1098 ARG A O   1 
ATOM   2117 C  CB  . ARG A 1 329 ? -18.899 -34.465 -10.464 1.00 76.80  ? 1098 ARG A CB  1 
ATOM   2118 N  N   . ASN A 1 330 ? -20.143 -31.933 -8.933  1.00 77.40  ? 1099 ASN A N   1 
ATOM   2119 C  CA  . ASN A 1 330 ? -20.355 -30.490 -8.849  1.00 82.55  ? 1099 ASN A CA  1 
ATOM   2120 C  C   . ASN A 1 330 ? -19.907 -29.934 -7.505  1.00 81.67  ? 1099 ASN A C   1 
ATOM   2121 O  O   . ASN A 1 330 ? -19.370 -28.832 -7.425  1.00 82.23  ? 1099 ASN A O   1 
ATOM   2122 C  CB  . ASN A 1 330 ? -21.826 -30.132 -9.081  1.00 84.26  ? 1099 ASN A CB  1 
ATOM   2123 C  CG  . ASN A 1 330 ? -22.359 -30.688 -10.379 1.00 83.34  ? 1099 ASN A CG  1 
ATOM   2124 O  OD1 . ASN A 1 330 ? -21.592 -31.027 -11.280 1.00 82.78  ? 1099 ASN A OD1 1 
ATOM   2125 N  ND2 . ASN A 1 330 ? -23.678 -30.788 -10.486 1.00 84.46  ? 1099 ASN A ND2 1 
ATOM   2126 N  N   . ALA A 1 331 ? -20.117 -30.719 -6.455  1.00 80.91  ? 1100 ALA A N   1 
ATOM   2127 C  CA  . ALA A 1 331 ? -19.907 -30.252 -5.091  1.00 84.67  ? 1100 ALA A CA  1 
ATOM   2128 C  C   . ALA A 1 331 ? -18.427 -30.186 -4.711  1.00 84.06  ? 1100 ALA A C   1 
ATOM   2129 O  O   . ALA A 1 331 ? -17.907 -29.115 -4.387  1.00 83.70  ? 1100 ALA A O   1 
ATOM   2130 C  CB  . ALA A 1 331 ? -20.666 -31.149 -4.110  1.00 87.14  ? 1100 ALA A CB  1 
ATOM   2131 N  N   . TYR A 1 332 ? -17.749 -31.329 -4.755  1.00 79.92  ? 1101 TYR A N   1 
ATOM   2132 C  CA  . TYR A 1 332 ? -16.382 -31.409 -4.244  1.00 82.39  ? 1101 TYR A CA  1 
ATOM   2133 C  C   . TYR A 1 332 ? -15.312 -31.441 -5.337  1.00 82.61  ? 1101 TYR A C   1 
ATOM   2134 O  O   . TYR A 1 332 ? -14.126 -31.307 -5.043  1.00 82.00  ? 1101 TYR A O   1 
ATOM   2135 C  CB  . TYR A 1 332 ? -16.234 -32.645 -3.350  1.00 85.16  ? 1101 TYR A CB  1 
ATOM   2136 N  N   . ILE A 1 333 ? -15.731 -31.600 -6.591  1.00 80.61  ? 1102 ILE A N   1 
ATOM   2137 C  CA  . ILE A 1 333 ? -14.794 -31.879 -7.678  1.00 80.99  ? 1102 ILE A CA  1 
ATOM   2138 C  C   . ILE A 1 333 ? -14.737 -30.809 -8.785  1.00 77.10  ? 1102 ILE A C   1 
ATOM   2139 O  O   . ILE A 1 333 ? -13.685 -30.211 -9.000  1.00 77.30  ? 1102 ILE A O   1 
ATOM   2140 C  CB  . ILE A 1 333 ? -15.119 -33.249 -8.321  1.00 75.97  ? 1102 ILE A CB  1 
ATOM   2141 C  CG1 . ILE A 1 333 ? -14.857 -34.378 -7.320  1.00 75.24  ? 1102 ILE A CG1 1 
ATOM   2142 C  CG2 . ILE A 1 333 ? -14.296 -33.476 -9.584  1.00 75.39  ? 1102 ILE A CG2 1 
ATOM   2143 C  CD1 . ILE A 1 333 ? -15.364 -35.723 -7.766  1.00 73.16  ? 1102 ILE A CD1 1 
ATOM   2144 N  N   . GLN A 1 334 ? -15.860 -30.566 -9.465  1.00 74.03  ? 1103 GLN A N   1 
ATOM   2145 C  CA  . GLN A 1 334 ? -15.877 -29.816 -10.731 1.00 75.52  ? 1103 GLN A CA  1 
ATOM   2146 C  C   . GLN A 1 334 ? -15.182 -28.449 -10.669 1.00 76.11  ? 1103 GLN A C   1 
ATOM   2147 O  O   . GLN A 1 334 ? -14.413 -28.098 -11.567 1.00 72.14  ? 1103 GLN A O   1 
ATOM   2148 C  CB  . GLN A 1 334 ? -17.323 -29.639 -11.214 1.00 77.86  ? 1103 GLN A CB  1 
ATOM   2149 C  CG  . GLN A 1 334 ? -17.486 -29.400 -12.719 1.00 78.39  ? 1103 GLN A CG  1 
ATOM   2150 C  CD  . GLN A 1 334 ? -17.516 -30.683 -13.530 1.00 79.20  ? 1103 GLN A CD  1 
ATOM   2151 O  OE1 . GLN A 1 334 ? -17.068 -31.736 -13.072 1.00 81.97  ? 1103 GLN A OE1 1 
ATOM   2152 N  NE2 . GLN A 1 334 ? -18.061 -30.605 -14.741 1.00 78.65  ? 1103 GLN A NE2 1 
ATOM   2153 N  N   . LYS A 1 335 ? -15.441 -27.682 -9.612  1.00 70.86  ? 1104 LYS A N   1 
ATOM   2154 C  CA  . LYS A 1 335 ? -14.828 -26.374 -9.470  1.00 73.52  ? 1104 LYS A CA  1 
ATOM   2155 C  C   . LYS A 1 335 ? -13.308 -26.492 -9.419  1.00 78.09  ? 1104 LYS A C   1 
ATOM   2156 O  O   . LYS A 1 335 ? -12.594 -25.661 -9.978  1.00 82.98  ? 1104 LYS A O   1 
ATOM   2157 C  CB  . LYS A 1 335 ? -15.344 -25.658 -8.216  1.00 76.79  ? 1104 LYS A CB  1 
ATOM   2158 N  N   . TYR A 1 336 ? -12.812 -27.535 -8.763  1.00 74.45  ? 1105 TYR A N   1 
ATOM   2159 C  CA  . TYR A 1 336 ? -11.370 -27.692 -8.610  1.00 74.00  ? 1105 TYR A CA  1 
ATOM   2160 C  C   . TYR A 1 336 ? -10.739 -28.278 -9.876  1.00 66.51  ? 1105 TYR A C   1 
ATOM   2161 O  O   . TYR A 1 336 ? -9.589  -27.977 -10.179 1.00 66.74  ? 1105 TYR A O   1 
ATOM   2162 C  CB  . TYR A 1 336 ? -11.041 -28.561 -7.392  1.00 76.69  ? 1105 TYR A CB  1 
ATOM   2163 N  N   . LEU A 1 337 ? -11.485 -29.099 -10.611 1.00 63.79  ? 1106 LEU A N   1 
ATOM   2164 C  CA  . LEU A 1 337 ? -10.994 -29.618 -11.888 1.00 62.69  ? 1106 LEU A CA  1 
ATOM   2165 C  C   . LEU A 1 337 ? -10.746 -28.451 -12.849 1.00 65.11  ? 1106 LEU A C   1 
ATOM   2166 O  O   . LEU A 1 337 ? -9.715  -28.384 -13.507 1.00 64.23  ? 1106 LEU A O   1 
ATOM   2167 C  CB  . LEU A 1 337 ? -11.975 -30.617 -12.510 1.00 61.55  ? 1106 LEU A CB  1 
ATOM   2168 C  CG  . LEU A 1 337 ? -11.881 -32.107 -12.129 1.00 63.07  ? 1106 LEU A CG  1 
ATOM   2169 C  CD1 . LEU A 1 337 ? -12.801 -32.983 -12.980 1.00 60.71  ? 1106 LEU A CD1 1 
ATOM   2170 C  CD2 . LEU A 1 337 ? -10.452 -32.611 -12.218 1.00 64.61  ? 1106 LEU A CD2 1 
ATOM   2171 N  N   . ALA A 1 338 ? -11.695 -27.527 -12.911 1.00 63.07  ? 383  ALA A N   1 
ATOM   2172 C  CA  . ALA A 1 338 ? -11.594 -26.389 -13.822 1.00 59.04  ? 383  ALA A CA  1 
ATOM   2173 C  C   . ALA A 1 338 ? -10.427 -25.483 -13.451 1.00 59.01  ? 383  ALA A C   1 
ATOM   2174 O  O   . ALA A 1 338 ? -9.853  -24.806 -14.301 1.00 58.10  ? 383  ALA A O   1 
ATOM   2175 C  CB  . ALA A 1 338 ? -12.881 -25.606 -13.826 1.00 62.21  ? 383  ALA A CB  1 
ATOM   2176 N  N   . LYS A 1 339 ? -10.080 -25.471 -12.173 1.00 61.22  ? 384  LYS A N   1 
ATOM   2177 C  CA  . LYS A 1 339 ? -8.961  -24.665 -11.728 1.00 63.16  ? 384  LYS A CA  1 
ATOM   2178 C  C   . LYS A 1 339 ? -7.661  -25.346 -12.148 1.00 61.27  ? 384  LYS A C   1 
ATOM   2179 O  O   . LYS A 1 339 ? -6.815  -24.756 -12.820 1.00 58.15  ? 384  LYS A O   1 
ATOM   2180 C  CB  . LYS A 1 339 ? -9.008  -24.482 -10.216 1.00 62.72  ? 384  LYS A CB  1 
ATOM   2181 C  CG  . LYS A 1 339 ? -8.304  -23.250 -9.717  1.00 61.45  ? 384  LYS A CG  1 
ATOM   2182 C  CD  . LYS A 1 339 ? -8.219  -23.291 -8.210  1.00 67.47  ? 384  LYS A CD  1 
ATOM   2183 C  CE  . LYS A 1 339 ? -9.595  -23.357 -7.583  1.00 72.25  ? 384  LYS A CE  1 
ATOM   2184 N  NZ  . LYS A 1 339 ? -9.500  -23.951 -6.218  1.00 76.35  ? 384  LYS A NZ  1 
ATOM   2185 N  N   . ILE A 1 340 ? -7.540  -26.613 -11.778 1.00 57.56  ? 385  ILE A N   1 
ATOM   2186 C  CA  . ILE A 1 340 ? -6.279  -27.340 -11.923 1.00 59.00  ? 385  ILE A CA  1 
ATOM   2187 C  C   . ILE A 1 340 ? -5.981  -27.782 -13.360 1.00 59.39  ? 385  ILE A C   1 
ATOM   2188 O  O   . ILE A 1 340 ? -4.848  -28.126 -13.670 1.00 60.06  ? 385  ILE A O   1 
ATOM   2189 C  CB  . ILE A 1 340 ? -6.237  -28.555 -10.973 1.00 62.48  ? 385  ILE A CB  1 
ATOM   2190 C  CG1 . ILE A 1 340 ? -7.262  -29.614 -11.372 1.00 65.11  ? 385  ILE A CG1 1 
ATOM   2191 C  CG2 . ILE A 1 340 ? -6.459  -28.091 -9.536  1.00 62.32  ? 385  ILE A CG2 1 
ATOM   2192 C  CD1 . ILE A 1 340 ? -7.442  -30.699 -10.337 1.00 69.89  ? 385  ILE A CD1 1 
ATOM   2193 N  N   . THR A 1 341 ? -6.979  -27.733 -14.240 1.00 59.10  ? 386  THR A N   1 
ATOM   2194 C  CA  . THR A 1 341 ? -6.764  -27.981 -15.668 1.00 59.32  ? 386  THR A CA  1 
ATOM   2195 C  C   . THR A 1 341 ? -6.396  -26.698 -16.416 1.00 56.09  ? 386  THR A C   1 
ATOM   2196 O  O   . THR A 1 341 ? -6.001  -26.742 -17.580 1.00 56.08  ? 386  THR A O   1 
ATOM   2197 C  CB  . THR A 1 341 ? -8.010  -28.579 -16.357 1.00 60.93  ? 386  THR A CB  1 
ATOM   2198 O  OG1 . THR A 1 341 ? -9.114  -27.671 -16.215 1.00 59.03  ? 386  THR A OG1 1 
ATOM   2199 C  CG2 . THR A 1 341 ? -8.362  -29.941 -15.764 1.00 64.59  ? 386  THR A CG2 1 
ATOM   2200 N  N   . GLY A 1 342 ? -6.555  -25.552 -15.761 1.00 54.36  ? 387  GLY A N   1 
ATOM   2201 C  CA  . GLY A 1 342 ? -6.231  -24.282 -16.376 1.00 52.20  ? 387  GLY A CA  1 
ATOM   2202 C  C   . GLY A 1 342 ? -7.419  -23.619 -17.046 1.00 51.14  ? 387  GLY A C   1 
ATOM   2203 O  O   . GLY A 1 342 ? -7.274  -22.592 -17.680 1.00 49.61  ? 387  GLY A O   1 
ATOM   2204 N  N   . ARG A 1 343 ? -8.602  -24.212 -16.906 1.00 52.90  ? 388  ARG A N   1 
ATOM   2205 C  CA  . ARG A 1 343 ? -9.807  -23.664 -17.534 1.00 51.35  ? 388  ARG A CA  1 
ATOM   2206 C  C   . ARG A 1 343 ? -10.264 -22.364 -16.890 1.00 50.51  ? 388  ARG A C   1 
ATOM   2207 O  O   . ARG A 1 343 ? -10.671 -21.436 -17.585 1.00 50.23  ? 388  ARG A O   1 
ATOM   2208 C  CB  . ARG A 1 343 ? -10.946 -24.695 -17.490 1.00 53.04  ? 388  ARG A CB  1 
ATOM   2209 C  CG  . ARG A 1 343 ? -10.679 -25.904 -18.351 1.00 55.29  ? 388  ARG A CG  1 
ATOM   2210 C  CD  . ARG A 1 343 ? -11.947 -26.400 -19.050 1.00 60.02  ? 388  ARG A CD  1 
ATOM   2211 N  NE  . ARG A 1 343 ? -11.750 -27.650 -19.779 1.00 63.19  ? 388  ARG A NE  1 
ATOM   2212 C  CZ  . ARG A 1 343 ? -12.677 -28.204 -20.558 1.00 68.36  ? 388  ARG A CZ  1 
ATOM   2213 N  NH1 . ARG A 1 343 ? -13.846 -27.598 -20.723 1.00 67.93  ? 388  ARG A NH1 1 
ATOM   2214 N  NH2 . ARG A 1 343 ? -12.438 -29.351 -21.179 1.00 70.26  ? 388  ARG A NH2 1 
ATOM   2215 N  N   . GLU A 1 344 ? -10.194 -22.286 -15.567 1.00 50.40  ? 389  GLU A N   1 
ATOM   2216 C  CA  . GLU A 1 344 ? -10.643 -21.077 -14.874 1.00 47.88  ? 389  GLU A CA  1 
ATOM   2217 C  C   . GLU A 1 344 ? -9.782  -19.871 -15.229 1.00 48.95  ? 389  GLU A C   1 
ATOM   2218 O  O   . GLU A 1 344 ? -10.284 -18.741 -15.390 1.00 45.15  ? 389  GLU A O   1 
ATOM   2219 C  CB  . GLU A 1 344 ? -10.639 -21.299 -13.364 1.00 52.68  ? 389  GLU A CB  1 
ATOM   2220 C  CG  . GLU A 1 344 ? -11.103 -20.078 -12.580 1.00 57.40  ? 389  GLU A CG  1 
ATOM   2221 C  CD  . GLU A 1 344 ? -11.273 -20.380 -11.107 1.00 64.24  ? 389  GLU A CD  1 
ATOM   2222 O  OE1 . GLU A 1 344 ? -11.461 -21.573 -10.770 1.00 66.82  ? 389  GLU A OE1 1 
ATOM   2223 O  OE2 . GLU A 1 344 ? -11.216 -19.427 -10.295 1.00 64.27  ? 389  GLU A OE2 1 
ATOM   2224 N  N   . ARG A 1 345 ? -8.483  -20.103 -15.355 1.00 48.44  ? 390  ARG A N   1 
ATOM   2225 C  CA  . ARG A 1 345 ? -7.581  -19.024 -15.740 1.00 49.02  ? 390  ARG A CA  1 
ATOM   2226 C  C   . ARG A 1 345 ? -7.871  -18.561 -17.172 1.00 47.42  ? 390  ARG A C   1 
ATOM   2227 O  O   . ARG A 1 345 ? -7.873  -17.365 -17.456 1.00 47.94  ? 390  ARG A O   1 
ATOM   2228 C  CB  . ARG A 1 345 ? -6.116  -19.457 -15.599 1.00 50.04  ? 390  ARG A CB  1 
ATOM   2229 C  CG  . ARG A 1 345 ? -5.200  -18.305 -15.173 1.00 51.50  ? 390  ARG A CG  1 
ATOM   2230 C  CD  . ARG A 1 345 ? -3.901  -18.272 -15.948 1.00 48.04  ? 390  ARG A CD  1 
ATOM   2231 N  NE  . ARG A 1 345 ? -3.208  -19.561 -16.031 1.00 49.94  ? 390  ARG A NE  1 
ATOM   2232 C  CZ  . ARG A 1 345 ? -2.182  -19.755 -16.853 1.00 54.02  ? 390  ARG A CZ  1 
ATOM   2233 N  NH1 . ARG A 1 345 ? -1.778  -18.751 -17.618 1.00 55.98  ? 390  ARG A NH1 1 
ATOM   2234 N  NH2 . ARG A 1 345 ? -1.555  -20.922 -16.916 1.00 53.63  ? 390  ARG A NH2 1 
ATOM   2235 N  N   . LYS A 1 346 ? -8.136  -19.518 -18.060 1.00 48.03  ? 391  LYS A N   1 
ATOM   2236 C  CA  . LYS A 1 346 ? -8.497  -19.240 -19.451 1.00 45.79  ? 391  LYS A CA  1 
ATOM   2237 C  C   . LYS A 1 346 ? -9.795  -18.426 -19.554 1.00 46.38  ? 391  LYS A C   1 
ATOM   2238 O  O   . LYS A 1 346 ? -9.924  -17.535 -20.397 1.00 49.67  ? 391  LYS A O   1 
ATOM   2239 C  CB  . LYS A 1 346 ? -8.636  -20.568 -20.234 1.00 46.65  ? 391  LYS A CB  1 
ATOM   2240 N  N   . ALA A 1 347 ? -10.747 -18.711 -18.674 1.00 48.76  ? 392  ALA A N   1 
ATOM   2241 C  CA  . ALA A 1 347 ? -12.048 -18.040 -18.706 1.00 46.63  ? 392  ALA A CA  1 
ATOM   2242 C  C   . ALA A 1 347 ? -11.958 -16.606 -18.226 1.00 49.93  ? 392  ALA A C   1 
ATOM   2243 O  O   . ALA A 1 347 ? -12.902 -15.819 -18.393 1.00 49.57  ? 392  ALA A O   1 
ATOM   2244 C  CB  . ALA A 1 347 ? -13.064 -18.816 -17.862 1.00 47.58  ? 392  ALA A CB  1 
ATOM   2245 N  N   . MET A 1 348 ? -10.829 -16.260 -17.619 1.00 49.75  ? 393  MET A N   1 
ATOM   2246 C  CA  . MET A 1 348 ? -10.641 -14.913 -17.096 1.00 49.08  ? 393  MET A CA  1 
ATOM   2247 C  C   . MET A 1 348 ? -9.944  -14.022 -18.111 1.00 46.03  ? 393  MET A C   1 
ATOM   2248 O  O   . MET A 1 348 ? -9.713  -12.846 -17.846 1.00 46.01  ? 393  MET A O   1 
ATOM   2249 C  CB  . MET A 1 348 ? -9.834  -14.947 -15.803 1.00 49.34  ? 393  MET A CB  1 
ATOM   2250 C  CG  . MET A 1 348 ? -10.682 -15.114 -14.558 1.00 50.06  ? 393  MET A CG  1 
ATOM   2251 S  SD  . MET A 1 348 ? -9.659  -15.218 -13.065 1.00 61.42  ? 393  MET A SD  1 
ATOM   2252 C  CE  . MET A 1 348 ? -8.539  -13.860 -13.310 1.00 56.03  ? 393  MET A CE  1 
ATOM   2253 N  N   . ARG A 1 349 ? -9.630  -14.596 -19.270 1.00 45.45  ? 394  ARG A N   1 
ATOM   2254 C  CA  . ARG A 1 349 ? -8.890  -13.911 -20.328 1.00 46.25  ? 394  ARG A CA  1 
ATOM   2255 C  C   . ARG A 1 349 ? -9.539  -12.606 -20.751 1.00 44.49  ? 394  ARG A C   1 
ATOM   2256 O  O   . ARG A 1 349 ? -8.843  -11.646 -21.073 1.00 45.00  ? 394  ARG A O   1 
ATOM   2257 C  CB  . ARG A 1 349 ? -8.736  -14.824 -21.556 1.00 50.23  ? 394  ARG A CB  1 
ATOM   2258 N  N   . VAL A 1 350 ? -10.866 -12.554 -20.732 1.00 40.27  ? 395  VAL A N   1 
ATOM   2259 C  CA  . VAL A 1 350 ? -11.555 -11.349 -21.171 1.00 40.25  ? 395  VAL A CA  1 
ATOM   2260 C  C   . VAL A 1 350 ? -11.315 -10.150 -20.221 1.00 40.85  ? 395  VAL A C   1 
ATOM   2261 O  O   . VAL A 1 350 ? -11.344 -8.994  -20.656 1.00 40.84  ? 395  VAL A O   1 
ATOM   2262 C  CB  . VAL A 1 350 ? -13.068 -11.595 -21.322 1.00 42.20  ? 395  VAL A CB  1 
ATOM   2263 C  CG1 . VAL A 1 350 ? -13.731 -11.744 -19.969 1.00 42.66  ? 395  VAL A CG1 1 
ATOM   2264 C  CG2 . VAL A 1 350 ? -13.709 -10.471 -22.119 1.00 41.62  ? 395  VAL A CG2 1 
ATOM   2265 N  N   . LEU A 1 351 ? -11.037 -10.420 -18.947 1.00 39.44  ? 396  LEU A N   1 
ATOM   2266 C  CA  . LEU A 1 351 ? -10.949 -9.348  -17.959 1.00 39.37  ? 396  LEU A CA  1 
ATOM   2267 C  C   . LEU A 1 351 ? -9.794  -8.361  -18.234 1.00 39.04  ? 396  LEU A C   1 
ATOM   2268 O  O   . LEU A 1 351 ? -10.017 -7.158  -18.154 1.00 39.58  ? 396  LEU A O   1 
ATOM   2269 C  CB  . LEU A 1 351 ? -10.842 -9.925  -16.547 1.00 37.39  ? 396  LEU A CB  1 
ATOM   2270 C  CG  . LEU A 1 351 ? -12.074 -10.718 -16.106 1.00 42.60  ? 396  LEU A CG  1 
ATOM   2271 C  CD1 . LEU A 1 351 ? -11.884 -11.382 -14.738 1.00 40.91  ? 396  LEU A CD1 1 
ATOM   2272 C  CD2 . LEU A 1 351 ? -13.325 -9.836  -16.134 1.00 43.08  ? 396  LEU A CD2 1 
ATOM   2273 N  N   . PRO A 1 352 ? -8.577  -8.853  -18.571 1.00 41.04  ? 397  PRO A N   1 
ATOM   2274 C  CA  . PRO A 1 352 ? -7.494  -7.917  -18.912 1.00 40.26  ? 397  PRO A CA  1 
ATOM   2275 C  C   . PRO A 1 352 ? -7.804  -7.064  -20.128 1.00 40.02  ? 397  PRO A C   1 
ATOM   2276 O  O   . PRO A 1 352 ? -7.358  -5.915  -20.209 1.00 38.38  ? 397  PRO A O   1 
ATOM   2277 C  CB  . PRO A 1 352 ? -6.307  -8.836  -19.224 1.00 39.57  ? 397  PRO A CB  1 
ATOM   2278 C  CG  . PRO A 1 352 ? -6.590  -10.083 -18.508 1.00 40.51  ? 397  PRO A CG  1 
ATOM   2279 C  CD  . PRO A 1 352 ? -8.070  -10.235 -18.451 1.00 41.96  ? 397  PRO A CD  1 
ATOM   2280 N  N   . VAL A 1 353 ? -8.547  -7.619  -21.074 1.00 38.65  ? 398  VAL A N   1 
ATOM   2281 C  CA  . VAL A 1 353 ? -8.918  -6.834  -22.240 1.00 38.87  ? 398  VAL A CA  1 
ATOM   2282 C  C   . VAL A 1 353 ? -9.880  -5.703  -21.848 1.00 39.87  ? 398  VAL A C   1 
ATOM   2283 O  O   . VAL A 1 353 ? -9.690  -4.565  -22.272 1.00 38.40  ? 398  VAL A O   1 
ATOM   2284 C  CB  . VAL A 1 353 ? -9.540  -7.707  -23.336 1.00 39.71  ? 398  VAL A CB  1 
ATOM   2285 C  CG1 . VAL A 1 353 ? -9.786  -6.879  -24.587 1.00 38.36  ? 398  VAL A CG1 1 
ATOM   2286 C  CG2 . VAL A 1 353 ? -8.610  -8.889  -23.656 1.00 39.26  ? 398  VAL A CG2 1 
ATOM   2287 N  N   . VAL A 1 354 ? -10.901 -6.013  -21.050 1.00 36.50  ? 399  VAL A N   1 
ATOM   2288 C  CA  . VAL A 1 354 ? -11.799 -4.979  -20.533 1.00 36.23  ? 399  VAL A CA  1 
ATOM   2289 C  C   . VAL A 1 354 ? -11.036 -3.892  -19.750 1.00 37.17  ? 399  VAL A C   1 
ATOM   2290 O  O   . VAL A 1 354 ? -11.266 -2.701  -19.959 1.00 34.14  ? 399  VAL A O   1 
ATOM   2291 C  CB  . VAL A 1 354 ? -12.890 -5.582  -19.631 1.00 37.35  ? 399  VAL A CB  1 
ATOM   2292 C  CG1 . VAL A 1 354 ? -13.746 -4.480  -18.996 1.00 34.45  ? 399  VAL A CG1 1 
ATOM   2293 C  CG2 . VAL A 1 354 ? -13.773 -6.522  -20.451 1.00 38.92  ? 399  VAL A CG2 1 
ATOM   2294 N  N   . VAL A 1 355 ? -10.145 -4.303  -18.851 1.00 36.78  ? 400  VAL A N   1 
ATOM   2295 C  CA  . VAL A 1 355 ? -9.342  -3.355  -18.082 1.00 35.42  ? 400  VAL A CA  1 
ATOM   2296 C  C   . VAL A 1 355 ? -8.443  -2.548  -19.018 1.00 33.96  ? 400  VAL A C   1 
ATOM   2297 O  O   . VAL A 1 355 ? -8.372  -1.335  -18.898 1.00 31.99  ? 400  VAL A O   1 
ATOM   2298 C  CB  . VAL A 1 355 ? -8.492  -4.069  -17.002 1.00 36.82  ? 400  VAL A CB  1 
ATOM   2299 C  CG1 . VAL A 1 355 ? -7.519  -3.105  -16.334 1.00 35.15  ? 400  VAL A CG1 1 
ATOM   2300 C  CG2 . VAL A 1 355 ? -9.405  -4.735  -15.973 1.00 37.16  ? 400  VAL A CG2 1 
ATOM   2301 N  N   . GLY A 1 356 ? -7.785  -3.214  -19.963 1.00 37.75  ? 401  GLY A N   1 
ATOM   2302 C  CA  . GLY A 1 356 ? -6.924  -2.533  -20.916 1.00 35.73  ? 401  GLY A CA  1 
ATOM   2303 C  C   . GLY A 1 356 ? -7.631  -1.457  -21.734 1.00 36.12  ? 401  GLY A C   1 
ATOM   2304 O  O   . GLY A 1 356 ? -7.117  -0.338  -21.879 1.00 35.97  ? 401  GLY A O   1 
ATOM   2305 N  N   . ALA A 1 357 ? -8.808  -1.789  -22.265 1.00 34.34  ? 402  ALA A N   1 
ATOM   2306 C  CA  . ALA A 1 357 ? -9.605  -0.837  -23.030 1.00 35.53  ? 402  ALA A CA  1 
ATOM   2307 C  C   . ALA A 1 357 ? -10.000 0.359   -22.163 1.00 36.76  ? 402  ALA A C   1 
ATOM   2308 O  O   . ALA A 1 357 ? -10.011 1.501   -22.632 1.00 33.88  ? 402  ALA A O   1 
ATOM   2309 C  CB  . ALA A 1 357 ? -10.858 -1.508  -23.598 1.00 35.16  ? 402  ALA A CB  1 
ATOM   2310 N  N   . PHE A 1 358 ? -10.348 0.091   -20.909 1.00 37.53  ? 403  PHE A N   1 
ATOM   2311 C  CA  . PHE A 1 358 ? -10.712 1.154   -19.991 1.00 34.48  ? 403  PHE A CA  1 
ATOM   2312 C  C   . PHE A 1 358 ? -9.538  2.119   -19.756 1.00 34.87  ? 403  PHE A C   1 
ATOM   2313 O  O   . PHE A 1 358 ? -9.707  3.344   -19.794 1.00 32.88  ? 403  PHE A O   1 
ATOM   2314 C  CB  . PHE A 1 358 ? -11.185 0.589   -18.655 1.00 34.95  ? 403  PHE A CB  1 
ATOM   2315 C  CG  . PHE A 1 358 ? -11.908 1.592   -17.832 1.00 35.73  ? 403  PHE A CG  1 
ATOM   2316 C  CD1 . PHE A 1 358 ? -11.214 2.414   -16.961 1.00 35.59  ? 403  PHE A CD1 1 
ATOM   2317 C  CD2 . PHE A 1 358 ? -13.276 1.765   -17.988 1.00 37.84  ? 403  PHE A CD2 1 
ATOM   2318 C  CE1 . PHE A 1 358 ? -11.878 3.374   -16.228 1.00 39.60  ? 403  PHE A CE1 1 
ATOM   2319 C  CE2 . PHE A 1 358 ? -13.962 2.713   -17.258 1.00 39.25  ? 403  PHE A CE2 1 
ATOM   2320 C  CZ  . PHE A 1 358 ? -13.260 3.533   -16.384 1.00 40.13  ? 403  PHE A CZ  1 
ATOM   2321 N  N   . LEU A 1 359 ? -8.355  1.571   -19.512 1.00 34.18  ? 404  LEU A N   1 
ATOM   2322 C  CA  . LEU A 1 359 ? -7.168  2.410   -19.326 1.00 33.53  ? 404  LEU A CA  1 
ATOM   2323 C  C   . LEU A 1 359 ? -6.850  3.205   -20.577 1.00 33.27  ? 404  LEU A C   1 
ATOM   2324 O  O   . LEU A 1 359 ? -6.479  4.382   -20.493 1.00 34.49  ? 404  LEU A O   1 
ATOM   2325 C  CB  . LEU A 1 359 ? -5.958  1.558   -18.927 1.00 33.72  ? 404  LEU A CB  1 
ATOM   2326 C  CG  . LEU A 1 359 ? -6.144  0.845   -17.587 1.00 35.49  ? 404  LEU A CG  1 
ATOM   2327 C  CD1 . LEU A 1 359 ? -4.919  -0.020  -17.255 1.00 36.88  ? 404  LEU A CD1 1 
ATOM   2328 C  CD2 . LEU A 1 359 ? -6.444  1.815   -16.472 1.00 37.69  ? 404  LEU A CD2 1 
ATOM   2329 N  N   . LEU A 1 360 ? -6.983  2.576   -21.740 1.00 32.55  ? 405  LEU A N   1 
ATOM   2330 C  CA  . LEU A 1 360 ? -6.708  3.261   -22.999 1.00 35.70  ? 405  LEU A CA  1 
ATOM   2331 C  C   . LEU A 1 360 ? -7.651  4.428   -23.213 1.00 33.86  ? 405  LEU A C   1 
ATOM   2332 O  O   . LEU A 1 360 ? -7.228  5.517   -23.630 1.00 34.07  ? 405  LEU A O   1 
ATOM   2333 C  CB  . LEU A 1 360 ? -6.812  2.301   -24.186 1.00 38.54  ? 405  LEU A CB  1 
ATOM   2334 C  CG  . LEU A 1 360 ? -5.595  1.405   -24.437 1.00 44.26  ? 405  LEU A CG  1 
ATOM   2335 C  CD1 . LEU A 1 360 ? -5.881  0.428   -25.576 1.00 43.52  ? 405  LEU A CD1 1 
ATOM   2336 C  CD2 . LEU A 1 360 ? -4.363  2.258   -24.742 1.00 42.45  ? 405  LEU A CD2 1 
ATOM   2337 N  N   . CYS A 1 361 ? -8.919  4.192   -22.910 1.00 31.97  ? 406  CYS A N   1 
ATOM   2338 C  CA  . CYS A 1 361 ? -9.983  5.171   -23.140 1.00 33.40  ? 406  CYS A CA  1 
ATOM   2339 C  C   . CYS A 1 361 ? -10.041 6.318   -22.145 1.00 31.69  ? 406  CYS A C   1 
ATOM   2340 O  O   . CYS A 1 361 ? -10.451 7.422   -22.504 1.00 32.78  ? 406  CYS A O   1 
ATOM   2341 C  CB  . CYS A 1 361 ? -11.330 4.466   -23.147 1.00 33.51  ? 406  CYS A CB  1 
ATOM   2342 S  SG  . CYS A 1 361 ? -11.583 3.559   -24.662 1.00 37.55  ? 406  CYS A SG  1 
ATOM   2343 N  N   . TRP A 1 362 ? -9.658  6.062   -20.898 1.00 30.02  ? 407  TRP A N   1 
ATOM   2344 C  CA  . TRP A 1 362 ? -9.797  7.055   -19.842 1.00 29.98  ? 407  TRP A CA  1 
ATOM   2345 C  C   . TRP A 1 362 ? -8.498  7.704   -19.345 1.00 30.34  ? 407  TRP A C   1 
ATOM   2346 O  O   . TRP A 1 362 ? -8.547  8.735   -18.689 1.00 31.19  ? 407  TRP A O   1 
ATOM   2347 C  CB  . TRP A 1 362 ? -10.524 6.425   -18.655 1.00 28.66  ? 407  TRP A CB  1 
ATOM   2348 C  CG  . TRP A 1 362 ? -11.988 6.320   -18.923 1.00 31.54  ? 407  TRP A CG  1 
ATOM   2349 C  CD1 . TRP A 1 362 ? -12.695 5.195   -19.262 1.00 33.99  ? 407  TRP A CD1 1 
ATOM   2350 C  CD2 . TRP A 1 362 ? -12.923 7.399   -18.912 1.00 32.19  ? 407  TRP A CD2 1 
ATOM   2351 N  NE1 . TRP A 1 362 ? -14.037 5.514   -19.441 1.00 34.04  ? 407  TRP A NE1 1 
ATOM   2352 C  CE2 . TRP A 1 362 ? -14.193 6.864   -19.232 1.00 32.30  ? 407  TRP A CE2 1 
ATOM   2353 C  CE3 . TRP A 1 362 ? -12.815 8.774   -18.644 1.00 29.48  ? 407  TRP A CE3 1 
ATOM   2354 C  CZ2 . TRP A 1 362 ? -15.335 7.649   -19.296 1.00 33.28  ? 407  TRP A CZ2 1 
ATOM   2355 C  CZ3 . TRP A 1 362 ? -13.951 9.550   -18.707 1.00 30.51  ? 407  TRP A CZ3 1 
ATOM   2356 C  CH2 . TRP A 1 362 ? -15.200 8.985   -19.035 1.00 33.09  ? 407  TRP A CH2 1 
ATOM   2357 N  N   . THR A 1 363 ? -7.349  7.110   -19.632 1.00 29.53  ? 408  THR A N   1 
ATOM   2358 C  CA  . THR A 1 363 ? -6.104  7.711   -19.151 1.00 29.46  ? 408  THR A CA  1 
ATOM   2359 C  C   . THR A 1 363 ? -5.900  9.120   -19.760 1.00 30.64  ? 408  THR A C   1 
ATOM   2360 O  O   . THR A 1 363 ? -5.633  10.044  -19.021 1.00 31.13  ? 408  THR A O   1 
ATOM   2361 C  CB  . THR A 1 363 ? -4.893  6.797   -19.404 1.00 29.84  ? 408  THR A CB  1 
ATOM   2362 O  OG1 . THR A 1 363 ? -5.057  5.602   -18.641 1.00 30.87  ? 408  THR A OG1 1 
ATOM   2363 C  CG2 . THR A 1 363 ? -3.591  7.465   -18.951 1.00 31.74  ? 408  THR A CG2 1 
ATOM   2364 N  N   . PRO A 1 364 ? -6.080  9.298   -21.086 1.00 28.33  ? 409  PRO A N   1 
ATOM   2365 C  CA  . PRO A 1 364 ? -5.944  10.683  -21.577 1.00 29.98  ? 409  PRO A CA  1 
ATOM   2366 C  C   . PRO A 1 364 ? -6.876  11.668  -20.866 1.00 32.13  ? 409  PRO A C   1 
ATOM   2367 O  O   . PRO A 1 364 ? -6.441  12.762  -20.542 1.00 31.82  ? 409  PRO A O   1 
ATOM   2368 C  CB  . PRO A 1 364 ? -6.319  10.582  -23.061 1.00 29.47  ? 409  PRO A CB  1 
ATOM   2369 C  CG  . PRO A 1 364 ? -6.012  9.068   -23.418 1.00 29.20  ? 409  PRO A CG  1 
ATOM   2370 C  CD  . PRO A 1 364 ? -6.420  8.349   -22.170 1.00 28.46  ? 409  PRO A CD  1 
ATOM   2371 N  N   . PHE A 1 365 ? -8.126  11.277  -20.634 1.00 29.34  ? 410  PHE A N   1 
ATOM   2372 C  CA  . PHE A 1 365 ? -9.093  12.126  -19.962 1.00 29.36  ? 410  PHE A CA  1 
ATOM   2373 C  C   . PHE A 1 365 ? -8.585  12.562  -18.598 1.00 29.96  ? 410  PHE A C   1 
ATOM   2374 O  O   . PHE A 1 365 ? -8.643  13.748  -18.243 1.00 30.17  ? 410  PHE A O   1 
ATOM   2375 C  CB  . PHE A 1 365 ? -10.435 11.397  -19.803 1.00 28.97  ? 410  PHE A CB  1 
ATOM   2376 C  CG  . PHE A 1 365 ? -11.499 12.229  -19.144 1.00 30.32  ? 410  PHE A CG  1 
ATOM   2377 C  CD1 . PHE A 1 365 ? -11.639 12.248  -17.755 1.00 28.05  ? 410  PHE A CD1 1 
ATOM   2378 C  CD2 . PHE A 1 365 ? -12.349 13.000  -19.907 1.00 30.57  ? 410  PHE A CD2 1 
ATOM   2379 C  CE1 . PHE A 1 365 ? -12.633 13.047  -17.139 1.00 29.70  ? 410  PHE A CE1 1 
ATOM   2380 C  CE2 . PHE A 1 365 ? -13.357 13.771  -19.302 1.00 31.62  ? 410  PHE A CE2 1 
ATOM   2381 C  CZ  . PHE A 1 365 ? -13.496 13.793  -17.923 1.00 30.27  ? 410  PHE A CZ  1 
ATOM   2382 N  N   . PHE A 1 366 ? -8.113  11.607  -17.805 1.00 30.10  ? 411  PHE A N   1 
ATOM   2383 C  CA  . PHE A 1 366 ? -7.735  11.983  -16.451 1.00 31.72  ? 411  PHE A CA  1 
ATOM   2384 C  C   . PHE A 1 366 ? -6.399  12.715  -16.404 1.00 33.41  ? 411  PHE A C   1 
ATOM   2385 O  O   . PHE A 1 366 ? -6.202  13.559  -15.541 1.00 33.26  ? 411  PHE A O   1 
ATOM   2386 C  CB  . PHE A 1 366 ? -7.717  10.774  -15.526 1.00 27.78  ? 411  PHE A CB  1 
ATOM   2387 C  CG  . PHE A 1 366 ? -9.098  10.353  -15.113 1.00 28.85  ? 411  PHE A CG  1 
ATOM   2388 C  CD1 . PHE A 1 366 ? -9.839  11.149  -14.235 1.00 29.49  ? 411  PHE A CD1 1 
ATOM   2389 C  CD2 . PHE A 1 366 ? -9.681  9.234   -15.660 1.00 28.39  ? 411  PHE A CD2 1 
ATOM   2390 C  CE1 . PHE A 1 366 ? -11.120 10.809  -13.881 1.00 29.71  ? 411  PHE A CE1 1 
ATOM   2391 C  CE2 . PHE A 1 366 ? -10.982 8.868   -15.317 1.00 29.02  ? 411  PHE A CE2 1 
ATOM   2392 C  CZ  . PHE A 1 366 ? -11.713 9.658   -14.419 1.00 29.92  ? 411  PHE A CZ  1 
ATOM   2393 N  N   . VAL A 1 367 ? -5.493  12.407  -17.323 1.00 30.95  ? 412  VAL A N   1 
ATOM   2394 C  CA  . VAL A 1 367 ? -4.250  13.179  -17.371 1.00 31.51  ? 412  VAL A CA  1 
ATOM   2395 C  C   . VAL A 1 367 ? -4.581  14.631  -17.746 1.00 33.96  ? 412  VAL A C   1 
ATOM   2396 O  O   . VAL A 1 367 ? -4.124  15.563  -17.080 1.00 35.36  ? 412  VAL A O   1 
ATOM   2397 C  CB  . VAL A 1 367 ? -3.241  12.569  -18.338 1.00 30.41  ? 412  VAL A CB  1 
ATOM   2398 C  CG1 . VAL A 1 367 ? -2.037  13.527  -18.558 1.00 31.94  ? 412  VAL A CG1 1 
ATOM   2399 C  CG2 . VAL A 1 367 ? -2.780  11.197  -17.775 1.00 29.53  ? 412  VAL A CG2 1 
ATOM   2400 N  N   . VAL A 1 368 ? -5.407  14.827  -18.773 1.00 29.88  ? 413  VAL A N   1 
ATOM   2401 C  CA  . VAL A 1 368 ? -5.797  16.191  -19.151 1.00 32.31  ? 413  VAL A CA  1 
ATOM   2402 C  C   . VAL A 1 368 ? -6.487  16.911  -17.996 1.00 33.93  ? 413  VAL A C   1 
ATOM   2403 O  O   . VAL A 1 368 ? -6.142  18.067  -17.667 1.00 34.62  ? 413  VAL A O   1 
ATOM   2404 C  CB  . VAL A 1 368 ? -6.715  16.211  -20.398 1.00 32.95  ? 413  VAL A CB  1 
ATOM   2405 C  CG1 . VAL A 1 368 ? -7.382  17.564  -20.560 1.00 35.55  ? 413  VAL A CG1 1 
ATOM   2406 C  CG2 . VAL A 1 368 ? -5.908  15.847  -21.653 1.00 32.15  ? 413  VAL A CG2 1 
ATOM   2407 N  N   . HIS A 1 369 ? -7.419  16.235  -17.331 1.00 32.71  ? 414  HIS A N   1 
ATOM   2408 C  CA  . HIS A 1 369 ? -8.207  16.956  -16.347 1.00 34.47  ? 414  HIS A CA  1 
ATOM   2409 C  C   . HIS A 1 369 ? -7.437  17.237  -15.070 1.00 33.80  ? 414  HIS A C   1 
ATOM   2410 O  O   . HIS A 1 369 ? -7.594  18.301  -14.483 1.00 33.29  ? 414  HIS A O   1 
ATOM   2411 C  CB  . HIS A 1 369 ? -9.507  16.219  -16.056 1.00 30.54  ? 414  HIS A CB  1 
ATOM   2412 C  CG  . HIS A 1 369 ? -10.564 16.504  -17.074 1.00 33.28  ? 414  HIS A CG  1 
ATOM   2413 N  ND1 . HIS A 1 369 ? -10.615 15.870  -18.292 1.00 32.29  ? 414  HIS A ND1 1 
ATOM   2414 C  CD2 . HIS A 1 369 ? -11.556 17.430  -17.086 1.00 33.13  ? 414  HIS A CD2 1 
ATOM   2415 C  CE1 . HIS A 1 369 ? -11.619 16.363  -19.002 1.00 34.23  ? 414  HIS A CE1 1 
ATOM   2416 N  NE2 . HIS A 1 369 ? -12.214 17.298  -18.284 1.00 33.35  ? 414  HIS A NE2 1 
ATOM   2417 N  N   . ILE A 1 370 ? -6.594  16.311  -14.635 1.00 32.08  ? 415  ILE A N   1 
ATOM   2418 C  CA  . ILE A 1 370 ? -5.862  16.594  -13.413 1.00 33.66  ? 415  ILE A CA  1 
ATOM   2419 C  C   . ILE A 1 370 ? -4.779  17.655  -13.695 1.00 34.24  ? 415  ILE A C   1 
ATOM   2420 O  O   . ILE A 1 370 ? -4.493  18.504  -12.844 1.00 34.23  ? 415  ILE A O   1 
ATOM   2421 C  CB  . ILE A 1 370 ? -5.251  15.302  -12.783 1.00 32.01  ? 415  ILE A CB  1 
ATOM   2422 C  CG1 . ILE A 1 370 ? -5.070  15.508  -11.271 1.00 34.57  ? 415  ILE A CG1 1 
ATOM   2423 C  CG2 . ILE A 1 370 ? -3.944  14.900  -13.457 1.00 30.57  ? 415  ILE A CG2 1 
ATOM   2424 C  CD1 . ILE A 1 370 ? -4.439  14.322  -10.553 1.00 36.91  ? 415  ILE A CD1 1 
ATOM   2425 N  N   . THR A 1 371 ? -4.219  17.645  -14.901 1.00 35.10  ? 416  THR A N   1 
ATOM   2426 C  CA  . THR A 1 371 ? -3.218  18.647  -15.267 1.00 35.56  ? 416  THR A CA  1 
ATOM   2427 C  C   . THR A 1 371 ? -3.824  20.059  -15.195 1.00 36.95  ? 416  THR A C   1 
ATOM   2428 O  O   . THR A 1 371 ? -3.272  20.954  -14.543 1.00 37.83  ? 416  THR A O   1 
ATOM   2429 C  CB  . THR A 1 371 ? -2.659  18.397  -16.665 1.00 33.45  ? 416  THR A CB  1 
ATOM   2430 O  OG1 . THR A 1 371 ? -1.878  17.187  -16.656 1.00 35.37  ? 416  THR A OG1 1 
ATOM   2431 C  CG2 . THR A 1 371 ? -1.761  19.542  -17.073 1.00 37.64  ? 416  THR A CG2 1 
ATOM   2432 N  N   . GLN A 1 372 ? -4.962  20.241  -15.854 1.00 36.30  ? 417  GLN A N   1 
ATOM   2433 C  CA  . GLN A 1 372 ? -5.698  21.505  -15.802 1.00 38.26  ? 417  GLN A CA  1 
ATOM   2434 C  C   . GLN A 1 372 ? -5.966  21.966  -14.380 1.00 38.67  ? 417  GLN A C   1 
ATOM   2435 O  O   . GLN A 1 372 ? -5.795  23.147  -14.035 1.00 38.15  ? 417  GLN A O   1 
ATOM   2436 C  CB  . GLN A 1 372 ? -7.026  21.364  -16.522 1.00 39.67  ? 417  GLN A CB  1 
ATOM   2437 C  CG  . GLN A 1 372 ? -6.945  21.342  -18.028 1.00 43.08  ? 417  GLN A CG  1 
ATOM   2438 C  CD  . GLN A 1 372 ? -8.343  21.294  -18.643 1.00 47.11  ? 417  GLN A CD  1 
ATOM   2439 O  OE1 . GLN A 1 372 ? -9.229  20.571  -18.168 1.00 50.34  ? 417  GLN A OE1 1 
ATOM   2440 N  NE2 . GLN A 1 372 ? -8.568  22.141  -19.645 1.00 42.37  ? 417  GLN A NE2 1 
ATOM   2441 N  N   . ALA A 1 373 ? -6.390  21.025  -13.549 1.00 36.63  ? 418  ALA A N   1 
ATOM   2442 C  CA  . ALA A 1 373 ? -6.769  21.345  -12.177 1.00 37.04  ? 418  ALA A CA  1 
ATOM   2443 C  C   . ALA A 1 373 ? -5.540  21.691  -11.345 1.00 36.29  ? 418  ALA A C   1 
ATOM   2444 O  O   . ALA A 1 373 ? -5.588  22.597  -10.508 1.00 38.28  ? 418  ALA A O   1 
ATOM   2445 C  CB  . ALA A 1 373 ? -7.543  20.167  -11.531 1.00 34.83  ? 418  ALA A CB  1 
ATOM   2446 N  N   . LEU A 1 374 ? -4.439  20.994  -11.576 1.00 36.44  ? 419  LEU A N   1 
ATOM   2447 C  CA  . LEU A 1 374 ? -3.206  21.256  -10.825 1.00 36.95  ? 419  LEU A CA  1 
ATOM   2448 C  C   . LEU A 1 374 ? -2.507  22.516  -11.326 1.00 38.61  ? 419  LEU A C   1 
ATOM   2449 O  O   . LEU A 1 374 ? -1.856  23.224  -10.549 1.00 40.71  ? 419  LEU A O   1 
ATOM   2450 C  CB  . LEU A 1 374 ? -2.243  20.076  -10.930 1.00 38.99  ? 419  LEU A CB  1 
ATOM   2451 C  CG  . LEU A 1 374 ? -2.601  18.765  -10.200 1.00 38.23  ? 419  LEU A CG  1 
ATOM   2452 C  CD1 . LEU A 1 374 ? -1.711  17.650  -10.722 1.00 37.01  ? 419  LEU A CD1 1 
ATOM   2453 C  CD2 . LEU A 1 374 ? -2.438  18.921  -8.693  1.00 38.09  ? 419  LEU A CD2 1 
ATOM   2454 N  N   . CYS A 1 375 ? -2.642  22.786  -12.623 1.00 42.53  ? 420  CYS A N   1 
ATOM   2455 C  CA  . CYS A 1 375 ? -1.842  23.823  -13.297 1.00 43.51  ? 420  CYS A CA  1 
ATOM   2456 C  C   . CYS A 1 375 ? -2.667  24.572  -14.332 1.00 40.77  ? 420  CYS A C   1 
ATOM   2457 O  O   . CYS A 1 375 ? -2.699  24.188  -15.505 1.00 43.51  ? 420  CYS A O   1 
ATOM   2458 C  CB  . CYS A 1 375 ? -0.606  23.194  -13.976 1.00 43.34  ? 420  CYS A CB  1 
ATOM   2459 S  SG  . CYS A 1 375 ? 0.545   24.362  -14.799 1.00 45.84  ? 420  CYS A SG  1 
ATOM   2460 N  N   . PRO A 1 376 ? -3.350  25.638  -13.901 1.00 43.77  ? 421  PRO A N   1 
ATOM   2461 C  CA  . PRO A 1 376 ? -4.154  26.468  -14.804 1.00 44.12  ? 421  PRO A CA  1 
ATOM   2462 C  C   . PRO A 1 376 ? -3.343  27.010  -15.979 1.00 47.24  ? 421  PRO A C   1 
ATOM   2463 O  O   . PRO A 1 376 ? -3.887  27.125  -17.075 1.00 47.89  ? 421  PRO A O   1 
ATOM   2464 C  CB  . PRO A 1 376 ? -4.624  27.614  -13.902 1.00 45.29  ? 421  PRO A CB  1 
ATOM   2465 C  CG  . PRO A 1 376 ? -4.595  27.023  -12.522 1.00 49.12  ? 421  PRO A CG  1 
ATOM   2466 C  CD  . PRO A 1 376 ? -3.385  26.133  -12.516 1.00 45.36  ? 421  PRO A CD  1 
ATOM   2467 N  N   . ALA A 1 377 ? -2.070  27.325  -15.755 1.00 44.25  ? 422  ALA A N   1 
ATOM   2468 C  CA  . ALA A 1 377 ? -1.207  27.838  -16.819 1.00 46.29  ? 422  ALA A CA  1 
ATOM   2469 C  C   . ALA A 1 377 ? -0.866  26.768  -17.857 1.00 43.72  ? 422  ALA A C   1 
ATOM   2470 O  O   . ALA A 1 377 ? -0.435  27.099  -18.961 1.00 44.70  ? 422  ALA A O   1 
ATOM   2471 C  CB  . ALA A 1 377 ? 0.075   28.423  -16.231 1.00 46.00  ? 422  ALA A CB  1 
ATOM   2472 N  N   . CYS A 1 378 ? -1.034  25.491  -17.498 1.00 41.03  ? 423  CYS A N   1 
ATOM   2473 C  CA  . CYS A 1 378 ? -0.787  24.395  -18.430 1.00 43.57  ? 423  CYS A CA  1 
ATOM   2474 C  C   . CYS A 1 378 ? -1.990  24.277  -19.362 1.00 45.48  ? 423  CYS A C   1 
ATOM   2475 O  O   . CYS A 1 378 ? -2.856  23.416  -19.186 1.00 44.76  ? 423  CYS A O   1 
ATOM   2476 C  CB  . CYS A 1 378 ? -0.529  23.064  -17.685 1.00 40.60  ? 423  CYS A CB  1 
ATOM   2477 S  SG  . CYS A 1 378 ? 0.809   23.145  -16.438 1.00 43.69  ? 423  CYS A SG  1 
ATOM   2478 N  N   . SER A 1 379 ? -2.028  25.156  -20.353 1.00 45.62  ? 424  SER A N   1 
ATOM   2479 C  CA  . SER A 1 379 ? -3.184  25.322  -21.221 1.00 43.48  ? 424  SER A CA  1 
ATOM   2480 C  C   . SER A 1 379 ? -3.386  24.154  -22.153 1.00 43.55  ? 424  SER A C   1 
ATOM   2481 O  O   . SER A 1 379 ? -2.562  23.920  -23.025 1.00 47.13  ? 424  SER A O   1 
ATOM   2482 C  CB  . SER A 1 379 ? -3.032  26.613  -22.041 1.00 48.26  ? 424  SER A CB  1 
ATOM   2483 O  OG  . SER A 1 379 ? -4.054  26.698  -23.020 1.00 50.10  ? 424  SER A OG  1 
ATOM   2484 N  N   . VAL A 1 380 ? -4.479  23.413  -21.972 1.00 41.94  ? 425  VAL A N   1 
ATOM   2485 C  CA  . VAL A 1 380 ? -4.817  22.321  -22.873 1.00 39.76  ? 425  VAL A CA  1 
ATOM   2486 C  C   . VAL A 1 380 ? -5.736  22.827  -23.971 1.00 43.39  ? 425  VAL A C   1 
ATOM   2487 O  O   . VAL A 1 380 ? -6.716  23.498  -23.677 1.00 44.72  ? 425  VAL A O   1 
ATOM   2488 C  CB  . VAL A 1 380 ? -5.513  21.167  -22.121 1.00 41.68  ? 425  VAL A CB  1 
ATOM   2489 C  CG1 . VAL A 1 380 ? -5.823  20.002  -23.071 1.00 41.56  ? 425  VAL A CG1 1 
ATOM   2490 C  CG2 . VAL A 1 380 ? -4.640  20.703  -20.962 1.00 44.57  ? 425  VAL A CG2 1 
ATOM   2491 N  N   . PRO A 1 381 ? -5.430  22.509  -25.239 1.00 41.95  ? 426  PRO A N   1 
ATOM   2492 C  CA  . PRO A 1 381 ? -6.297  22.971  -26.323 1.00 41.07  ? 426  PRO A CA  1 
ATOM   2493 C  C   . PRO A 1 381 ? -7.731  22.466  -26.138 1.00 41.39  ? 426  PRO A C   1 
ATOM   2494 O  O   . PRO A 1 381 ? -7.941  21.262  -25.965 1.00 40.01  ? 426  PRO A O   1 
ATOM   2495 C  CB  . PRO A 1 381 ? -5.655  22.368  -27.569 1.00 42.93  ? 426  PRO A CB  1 
ATOM   2496 C  CG  . PRO A 1 381 ? -4.238  22.106  -27.174 1.00 42.24  ? 426  PRO A CG  1 
ATOM   2497 C  CD  . PRO A 1 381 ? -4.315  21.691  -25.746 1.00 40.28  ? 426  PRO A CD  1 
ATOM   2498 N  N   . PRO A 1 382 ? -8.704  23.386  -26.116 1.00 39.03  ? 427  PRO A N   1 
ATOM   2499 C  CA  . PRO A 1 382 ? -10.098 22.976  -25.921 1.00 39.68  ? 427  PRO A CA  1 
ATOM   2500 C  C   . PRO A 1 382 ? -10.494 21.805  -26.816 1.00 39.19  ? 427  PRO A C   1 
ATOM   2501 O  O   . PRO A 1 382 ? -11.225 20.929  -26.386 1.00 37.66  ? 427  PRO A O   1 
ATOM   2502 C  CB  . PRO A 1 382 ? -10.883 24.255  -26.282 1.00 38.70  ? 427  PRO A CB  1 
ATOM   2503 C  CG  . PRO A 1 382 ? -9.963  25.350  -25.878 1.00 40.20  ? 427  PRO A CG  1 
ATOM   2504 C  CD  . PRO A 1 382 ? -8.579  24.855  -26.263 1.00 37.75  ? 427  PRO A CD  1 
ATOM   2505 N  N   . ARG A 1 383 ? -9.970  21.781  -28.034 1.00 43.28  ? 428  ARG A N   1 
ATOM   2506 C  CA  . ARG A 1 383 ? -10.217 20.708  -28.988 1.00 44.45  ? 428  ARG A CA  1 
ATOM   2507 C  C   . ARG A 1 383 ? -9.788  19.333  -28.435 1.00 42.07  ? 428  ARG A C   1 
ATOM   2508 O  O   . ARG A 1 383 ? -10.424 18.320  -28.712 1.00 42.38  ? 428  ARG A O   1 
ATOM   2509 C  CB  . ARG A 1 383 ? -9.483  21.034  -30.284 1.00 44.71  ? 428  ARG A CB  1 
ATOM   2510 C  CG  . ARG A 1 383 ? -9.573  20.041  -31.405 1.00 52.07  ? 428  ARG A CG  1 
ATOM   2511 C  CD  . ARG A 1 383 ? -8.623  20.502  -32.518 1.00 56.51  ? 428  ARG A CD  1 
ATOM   2512 N  NE  . ARG A 1 383 ? -7.639  19.483  -32.886 1.00 60.18  ? 428  ARG A NE  1 
ATOM   2513 C  CZ  . ARG A 1 383 ? -6.635  19.690  -33.740 1.00 63.51  ? 428  ARG A CZ  1 
ATOM   2514 N  NH1 . ARG A 1 383 ? -6.470  20.880  -34.309 1.00 65.54  ? 428  ARG A NH1 1 
ATOM   2515 N  NH2 . ARG A 1 383 ? -5.790  18.707  -34.020 1.00 62.46  ? 428  ARG A NH2 1 
ATOM   2516 N  N   . LEU A 1 384 ? -8.734  19.330  -27.628 1.00 38.61  ? 429  LEU A N   1 
ATOM   2517 C  CA  . LEU A 1 384 ? -8.196  18.099  -27.053 1.00 37.73  ? 429  LEU A CA  1 
ATOM   2518 C  C   . LEU A 1 384 ? -9.044  17.700  -25.857 1.00 39.90  ? 429  LEU A C   1 
ATOM   2519 O  O   . LEU A 1 384 ? -9.308  16.521  -25.642 1.00 37.23  ? 429  LEU A O   1 
ATOM   2520 C  CB  . LEU A 1 384 ? -6.733  18.274  -26.626 1.00 39.94  ? 429  LEU A CB  1 
ATOM   2521 C  CG  . LEU A 1 384 ? -6.107  17.046  -25.943 1.00 45.25  ? 429  LEU A CG  1 
ATOM   2522 C  CD1 . LEU A 1 384 ? -6.197  15.845  -26.875 1.00 45.08  ? 429  LEU A CD1 1 
ATOM   2523 C  CD2 . LEU A 1 384 ? -4.655  17.260  -25.504 1.00 46.70  ? 429  LEU A CD2 1 
ATOM   2524 N  N   . VAL A 1 385 ? -9.455  18.698  -25.070 1.00 37.86  ? 430  VAL A N   1 
ATOM   2525 C  CA  . VAL A 1 385 ? -10.350 18.451  -23.946 1.00 36.56  ? 430  VAL A CA  1 
ATOM   2526 C  C   . VAL A 1 385 ? -11.592 17.732  -24.466 1.00 34.17  ? 430  VAL A C   1 
ATOM   2527 O  O   . VAL A 1 385 ? -12.004 16.708  -23.908 1.00 35.11  ? 430  VAL A O   1 
ATOM   2528 C  CB  . VAL A 1 385 ? -10.745 19.749  -23.220 1.00 40.20  ? 430  VAL A CB  1 
ATOM   2529 C  CG1 . VAL A 1 385 ? -11.710 19.436  -22.072 1.00 38.05  ? 430  VAL A CG1 1 
ATOM   2530 C  CG2 . VAL A 1 385 ? -9.489  20.476  -22.714 1.00 40.45  ? 430  VAL A CG2 1 
ATOM   2531 N  N   . SER A 1 386 ? -12.134 18.239  -25.569 1.00 41.72  ? 431  SER A N   1 
ATOM   2532 C  CA  A SER A 1 386 ? -13.288 17.624  -26.210 0.48 43.41  ? 431  SER A CA  1 
ATOM   2533 C  CA  B SER A 1 386 ? -13.296 17.622  -26.198 0.52 44.20  ? 431  SER A CA  1 
ATOM   2534 C  C   . SER A 1 386 ? -12.974 16.216  -26.706 1.00 42.06  ? 431  SER A C   1 
ATOM   2535 O  O   . SER A 1 386 ? -13.755 15.302  -26.510 1.00 41.01  ? 431  SER A O   1 
ATOM   2536 C  CB  A SER A 1 386 ? -13.774 18.482  -27.372 0.48 42.57  ? 431  SER A CB  1 
ATOM   2537 C  CB  B SER A 1 386 ? -13.819 18.489  -27.345 0.52 42.64  ? 431  SER A CB  1 
ATOM   2538 O  OG  A SER A 1 386 ? -14.853 17.858  -28.039 0.48 39.76  ? 431  SER A OG  1 
ATOM   2539 O  OG  B SER A 1 386 ? -14.358 19.712  -26.860 0.52 44.13  ? 431  SER A OG  1 
ATOM   2540 N  N   . ALA A 1 387 ? -11.821 16.049  -27.355 1.00 38.43  ? 432  ALA A N   1 
ATOM   2541 C  CA  . ALA A 1 387 ? -11.430 14.736  -27.878 1.00 36.64  ? 432  ALA A CA  1 
ATOM   2542 C  C   . ALA A 1 387 ? -11.335 13.663  -26.790 1.00 38.09  ? 432  ALA A C   1 
ATOM   2543 O  O   . ALA A 1 387 ? -11.844 12.551  -26.974 1.00 37.01  ? 432  ALA A O   1 
ATOM   2544 C  CB  . ALA A 1 387 ? -10.109 14.825  -28.614 1.00 37.24  ? 432  ALA A CB  1 
ATOM   2545 N  N   . VAL A 1 388 ? -10.674 13.975  -25.673 1.00 33.05  ? 433  VAL A N   1 
ATOM   2546 C  CA  . VAL A 1 388 ? -10.499 12.965  -24.620 1.00 33.54  ? 433  VAL A CA  1 
ATOM   2547 C  C   . VAL A 1 388 ? -11.821 12.656  -23.907 1.00 34.92  ? 433  VAL A C   1 
ATOM   2548 O  O   . VAL A 1 388 ? -11.972 11.579  -23.314 1.00 34.68  ? 433  VAL A O   1 
ATOM   2549 C  CB  . VAL A 1 388 ? -9.436  13.369  -23.553 1.00 32.33  ? 433  VAL A CB  1 
ATOM   2550 C  CG1 . VAL A 1 388 ? -8.081  13.593  -24.210 1.00 32.59  ? 433  VAL A CG1 1 
ATOM   2551 C  CG2 . VAL A 1 388 ? -9.881  14.590  -22.737 1.00 34.16  ? 433  VAL A CG2 1 
ATOM   2552 N  N   . THR A 1 389 ? -12.783 13.572  -23.973 1.00 34.78  ? 434  THR A N   1 
ATOM   2553 C  CA  . THR A 1 389 ? -14.098 13.291  -23.398 1.00 33.81  ? 434  THR A CA  1 
ATOM   2554 C  C   . THR A 1 389 ? -14.824 12.241  -24.259 1.00 33.94  ? 434  THR A C   1 
ATOM   2555 O  O   . THR A 1 389 ? -15.294 11.208  -23.746 1.00 34.49  ? 434  THR A O   1 
ATOM   2556 C  CB  . THR A 1 389 ? -14.930 14.574  -23.268 1.00 36.23  ? 434  THR A CB  1 
ATOM   2557 O  OG1 . THR A 1 389 ? -14.248 15.464  -22.383 1.00 36.06  ? 434  THR A OG1 1 
ATOM   2558 C  CG2 . THR A 1 389 ? -16.316 14.268  -22.691 1.00 33.86  ? 434  THR A CG2 1 
ATOM   2559 N  N   . TRP A 1 390 ? -14.851 12.481  -25.566 1.00 37.21  ? 435  TRP A N   1 
ATOM   2560 C  CA  . TRP A 1 390 ? -15.436 11.535  -26.513 1.00 39.22  ? 435  TRP A CA  1 
ATOM   2561 C  C   . TRP A 1 390 ? -14.800 10.158  -26.358 1.00 38.21  ? 435  TRP A C   1 
ATOM   2562 O  O   . TRP A 1 390 ? -15.492 9.146   -26.355 1.00 36.91  ? 435  TRP A O   1 
ATOM   2563 C  CB  . TRP A 1 390 ? -15.289 12.029  -27.966 1.00 36.53  ? 435  TRP A CB  1 
ATOM   2564 C  CG  . TRP A 1 390 ? -16.307 13.083  -28.385 1.00 39.10  ? 435  TRP A CG  1 
ATOM   2565 C  CD1 . TRP A 1 390 ? -16.107 14.419  -28.452 1.00 40.93  ? 435  TRP A CD1 1 
ATOM   2566 C  CD2 . TRP A 1 390 ? -17.672 12.864  -28.788 1.00 40.05  ? 435  TRP A CD2 1 
ATOM   2567 N  NE1 . TRP A 1 390 ? -17.248 15.054  -28.870 1.00 42.11  ? 435  TRP A NE1 1 
ATOM   2568 C  CE2 . TRP A 1 390 ? -18.226 14.125  -29.083 1.00 39.92  ? 435  TRP A CE2 1 
ATOM   2569 C  CE3 . TRP A 1 390 ? -18.472 11.729  -28.924 1.00 38.98  ? 435  TRP A CE3 1 
ATOM   2570 C  CZ2 . TRP A 1 390 ? -19.550 14.289  -29.507 1.00 40.14  ? 435  TRP A CZ2 1 
ATOM   2571 C  CZ3 . TRP A 1 390 ? -19.800 11.892  -29.353 1.00 38.09  ? 435  TRP A CZ3 1 
ATOM   2572 C  CH2 . TRP A 1 390 ? -20.317 13.157  -29.640 1.00 38.40  ? 435  TRP A CH2 1 
ATOM   2573 N  N   . LEU A 1 391 ? -13.481 10.121  -26.229 1.00 33.86  ? 436  LEU A N   1 
ATOM   2574 C  CA  . LEU A 1 391 ? -12.781 8.845   -26.115 1.00 34.19  ? 436  LEU A CA  1 
ATOM   2575 C  C   . LEU A 1 391 ? -13.212 8.094   -24.852 1.00 34.92  ? 436  LEU A C   1 
ATOM   2576 O  O   . LEU A 1 391 ? -13.461 6.900   -24.906 1.00 33.95  ? 436  LEU A O   1 
ATOM   2577 C  CB  . LEU A 1 391 ? -11.278 9.058   -26.124 1.00 31.86  ? 436  LEU A CB  1 
ATOM   2578 C  CG  . LEU A 1 391 ? -10.408 7.818   -25.925 1.00 32.44  ? 436  LEU A CG  1 
ATOM   2579 C  CD1 . LEU A 1 391 ? -10.645 6.772   -27.022 1.00 33.36  ? 436  LEU A CD1 1 
ATOM   2580 C  CD2 . LEU A 1 391 ? -8.944  8.272   -25.885 1.00 31.55  ? 436  LEU A CD2 1 
ATOM   2581 N  N   . GLY A 1 392 ? -13.312 8.805   -23.731 1.00 33.02  ? 437  GLY A N   1 
ATOM   2582 C  CA  . GLY A 1 392 ? -13.858 8.244   -22.506 1.00 32.66  ? 437  GLY A CA  1 
ATOM   2583 C  C   . GLY A 1 392 ? -15.241 7.607   -22.677 1.00 32.53  ? 437  GLY A C   1 
ATOM   2584 O  O   . GLY A 1 392 ? -15.476 6.477   -22.226 1.00 32.21  ? 437  GLY A O   1 
ATOM   2585 N  N   . TYR A 1 393 ? -16.144 8.317   -23.342 1.00 33.15  ? 438  TYR A N   1 
ATOM   2586 C  CA  . TYR A 1 393 ? -17.523 7.851   -23.516 1.00 34.97  ? 438  TYR A CA  1 
ATOM   2587 C  C   . TYR A 1 393 ? -17.623 6.680   -24.483 1.00 34.99  ? 438  TYR A C   1 
ATOM   2588 O  O   . TYR A 1 393 ? -18.469 5.822   -24.311 1.00 35.31  ? 438  TYR A O   1 
ATOM   2589 C  CB  . TYR A 1 393 ? -18.419 8.996   -23.997 1.00 35.69  ? 438  TYR A CB  1 
ATOM   2590 C  CG  . TYR A 1 393 ? -18.670 10.050  -22.943 1.00 35.97  ? 438  TYR A CG  1 
ATOM   2591 C  CD1 . TYR A 1 393 ? -18.543 9.752   -21.591 1.00 34.21  ? 438  TYR A CD1 1 
ATOM   2592 C  CD2 . TYR A 1 393 ? -19.053 11.345  -23.301 1.00 35.31  ? 438  TYR A CD2 1 
ATOM   2593 C  CE1 . TYR A 1 393 ? -18.779 10.715  -20.616 1.00 34.41  ? 438  TYR A CE1 1 
ATOM   2594 C  CE2 . TYR A 1 393 ? -19.301 12.313  -22.334 1.00 36.05  ? 438  TYR A CE2 1 
ATOM   2595 C  CZ  . TYR A 1 393 ? -19.159 11.995  -20.994 1.00 34.57  ? 438  TYR A CZ  1 
ATOM   2596 O  OH  . TYR A 1 393 ? -19.414 12.964  -20.026 1.00 38.25  ? 438  TYR A OH  1 
ATOM   2597 N  N   . VAL A 1 394 ? -16.755 6.657   -25.492 1.00 34.03  ? 439  VAL A N   1 
ATOM   2598 C  CA  . VAL A 1 394 ? -16.685 5.555   -26.456 1.00 35.72  ? 439  VAL A CA  1 
ATOM   2599 C  C   . VAL A 1 394 ? -16.409 4.209   -25.765 1.00 35.91  ? 439  VAL A C   1 
ATOM   2600 O  O   . VAL A 1 394 ? -16.905 3.169   -26.203 1.00 35.93  ? 439  VAL A O   1 
ATOM   2601 C  CB  . VAL A 1 394 ? -15.607 5.826   -27.530 1.00 36.97  ? 439  VAL A CB  1 
ATOM   2602 C  CG1 . VAL A 1 394 ? -15.128 4.536   -28.177 1.00 39.90  ? 439  VAL A CG1 1 
ATOM   2603 C  CG2 . VAL A 1 394 ? -16.141 6.794   -28.591 1.00 37.47  ? 439  VAL A CG2 1 
ATOM   2604 N  N   . ASN A 1 395 ? -15.662 4.227   -24.665 1.00 35.35  ? 440  ASN A N   1 
ATOM   2605 C  CA  . ASN A 1 395 ? -15.462 3.002   -23.887 1.00 35.42  ? 440  ASN A CA  1 
ATOM   2606 C  C   . ASN A 1 395 ? -16.769 2.270   -23.549 1.00 35.35  ? 440  ASN A C   1 
ATOM   2607 O  O   . ASN A 1 395 ? -16.815 1.042   -23.546 1.00 36.87  ? 440  ASN A O   1 
ATOM   2608 C  CB  . ASN A 1 395 ? -14.717 3.282   -22.585 1.00 34.24  ? 440  ASN A CB  1 
ATOM   2609 C  CG  . ASN A 1 395 ? -14.399 2.005   -21.825 1.00 37.24  ? 440  ASN A CG  1 
ATOM   2610 O  OD1 . ASN A 1 395 ? -15.004 1.722   -20.794 1.00 40.24  ? 440  ASN A OD1 1 
ATOM   2611 N  ND2 . ASN A 1 395 ? -13.484 1.207   -22.355 1.00 36.95  ? 440  ASN A ND2 1 
ATOM   2612 N  N   . SER A 1 396 ? -17.827 3.033   -23.290 1.00 36.71  ? 441  SER A N   1 
ATOM   2613 C  CA  . SER A 1 396 ? -19.106 2.450   -22.888 1.00 37.18  ? 441  SER A CA  1 
ATOM   2614 C  C   . SER A 1 396 ? -19.734 1.601   -23.990 1.00 38.18  ? 441  SER A C   1 
ATOM   2615 O  O   . SER A 1 396 ? -20.618 0.787   -23.727 1.00 40.34  ? 441  SER A O   1 
ATOM   2616 C  CB  . SER A 1 396 ? -20.070 3.554   -22.455 1.00 38.91  ? 441  SER A CB  1 
ATOM   2617 O  OG  . SER A 1 396 ? -19.687 4.063   -21.182 1.00 40.01  ? 441  SER A OG  1 
ATOM   2618 N  N   . ALA A 1 397 ? -19.277 1.796   -25.221 1.00 37.44  ? 442  ALA A N   1 
ATOM   2619 C  CA  . ALA A 1 397 ? -19.744 0.998   -26.351 1.00 39.28  ? 442  ALA A CA  1 
ATOM   2620 C  C   . ALA A 1 397 ? -18.876 -0.230  -26.625 1.00 41.79  ? 442  ALA A C   1 
ATOM   2621 O  O   . ALA A 1 397 ? -19.302 -1.148  -27.334 1.00 40.90  ? 442  ALA A O   1 
ATOM   2622 C  CB  . ALA A 1 397 ? -19.818 1.865   -27.601 1.00 37.42  ? 442  ALA A CB  1 
ATOM   2623 N  N   . LEU A 1 398 ? -17.664 -0.253  -26.065 1.00 40.32  ? 443  LEU A N   1 
ATOM   2624 C  CA  . LEU A 1 398 ? -16.674 -1.277  -26.411 1.00 39.23  ? 443  LEU A CA  1 
ATOM   2625 C  C   . LEU A 1 398 ? -16.862 -2.591  -25.696 1.00 40.27  ? 443  LEU A C   1 
ATOM   2626 O  O   . LEU A 1 398 ? -16.614 -3.647  -26.285 1.00 40.02  ? 443  LEU A O   1 
ATOM   2627 C  CB  . LEU A 1 398 ? -15.251 -0.788  -26.114 1.00 40.17  ? 443  LEU A CB  1 
ATOM   2628 C  CG  . LEU A 1 398 ? -14.776 0.479   -26.815 1.00 40.68  ? 443  LEU A CG  1 
ATOM   2629 C  CD1 . LEU A 1 398 ? -13.339 0.825   -26.387 1.00 40.40  ? 443  LEU A CD1 1 
ATOM   2630 C  CD2 . LEU A 1 398 ? -14.881 0.319   -28.321 1.00 39.15  ? 443  LEU A CD2 1 
ATOM   2631 N  N   . ASN A 1 399 ? -17.254 -2.548  -24.423 1.00 41.44  ? 444  ASN A N   1 
ATOM   2632 C  CA  . ASN A 1 399 ? -17.316 -3.799  -23.641 1.00 43.91  ? 444  ASN A CA  1 
ATOM   2633 C  C   . ASN A 1 399 ? -18.182 -4.912  -24.240 1.00 43.76  ? 444  ASN A C   1 
ATOM   2634 O  O   . ASN A 1 399 ? -17.769 -6.068  -24.227 1.00 46.05  ? 444  ASN A O   1 
ATOM   2635 C  CB  . ASN A 1 399 ? -17.774 -3.517  -22.209 1.00 44.05  ? 444  ASN A CB  1 
ATOM   2636 C  CG  . ASN A 1 399 ? -16.635 -3.035  -21.329 1.00 46.51  ? 444  ASN A CG  1 
ATOM   2637 O  OD1 . ASN A 1 399 ? -15.535 -2.776  -21.813 1.00 44.09  ? 444  ASN A OD1 1 
ATOM   2638 N  ND2 . ASN A 1 399 ? -16.900 -2.887  -20.037 1.00 47.66  ? 444  ASN A ND2 1 
ATOM   2639 N  N   . PRO A 1 400 ? -19.381 -4.589  -24.759 1.00 42.61  ? 445  PRO A N   1 
ATOM   2640 C  CA  . PRO A 1 400 ? -20.140 -5.691  -25.369 1.00 44.27  ? 445  PRO A CA  1 
ATOM   2641 C  C   . PRO A 1 400 ? -19.373 -6.370  -26.506 1.00 44.47  ? 445  PRO A C   1 
ATOM   2642 O  O   . PRO A 1 400 ? -19.448 -7.590  -26.669 1.00 46.80  ? 445  PRO A O   1 
ATOM   2643 C  CB  . PRO A 1 400 ? -21.404 -4.999  -25.896 1.00 43.68  ? 445  PRO A CB  1 
ATOM   2644 C  CG  . PRO A 1 400 ? -21.595 -3.850  -24.948 1.00 41.13  ? 445  PRO A CG  1 
ATOM   2645 C  CD  . PRO A 1 400 ? -20.188 -3.357  -24.665 1.00 41.81  ? 445  PRO A CD  1 
ATOM   2646 N  N   . VAL A 1 401 ? -18.633 -5.582  -27.274 1.00 44.44  ? 446  VAL A N   1 
ATOM   2647 C  CA  . VAL A 1 401 ? -17.831 -6.128  -28.357 1.00 45.04  ? 446  VAL A CA  1 
ATOM   2648 C  C   . VAL A 1 401 ? -16.707 -6.982  -27.799 1.00 44.73  ? 446  VAL A C   1 
ATOM   2649 O  O   . VAL A 1 401 ? -16.430 -8.064  -28.316 1.00 45.28  ? 446  VAL A O   1 
ATOM   2650 C  CB  . VAL A 1 401 ? -17.232 -5.029  -29.236 1.00 46.83  ? 446  VAL A CB  1 
ATOM   2651 C  CG1 . VAL A 1 401 ? -16.463 -5.644  -30.385 1.00 45.02  ? 446  VAL A CG1 1 
ATOM   2652 C  CG2 . VAL A 1 401 ? -18.330 -4.105  -29.748 1.00 43.99  ? 446  VAL A CG2 1 
ATOM   2653 N  N   . ILE A 1 402 ? -16.063 -6.493  -26.744 1.00 42.19  ? 447  ILE A N   1 
ATOM   2654 C  CA  . ILE A 1 402 ? -14.958 -7.221  -26.120 1.00 43.77  ? 447  ILE A CA  1 
ATOM   2655 C  C   . ILE A 1 402 ? -15.406 -8.595  -25.617 1.00 46.12  ? 447  ILE A C   1 
ATOM   2656 O  O   . ILE A 1 402 ? -14.723 -9.594  -25.860 1.00 49.46  ? 447  ILE A O   1 
ATOM   2657 C  CB  . ILE A 1 402 ? -14.347 -6.418  -24.960 1.00 43.03  ? 447  ILE A CB  1 
ATOM   2658 C  CG1 . ILE A 1 402 ? -13.683 -5.153  -25.500 1.00 42.22  ? 447  ILE A CG1 1 
ATOM   2659 C  CG2 . ILE A 1 402 ? -13.320 -7.260  -24.206 1.00 42.90  ? 447  ILE A CG2 1 
ATOM   2660 C  CD1 . ILE A 1 402 ? -13.002 -4.304  -24.418 1.00 41.48  ? 447  ILE A CD1 1 
ATOM   2661 N  N   . TYR A 1 403 ? -16.561 -8.657  -24.950 1.00 46.85  ? 448  TYR A N   1 
ATOM   2662 C  CA  . TYR A 1 403 ? -17.085 -9.947  -24.476 1.00 47.05  ? 448  TYR A CA  1 
ATOM   2663 C  C   . TYR A 1 403 ? -17.306 -10.911 -25.627 1.00 48.50  ? 448  TYR A C   1 
ATOM   2664 O  O   . TYR A 1 403 ? -16.942 -12.082 -25.541 1.00 50.21  ? 448  TYR A O   1 
ATOM   2665 C  CB  . TYR A 1 403 ? -18.410 -9.785  -23.732 1.00 48.90  ? 448  TYR A CB  1 
ATOM   2666 C  CG  . TYR A 1 403 ? -18.366 -8.806  -22.606 1.00 46.55  ? 448  TYR A CG  1 
ATOM   2667 C  CD1 . TYR A 1 403 ? -17.242 -8.696  -21.802 1.00 47.04  ? 448  TYR A CD1 1 
ATOM   2668 C  CD2 . TYR A 1 403 ? -19.444 -7.975  -22.352 1.00 47.26  ? 448  TYR A CD2 1 
ATOM   2669 C  CE1 . TYR A 1 403 ? -17.190 -7.777  -20.771 1.00 47.83  ? 448  TYR A CE1 1 
ATOM   2670 C  CE2 . TYR A 1 403 ? -19.404 -7.058  -21.331 1.00 48.16  ? 448  TYR A CE2 1 
ATOM   2671 C  CZ  . TYR A 1 403 ? -18.272 -6.961  -20.542 1.00 47.30  ? 448  TYR A CZ  1 
ATOM   2672 O  OH  . TYR A 1 403 ? -18.239 -6.053  -19.518 1.00 49.13  ? 448  TYR A OH  1 
ATOM   2673 N  N   . THR A 1 404 ? -17.923 -10.405 -26.694 1.00 53.87  ? 449  THR A N   1 
ATOM   2674 C  CA  . THR A 1 404 ? -18.314 -11.222 -27.838 1.00 53.76  ? 449  THR A CA  1 
ATOM   2675 C  C   . THR A 1 404 ? -17.093 -11.805 -28.529 1.00 54.17  ? 449  THR A C   1 
ATOM   2676 O  O   . THR A 1 404 ? -17.124 -12.934 -29.009 1.00 57.13  ? 449  THR A O   1 
ATOM   2677 C  CB  . THR A 1 404 ? -19.138 -10.412 -28.863 1.00 51.13  ? 449  THR A CB  1 
ATOM   2678 O  OG1 . THR A 1 404 ? -20.262 -9.818  -28.207 1.00 55.63  ? 449  THR A OG1 1 
ATOM   2679 C  CG2 . THR A 1 404 ? -19.646 -11.315 -29.984 1.00 53.24  ? 449  THR A CG2 1 
ATOM   2680 N  N   . VAL A 1 405 ? -16.019 -11.025 -28.578 1.00 53.41  ? 450  VAL A N   1 
ATOM   2681 C  CA  . VAL A 1 405 ? -14.785 -11.465 -29.212 1.00 52.80  ? 450  VAL A CA  1 
ATOM   2682 C  C   . VAL A 1 405 ? -13.973 -12.362 -28.285 1.00 54.41  ? 450  VAL A C   1 
ATOM   2683 O  O   . VAL A 1 405 ? -13.508 -13.421 -28.697 1.00 55.60  ? 450  VAL A O   1 
ATOM   2684 C  CB  . VAL A 1 405 ? -13.910 -10.263 -29.651 1.00 53.53  ? 450  VAL A CB  1 
ATOM   2685 C  CG1 . VAL A 1 405 ? -12.575 -10.748 -30.206 1.00 53.11  ? 450  VAL A CG1 1 
ATOM   2686 C  CG2 . VAL A 1 405 ? -14.635 -9.422  -30.688 1.00 52.23  ? 450  VAL A CG2 1 
ATOM   2687 N  N   . PHE A 1 406 ? -13.820 -11.955 -27.028 1.00 52.66  ? 451  PHE A N   1 
ATOM   2688 C  CA  . PHE A 1 406 ? -12.817 -12.590 -26.174 1.00 53.03  ? 451  PHE A CA  1 
ATOM   2689 C  C   . PHE A 1 406 ? -13.317 -13.546 -25.100 1.00 55.35  ? 451  PHE A C   1 
ATOM   2690 O  O   . PHE A 1 406 ? -12.508 -14.195 -24.451 1.00 58.44  ? 451  PHE A O   1 
ATOM   2691 C  CB  . PHE A 1 406 ? -11.957 -11.520 -25.500 1.00 50.25  ? 451  PHE A CB  1 
ATOM   2692 C  CG  . PHE A 1 406 ? -11.152 -10.705 -26.462 1.00 53.71  ? 451  PHE A CG  1 
ATOM   2693 C  CD1 . PHE A 1 406 ? -9.963  -11.195 -26.974 1.00 57.05  ? 451  PHE A CD1 1 
ATOM   2694 C  CD2 . PHE A 1 406 ? -11.571 -9.445  -26.848 1.00 53.37  ? 451  PHE A CD2 1 
ATOM   2695 C  CE1 . PHE A 1 406 ? -9.215  -10.441 -27.866 1.00 55.82  ? 451  PHE A CE1 1 
ATOM   2696 C  CE2 . PHE A 1 406 ? -10.821 -8.686  -27.732 1.00 52.94  ? 451  PHE A CE2 1 
ATOM   2697 C  CZ  . PHE A 1 406 ? -9.644  -9.187  -28.239 1.00 52.53  ? 451  PHE A CZ  1 
ATOM   2698 N  N   . ASN A 1 407 ? -14.624 -13.641 -24.893 1.00 55.52  ? 452  ASN A N   1 
ATOM   2699 C  CA  . ASN A 1 407 ? -15.130 -14.627 -23.940 1.00 54.63  ? 452  ASN A CA  1 
ATOM   2700 C  C   . ASN A 1 407 ? -15.970 -15.705 -24.605 1.00 56.70  ? 452  ASN A C   1 
ATOM   2701 O  O   . ASN A 1 407 ? -16.943 -15.415 -25.292 1.00 57.51  ? 452  ASN A O   1 
ATOM   2702 C  CB  . ASN A 1 407 ? -15.955 -13.975 -22.834 1.00 56.54  ? 452  ASN A CB  1 
ATOM   2703 C  CG  . ASN A 1 407 ? -16.523 -15.001 -21.869 1.00 58.84  ? 452  ASN A CG  1 
ATOM   2704 O  OD1 . ASN A 1 407 ? -17.652 -15.472 -22.037 1.00 55.49  ? 452  ASN A OD1 1 
ATOM   2705 N  ND2 . ASN A 1 407 ? -15.727 -15.382 -20.870 1.00 57.26  ? 452  ASN A ND2 1 
ATOM   2706 N  N   . ALA A 1 408 ? -15.599 -16.956 -24.367 1.00 61.60  ? 453  ALA A N   1 
ATOM   2707 C  CA  . ALA A 1 408 ? -16.199 -18.072 -25.071 1.00 59.83  ? 453  ALA A CA  1 
ATOM   2708 C  C   . ALA A 1 408 ? -17.709 -18.161 -24.874 1.00 62.04  ? 453  ALA A C   1 
ATOM   2709 O  O   . ALA A 1 408 ? -18.461 -18.366 -25.834 1.00 62.22  ? 453  ALA A O   1 
ATOM   2710 C  CB  . ALA A 1 408 ? -15.536 -19.372 -24.634 1.00 64.38  ? 453  ALA A CB  1 
ATOM   2711 N  N   . GLU A 1 409 ? -18.157 -18.023 -23.631 1.00 61.99  ? 454  GLU A N   1 
ATOM   2712 C  CA  . GLU A 1 409 ? -19.571 -18.232 -23.343 1.00 63.70  ? 454  GLU A CA  1 
ATOM   2713 C  C   . GLU A 1 409 ? -20.403 -17.133 -24.002 1.00 59.43  ? 454  GLU A C   1 
ATOM   2714 O  O   . GLU A 1 409 ? -21.405 -17.430 -24.648 1.00 59.56  ? 454  GLU A O   1 
ATOM   2715 C  CB  . GLU A 1 409 ? -19.824 -18.288 -21.835 1.00 66.01  ? 454  GLU A CB  1 
ATOM   2716 N  N   . PHE A 1 410 ? -19.975 -15.874 -23.873 1.00 57.04  ? 455  PHE A N   1 
ATOM   2717 C  CA  . PHE A 1 410 ? -20.681 -14.782 -24.541 1.00 58.02  ? 455  PHE A CA  1 
ATOM   2718 C  C   . PHE A 1 410 ? -20.670 -14.981 -26.056 1.00 60.04  ? 455  PHE A C   1 
ATOM   2719 O  O   . PHE A 1 410 ? -21.697 -14.839 -26.721 1.00 57.07  ? 455  PHE A O   1 
ATOM   2720 C  CB  . PHE A 1 410 ? -20.064 -13.430 -24.182 1.00 56.12  ? 455  PHE A CB  1 
ATOM   2721 C  CG  . PHE A 1 410 ? -20.590 -12.834 -22.905 1.00 56.94  ? 455  PHE A CG  1 
ATOM   2722 C  CD1 . PHE A 1 410 ? -21.878 -12.311 -22.843 1.00 57.99  ? 455  PHE A CD1 1 
ATOM   2723 C  CD2 . PHE A 1 410 ? -19.794 -12.783 -21.772 1.00 55.74  ? 455  PHE A CD2 1 
ATOM   2724 C  CE1 . PHE A 1 410 ? -22.363 -11.754 -21.675 1.00 53.49  ? 455  PHE A CE1 1 
ATOM   2725 C  CE2 . PHE A 1 410 ? -20.274 -12.217 -20.599 1.00 56.41  ? 455  PHE A CE2 1 
ATOM   2726 C  CZ  . PHE A 1 410 ? -21.555 -11.702 -20.551 1.00 54.43  ? 455  PHE A CZ  1 
ATOM   2727 N  N   . ARG A 1 411 ? -19.498 -15.315 -26.587 1.00 63.94  ? 456  ARG A N   1 
ATOM   2728 C  CA  . ARG A 1 411 ? -19.324 -15.564 -28.014 1.00 64.77  ? 456  ARG A CA  1 
ATOM   2729 C  C   . ARG A 1 411 ? -20.246 -16.666 -28.539 1.00 64.84  ? 456  ARG A C   1 
ATOM   2730 O  O   . ARG A 1 411 ? -20.832 -16.541 -29.618 1.00 68.50  ? 456  ARG A O   1 
ATOM   2731 C  CB  . ARG A 1 411 ? -17.861 -15.922 -28.300 1.00 66.06  ? 456  ARG A CB  1 
ATOM   2732 C  CG  . ARG A 1 411 ? -17.533 -16.087 -29.766 1.00 66.87  ? 456  ARG A CG  1 
ATOM   2733 C  CD  . ARG A 1 411 ? -16.041 -16.242 -29.953 1.00 66.54  ? 456  ARG A CD  1 
ATOM   2734 N  N   . ASN A 1 412 ? -20.381 -17.748 -27.779 1.00 65.55  ? 457  ASN A N   1 
ATOM   2735 C  CA  . ASN A 1 412 ? -21.242 -18.848 -28.201 1.00 67.46  ? 457  ASN A CA  1 
ATOM   2736 C  C   . ASN A 1 412 ? -22.713 -18.462 -28.089 1.00 69.49  ? 457  ASN A C   1 
ATOM   2737 O  O   . ASN A 1 412 ? -23.521 -18.834 -28.935 1.00 71.13  ? 457  ASN A O   1 
ATOM   2738 C  CB  . ASN A 1 412 ? -20.958 -20.106 -27.384 1.00 70.35  ? 457  ASN A CB  1 
ATOM   2739 N  N   . VAL A 1 413 ? -23.059 -17.704 -27.053 1.00 66.33  ? 458  VAL A N   1 
ATOM   2740 C  CA  . VAL A 1 413 ? -24.427 -17.214 -26.901 1.00 71.77  ? 458  VAL A CA  1 
ATOM   2741 C  C   . VAL A 1 413 ? -24.767 -16.249 -28.042 1.00 71.55  ? 458  VAL A C   1 
ATOM   2742 O  O   . VAL A 1 413 ? -25.875 -16.255 -28.570 1.00 71.90  ? 458  VAL A O   1 
ATOM   2743 C  CB  . VAL A 1 413 ? -24.629 -16.518 -25.540 1.00 71.62  ? 458  VAL A CB  1 
ATOM   2744 C  CG1 . VAL A 1 413 ? -25.938 -15.731 -25.523 1.00 72.57  ? 458  VAL A CG1 1 
ATOM   2745 C  CG2 . VAL A 1 413 ? -24.598 -17.542 -24.417 1.00 72.67  ? 458  VAL A CG2 1 
ATOM   2746 N  N   . PHE A 1 414 ? -23.789 -15.432 -28.428 1.00 72.89  ? 459  PHE A N   1 
ATOM   2747 C  CA  . PHE A 1 414 ? -23.917 -14.566 -29.595 1.00 71.02  ? 459  PHE A CA  1 
ATOM   2748 C  C   . PHE A 1 414 ? -24.079 -15.385 -30.872 1.00 75.57  ? 459  PHE A C   1 
ATOM   2749 O  O   . PHE A 1 414 ? -25.098 -15.281 -31.554 1.00 75.69  ? 459  PHE A O   1 
ATOM   2750 C  CB  . PHE A 1 414 ? -22.696 -13.652 -29.708 1.00 72.45  ? 459  PHE A CB  1 
ATOM   2751 C  CG  . PHE A 1 414 ? -22.717 -12.734 -30.903 1.00 72.81  ? 459  PHE A CG  1 
ATOM   2752 C  CD1 . PHE A 1 414 ? -23.359 -11.503 -30.838 1.00 70.86  ? 459  PHE A CD1 1 
ATOM   2753 C  CD2 . PHE A 1 414 ? -22.067 -13.089 -32.081 1.00 73.02  ? 459  PHE A CD2 1 
ATOM   2754 C  CE1 . PHE A 1 414 ? -23.366 -10.647 -31.927 1.00 67.69  ? 459  PHE A CE1 1 
ATOM   2755 C  CE2 . PHE A 1 414 ? -22.074 -12.242 -33.176 1.00 71.60  ? 459  PHE A CE2 1 
ATOM   2756 C  CZ  . PHE A 1 414 ? -22.724 -11.019 -33.100 1.00 70.45  ? 459  PHE A CZ  1 
ATOM   2757 N  N   . ARG A 1 415 ? -23.071 -16.211 -31.166 1.00 76.62  ? 460  ARG A N   1 
ATOM   2758 C  CA  . ARG A 1 415 ? -22.989 -16.992 -32.405 1.00 76.54  ? 460  ARG A CA  1 
ATOM   2759 C  C   . ARG A 1 415 ? -24.276 -17.723 -32.767 1.00 84.23  ? 460  ARG A C   1 
ATOM   2760 O  O   . ARG A 1 415 ? -24.513 -18.013 -33.940 1.00 87.91  ? 460  ARG A O   1 
ATOM   2761 C  CB  . ARG A 1 415 ? -21.843 -18.011 -32.321 1.00 75.05  ? 460  ARG A CB  1 
ATOM   2762 N  N   . LYS A 1 416 ? -25.099 -18.039 -31.770 1.00 83.23  ? 461  LYS A N   1 
ATOM   2763 C  CA  . LYS A 1 416 ? -26.452 -18.493 -32.063 1.00 87.21  ? 461  LYS A CA  1 
ATOM   2764 C  C   . LYS A 1 416 ? -27.347 -17.256 -32.207 1.00 87.23  ? 461  LYS A C   1 
ATOM   2765 O  O   . LYS A 1 416 ? -28.175 -16.935 -31.351 1.00 88.70  ? 461  LYS A O   1 
ATOM   2766 C  CB  . LYS A 1 416 ? -26.965 -19.486 -31.002 1.00 86.86  ? 461  LYS A CB  1 
ATOM   2767 C  CG  . LYS A 1 416 ? -26.919 -19.020 -29.561 1.00 83.14  ? 461  LYS A CG  1 
ATOM   2768 C  CD  . LYS A 1 416 ? -27.899 -19.813 -28.711 1.00 84.54  ? 461  LYS A CD  1 
ATOM   2769 C  CE  . LYS A 1 416 ? -27.557 -21.288 -28.703 1.00 86.30  ? 461  LYS A CE  1 
ATOM   2770 N  N   . ALA A 1 417 ? -27.129 -16.547 -33.309 1.00 88.72  ? 462  ALA A N   1 
ATOM   2771 C  CA  . ALA A 1 417 ? -27.956 -15.419 -33.688 1.00 86.97  ? 462  ALA A CA  1 
ATOM   2772 C  C   . ALA A 1 417 ? -29.367 -15.895 -34.005 1.00 92.01  ? 462  ALA A C   1 
ATOM   2773 O  O   . ALA A 1 417 ? -30.305 -15.604 -33.267 1.00 95.93  ? 462  ALA A O   1 
ATOM   2774 C  CB  . ALA A 1 417 ? -27.355 -14.701 -34.881 1.00 86.10  ? 462  ALA A CB  1 
HETATM 2775 C  CAB . AQD B 2 .   ? -16.765 11.793  -16.344 1.00 26.89  ? 1201 AQD A CAB 1 
HETATM 2776 O  OAR . AQD B 2 .   ? -16.479 13.184  -16.085 1.00 31.19  ? 1201 AQD A OAR 1 
HETATM 2777 C  CAW . AQD B 2 .   ? -15.615 13.449  -14.994 1.00 27.18  ? 1201 AQD A CAW 1 
HETATM 2778 C  CAK . AQD B 2 .   ? -15.231 12.434  -14.098 1.00 32.67  ? 1201 AQD A CAK 1 
HETATM 2779 C  CAV . AQD B 2 .   ? -14.376 12.763  -13.031 1.00 27.75  ? 1201 AQD A CAV 1 
HETATM 2780 N  NAP . AQD B 2 .   ? -13.960 11.763  -12.096 1.00 31.76  ? 1201 AQD A NAP 1 
HETATM 2781 C  CAA . AQD B 2 .   ? -14.651 10.489  -12.085 1.00 29.80  ? 1201 AQD A CAA 1 
HETATM 2782 C  CAU . AQD B 2 .   ? -13.891 14.071  -12.887 1.00 35.13  ? 1201 AQD A CAU 1 
HETATM 2783 CL CLA . AQD B 2 .   ? -12.777 14.490  -11.593 1.00 41.84  ? 1201 AQD A CLA 1 
HETATM 2784 C  CAL . AQD B 2 .   ? -14.265 15.058  -13.780 1.00 32.20  ? 1201 AQD A CAL 1 
HETATM 2785 C  CAX . AQD B 2 .   ? -15.118 14.748  -14.834 1.00 28.31  ? 1201 AQD A CAX 1 
HETATM 2786 C  CAS . AQD B 2 .   ? -15.526 15.904  -15.744 1.00 33.92  ? 1201 AQD A CAS 1 
HETATM 2787 O  OAD . AQD B 2 .   ? -14.929 16.950  -15.642 1.00 36.55  ? 1201 AQD A OAD 1 
HETATM 2788 N  NAQ . AQD B 2 .   ? -16.638 15.809  -16.648 1.00 34.47  ? 1201 AQD A NAQ 1 
HETATM 2789 C  CAZ . AQD B 2 .   ? -16.997 16.959  -17.469 1.00 40.86  ? 1201 AQD A CAZ 1 
HETATM 2790 C  CAY . AQD B 2 .   ? -17.416 16.578  -18.817 1.00 51.93  ? 1201 AQD A CAY 1 
HETATM 2791 C  CAC . AQD B 2 .   ? -16.699 15.290  -19.320 1.00 33.08  ? 1201 AQD A CAC 1 
HETATM 2792 C  CAM . AQD B 2 .   ? -18.166 17.653  -16.797 1.00 41.57  ? 1201 AQD A CAM 1 
HETATM 2793 C  CAN . AQD B 2 .   ? -19.349 17.390  -17.881 1.00 61.28  ? 1201 AQD A CAN 1 
HETATM 2794 N  NBA . AQD B 2 .   ? -18.795 16.355  -18.773 1.00 60.99  ? 1201 AQD A NBA 1 
HETATM 2795 C  CAO . AQD B 2 .   ? -19.331 16.401  -20.098 1.00 68.84  ? 1201 AQD A CAO 1 
HETATM 2796 C  CAT . AQD B 2 .   ? -20.852 16.758  -20.138 1.00 54.50  ? 1201 AQD A CAT 1 
HETATM 2797 C  CAI . AQD B 2 .   ? -21.259 18.001  -20.632 1.00 53.54  ? 1201 AQD A CAI 1 
HETATM 2798 C  CAG . AQD B 2 .   ? -22.616 18.335  -20.665 1.00 59.38  ? 1201 AQD A CAG 1 
HETATM 2799 C  CAF . AQD B 2 .   ? -23.565 17.421  -20.210 1.00 61.98  ? 1201 AQD A CAF 1 
HETATM 2800 C  CAH . AQD B 2 .   ? -23.166 16.184  -19.721 1.00 69.04  ? 1201 AQD A CAH 1 
HETATM 2801 C  CAJ . AQD B 2 .   ? -21.806 15.847  -19.682 1.00 58.81  ? 1201 AQD A CAJ 1 
HETATM 2802 P  P   . PO4 C 3 .   ? -20.076 -17.196 -3.851  1.00 55.90  ? 1202 PO4 A P   1 
HETATM 2803 O  O1  . PO4 C 3 .   ? -21.181 -16.493 -4.618  1.00 56.26  ? 1202 PO4 A O1  1 
HETATM 2804 O  O2  . PO4 C 3 .   ? -19.786 -18.542 -4.468  1.00 53.71  ? 1202 PO4 A O2  1 
HETATM 2805 O  O3  . PO4 C 3 .   ? -18.816 -16.372 -3.924  1.00 44.88  ? 1202 PO4 A O3  1 
HETATM 2806 O  O4  . PO4 C 3 .   ? -20.489 -17.369 -2.407  1.00 54.31  ? 1202 PO4 A O4  1 
HETATM 2807 P  P   . PO4 D 3 .   ? -0.005  -20.445 -21.044 0.50 65.76  ? 1203 PO4 A P   1 
HETATM 2808 O  O1  . PO4 D 3 .   ? -0.310  -19.573 -22.240 0.50 64.53  ? 1203 PO4 A O1  1 
HETATM 2809 O  O2  . PO4 D 3 .   ? 1.192   -21.317 -21.340 0.50 66.68  ? 1203 PO4 A O2  1 
HETATM 2810 O  O3  . PO4 D 3 .   ? -1.197  -21.324 -20.746 0.50 66.67  ? 1203 PO4 A O3  1 
HETATM 2811 O  O4  . PO4 D 3 .   ? 0.293   -19.569 -19.849 0.50 64.51  ? 1203 PO4 A O4  1 
HETATM 2812 P  P   . PO4 E 3 .   ? -33.844 11.443  -21.031 0.50 54.23  ? 1204 PO4 A P   1 
HETATM 2813 O  O1  . PO4 E 3 .   ? -33.585 10.565  -22.235 0.50 54.23  ? 1204 PO4 A O1  1 
HETATM 2814 O  O2  . PO4 E 3 .   ? -35.052 12.320  -21.288 0.50 54.23  ? 1204 PO4 A O2  1 
HETATM 2815 O  O3  . PO4 E 3 .   ? -32.635 12.318  -20.775 0.50 54.23  ? 1204 PO4 A O3  1 
HETATM 2816 O  O4  . PO4 E 3 .   ? -34.105 10.566  -19.828 0.50 54.23  ? 1204 PO4 A O4  1 
HETATM 2817 C  C1  . OLA F 4 .   ? -25.664 -12.774 -12.593 1.00 72.89  ? 1205 OLA A C1  1 
HETATM 2818 O  O1  . OLA F 4 .   ? -24.593 -12.950 -13.221 1.00 73.33  ? 1205 OLA A O1  1 
HETATM 2819 O  O2  . OLA F 4 .   ? -26.009 -13.630 -11.743 1.00 76.06  ? 1205 OLA A O2  1 
HETATM 2820 C  C2  . OLA F 4 .   ? -26.523 -11.555 -12.868 1.00 62.37  ? 1205 OLA A C2  1 
HETATM 2821 C  C3  . OLA F 4 .   ? -26.764 -10.728 -11.608 1.00 52.15  ? 1205 OLA A C3  1 
HETATM 2822 C  C4  . OLA F 4 .   ? -26.643 -9.238  -11.902 1.00 55.48  ? 1205 OLA A C4  1 
HETATM 2823 C  C5  . OLA F 4 .   ? -26.421 -8.462  -10.608 1.00 57.14  ? 1205 OLA A C5  1 
HETATM 2824 C  C6  . OLA F 4 .   ? -27.123 -7.111  -10.627 1.00 60.63  ? 1205 OLA A C6  1 
HETATM 2825 C  C7  . OLA F 4 .   ? -26.186 -5.995  -10.177 1.00 54.09  ? 1205 OLA A C7  1 
HETATM 2826 C  C8  . OLA F 4 .   ? -26.235 -4.791  -11.114 1.00 47.70  ? 1205 OLA A C8  1 
HETATM 2827 C  C9  . OLA F 4 .   ? -27.208 -3.755  -10.606 1.00 44.50  ? 1205 OLA A C9  1 
HETATM 2828 C  C10 . OLA F 4 .   ? -26.773 -2.546  -10.266 1.00 40.03  ? 1205 OLA A C10 1 
HETATM 2829 C  C11 . OLA F 4 .   ? -27.319 -1.312  -10.938 1.00 35.88  ? 1205 OLA A C11 1 
HETATM 2830 C  C12 . OLA F 4 .   ? -27.373 -0.200  -9.897  1.00 41.42  ? 1205 OLA A C12 1 
HETATM 2831 C  C13 . OLA F 4 .   ? -27.987 1.076   -10.452 1.00 43.84  ? 1205 OLA A C13 1 
HETATM 2832 C  C14 . OLA F 4 .   ? -27.630 2.237   -9.531  1.00 45.82  ? 1205 OLA A C14 1 
HETATM 2833 C  C15 . OLA F 4 .   ? -28.530 3.442   -9.772  1.00 55.54  ? 1205 OLA A C15 1 
HETATM 2834 C  C1  . OLA G 4 .   ? -17.334 19.034  -31.555 1.00 99.28  ? 1206 OLA A C1  1 
HETATM 2835 O  O1  . OLA G 4 .   ? -17.330 19.410  -32.747 1.00 105.51 ? 1206 OLA A O1  1 
HETATM 2836 O  O2  . OLA G 4 .   ? -17.618 19.856  -30.656 1.00 105.04 ? 1206 OLA A O2  1 
HETATM 2837 C  C2  . OLA G 4 .   ? -16.998 17.606  -31.210 1.00 79.86  ? 1206 OLA A C2  1 
HETATM 2838 C  C3  . OLA G 4 .   ? -16.754 16.813  -32.487 1.00 66.97  ? 1206 OLA A C3  1 
HETATM 2839 C  C4  . OLA G 4 .   ? -17.387 15.434  -32.369 1.00 52.94  ? 1206 OLA A C4  1 
HETATM 2840 C  C5  . OLA G 4 .   ? -16.516 14.348  -32.983 1.00 57.15  ? 1206 OLA A C5  1 
HETATM 2841 C  C6  . OLA G 4 .   ? -17.333 13.075  -33.197 1.00 51.34  ? 1206 OLA A C6  1 
HETATM 2842 C  C7  . OLA G 4 .   ? -16.780 11.899  -32.399 1.00 43.21  ? 1206 OLA A C7  1 
HETATM 2843 C  C8  . OLA G 4 .   ? -17.698 10.694  -32.554 1.00 44.16  ? 1206 OLA A C8  1 
HETATM 2844 C  C9  . OLA G 4 .   ? -17.170 9.496   -31.798 1.00 48.27  ? 1206 OLA A C9  1 
HETATM 2845 C  C10 . OLA G 4 .   ? -17.994 8.459   -31.599 1.00 49.02  ? 1206 OLA A C10 1 
HETATM 2846 C  C11 . OLA G 4 .   ? -18.157 7.440   -32.702 1.00 46.78  ? 1206 OLA A C11 1 
HETATM 2847 C  C12 . OLA G 4 .   ? -18.298 6.032   -32.135 1.00 51.42  ? 1206 OLA A C12 1 
HETATM 2848 C  C13 . OLA G 4 .   ? -19.777 5.665   -32.030 1.00 47.86  ? 1206 OLA A C13 1 
HETATM 2849 C  C14 . OLA G 4 .   ? -20.197 4.721   -33.147 1.00 52.84  ? 1206 OLA A C14 1 
HETATM 2850 C  C15 . OLA G 4 .   ? -20.488 3.331   -32.593 1.00 43.07  ? 1206 OLA A C15 1 
HETATM 2851 C  C1  . OLA H 4 .   ? -13.735 19.273  -31.056 1.00 103.20 ? 1207 OLA A C1  1 
HETATM 2852 O  O1  . OLA H 4 .   ? -14.378 19.425  -32.117 1.00 112.35 ? 1207 OLA A O1  1 
HETATM 2853 O  O2  . OLA H 4 .   ? -13.879 20.128  -30.152 1.00 98.09  ? 1207 OLA A O2  1 
HETATM 2854 C  C2  . OLA H 4 .   ? -12.801 18.089  -30.885 1.00 92.94  ? 1207 OLA A C2  1 
HETATM 2855 C  C3  . OLA H 4 .   ? -13.596 16.810  -30.629 1.00 80.87  ? 1207 OLA A C3  1 
HETATM 2856 C  C4  . OLA H 4 .   ? -13.425 15.775  -31.735 1.00 66.30  ? 1207 OLA A C4  1 
HETATM 2857 C  C5  . OLA H 4 .   ? -12.217 14.889  -31.480 1.00 50.07  ? 1207 OLA A C5  1 
HETATM 2858 C  C6  . OLA H 4 .   ? -12.375 13.552  -32.176 1.00 46.47  ? 1207 OLA A C6  1 
HETATM 2859 C  C7  . OLA H 4 .   ? -12.954 12.518  -31.218 1.00 40.27  ? 1207 OLA A C7  1 
HETATM 2860 C  C8  . OLA H 4 .   ? -12.356 11.153  -31.517 1.00 36.49  ? 1207 OLA A C8  1 
HETATM 2861 C  C9  . OLA H 4 .   ? -12.614 10.189  -30.380 1.00 34.97  ? 1207 OLA A C9  1 
HETATM 2862 C  C10 . OLA H 4 .   ? -13.121 8.975   -30.621 1.00 36.20  ? 1207 OLA A C10 1 
HETATM 2863 C  C11 . OLA H 4 .   ? -12.284 7.933   -31.331 1.00 46.24  ? 1207 OLA A C11 1 
HETATM 2864 C  C12 . OLA H 4 .   ? -12.448 6.594   -30.628 1.00 53.31  ? 1207 OLA A C12 1 
HETATM 2865 C  C13 . OLA H 4 .   ? -11.611 5.500   -31.283 1.00 50.02  ? 1207 OLA A C13 1 
HETATM 2866 C  C14 . OLA H 4 .   ? -12.325 4.155   -31.199 1.00 46.12  ? 1207 OLA A C14 1 
HETATM 2867 C  C15 . OLA H 4 .   ? -11.304 3.030   -31.041 1.00 55.66  ? 1207 OLA A C15 1 
HETATM 2868 C  C1  . OLA I 4 .   ? -16.063 10.947  1.992   1.00 60.84  ? 1208 OLA A C1  1 
HETATM 2869 O  O1  . OLA I 4 .   ? -15.657 12.078  2.362   1.00 50.74  ? 1208 OLA A O1  1 
HETATM 2870 O  O2  . OLA I 4 .   ? -16.690 10.237  2.812   1.00 65.11  ? 1208 OLA A O2  1 
HETATM 2871 C  C2  . OLA I 4 .   ? -15.820 10.480  0.571   1.00 51.60  ? 1208 OLA A C2  1 
HETATM 2872 C  C3  . OLA I 4 .   ? -15.293 9.046   0.524   1.00 45.64  ? 1208 OLA A C3  1 
HETATM 2873 C  C4  . OLA I 4 .   ? -14.274 8.892   -0.607  1.00 48.05  ? 1208 OLA A C4  1 
HETATM 2874 C  C5  . OLA I 4 .   ? -13.409 7.657   -0.405  1.00 51.34  ? 1208 OLA A C5  1 
HETATM 2875 C  C6  . OLA I 4 .   ? -13.325 6.776   -1.652  1.00 47.47  ? 1208 OLA A C6  1 
HETATM 2876 C  C7  . OLA I 4 .   ? -11.981 6.048   -1.736  1.00 50.30  ? 1208 OLA A C7  1 
HETATM 2877 C  C8  . OLA I 4 .   ? -11.726 5.496   -3.142  1.00 48.14  ? 1208 OLA A C8  1 
HETATM 2878 C  C9  . OLA I 4 .   ? -10.465 4.663   -3.205  1.00 48.02  ? 1208 OLA A C9  1 
HETATM 2879 C  C10 . OLA I 4 .   ? -10.353 3.729   -4.154  1.00 45.94  ? 1208 OLA A C10 1 
HETATM 2880 C  C11 . OLA I 4 .   ? -10.145 2.268   -3.828  1.00 55.85  ? 1208 OLA A C11 1 
HETATM 2881 C  C12 . OLA I 4 .   ? -11.053 1.404   -4.707  1.00 45.63  ? 1208 OLA A C12 1 
HETATM 2882 C  C13 . OLA I 4 .   ? -12.466 1.251   -4.131  1.00 43.28  ? 1208 OLA A C13 1 
HETATM 2883 C  C14 . OLA I 4 .   ? -13.194 0.123   -4.865  1.00 34.91  ? 1208 OLA A C14 1 
HETATM 2884 C  C15 . OLA I 4 .   ? -14.443 -0.361  -4.131  1.00 35.18  ? 1208 OLA A C15 1 
HETATM 2885 C  C1  . OLA J 4 .   ? -17.264 -12.964 -33.470 1.00 93.42  ? 1209 OLA A C1  1 
HETATM 2886 O  O1  . OLA J 4 .   ? -18.255 -13.494 -32.921 1.00 97.06  ? 1209 OLA A O1  1 
HETATM 2887 O  O2  . OLA J 4 .   ? -16.152 -13.530 -33.387 1.00 90.76  ? 1209 OLA A O2  1 
HETATM 2888 C  C2  . OLA J 4 .   ? -17.411 -11.659 -34.221 1.00 90.38  ? 1209 OLA A C2  1 
HETATM 2889 C  C3  . OLA J 4 .   ? -18.038 -10.604 -33.318 1.00 80.15  ? 1209 OLA A C3  1 
HETATM 2890 C  C4  . OLA J 4 .   ? -17.242 -9.303  -33.364 1.00 72.06  ? 1209 OLA A C4  1 
HETATM 2891 C  C5  . OLA J 4 .   ? -17.782 -8.345  -34.422 1.00 68.55  ? 1209 OLA A C5  1 
HETATM 2892 C  C6  . OLA J 4 .   ? -18.485 -7.154  -33.774 1.00 63.43  ? 1209 OLA A C6  1 
HETATM 2893 C  C7  . OLA J 4 .   ? -19.885 -7.567  -33.336 1.00 63.48  ? 1209 OLA A C7  1 
HETATM 2894 C  C8  . OLA J 4 .   ? -20.615 -6.445  -32.607 1.00 59.59  ? 1209 OLA A C8  1 
HETATM 2895 C  C9  . OLA J 4 .   ? -21.647 -7.079  -31.707 1.00 57.29  ? 1209 OLA A C9  1 
HETATM 2896 C  C10 . OLA J 4 .   ? -21.621 -6.844  -30.398 1.00 57.16  ? 1209 OLA A C10 1 
HETATM 2897 C  C11 . OLA J 4 .   ? -22.663 -5.941  -29.782 1.00 54.95  ? 1209 OLA A C11 1 
HETATM 2898 C  C12 . OLA J 4 .   ? -23.218 -6.622  -28.540 1.00 53.45  ? 1209 OLA A C12 1 
HETATM 2899 C  C13 . OLA J 4 .   ? -23.366 -8.110  -28.798 1.00 56.12  ? 1209 OLA A C13 1 
HETATM 2900 C  C14 . OLA J 4 .   ? -24.201 -8.767  -27.713 1.00 52.33  ? 1209 OLA A C14 1 
HETATM 2901 C  C15 . OLA J 4 .   ? -23.382 -8.939  -26.443 1.00 47.51  ? 1209 OLA A C15 1 
HETATM 2902 C  C16 . OLA J 4 .   ? -23.889 -10.144 -25.666 1.00 55.13  ? 1209 OLA A C16 1 
HETATM 2903 C  C17 . OLA J 4 .   ? -23.642 -11.417 -26.464 1.00 59.13  ? 1209 OLA A C17 1 
HETATM 2904 C  C18 . OLA J 4 .   ? -24.964 -12.103 -26.794 1.00 57.72  ? 1209 OLA A C18 1 
HETATM 2905 C  C1  . OLA K 4 .   ? -1.628  -15.037 -16.997 1.00 73.35  ? 1210 OLA A C1  1 
HETATM 2906 O  O1  . OLA K 4 .   ? -2.350  -15.789 -17.694 1.00 64.99  ? 1210 OLA A O1  1 
HETATM 2907 O  O2  . OLA K 4 .   ? -0.994  -15.507 -16.018 1.00 72.02  ? 1210 OLA A O2  1 
HETATM 2908 C  C2  . OLA K 4 .   ? -1.529  -13.569 -17.343 1.00 70.92  ? 1210 OLA A C2  1 
HETATM 2909 C  C3  . OLA K 4 .   ? -2.808  -13.134 -18.053 1.00 67.91  ? 1210 OLA A C3  1 
HETATM 2910 C  C4  . OLA K 4 .   ? -2.516  -12.053 -19.085 1.00 64.64  ? 1210 OLA A C4  1 
HETATM 2911 C  C5  . OLA K 4 .   ? -1.923  -10.822 -18.414 1.00 63.86  ? 1210 OLA A C5  1 
HETATM 2912 C  C6  . OLA K 4 .   ? -2.861  -10.259 -17.347 1.00 70.74  ? 1210 OLA A C6  1 
HETATM 2913 C  C7  . OLA K 4 .   ? -2.107  -9.777  -16.107 1.00 68.94  ? 1210 OLA A C7  1 
HETATM 2914 C  C8  . OLA K 4 .   ? -3.033  -9.025  -15.149 1.00 55.95  ? 1210 OLA A C8  1 
HETATM 2915 C  C9  . OLA K 4 .   ? -3.288  -7.613  -15.632 1.00 58.74  ? 1210 OLA A C9  1 
HETATM 2916 C  C10 . OLA K 4 .   ? -4.446  -7.310  -16.224 1.00 55.58  ? 1210 OLA A C10 1 
HETATM 2917 C  C11 . OLA K 4 .   ? -4.725  -5.908  -16.701 1.00 29.01  ? 1210 OLA A C11 1 
HETATM 2918 C  C12 . OLA K 4 .   ? -4.017  -5.664  -18.034 1.00 41.83  ? 1210 OLA A C12 1 
HETATM 2919 C  C13 . OLA K 4 .   ? -3.643  -4.193  -18.168 1.00 38.94  ? 1210 OLA A C13 1 
HETATM 2920 C  C14 . OLA K 4 .   ? -3.625  -3.752  -19.630 1.00 48.59  ? 1210 OLA A C14 1 
HETATM 2921 C  C15 . OLA K 4 .   ? -2.683  -2.575  -19.840 1.00 53.94  ? 1210 OLA A C15 1 
HETATM 2922 C  C16 . OLA K 4 .   ? -2.607  -2.192  -21.317 1.00 55.89  ? 1210 OLA A C16 1 
HETATM 2923 C  C17 . OLA K 4 .   ? -3.280  -0.848  -21.566 1.00 52.72  ? 1210 OLA A C17 1 
HETATM 2924 C  C18 . OLA K 4 .   ? -2.733  0.219   -20.623 1.00 59.37  ? 1210 OLA A C18 1 
HETATM 2925 C  C1  . OLA L 4 .   ? -5.599  -19.769 4.106   1.00 71.40  ? 1211 OLA A C1  1 
HETATM 2926 O  O1  . OLA L 4 .   ? -4.640  -19.061 4.481   1.00 71.00  ? 1211 OLA A O1  1 
HETATM 2927 O  O2  . OLA L 4 .   ? -5.681  -20.933 4.561   1.00 76.30  ? 1211 OLA A O2  1 
HETATM 2928 C  C2  . OLA L 4 .   ? -6.625  -19.232 3.125   1.00 64.03  ? 1211 OLA A C2  1 
HETATM 2929 C  C3  . OLA L 4 .   ? -7.005  -17.799 3.496   1.00 46.11  ? 1211 OLA A C3  1 
HETATM 2930 C  C4  . OLA L 4 .   ? -6.242  -16.802 2.625   1.00 49.50  ? 1211 OLA A C4  1 
HETATM 2931 C  C5  . OLA L 4 .   ? -6.181  -15.392 3.218   1.00 41.17  ? 1211 OLA A C5  1 
HETATM 2932 C  C6  . OLA L 4 .   ? -6.172  -14.379 2.081   1.00 47.05  ? 1211 OLA A C6  1 
HETATM 2933 C  C7  . OLA L 4 .   ? -6.592  -12.972 2.489   1.00 45.88  ? 1211 OLA A C7  1 
HETATM 2934 C  C8  . OLA L 4 .   ? -7.275  -12.304 1.298   1.00 52.96  ? 1211 OLA A C8  1 
HETATM 2935 C  C9  . OLA L 4 .   ? -7.503  -10.828 1.511   1.00 56.39  ? 1211 OLA A C9  1 
HETATM 2936 C  C10 . OLA L 4 .   ? -7.513  -10.026 0.446   1.00 51.71  ? 1211 OLA A C10 1 
HETATM 2937 C  C11 . OLA L 4 .   ? -8.467  -8.865  0.330   1.00 51.29  ? 1211 OLA A C11 1 
HETATM 2938 C  C12 . OLA L 4 .   ? -7.697  -7.694  -0.277  1.00 51.27  ? 1211 OLA A C12 1 
HETATM 2939 C  C13 . OLA L 4 .   ? -8.563  -6.443  -0.340  1.00 59.79  ? 1211 OLA A C13 1 
HETATM 2940 C  C14 . OLA L 4 .   ? -8.018  -5.456  -1.364  1.00 55.97  ? 1211 OLA A C14 1 
HETATM 2941 C  C1  . OLA M 4 .   ? -8.142  -12.470 -31.173 1.00 73.95  ? 1212 OLA A C1  1 
HETATM 2942 O  O1  . OLA M 4 .   ? -7.043  -12.678 -31.735 1.00 78.24  ? 1212 OLA A O1  1 
HETATM 2943 O  O2  . OLA M 4 .   ? -8.672  -13.394 -30.510 1.00 68.02  ? 1212 OLA A O2  1 
HETATM 2944 C  C2  . OLA M 4 .   ? -8.809  -11.118 -31.286 1.00 74.20  ? 1212 OLA A C2  1 
HETATM 2945 C  C3  . OLA M 4 .   ? -8.003  -10.221 -32.222 1.00 69.78  ? 1212 OLA A C3  1 
HETATM 2946 C  C4  . OLA M 4 .   ? -8.807  -9.012  -32.705 1.00 69.93  ? 1212 OLA A C4  1 
HETATM 2947 C  C5  . OLA M 4 .   ? -8.779  -7.843  -31.721 1.00 73.84  ? 1212 OLA A C5  1 
HETATM 2948 C  C6  . OLA M 4 .   ? -9.544  -6.634  -32.256 1.00 75.04  ? 1212 OLA A C6  1 
HETATM 2949 C  C7  . OLA M 4 .   ? -10.414 -6.011  -31.169 1.00 82.64  ? 1212 OLA A C7  1 
HETATM 2950 C  C8  . OLA M 4 .   ? -9.776  -4.763  -30.563 1.00 78.49  ? 1212 OLA A C8  1 
HETATM 2951 C  C9  . OLA M 4 .   ? -10.624 -4.268  -29.410 1.00 75.19  ? 1212 OLA A C9  1 
HETATM 2952 C  C10 . OLA M 4 .   ? -10.168 -3.345  -28.557 1.00 67.33  ? 1212 OLA A C10 1 
HETATM 2953 C  C11 . OLA M 4 .   ? -9.836  -3.709  -27.127 1.00 54.78  ? 1212 OLA A C11 1 
HETATM 2954 C  C12 . OLA M 4 .   ? -8.674  -2.854  -26.633 1.00 53.68  ? 1212 OLA A C12 1 
HETATM 2955 C  C13 . OLA M 4 .   ? -7.614  -3.723  -25.969 1.00 55.64  ? 1212 OLA A C13 1 
HETATM 2956 C  C14 . OLA M 4 .   ? -6.979  -3.019  -24.779 1.00 52.26  ? 1212 OLA A C14 1 
HETATM 2957 C  C15 . OLA M 4 .   ? -5.594  -3.577  -24.468 1.00 49.20  ? 1212 OLA A C15 1 
HETATM 2958 C  C16 . OLA M 4 .   ? -5.639  -5.071  -24.160 1.00 51.39  ? 1212 OLA A C16 1 
HETATM 2959 C  C17 . OLA M 4 .   ? -4.493  -5.504  -23.246 1.00 45.62  ? 1212 OLA A C17 1 
HETATM 2960 C  C18 . OLA M 4 .   ? -4.379  -7.032  -23.163 1.00 40.45  ? 1212 OLA A C18 1 
HETATM 2961 C  C1  . OLA N 4 .   ? 3.571   20.957  -10.907 1.00 78.74  ? 1213 OLA A C1  1 
HETATM 2962 O  O1  . OLA N 4 .   ? 4.492   20.287  -11.428 1.00 77.39  ? 1213 OLA A O1  1 
HETATM 2963 O  O2  . OLA N 4 .   ? 3.862   21.728  -9.967  1.00 83.85  ? 1213 OLA A O2  1 
HETATM 2964 C  C2  . OLA N 4 .   ? 2.141   20.847  -11.400 1.00 68.60  ? 1213 OLA A C2  1 
HETATM 2965 C  C3  . OLA N 4 .   ? 1.941   19.497  -12.083 1.00 60.43  ? 1213 OLA A C3  1 
HETATM 2966 C  C4  . OLA N 4 .   ? 1.297   19.648  -13.459 1.00 51.66  ? 1213 OLA A C4  1 
HETATM 2967 C  C5  . OLA N 4 .   ? 1.264   18.343  -14.263 1.00 48.95  ? 1213 OLA A C5  1 
HETATM 2968 C  C6  . OLA N 4 .   ? 0.920   17.113  -13.425 1.00 47.34  ? 1213 OLA A C6  1 
HETATM 2969 C  C7  . OLA N 4 .   ? 0.005   16.160  -14.197 1.00 48.50  ? 1213 OLA A C7  1 
HETATM 2970 C  C8  . OLA N 4 .   ? 0.552   14.749  -14.337 1.00 52.53  ? 1213 OLA A C8  1 
HETATM 2971 C  C9  . OLA N 4 .   ? -0.275  13.801  -13.494 1.00 49.60  ? 1213 OLA A C9  1 
HETATM 2972 C  C10 . OLA N 4 .   ? -0.675  12.625  -13.990 1.00 39.86  ? 1213 OLA A C10 1 
HETATM 2973 C  C11 . OLA N 4 .   ? 0.343   11.545  -14.277 1.00 50.63  ? 1213 OLA A C11 1 
HETATM 2974 C  C12 . OLA N 4 .   ? -0.324  10.175  -14.253 1.00 57.34  ? 1213 OLA A C12 1 
HETATM 2975 C  C13 . OLA N 4 .   ? 0.571   9.108   -14.876 1.00 66.27  ? 1213 OLA A C13 1 
HETATM 2976 C  C14 . OLA N 4 .   ? -0.212  8.140   -15.761 1.00 54.32  ? 1213 OLA A C14 1 
HETATM 2977 C  C15 . OLA N 4 .   ? -1.065  7.171   -14.944 1.00 60.74  ? 1213 OLA A C15 1 
HETATM 2978 C  C16 . OLA N 4 .   ? -1.138  5.801   -15.621 1.00 57.57  ? 1213 OLA A C16 1 
HETATM 2979 C  C17 . OLA N 4 .   ? -2.488  5.105   -15.437 1.00 52.98  ? 1213 OLA A C17 1 
HETATM 2980 C  C18 . OLA N 4 .   ? -2.727  4.667   -13.992 1.00 43.02  ? 1213 OLA A C18 1 
HETATM 2981 C  C1  . PEG O 5 .   ? -2.839  13.876  -24.342 1.00 69.35  ? 1214 PEG A C1  1 
HETATM 2982 O  O1  . PEG O 5 .   ? -2.966  12.463  -24.079 1.00 67.16  ? 1214 PEG A O1  1 
HETATM 2983 C  C2  . PEG O 5 .   ? -1.881  14.701  -23.429 1.00 49.71  ? 1214 PEG A C2  1 
HETATM 2984 O  O2  . PEG O 5 .   ? -1.898  15.993  -23.575 1.00 66.75  ? 1214 PEG A O2  1 
HETATM 2985 C  C3  . PEG O 5 .   ? -1.162  16.862  -22.656 1.00 53.97  ? 1214 PEG A C3  1 
HETATM 2986 C  C4  . PEG O 5 .   ? -1.710  18.285  -22.420 1.00 58.22  ? 1214 PEG A C4  1 
HETATM 2987 O  O4  . PEG O 5 .   ? -0.940  19.206  -21.773 1.00 47.00  ? 1214 PEG A O4  1 
HETATM 2988 C  C1  . PEG P 5 .   ? -1.946  14.864  -6.755  1.00 49.91  ? 1215 PEG A C1  1 
HETATM 2989 O  O1  . PEG P 5 .   ? -1.353  13.674  -7.319  1.00 60.64  ? 1215 PEG A O1  1 
HETATM 2990 C  C2  . PEG P 5 .   ? -1.208  15.564  -5.570  1.00 90.06  ? 1215 PEG A C2  1 
HETATM 2991 O  O2  . PEG P 5 .   ? -1.114  16.854  -5.598  1.00 90.65  ? 1215 PEG A O2  1 
HETATM 2992 C  C3  . PEG P 5 .   ? 0.004   17.504  -4.926  1.00 90.86  ? 1215 PEG A C3  1 
HETATM 2993 C  C4  . PEG P 5 .   ? 0.691   18.703  -5.610  1.00 83.59  ? 1215 PEG A C4  1 
HETATM 2994 O  O4  . PEG P 5 .   ? 1.773   18.460  -6.397  1.00 74.58  ? 1215 PEG A O4  1 
HETATM 2995 C  C1  . PEG Q 5 .   ? -25.102 10.936  -5.613  1.00 56.65  ? 1216 PEG A C1  1 
HETATM 2996 O  O1  . PEG Q 5 .   ? -25.469 11.640  -4.407  1.00 49.20  ? 1216 PEG A O1  1 
HETATM 2997 C  C2  . PEG Q 5 .   ? -24.794 11.791  -6.881  1.00 45.88  ? 1216 PEG A C2  1 
HETATM 2998 O  O2  . PEG Q 5 .   ? -25.223 11.363  -8.026  1.00 54.82  ? 1216 PEG A O2  1 
HETATM 2999 C  C3  . PEG Q 5 .   ? -26.648 11.362  -8.325  1.00 53.24  ? 1216 PEG A C3  1 
HETATM 3000 C  C4  . PEG Q 5 .   ? -27.234 12.573  -9.069  1.00 56.09  ? 1216 PEG A C4  1 
HETATM 3001 O  O4  . PEG Q 5 .   ? -28.539 12.513  -9.449  1.00 58.91  ? 1216 PEG A O4  1 
HETATM 3002 C  C1  . PEG R 5 .   ? -29.048 13.657  -28.802 1.00 57.52  ? 1217 PEG A C1  1 
HETATM 3003 O  O1  . PEG R 5 .   ? -29.251 15.049  -29.116 1.00 54.10  ? 1217 PEG A O1  1 
HETATM 3004 C  C2  . PEG R 5 .   ? -30.212 12.679  -29.145 1.00 65.39  ? 1217 PEG A C2  1 
HETATM 3005 O  O2  . PEG R 5 .   ? -30.144 11.460  -28.725 1.00 65.94  ? 1217 PEG A O2  1 
HETATM 3006 C  C3  . PEG R 5 .   ? -30.046 10.351  -29.672 1.00 58.10  ? 1217 PEG A C3  1 
HETATM 3007 C  C4  . PEG R 5 .   ? -30.774 9.037   -29.317 1.00 61.57  ? 1217 PEG A C4  1 
HETATM 3008 O  O4  . PEG R 5 .   ? -30.582 7.934   -30.094 1.00 59.13  ? 1217 PEG A O4  1 
HETATM 3009 C  C1  . PEG S 5 .   ? -35.661 -5.405  -14.133 1.00 59.15  ? 1218 PEG A C1  1 
HETATM 3010 O  O1  . PEG S 5 .   ? -35.258 -4.077  -14.523 1.00 61.23  ? 1218 PEG A O1  1 
HETATM 3011 C  C2  . PEG S 5 .   ? -35.656 -6.532  -15.219 1.00 85.22  ? 1218 PEG A C2  1 
HETATM 3012 O  O2  . PEG S 5 .   ? -34.528 -7.097  -15.519 1.00 80.53  ? 1218 PEG A O2  1 
HETATM 3013 C  C3  . PEG S 5 .   ? -34.442 -8.548  -15.630 1.00 73.26  ? 1218 PEG A C3  1 
HETATM 3014 C  C4  . PEG S 5 .   ? -34.725 -9.380  -14.366 1.00 65.45  ? 1218 PEG A C4  1 
HETATM 3015 O  O4  . PEG S 5 .   ? -34.447 -10.706 -14.415 1.00 70.12  ? 1218 PEG A O4  1 
HETATM 3016 C  C1  . PEG T 5 .   ? -33.159 24.326  -17.642 1.00 58.92  ? 1219 PEG A C1  1 
HETATM 3017 O  O1  . PEG T 5 .   ? -34.049 25.339  -18.162 1.00 69.72  ? 1219 PEG A O1  1 
HETATM 3018 C  C2  . PEG T 5 .   ? -33.780 23.240  -16.709 1.00 65.39  ? 1219 PEG A C2  1 
HETATM 3019 O  O2  . PEG T 5 .   ? -34.520 22.315  -17.241 1.00 68.31  ? 1219 PEG A O2  1 
HETATM 3020 C  C3  . PEG T 5 .   ? -34.959 21.206  -16.405 1.00 51.94  ? 1219 PEG A C3  1 
HETATM 3021 C  C4  . PEG T 5 .   ? -35.211 19.850  -17.078 1.00 57.66  ? 1219 PEG A C4  1 
HETATM 3022 O  O4  . PEG T 5 .   ? -35.470 18.796  -16.265 1.00 62.29  ? 1219 PEG A O4  1 
HETATM 3023 C  C1  . PEG U 5 .   ? -33.781 24.528  -12.801 1.00 68.07  ? 1220 PEG A C1  1 
HETATM 3024 O  O1  . PEG U 5 .   ? -32.817 25.246  -12.000 1.00 66.58  ? 1220 PEG A O1  1 
HETATM 3025 C  C2  . PEG U 5 .   ? -34.245 23.122  -12.303 1.00 67.82  ? 1220 PEG A C2  1 
HETATM 3026 O  O2  . PEG U 5 .   ? -33.739 22.079  -12.880 1.00 77.05  ? 1220 PEG A O2  1 
HETATM 3027 C  C3  . PEG U 5 .   ? -33.031 21.079  -12.088 1.00 70.25  ? 1220 PEG A C3  1 
HETATM 3028 C  C4  . PEG U 5 .   ? -33.048 19.622  -12.585 1.00 62.07  ? 1220 PEG A C4  1 
HETATM 3029 O  O4  . PEG U 5 .   ? -32.445 18.656  -11.839 1.00 49.50  ? 1220 PEG A O4  1 
HETATM 3030 C  C1  . PEG V 5 .   ? -26.247 4.629   -5.240  1.00 39.74  ? 1221 PEG A C1  1 
HETATM 3031 O  O1  . PEG V 5 .   ? -26.929 5.818   -4.789  1.00 44.86  ? 1221 PEG A O1  1 
HETATM 3032 C  C2  . PEG V 5 .   ? -27.128 3.536   -5.928  1.00 73.93  ? 1221 PEG A C2  1 
HETATM 3033 O  O2  . PEG V 5 .   ? -27.267 2.398   -5.323  1.00 71.73  ? 1221 PEG A O2  1 
HETATM 3034 C  C3  . PEG V 5 .   ? -27.657 1.229   -6.094  1.00 62.34  ? 1221 PEG A C3  1 
HETATM 3035 C  C4  . PEG V 5 .   ? -27.197 -0.153  -5.602  1.00 62.40  ? 1221 PEG A C4  1 
HETATM 3036 O  O4  . PEG V 5 .   ? -27.415 -1.215  -6.424  1.00 68.34  ? 1221 PEG A O4  1 
HETATM 3037 C  C1  . PEG W 5 .   ? -1.862  14.298  0.897   1.00 64.98  ? 1222 PEG A C1  1 
HETATM 3038 O  O1  . PEG W 5 .   ? -2.298  15.659  0.718   1.00 60.91  ? 1222 PEG A O1  1 
HETATM 3039 C  C2  . PEG W 5 .   ? -1.693  13.449  -0.397  1.00 69.48  ? 1222 PEG A C2  1 
HETATM 3040 O  O2  . PEG W 5 .   ? -2.571  13.643  -1.322  1.00 73.17  ? 1222 PEG A O2  1 
HETATM 3041 C  C3  . PEG W 5 .   ? -2.853  12.580  -2.278  1.00 71.88  ? 1222 PEG A C3  1 
HETATM 3042 C  C4  . PEG W 5 .   ? -1.792  12.238  -3.339  1.00 67.51  ? 1222 PEG A C4  1 
HETATM 3043 O  O4  . PEG W 5 .   ? -1.879  11.017  -3.931  1.00 69.24  ? 1222 PEG A O4  1 
HETATM 3044 C  C1  . GOL X 6 .   ? -16.192 -18.106 -5.680  1.00 66.48  ? 1223 GOL A C1  1 
HETATM 3045 O  O1  . GOL X 6 .   ? -16.297 -16.733 -5.359  1.00 71.83  ? 1223 GOL A O1  1 
HETATM 3046 C  C2  . GOL X 6 .   ? -16.781 -18.333 -7.055  1.00 53.80  ? 1223 GOL A C2  1 
HETATM 3047 O  O2  . GOL X 6 .   ? -15.730 -18.409 -7.989  1.00 45.74  ? 1223 GOL A O2  1 
HETATM 3048 C  C3  . GOL X 6 .   ? -17.549 -19.630 -7.137  1.00 58.49  ? 1223 GOL A C3  1 
HETATM 3049 O  O3  . GOL X 6 .   ? -18.798 -19.408 -6.524  1.00 55.92  ? 1223 GOL A O3  1 
HETATM 3050 O  O   . HOH Y 7 .   ? -0.720  21.147  -21.302 0.90 49.71  ? 1301 HOH A O   1 
HETATM 3051 O  O   . HOH Y 7 .   ? -7.457  -27.814 -20.093 1.00 55.76  ? 1302 HOH A O   1 
HETATM 3052 O  O   . HOH Y 7 .   ? 1.127   -36.613 -19.447 1.00 48.86  ? 1303 HOH A O   1 
HETATM 3053 O  O   . HOH Y 7 .   ? 1.261   -24.559 -12.641 1.00 54.10  ? 1304 HOH A O   1 
HETATM 3054 O  O   . HOH Y 7 .   ? -33.908 -51.360 -12.871 1.00 52.37  ? 1305 HOH A O   1 
HETATM 3055 O  O   . HOH Y 7 .   ? -21.474 -44.599 -1.531  1.00 64.87  ? 1306 HOH A O   1 
HETATM 3056 O  O   . HOH Y 7 .   ? -20.392 -4.845  -19.083 1.00 43.78  ? 1307 HOH A O   1 
HETATM 3057 O  O   . HOH Y 7 .   ? -4.601  -37.447 -14.681 1.00 50.68  ? 1308 HOH A O   1 
HETATM 3058 O  O   . HOH Y 7 .   ? -13.560 -17.194 -1.349  1.00 48.13  ? 1309 HOH A O   1 
HETATM 3059 O  O   . HOH Y 7 .   ? -19.881 19.775  -24.400 1.00 56.31  ? 1310 HOH A O   1 
HETATM 3060 O  O   . HOH Y 7 .   ? -17.372 -13.900 -17.597 1.00 50.18  ? 1311 HOH A O   1 
HETATM 3061 O  O   . HOH Y 7 .   ? -15.609 19.495  -24.650 1.00 53.00  ? 1312 HOH A O   1 
HETATM 3062 O  O   . HOH Y 7 .   ? -17.872 20.168  -20.250 1.00 54.75  ? 1313 HOH A O   1 
HETATM 3063 O  O   . HOH Y 7 .   ? -23.516 -13.513 -8.264  1.00 52.49  ? 1314 HOH A O   1 
HETATM 3064 O  O   . HOH Y 7 .   ? -12.908 20.579  -15.092 1.00 50.29  ? 1315 HOH A O   1 
HETATM 3065 O  O   . HOH Y 7 .   ? -13.560 22.113  -28.562 1.00 54.57  ? 1316 HOH A O   1 
HETATM 3066 O  O   . HOH Y 7 .   ? -14.449 -14.284 -17.042 1.00 52.86  ? 1317 HOH A O   1 
HETATM 3067 O  O   . HOH Y 7 .   ? -9.627  9.854   -22.844 1.00 29.91  ? 1318 HOH A O   1 
HETATM 3068 O  O   . HOH Y 7 .   ? -17.861 -15.925 -15.725 1.00 51.03  ? 1319 HOH A O   1 
HETATM 3069 O  O   . HOH Y 7 .   ? -4.949  24.369  -17.955 1.00 44.18  ? 1320 HOH A O   1 
HETATM 3070 O  O   . HOH Y 7 .   ? -20.717 22.725  -21.784 1.00 56.68  ? 1321 HOH A O   1 
HETATM 3071 O  O   . HOH Y 7 .   ? -33.425 -44.015 -16.091 1.00 58.80  ? 1322 HOH A O   1 
HETATM 3072 O  O   . HOH Y 7 .   ? -19.966 25.335  -15.316 1.00 57.25  ? 1323 HOH A O   1 
HETATM 3073 O  O   . HOH Y 7 .   ? -16.653 12.939  -1.642  1.00 41.29  ? 1324 HOH A O   1 
HETATM 3074 O  O   . HOH Y 7 .   ? -27.144 -21.143 -20.551 1.00 62.52  ? 1325 HOH A O   1 
HETATM 3075 O  O   . HOH Y 7 .   ? -14.979 19.541  -16.261 1.00 37.53  ? 1326 HOH A O   1 
HETATM 3076 O  O   . HOH Y 7 .   ? -25.597 -50.402 -4.700  1.00 57.39  ? 1327 HOH A O   1 
HETATM 3077 O  O   . HOH Y 7 .   ? -13.487 -1.331  -20.882 1.00 39.71  ? 1328 HOH A O   1 
HETATM 3078 O  O   . HOH Y 7 .   ? -5.372  -20.588 -3.464  1.00 55.52  ? 1329 HOH A O   1 
HETATM 3079 O  O   . HOH Y 7 .   ? -21.212 21.485  -8.918  1.00 40.14  ? 1330 HOH A O   1 
HETATM 3080 O  O   . HOH Y 7 .   ? -23.469 24.465  -12.580 1.00 52.28  ? 1331 HOH A O   1 
HETATM 3081 O  O   . HOH Y 7 .   ? -12.438 -49.593 -13.087 1.00 48.04  ? 1332 HOH A O   1 
HETATM 3082 O  O   . HOH Y 7 .   ? -6.902  24.254  -19.905 1.00 50.48  ? 1333 HOH A O   1 
HETATM 3083 O  O   . HOH Y 7 .   ? -11.569 24.847  -4.971  1.00 59.04  ? 1334 HOH A O   1 
HETATM 3084 O  O   . HOH Y 7 .   ? -10.916 -48.959 -10.905 1.00 54.76  ? 1335 HOH A O   1 
HETATM 3085 O  O   . HOH Y 7 .   ? -22.157 24.878  -9.267  1.00 54.13  ? 1336 HOH A O   1 
HETATM 3086 O  O   . HOH Y 7 .   ? -6.013  -42.753 -6.870  1.00 59.94  ? 1337 HOH A O   1 
HETATM 3087 O  O   . HOH Y 7 .   ? -17.682 5.782   -20.452 1.00 41.50  ? 1338 HOH A O   1 
HETATM 3088 O  O   . HOH Y 7 .   ? -22.109 -1.626  -27.265 1.00 46.18  ? 1339 HOH A O   1 
HETATM 3089 O  O   . HOH Y 7 .   ? -20.350 -2.452  -20.233 1.00 44.70  ? 1340 HOH A O   1 
HETATM 3090 O  O   . HOH Y 7 .   ? -30.040 -45.715 -7.330  1.00 57.99  ? 1341 HOH A O   1 
HETATM 3091 O  O   . HOH Y 7 .   ? 0.012   -27.388 -17.429 1.00 51.25  ? 1342 HOH A O   1 
HETATM 3092 O  O   . HOH Y 7 .   ? -16.208 -17.409 -19.044 1.00 57.09  ? 1343 HOH A O   1 
HETATM 3093 O  O   . HOH Y 7 .   ? -20.565 -48.842 -22.231 1.00 47.83  ? 1344 HOH A O   1 
HETATM 3094 O  O   . HOH Y 7 .   ? -28.530 13.867  -20.806 1.00 42.65  ? 1345 HOH A O   1 
HETATM 3095 O  O   . HOH Y 7 .   ? -6.707  -22.152 -13.912 1.00 46.62  ? 1346 HOH A O   1 
HETATM 3096 O  O   . HOH Y 7 .   ? 1.536   -31.146 -11.699 1.00 57.37  ? 1347 HOH A O   1 
HETATM 3097 O  O   . HOH Y 7 .   ? -3.193  25.655  -25.454 1.00 43.89  ? 1348 HOH A O   1 
HETATM 3098 O  O   . HOH Y 7 .   ? -25.159 15.614  -2.543  1.00 41.02  ? 1349 HOH A O   1 
HETATM 3099 O  O   . HOH Y 7 .   ? -4.627  -21.709 -17.869 1.00 50.37  ? 1350 HOH A O   1 
HETATM 3100 O  O   . HOH Y 7 .   ? -21.875 25.851  -13.672 1.00 58.76  ? 1351 HOH A O   1 
HETATM 3101 O  O   . HOH Y 7 .   ? -23.854 -15.543 -4.907  1.00 51.43  ? 1352 HOH A O   1 
HETATM 3102 O  O   . HOH Y 7 .   ? -3.244  -27.676 -15.933 1.00 47.31  ? 1353 HOH A O   1 
HETATM 3103 O  O   . HOH Y 7 .   ? -2.706  -35.266 -14.721 1.00 46.56  ? 1354 HOH A O   1 
HETATM 3104 O  O   . HOH Y 7 .   ? -9.273  -41.381 -18.361 1.00 49.20  ? 1355 HOH A O   1 
HETATM 3105 O  O   . HOH Y 7 .   ? -19.083 9.500   -17.034 1.00 36.83  ? 1356 HOH A O   1 
HETATM 3106 O  O   . HOH Y 7 .   ? -24.900 26.197  -8.974  1.00 63.86  ? 1357 HOH A O   1 
HETATM 3107 O  O   . HOH Y 7 .   ? -17.230 -16.272 -12.113 1.00 51.19  ? 1358 HOH A O   1 
HETATM 3108 O  O   . HOH Y 7 .   ? -15.615 -0.939  -18.403 1.00 48.52  ? 1359 HOH A O   1 
HETATM 3109 O  O   . HOH Y 7 .   ? -13.328 21.874  -24.706 1.00 44.67  ? 1360 HOH A O   1 
HETATM 3110 O  O   . HOH Y 7 .   ? -13.835 -14.951 -14.486 1.00 49.16  ? 1361 HOH A O   1 
HETATM 3111 O  O   . HOH Y 7 .   ? -18.773 -15.447 -19.399 1.00 50.28  ? 1362 HOH A O   1 
HETATM 3112 O  O   . HOH Y 7 .   ? -19.097 -42.710 -1.319  1.00 61.93  ? 1363 HOH A O   1 
HETATM 3113 O  O   . HOH Y 7 .   ? -20.303 4.417   -17.364 1.00 42.41  ? 1364 HOH A O   1 
HETATM 3114 O  O   . HOH Y 7 .   ? -5.469  -22.206 7.133   1.00 56.07  ? 1365 HOH A O   1 
HETATM 3115 O  O   . HOH Y 7 .   ? -9.913  19.902  -15.070 1.00 36.18  ? 1366 HOH A O   1 
HETATM 3116 O  O   . HOH Y 7 .   ? -15.007 -14.325 -4.067  1.00 50.20  ? 1367 HOH A O   1 
HETATM 3117 O  O   . HOH Y 7 .   ? -33.229 -43.814 -13.530 1.00 53.98  ? 1368 HOH A O   1 
HETATM 3118 O  O   . HOH Y 7 .   ? -30.387 26.756  -11.612 1.00 59.89  ? 1369 HOH A O   1 
HETATM 3119 O  O   . HOH Y 7 .   ? -24.666 -42.442 -6.388  1.00 62.81  ? 1370 HOH A O   1 
HETATM 3120 O  O   . HOH Y 7 .   ? -26.126 -20.392 0.781   1.00 61.55  ? 1371 HOH A O   1 
HETATM 3121 O  O   . HOH Y 7 .   ? -10.821 26.016  -7.900  1.00 42.17  ? 1372 HOH A O   1 
HETATM 3122 O  O   . HOH Y 7 .   ? -13.881 -19.656 -3.090  1.00 57.88  ? 1373 HOH A O   1 
HETATM 3123 O  O   . HOH Y 7 .   ? -6.976  25.772  -21.837 1.00 44.12  ? 1374 HOH A O   1 
HETATM 3124 O  O   . HOH Y 7 .   ? -0.663  -28.884 -22.087 1.00 53.02  ? 1375 HOH A O   1 
HETATM 3125 O  O   . HOH Y 7 .   ? -16.500 3.901   -19.319 1.00 41.65  ? 1376 HOH A O   1 
HETATM 3126 O  O   . HOH Y 7 .   ? -0.648  -34.686 -19.634 1.00 43.97  ? 1377 HOH A O   1 
HETATM 3127 O  O   . HOH Y 7 .   ? 0.992   -33.345 -13.266 1.00 52.25  ? 1378 HOH A O   1 
HETATM 3128 O  O   . HOH Y 7 .   ? -35.142 9.302   -17.348 1.00 56.82  ? 1379 HOH A O   1 
HETATM 3129 O  O   . HOH Y 7 .   ? -23.546 -27.947 9.292   1.00 68.56  ? 1380 HOH A O   1 
HETATM 3130 O  O   . HOH Y 7 .   ? -27.876 -41.805 -15.761 1.00 57.09  ? 1381 HOH A O   1 
HETATM 3131 O  O   . HOH Y 7 .   ? -3.467  -19.811 -4.767  1.00 60.90  ? 1382 HOH A O   1 
HETATM 3132 O  O   . HOH Y 7 .   ? -13.247 -17.596 -22.557 1.00 56.27  ? 1383 HOH A O   1 
HETATM 3133 O  O   . HOH Y 7 .   ? -0.904  -37.921 -15.133 1.00 58.06  ? 1384 HOH A O   1 
HETATM 3134 O  O   . HOH Y 7 .   ? -23.867 -12.714 -5.645  1.00 46.81  ? 1385 HOH A O   1 
HETATM 3135 O  O   . HOH Y 7 .   ? -14.382 19.326  -19.244 1.00 44.46  ? 1386 HOH A O   1 
HETATM 3136 O  O   . HOH Y 7 .   ? -16.691 21.605  -27.795 1.00 62.46  ? 1387 HOH A O   1 
HETATM 3137 O  O   . HOH Y 7 .   ? -11.509 23.106  -20.463 1.00 48.90  ? 1388 HOH A O   1 
HETATM 3138 O  O   . HOH Y 7 .   ? -32.139 -45.280 -20.943 1.00 67.00  ? 1389 HOH A O   1 
HETATM 3139 O  O   . HOH Y 7 .   ? -12.328 21.241  -18.798 1.00 45.29  ? 1390 HOH A O   1 
HETATM 3140 O  O   . HOH Y 7 .   ? -10.175 -52.147 -7.660  1.00 70.74  ? 1391 HOH A O   1 
HETATM 3141 O  O   . HOH Y 7 .   ? -0.487  27.423  -12.873 1.00 47.68  ? 1392 HOH A O   1 
HETATM 3142 O  O   . HOH Y 7 .   ? -0.001  -31.898 -21.032 0.50 36.22  ? 1393 HOH A O   1 
HETATM 3143 O  O   . HOH Y 7 .   ? -10.008 -27.870 -23.056 1.00 68.73  ? 1394 HOH A O   1 
HETATM 3144 O  O   . HOH Y 7 .   ? -9.849  21.928  -13.438 1.00 48.90  ? 1395 HOH A O   1 
HETATM 3145 O  O   . HOH Y 7 .   ? -8.657  -43.640 -16.955 1.00 53.85  ? 1396 HOH A O   1 
HETATM 3146 O  O   . HOH Y 7 .   ? -18.627 6.690   -17.902 1.00 40.13  ? 1397 HOH A O   1 
HETATM 3147 O  O   . HOH Y 7 .   ? -12.063 23.493  -22.878 1.00 44.98  ? 1398 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A 38  ? 1.0398 0.9128 0.7143 0.0923  -0.0145 0.2253  34   GLY A N   
2    C CA  . GLY A 38  ? 0.9559 0.8423 0.6528 0.0975  -0.0331 0.2153  34   GLY A CA  
3    C C   . GLY A 38  ? 0.8770 0.7851 0.5651 0.1028  -0.0513 0.2029  34   GLY A C   
4    O O   . GLY A 38  ? 0.8551 0.7817 0.5696 0.0979  -0.0609 0.1879  34   GLY A O   
5    N N   . ALA A 39  ? 0.8982 0.8026 0.5479 0.1128  -0.0562 0.2094  35   ALA A N   
6    C CA  . ALA A 39  ? 0.8901 0.8118 0.5269 0.1183  -0.0752 0.1971  35   ALA A CA  
7    C C   . ALA A 39  ? 0.8878 0.8230 0.5340 0.1062  -0.0712 0.1798  35   ALA A C   
8    O O   . ALA A 39  ? 0.8961 0.8480 0.5538 0.1048  -0.0872 0.1646  35   ALA A O   
9    C CB  . ALA A 39  ? 0.9438 0.8554 0.5318 0.1326  -0.0798 0.2078  35   ALA A CB  
10   N N   . ALA A 40  ? 0.8753 0.8030 0.5185 0.0973  -0.0499 0.1823  36   ALA A N   
11   C CA  . ALA A 40  ? 0.8215 0.7608 0.4730 0.0871  -0.0445 0.1671  36   ALA A CA  
12   C C   . ALA A 40  ? 0.8055 0.7571 0.5004 0.0761  -0.0481 0.1542  36   ALA A C   
13   O O   . ALA A 40  ? 0.8608 0.8255 0.5653 0.0711  -0.0550 0.1387  36   ALA A O   
14   C CB  . ALA A 40  ? 0.8464 0.7773 0.4874 0.0811  -0.0204 0.1746  36   ALA A CB  
15   N N   . ALA A 41  ? 0.8001 0.7457 0.5196 0.0730  -0.0431 0.1608  37   ALA A N   
16   C CA  . ALA A 41  ? 0.7840 0.7403 0.5420 0.0644  -0.0457 0.1499  37   ALA A CA  
17   C C   . ALA A 41  ? 0.7447 0.7170 0.5137 0.0693  -0.0669 0.1412  37   ALA A C   
18   O O   . ALA A 41  ? 0.7191 0.7054 0.5099 0.0621  -0.0724 0.1280  37   ALA A O   
19   C CB  . ALA A 41  ? 0.7798 0.7238 0.5570 0.0624  -0.0366 0.1587  37   ALA A CB  
20   N N   . LEU A 42  ? 0.7544 0.7244 0.5085 0.0816  -0.0791 0.1496  38   LEU A N   
21   C CA  . LEU A 42  ? 0.7512 0.7381 0.5172 0.0869  -0.1007 0.1429  38   LEU A CA  
22   C C   . LEU A 42  ? 0.7353 0.7332 0.4900 0.0842  -0.1126 0.1291  38   LEU A C   
23   O O   . LEU A 42  ? 0.7226 0.7362 0.5022 0.0779  -0.1227 0.1171  38   LEU A O   
24   C CB  . LEU A 42  ? 0.7526 0.7344 0.5024 0.1020  -0.1117 0.1556  38   LEU A CB  
25   C CG  . LEU A 42  ? 0.7562 0.7579 0.5187 0.1086  -0.1361 0.1496  38   LEU A CG  
26   C CD1 . LEU A 42  ? 0.7368 0.7574 0.5451 0.1002  -0.1386 0.1403  38   LEU A CD1 
27   C CD2 . LEU A 42  ? 0.7773 0.7731 0.5277 0.1246  -0.1450 0.1639  38   LEU A CD2 
28   N N   . VAL A 43  ? 0.7742 0.7625 0.4905 0.0892  -0.1108 0.1310  39   VAL A N   
29   C CA  . VAL A 43  ? 0.7571 0.7518 0.4571 0.0886  -0.1222 0.1170  39   VAL A CA  
30   C C   . VAL A 43  ? 0.7582 0.7584 0.4781 0.0753  -0.1140 0.1037  39   VAL A C   
31   O O   . VAL A 43  ? 0.7653 0.7770 0.5022 0.0699  -0.1274 0.0903  39   VAL A O   
32   C CB  . VAL A 43  ? 0.8271 0.8086 0.4781 0.0982  -0.1182 0.1223  39   VAL A CB  
33   C CG1 . VAL A 43  ? 0.8491 0.8340 0.4827 0.0969  -0.1263 0.1058  39   VAL A CG1 
34   C CG2 . VAL A 43  ? 0.8222 0.7991 0.4491 0.1130  -0.1319 0.1333  39   VAL A CG2 
35   N N   . GLY A 44  ? 0.7529 0.7450 0.4725 0.0696  -0.0924 0.1077  40   GLY A N   
36   C CA  . GLY A 44  ? 0.7106 0.7077 0.4492 0.0582  -0.0839 0.0962  40   GLY A CA  
37   C C   . GLY A 44  ? 0.6687 0.6771 0.4477 0.0500  -0.0896 0.0900  40   GLY A C   
38   O O   . GLY A 44  ? 0.6624 0.6780 0.4553 0.0428  -0.0938 0.0775  40   GLY A O   
39   N N   . GLY A 45  ? 0.6266 0.6354 0.4232 0.0519  -0.0891 0.0993  41   GLY A N   
40   C CA  . GLY A 45  ? 0.6239 0.6437 0.4576 0.0459  -0.0919 0.0953  41   GLY A CA  
41   C C   . GLY A 45  ? 0.6051 0.6404 0.4523 0.0456  -0.1117 0.0866  41   GLY A C   
42   O O   . GLY A 45  ? 0.6047 0.6493 0.4754 0.0369  -0.1136 0.0776  41   GLY A O   
43   N N   . VAL A 46  ? 0.6337 0.6715 0.4660 0.0548  -0.1272 0.0898  42   VAL A N   
44   C CA  . VAL A 46  ? 0.6196 0.6731 0.4662 0.0540  -0.1484 0.0816  42   VAL A CA  
45   C C   . VAL A 46  ? 0.6208 0.6736 0.4601 0.0463  -0.1537 0.0671  42   VAL A C   
46   O O   . VAL A 46  ? 0.6288 0.6928 0.4941 0.0379  -0.1620 0.0584  42   VAL A O   
47   C CB  . VAL A 46  ? 0.6650 0.7205 0.4929 0.0666  -0.1657 0.0873  42   VAL A CB  
48   C CG1 . VAL A 46  ? 0.6783 0.7481 0.5150 0.0645  -0.1896 0.0762  42   VAL A CG1 
49   C CG2 . VAL A 46  ? 0.6616 0.7210 0.5056 0.0743  -0.1641 0.1003  42   VAL A CG2 
50   N N   . LEU A 47  ? 0.6580 0.6970 0.4623 0.0495  -0.1476 0.0650  43   LEU A N   
51   C CA  . LEU A 47  ? 0.6174 0.6529 0.4114 0.0444  -0.1514 0.0508  43   LEU A CA  
52   C C   . LEU A 47  ? 0.6314 0.6692 0.4524 0.0327  -0.1396 0.0453  43   LEU A C   
53   O O   . LEU A 47  ? 0.6233 0.6645 0.4570 0.0255  -0.1485 0.0340  43   LEU A O   
54   C CB  . LEU A 47  ? 0.6511 0.6722 0.4022 0.0519  -0.1433 0.0508  43   LEU A CB  
55   C CG  . LEU A 47  ? 0.6961 0.7129 0.4123 0.0642  -0.1584 0.0523  43   LEU A CG  
56   C CD1 . LEU A 47  ? 0.7708 0.7737 0.4437 0.0723  -0.1459 0.0540  43   LEU A CD1 
57   C CD2 . LEU A 47  ? 0.7139 0.7365 0.4330 0.0628  -0.1842 0.0381  43   LEU A CD2 
58   N N   . LEU A 48  ? 0.5625 0.5973 0.3921 0.0308  -0.1205 0.0534  44   LEU A N   
59   C CA  . LEU A 48  ? 0.5541 0.5908 0.4068 0.0211  -0.1095 0.0487  44   LEU A CA  
60   C C   . LEU A 48  ? 0.5552 0.6047 0.4425 0.0144  -0.1185 0.0458  44   LEU A C   
61   O O   . LEU A 48  ? 0.5498 0.6011 0.4495 0.0068  -0.1209 0.0369  44   LEU A O   
62   C CB  . LEU A 48  ? 0.5596 0.5911 0.4164 0.0205  -0.0900 0.0577  44   LEU A CB  
63   C CG  . LEU A 48  ? 0.5415 0.5752 0.4213 0.0115  -0.0797 0.0530  44   LEU A CG  
64   C CD1 . LEU A 48  ? 0.5777 0.6080 0.4472 0.0083  -0.0779 0.0424  44   LEU A CD1 
65   C CD2 . LEU A 48  ? 0.5416 0.5697 0.4266 0.0109  -0.0633 0.0614  44   LEU A CD2 
66   N N   . ILE A 49  ? 0.5197 0.5780 0.4228 0.0179  -0.1228 0.0541  45   ILE A N   
67   C CA  . ILE A 49  ? 0.4954 0.5691 0.4337 0.0126  -0.1291 0.0533  45   ILE A CA  
68   C C   . ILE A 49  ? 0.4956 0.5767 0.4403 0.0075  -0.1479 0.0437  45   ILE A C   
69   O O   . ILE A 49  ? 0.4899 0.5772 0.4580 -0.0018 -0.1491 0.0387  45   ILE A O   
70   C CB  . ILE A 49  ? 0.5051 0.5882 0.4573 0.0201  -0.1310 0.0642  45   ILE A CB  
71   C CG1 . ILE A 49  ? 0.4965 0.5704 0.4488 0.0227  -0.1120 0.0720  45   ILE A CG1 
72   C CG2 . ILE A 49  ? 0.5187 0.6221 0.5075 0.0158  -0.1399 0.0634  45   ILE A CG2 
73   C CD1 . ILE A 49  ? 0.5115 0.5881 0.4705 0.0327  -0.1121 0.0832  45   ILE A CD1 
74   N N   . GLY A 50  ? 0.5379 0.6163 0.4601 0.0135  -0.1626 0.0412  46   GLY A N   
75   C CA  . GLY A 50  ? 0.5264 0.6082 0.4506 0.0089  -0.1825 0.0303  46   GLY A CA  
76   C C   . GLY A 50  ? 0.5493 0.6196 0.4680 0.0007  -0.1792 0.0190  46   GLY A C   
77   O O   . GLY A 50  ? 0.5486 0.6234 0.4890 -0.0089 -0.1882 0.0122  46   GLY A O   
78   N N   . ALA A 51  ? 0.5642 0.6197 0.4550 0.0047  -0.1658 0.0176  47   ALA A N   
79   C CA  . ALA A 51  ? 0.5599 0.6039 0.4427 -0.0004 -0.1624 0.0067  47   ALA A CA  
80   C C   . ALA A 51  ? 0.5420 0.5902 0.4558 -0.0104 -0.1527 0.0072  47   ALA A C   
81   O O   . ALA A 51  ? 0.5594 0.6026 0.4807 -0.0175 -0.1581 -0.0015 47   ALA A O   
82   C CB  . ALA A 51  ? 0.6119 0.6431 0.4614 0.0072  -0.1483 0.0064  47   ALA A CB  
83   N N   . VAL A 52  ? 0.5062 0.5614 0.4358 -0.0103 -0.1386 0.0173  48   VAL A N   
84   C CA  . VAL A 52  ? 0.5068 0.5657 0.4620 -0.0182 -0.1290 0.0183  48   VAL A CA  
85   C C   . VAL A 52  ? 0.5179 0.5885 0.5029 -0.0261 -0.1409 0.0176  48   VAL A C   
86   O O   . VAL A 52  ? 0.4812 0.5490 0.4790 -0.0342 -0.1407 0.0131  48   VAL A O   
87   C CB  . VAL A 52  ? 0.4775 0.5407 0.4424 -0.0156 -0.1128 0.0282  48   VAL A CB  
88   C CG1 . VAL A 52  ? 0.4828 0.5505 0.4726 -0.0227 -0.1049 0.0288  48   VAL A CG1 
89   C CG2 . VAL A 52  ? 0.4783 0.5302 0.4191 -0.0106 -0.0997 0.0292  48   VAL A CG2 
90   N N   . LEU A 53  ? 0.4993 0.5836 0.4964 -0.0237 -0.1512 0.0227  49   LEU A N   
91   C CA  . LEU A 53  ? 0.4627 0.5629 0.4937 -0.0315 -0.1614 0.0238  49   LEU A CA  
92   C C   . LEU A 53  ? 0.4701 0.5634 0.4998 -0.0394 -0.1778 0.0127  49   LEU A C   
93   O O   . LEU A 53  ? 0.4928 0.5881 0.5454 -0.0499 -0.1786 0.0112  49   LEU A O   
94   C CB  . LEU A 53  ? 0.4443 0.5626 0.4890 -0.0256 -0.1704 0.0312  49   LEU A CB  
95   C CG  . LEU A 53  ? 0.4893 0.6155 0.5432 -0.0183 -0.1553 0.0426  49   LEU A CG  
96   C CD1 . LEU A 53  ? 0.5020 0.6434 0.5643 -0.0098 -0.1660 0.0493  49   LEU A CD1 
97   C CD2 . LEU A 53  ? 0.4396 0.5749 0.5226 -0.0245 -0.1423 0.0467  49   LEU A CD2 
98   N N   . ALA A 54  ? 0.5206 0.6036 0.5218 -0.0342 -0.1906 0.0050  50   ALA A N   
99   C CA  . ALA A 54  ? 0.5471 0.6210 0.5447 -0.0408 -0.2087 -0.0073 50   ALA A CA  
100  C C   . ALA A 54  ? 0.5563 0.6121 0.5471 -0.0464 -0.2010 -0.0146 50   ALA A C   
101  O O   . ALA A 54  ? 0.5591 0.6116 0.5684 -0.0572 -0.2096 -0.0196 50   ALA A O   
102  C CB  . ALA A 54  ? 0.5815 0.6465 0.5441 -0.0315 -0.2234 -0.0148 50   ALA A CB  
103  N N   . GLY A 55  ? 0.5574 0.6012 0.5223 -0.0390 -0.1855 -0.0150 51   GLY A N   
104  C CA  . GLY A 55  ? 0.5382 0.5650 0.4935 -0.0414 -0.1784 -0.0222 51   GLY A CA  
105  C C   . GLY A 55  ? 0.5468 0.5778 0.5328 -0.0513 -0.1698 -0.0170 51   GLY A C   
106  O O   . GLY A 55  ? 0.5633 0.5834 0.5564 -0.0588 -0.1754 -0.0230 51   GLY A O   
107  N N   . ASN A 56  ? 0.4870 0.5320 0.4896 -0.0506 -0.1561 -0.0056 52   ASN A N   
108  C CA  . ASN A 56  ? 0.4560 0.5049 0.4836 -0.0581 -0.1462 0.0001  52   ASN A CA  
109  C C   . ASN A 56  ? 0.4629 0.5228 0.5234 -0.0692 -0.1561 0.0032  52   ASN A C   
110  O O   . ASN A 56  ? 0.4775 0.5343 0.5542 -0.0770 -0.1512 0.0055  52   ASN A O   
111  C CB  . ASN A 56  ? 0.4390 0.4982 0.4719 -0.0530 -0.1290 0.0100  52   ASN A CB  
112  C CG  . ASN A 56  ? 0.4644 0.5121 0.4720 -0.0457 -0.1170 0.0073  52   ASN A CG  
113  O OD1 . ASN A 56  ? 0.4943 0.5324 0.4988 -0.0473 -0.1100 0.0044  52   ASN A OD1 
114  N ND2 . ASN A 56  ? 0.4695 0.5178 0.4591 -0.0377 -0.1153 0.0084  52   ASN A ND2 
115  N N   . SER A 57  ? 0.4938 0.5676 0.5659 -0.0699 -0.1698 0.0042  53   SER A N   
116  C CA  A SER A 57  ? 0.4981 0.5845 0.6050 -0.0817 -0.1807 0.0066  53   SER A CA  
117  C CA  B SER A 57  ? 0.5004 0.5867 0.6075 -0.0818 -0.1803 0.0068  53   SER A CA  
118  C C   . SER A 57  ? 0.5372 0.6042 0.6396 -0.0907 -0.1944 -0.0043 53   SER A C   
119  O O   . SER A 57  ? 0.5360 0.6029 0.6637 -0.1027 -0.1956 -0.0019 53   SER A O   
120  C CB  A SER A 57  ? 0.4889 0.5961 0.6098 -0.0796 -0.1944 0.0093  53   SER A CB  
121  C CB  B SER A 57  ? 0.4863 0.5945 0.6094 -0.0800 -0.1935 0.0100  53   SER A CB  
122  O OG  A SER A 57  ? 0.4622 0.5863 0.5906 -0.0712 -0.1814 0.0201  53   SER A OG  
123  O OG  B SER A 57  ? 0.5408 0.6402 0.6406 -0.0761 -0.2121 -0.0003 53   SER A OG  
124  N N   . LEU A 58  ? 0.5920 0.6413 0.6609 -0.0843 -0.2043 -0.0162 54   LEU A N   
125  C CA  . LEU A 58  ? 0.6120 0.6391 0.6716 -0.0906 -0.2190 -0.0290 54   LEU A CA  
126  C C   . LEU A 58  ? 0.5962 0.6054 0.6546 -0.0945 -0.2067 -0.0291 54   LEU A C   
127  O O   . LEU A 58  ? 0.6154 0.6096 0.6826 -0.1043 -0.2162 -0.0345 54   LEU A O   
128  C CB  . LEU A 58  ? 0.6255 0.6369 0.6441 -0.0797 -0.2297 -0.0420 54   LEU A CB  
129  C CG  . LEU A 58  ? 0.6452 0.6654 0.6602 -0.0777 -0.2510 -0.0470 54   LEU A CG  
130  C CD1 . LEU A 58  ? 0.7009 0.7110 0.6705 -0.0620 -0.2516 -0.0536 54   LEU A CD1 
131  C CD2 . LEU A 58  ? 0.6811 0.6913 0.7085 -0.0892 -0.2731 -0.0578 54   LEU A CD2 
132  N N   . VAL A 59  ? 0.5608 0.5707 0.6083 -0.0866 -0.1867 -0.0232 55   VAL A N   
133  C CA  . VAL A 59  ? 0.5784 0.5748 0.6260 -0.0887 -0.1742 -0.0214 55   VAL A CA  
134  C C   . VAL A 59  ? 0.5890 0.5956 0.6723 -0.1007 -0.1692 -0.0100 55   VAL A C   
135  O O   . VAL A 59  ? 0.5874 0.5786 0.6781 -0.1087 -0.1707 -0.0107 55   VAL A O   
136  C CB  . VAL A 59  ? 0.5862 0.5840 0.6152 -0.0773 -0.1552 -0.0179 55   VAL A CB  
137  C CG1 . VAL A 59  ? 0.5837 0.5744 0.6194 -0.0795 -0.1417 -0.0127 55   VAL A CG1 
138  C CG2 . VAL A 59  ? 0.5804 0.5645 0.5741 -0.0664 -0.1574 -0.0290 55   VAL A CG2 
139  N N   . CYS A 60  ? 0.5665 0.5986 0.6717 -0.1012 -0.1628 0.0009  56   CYS A N   
140  C CA  . CYS A 60  ? 0.5772 0.6229 0.7163 -0.1107 -0.1549 0.0132  56   CYS A CA  
141  C C   . CYS A 60  ? 0.5365 0.5808 0.7017 -0.1258 -0.1703 0.0121  56   CYS A C   
142  O O   . CYS A 60  ? 0.5684 0.6063 0.7505 -0.1356 -0.1655 0.0180  56   CYS A O   
143  C CB  . CYS A 60  ? 0.5579 0.6321 0.7147 -0.1063 -0.1463 0.0237  56   CYS A CB  
144  S SG  . CYS A 60  ? 0.5759 0.6510 0.7124 -0.0926 -0.1242 0.0287  56   CYS A SG  
145  N N   . VAL A 61  ? 0.5967 0.6466 0.7650 -0.1278 -0.1893 0.0047  57   VAL A N   
146  C CA  . VAL A 61  ? 0.5952 0.6451 0.7905 -0.1431 -0.2072 0.0021  57   VAL A CA  
147  C C   . VAL A 61  ? 0.6602 0.6755 0.8393 -0.1488 -0.2154 -0.0084 57   VAL A C   
148  O O   . VAL A 61  ? 0.6533 0.6619 0.8574 -0.1638 -0.2219 -0.0063 57   VAL A O   
149  C CB  . VAL A 61  ? 0.6049 0.6689 0.8041 -0.1421 -0.2280 -0.0048 57   VAL A CB  
150  C CG1 . VAL A 61  ? 0.6389 0.7012 0.8617 -0.1552 -0.2433 -0.0094 57   VAL A CG1 
151  C CG2 . VAL A 61  ? 0.5977 0.6957 0.8160 -0.1359 -0.2199 0.0067  57   VAL A CG2 
152  N N   . SER A 62  ? 0.6523 0.6453 0.7908 -0.1367 -0.2144 -0.0191 58   SER A N   
153  C CA  A SER A 62  ? 0.6554 0.6143 0.7758 -0.1393 -0.2222 -0.0303 58   SER A CA  
154  C CA  B SER A 62  ? 0.6465 0.6052 0.7658 -0.1388 -0.2218 -0.0303 58   SER A CA  
155  C C   . SER A 62  ? 0.6720 0.6191 0.8025 -0.1448 -0.2074 -0.0208 58   SER A C   
156  O O   . SER A 62  ? 0.7078 0.6334 0.8470 -0.1557 -0.2157 -0.0233 58   SER A O   
157  C CB  A SER A 62  ? 0.6324 0.5737 0.7077 -0.1232 -0.2227 -0.0434 58   SER A CB  
158  C CB  B SER A 62  ? 0.6264 0.5683 0.7007 -0.1221 -0.2204 -0.0425 58   SER A CB  
159  O OG  A SER A 62  ? 0.6348 0.5790 0.6966 -0.1192 -0.2405 -0.0542 58   SER A OG  
160  O OG  B SER A 62  ? 0.6182 0.5657 0.6806 -0.1118 -0.1986 -0.0350 58   SER A OG  
161  N N   . VAL A 63  ? 0.6446 0.6042 0.7735 -0.1375 -0.1863 -0.0097 59   VAL A N   
162  C CA  . VAL A 63  ? 0.6656 0.6154 0.8022 -0.1416 -0.1721 0.0005  59   VAL A CA  
163  C C   . VAL A 63  ? 0.7018 0.6642 0.8801 -0.1588 -0.1733 0.0127  59   VAL A C   
164  O O   . VAL A 63  ? 0.7074 0.6537 0.8960 -0.1679 -0.1699 0.0189  59   VAL A O   
165  C CB  . VAL A 63  ? 0.6318 0.5932 0.7571 -0.1297 -0.1507 0.0089  59   VAL A CB  
166  C CG1 . VAL A 63  ? 0.6053 0.5573 0.7375 -0.1332 -0.1370 0.0202  59   VAL A CG1 
167  C CG2 . VAL A 63  ? 0.6490 0.5992 0.7375 -0.1143 -0.1490 -0.0024 59   VAL A CG2 
168  N N   . ALA A 64  ? 0.6910 0.6823 0.8942 -0.1632 -0.1787 0.0163  60   ALA A N   
169  C CA  . ALA A 64  ? 0.6693 0.6782 0.9169 -0.1799 -0.1807 0.0277  60   ALA A CA  
170  C C   . ALA A 64  ? 0.7254 0.7157 0.9849 -0.1937 -0.1995 0.0197  60   ALA A C   
171  O O   . ALA A 64  ? 0.7440 0.7307 1.0262 -0.2050 -0.1937 0.0288  60   ALA A O   
172  C CB  . ALA A 64  ? 0.6603 0.7072 0.9307 -0.1780 -0.1816 0.0327  60   ALA A CB  
173  N N   . THR A 65  ? 0.6874 0.6659 0.9253 -0.1884 -0.2173 0.0026  61   THR A N   
174  C CA  . THR A 65  ? 0.7469 0.7098 0.9897 -0.1962 -0.2323 -0.0068 61   THR A CA  
175  C C   . THR A 65  ? 0.7987 0.7203 1.0220 -0.1984 -0.2341 -0.0132 61   THR A C   
176  O O   . THR A 65  ? 0.8326 0.7413 1.0710 -0.2094 -0.2397 -0.0136 61   THR A O   
177  C CB  . THR A 65  ? 0.7710 0.7364 0.9953 -0.1884 -0.2509 -0.0231 61   THR A CB  
178  O OG1 . THR A 65  ? 0.8012 0.7495 0.9831 -0.1737 -0.2524 -0.0339 61   THR A OG1 
179  C CG2 . THR A 65  ? 0.7337 0.7382 0.9802 -0.1869 -0.2517 -0.0168 61   THR A CG2 
180  N N   . GLU A 66  ? 0.7795 0.6804 0.9700 -0.1877 -0.2294 -0.0180 62   GLU A N   
181  C CA  . GLU A 66  ? 0.7648 0.6248 0.9304 -0.1854 -0.2339 -0.0277 62   GLU A CA  
182  C C   . GLU A 66  ? 0.7583 0.6009 0.9246 -0.1880 -0.2191 -0.0158 62   GLU A C   
183  O O   . GLU A 66  ? 0.7508 0.6022 0.9070 -0.1793 -0.2045 -0.0086 62   GLU A O   
184  C CB  . GLU A 66  ? 0.7445 0.5893 0.8673 -0.1688 -0.2414 -0.0452 62   GLU A CB  
185  N N   . ARG A 67  ? 0.7499 0.5683 0.9242 -0.1968 -0.2205 -0.0135 63   ARG A N   
186  C CA  . ARG A 67  ? 0.7435 0.5433 0.9183 -0.1992 -0.2066 -0.0005 63   ARG A CA  
187  C C   . ARG A 67  ? 0.7771 0.5489 0.9131 -0.1842 -0.2054 -0.0092 63   ARG A C   
188  O O   . ARG A 67  ? 0.7860 0.5583 0.9138 -0.1765 -0.1873 0.0022  63   ARG A O   
189  C CB  . ARG A 67  ? 0.7703 0.5483 0.9607 -0.2117 -0.2095 0.0033  63   ARG A CB  
190  N N   . ALA A 68  ? 0.7712 0.5268 0.8788 -0.1735 -0.2188 -0.0291 64   ALA A N   
191  C CA  . ALA A 68  ? 0.8049 0.5399 0.8741 -0.1547 -0.2146 -0.0388 64   ALA A CA  
192  C C   . ALA A 68  ? 0.7847 0.5502 0.8403 -0.1391 -0.1979 -0.0350 64   ALA A C   
193  O O   . ALA A 68  ? 0.7756 0.5321 0.8055 -0.1235 -0.1893 -0.0385 64   ALA A O   
194  C CB  . ALA A 68  ? 0.8209 0.5323 0.8638 -0.1470 -0.2324 -0.0610 64   ALA A CB  
195  N N   . LEU A 69  ? 0.7470 0.5481 0.8207 -0.1431 -0.1940 -0.0282 65   LEU A N   
196  C CA  . LEU A 69  ? 0.6977 0.5256 0.7602 -0.1296 -0.1784 -0.0241 65   LEU A CA  
197  C C   . LEU A 69  ? 0.6920 0.5380 0.7730 -0.1328 -0.1599 -0.0050 65   LEU A C   
198  O O   . LEU A 69  ? 0.6863 0.5524 0.7597 -0.1226 -0.1465 -0.0006 65   LEU A O   
199  C CB  . LEU A 69  ? 0.6639 0.5176 0.7282 -0.1279 -0.1849 -0.0294 65   LEU A CB  
200  C CG  . LEU A 69  ? 0.6949 0.5348 0.7330 -0.1203 -0.2008 -0.0484 65   LEU A CG  
201  C CD1 . LEU A 69  ? 0.6625 0.5283 0.7058 -0.1205 -0.2082 -0.0506 65   LEU A CD1 
202  C CD2 . LEU A 69  ? 0.6951 0.5231 0.6984 -0.1021 -0.1924 -0.0565 65   LEU A CD2 
203  N N   . GLN A 70  ? 0.7254 0.5632 0.8296 -0.1467 -0.1589 0.0064  66   GLN A N   
204  C CA  . GLN A 70  ? 0.7360 0.5900 0.8562 -0.1494 -0.1406 0.0252  66   GLN A CA  
205  C C   . GLN A 70  ? 0.7550 0.5880 0.8535 -0.1395 -0.1299 0.0292  66   GLN A C   
206  O O   . GLN A 70  ? 0.8182 0.6270 0.9206 -0.1464 -0.1298 0.0361  66   GLN A O   
207  C CB  . GLN A 70  ? 0.7476 0.6067 0.9051 -0.1691 -0.1423 0.0379  66   GLN A CB  
208  C CG  . GLN A 70  ? 0.6992 0.5903 0.8829 -0.1767 -0.1487 0.0379  66   GLN A CG  
209  C CD  . GLN A 70  ? 0.7194 0.6141 0.9425 -0.1978 -0.1569 0.0455  66   GLN A CD  
210  O OE1 . GLN A 70  ? 0.7344 0.6088 0.9682 -0.2084 -0.1545 0.0543  66   GLN A OE1 
211  N NE2 . GLN A 70  ? 0.7194 0.6404 0.9657 -0.2041 -0.1672 0.0426  66   GLN A NE2 
212  N N   . THR A 71  ? 0.6922 0.5341 0.7678 -0.1233 -0.1217 0.0248  67   THR A N   
213  C CA  . THR A 71  ? 0.6954 0.5216 0.7484 -0.1109 -0.1131 0.0262  67   THR A CA  
214  C C   . THR A 71  ? 0.6933 0.5451 0.7427 -0.1018 -0.0972 0.0340  67   THR A C   
215  O O   . THR A 71  ? 0.6586 0.5371 0.7174 -0.1024 -0.0944 0.0343  67   THR A O   
216  C CB  . THR A 71  ? 0.7377 0.5461 0.7637 -0.0981 -0.1218 0.0088  67   THR A CB  
217  O OG1 . THR A 71  ? 0.7030 0.5350 0.7205 -0.0892 -0.1198 0.0010  67   THR A OG1 
218  C CG2 . THR A 71  ? 0.7088 0.4921 0.7353 -0.1056 -0.1393 -0.0022 67   THR A CG2 
219  N N   . PRO A 72  ? 0.6506 0.4929 0.6852 -0.0927 -0.0879 0.0397  68   PRO A N   
220  C CA  . PRO A 72  ? 0.6399 0.5036 0.6684 -0.0834 -0.0745 0.0452  68   PRO A CA  
221  C C   . PRO A 72  ? 0.6467 0.5284 0.6658 -0.0741 -0.0754 0.0336  68   PRO A C   
222  O O   . PRO A 72  ? 0.6230 0.5283 0.6485 -0.0731 -0.0677 0.0374  68   PRO A O   
223  C CB  . PRO A 72  ? 0.6705 0.5147 0.6797 -0.0735 -0.0701 0.0486  68   PRO A CB  
224  C CG  . PRO A 72  ? 0.7104 0.5268 0.7250 -0.0826 -0.0755 0.0542  68   PRO A CG  
225  C CD  . PRO A 72  ? 0.7032 0.5138 0.7275 -0.0914 -0.0896 0.0430  68   PRO A CD  
226  N N   . THR A 73  ? 0.6028 0.4726 0.6064 -0.0669 -0.0837 0.0200  69   THR A N   
227  C CA  . THR A 73  ? 0.6094 0.4952 0.6045 -0.0590 -0.0839 0.0099  69   THR A CA  
228  C C   . THR A 73  ? 0.5757 0.4804 0.5854 -0.0669 -0.0866 0.0100  69   THR A C   
229  O O   . THR A 73  ? 0.5603 0.4853 0.5702 -0.0630 -0.0809 0.0100  69   THR A O   
230  C CB  . THR A 73  ? 0.6607 0.5308 0.6385 -0.0508 -0.0924 -0.0045 69   THR A CB  
231  O OG1 . THR A 73  ? 0.6869 0.5423 0.6517 -0.0411 -0.0899 -0.0050 69   THR A OG1 
232  C CG2 . THR A 73  ? 0.5783 0.4665 0.5487 -0.0440 -0.0912 -0.0131 69   THR A CG2 
233  N N   . ASN A 74  ? 0.5834 0.4811 0.6060 -0.0780 -0.0960 0.0104  70   ASN A N   
234  C CA  . ASN A 74  ? 0.5823 0.4975 0.6175 -0.0840 -0.1015 0.0087  70   ASN A CA  
235  C C   . ASN A 74  ? 0.5382 0.4775 0.5946 -0.0893 -0.0923 0.0216  70   ASN A C   
236  O O   . ASN A 74  ? 0.5427 0.5002 0.6084 -0.0910 -0.0948 0.0211  70   ASN A O   
237  C CB  . ASN A 74  ? 0.5699 0.4702 0.6119 -0.0937 -0.1174 0.0025  70   ASN A CB  
238  C CG  . ASN A 74  ? 0.6080 0.4910 0.6257 -0.0854 -0.1274 -0.0136 70   ASN A CG  
239  O OD1 . ASN A 74  ? 0.6168 0.5027 0.6155 -0.0729 -0.1213 -0.0189 70   ASN A OD1 
240  N ND2 . ASN A 74  ? 0.5875 0.4523 0.6060 -0.0921 -0.1425 -0.0215 70   ASN A ND2 
241  N N   . SER A 75  ? 0.5373 0.4766 0.5994 -0.0903 -0.0813 0.0331  71   SER A N   
242  C CA  A SER A 75  ? 0.5211 0.4837 0.5988 -0.0916 -0.0699 0.0444  71   SER A CA  
243  C CA  B SER A 75  ? 0.5212 0.4838 0.5988 -0.0916 -0.0699 0.0444  71   SER A CA  
244  C C   . SER A 75  ? 0.5095 0.4870 0.5754 -0.0807 -0.0643 0.0399  71   SER A C   
245  O O   . SER A 75  ? 0.4816 0.4791 0.5593 -0.0811 -0.0615 0.0432  71   SER A O   
246  C CB  A SER A 75  ? 0.5249 0.4824 0.6038 -0.0918 -0.0579 0.0569  71   SER A CB  
247  C CB  B SER A 75  ? 0.5275 0.4855 0.6064 -0.0917 -0.0577 0.0570  71   SER A CB  
248  O OG  A SER A 75  ? 0.5400 0.4872 0.5946 -0.0800 -0.0527 0.0535  71   SER A OG  
249  O OG  B SER A 75  ? 0.5285 0.4717 0.6198 -0.1028 -0.0613 0.0634  71   SER A OG  
250  N N   . PHE A 76  ? 0.4579 0.4254 0.5017 -0.0710 -0.0628 0.0327  72   PHE A N   
251  C CA  . PHE A 76  ? 0.4337 0.4135 0.4676 -0.0621 -0.0578 0.0283  72   PHE A CA  
252  C C   . PHE A 76  ? 0.4272 0.4137 0.4601 -0.0621 -0.0656 0.0207  72   PHE A C   
253  O O   . PHE A 76  ? 0.4250 0.4255 0.4581 -0.0584 -0.0616 0.0211  72   PHE A O   
254  C CB  . PHE A 76  ? 0.4517 0.4212 0.4660 -0.0526 -0.0553 0.0224  72   PHE A CB  
255  C CG  . PHE A 76  ? 0.4578 0.4204 0.4684 -0.0502 -0.0483 0.0296  72   PHE A CG  
256  C CD1 . PHE A 76  ? 0.4968 0.4706 0.5073 -0.0461 -0.0383 0.0355  72   PHE A CD1 
257  C CD2 . PHE A 76  ? 0.4827 0.4258 0.4884 -0.0512 -0.0519 0.0307  72   PHE A CD2 
258  C CE1 . PHE A 76  ? 0.4884 0.4552 0.4919 -0.0426 -0.0321 0.0423  72   PHE A CE1 
259  C CE2 . PHE A 76  ? 0.4919 0.4275 0.4916 -0.0480 -0.0454 0.0386  72   PHE A CE2 
260  C CZ  . PHE A 76  ? 0.5091 0.4571 0.5069 -0.0435 -0.0355 0.0445  72   PHE A CZ  
261  N N   . ILE A 77  ? 0.4709 0.4451 0.5003 -0.0655 -0.0769 0.0137  73   ILE A N   
262  C CA  . ILE A 77  ? 0.4645 0.4430 0.4887 -0.0644 -0.0852 0.0062  73   ILE A CA  
263  C C   . ILE A 77  ? 0.4933 0.4890 0.5369 -0.0706 -0.0880 0.0124  73   ILE A C   
264  O O   . ILE A 77  ? 0.4682 0.4752 0.5087 -0.0669 -0.0891 0.0109  73   ILE A O   
265  C CB  . ILE A 77  ? 0.5132 0.4727 0.5272 -0.0658 -0.0976 -0.0038 73   ILE A CB  
266  C CG1 . ILE A 77  ? 0.5379 0.4839 0.5312 -0.0561 -0.0942 -0.0111 73   ILE A CG1 
267  C CG2 . ILE A 77  ? 0.4718 0.4359 0.4803 -0.0654 -0.1078 -0.0106 73   ILE A CG2 
268  C CD1 . ILE A 77  ? 0.6349 0.5622 0.6134 -0.0538 -0.1055 -0.0230 73   ILE A CD1 
269  N N   . VAL A 78  ? 0.4534 0.4519 0.5179 -0.0798 -0.0886 0.0203  74   VAL A N   
270  C CA  . VAL A 78  ? 0.4527 0.4717 0.5402 -0.0849 -0.0896 0.0275  74   VAL A CA  
271  C C   . VAL A 78  ? 0.4342 0.4701 0.5228 -0.0773 -0.0765 0.0338  74   VAL A C   
272  O O   . VAL A 78  ? 0.4304 0.4808 0.5248 -0.0750 -0.0785 0.0347  74   VAL A O   
273  C CB  . VAL A 78  ? 0.4419 0.4634 0.5551 -0.0965 -0.0900 0.0364  74   VAL A CB  
274  C CG1 . VAL A 78  ? 0.4711 0.5195 0.6110 -0.0995 -0.0872 0.0456  74   VAL A CG1 
275  C CG2 . VAL A 78  ? 0.4507 0.4561 0.5670 -0.1058 -0.1062 0.0295  74   VAL A CG2 
276  N N   . SER A 79  ? 0.4018 0.4342 0.4840 -0.0731 -0.0643 0.0379  75   SER A N   
277  C CA  . SER A 79  ? 0.4164 0.4599 0.4957 -0.0651 -0.0526 0.0417  75   SER A CA  
278  C C   . SER A 79  ? 0.4215 0.4666 0.4865 -0.0580 -0.0544 0.0349  75   SER A C   
279  O O   . SER A 79  ? 0.4020 0.4594 0.4720 -0.0541 -0.0507 0.0382  75   SER A O   
280  C CB  . SER A 79  ? 0.4460 0.4805 0.5139 -0.0607 -0.0424 0.0437  75   SER A CB  
281  O OG  . SER A 79  ? 0.4332 0.4758 0.4963 -0.0529 -0.0326 0.0455  75   SER A OG  
282  N N   . LEU A 80  ? 0.4219 0.4542 0.4691 -0.0559 -0.0593 0.0261  76   LEU A N   
283  C CA  . LEU A 80  ? 0.3977 0.4308 0.4310 -0.0501 -0.0603 0.0206  76   LEU A CA  
284  C C   . LEU A 80  ? 0.4087 0.4499 0.4468 -0.0514 -0.0689 0.0209  76   LEU A C   
285  O O   . LEU A 80  ? 0.4203 0.4674 0.4533 -0.0465 -0.0668 0.0219  76   LEU A O   
286  C CB  . LEU A 80  ? 0.4188 0.4383 0.4338 -0.0473 -0.0636 0.0115  76   LEU A CB  
287  C CG  . LEU A 80  ? 0.4720 0.4857 0.4789 -0.0429 -0.0556 0.0098  76   LEU A CG  
288  C CD1 . LEU A 80  ? 0.5211 0.5219 0.5144 -0.0403 -0.0601 0.0012  76   LEU A CD1 
289  C CD2 . LEU A 80  ? 0.4427 0.4640 0.4454 -0.0378 -0.0478 0.0102  76   LEU A CD2 
290  N N   . ALA A 81  ? 0.4078 0.4477 0.4550 -0.0580 -0.0796 0.0198  77   ALA A N   
291  C CA  . ALA A 81  ? 0.4168 0.4649 0.4693 -0.0594 -0.0906 0.0193  77   ALA A CA  
292  C C   . ALA A 81  ? 0.4215 0.4887 0.4933 -0.0583 -0.0859 0.0288  77   ALA A C   
293  O O   . ALA A 81  ? 0.4085 0.4835 0.4782 -0.0538 -0.0897 0.0298  77   ALA A O   
294  C CB  . ALA A 81  ? 0.4270 0.4694 0.4885 -0.0683 -0.1047 0.0154  77   ALA A CB  
295  N N   . ALA A 82  ? 0.3860 0.4597 0.4748 -0.0612 -0.0771 0.0359  78   ALA A N   
296  C CA  . ALA A 82  ? 0.4001 0.4922 0.5077 -0.0586 -0.0704 0.0449  78   ALA A CA  
297  C C   . ALA A 82  ? 0.4460 0.5380 0.5399 -0.0485 -0.0623 0.0452  78   ALA A C   
298  O O   . ALA A 82  ? 0.4248 0.5281 0.5260 -0.0439 -0.0631 0.0492  78   ALA A O   
299  C CB  . ALA A 82  ? 0.3822 0.4787 0.5048 -0.0620 -0.0599 0.0521  78   ALA A CB  
300  N N   . ALA A 83  ? 0.3909 0.4698 0.4663 -0.0453 -0.0550 0.0412  79   ALA A N   
301  C CA  . ALA A 83  ? 0.4070 0.4828 0.4697 -0.0376 -0.0477 0.0407  79   ALA A CA  
302  C C   . ALA A 83  ? 0.4318 0.5071 0.4849 -0.0345 -0.0546 0.0391  79   ALA A C   
303  O O   . ALA A 83  ? 0.4346 0.5130 0.4869 -0.0287 -0.0511 0.0428  79   ALA A O   
304  C CB  . ALA A 83  ? 0.4113 0.4741 0.4579 -0.0365 -0.0417 0.0353  79   ALA A CB  
305  N N   . ASP A 84  ? 0.4157 0.4857 0.4599 -0.0377 -0.0646 0.0337  80   ASP A N   
306  C CA  . ASP A 84  ? 0.4139 0.4826 0.4449 -0.0337 -0.0711 0.0325  80   ASP A CA  
307  C C   . ASP A 84  ? 0.4231 0.5050 0.4679 -0.0328 -0.0802 0.0375  80   ASP A C   
308  O O   . ASP A 84  ? 0.4198 0.5035 0.4574 -0.0265 -0.0815 0.0409  80   ASP A O   
309  C CB  . ASP A 84  ? 0.4383 0.4961 0.4517 -0.0354 -0.0781 0.0240  80   ASP A CB  
310  C CG  . ASP A 84  ? 0.5384 0.5858 0.5367 -0.0333 -0.0683 0.0197  80   ASP A CG  
311  O OD1 . ASP A 84  ? 0.5135 0.5615 0.5109 -0.0302 -0.0582 0.0232  80   ASP A OD1 
312  O OD2 . ASP A 84  ? 0.5712 0.6100 0.5598 -0.0345 -0.0713 0.0127  80   ASP A OD2 
313  N N   . LEU A 85  ? 0.4064 0.4981 0.4725 -0.0389 -0.0862 0.0389  81   LEU A N   
314  C CA  . LEU A 85  ? 0.3938 0.5024 0.4791 -0.0382 -0.0948 0.0440  81   LEU A CA  
315  C C   . LEU A 85  ? 0.3928 0.5111 0.4879 -0.0307 -0.0847 0.0521  81   LEU A C   
316  O O   . LEU A 85  ? 0.4103 0.5359 0.5068 -0.0243 -0.0897 0.0559  81   LEU A O   
317  C CB  . LEU A 85  ? 0.4084 0.5275 0.5198 -0.0480 -0.1015 0.0448  81   LEU A CB  
318  C CG  . LEU A 85  ? 0.4028 0.5125 0.5077 -0.0555 -0.1165 0.0362  81   LEU A CG  
319  C CD1 . LEU A 85  ? 0.4363 0.5550 0.5709 -0.0670 -0.1216 0.0384  81   LEU A CD1 
320  C CD2 . LEU A 85  ? 0.4200 0.5313 0.5135 -0.0513 -0.1321 0.0325  81   LEU A CD2 
321  N N   . LEU A 86  ? 0.3599 0.4773 0.4605 -0.0305 -0.0711 0.0545  82   LEU A N   
322  C CA  . LEU A 86  ? 0.3887 0.5123 0.4962 -0.0222 -0.0608 0.0607  82   LEU A CA  
323  C C   . LEU A 86  ? 0.4070 0.5183 0.4934 -0.0144 -0.0585 0.0603  82   LEU A C   
324  O O   . LEU A 86  ? 0.4139 0.5298 0.5046 -0.0063 -0.0565 0.0655  82   LEU A O   
325  C CB  . LEU A 86  ? 0.3550 0.4762 0.4658 -0.0229 -0.0473 0.0615  82   LEU A CB  
326  C CG  . LEU A 86  ? 0.3872 0.5240 0.5233 -0.0286 -0.0461 0.0662  82   LEU A CG  
327  C CD1 . LEU A 86  ? 0.3813 0.5123 0.5142 -0.0291 -0.0330 0.0669  82   LEU A CD1 
328  C CD2 . LEU A 86  ? 0.3763 0.5353 0.5369 -0.0233 -0.0465 0.0738  82   LEU A CD2 
329  N N   . LEU A 87  ? 0.3751 0.4707 0.4394 -0.0166 -0.0583 0.0546  83   LEU A N   
330  C CA  . LEU A 87  ? 0.4020 0.4859 0.4472 -0.0109 -0.0553 0.0554  83   LEU A CA  
331  C C   . LEU A 87  ? 0.4086 0.4967 0.4498 -0.0061 -0.0656 0.0593  83   LEU A C   
332  O O   . LEU A 87  ? 0.4134 0.4989 0.4513 0.0015  -0.0630 0.0651  83   LEU A O   
333  C CB  . LEU A 87  ? 0.3993 0.4694 0.4248 -0.0147 -0.0524 0.0490  83   LEU A CB  
334  C CG  . LEU A 87  ? 0.4214 0.4797 0.4292 -0.0107 -0.0469 0.0508  83   LEU A CG  
335  C CD1 . LEU A 87  ? 0.4235 0.4753 0.4349 -0.0083 -0.0357 0.0526  83   LEU A CD1 
336  C CD2 . LEU A 87  ? 0.4551 0.5053 0.4456 -0.0140 -0.0462 0.0450  83   LEU A CD2 
337  N N   . ALA A 88  ? 0.4206 0.5136 0.4609 -0.0099 -0.0781 0.0560  84   ALA A N   
338  C CA  . ALA A 88  ? 0.4274 0.5248 0.4619 -0.0050 -0.0906 0.0586  84   ALA A CA  
339  C C   . ALA A 88  ? 0.4143 0.5283 0.4710 0.0008  -0.0945 0.0660  84   ALA A C   
340  O O   . ALA A 88  ? 0.4353 0.5501 0.4848 0.0090  -0.1006 0.0709  84   ALA A O   
341  C CB  . ALA A 88  ? 0.4228 0.5218 0.4530 -0.0107 -0.1049 0.0515  84   ALA A CB  
342  N N   . LEU A 89  ? 0.3991 0.5268 0.4824 -0.0025 -0.0906 0.0674  85   LEU A N   
343  C CA  . LEU A 89  ? 0.4260 0.5731 0.5344 0.0036  -0.0929 0.0744  85   LEU A CA  
344  C C   . LEU A 89  ? 0.4526 0.5953 0.5608 0.0140  -0.0799 0.0802  85   LEU A C   
345  O O   . LEU A 89  ? 0.4454 0.5965 0.5616 0.0238  -0.0832 0.0864  85   LEU A O   
346  C CB  . LEU A 89  ? 0.4227 0.5886 0.5619 -0.0043 -0.0932 0.0746  85   LEU A CB  
347  C CG  . LEU A 89  ? 0.4067 0.5790 0.5542 -0.0153 -0.1081 0.0694  85   LEU A CG  
348  C CD1 . LEU A 89  ? 0.3885 0.5774 0.5679 -0.0239 -0.1042 0.0718  85   LEU A CD1 
349  C CD2 . LEU A 89  ? 0.4029 0.5860 0.5537 -0.0116 -0.1264 0.0701  85   LEU A CD2 
350  N N   . LEU A 90  ? 0.4198 0.5489 0.5190 0.0123  -0.0661 0.0777  86   LEU A N   
351  C CA  . LEU A 90  ? 0.4311 0.5553 0.5322 0.0211  -0.0538 0.0812  86   LEU A CA  
352  C C   . LEU A 90  ? 0.4554 0.5558 0.5317 0.0254  -0.0483 0.0811  86   LEU A C   
353  O O   . LEU A 90  ? 0.4776 0.5712 0.5537 0.0345  -0.0421 0.0847  86   LEU A O   
354  C CB  . LEU A 90  ? 0.3936 0.5198 0.5036 0.0174  -0.0423 0.0784  86   LEU A CB  
355  C CG  . LEU A 90  ? 0.3945 0.5441 0.5319 0.0130  -0.0432 0.0807  86   LEU A CG  
356  C CD1 . LEU A 90  ? 0.4140 0.5619 0.5539 0.0118  -0.0296 0.0794  86   LEU A CD1 
357  C CD2 . LEU A 90  ? 0.4240 0.5951 0.5849 0.0216  -0.0470 0.0878  86   LEU A CD2 
358  N N   . VAL A 91  ? 0.4305 0.5177 0.4868 0.0190  -0.0501 0.0771  87   VAL A N   
359  C CA  . VAL A 91  ? 0.4422 0.5080 0.4783 0.0206  -0.0430 0.0775  87   VAL A CA  
360  C C   . VAL A 91  ? 0.4793 0.5373 0.4967 0.0228  -0.0494 0.0816  87   VAL A C   
361  O O   . VAL A 91  ? 0.4833 0.5286 0.4911 0.0296  -0.0464 0.0879  87   VAL A O   
362  C CB  . VAL A 91  ? 0.4486 0.5051 0.4768 0.0118  -0.0358 0.0701  87   VAL A CB  
363  C CG1 . VAL A 91  ? 0.4723 0.5093 0.4828 0.0113  -0.0294 0.0706  87   VAL A CG1 
364  C CG2 . VAL A 91  ? 0.4398 0.5000 0.4809 0.0117  -0.0283 0.0669  87   VAL A CG2 
365  N N   . LEU A 92  ? 0.4434 0.5065 0.4533 0.0177  -0.0579 0.0781  88   LEU A N   
366  C CA  . LEU A 92  ? 0.4831 0.5381 0.4703 0.0204  -0.0631 0.0813  88   LEU A CA  
367  C C   . LEU A 92  ? 0.4800 0.5363 0.4642 0.0312  -0.0705 0.0904  88   LEU A C   
368  O O   . LEU A 92  ? 0.5227 0.5651 0.4858 0.0358  -0.0687 0.0966  88   LEU A O   
369  C CB  . LEU A 92  ? 0.4694 0.5304 0.4492 0.0148  -0.0728 0.0744  88   LEU A CB  
370  C CG  . LEU A 92  ? 0.4617 0.5183 0.4389 0.0059  -0.0661 0.0659  88   LEU A CG  
371  C CD1 . LEU A 92  ? 0.4653 0.5229 0.4296 0.0027  -0.0756 0.0591  88   LEU A CD1 
372  C CD2 . LEU A 92  ? 0.4782 0.5202 0.4434 0.0051  -0.0525 0.0674  88   LEU A CD2 
373  N N   . PRO A 93  ? 0.5067 0.5803 0.5121 0.0357  -0.0789 0.0922  89   PRO A N   
374  C CA  . PRO A 93  ? 0.4926 0.5672 0.4939 0.0475  -0.0869 0.1011  89   PRO A CA  
375  C C   . PRO A 93  ? 0.5240 0.5797 0.5164 0.0556  -0.0763 0.1093  89   PRO A C   
376  O O   . PRO A 93  ? 0.5274 0.5697 0.4984 0.0620  -0.0781 0.1168  89   PRO A O   
377  C CB  . PRO A 93  ? 0.4731 0.5727 0.5055 0.0504  -0.0952 0.1012  89   PRO A CB  
378  C CG  . PRO A 93  ? 0.4493 0.5605 0.4937 0.0381  -0.0980 0.0923  89   PRO A CG  
379  C CD  . PRO A 93  ? 0.4399 0.5341 0.4717 0.0305  -0.0838 0.0873  89   PRO A CD  
380  N N   . LEU A 94  ? 0.5203 0.5730 0.5272 0.0556  -0.0654 0.1078  90   LEU A N   
381  C CA  . LEU A 94  ? 0.5332 0.5650 0.5327 0.0625  -0.0560 0.1138  90   LEU A CA  
382  C C   . LEU A 94  ? 0.5334 0.5426 0.5108 0.0551  -0.0471 0.1139  90   LEU A C   
383  O O   . LEU A 94  ? 0.5649 0.5536 0.5295 0.0597  -0.0421 0.1214  90   LEU A O   
384  C CB  . LEU A 94  ? 0.5494 0.5837 0.5686 0.0651  -0.0477 0.1104  90   LEU A CB  
385  C CG  . LEU A 94  ? 0.5450 0.5976 0.5846 0.0775  -0.0539 0.1149  90   LEU A CG  
386  C CD1 . LEU A 94  ? 0.5967 0.6547 0.6550 0.0811  -0.0445 0.1111  90   LEU A CD1 
387  C CD2 . LEU A 94  ? 0.5295 0.5686 0.5578 0.0907  -0.0576 0.1251  90   LEU A CD2 
388  N N   . PHE A 95  ? 0.5521 0.5652 0.5261 0.0438  -0.0451 0.1061  91   PHE A N   
389  C CA  . PHE A 95  ? 0.5380 0.5346 0.4931 0.0372  -0.0371 0.1068  91   PHE A CA  
390  C C   . PHE A 95  ? 0.5676 0.5576 0.4995 0.0420  -0.0416 0.1155  91   PHE A C   
391  O O   . PHE A 95  ? 0.5838 0.5549 0.5010 0.0430  -0.0340 0.1236  91   PHE A O   
392  C CB  . PHE A 95  ? 0.5556 0.5596 0.5120 0.0260  -0.0348 0.0966  91   PHE A CB  
393  C CG  . PHE A 95  ? 0.5367 0.5301 0.4746 0.0205  -0.0282 0.0977  91   PHE A CG  
394  C CD1 . PHE A 95  ? 0.5658 0.5428 0.5016 0.0169  -0.0168 0.1006  91   PHE A CD1 
395  C CD2 . PHE A 95  ? 0.5417 0.5416 0.4650 0.0191  -0.0331 0.0955  91   PHE A CD2 
396  C CE1 . PHE A 95  ? 0.5866 0.5569 0.5089 0.0112  -0.0093 0.1027  91   PHE A CE1 
397  C CE2 . PHE A 95  ? 0.5499 0.5422 0.4566 0.0152  -0.0252 0.0969  91   PHE A CE2 
398  C CZ  . PHE A 95  ? 0.5819 0.5608 0.4895 0.0110  -0.0126 0.1012  91   PHE A CZ  
399  N N   . VAL A 96  ? 0.5570 0.5617 0.4850 0.0449  -0.0542 0.1142  92   VAL A N   
400  C CA  . VAL A 96  ? 0.5789 0.5781 0.4814 0.0514  -0.0604 0.1218  92   VAL A CA  
401  C C   . VAL A 96  ? 0.6505 0.6378 0.5472 0.0633  -0.0613 0.1347  92   VAL A C   
402  O O   . VAL A 96  ? 0.6529 0.6231 0.5259 0.0669  -0.0567 0.1446  92   VAL A O   
403  C CB  . VAL A 96  ? 0.6001 0.6175 0.5011 0.0530  -0.0769 0.1161  92   VAL A CB  
404  C CG1 . VAL A 96  ? 0.6148 0.6264 0.4874 0.0628  -0.0856 0.1243  92   VAL A CG1 
405  C CG2 . VAL A 96  ? 0.5789 0.6019 0.4787 0.0424  -0.0756 0.1045  92   VAL A CG2 
406  N N   . TYR A 97  ? 0.6405 0.6365 0.5589 0.0699  -0.0664 0.1351  93   TYR A N   
407  C CA  . TYR A 97  ? 0.6669 0.6513 0.5828 0.0828  -0.0673 0.1466  93   TYR A CA  
408  C C   . TYR A 97  ? 0.6573 0.6132 0.5627 0.0808  -0.0523 0.1531  93   TYR A C   
409  O O   . TYR A 97  ? 0.6965 0.6337 0.5832 0.0883  -0.0510 0.1654  93   TYR A O   
410  C CB  . TYR A 97  ? 0.6721 0.6720 0.6172 0.0897  -0.0719 0.1442  93   TYR A CB  
411  C CG  . TYR A 97  ? 0.6956 0.6830 0.6393 0.1048  -0.0727 0.1552  93   TYR A CG  
412  C CD1 . TYR A 97  ? 0.6916 0.6837 0.6256 0.1172  -0.0859 0.1640  93   TYR A CD1 
413  C CD2 . TYR A 97  ? 0.7233 0.6927 0.6741 0.1075  -0.0613 0.1565  93   TYR A CD2 
414  C CE1 . TYR A 97  ? 0.7522 0.7318 0.6843 0.1324  -0.0871 0.1747  93   TYR A CE1 
415  C CE2 . TYR A 97  ? 0.7353 0.6904 0.6839 0.1223  -0.0622 0.1663  93   TYR A CE2 
416  C CZ  . TYR A 97  ? 0.7823 0.7426 0.7219 0.1350  -0.0748 0.1759  93   TYR A CZ  
417  O OH  . TYR A 97  ? 0.8858 0.8310 0.8231 0.1514  -0.0761 0.1863  93   TYR A OH  
418  N N   . SER A 98  ? 0.6662 0.6185 0.5841 0.0704  -0.0417 0.1450  94   SER A N   
419  C CA  . SER A 98  ? 0.7131 0.6397 0.6254 0.0656  -0.0285 0.1487  94   SER A CA  
420  C C   . SER A 98  ? 0.7067 0.6202 0.5941 0.0609  -0.0228 0.1569  94   SER A C   
421  O O   . SER A 98  ? 0.7523 0.6425 0.6274 0.0640  -0.0167 0.1687  94   SER A O   
422  C CB  . SER A 98  ? 0.7305 0.6599 0.6595 0.0543  -0.0208 0.1363  94   SER A CB  
423  O OG  . SER A 98  ? 0.8066 0.7115 0.7355 0.0509  -0.0106 0.1385  94   SER A OG  
424  N N   . GLU A 99  ? 0.7454 0.6733 0.6252 0.0542  -0.0243 0.1512  95   GLU A N   
425  C CA  . GLU A 99  ? 0.7347 0.6544 0.5905 0.0503  -0.0175 0.1579  95   GLU A CA  
426  C C   . GLU A 99  ? 0.7667 0.6767 0.5966 0.0624  -0.0225 0.1724  95   GLU A C   
427  O O   . GLU A 99  ? 0.7781 0.6708 0.5884 0.0617  -0.0128 0.1841  95   GLU A O   
428  C CB  . GLU A 99  ? 0.7012 0.6399 0.5542 0.0436  -0.0200 0.1469  95   GLU A CB  
429  C CG  . GLU A 99  ? 0.7020 0.6468 0.5753 0.0314  -0.0127 0.1349  95   GLU A CG  
430  C CD  . GLU A 99  ? 0.7540 0.6839 0.6256 0.0226  0.0026  0.1394  95   GLU A CD  
431  O OE1 . GLU A 99  ? 0.7631 0.6934 0.6187 0.0195  0.0093  0.1428  95   GLU A OE1 
432  O OE2 . GLU A 99  ? 0.7751 0.6926 0.6611 0.0193  0.0080  0.1399  95   GLU A OE2 
433  N N   . VAL A 100 ? 0.7437 0.6656 0.5742 0.0735  -0.0378 0.1722  96   VAL A N   
434  C CA  . VAL A 100 ? 0.7691 0.6823 0.5756 0.0871  -0.0451 0.1858  96   VAL A CA  
435  C C   . VAL A 100 ? 0.8160 0.7031 0.6216 0.0931  -0.0378 0.1993  96   VAL A C   
436  O O   . VAL A 100 ? 0.8671 0.7359 0.6474 0.0998  -0.0349 0.2142  96   VAL A O   
437  C CB  . VAL A 100 ? 0.7532 0.6875 0.5660 0.0976  -0.0652 0.1815  96   VAL A CB  
438  C CG1 . VAL A 100 ? 0.8068 0.7315 0.5958 0.1137  -0.0743 0.1960  96   VAL A CG1 
439  C CG2 . VAL A 100 ? 0.7203 0.6757 0.5308 0.0914  -0.0736 0.1687  96   VAL A CG2 
440  N N   . GLN A 101 ? 0.8224 0.7061 0.6542 0.0909  -0.0342 0.1940  97   GLN A N   
441  C CA  . GLN A 101 ? 0.8269 0.6828 0.6595 0.0961  -0.0274 0.2045  97   GLN A CA  
442  C C   . GLN A 101 ? 0.8026 0.6363 0.6324 0.0822  -0.0104 0.2074  97   GLN A C   
443  O O   . GLN A 101 ? 0.8135 0.6238 0.6512 0.0816  -0.0037 0.2109  97   GLN A O   
444  C CB  . GLN A 101 ? 0.9168 0.7779 0.7768 0.1019  -0.0315 0.1966  97   GLN A CB  
445  N N   . GLY A 102 ? 0.8429 0.6846 0.6629 0.0713  -0.0040 0.2052  98   GLY A N   
446  C CA  . GLY A 102 ? 0.8905 0.7162 0.7094 0.0576  0.0120  0.2091  98   GLY A CA  
447  C C   . GLY A 102 ? 0.8976 0.7218 0.7439 0.0456  0.0178  0.1965  98   GLY A C   
448  O O   . GLY A 102 ? 0.9023 0.7063 0.7532 0.0362  0.0288  0.2010  98   GLY A O   
449  N N   . GLY A 103 ? 0.8765 0.7218 0.7409 0.0457  0.0100  0.1811  99   GLY A N   
450  C CA  . GLY A 103 ? 0.8350 0.6803 0.7224 0.0363  0.0140  0.1683  99   GLY A CA  
451  C C   . GLY A 103 ? 0.8325 0.6631 0.7318 0.0442  0.0110  0.1664  99   GLY A C   
452  O O   . GLY A 103 ? 0.8525 0.6841 0.7688 0.0395  0.0123  0.1544  99   GLY A O   
453  N N   . ALA A 104 ? 0.8413 0.6579 0.7304 0.0577  0.0070  0.1782  100  ALA A N   
454  C CA  . ALA A 104 ? 0.8671 0.6681 0.7660 0.0679  0.0046  0.1771  100  ALA A CA  
455  C C   . ALA A 104 ? 0.8265 0.6537 0.7423 0.0753  -0.0035 0.1649  100  ALA A C   
456  O O   . ALA A 104 ? 0.8071 0.6618 0.7238 0.0768  -0.0106 0.1624  100  ALA A O   
457  C CB  . ALA A 104 ? 0.9066 0.6868 0.7900 0.0822  0.0018  0.1935  100  ALA A CB  
458  N N   . TRP A 105 ? 0.7765 0.5941 0.7054 0.0796  -0.0019 0.1574  101  TRP A N   
459  C CA  . TRP A 105 ? 0.7431 0.5837 0.6888 0.0881  -0.0070 0.1477  101  TRP A CA  
460  C C   . TRP A 105 ? 0.7865 0.6128 0.7345 0.1063  -0.0094 0.1526  101  TRP A C   
461  O O   . TRP A 105 ? 0.8039 0.6007 0.7503 0.1085  -0.0042 0.1515  101  TRP A O   
462  C CB  . TRP A 105 ? 0.6940 0.5396 0.6520 0.0782  -0.0020 0.1324  101  TRP A CB  
463  C CG  . TRP A 105 ? 0.6837 0.5525 0.6577 0.0866  -0.0049 0.1238  101  TRP A CG  
464  C CD1 . TRP A 105 ? 0.6986 0.5594 0.6804 0.0969  -0.0023 0.1180  101  TRP A CD1 
465  C CD2 . TRP A 105 ? 0.6850 0.5884 0.6692 0.0857  -0.0103 0.1206  101  TRP A CD2 
466  N NE1 . TRP A 105 ? 0.6950 0.5857 0.6918 0.1023  -0.0042 0.1123  101  TRP A NE1 
467  C CE2 . TRP A 105 ? 0.6890 0.6058 0.6889 0.0946  -0.0095 0.1141  101  TRP A CE2 
468  C CE3 . TRP A 105 ? 0.6981 0.6215 0.6794 0.0780  -0.0156 0.1222  101  TRP A CE3 
469  C CZ2 . TRP A 105 ? 0.6552 0.6050 0.6702 0.0946  -0.0132 0.1107  101  TRP A CZ2 
470  C CZ3 . TRP A 105 ? 0.6477 0.6016 0.6433 0.0782  -0.0209 0.1174  101  TRP A CZ3 
471  C CH2 . TRP A 105 ? 0.6435 0.6106 0.6569 0.0857  -0.0195 0.1124  101  TRP A CH2 
472  N N   . LEU A 106 ? 0.7741 0.6208 0.7265 0.1197  -0.0180 0.1579  102  LEU A N   
473  C CA  . LEU A 106 ? 0.7990 0.6335 0.7527 0.1391  -0.0210 0.1650  102  LEU A CA  
474  C C   . LEU A 106 ? 0.8078 0.6653 0.7836 0.1504  -0.0224 0.1562  102  LEU A C   
475  O O   . LEU A 106 ? 0.8288 0.6811 0.8097 0.1686  -0.0244 0.1602  102  LEU A O   
476  C CB  . LEU A 106 ? 0.8158 0.6547 0.7576 0.1489  -0.0304 0.1795  102  LEU A CB  
477  N N   . LEU A 107 ? 0.7568 0.6395 0.7455 0.1403  -0.0205 0.1448  103  LEU A N   
478  C CA  . LEU A 107 ? 0.7158 0.6241 0.7262 0.1492  -0.0200 0.1375  103  LEU A CA  
479  C C   . LEU A 107 ? 0.7335 0.6247 0.7449 0.1483  -0.0098 0.1261  103  LEU A C   
480  O O   . LEU A 107 ? 0.7368 0.5951 0.7339 0.1419  -0.0052 0.1242  103  LEU A O   
481  C CB  . LEU A 107 ? 0.6848 0.6315 0.7087 0.1395  -0.0247 0.1335  103  LEU A CB  
482  C CG  . LEU A 107 ? 0.6711 0.6319 0.6901 0.1387  -0.0364 0.1425  103  LEU A CG  
483  C CD1 . LEU A 107 ? 0.6813 0.6763 0.7139 0.1282  -0.0419 0.1370  103  LEU A CD1 
484  C CD2 . LEU A 107 ? 0.6868 0.6519 0.7108 0.1583  -0.0445 0.1527  103  LEU A CD2 
485  N N   . SER A 108 ? 0.6903 0.6034 0.7182 0.1549  -0.0064 0.1187  104  SER A N   
486  C CA  . SER A 108 ? 0.6810 0.5762 0.7064 0.1590  0.0025  0.1081  104  SER A CA  
487  C C   . SER A 108 ? 0.6511 0.5385 0.6685 0.1404  0.0067  0.0979  104  SER A C   
488  O O   . SER A 108 ? 0.6429 0.5495 0.6630 0.1263  0.0042  0.0976  104  SER A O   
489  C CB  . SER A 108 ? 0.6838 0.6062 0.7279 0.1734  0.0066  0.1044  104  SER A CB  
490  O OG  . SER A 108 ? 0.6494 0.6031 0.7052 0.1623  0.0081  0.0998  104  SER A OG  
491  N N   . PRO A 109 ? 0.6884 0.5462 0.6954 0.1410  0.0120  0.0889  105  PRO A N   
492  C CA  . PRO A 109 ? 0.6674 0.5189 0.6681 0.1248  0.0147  0.0781  105  PRO A CA  
493  C C   . PRO A 109 ? 0.6589 0.5407 0.6691 0.1233  0.0180  0.0706  105  PRO A C   
494  O O   . PRO A 109 ? 0.6459 0.5343 0.6541 0.1081  0.0178  0.0654  105  PRO A O   
495  C CB  . PRO A 109 ? 0.7230 0.5356 0.7117 0.1296  0.0177  0.0699  105  PRO A CB  
496  C CG  . PRO A 109 ? 0.7238 0.5299 0.7146 0.1517  0.0190  0.0733  105  PRO A CG  
497  C CD  . PRO A 109 ? 0.7230 0.5492 0.7227 0.1566  0.0142  0.0881  105  PRO A CD  
498  N N   . ARG A 110 ? 0.6117 0.5125 0.6328 0.1387  0.0214  0.0711  106  ARG A N   
499  C CA  . ARG A 110 ? 0.5916 0.5222 0.6227 0.1371  0.0259  0.0664  106  ARG A CA  
500  C C   . ARG A 110 ? 0.5682 0.5296 0.6119 0.1247  0.0207  0.0730  106  ARG A C   
501  O O   . ARG A 110 ? 0.5633 0.5400 0.6096 0.1143  0.0224  0.0687  106  ARG A O   
502  C CB  . ARG A 110 ? 0.6247 0.5703 0.6665 0.1572  0.0327  0.0666  106  ARG A CB  
503  C CG  . ARG A 110 ? 0.7406 0.6589 0.7675 0.1703  0.0397  0.0561  106  ARG A CG  
504  C CD  . ARG A 110 ? 0.8203 0.7205 0.8299 0.1578  0.0407  0.0437  106  ARG A CD  
505  N NE  . ARG A 110 ? 0.8551 0.7841 0.8713 0.1482  0.0435  0.0426  106  ARG A NE  
506  C CZ  . ARG A 110 ? 0.8227 0.7449 0.8271 0.1363  0.0432  0.0338  106  ARG A CZ  
507  N NH1 . ARG A 110 ? 0.8796 0.7693 0.8671 0.1312  0.0398  0.0244  106  ARG A NH1 
508  N NH2 . ARG A 110 ? 0.6499 0.5980 0.6607 0.1293  0.0459  0.0347  106  ARG A NH2 
509  N N   . LEU A 111 ? 0.5565 0.5257 0.6068 0.1266  0.0136  0.0832  107  LEU A N   
510  C CA  . LEU A 111 ? 0.5383 0.5323 0.5973 0.1146  0.0068  0.0880  107  LEU A CA  
511  C C   . LEU A 111 ? 0.5412 0.5206 0.5852 0.0971  0.0049  0.0841  107  LEU A C   
512  O O   . LEU A 111 ? 0.5092 0.5049 0.5568 0.0855  0.0034  0.0816  107  LEU A O   
513  C CB  . LEU A 111 ? 0.5221 0.5254 0.5876 0.1214  -0.0021 0.0989  107  LEU A CB  
514  C CG  . LEU A 111 ? 0.4983 0.5249 0.5706 0.1105  -0.0114 0.1030  107  LEU A CG  
515  C CD1 . LEU A 111 ? 0.4764 0.5350 0.5691 0.1060  -0.0102 0.1000  107  LEU A CD1 
516  C CD2 . LEU A 111 ? 0.5293 0.5622 0.6048 0.1198  -0.0215 0.1132  107  LEU A CD2 
517  N N   . CYS A 112 ? 0.5464 0.4950 0.5748 0.0954  0.0054  0.0841  108  CYS A N   
518  C CA  . CYS A 112 ? 0.5363 0.4721 0.5533 0.0792  0.0053  0.0803  108  CYS A CA  
519  C C   . CYS A 112 ? 0.5380 0.4793 0.5557 0.0715  0.0094  0.0692  108  CYS A C   
520  O O   . CYS A 112 ? 0.5381 0.4907 0.5557 0.0593  0.0076  0.0670  108  CYS A O   
521  C CB  . CYS A 112 ? 0.5659 0.4671 0.5698 0.0783  0.0069  0.0817  108  CYS A CB  
522  S SG  . CYS A 112 ? 0.6155 0.5055 0.6109 0.0580  0.0082  0.0770  108  CYS A SG  
523  N N   . ASP A 113 ? 0.5445 0.4773 0.5611 0.0800  0.0147  0.0621  109  ASP A N   
524  C CA  . ASP A 113 ? 0.5275 0.4653 0.5419 0.0751  0.0183  0.0518  109  ASP A CA  
525  C C   . ASP A 113 ? 0.5343 0.5038 0.5602 0.0712  0.0181  0.0538  109  ASP A C   
526  O O   . ASP A 113 ? 0.5002 0.4751 0.5235 0.0605  0.0177  0.0489  109  ASP A O   
527  C CB  . ASP A 113 ? 0.5715 0.4974 0.5809 0.0884  0.0241  0.0445  109  ASP A CB  
528  C CG  . ASP A 113 ? 0.6162 0.5058 0.6126 0.0900  0.0234  0.0390  109  ASP A CG  
529  O OD1 . ASP A 113 ? 0.6155 0.4904 0.6073 0.0770  0.0197  0.0383  109  ASP A OD1 
530  O OD2 . ASP A 113 ? 0.6288 0.5043 0.6205 0.1044  0.0268  0.0352  109  ASP A OD2 
531  N N   . ALA A 114 ? 0.4765 0.4666 0.5164 0.0798  0.0181  0.0611  110  ALA A N   
532  C CA  . ALA A 114 ? 0.4558 0.4756 0.5101 0.0749  0.0169  0.0643  110  ALA A CA  
533  C C   . ALA A 114 ? 0.4471 0.4713 0.4994 0.0602  0.0093  0.0657  110  ALA A C   
534  O O   . ALA A 114 ? 0.4497 0.4839 0.5035 0.0510  0.0091  0.0626  110  ALA A O   
535  C CB  . ALA A 114 ? 0.4370 0.4786 0.5102 0.0858  0.0162  0.0726  110  ALA A CB  
536  N N   . LEU A 115 ? 0.4687 0.4838 0.5157 0.0591  0.0036  0.0706  111  LEU A N   
537  C CA  . LEU A 115 ? 0.4595 0.4781 0.5019 0.0477  -0.0030 0.0721  111  LEU A CA  
538  C C   . LEU A 115 ? 0.4649 0.4722 0.4963 0.0365  -0.0007 0.0647  111  LEU A C   
539  O O   . LEU A 115 ? 0.4487 0.4661 0.4804 0.0276  -0.0036 0.0626  111  LEU A O   
540  C CB  . LEU A 115 ? 0.4680 0.4759 0.5025 0.0507  -0.0079 0.0795  111  LEU A CB  
541  C CG  . LEU A 115 ? 0.5614 0.5883 0.6058 0.0563  -0.0162 0.0872  111  LEU A CG  
542  C CD1 . LEU A 115 ? 0.5542 0.5657 0.5862 0.0616  -0.0200 0.0950  111  LEU A CD1 
543  C CD2 . LEU A 115 ? 0.5074 0.5522 0.5555 0.0461  -0.0230 0.0853  111  LEU A CD2 
544  N N   . MET A 116 ? 0.4550 0.4409 0.4774 0.0374  0.0039  0.0605  112  MET A N   
545  C CA  . MET A 116 ? 0.4713 0.4473 0.4858 0.0271  0.0053  0.0532  112  MET A CA  
546  C C   . MET A 116 ? 0.4713 0.4584 0.4886 0.0246  0.0071  0.0460  112  MET A C   
547  O O   . MET A 116 ? 0.4610 0.4514 0.4757 0.0155  0.0056  0.0420  112  MET A O   
548  C CB  . MET A 116 ? 0.4696 0.4201 0.4768 0.0283  0.0084  0.0498  112  MET A CB  
549  C CG  . MET A 116 ? 0.4897 0.4260 0.4922 0.0282  0.0074  0.0582  112  MET A CG  
550  S SD  . MET A 116 ? 0.5435 0.4473 0.5393 0.0244  0.0103  0.0548  112  MET A SD  
551  C CE  . MET A 116 ? 0.5659 0.4578 0.5612 0.0373  0.0124  0.0468  112  MET A CE  
552  N N   . ALA A 117 ? 0.4010 0.3940 0.4229 0.0336  0.0109  0.0451  113  ALA A N   
553  C CA  . ALA A 117 ? 0.3905 0.3934 0.4130 0.0321  0.0136  0.0402  113  ALA A CA  
554  C C   . ALA A 117 ? 0.3928 0.4150 0.4237 0.0246  0.0099  0.0440  113  ALA A C   
555  O O   . ALA A 117 ? 0.3875 0.4120 0.4149 0.0178  0.0092  0.0399  113  ALA A O   
556  C CB  . ALA A 117 ? 0.4055 0.4127 0.4309 0.0441  0.0202  0.0403  113  ALA A CB  
557  N N   . MET A 118 ? 0.4498 0.4846 0.4913 0.0263  0.0063  0.0515  114  MET A N   
558  C CA  . MET A 118 ? 0.4226 0.4734 0.4721 0.0188  0.0006  0.0543  114  MET A CA  
559  C C   . MET A 118 ? 0.4173 0.4603 0.4561 0.0095  -0.0043 0.0509  114  MET A C   
560  O O   . MET A 118 ? 0.4363 0.4842 0.4748 0.0026  -0.0065 0.0480  114  MET A O   
561  C CB  . MET A 118 ? 0.4096 0.4747 0.4725 0.0229  -0.0044 0.0620  114  MET A CB  
562  C CG  . MET A 118 ? 0.4393 0.5210 0.5128 0.0153  -0.0117 0.0639  114  MET A CG  
563  S SD  . MET A 118 ? 0.5559 0.6513 0.6422 0.0116  -0.0061 0.0637  114  MET A SD  
564  C CE  . MET A 118 ? 0.5991 0.7088 0.7024 0.0240  0.0016  0.0701  114  MET A CE  
565  N N   . ASP A 119 ? 0.4240 0.4545 0.4542 0.0100  -0.0052 0.0519  115  ASP A N   
566  C CA  . ASP A 119 ? 0.4180 0.4413 0.4380 0.0025  -0.0072 0.0495  115  ASP A CA  
567  C C   . ASP A 119 ? 0.4413 0.4614 0.4577 -0.0031 -0.0046 0.0415  115  ASP A C   
568  O O   . ASP A 119 ? 0.4027 0.4279 0.4171 -0.0088 -0.0074 0.0387  115  ASP A O   
569  C CB  . ASP A 119 ? 0.4127 0.4205 0.4250 0.0044  -0.0052 0.0528  115  ASP A CB  
570  C CG  . ASP A 119 ? 0.4627 0.4677 0.4655 -0.0011 -0.0071 0.0551  115  ASP A CG  
571  O OD1 . ASP A 119 ? 0.4540 0.4696 0.4551 -0.0037 -0.0121 0.0550  115  ASP A OD1 
572  O OD2 . ASP A 119 ? 0.4840 0.4753 0.4807 -0.0027 -0.0032 0.0570  115  ASP A OD2 
573  N N   . VAL A 120 ? 0.3876 0.3984 0.4023 -0.0004 -0.0001 0.0373  116  VAL A N   
574  C CA  . VAL A 120 ? 0.3878 0.3953 0.3984 -0.0044 0.0009  0.0294  116  VAL A CA  
575  C C   . VAL A 120 ? 0.3732 0.3925 0.3866 -0.0051 0.0000  0.0284  116  VAL A C   
576  O O   . VAL A 120 ? 0.3562 0.3771 0.3667 -0.0100 -0.0021 0.0243  116  VAL A O   
577  C CB  . VAL A 120 ? 0.4076 0.4020 0.4142 -0.0001 0.0043  0.0240  116  VAL A CB  
578  C CG1 . VAL A 120 ? 0.4101 0.4038 0.4120 -0.0026 0.0035  0.0157  116  VAL A CG1 
579  C CG2 . VAL A 120 ? 0.3935 0.3729 0.3981 -0.0021 0.0047  0.0244  116  VAL A CG2 
580  N N   . MET A 121 ? 0.4149 0.4424 0.4349 0.0000  0.0019  0.0328  117  MET A N   
581  C CA  . MET A 121 ? 0.4042 0.4414 0.4279 -0.0012 0.0024  0.0336  117  MET A CA  
582  C C   . MET A 121 ? 0.3827 0.4267 0.4097 -0.0086 -0.0037 0.0348  117  MET A C   
583  O O   . MET A 121 ? 0.3776 0.4218 0.4021 -0.0121 -0.0048 0.0322  117  MET A O   
584  C CB  . MET A 121 ? 0.3847 0.4325 0.4187 0.0051  0.0071  0.0397  117  MET A CB  
585  C CG  . MET A 121 ? 0.4063 0.4629 0.4444 0.0031  0.0097  0.0420  117  MET A CG  
586  S SD  . MET A 121 ? 0.4594 0.5327 0.5136 0.0097  0.0171  0.0509  117  MET A SD  
587  C CE  . MET A 121 ? 0.4962 0.5825 0.5684 0.0053  0.0085  0.0564  117  MET A CE  
588  N N   . LEU A 122 ? 0.3865 0.4346 0.4177 -0.0098 -0.0083 0.0385  118  LEU A N   
589  C CA  . LEU A 122 ? 0.3611 0.4148 0.3943 -0.0156 -0.0154 0.0389  118  LEU A CA  
590  C C   . LEU A 122 ? 0.3919 0.4377 0.4133 -0.0196 -0.0173 0.0328  118  LEU A C   
591  O O   . LEU A 122 ? 0.4014 0.4478 0.4211 -0.0235 -0.0212 0.0300  118  LEU A O   
592  C CB  . LEU A 122 ? 0.3574 0.4178 0.3961 -0.0145 -0.0212 0.0439  118  LEU A CB  
593  C CG  . LEU A 122 ? 0.3694 0.4432 0.4251 -0.0109 -0.0211 0.0503  118  LEU A CG  
594  C CD1 . LEU A 122 ? 0.3858 0.4662 0.4460 -0.0083 -0.0285 0.0549  118  LEU A CD1 
595  C CD2 . LEU A 122 ? 0.3797 0.4630 0.4474 -0.0162 -0.0222 0.0514  118  LEU A CD2 
596  N N   . CYS A 123 ? 0.4134 0.4515 0.4277 -0.0185 -0.0142 0.0310  119  CYS A N   
597  C CA  . CYS A 123 ? 0.4050 0.4385 0.4114 -0.0218 -0.0141 0.0256  119  CYS A CA  
598  C C   . CYS A 123 ? 0.3944 0.4269 0.4003 -0.0226 -0.0131 0.0201  119  CYS A C   
599  O O   . CYS A 123 ? 0.3959 0.4291 0.3987 -0.0247 -0.0158 0.0163  119  CYS A O   
600  C CB  . CYS A 123 ? 0.4100 0.4365 0.4130 -0.0217 -0.0100 0.0261  119  CYS A CB  
601  S SG  . CYS A 123 ? 0.4310 0.4565 0.4291 -0.0261 -0.0083 0.0208  119  CYS A SG  
602  N N   . THR A 124 ? 0.3480 0.3779 0.3553 -0.0195 -0.0095 0.0196  120  THR A N   
603  C CA  . THR A 124 ? 0.3707 0.3987 0.3747 -0.0187 -0.0090 0.0149  120  THR A CA  
604  C C   . THR A 124 ? 0.3757 0.4077 0.3813 -0.0196 -0.0111 0.0172  120  THR A C   
605  O O   . THR A 124 ? 0.3590 0.3888 0.3602 -0.0204 -0.0133 0.0136  120  THR A O   
606  C CB  . THR A 124 ? 0.3880 0.4112 0.3899 -0.0137 -0.0049 0.0138  120  THR A CB  
607  O OG1 . THR A 124 ? 0.3912 0.4074 0.3924 -0.0140 -0.0040 0.0111  120  THR A OG1 
608  C CG2 . THR A 124 ? 0.3872 0.4077 0.3821 -0.0116 -0.0053 0.0089  120  THR A CG2 
609  N N   . ALA A 125 ? 0.3787 0.4164 0.3919 -0.0198 -0.0109 0.0236  121  ALA A N   
610  C CA  . ALA A 125 ? 0.3878 0.4287 0.4055 -0.0226 -0.0130 0.0268  121  ALA A CA  
611  C C   . ALA A 125 ? 0.3871 0.4247 0.4013 -0.0269 -0.0198 0.0230  121  ALA A C   
612  O O   . ALA A 125 ? 0.3730 0.4065 0.3851 -0.0284 -0.0217 0.0221  121  ALA A O   
613  C CB  . ALA A 125 ? 0.3765 0.4274 0.4080 -0.0232 -0.0125 0.0344  121  ALA A CB  
614  N N   . SER A 126 ? 0.4032 0.4413 0.4151 -0.0278 -0.0230 0.0209  122  SER A N   
615  C CA  . SER A 126 ? 0.4156 0.4504 0.4216 -0.0301 -0.0288 0.0166  122  SER A CA  
616  C C   . SER A 126 ? 0.4155 0.4451 0.4142 -0.0284 -0.0276 0.0106  122  SER A C   
617  O O   . SER A 126 ? 0.4139 0.4384 0.4096 -0.0289 -0.0314 0.0079  122  SER A O   
618  C CB  . SER A 126 ? 0.4162 0.4527 0.4176 -0.0297 -0.0308 0.0161  122  SER A CB  
619  O OG  . SER A 126 ? 0.4498 0.4916 0.4580 -0.0306 -0.0346 0.0213  122  SER A OG  
620  N N   . ILE A 127 ? 0.3969 0.4273 0.3939 -0.0262 -0.0231 0.0084  123  ILE A N   
621  C CA  . ILE A 127 ? 0.3946 0.4233 0.3876 -0.0242 -0.0227 0.0024  123  ILE A CA  
622  C C   . ILE A 127 ? 0.4134 0.4378 0.4045 -0.0221 -0.0236 0.0026  123  ILE A C   
623  O O   . ILE A 127 ? 0.4141 0.4352 0.4012 -0.0203 -0.0266 -0.0010 123  ILE A O   
624  C CB  . ILE A 127 ? 0.3979 0.4287 0.3927 -0.0237 -0.0188 0.0001  123  ILE A CB  
625  C CG1 . ILE A 127 ? 0.4508 0.4835 0.4467 -0.0259 -0.0166 0.0030  123  ILE A CG1 
626  C CG2 . ILE A 127 ? 0.4140 0.4470 0.4084 -0.0223 -0.0199 -0.0065 123  ILE A CG2 
627  C CD1 . ILE A 127 ? 0.4632 0.4955 0.4626 -0.0272 -0.0124 0.0026  123  ILE A CD1 
628  N N   . PHE A 128 ? 0.3627 0.3870 0.3556 -0.0213 -0.0204 0.0072  124  PHE A N   
629  C CA  . PHE A 128 ? 0.3768 0.3966 0.3652 -0.0185 -0.0196 0.0090  124  PHE A CA  
630  C C   . PHE A 128 ? 0.3951 0.4105 0.3847 -0.0212 -0.0228 0.0125  124  PHE A C   
631  O O   . PHE A 128 ? 0.4104 0.4189 0.3938 -0.0189 -0.0240 0.0126  124  PHE A O   
632  C CB  . PHE A 128 ? 0.3817 0.4031 0.3705 -0.0159 -0.0138 0.0138  124  PHE A CB  
633  C CG  . PHE A 128 ? 0.4075 0.4277 0.3912 -0.0118 -0.0120 0.0086  124  PHE A CG  
634  C CD1 . PHE A 128 ? 0.3763 0.3965 0.3595 -0.0126 -0.0154 0.0013  124  PHE A CD1 
635  C CD2 . PHE A 128 ? 0.4203 0.4394 0.4001 -0.0071 -0.0068 0.0108  124  PHE A CD2 
636  C CE1 . PHE A 128 ? 0.3857 0.4038 0.3665 -0.0105 -0.0152 -0.0041 124  PHE A CE1 
637  C CE2 . PHE A 128 ? 0.4275 0.4424 0.4012 -0.0033 -0.0067 0.0044  124  PHE A CE2 
638  C CZ  . PHE A 128 ? 0.3966 0.4105 0.3716 -0.0058 -0.0117 -0.0032 124  PHE A CZ  
639  N N   . ASN A 129 ? 0.3839 0.4018 0.3807 -0.0260 -0.0252 0.0151  125  ASN A N   
640  C CA  . ASN A 129 ? 0.4134 0.4248 0.4120 -0.0298 -0.0300 0.0168  125  ASN A CA  
641  C C   . ASN A 129 ? 0.4222 0.4256 0.4125 -0.0280 -0.0356 0.0093  125  ASN A C   
642  O O   . ASN A 129 ? 0.4342 0.4274 0.4216 -0.0281 -0.0387 0.0097  125  ASN A O   
643  C CB  . ASN A 129 ? 0.4223 0.4389 0.4317 -0.0356 -0.0333 0.0204  125  ASN A CB  
644  C CG  . ASN A 129 ? 0.4603 0.4835 0.4820 -0.0383 -0.0286 0.0297  125  ASN A CG  
645  O OD1 . ASN A 129 ? 0.4581 0.4771 0.4852 -0.0423 -0.0290 0.0349  125  ASN A OD1 
646  N ND2 . ASN A 129 ? 0.4737 0.5069 0.5001 -0.0356 -0.0234 0.0325  125  ASN A ND2 
647  N N   . LEU A 130 ? 0.4234 0.4311 0.4101 -0.0257 -0.0360 0.0031  126  LEU A N   
648  C CA  . LEU A 130 ? 0.4402 0.4429 0.4194 -0.0218 -0.0394 -0.0042 126  LEU A CA  
649  C C   . LEU A 130 ? 0.4412 0.4405 0.4165 -0.0166 -0.0386 -0.0056 126  LEU A C   
650  O O   . LEU A 130 ? 0.4928 0.4832 0.4628 -0.0131 -0.0424 -0.0086 126  LEU A O   
651  C CB  . LEU A 130 ? 0.4368 0.4476 0.4143 -0.0201 -0.0376 -0.0090 126  LEU A CB  
652  C CG  . LEU A 130 ? 0.4082 0.4201 0.3847 -0.0233 -0.0400 -0.0081 126  LEU A CG  
653  C CD1 . LEU A 130 ? 0.4318 0.4516 0.4051 -0.0214 -0.0358 -0.0103 126  LEU A CD1 
654  C CD2 . LEU A 130 ? 0.4213 0.4225 0.3915 -0.0232 -0.0474 -0.0121 126  LEU A CD2 
655  N N   . CYS A 131 ? 0.4223 0.4275 0.3992 -0.0153 -0.0344 -0.0038 127  CYS A N   
656  C CA  A CYS A 131 ? 0.4518 0.4539 0.4232 -0.0097 -0.0348 -0.0048 127  CYS A CA  
657  C CA  B CYS A 131 ? 0.4483 0.4503 0.4196 -0.0097 -0.0349 -0.0051 127  CYS A CA  
658  C C   . CYS A 131 ? 0.4855 0.4756 0.4517 -0.0092 -0.0358 0.0013  127  CYS A C   
659  O O   . CYS A 131 ? 0.4831 0.4653 0.4424 -0.0039 -0.0392 -0.0002 127  CYS A O   
660  C CB  A CYS A 131 ? 0.4548 0.4629 0.4266 -0.0087 -0.0310 -0.0042 127  CYS A CB  
661  C CB  B CYS A 131 ? 0.4627 0.4714 0.4347 -0.0083 -0.0315 -0.0053 127  CYS A CB  
662  S SG  A CYS A 131 ? 0.4087 0.4277 0.3863 -0.0085 -0.0309 -0.0120 127  CYS A SG  
663  S SG  B CYS A 131 ? 0.5356 0.5446 0.5011 -0.0005 -0.0352 -0.0111 127  CYS A SG  
664  N N   . ALA A 132 ? 0.4174 0.4067 0.3882 -0.0144 -0.0326 0.0090  128  ALA A N   
665  C CA  . ALA A 132 ? 0.4576 0.4366 0.4265 -0.0158 -0.0317 0.0172  128  ALA A CA  
666  C C   . ALA A 132 ? 0.4648 0.4302 0.4321 -0.0172 -0.0381 0.0157  128  ALA A C   
667  O O   . ALA A 132 ? 0.4755 0.4281 0.4363 -0.0150 -0.0388 0.0200  128  ALA A O   
668  C CB  . ALA A 132 ? 0.4319 0.4168 0.4115 -0.0223 -0.0267 0.0257  128  ALA A CB  
669  N N   . ILE A 133 ? 0.4559 0.4224 0.4273 -0.0204 -0.0427 0.0098  129  ILE A N   
670  C CA  . ILE A 133 ? 0.4479 0.3997 0.4154 -0.0203 -0.0497 0.0059  129  ILE A CA  
671  C C   . ILE A 133 ? 0.4708 0.4156 0.4277 -0.0105 -0.0517 0.0009  129  ILE A C   
672  O O   . ILE A 133 ? 0.5136 0.4413 0.4647 -0.0083 -0.0553 0.0025  129  ILE A O   
673  C CB  . ILE A 133 ? 0.4735 0.4285 0.4427 -0.0226 -0.0543 -0.0016 129  ILE A CB  
674  C CG1 . ILE A 133 ? 0.4567 0.4167 0.4370 -0.0320 -0.0552 0.0035  129  ILE A CG1 
675  C CG2 . ILE A 133 ? 0.4812 0.4191 0.4422 -0.0194 -0.0616 -0.0084 129  ILE A CG2 
676  C CD1 . ILE A 133 ? 0.4429 0.4088 0.4226 -0.0333 -0.0594 -0.0028 129  ILE A CD1 
677  N N   . SER A 134 ? 0.4717 0.4295 0.4274 -0.0047 -0.0497 -0.0047 130  SER A N   
678  C CA  . SER A 134 ? 0.4933 0.4487 0.4423 0.0053  -0.0525 -0.0103 130  SER A CA  
679  C C   . SER A 134 ? 0.5128 0.4594 0.4543 0.0097  -0.0524 -0.0037 130  SER A C   
680  O O   . SER A 134 ? 0.5180 0.4524 0.4519 0.0169  -0.0567 -0.0046 130  SER A O   
681  C CB  . SER A 134 ? 0.4611 0.4351 0.4146 0.0090  -0.0505 -0.0171 130  SER A CB  
682  O OG  . SER A 134 ? 0.4724 0.4553 0.4279 0.0078  -0.0471 -0.0140 130  SER A OG  
683  N N   . VAL A 135 ? 0.4579 0.4097 0.3997 0.0065  -0.0474 0.0030  131  VAL A N   
684  C CA  . VAL A 135 ? 0.4654 0.4082 0.3966 0.0113  -0.0461 0.0104  131  VAL A CA  
685  C C   . VAL A 135 ? 0.4919 0.4144 0.4196 0.0084  -0.0467 0.0191  131  VAL A C   
686  O O   . VAL A 135 ? 0.5170 0.4251 0.4333 0.0154  -0.0492 0.0224  131  VAL A O   
687  C CB  . VAL A 135 ? 0.4724 0.4244 0.4032 0.0091  -0.0392 0.0157  131  VAL A CB  
688  C CG1 . VAL A 135 ? 0.4872 0.4282 0.4049 0.0133  -0.0359 0.0257  131  VAL A CG1 
689  C CG2 . VAL A 135 ? 0.4539 0.4207 0.3855 0.0133  -0.0403 0.0069  131  VAL A CG2 
690  N N   . ASP A 136 ? 0.5047 0.4256 0.4429 -0.0021 -0.0451 0.0227  132  ASP A N   
691  C CA  . ASP A 136 ? 0.5291 0.4315 0.4689 -0.0083 -0.0459 0.0310  132  ASP A CA  
692  C C   . ASP A 136 ? 0.5466 0.4296 0.4800 -0.0039 -0.0543 0.0253  132  ASP A C   
693  O O   . ASP A 136 ? 0.5478 0.4103 0.4740 -0.0023 -0.0556 0.0322  132  ASP A O   
694  C CB  . ASP A 136 ? 0.5443 0.4533 0.5006 -0.0210 -0.0447 0.0337  132  ASP A CB  
695  C CG  . ASP A 136 ? 0.5798 0.4708 0.5424 -0.0298 -0.0468 0.0417  132  ASP A CG  
696  O OD1 . ASP A 136 ? 0.6122 0.4994 0.5759 -0.0327 -0.0398 0.0546  132  ASP A OD1 
697  O OD2 . ASP A 136 ? 0.5904 0.4710 0.5570 -0.0342 -0.0551 0.0352  132  ASP A OD2 
698  N N   . ARG A 137 ? 0.5232 0.4116 0.4585 -0.0014 -0.0593 0.0132  133  ARG A N   
699  C CA  . ARG A 137 ? 0.5545 0.4253 0.4829 0.0045  -0.0668 0.0061  133  ARG A CA  
700  C C   . ARG A 137 ? 0.5498 0.4160 0.4666 0.0185  -0.0684 0.0049  133  ARG A C   
701  O O   . ARG A 137 ? 0.5736 0.4180 0.4823 0.0242  -0.0733 0.0052  133  ARG A O   
702  C CB  . ARG A 137 ? 0.5522 0.4317 0.4838 0.0050  -0.0701 -0.0063 133  ARG A CB  
703  C CG  . ARG A 137 ? 0.5466 0.4238 0.4865 -0.0073 -0.0727 -0.0063 133  ARG A CG  
704  C CD  . ARG A 137 ? 0.5708 0.4210 0.5108 -0.0138 -0.0786 -0.0020 133  ARG A CD  
705  N NE  . ARG A 137 ? 0.5943 0.4431 0.5429 -0.0230 -0.0735 0.0124  133  ARG A NE  
706  C CZ  . ARG A 137 ? 0.6302 0.4566 0.5801 -0.0287 -0.0755 0.0206  133  ARG A CZ  
707  N NH1 . ARG A 137 ? 0.6535 0.4537 0.5960 -0.0261 -0.0839 0.0152  133  ARG A NH1 
708  N NH2 . ARG A 137 ? 0.6228 0.4524 0.5814 -0.0365 -0.0683 0.0349  133  ARG A NH2 
709  N N   . PHE A 138 ? 0.5531 0.4386 0.4693 0.0242  -0.0653 0.0034  134  PHE A N   
710  C CA  . PHE A 138 ? 0.5655 0.4486 0.4718 0.0376  -0.0686 0.0023  134  PHE A CA  
711  C C   . PHE A 138 ? 0.5966 0.4588 0.4907 0.0396  -0.0681 0.0147  134  PHE A C   
712  O O   . PHE A 138 ? 0.5983 0.4432 0.4823 0.0494  -0.0733 0.0154  134  PHE A O   
713  C CB  . PHE A 138 ? 0.5458 0.4531 0.4547 0.0420  -0.0670 -0.0020 134  PHE A CB  
714  C CG  . PHE A 138 ? 0.5744 0.4808 0.4742 0.0559  -0.0724 -0.0035 134  PHE A CG  
715  C CD1 . PHE A 138 ? 0.6510 0.5573 0.5521 0.0664  -0.0784 -0.0118 134  PHE A CD1 
716  C CD2 . PHE A 138 ? 0.5633 0.4683 0.4520 0.0599  -0.0720 0.0035  134  PHE A CD2 
717  C CE1 . PHE A 138 ? 0.6534 0.5600 0.5477 0.0804  -0.0847 -0.0130 134  PHE A CE1 
718  C CE2 . PHE A 138 ? 0.6058 0.5095 0.4846 0.0738  -0.0789 0.0020  134  PHE A CE2 
719  C CZ  . PHE A 138 ? 0.5827 0.4879 0.4656 0.0838  -0.0857 -0.0061 134  PHE A CZ  
720  N N   . VAL A 139 ? 0.5868 0.4508 0.4816 0.0312  -0.0612 0.0251  135  VAL A N   
721  C CA  . VAL A 139 ? 0.5878 0.4330 0.4710 0.0318  -0.0580 0.0393  135  VAL A CA  
722  C C   . VAL A 139 ? 0.5987 0.4164 0.4823 0.0270  -0.0609 0.0445  135  VAL A C   
723  O O   . VAL A 139 ? 0.6300 0.4260 0.5006 0.0330  -0.0622 0.0528  135  VAL A O   
724  C CB  . VAL A 139 ? 0.5878 0.4434 0.4741 0.0233  -0.0478 0.0495  135  VAL A CB  
725  C CG1 . VAL A 139 ? 0.5895 0.4251 0.4672 0.0208  -0.0419 0.0667  135  VAL A CG1 
726  C CG2 . VAL A 139 ? 0.5564 0.4318 0.4362 0.0307  -0.0459 0.0452  135  VAL A CG2 
727  N N   . ALA A 140 ? 0.6142 0.4309 0.5115 0.0164  -0.0629 0.0395  136  ALA A N   
728  C CA  . ALA A 140 ? 0.6556 0.4444 0.5544 0.0105  -0.0674 0.0426  136  ALA A CA  
729  C C   . ALA A 140 ? 0.6377 0.4072 0.5239 0.0242  -0.0758 0.0353  136  ALA A C   
730  O O   . ALA A 140 ? 0.6706 0.4110 0.5487 0.0259  -0.0787 0.0423  136  ALA A O   
731  C CB  . ALA A 140 ? 0.6346 0.4279 0.5493 -0.0023 -0.0703 0.0358  136  ALA A CB  
732  N N   . VAL A 141 ? 0.6620 0.4482 0.5475 0.0343  -0.0793 0.0217  137  VAL A N   
733  C CA  . VAL A 141 ? 0.6756 0.4487 0.5516 0.0493  -0.0867 0.0132  137  VAL A CA  
734  C C   . VAL A 141 ? 0.6663 0.4341 0.5287 0.0629  -0.0876 0.0200  137  VAL A C   
735  O O   . VAL A 141 ? 0.6774 0.4195 0.5289 0.0725  -0.0929 0.0221  137  VAL A O   
736  C CB  . VAL A 141 ? 0.6755 0.4721 0.5578 0.0557  -0.0885 -0.0027 137  VAL A CB  
737  C CG1 . VAL A 141 ? 0.7163 0.5036 0.5905 0.0735  -0.0949 -0.0111 137  VAL A CG1 
738  C CG2 . VAL A 141 ? 0.6892 0.4867 0.5800 0.0445  -0.0890 -0.0096 137  VAL A CG2 
739  N N   . ALA A 142 ? 0.6587 0.4489 0.5203 0.0646  -0.0832 0.0234  138  ALA A N   
740  C CA  . ALA A 142 ? 0.6717 0.4602 0.5187 0.0792  -0.0859 0.0279  138  ALA A CA  
741  C C   . ALA A 142 ? 0.6782 0.4420 0.5100 0.0782  -0.0825 0.0455  138  ALA A C   
742  O O   . ALA A 142 ? 0.6954 0.4460 0.5109 0.0918  -0.0867 0.0505  138  ALA A O   
743  C CB  . ALA A 142 ? 0.6297 0.4500 0.4802 0.0818  -0.0842 0.0230  138  ALA A CB  
744  N N   . VAL A 143 ? 0.6960 0.4545 0.5334 0.0626  -0.0745 0.0556  139  VAL A N   
745  C CA  . VAL A 143 ? 0.7125 0.4509 0.5376 0.0599  -0.0682 0.0744  139  VAL A CA  
746  C C   . VAL A 143 ? 0.7555 0.4684 0.5893 0.0458  -0.0663 0.0826  139  VAL A C   
747  O O   . VAL A 143 ? 0.7321 0.4519 0.5792 0.0303  -0.0586 0.0894  139  VAL A O   
748  C CB  . VAL A 143 ? 0.7327 0.4920 0.5567 0.0546  -0.0577 0.0823  139  VAL A CB  
749  C CG1 . VAL A 143 ? 0.6997 0.4397 0.5060 0.0561  -0.0500 0.1024  139  VAL A CG1 
750  C CG2 . VAL A 143 ? 0.6665 0.4526 0.4862 0.0653  -0.0610 0.0710  139  VAL A CG2 
751  N N   . PRO A 144 ? 0.8391 0.5220 0.6665 0.0515  -0.0741 0.0816  140  PRO A N   
752  C CA  . PRO A 144 ? 0.8870 0.5389 0.7206 0.0388  -0.0743 0.0899  140  PRO A CA  
753  C C   . PRO A 144 ? 0.8362 0.4766 0.6663 0.0297  -0.0634 0.1123  140  PRO A C   
754  O O   . PRO A 144 ? 0.8481 0.4747 0.6574 0.0411  -0.0610 0.1241  140  PRO A O   
755  C CB  . PRO A 144 ? 0.9496 0.5697 0.7691 0.0532  -0.0846 0.0858  140  PRO A CB  
756  C CG  . PRO A 144 ? 0.9341 0.5774 0.7496 0.0702  -0.0907 0.0692  140  PRO A CG  
757  C CD  . PRO A 144 ? 0.8727 0.5494 0.6873 0.0712  -0.0838 0.0721  140  PRO A CD  
758  N N   . LEU A 145 ? 0.8521 0.4984 0.7019 0.0103  -0.0566 0.1188  141  LEU A N   
759  C CA  . LEU A 145 ? 0.8599 0.4963 0.7098 0.0006  -0.0446 0.1414  141  LEU A CA  
760  C C   . LEU A 145 ? 0.8831 0.4928 0.7505 -0.0175 -0.0459 0.1490  141  LEU A C   
761  O O   . LEU A 145 ? 0.8913 0.5016 0.7766 -0.0272 -0.0544 0.1360  141  LEU A O   
762  C CB  . LEU A 145 ? 0.8087 0.4807 0.6687 -0.0062 -0.0324 0.1460  141  LEU A CB  
763  C CG  . LEU A 145 ? 0.7766 0.4732 0.6189 0.0096  -0.0295 0.1411  141  LEU A CG  
764  C CD1 . LEU A 145 ? 0.7562 0.4828 0.6099 0.0014  -0.0170 0.1462  141  LEU A CD1 
765  C CD2 . LEU A 145 ? 0.8159 0.4931 0.6287 0.0249  -0.0277 0.1532  141  LEU A CD2 
766  N N   . ARG A 146 ? 0.9369 0.5232 0.7986 -0.0221 -0.0376 0.1705  142  ARG A N   
767  C CA  . ARG A 146 ? 0.9796 0.5402 0.8603 -0.0415 -0.0376 0.1809  142  ARG A CA  
768  C C   . ARG A 146 ? 0.9855 0.5569 0.8777 -0.0548 -0.0198 0.2043  142  ARG A C   
769  O O   . ARG A 146 ? 1.0184 0.5837 0.8896 -0.0458 -0.0088 0.2215  142  ARG A O   
770  C CB  . ARG A 146 ? 0.9892 0.5013 0.8528 -0.0346 -0.0456 0.1857  142  ARG A CB  
771  C CG  . ARG A 146 ? 1.0274 0.5070 0.9111 -0.0553 -0.0485 0.1941  142  ARG A CG  
772  C CD  . ARG A 146 ? 1.0613 0.4890 0.9253 -0.0466 -0.0569 0.1984  142  ARG A CD  
773  N NE  . ARG A 146 ? 1.1393 0.5425 1.0021 -0.0547 -0.0446 0.2251  142  ARG A NE  
774  C CZ  . ARG A 146 ? 1.2575 0.6256 1.1177 -0.0531 -0.0463 0.2290  142  ARG A CZ  
775  N NH1 . ARG A 146 ? 1.2989 0.6548 1.1615 -0.0594 -0.0307 0.2521  142  ARG A NH1 
776  N NH2 . ARG A 146 ? 1.3023 0.6467 1.1569 -0.0446 -0.0626 0.2099  142  ARG A NH2 
777  N N   . TYR A 147 ? 0.8913 0.4795 0.8164 -0.0755 -0.0171 0.2052  143  TYR A N   
778  C CA  . TYR A 147 ? 0.8926 0.4975 0.8341 -0.0885 0.0010  0.2268  143  TYR A CA  
779  C C   . TYR A 147 ? 0.9141 0.4874 0.8704 -0.1060 0.0049  0.2464  143  TYR A C   
780  O O   . TYR A 147 ? 0.9489 0.4954 0.9176 -0.1161 -0.0089 0.2388  143  TYR A O   
781  C CB  . TYR A 147 ? 0.8482 0.4939 0.8207 -0.1008 0.0031  0.2187  143  TYR A CB  
782  C CG  . TYR A 147 ? 0.8182 0.4954 0.7807 -0.0866 -0.0006 0.1995  143  TYR A CG  
783  C CD1 . TYR A 147 ? 0.8014 0.4803 0.7309 -0.0651 0.0011  0.1962  143  TYR A CD1 
784  C CD2 . TYR A 147 ? 0.7522 0.4571 0.7389 -0.0952 -0.0062 0.1854  143  TYR A CD2 
785  C CE1 . TYR A 147 ? 0.7817 0.4888 0.7051 -0.0541 -0.0025 0.1790  143  TYR A CE1 
786  C CE2 . TYR A 147 ? 0.7561 0.4878 0.7347 -0.0834 -0.0088 0.1695  143  TYR A CE2 
787  C CZ  . TYR A 147 ? 0.7621 0.4945 0.7100 -0.0637 -0.0068 0.1662  143  TYR A CZ  
788  O OH  . TYR A 147 ? 0.7477 0.5063 0.6908 -0.0540 -0.0097 0.1505  143  TYR A OH  
789  N N   . ASN A 148 ? 0.9306 0.5064 0.8851 -0.1094 0.0241  0.2717  144  ASN A N   
790  C CA  . ASN A 148 ? 0.9747 0.5329 0.9440 -0.1258 0.0332  0.2850  144  ASN A CA  
791  C C   . ASN A 148 ? 0.9823 0.5651 0.9967 -0.1488 0.0315  0.2780  144  ASN A C   
792  O O   . ASN A 148 ? 0.9767 0.5400 1.0095 -0.1635 0.0246  0.2741  144  ASN A O   
793  C CB  . ASN A 148 ? 0.9803 0.5446 0.9313 -0.1218 0.0555  0.3072  144  ASN A CB  
794  C CG  . ASN A 148 ? 1.0219 0.5567 0.9263 -0.1003 0.0559  0.3155  144  ASN A CG  
795  O OD1 . ASN A 148 ? 1.0808 0.5779 0.9701 -0.0929 0.0432  0.3104  144  ASN A OD1 
796  N ND2 . ASN A 148 ? 1.0280 0.5814 0.9093 -0.0887 0.0697  0.3275  144  ASN A ND2 
797  N N   . ARG A 149 ? 0.9345 0.5607 0.9658 -0.1507 0.0376  0.2762  145  ARG A N   
798  C CA  . ARG A 149 ? 0.9083 0.5649 0.9822 -0.1699 0.0368  0.2704  145  ARG A CA  
799  C C   . ARG A 149 ? 0.8806 0.5414 0.9691 -0.1734 0.0147  0.2476  145  ARG A C   
800  O O   . ARG A 149 ? 0.8794 0.5395 0.9473 -0.1590 0.0053  0.2363  145  ARG A O   
801  C CB  . ARG A 149 ? 0.8995 0.6017 0.9843 -0.1686 0.0551  0.2797  145  ARG A CB  
802  C CG  . ARG A 149 ? 0.9799 0.6838 1.0542 -0.1677 0.0776  0.3010  145  ARG A CG  
803  C CD  . ARG A 149 ? 1.0479 0.7980 1.1318 -0.1639 0.0948  0.3071  145  ARG A CD  
804  N NE  . ARG A 149 ? 1.0974 0.8815 1.2273 -0.1803 0.0934  0.3014  145  ARG A NE  
805  C CZ  . ARG A 149 ? 1.0568 0.8723 1.2032 -0.1783 0.0877  0.2893  145  ARG A CZ  
806  N NH1 . ARG A 149 ? 1.0343 0.8515 1.1558 -0.1618 0.0837  0.2819  145  ARG A NH1 
807  N NH2 . ARG A 149 ? 1.0109 0.8560 1.1983 -0.1924 0.0855  0.2848  145  ARG A NH2 
808  N N   . GLN A 150 ? 0.9701 0.6371 1.0921 -0.1916 0.0063  0.2394  146  GLN A N   
809  C CA  . GLN A 150 ? 0.9605 0.6329 1.0959 -0.1958 -0.0148 0.2171  146  GLN A CA  
810  C C   . GLN A 150 ? 0.8788 0.5940 1.0248 -0.1922 -0.0126 0.2126  146  GLN A C   
811  O O   . GLN A 150 ? 0.8748 0.6214 1.0304 -0.1919 0.0055  0.2259  146  GLN A O   
812  C CB  . GLN A 150 ? 0.9959 0.6657 1.1635 -0.2155 -0.0242 0.2102  146  GLN A CB  
813  N N   . GLY A 151 ? 0.8173 0.5351 0.9572 -0.1867 -0.0297 0.1910  147  GLY A N   
814  C CA  . GLY A 151 ? 0.8326 0.5919 0.9776 -0.1799 -0.0276 0.1811  147  GLY A CA  
815  C C   . GLY A 151 ? 0.8550 0.6195 0.9624 -0.1560 -0.0221 0.1741  147  GLY A C   
816  O O   . GLY A 151 ? 0.9023 0.6421 0.9814 -0.1446 -0.0181 0.1795  147  GLY A O   
817  N N   . GLY A 152 ? 0.7601 0.5562 0.8681 -0.1487 -0.0228 0.1623  148  GLY A N   
818  C CA  . GLY A 152 ? 0.7912 0.5963 0.8686 -0.1281 -0.0186 0.1544  148  GLY A CA  
819  C C   . GLY A 152 ? 0.7476 0.5753 0.8214 -0.1217 0.0014  0.1695  148  GLY A C   
820  O O   . GLY A 152 ? 0.7011 0.5409 0.7975 -0.1329 0.0134  0.1864  148  GLY A O   
821  N N   . SER A 153 ? 0.6752 0.5091 0.7209 -0.1035 0.0050  0.1632  149  SER A N   
822  C CA  . SER A 153 ? 0.6567 0.5081 0.6920 -0.0946 0.0228  0.1753  149  SER A CA  
823  C C   . SER A 153 ? 0.5749 0.4627 0.6256 -0.0940 0.0275  0.1699  149  SER A C   
824  O O   . SER A 153 ? 0.6289 0.5343 0.6756 -0.0876 0.0427  0.1793  149  SER A O   
825  C CB  . SER A 153 ? 0.6426 0.4813 0.6392 -0.0750 0.0231  0.1709  149  SER A CB  
826  O OG  . SER A 153 ? 0.6256 0.4725 0.6139 -0.0664 0.0116  0.1505  149  SER A OG  
827  N N   . ARG A 154 ? 0.5949 0.4920 0.6607 -0.0992 0.0142  0.1547  150  ARG A N   
828  C CA  . ARG A 154 ? 0.5456 0.4737 0.6231 -0.0968 0.0154  0.1470  150  ARG A CA  
829  C C   . ARG A 154 ? 0.5779 0.5125 0.6277 -0.0790 0.0187  0.1382  150  ARG A C   
830  O O   . ARG A 154 ? 0.5338 0.4919 0.5887 -0.0746 0.0235  0.1350  150  ARG A O   
831  C CB  . ARG A 154 ? 0.5594 0.5128 0.6648 -0.1050 0.0291  0.1619  150  ARG A CB  
832  C CG  . ARG A 154 ? 0.5891 0.5395 0.7280 -0.1249 0.0251  0.1708  150  ARG A CG  
833  C CD  . ARG A 154 ? 0.6378 0.6184 0.8086 -0.1327 0.0394  0.1859  150  ARG A CD  
834  N N   . ARG A 155 ? 0.5597 0.4731 0.5813 -0.0687 0.0148  0.1338  151  ARG A N   
835  C CA  . ARG A 155 ? 0.5462 0.4656 0.5440 -0.0532 0.0152  0.1238  151  ARG A CA  
836  C C   . ARG A 155 ? 0.5262 0.4588 0.5300 -0.0522 0.0053  0.1068  151  ARG A C   
837  O O   . ARG A 155 ? 0.5242 0.4686 0.5175 -0.0428 0.0076  0.1000  151  ARG A O   
838  C CB  . ARG A 155 ? 0.5631 0.4590 0.5326 -0.0424 0.0110  0.1219  151  ARG A CB  
839  C CG  . ARG A 155 ? 0.5831 0.4592 0.5511 -0.0444 -0.0037 0.1119  151  ARG A CG  
840  C CD  . ARG A 155 ? 0.6341 0.4883 0.5745 -0.0318 -0.0063 0.1126  151  ARG A CD  
841  N NE  . ARG A 155 ? 0.6281 0.4592 0.5663 -0.0325 -0.0186 0.1058  151  ARG A NE  
842  C CZ  . ARG A 155 ? 0.6834 0.4954 0.6005 -0.0207 -0.0239 0.1037  151  ARG A CZ  
843  N NH1 . ARG A 155 ? 0.6423 0.4562 0.5381 -0.0077 -0.0192 0.1076  151  ARG A NH1 
844  N NH2 . ARG A 155 ? 0.6947 0.4856 0.6110 -0.0208 -0.0347 0.0967  151  ARG A NH2 
845  N N   . GLN A 156 ? 0.4938 0.4229 0.5129 -0.0617 -0.0058 0.1000  152  GLN A N   
846  C CA  . GLN A 156 ? 0.4999 0.4419 0.5237 -0.0608 -0.0138 0.0859  152  GLN A CA  
847  C C   . GLN A 156 ? 0.4782 0.4463 0.5192 -0.0633 -0.0067 0.0896  152  GLN A C   
848  O O   . GLN A 156 ? 0.4779 0.4583 0.5139 -0.0565 -0.0065 0.0817  152  GLN A O   
849  C CB  . GLN A 156 ? 0.5207 0.4523 0.5538 -0.0692 -0.0276 0.0776  152  GLN A CB  
850  C CG  . GLN A 156 ? 0.5492 0.4563 0.5631 -0.0632 -0.0363 0.0693  152  GLN A CG  
851  C CD  . GLN A 156 ? 0.5874 0.4716 0.5966 -0.0655 -0.0341 0.0801  152  GLN A CD  
852  O OE1 . GLN A 156 ? 0.5701 0.4530 0.5961 -0.0767 -0.0302 0.0920  152  GLN A OE1 
853  N NE2 . GLN A 156 ? 0.5783 0.4450 0.5659 -0.0548 -0.0363 0.0770  152  GLN A NE2 
854  N N   . LEU A 157 ? 0.4629 0.4393 0.5255 -0.0728 -0.0006 0.1020  153  LEU A N   
855  C CA  A LEU A 157 ? 0.4427 0.4455 0.5239 -0.0739 0.0068  0.1064  153  LEU A CA  
856  C CA  B LEU A 157 ? 0.4430 0.4458 0.5243 -0.0740 0.0070  0.1066  153  LEU A CA  
857  C C   . LEU A 157 ? 0.4456 0.4567 0.5099 -0.0607 0.0192  0.1082  153  LEU A C   
858  O O   . LEU A 157 ? 0.4385 0.4655 0.5058 -0.0555 0.0210  0.1033  153  LEU A O   
859  C CB  A LEU A 157 ? 0.4456 0.4579 0.5552 -0.0862 0.0128  0.1209  153  LEU A CB  
860  C CB  B LEU A 157 ? 0.4491 0.4609 0.5582 -0.0861 0.0133  0.1215  153  LEU A CB  
861  C CG  A LEU A 157 ? 0.4691 0.4803 0.6027 -0.1006 -0.0013 0.1174  153  LEU A CG  
862  C CG  B LEU A 157 ? 0.4211 0.4617 0.5500 -0.0850 0.0254  0.1299  153  LEU A CG  
863  C CD1 A LEU A 157 ? 0.4611 0.4809 0.6255 -0.1144 0.0046  0.1329  153  LEU A CD1 
864  C CD1 B LEU A 157 ? 0.4417 0.4991 0.5849 -0.0858 0.0158  0.1200  153  LEU A CD1 
865  C CD2 A LEU A 157 ? 0.4387 0.4679 0.5814 -0.0991 -0.0098 0.1068  153  LEU A CD2 
866  C CD2 B LEU A 157 ? 0.4036 0.4529 0.5608 -0.0973 0.0336  0.1467  153  LEU A CD2 
867  N N   . LEU A 158 ? 0.4370 0.4357 0.4824 -0.0547 0.0271  0.1152  154  LEU A N   
868  C CA  . LEU A 158 ? 0.4248 0.4283 0.4501 -0.0413 0.0376  0.1160  154  LEU A CA  
869  C C   . LEU A 158 ? 0.4341 0.4347 0.4419 -0.0323 0.0290  0.0997  154  LEU A C   
870  O O   . LEU A 158 ? 0.4238 0.4358 0.4275 -0.0249 0.0332  0.0952  154  LEU A O   
871  C CB  . LEU A 158 ? 0.4372 0.4253 0.4427 -0.0364 0.0458  0.1267  154  LEU A CB  
872  C CG  . LEU A 158 ? 0.4346 0.4272 0.4582 -0.0454 0.0577  0.1453  154  LEU A CG  
873  C CD1 . LEU A 158 ? 0.4633 0.4354 0.4651 -0.0415 0.0641  0.1567  154  LEU A CD1 
874  C CD2 . LEU A 158 ? 0.4271 0.4451 0.4626 -0.0418 0.0724  0.1522  154  LEU A CD2 
875  N N   . LEU A 159 ? 0.4439 0.4297 0.4434 -0.0332 0.0171  0.0909  155  LEU A N   
876  C CA  . LEU A 159 ? 0.4553 0.4404 0.4424 -0.0263 0.0093  0.0763  155  LEU A CA  
877  C C   . LEU A 159 ? 0.4356 0.4361 0.4381 -0.0297 0.0064  0.0698  155  LEU A C   
878  O O   . LEU A 159 ? 0.4460 0.4529 0.4418 -0.0231 0.0075  0.0631  155  LEU A O   
879  C CB  . LEU A 159 ? 0.4702 0.4388 0.4487 -0.0264 -0.0018 0.0690  155  LEU A CB  
880  C CG  . LEU A 159 ? 0.4965 0.4662 0.4650 -0.0198 -0.0092 0.0548  155  LEU A CG  
881  C CD1 . LEU A 159 ? 0.4713 0.4435 0.4231 -0.0092 -0.0050 0.0525  155  LEU A CD1 
882  C CD2 . LEU A 159 ? 0.5014 0.4562 0.4635 -0.0190 -0.0186 0.0489  155  LEU A CD2 
883  N N   . ILE A 160 ? 0.4634 0.4688 0.4862 -0.0398 0.0021  0.0720  156  ILE A N   
884  C CA  . ILE A 160 ? 0.4478 0.4676 0.4844 -0.0424 -0.0013 0.0673  156  ILE A CA  
885  C C   . ILE A 160 ? 0.4164 0.4521 0.4583 -0.0371 0.0091  0.0722  156  ILE A C   
886  O O   . ILE A 160 ? 0.4188 0.4605 0.4581 -0.0322 0.0083  0.0656  156  ILE A O   
887  C CB  . ILE A 160 ? 0.4293 0.4522 0.4872 -0.0540 -0.0087 0.0699  156  ILE A CB  
888  C CG1 . ILE A 160 ? 0.4447 0.4511 0.4940 -0.0568 -0.0208 0.0607  156  ILE A CG1 
889  C CG2 . ILE A 160 ? 0.3925 0.4334 0.4659 -0.0553 -0.0108 0.0683  156  ILE A CG2 
890  C CD1 . ILE A 160 ? 0.4261 0.4283 0.4925 -0.0687 -0.0296 0.0628  156  ILE A CD1 
891  N N   . GLY A 161 ? 0.3937 0.4352 0.4424 -0.0374 0.0197  0.0839  157  GLY A N   
892  C CA  . GLY A 161 ? 0.4115 0.4673 0.4626 -0.0299 0.0312  0.0883  157  GLY A CA  
893  C C   . GLY A 161 ? 0.4120 0.4604 0.4378 -0.0177 0.0334  0.0798  157  GLY A C   
894  O O   . GLY A 161 ? 0.3923 0.4481 0.4181 -0.0117 0.0357  0.0757  157  GLY A O   
895  N N   . ALA A 162 ? 0.4085 0.4415 0.4131 -0.0140 0.0316  0.0771  158  ALA A N   
896  C CA  . ALA A 162 ? 0.4145 0.4406 0.3964 -0.0034 0.0312  0.0680  158  ALA A CA  
897  C C   . ALA A 162 ? 0.4053 0.4320 0.3896 -0.0043 0.0221  0.0560  158  ALA A C   
898  O O   . ALA A 162 ? 0.4220 0.4496 0.3990 0.0023  0.0234  0.0498  158  ALA A O   
899  C CB  . ALA A 162 ? 0.4143 0.4251 0.3753 0.0005  0.0284  0.0671  158  ALA A CB  
900  N N   . THR A 163 ? 0.4135 0.4388 0.4077 -0.0124 0.0131  0.0531  159  THR A N   
901  C CA  . THR A 163 ? 0.4222 0.4482 0.4183 -0.0138 0.0055  0.0434  159  THR A CA  
902  C C   . THR A 163 ? 0.4426 0.4792 0.4493 -0.0128 0.0085  0.0438  159  THR A C   
903  O O   . THR A 163 ? 0.4147 0.4498 0.4164 -0.0096 0.0068  0.0367  159  THR A O   
904  C CB  . THR A 163 ? 0.4538 0.4768 0.4576 -0.0218 -0.0033 0.0415  159  THR A CB  
905  O OG1 . THR A 163 ? 0.4853 0.4964 0.4766 -0.0201 -0.0078 0.0375  159  THR A OG1 
906  C CG2 . THR A 163 ? 0.4886 0.5155 0.4964 -0.0234 -0.0086 0.0348  159  THR A CG2 
907  N N   . TRP A 164 ? 0.4087 0.4562 0.4315 -0.0157 0.0128  0.0525  160  TRP A N   
908  C CA  . TRP A 164 ? 0.3927 0.4514 0.4272 -0.0136 0.0151  0.0539  160  TRP A CA  
909  C C   . TRP A 164 ? 0.4051 0.4640 0.4303 -0.0031 0.0243  0.0536  160  TRP A C   
910  O O   . TRP A 164 ? 0.4094 0.4688 0.4343 0.0014  0.0243  0.0497  160  TRP A O   
911  C CB  . TRP A 164 ? 0.3934 0.4666 0.4512 -0.0196 0.0158  0.0632  160  TRP A CB  
912  C CG  . TRP A 164 ? 0.3877 0.4606 0.4542 -0.0283 0.0041  0.0604  160  TRP A CG  
913  C CD1 . TRP A 164 ? 0.4087 0.4743 0.4759 -0.0362 -0.0025 0.0600  160  TRP A CD1 
914  C CD2 . TRP A 164 ? 0.3919 0.4699 0.4642 -0.0288 -0.0028 0.0571  160  TRP A CD2 
915  N NE1 . TRP A 164 ? 0.3863 0.4526 0.4589 -0.0413 -0.0133 0.0557  160  TRP A NE1 
916  C CE2 . TRP A 164 ? 0.3909 0.4653 0.4662 -0.0368 -0.0135 0.0544  160  TRP A CE2 
917  C CE3 . TRP A 164 ? 0.4351 0.5185 0.5087 -0.0225 -0.0012 0.0564  160  TRP A CE3 
918  C CZ2 . TRP A 164 ? 0.4027 0.4800 0.4803 -0.0382 -0.0224 0.0511  160  TRP A CZ2 
919  C CZ3 . TRP A 164 ? 0.4206 0.5065 0.4979 -0.0243 -0.0097 0.0544  160  TRP A CZ3 
920  C CH2 . TRP A 164 ? 0.4172 0.5006 0.4955 -0.0319 -0.0201 0.0518  160  TRP A CH2 
921  N N   . LEU A 165 ? 0.3640 0.4206 0.3795 0.0014  0.0321  0.0576  161  LEU A N   
922  C CA  . LEU A 165 ? 0.3762 0.4312 0.3787 0.0129  0.0406  0.0561  161  LEU A CA  
923  C C   . LEU A 165 ? 0.4207 0.4613 0.4046 0.0171  0.0343  0.0434  161  LEU A C   
924  O O   . LEU A 165 ? 0.4141 0.4517 0.3926 0.0242  0.0364  0.0385  161  LEU A O   
925  C CB  . LEU A 165 ? 0.3819 0.4366 0.3744 0.0176  0.0505  0.0636  161  LEU A CB  
926  C CG  . LEU A 165 ? 0.4035 0.4754 0.4167 0.0152  0.0608  0.0775  161  LEU A CG  
927  C CD1 . LEU A 165 ? 0.4028 0.4722 0.4009 0.0215  0.0725  0.0851  161  LEU A CD1 
928  C CD2 . LEU A 165 ? 0.4038 0.4901 0.4317 0.0209  0.0663  0.0788  161  LEU A CD2 
929  N N   . LEU A 166 ? 0.3977 0.4297 0.3737 0.0126  0.0262  0.0383  162  LEU A N   
930  C CA  A LEU A 166 ? 0.4152 0.4366 0.3786 0.0146  0.0192  0.0266  162  LEU A CA  
931  C CA  B LEU A 166 ? 0.4113 0.4327 0.3744 0.0150  0.0195  0.0266  162  LEU A CA  
932  C C   . LEU A 166 ? 0.4049 0.4272 0.3784 0.0113  0.0152  0.0221  162  LEU A C   
933  O O   . LEU A 166 ? 0.4300 0.4450 0.3967 0.0149  0.0138  0.0147  162  LEU A O   
934  C CB  A LEU A 166 ? 0.4104 0.4264 0.3685 0.0103  0.0114  0.0231  162  LEU A CB  
935  C CB  B LEU A 166 ? 0.4163 0.4315 0.3721 0.0115  0.0119  0.0228  162  LEU A CB  
936  C CG  A LEU A 166 ? 0.4344 0.4446 0.3762 0.0159  0.0136  0.0257  162  LEU A CG  
937  C CG  B LEU A 166 ? 0.4360 0.4433 0.3807 0.0140  0.0046  0.0111  162  LEU A CG  
938  C CD1 A LEU A 166 ? 0.4500 0.4551 0.3889 0.0124  0.0052  0.0228  162  LEU A CD1 
939  C CD1 B LEU A 166 ? 0.4718 0.4725 0.3999 0.0237  0.0075  0.0065  162  LEU A CD1 
940  C CD2 A LEU A 166 ? 0.4417 0.4451 0.3646 0.0259  0.0149  0.0189  162  LEU A CD2 
941  C CD2 B LEU A 166 ? 0.4251 0.4291 0.3642 0.0125  -0.0024 0.0086  162  LEU A CD2 
942  N N   . SER A 167 ? 0.4044 0.4343 0.3933 0.0041  0.0128  0.0267  163  SER A N   
943  C CA  . SER A 167 ? 0.4018 0.4325 0.3987 0.0014  0.0095  0.0246  163  SER A CA  
944  C C   . SER A 167 ? 0.4304 0.4620 0.4297 0.0084  0.0151  0.0264  163  SER A C   
945  O O   . SER A 167 ? 0.4451 0.4692 0.4421 0.0099  0.0136  0.0217  163  SER A O   
946  C CB  . SER A 167 ? 0.3809 0.4196 0.3909 -0.0059 0.0053  0.0295  163  SER A CB  
947  O OG  . SER A 167 ? 0.4220 0.4580 0.4287 -0.0108 0.0006  0.0277  163  SER A OG  
948  N N   . ALA A 168 ? 0.4068 0.4472 0.4114 0.0129  0.0223  0.0335  164  ALA A N   
949  C CA  . ALA A 168 ? 0.4066 0.4492 0.4136 0.0220  0.0289  0.0353  164  ALA A CA  
950  C C   . ALA A 168 ? 0.4253 0.4530 0.4131 0.0302  0.0309  0.0265  164  ALA A C   
951  O O   . ALA A 168 ? 0.4341 0.4546 0.4199 0.0361  0.0319  0.0230  164  ALA A O   
952  C CB  . ALA A 168 ? 0.4060 0.4641 0.4241 0.0255  0.0377  0.0451  164  ALA A CB  
953  N N   . ALA A 169 ? 0.4166 0.4382 0.3895 0.0310  0.0304  0.0225  165  ALA A N   
954  C CA  . ALA A 169 ? 0.4460 0.4530 0.3990 0.0388  0.0301  0.0127  165  ALA A CA  
955  C C   . ALA A 169 ? 0.4556 0.4502 0.4078 0.0344  0.0214  0.0031  165  ALA A C   
956  O O   . ALA A 169 ? 0.4750 0.4571 0.4185 0.0406  0.0212  -0.0041 165  ALA A O   
957  C CB  . ALA A 169 ? 0.4181 0.4219 0.3549 0.0405  0.0293  0.0108  165  ALA A CB  
958  N N   . VAL A 170 ? 0.4273 0.4248 0.3886 0.0240  0.0147  0.0031  166  VAL A N   
959  C CA  . VAL A 170 ? 0.4427 0.4317 0.4072 0.0182  0.0083  -0.0034 166  VAL A CA  
960  C C   . VAL A 170 ? 0.4495 0.4348 0.4217 0.0199  0.0110  -0.0002 166  VAL A C   
961  O O   . VAL A 170 ? 0.4517 0.4231 0.4203 0.0210  0.0090  -0.0063 166  VAL A O   
962  C CB  . VAL A 170 ? 0.4229 0.4188 0.3961 0.0079  0.0029  -0.0023 166  VAL A CB  
963  C CG1 . VAL A 170 ? 0.4234 0.4126 0.4021 0.0016  -0.0012 -0.0067 166  VAL A CG1 
964  C CG2 . VAL A 170 ? 0.4057 0.4033 0.3710 0.0076  -0.0007 -0.0060 166  VAL A CG2 
965  N N   . ALA A 171 ? 0.4014 0.3984 0.3844 0.0205  0.0147  0.0093  167  ALA A N   
966  C CA  . ALA A 171 ? 0.4118 0.4068 0.4028 0.0227  0.0159  0.0136  167  ALA A CA  
967  C C   . ALA A 171 ? 0.4124 0.4008 0.3989 0.0349  0.0218  0.0129  167  ALA A C   
968  O O   . ALA A 171 ? 0.4311 0.4116 0.4207 0.0383  0.0219  0.0142  167  ALA A O   
969  C CB  . ALA A 171 ? 0.4078 0.4192 0.4128 0.0192  0.0156  0.0234  167  ALA A CB  
970  N N   . ALA A 172 ? 0.4568 0.4481 0.4351 0.0426  0.0273  0.0114  168  ALA A N   
971  C CA  . ALA A 172 ? 0.4524 0.4422 0.4272 0.0564  0.0352  0.0122  168  ALA A CA  
972  C C   . ALA A 172 ? 0.4630 0.4304 0.4285 0.0632  0.0337  0.0042  168  ALA A C   
973  O O   . ALA A 172 ? 0.4779 0.4446 0.4476 0.0732  0.0385  0.0074  168  ALA A O   
974  C CB  . ALA A 172 ? 0.4439 0.4379 0.4062 0.0637  0.0419  0.0110  168  ALA A CB  
975  N N   . PRO A 173 ? 0.4875 0.4367 0.4419 0.0581  0.0267  -0.0063 169  PRO A N   
976  C CA  . PRO A 173 ? 0.5059 0.4313 0.4526 0.0637  0.0248  -0.0139 169  PRO A CA  
977  C C   . PRO A 173 ? 0.5173 0.4382 0.4769 0.0615  0.0239  -0.0070 169  PRO A C   
978  O O   . PRO A 173 ? 0.5399 0.4430 0.4948 0.0700  0.0250  -0.0099 169  PRO A O   
979  C CB  . PRO A 173 ? 0.4983 0.4092 0.4367 0.0546  0.0157  -0.0252 169  PRO A CB  
980  C CG  . PRO A 173 ? 0.5158 0.4414 0.4492 0.0519  0.0152  -0.0257 169  PRO A CG  
981  C CD  . PRO A 173 ? 0.4918 0.4401 0.4401 0.0488  0.0202  -0.0124 169  PRO A CD  
982  N N   . VAL A 174 ? 0.4703 0.4052 0.4435 0.0514  0.0218  0.0018  170  VAL A N   
983  C CA  . VAL A 174 ? 0.4711 0.4015 0.4534 0.0499  0.0205  0.0092  170  VAL A CA  
984  C C   . VAL A 174 ? 0.4896 0.4243 0.4764 0.0641  0.0259  0.0155  170  VAL A C   
985  O O   . VAL A 174 ? 0.4884 0.4076 0.4751 0.0694  0.0254  0.0174  170  VAL A O   
986  C CB  . VAL A 174 ? 0.4788 0.4250 0.4715 0.0385  0.0172  0.0172  170  VAL A CB  
987  C CG1 . VAL A 174 ? 0.4953 0.4375 0.4941 0.0392  0.0161  0.0260  170  VAL A CG1 
988  C CG2 . VAL A 174 ? 0.4727 0.4144 0.4625 0.0256  0.0125  0.0112  170  VAL A CG2 
989  N N   . LEU A 175 ? 0.5357 0.4913 0.5275 0.0706  0.0314  0.0190  171  LEU A N   
990  C CA  . LEU A 175 ? 0.5282 0.4933 0.5278 0.0851  0.0377  0.0249  171  LEU A CA  
991  C C   . LEU A 175 ? 0.5603 0.5037 0.5471 0.0999  0.0418  0.0175  171  LEU A C   
992  O O   . LEU A 175 ? 0.5959 0.5402 0.5888 0.1127  0.0454  0.0220  171  LEU A O   
993  C CB  . LEU A 175 ? 0.5231 0.5155 0.5316 0.0879  0.0443  0.0299  171  LEU A CB  
994  C CG  . LEU A 175 ? 0.5430 0.5609 0.5711 0.0788  0.0412  0.0402  171  LEU A CG  
995  C CD1 . LEU A 175 ? 0.5519 0.5938 0.5897 0.0812  0.0489  0.0451  171  LEU A CD1 
996  C CD2 . LEU A 175 ? 0.5436 0.5670 0.5855 0.0837  0.0382  0.0479  171  LEU A CD2 
997  N N   . CYS A 176 ? 0.6472 0.5709 0.6159 0.0994  0.0405  0.0055  172  CYS A N   
998  C CA  . CYS A 176 ? 0.6562 0.5569 0.6095 0.1143  0.0436  -0.0038 172  CYS A CA  
999  C C   . CYS A 176 ? 0.7235 0.5946 0.6744 0.1134  0.0376  -0.0064 172  CYS A C   
1000 O O   . CYS A 176 ? 0.7264 0.5738 0.6652 0.1260  0.0389  -0.0142 172  CYS A O   
1001 C CB  . CYS A 176 ? 0.7019 0.5913 0.6346 0.1149  0.0428  -0.0168 172  CYS A CB  
1002 S SG  . CYS A 176 ? 0.6612 0.5796 0.5913 0.1179  0.0514  -0.0131 172  CYS A SG  
1003 N N   . GLY A 177 ? 0.6841 0.5550 0.6451 0.0991  0.0315  0.0000  173  GLY A N   
1004 C CA  . GLY A 177 ? 0.7022 0.5455 0.6620 0.0966  0.0269  0.0004  173  GLY A CA  
1005 C C   . GLY A 177 ? 0.7130 0.5322 0.6639 0.0844  0.0203  -0.0106 173  GLY A C   
1006 O O   . GLY A 177 ? 0.7328 0.5307 0.6699 0.0905  0.0188  -0.0234 173  GLY A O   
1007 N N   . LEU A 178 ? 0.6927 0.5155 0.6519 0.0675  0.0159  -0.0060 174  LEU A N   
1008 C CA  . LEU A 178 ? 0.7084 0.5142 0.6649 0.0538  0.0096  -0.0153 174  LEU A CA  
1009 C C   . LEU A 178 ? 0.7462 0.5260 0.7069 0.0461  0.0069  -0.0114 174  LEU A C   
1010 O O   . LEU A 178 ? 0.7645 0.5256 0.7249 0.0355  0.0016  -0.0196 174  LEU A O   
1011 C CB  . LEU A 178 ? 0.6808 0.5107 0.6446 0.0399  0.0075  -0.0140 174  LEU A CB  
1012 C CG  . LEU A 178 ? 0.6630 0.5163 0.6226 0.0450  0.0097  -0.0170 174  LEU A CG  
1013 C CD1 . LEU A 178 ? 0.6168 0.4895 0.5833 0.0314  0.0067  -0.0159 174  LEU A CD1 
1014 C CD2 . LEU A 178 ? 0.6703 0.5096 0.6137 0.0545  0.0086  -0.0309 174  LEU A CD2 
1015 N N   . ASN A 179 ? 0.7730 0.5515 0.7380 0.0511  0.0102  0.0016  175  ASN A N   
1016 C CA  . ASN A 179 ? 0.8005 0.5532 0.7679 0.0443  0.0089  0.0080  175  ASN A CA  
1017 C C   . ASN A 179 ? 0.8845 0.6005 0.8426 0.0547  0.0076  0.0012  175  ASN A C   
1018 O O   . ASN A 179 ? 0.8599 0.5740 0.8095 0.0714  0.0093  -0.0055 175  ASN A O   
1019 C CB  . ASN A 179 ? 0.8030 0.5675 0.7757 0.0462  0.0119  0.0254  175  ASN A CB  
1020 C CG  . ASN A 179 ? 0.8026 0.5969 0.7827 0.0341  0.0122  0.0317  175  ASN A CG  
1021 O OD1 . ASN A 179 ? 0.8090 0.6115 0.7923 0.0219  0.0105  0.0247  175  ASN A OD1 
1022 N ND2 . ASN A 179 ? 0.7406 0.5509 0.7230 0.0384  0.0136  0.0444  175  ASN A ND2 
1023 N N   . ASP A 180 ? 0.9188 0.6054 0.8789 0.0450  0.0051  0.0034  176  ASP A N   
1024 C CA  . ASP A 180 ? 0.9446 0.5900 0.8962 0.0520  0.0024  -0.0040 176  ASP A CA  
1025 C C   . ASP A 180 ? 1.0231 0.6610 0.9663 0.0753  0.0062  -0.0003 176  ASP A C   
1026 O O   . ASP A 180 ? 1.0774 0.7087 1.0101 0.0903  0.0063  -0.0124 176  ASP A O   
1027 C CB  . ASP A 180 ? 0.8923 0.5099 0.8506 0.0371  0.0009  0.0039  176  ASP A CB  
1028 N N   . PRO A 186 ? 1.0329 0.7089 0.9901 0.0530  0.0179  0.0983  182  PRO A N   
1029 C CA  . PRO A 186 ? 1.0302 0.7277 0.9879 0.0719  0.0155  0.0967  182  PRO A CA  
1030 C C   . PRO A 186 ? 0.9969 0.7088 0.9507 0.0806  0.0139  0.1131  182  PRO A C   
1031 O O   . PRO A 186 ? 0.9875 0.7229 0.9454 0.0945  0.0110  0.1136  182  PRO A O   
1032 C CB  . PRO A 186 ? 1.0553 0.7219 1.0091 0.0864  0.0149  0.0902  182  PRO A CB  
1033 C CG  . PRO A 186 ? 1.0712 0.6957 1.0189 0.0788  0.0159  0.0974  182  PRO A CG  
1034 C CD  . PRO A 186 ? 1.0429 0.6738 0.9952 0.0550  0.0183  0.0997  182  PRO A CD  
1035 N N   . ALA A 187 ? 0.9928 0.6907 0.9390 0.0726  0.0157  0.1267  183  ALA A N   
1036 C CA  . ALA A 187 ? 0.9078 0.6188 0.8463 0.0793  0.0135  0.1423  183  ALA A CA  
1037 C C   . ALA A 187 ? 0.8546 0.5981 0.7942 0.0669  0.0136  0.1423  183  ALA A C   
1038 O O   . ALA A 187 ? 0.8301 0.5845 0.7606 0.0690  0.0117  0.1539  183  ALA A O   
1039 C CB  . ALA A 187 ? 0.9452 0.6212 0.8708 0.0793  0.0162  0.1584  183  ALA A CB  
1040 N N   . VAL A 188 ? 0.7734 0.5305 0.7224 0.0549  0.0154  0.1287  184  VAL A N   
1041 C CA  . VAL A 188 ? 0.7647 0.5504 0.7155 0.0434  0.0157  0.1267  184  VAL A CA  
1042 C C   . VAL A 188 ? 0.7701 0.5791 0.7326 0.0427  0.0134  0.1112  184  VAL A C   
1043 O O   . VAL A 188 ? 0.7972 0.5962 0.7649 0.0471  0.0137  0.1015  184  VAL A O   
1044 C CB  . VAL A 188 ? 0.7942 0.5692 0.7439 0.0255  0.0223  0.1286  184  VAL A CB  
1045 C CG1 . VAL A 188 ? 0.8072 0.5580 0.7444 0.0253  0.0266  0.1462  184  VAL A CG1 
1046 C CG2 . VAL A 188 ? 0.8426 0.6021 0.8028 0.0168  0.0241  0.1158  184  VAL A CG2 
1047 N N   . CYS A 189 ? 0.6757 0.5140 0.6406 0.0381  0.0114  0.1089  185  CYS A N   
1048 C CA  . CYS A 189 ? 0.6567 0.5164 0.6318 0.0374  0.0096  0.0961  185  CYS A CA  
1049 C C   . CYS A 189 ? 0.6387 0.5057 0.6164 0.0220  0.0122  0.0883  185  CYS A C   
1050 O O   . CYS A 189 ? 0.6466 0.5314 0.6226 0.0161  0.0114  0.0900  185  CYS A O   
1051 C CB  . CYS A 189 ? 0.6533 0.5415 0.6323 0.0450  0.0040  0.0983  185  CYS A CB  
1052 S SG  . CYS A 189 ? 0.6672 0.5786 0.6598 0.0463  0.0035  0.0853  185  CYS A SG  
1053 N N   . ARG A 190 ? 0.6630 0.5153 0.6447 0.0163  0.0146  0.0791  186  ARG A N   
1054 C CA  . ARG A 190 ? 0.6324 0.4911 0.6189 0.0024  0.0161  0.0711  186  ARG A CA  
1055 C C   . ARG A 190 ? 0.6237 0.4797 0.6150 0.0029  0.0145  0.0568  186  ARG A C   
1056 O O   . ARG A 190 ? 0.6369 0.4770 0.6261 0.0120  0.0139  0.0532  186  ARG A O   
1057 C CB  . ARG A 190 ? 0.6677 0.5079 0.6541 -0.0090 0.0205  0.0767  186  ARG A CB  
1058 C CG  . ARG A 190 ? 0.7230 0.5634 0.7012 -0.0097 0.0238  0.0918  186  ARG A CG  
1059 C CD  . ARG A 190 ? 0.7840 0.6130 0.7653 -0.0238 0.0304  0.0968  186  ARG A CD  
1060 N NE  . ARG A 190 ? 0.7807 0.5965 0.7509 -0.0220 0.0350  0.1137  186  ARG A NE  
1061 C CZ  . ARG A 190 ? 0.7939 0.5799 0.7624 -0.0232 0.0383  0.1219  186  ARG A CZ  
1062 N NH1 . ARG A 190 ? 0.7312 0.4962 0.7092 -0.0270 0.0369  0.1136  186  ARG A NH1 
1063 N NH2 . ARG A 190 ? 0.8334 0.6088 0.7891 -0.0205 0.0428  0.1387  186  ARG A NH2 
1064 N N   . LEU A 191 ? 0.5583 0.4291 0.5542 -0.0057 0.0136  0.0484  187  LEU A N   
1065 C CA  . LEU A 191 ? 0.5743 0.4411 0.5721 -0.0063 0.0114  0.0347  187  LEU A CA  
1066 C C   . LEU A 191 ? 0.6032 0.4478 0.6048 -0.0161 0.0111  0.0306  187  LEU A C   
1067 O O   . LEU A 191 ? 0.6105 0.4612 0.6194 -0.0287 0.0119  0.0307  187  LEU A O   
1068 C CB  . LEU A 191 ? 0.5714 0.4620 0.5723 -0.0108 0.0096  0.0279  187  LEU A CB  
1069 C CG  . LEU A 191 ? 0.6054 0.5165 0.6047 -0.0024 0.0090  0.0288  187  LEU A CG  
1070 C CD1 . LEU A 191 ? 0.5514 0.4805 0.5528 -0.0082 0.0072  0.0227  187  LEU A CD1 
1071 C CD2 . LEU A 191 ? 0.6511 0.5552 0.6466 0.0099  0.0096  0.0246  187  LEU A CD2 
1072 N N   . GLU A 192 ? 0.6238 0.4427 0.6216 -0.0105 0.0099  0.0269  188  GLU A N   
1073 C CA  . GLU A 192 ? 0.6688 0.4625 0.6714 -0.0206 0.0087  0.0236  188  GLU A CA  
1074 C C   . GLU A 192 ? 0.7109 0.5021 0.7161 -0.0252 0.0026  0.0068  188  GLU A C   
1075 O O   . GLU A 192 ? 0.7536 0.5294 0.7669 -0.0367 -0.0003 0.0019  188  GLU A O   
1076 C CB  . GLU A 192 ? 0.7278 0.4899 0.7239 -0.0123 0.0094  0.0280  188  GLU A CB  
1077 C CG  . GLU A 192 ? 0.7704 0.5334 0.7621 -0.0056 0.0140  0.0451  188  GLU A CG  
1078 C CD  . GLU A 192 ? 0.8669 0.6017 0.8506 0.0080  0.0139  0.0486  188  GLU A CD  
1079 O OE1 . GLU A 192 ? 0.8870 0.6009 0.8674 0.0135  0.0109  0.0370  188  GLU A OE1 
1080 O OE2 . GLU A 192 ? 0.8849 0.6179 0.8643 0.0146  0.0164  0.0628  188  GLU A OE2 
1081 N N   . ASP A 193 ? 0.6253 0.4316 0.6239 -0.0164 0.0004  -0.0018 189  ASP A N   
1082 C CA  . ASP A 193 ? 0.6075 0.4109 0.6044 -0.0184 -0.0063 -0.0178 189  ASP A CA  
1083 C C   . ASP A 193 ? 0.5789 0.4023 0.5879 -0.0324 -0.0088 -0.0202 189  ASP A C   
1084 O O   . ASP A 193 ? 0.5581 0.4072 0.5676 -0.0314 -0.0071 -0.0175 189  ASP A O   
1085 C CB  . ASP A 193 ? 0.6499 0.4621 0.6334 -0.0035 -0.0064 -0.0246 189  ASP A CB  
1086 C CG  . ASP A 193 ? 0.6979 0.5015 0.6738 -0.0024 -0.0138 -0.0415 189  ASP A CG  
1087 O OD1 . ASP A 193 ? 0.6414 0.4524 0.6250 -0.0139 -0.0196 -0.0478 189  ASP A OD1 
1088 O OD2 . ASP A 193 ? 0.8262 0.6146 0.7877 0.0107  -0.0143 -0.0489 189  ASP A OD2 
1089 N N   . ARG A 194 ? 0.5722 0.3838 0.5925 -0.0452 -0.0132 -0.0255 190  ARG A N   
1090 C CA  . ARG A 194 ? 0.5761 0.4085 0.6119 -0.0584 -0.0148 -0.0265 190  ARG A CA  
1091 C C   . ARG A 194 ? 0.5516 0.4014 0.5833 -0.0548 -0.0216 -0.0386 190  ARG A C   
1092 O O   . ARG A 194 ? 0.5404 0.4151 0.5789 -0.0583 -0.0204 -0.0362 190  ARG A O   
1093 C CB  . ARG A 194 ? 0.5773 0.3943 0.6301 -0.0739 -0.0180 -0.0289 190  ARG A CB  
1094 C CG  . ARG A 194 ? 0.6043 0.4065 0.6626 -0.0798 -0.0096 -0.0136 190  ARG A CG  
1095 C CD  . ARG A 194 ? 0.6344 0.4154 0.7097 -0.0953 -0.0129 -0.0162 190  ARG A CD  
1096 N NE  . ARG A 194 ? 0.6038 0.4051 0.6997 -0.1087 -0.0179 -0.0238 190  ARG A NE  
1097 C CZ  . ARG A 194 ? 0.6744 0.4633 0.7868 -0.1213 -0.0265 -0.0338 190  ARG A CZ  
1098 N NH1 . ARG A 194 ? 0.6638 0.4166 0.7723 -0.1224 -0.0312 -0.0384 190  ARG A NH1 
1099 N NH2 . ARG A 194 ? 0.6956 0.5083 0.8292 -0.1326 -0.0312 -0.0399 190  ARG A NH2 
1100 N N   . ASP A 195 ? 0.5399 0.3754 0.5588 -0.0466 -0.0284 -0.0514 191  ASP A N   
1101 C CA  . ASP A 195 ? 0.5040 0.3537 0.5151 -0.0414 -0.0349 -0.0622 191  ASP A CA  
1102 C C   . ASP A 195 ? 0.5047 0.3760 0.5070 -0.0320 -0.0282 -0.0540 191  ASP A C   
1103 O O   . ASP A 195 ? 0.5043 0.3959 0.5082 -0.0328 -0.0303 -0.0556 191  ASP A O   
1104 C CB  . ASP A 195 ? 0.5815 0.4095 0.5748 -0.0316 -0.0423 -0.0766 191  ASP A CB  
1105 C CG  . ASP A 195 ? 0.6924 0.4971 0.6943 -0.0417 -0.0520 -0.0876 191  ASP A CG  
1106 O OD1 . ASP A 195 ? 0.7105 0.5249 0.7267 -0.0529 -0.0605 -0.0946 191  ASP A OD1 
1107 O OD2 . ASP A 195 ? 0.7505 0.5269 0.7455 -0.0381 -0.0519 -0.0898 191  ASP A OD2 
1108 N N   . TYR A 196 ? 0.4626 0.3292 0.4569 -0.0230 -0.0206 -0.0453 192  TYR A N   
1109 C CA  . TYR A 196 ? 0.4517 0.3386 0.4404 -0.0154 -0.0151 -0.0378 192  TYR A CA  
1110 C C   . TYR A 196 ? 0.4509 0.3586 0.4522 -0.0244 -0.0124 -0.0288 192  TYR A C   
1111 O O   . TYR A 196 ? 0.4360 0.3619 0.4359 -0.0229 -0.0126 -0.0282 192  TYR A O   
1112 C CB  . TYR A 196 ? 0.4671 0.3479 0.4486 -0.0041 -0.0084 -0.0299 192  TYR A CB  
1113 C CG  . TYR A 196 ? 0.4732 0.3764 0.4532 0.0015  -0.0038 -0.0224 192  TYR A CG  
1114 C CD1 . TYR A 196 ? 0.4605 0.3708 0.4299 0.0102  -0.0033 -0.0268 192  TYR A CD1 
1115 C CD2 . TYR A 196 ? 0.4530 0.3697 0.4417 -0.0028 -0.0004 -0.0110 192  TYR A CD2 
1116 C CE1 . TYR A 196 ? 0.4598 0.3899 0.4304 0.0133  0.0009  -0.0191 192  TYR A CE1 
1117 C CE2 . TYR A 196 ? 0.4591 0.3947 0.4481 0.0005  0.0020  -0.0052 192  TYR A CE2 
1118 C CZ  . TYR A 196 ? 0.4671 0.4094 0.4487 0.0078  0.0028  -0.0089 192  TYR A CZ  
1119 O OH  . TYR A 196 ? 0.4671 0.4273 0.4515 0.0093  0.0053  -0.0021 192  TYR A OH  
1120 N N   . VAL A 197 ? 0.4702 0.3734 0.4820 -0.0329 -0.0096 -0.0216 193  VAL A N   
1121 C CA  . VAL A 197 ? 0.4485 0.3697 0.4692 -0.0399 -0.0058 -0.0131 193  VAL A CA  
1122 C C   . VAL A 197 ? 0.4313 0.3686 0.4606 -0.0466 -0.0101 -0.0200 193  VAL A C   
1123 O O   . VAL A 197 ? 0.4333 0.3889 0.4629 -0.0459 -0.0086 -0.0169 193  VAL A O   
1124 C CB  . VAL A 197 ? 0.4400 0.3513 0.4685 -0.0476 -0.0010 -0.0037 193  VAL A CB  
1125 C CG1 . VAL A 197 ? 0.4430 0.3730 0.4799 -0.0552 0.0033  0.0035  193  VAL A CG1 
1126 C CG2 . VAL A 197 ? 0.4677 0.3677 0.4870 -0.0388 0.0030  0.0054  193  VAL A CG2 
1127 N N   . VAL A 198 ? 0.4535 0.3838 0.4896 -0.0522 -0.0165 -0.0301 194  VAL A N   
1128 C CA  . VAL A 198 ? 0.4357 0.3826 0.4813 -0.0571 -0.0221 -0.0374 194  VAL A CA  
1129 C C   . VAL A 198 ? 0.4424 0.3988 0.4742 -0.0469 -0.0255 -0.0419 194  VAL A C   
1130 O O   . VAL A 198 ? 0.4220 0.3966 0.4571 -0.0469 -0.0255 -0.0406 194  VAL A O   
1131 C CB  . VAL A 198 ? 0.4522 0.3900 0.5086 -0.0649 -0.0308 -0.0487 194  VAL A CB  
1132 C CG1 . VAL A 198 ? 0.4413 0.4000 0.5090 -0.0684 -0.0375 -0.0558 194  VAL A CG1 
1133 C CG2 . VAL A 198 ? 0.4594 0.3865 0.5319 -0.0770 -0.0269 -0.0431 194  VAL A CG2 
1134 N N   . TYR A 199 ? 0.4556 0.3986 0.4717 -0.0376 -0.0278 -0.0468 195  TYR A N   
1135 C CA  . TYR A 199 ? 0.4643 0.4136 0.4651 -0.0271 -0.0291 -0.0491 195  TYR A CA  
1136 C C   . TYR A 199 ? 0.4810 0.4454 0.4811 -0.0248 -0.0227 -0.0388 195  TYR A C   
1137 O O   . TYR A 199 ? 0.4312 0.4085 0.4300 -0.0234 -0.0250 -0.0396 195  TYR A O   
1138 C CB  . TYR A 199 ? 0.4826 0.4148 0.4663 -0.0165 -0.0282 -0.0525 195  TYR A CB  
1139 C CG  . TYR A 199 ? 0.4766 0.4157 0.4454 -0.0054 -0.0243 -0.0491 195  TYR A CG  
1140 C CD1 . TYR A 199 ? 0.5198 0.4673 0.4802 -0.0018 -0.0287 -0.0535 195  TYR A CD1 
1141 C CD2 . TYR A 199 ? 0.4964 0.4341 0.4607 0.0015  -0.0160 -0.0408 195  TYR A CD2 
1142 C CE1 . TYR A 199 ? 0.5021 0.4550 0.4493 0.0076  -0.0238 -0.0486 195  TYR A CE1 
1143 C CE2 . TYR A 199 ? 0.5449 0.4905 0.4991 0.0104  -0.0113 -0.0365 195  TYR A CE2 
1144 C CZ  . TYR A 199 ? 0.5677 0.5201 0.5131 0.0129  -0.0146 -0.0400 195  TYR A CZ  
1145 O OH  . TYR A 199 ? 0.5934 0.5526 0.5294 0.0208  -0.0087 -0.0340 195  TYR A OH  
1146 N N   . SER A 200 ? 0.4396 0.4018 0.4406 -0.0241 -0.0159 -0.0293 196  SER A N   
1147 C CA  . SER A 200 ? 0.4444 0.4196 0.4448 -0.0221 -0.0117 -0.0205 196  SER A CA  
1148 C C   . SER A 200 ? 0.4339 0.4221 0.4441 -0.0295 -0.0117 -0.0180 196  SER A C   
1149 O O   . SER A 200 ? 0.4399 0.4390 0.4481 -0.0278 -0.0117 -0.0158 196  SER A O   
1150 C CB  . SER A 200 ? 0.4751 0.4459 0.4743 -0.0187 -0.0061 -0.0115 196  SER A CB  
1151 O OG  . SER A 200 ? 0.4616 0.4456 0.4621 -0.0183 -0.0041 -0.0040 196  SER A OG  
1152 N N   . SER A 201 ? 0.4226 0.4094 0.4434 -0.0375 -0.0110 -0.0181 197  SER A N   
1153 C CA  . SER A 201 ? 0.3898 0.3906 0.4201 -0.0434 -0.0094 -0.0160 197  SER A CA  
1154 C C   . SER A 201 ? 0.3911 0.4034 0.4231 -0.0419 -0.0150 -0.0236 197  SER A C   
1155 O O   . SER A 201 ? 0.4018 0.4259 0.4343 -0.0409 -0.0141 -0.0218 197  SER A O   
1156 C CB  . SER A 201 ? 0.4169 0.4150 0.4605 -0.0528 -0.0068 -0.0146 197  SER A CB  
1157 O OG  . SER A 201 ? 0.4437 0.4316 0.4842 -0.0535 -0.0009 -0.0052 197  SER A OG  
1158 N N   . VAL A 202 ? 0.4309 0.4384 0.4625 -0.0409 -0.0215 -0.0324 198  VAL A N   
1159 C CA  . VAL A 202 ? 0.4130 0.4297 0.4439 -0.0377 -0.0282 -0.0396 198  VAL A CA  
1160 C C   . VAL A 202 ? 0.4286 0.4454 0.4440 -0.0287 -0.0283 -0.0373 198  VAL A C   
1161 O O   . VAL A 202 ? 0.4201 0.4467 0.4354 -0.0265 -0.0295 -0.0367 198  VAL A O   
1162 C CB  . VAL A 202 ? 0.4338 0.4437 0.4656 -0.0381 -0.0368 -0.0503 198  VAL A CB  
1163 C CG1 . VAL A 202 ? 0.4275 0.4461 0.4547 -0.0323 -0.0449 -0.0570 198  VAL A CG1 
1164 C CG2 . VAL A 202 ? 0.4442 0.4559 0.4967 -0.0494 -0.0378 -0.0528 198  VAL A CG2 
1165 N N   . CYS A 203 ? 0.4197 0.4253 0.4227 -0.0234 -0.0263 -0.0354 199  CYS A N   
1166 C CA  . CYS A 203 ? 0.4362 0.4418 0.4259 -0.0157 -0.0255 -0.0324 199  CYS A CA  
1167 C C   . CYS A 203 ? 0.4398 0.4519 0.4315 -0.0165 -0.0207 -0.0236 199  CYS A C   
1168 O O   . CYS A 203 ? 0.4283 0.4440 0.4149 -0.0133 -0.0216 -0.0216 199  CYS A O   
1169 C CB  . CYS A 203 ? 0.4985 0.4925 0.4760 -0.0091 -0.0231 -0.0326 199  CYS A CB  
1170 S SG  . CYS A 203 ? 0.9362 0.9218 0.9022 -0.0040 -0.0314 -0.0449 199  CYS A SG  
1171 N N   . SER A 204 ? 0.4371 0.4493 0.4355 -0.0208 -0.0164 -0.0183 200  SER A N   
1172 C CA  . SER A 204 ? 0.4317 0.4490 0.4306 -0.0213 -0.0135 -0.0109 200  SER A CA  
1173 C C   . SER A 204 ? 0.4451 0.4707 0.4491 -0.0249 -0.0145 -0.0114 200  SER A C   
1174 O O   . SER A 204 ? 0.4403 0.4690 0.4418 -0.0242 -0.0146 -0.0080 200  SER A O   
1175 C CB  . SER A 204 ? 0.4208 0.4343 0.4217 -0.0221 -0.0094 -0.0044 200  SER A CB  
1176 O OG  . SER A 204 ? 0.4849 0.4917 0.4814 -0.0169 -0.0076 -0.0037 200  SER A OG  
1177 N N   . PHE A 205 ? 0.3877 0.4172 0.3993 -0.0286 -0.0152 -0.0159 201  PHE A N   
1178 C CA  . PHE A 205 ? 0.3769 0.4160 0.3936 -0.0310 -0.0138 -0.0156 201  PHE A CA  
1179 C C   . PHE A 205 ? 0.3798 0.4284 0.4051 -0.0313 -0.0169 -0.0226 201  PHE A C   
1180 O O   . PHE A 205 ? 0.3890 0.4433 0.4123 -0.0275 -0.0190 -0.0246 201  PHE A O   
1181 C CB  . PHE A 205 ? 0.4090 0.4479 0.4299 -0.0358 -0.0080 -0.0101 201  PHE A CB  
1182 C CG  . PHE A 205 ? 0.3909 0.4394 0.4135 -0.0368 -0.0046 -0.0087 201  PHE A CG  
1183 C CD1 . PHE A 205 ? 0.4218 0.4704 0.4346 -0.0333 -0.0048 -0.0059 201  PHE A CD1 
1184 C CD2 . PHE A 205 ? 0.4086 0.4661 0.4430 -0.0410 -0.0011 -0.0103 201  PHE A CD2 
1185 C CE1 . PHE A 205 ? 0.4384 0.4943 0.4492 -0.0325 -0.0015 -0.0055 201  PHE A CE1 
1186 C CE2 . PHE A 205 ? 0.4023 0.4698 0.4373 -0.0404 0.0039  -0.0086 201  PHE A CE2 
1187 C CZ  . PHE A 205 ? 0.4102 0.4759 0.4314 -0.0353 0.0037  -0.0067 201  PHE A CZ  
1188 N N   . PHE A 206 ? 0.4192 0.4694 0.4550 -0.0358 -0.0179 -0.0265 202  PHE A N   
1189 C CA  . PHE A 206 ? 0.4071 0.4708 0.4564 -0.0372 -0.0207 -0.0325 202  PHE A CA  
1190 C C   . PHE A 206 ? 0.4398 0.5054 0.4844 -0.0304 -0.0292 -0.0391 202  PHE A C   
1191 O O   . PHE A 206 ? 0.4274 0.5056 0.4811 -0.0285 -0.0323 -0.0434 202  PHE A O   
1192 C CB  . PHE A 206 ? 0.3946 0.4599 0.4598 -0.0455 -0.0206 -0.0349 202  PHE A CB  
1193 C CG  . PHE A 206 ? 0.4019 0.4681 0.4741 -0.0523 -0.0112 -0.0272 202  PHE A CG  
1194 C CD1 . PHE A 206 ? 0.4004 0.4802 0.4780 -0.0526 -0.0046 -0.0235 202  PHE A CD1 
1195 C CD2 . PHE A 206 ? 0.4366 0.4885 0.5076 -0.0572 -0.0086 -0.0233 202  PHE A CD2 
1196 C CE1 . PHE A 206 ? 0.4292 0.5091 0.5099 -0.0580 0.0050  -0.0151 202  PHE A CE1 
1197 C CE2 . PHE A 206 ? 0.4354 0.4861 0.5108 -0.0629 0.0003  -0.0146 202  PHE A CE2 
1198 C CZ  . PHE A 206 ? 0.4199 0.4847 0.4993 -0.0634 0.0073  -0.0100 202  PHE A CZ  
1199 N N   . LEU A 207 ? 0.4967 0.5501 0.5268 -0.0258 -0.0324 -0.0394 203  LEU A N   
1200 C CA  . LEU A 207 ? 0.5035 0.5562 0.5248 -0.0182 -0.0397 -0.0438 203  LEU A CA  
1201 C C   . LEU A 207 ? 0.5338 0.5841 0.5440 -0.0124 -0.0384 -0.0390 203  LEU A C   
1202 O O   . LEU A 207 ? 0.5159 0.5710 0.5256 -0.0071 -0.0429 -0.0417 203  LEU A O   
1203 C CB  . LEU A 207 ? 0.5280 0.5685 0.5375 -0.0155 -0.0433 -0.0466 203  LEU A CB  
1204 C CG  . LEU A 207 ? 0.5589 0.5973 0.5575 -0.0077 -0.0520 -0.0525 203  LEU A CG  
1205 C CD1 . LEU A 207 ? 0.6068 0.6595 0.6198 -0.0081 -0.0600 -0.0599 203  LEU A CD1 
1206 C CD2 . LEU A 207 ? 0.6085 0.6349 0.5964 -0.0060 -0.0545 -0.0569 203  LEU A CD2 
1207 N N   . PRO A 208 ? 0.5175 0.5600 0.5203 -0.0134 -0.0330 -0.0319 204  PRO A N   
1208 C CA  . PRO A 208 ? 0.5129 0.5524 0.5081 -0.0097 -0.0329 -0.0280 204  PRO A CA  
1209 C C   . PRO A 208 ? 0.5159 0.5629 0.5170 -0.0096 -0.0324 -0.0293 204  PRO A C   
1210 O O   . PRO A 208 ? 0.4910 0.5350 0.4864 -0.0045 -0.0353 -0.0296 204  PRO A O   
1211 C CB  . PRO A 208 ? 0.5284 0.5609 0.5190 -0.0123 -0.0280 -0.0206 204  PRO A CB  
1212 C CG  . PRO A 208 ? 0.5459 0.5792 0.5424 -0.0168 -0.0246 -0.0204 204  PRO A CG  
1213 C CD  . PRO A 208 ? 0.5283 0.5635 0.5286 -0.0165 -0.0283 -0.0274 204  PRO A CD  
1214 N N   . CYS A 209 ? 0.4784 0.5338 0.4894 -0.0142 -0.0282 -0.0297 205  CYS A N   
1215 C CA  . CYS A 209 ? 0.4948 0.5574 0.5085 -0.0126 -0.0260 -0.0308 205  CYS A CA  
1216 C C   . CYS A 209 ? 0.4863 0.5572 0.5049 -0.0061 -0.0304 -0.0369 205  CYS A C   
1217 O O   . CYS A 209 ? 0.5014 0.5692 0.5135 -0.0003 -0.0319 -0.0378 205  CYS A O   
1218 C CB  . CYS A 209 ? 0.4878 0.5584 0.5100 -0.0182 -0.0191 -0.0287 205  CYS A CB  
1219 S SG  . CYS A 209 ? 0.6714 0.7316 0.6838 -0.0222 -0.0151 -0.0209 205  CYS A SG  
1220 N N   . PRO A 210 ? 0.4878 0.5688 0.5181 -0.0065 -0.0335 -0.0415 206  PRO A N   
1221 C CA  . PRO A 210 ? 0.4939 0.5839 0.5294 0.0012  -0.0390 -0.0470 206  PRO A CA  
1222 C C   . PRO A 210 ? 0.5001 0.5768 0.5199 0.0093  -0.0456 -0.0467 206  PRO A C   
1223 O O   . PRO A 210 ? 0.5172 0.5948 0.5351 0.0173  -0.0484 -0.0489 206  PRO A O   
1224 C CB  . PRO A 210 ? 0.5022 0.6048 0.5537 -0.0020 -0.0433 -0.0521 206  PRO A CB  
1225 C CG  . PRO A 210 ? 0.4784 0.5709 0.5262 -0.0096 -0.0419 -0.0497 206  PRO A CG  
1226 C CD  . PRO A 210 ? 0.4867 0.5720 0.5280 -0.0136 -0.0332 -0.0428 206  PRO A CD  
1227 N N   . LEU A 211 ? 0.5055 0.5693 0.5138 0.0079  -0.0474 -0.0435 207  LEU A N   
1228 C CA  . LEU A 211 ? 0.5112 0.5617 0.5040 0.0149  -0.0519 -0.0411 207  LEU A CA  
1229 C C   . LEU A 211 ? 0.5359 0.5757 0.5209 0.0162  -0.0494 -0.0368 207  LEU A C   
1230 O O   . LEU A 211 ? 0.5659 0.5989 0.5443 0.0235  -0.0535 -0.0371 207  LEU A O   
1231 C CB  . LEU A 211 ? 0.5367 0.5769 0.5185 0.0132  -0.0518 -0.0375 207  LEU A CB  
1232 C CG  . LEU A 211 ? 0.6159 0.6628 0.6021 0.0129  -0.0564 -0.0436 207  LEU A CG  
1233 C CD1 . LEU A 211 ? 0.6725 0.7074 0.6435 0.0139  -0.0558 -0.0407 207  LEU A CD1 
1234 C CD2 . LEU A 211 ? 0.6187 0.6748 0.6092 0.0202  -0.0657 -0.0503 207  LEU A CD2 
1235 N N   . MET A 212 ? 0.4750 0.5120 0.4603 0.0093  -0.0438 -0.0331 208  MET A N   
1236 C CA  . MET A 212 ? 0.4801 0.5070 0.4590 0.0095  -0.0431 -0.0306 208  MET A CA  
1237 C C   . MET A 212 ? 0.4947 0.5260 0.4758 0.0155  -0.0441 -0.0363 208  MET A C   
1238 O O   . MET A 212 ? 0.5080 0.5269 0.4808 0.0203  -0.0474 -0.0365 208  MET A O   
1239 C CB  . MET A 212 ? 0.5151 0.5407 0.4948 0.0014  -0.0384 -0.0262 208  MET A CB  
1240 C CG  . MET A 212 ? 0.5596 0.5878 0.5398 0.0003  -0.0363 -0.0282 208  MET A CG  
1241 S SD  . MET A 212 ? 0.5598 0.5863 0.5398 -0.0081 -0.0329 -0.0220 208  MET A SD  
1242 C CE  . MET A 212 ? 0.5880 0.6219 0.5756 -0.0118 -0.0290 -0.0197 208  MET A CE  
1243 N N   . LEU A 213 ? 0.4271 0.4753 0.4196 0.0157  -0.0411 -0.0406 209  LEU A N   
1244 C CA  . LEU A 213 ? 0.4541 0.5097 0.4497 0.0230  -0.0403 -0.0460 209  LEU A CA  
1245 C C   . LEU A 213 ? 0.4641 0.5179 0.4587 0.0335  -0.0471 -0.0496 209  LEU A C   
1246 O O   . LEU A 213 ? 0.4918 0.5394 0.4808 0.0418  -0.0486 -0.0527 209  LEU A O   
1247 C CB  . LEU A 213 ? 0.4606 0.5378 0.4717 0.0203  -0.0339 -0.0483 209  LEU A CB  
1248 C CG  . LEU A 213 ? 0.5069 0.5838 0.5159 0.0120  -0.0267 -0.0441 209  LEU A CG  
1249 C CD1 . LEU A 213 ? 0.5022 0.5988 0.5273 0.0081  -0.0195 -0.0442 209  LEU A CD1 
1250 C CD2 . LEU A 213 ? 0.5297 0.5962 0.5245 0.0153  -0.0255 -0.0445 209  LEU A CD2 
1251 N N   . LEU A 214 ? 0.4740 0.5316 0.4722 0.0344  -0.0518 -0.0495 210  LEU A N   
1252 C CA  A LEU A 214 ? 0.4869 0.5419 0.4820 0.0454  -0.0596 -0.0519 210  LEU A CA  
1253 C CA  B LEU A 214 ? 0.4864 0.5416 0.4817 0.0455  -0.0595 -0.0520 210  LEU A CA  
1254 C C   . LEU A 214 ? 0.5105 0.5401 0.4871 0.0494  -0.0629 -0.0472 210  LEU A C   
1255 O O   . LEU A 214 ? 0.5165 0.5382 0.4877 0.0599  -0.0674 -0.0491 210  LEU A O   
1256 C CB  A LEU A 214 ? 0.4775 0.5405 0.4771 0.0452  -0.0651 -0.0529 210  LEU A CB  
1257 C CB  B LEU A 214 ? 0.4794 0.5437 0.4800 0.0455  -0.0651 -0.0533 210  LEU A CB  
1258 C CG  A LEU A 214 ? 0.4955 0.5520 0.4863 0.0570  -0.0745 -0.0535 210  LEU A CG  
1259 C CG  B LEU A 214 ? 0.4634 0.5538 0.4867 0.0429  -0.0647 -0.0592 210  LEU A CG  
1260 C CD1 A LEU A 214 ? 0.4981 0.5685 0.5006 0.0679  -0.0780 -0.0597 210  LEU A CD1 
1261 C CD1 B LEU A 214 ? 0.4808 0.5756 0.5066 0.0413  -0.0722 -0.0614 210  LEU A CD1 
1262 C CD2 A LEU A 214 ? 0.4987 0.5594 0.4882 0.0562  -0.0806 -0.0544 210  LEU A CD2 
1263 C CD2 B LEU A 214 ? 0.4669 0.5731 0.5029 0.0529  -0.0664 -0.0646 210  LEU A CD2 
1264 N N   . LEU A 215 ? 0.4735 0.4899 0.4413 0.0411  -0.0605 -0.0406 211  LEU A N   
1265 C CA  . LEU A 215 ? 0.5232 0.5161 0.4766 0.0424  -0.0627 -0.0345 211  LEU A CA  
1266 C C   . LEU A 215 ? 0.5406 0.5219 0.4906 0.0430  -0.0624 -0.0364 211  LEU A C   
1267 O O   . LEU A 215 ? 0.5592 0.5222 0.4998 0.0491  -0.0667 -0.0353 211  LEU A O   
1268 C CB  . LEU A 215 ? 0.5128 0.4987 0.4614 0.0332  -0.0591 -0.0265 211  LEU A CB  
1269 C CG  . LEU A 215 ? 0.5358 0.5233 0.4788 0.0361  -0.0608 -0.0237 211  LEU A CG  
1270 C CD1 . LEU A 215 ? 0.5659 0.5487 0.5049 0.0283  -0.0553 -0.0161 211  LEU A CD1 
1271 C CD2 . LEU A 215 ? 0.5681 0.5417 0.4985 0.0465  -0.0667 -0.0211 211  LEU A CD2 
1272 N N   . TYR A 216 ? 0.5099 0.4993 0.4654 0.0372  -0.0579 -0.0393 212  TYR A N   
1273 C CA  . TYR A 216 ? 0.5233 0.5014 0.4727 0.0390  -0.0587 -0.0430 212  TYR A CA  
1274 C C   . TYR A 216 ? 0.5711 0.5499 0.5195 0.0526  -0.0615 -0.0502 212  TYR A C   
1275 O O   . TYR A 216 ? 0.5559 0.5148 0.4942 0.0584  -0.0658 -0.0523 212  TYR A O   
1276 C CB  . TYR A 216 ? 0.5194 0.5080 0.4724 0.0325  -0.0535 -0.0451 212  TYR A CB  
1277 C CG  . TYR A 216 ? 0.5255 0.5075 0.4772 0.0209  -0.0528 -0.0386 212  TYR A CG  
1278 C CD1 . TYR A 216 ? 0.5691 0.5308 0.5137 0.0174  -0.0575 -0.0360 212  TYR A CD1 
1279 C CD2 . TYR A 216 ? 0.4904 0.4863 0.4496 0.0136  -0.0478 -0.0351 212  TYR A CD2 
1280 C CE1 . TYR A 216 ? 0.5393 0.4985 0.4866 0.0070  -0.0573 -0.0299 212  TYR A CE1 
1281 C CE2 . TYR A 216 ? 0.5277 0.5193 0.4871 0.0047  -0.0473 -0.0291 212  TYR A CE2 
1282 C CZ  . TYR A 216 ? 0.5513 0.5263 0.5059 0.0015  -0.0520 -0.0265 212  TYR A CZ  
1283 O OH  . TYR A 216 ? 0.5176 0.4919 0.4763 -0.0073 -0.0518 -0.0204 212  TYR A OH  
1284 N N   . TRP A 217 ? 0.5231 0.5244 0.4831 0.0578  -0.0596 -0.0540 213  TRP A N   
1285 C CA  . TRP A 217 ? 0.5406 0.5479 0.5035 0.0720  -0.0617 -0.0607 213  TRP A CA  
1286 C C   . TRP A 217 ? 0.5809 0.5699 0.5346 0.0819  -0.0699 -0.0590 213  TRP A C   
1287 O O   . TRP A 217 ? 0.6096 0.5853 0.5560 0.0929  -0.0729 -0.0632 213  TRP A O   
1288 C CB  . TRP A 217 ? 0.5231 0.5615 0.5052 0.0739  -0.0585 -0.0640 213  TRP A CB  
1289 C CG  . TRP A 217 ? 0.6367 0.6852 0.6257 0.0893  -0.0616 -0.0701 213  TRP A CG  
1290 C CD1 . TRP A 217 ? 0.6121 0.6681 0.6038 0.0992  -0.0573 -0.0765 213  TRP A CD1 
1291 C CD2 . TRP A 217 ? 0.7006 0.7539 0.6944 0.0979  -0.0697 -0.0703 213  TRP A CD2 
1292 N NE1 . TRP A 217 ? 0.6039 0.6704 0.6043 0.1136  -0.0620 -0.0806 213  TRP A NE1 
1293 C CE2 . TRP A 217 ? 0.6687 0.7335 0.6706 0.1130  -0.0704 -0.0769 213  TRP A CE2 
1294 C CE3 . TRP A 217 ? 0.7063 0.7551 0.6967 0.0957  -0.0766 -0.0658 213  TRP A CE3 
1295 C CZ2 . TRP A 217 ? 0.6622 0.7351 0.6708 0.1255  -0.0789 -0.0787 213  TRP A CZ2 
1296 C CZ3 . TRP A 217 ? 0.6663 0.7217 0.6605 0.1081  -0.0854 -0.0678 213  TRP A CZ3 
1297 C CH2 . TRP A 217 ? 0.6371 0.7049 0.6413 0.1226  -0.0870 -0.0741 213  TRP A CH2 
1298 N N   . ALA A 218 ? 0.5364 0.5229 0.4884 0.0790  -0.0733 -0.0528 214  ALA A N   
1299 C CA  . ALA A 218 ? 0.5523 0.5194 0.4924 0.0878  -0.0805 -0.0487 214  ALA A CA  
1300 C C   . ALA A 218 ? 0.5864 0.5213 0.5116 0.0859  -0.0818 -0.0446 214  ALA A C   
1301 O O   . ALA A 218 ? 0.6322 0.5485 0.5483 0.0966  -0.0871 -0.0447 214  ALA A O   
1302 C CB  . ALA A 218 ? 0.5321 0.5014 0.4692 0.0841  -0.0824 -0.0421 214  ALA A CB  
1303 N N   . THR A 219 ? 0.5649 0.4934 0.4890 0.0722  -0.0778 -0.0408 215  THR A N   
1304 C CA  . THR A 219 ? 0.6170 0.5171 0.5311 0.0672  -0.0797 -0.0369 215  THR A CA  
1305 C C   . THR A 219 ? 0.6146 0.5020 0.5237 0.0752  -0.0829 -0.0460 215  THR A C   
1306 O O   . THR A 219 ? 0.6142 0.4744 0.5131 0.0803  -0.0882 -0.0449 215  THR A O   
1307 C CB  . THR A 219 ? 0.5981 0.5000 0.5163 0.0511  -0.0755 -0.0326 215  THR A CB  
1308 O OG1 . THR A 219 ? 0.5923 0.5017 0.5128 0.0451  -0.0722 -0.0238 215  THR A OG1 
1309 C CG2 . THR A 219 ? 0.6254 0.4998 0.5372 0.0449  -0.0791 -0.0298 215  THR A CG2 
1310 N N   . PHE A 220 ? 0.6241 0.5297 0.5391 0.0768  -0.0792 -0.0547 216  PHE A N   
1311 C CA  . PHE A 220 ? 0.6529 0.5480 0.5607 0.0865  -0.0811 -0.0645 216  PHE A CA  
1312 C C   . PHE A 220 ? 0.6643 0.5547 0.5695 0.1043  -0.0850 -0.0684 216  PHE A C   
1313 O O   . PHE A 220 ? 0.6910 0.5563 0.5847 0.1132  -0.0899 -0.0730 216  PHE A O   
1314 C CB  . PHE A 220 ? 0.6421 0.5607 0.5554 0.0859  -0.0743 -0.0716 216  PHE A CB  
1315 C CG  . PHE A 220 ? 0.6276 0.5411 0.5371 0.0725  -0.0731 -0.0706 216  PHE A CG  
1316 C CD1 . PHE A 220 ? 0.6828 0.5725 0.5788 0.0730  -0.0782 -0.0764 216  PHE A CD1 
1317 C CD2 . PHE A 220 ? 0.6579 0.5894 0.5767 0.0602  -0.0682 -0.0645 216  PHE A CD2 
1318 C CE1 . PHE A 220 ? 0.7035 0.5897 0.5964 0.0612  -0.0792 -0.0759 216  PHE A CE1 
1319 C CE2 . PHE A 220 ? 0.6532 0.5809 0.5689 0.0492  -0.0681 -0.0632 216  PHE A CE2 
1320 C CZ  . PHE A 220 ? 0.6987 0.6049 0.6019 0.0496  -0.0740 -0.0689 216  PHE A CZ  
1321 N N   . ARG A 221 ? 0.6317 0.5451 0.5475 0.1100  -0.0839 -0.0668 217  ARG A N   
1322 C CA  . ARG A 221 ? 0.6601 0.5727 0.5757 0.1281  -0.0887 -0.0701 217  ARG A CA  
1323 C C   . ARG A 221 ? 0.6806 0.5594 0.5816 0.1311  -0.0963 -0.0625 217  ARG A C   
1324 O O   . ARG A 221 ? 0.6720 0.5308 0.5642 0.1453  -0.1015 -0.0657 217  ARG A O   
1325 C CB  . ARG A 221 ? 0.6260 0.5730 0.5586 0.1320  -0.0877 -0.0703 217  ARG A CB  
1326 C CG  . ARG A 221 ? 0.6881 0.6452 0.6268 0.1520  -0.0916 -0.0764 217  ARG A CG  
1327 N N   . GLY A 222 ? 0.7127 0.5842 0.6106 0.1181  -0.0960 -0.0519 218  GLY A N   
1328 C CA  . GLY A 222 ? 0.6997 0.5395 0.5838 0.1182  -0.1008 -0.0418 218  GLY A CA  
1329 C C   . GLY A 222 ? 0.7386 0.5428 0.6118 0.1174  -0.1042 -0.0432 218  GLY A C   
1330 O O   . GLY A 222 ? 0.7546 0.5309 0.6165 0.1269  -0.1099 -0.0400 218  GLY A O   
1331 N N   . LEU A 223 ? 0.7504 0.5538 0.6262 0.1062  -0.1016 -0.0480 219  LEU A N   
1332 C CA  . LEU A 223 ? 0.7776 0.5472 0.6436 0.1042  -0.1066 -0.0515 219  LEU A CA  
1333 C C   . LEU A 223 ? 0.7785 0.5364 0.6365 0.1231  -0.1108 -0.0634 219  LEU A C   
1334 O O   . LEU A 223 ? 0.8007 0.5225 0.6469 0.1286  -0.1174 -0.0636 219  LEU A O   
1335 C CB  . LEU A 223 ? 0.7714 0.5455 0.6416 0.0888  -0.1045 -0.0552 219  LEU A CB  
1336 C CG  . LEU A 223 ? 0.7431 0.5185 0.6202 0.0697  -0.1019 -0.0431 219  LEU A CG  
1337 C CD1 . LEU A 223 ? 0.7253 0.5137 0.6088 0.0571  -0.1000 -0.0476 219  LEU A CD1 
1338 C CD2 . LEU A 223 ? 0.7635 0.5024 0.6345 0.0639  -0.1070 -0.0340 219  LEU A CD2 
1339 N N   . GLN A 224 ? 0.7563 0.5441 0.6213 0.1331  -0.1065 -0.0731 220  GLN A N   
1340 C CA  . GLN A 224 ? 0.7747 0.5575 0.6340 0.1532  -0.1085 -0.0847 220  GLN A CA  
1341 C C   . GLN A 224 ? 0.7957 0.5560 0.6475 0.1685  -0.1153 -0.0810 220  GLN A C   
1342 O O   . GLN A 224 ? 0.7875 0.5200 0.6274 0.1817  -0.1204 -0.0880 220  GLN A O   
1343 C CB  . GLN A 224 ? 0.7708 0.5961 0.6439 0.1617  -0.1010 -0.0917 220  GLN A CB  
1344 C CG  . GLN A 224 ? 0.8269 0.6663 0.7005 0.1552  -0.0944 -0.0995 220  GLN A CG  
1345 C CD  . GLN A 224 ? 0.8762 0.7365 0.7530 0.1731  -0.0887 -0.1108 220  GLN A CD  
1346 O OE1 . GLN A 224 ? 0.8525 0.7165 0.7329 0.1906  -0.0905 -0.1135 220  GLN A OE1 
1347 N NE2 . GLN A 224 ? 0.9310 0.8056 0.8063 0.1696  -0.0814 -0.1170 220  GLN A NE2 
1348 N N   . ARG A 225 ? 0.8126 0.5831 0.6695 0.1675  -0.1160 -0.0700 221  ARG A N   
1349 C CA  . ARG A 225 ? 0.8252 0.5761 0.6737 0.1825  -0.1228 -0.0644 221  ARG A CA  
1350 C C   . ARG A 225 ? 0.8326 0.5331 0.6641 0.1790  -0.1287 -0.0580 221  ARG A C   
1351 O O   . ARG A 225 ? 0.8803 0.5550 0.7010 0.1944  -0.1350 -0.0560 221  ARG A O   
1352 C CB  . ARG A 225 ? 0.8746 0.6463 0.7288 0.1802  -0.1226 -0.0535 221  ARG A CB  
1353 C CG  . ARG A 225 ? 0.9285 0.7244 0.7902 0.2002  -0.1263 -0.0573 221  ARG A CG  
1354 C CD  . ARG A 225 ? 0.9108 0.7521 0.7909 0.1939  -0.1222 -0.0584 221  ARG A CD  
1355 N NE  . ARG A 225 ? 0.9559 0.7966 0.8323 0.1775  -0.1205 -0.0472 221  ARG A NE  
1356 C CZ  . ARG A 225 ? 0.9660 0.8387 0.8552 0.1681  -0.1168 -0.0472 221  ARG A CZ  
1357 N NH1 . ARG A 225 ? 0.9366 0.8450 0.8452 0.1717  -0.1145 -0.0568 221  ARG A NH1 
1358 N NH2 . ARG A 225 ? 0.9924 0.8612 0.8755 0.1551  -0.1149 -0.0373 221  ARG A NH2 
1359 N N   . TRP A 226 ? 0.8643 0.5504 0.6946 0.1589  -0.1270 -0.0546 222  TRP A N   
1360 C CA  . TRP A 226 ? 0.8781 0.5170 0.6964 0.1522  -0.1325 -0.0483 222  TRP A CA  
1361 C C   . TRP A 226 ? 0.9003 0.5107 0.7098 0.1575  -0.1381 -0.0621 222  TRP A C   
1362 O O   . TRP A 226 ? 0.9128 0.4802 0.7123 0.1542  -0.1444 -0.0589 222  TRP A O   
1363 C CB  . TRP A 226 ? 0.9122 0.5495 0.7364 0.1272  -0.1289 -0.0370 222  TRP A CB  
1364 C CG  . TRP A 226 ? 0.9958 0.6445 0.8215 0.1233  -0.1247 -0.0211 222  TRP A CG  
1365 C CD1 . TRP A 226 ? 0.9753 0.6629 0.8106 0.1198  -0.1185 -0.0188 222  TRP A CD1 
1366 C CD2 . TRP A 226 ? 1.0434 0.6628 0.8585 0.1236  -0.1263 -0.0053 222  TRP A CD2 
1367 N NE1 . TRP A 226 ? 1.0075 0.6921 0.8372 0.1186  -0.1166 -0.0037 222  TRP A NE1 
1368 C CE2 . TRP A 226 ? 1.0443 0.6881 0.8612 0.1210  -0.1206 0.0056  222  TRP A CE2 
1369 C CE3 . TRP A 226 ? 1.0704 0.6436 0.8735 0.1258  -0.1318 0.0010  222  TRP A CE3 
1370 C CZ2 . TRP A 226 ? 1.0567 0.6817 0.8618 0.1216  -0.1195 0.0229  222  TRP A CZ2 
1371 C CZ3 . TRP A 226 ? 1.1023 0.6564 0.8956 0.1253  -0.1303 0.0196  222  TRP A CZ3 
1372 C CH2 . TRP A 226 ? 1.0692 0.6501 0.8629 0.1236  -0.1238 0.0305  222  TRP A CH2 
1373 N N   . GLU A 227 ? 0.8606 0.4937 0.6730 0.1657  -0.1355 -0.0773 223  GLU A N   
1374 C CA  . GLU A 227 ? 0.8552 0.4634 0.6564 0.1706  -0.1402 -0.0921 223  GLU A CA  
1375 C C   . GLU A 227 ? 0.8986 0.4815 0.6871 0.1957  -0.1458 -0.1002 223  GLU A C   
1376 O O   . GLU A 227 ? 0.8663 0.4744 0.6592 0.2148  -0.1424 -0.1042 223  GLU A O   
1377 C CB  . GLU A 227 ? 0.8174 0.4602 0.6242 0.1687  -0.1337 -0.1040 223  GLU A CB  
1378 C CG  . GLU A 227 ? 0.8100 0.4698 0.6269 0.1442  -0.1302 -0.0969 223  GLU A CG  
1379 C CD  . GLU A 227 ? 0.8155 0.5107 0.6376 0.1418  -0.1230 -0.1058 223  GLU A CD  
1380 O OE1 . GLU A 227 ? 0.8154 0.5216 0.6322 0.1583  -0.1199 -0.1181 223  GLU A OE1 
1381 O OE2 . GLU A 227 ? 0.8033 0.5146 0.6342 0.1237  -0.1199 -0.0998 223  GLU A OE2 
1382 N N   . VAL A 228 ? 0.8769 0.4094 0.6509 0.1957  -0.1547 -0.1025 224  VAL A N   
1383 C CA  . VAL A 228 ? 0.9088 0.4120 0.6691 0.2203  -0.1606 -0.1099 224  VAL A CA  
1384 C C   . VAL A 228 ? 0.9093 0.4270 0.6643 0.2377  -0.1580 -0.1301 224  VAL A C   
1385 O O   . VAL A 228 ? 0.8985 0.4289 0.6533 0.2278  -0.1552 -0.1391 224  VAL A O   
1386 C CB  . VAL A 228 ? 0.9789 0.4238 0.7258 0.2136  -0.1704 -0.1069 224  VAL A CB  
1387 C CG1 . VAL A 228 ? 1.0019 0.4274 0.7528 0.1961  -0.1720 -0.0861 224  VAL A CG1 
1388 C CG2 . VAL A 228 ? 0.9640 0.3937 0.7056 0.2005  -0.1743 -0.1195 224  VAL A CG2 
1389 N N   . ALA A 229 ? 0.8772 0.4008 0.6300 0.2610  -0.1570 -0.1345 225  ALA A N   
1390 C CA  . ALA A 229 ? 0.8871 0.4275 0.6356 0.2772  -0.1522 -0.1508 225  ALA A CA  
1391 C C   . ALA A 229 ? 0.9250 0.4306 0.6562 0.2713  -0.1577 -0.1613 225  ALA A C   
1392 O O   . ALA A 229 ? 0.9224 0.4413 0.6481 0.2722  -0.1538 -0.1739 225  ALA A O   
1393 C CB  . ALA A 229 ? 0.9021 0.4547 0.6539 0.3015  -0.1507 -0.1509 225  ALA A CB  
1394 N N   . ARG A 230 ? 0.9574 0.4190 0.6799 0.2653  -0.1666 -0.1556 226  ARG A N   
1395 C CA  . ARG A 230 ? 0.9976 0.4249 0.7053 0.2599  -0.1735 -0.1658 226  ARG A CA  
1396 C C   . ARG A 230 ? 0.9889 0.4021 0.6978 0.2324  -0.1786 -0.1640 226  ARG A C   
1397 O O   . ARG A 230 ? 1.0148 0.3914 0.7221 0.2172  -0.1868 -0.1577 226  ARG A O   
1398 C CB  . ARG A 230 ? 1.0459 0.4331 0.7451 0.2669  -0.1805 -0.1617 226  ARG A CB  
1399 C CG  . ARG A 230 ? 1.0596 0.4616 0.7567 0.2956  -0.1761 -0.1664 226  ARG A CG  
1400 C CD  . ARG A 230 ? 1.1107 0.4726 0.7979 0.3046  -0.1829 -0.1634 226  ARG A CD  
1401 N NE  . ARG A 230 ? 1.1223 0.5021 0.8093 0.3323  -0.1788 -0.1681 226  ARG A NE  
1402 C CZ  . ARG A 230 ? 1.1431 0.5298 0.8216 0.3494  -0.1759 -0.1837 226  ARG A CZ  
1403 N NH1 . ARG A 230 ? 1.1565 0.5320 0.8235 0.3424  -0.1774 -0.1965 226  ARG A NH1 
1404 N NH2 . ARG A 230 ? 1.1530 0.5581 0.8346 0.3741  -0.1718 -0.1862 226  ARG A NH2 
1405 N N   . ARG A 231 ? 0.9759 0.4205 0.6890 0.2266  -0.1733 -0.1696 227  ARG A N   
1406 C CA  A ARG A 231 ? 0.9610 0.4014 0.6779 0.2014  -0.1775 -0.1680 227  ARG A CA  
1407 C CA  B ARG A 231 ? 0.9611 0.4015 0.6779 0.2015  -0.1775 -0.1681 227  ARG A CA  
1408 C C   . ARG A 231 ? 1.0010 0.4080 0.7070 0.1908  -0.1879 -0.1765 227  ARG A C   
1409 O O   . ARG A 231 ? 1.0069 0.3925 0.7198 0.1686  -0.1954 -0.1691 227  ARG A O   
1410 C CB  A ARG A 231 ? 0.9213 0.4029 0.6414 0.2012  -0.1693 -0.1746 227  ARG A CB  
1411 C CB  B ARG A 231 ? 0.9217 0.4035 0.6416 0.2016  -0.1692 -0.1749 227  ARG A CB  
1412 C CG  A ARG A 231 ? 0.9019 0.3845 0.6275 0.1758  -0.1734 -0.1722 227  ARG A CG  
1413 C CG  B ARG A 231 ? 0.9056 0.3880 0.6290 0.1772  -0.1736 -0.1744 227  ARG A CG  
1414 C CD  A ARG A 231 ? 0.8786 0.3950 0.6000 0.1772  -0.1669 -0.1826 227  ARG A CD  
1415 C CD  B ARG A 231 ? 0.8639 0.3893 0.5915 0.1777  -0.1639 -0.1779 227  ARG A CD  
1416 N NE  A ARG A 231 ? 0.9094 0.4231 0.6131 0.1914  -0.1668 -0.1973 227  ARG A NE  
1417 N NE  B ARG A 231 ? 0.8260 0.3893 0.5718 0.1828  -0.1522 -0.1650 227  ARG A NE  
1418 C CZ  A ARG A 231 ? 0.9392 0.4312 0.6312 0.1828  -0.1762 -0.2053 227  ARG A CZ  
1419 C CZ  B ARG A 231 ? 0.7792 0.3888 0.5408 0.1744  -0.1417 -0.1574 227  ARG A CZ  
1420 N NH1 A ARG A 231 ? 0.9401 0.4140 0.6396 0.1591  -0.1865 -0.1998 227  ARG A NH1 
1421 N NH1 B ARG A 231 ? 0.7731 0.3985 0.5346 0.1609  -0.1401 -0.1599 227  ARG A NH1 
1422 N NH2 A ARG A 231 ? 0.9694 0.4591 0.6432 0.1981  -0.1754 -0.2186 227  ARG A NH2 
1423 N NH2 B ARG A 231 ? 0.7516 0.3903 0.5287 0.1797  -0.1336 -0.1472 227  ARG A NH2 
1424 N N   . ALA A 232 ? 0.7009 0.7044 0.7554 -0.3453 0.0051  -0.0315 1001 ALA A N   
1425 C CA  . ALA A 232 ? 0.7170 0.7212 0.7330 -0.3664 0.0184  -0.0265 1001 ALA A CA  
1426 C C   . ALA A 232 ? 0.6682 0.6826 0.7107 -0.3170 0.0290  -0.0428 1001 ALA A C   
1427 O O   . ALA A 232 ? 0.6687 0.6626 0.6862 -0.3108 0.0201  -0.0259 1001 ALA A O   
1428 C CB  . ALA A 232 ? 0.7573 0.7958 0.7489 -0.4251 0.0561  -0.0489 1001 ALA A CB  
1429 N N   . ASP A 233 ? 0.6306 0.6747 0.7265 -0.2839 0.0430  -0.0720 1002 ASP A N   
1430 C CA  . ASP A 233 ? 0.5913 0.6408 0.7132 -0.2394 0.0472  -0.0833 1002 ASP A CA  
1431 C C   . ASP A 233 ? 0.5771 0.5866 0.6822 -0.2063 0.0182  -0.0595 1002 ASP A C   
1432 O O   . ASP A 233 ? 0.5644 0.5643 0.6581 -0.1890 0.0199  -0.0554 1002 ASP A O   
1433 C CB  . ASP A 233 ? 0.5631 0.6441 0.7522 -0.2119 0.0522  -0.1089 1002 ASP A CB  
1434 C CG  . ASP A 233 ? 0.5706 0.6984 0.8064 -0.2367 0.0886  -0.1430 1002 ASP A CG  
1435 O OD1 . ASP A 233 ? 0.5964 0.7328 0.8033 -0.2729 0.1184  -0.1536 1002 ASP A OD1 
1436 O OD2 . ASP A 233 ? 0.5563 0.7130 0.8617 -0.2237 0.0882  -0.1613 1002 ASP A OD2 
1437 N N   . LEU A 234 ? 0.5993 0.5857 0.7070 -0.1998 -0.0046 -0.0479 1003 LEU A N   
1438 C CA  . LEU A 234 ? 0.5988 0.5499 0.7025 -0.1710 -0.0230 -0.0361 1003 LEU A CA  
1439 C C   . LEU A 234 ? 0.6055 0.5287 0.6890 -0.1849 -0.0346 -0.0102 1003 LEU A C   
1440 O O   . LEU A 234 ? 0.5986 0.5054 0.6844 -0.1624 -0.0383 -0.0053 1003 LEU A O   
1441 C CB  . LEU A 234 ? 0.6058 0.5391 0.7237 -0.1629 -0.0386 -0.0392 1003 LEU A CB  
1442 C CG  . LEU A 234 ? 0.6079 0.5086 0.7278 -0.1368 -0.0468 -0.0408 1003 LEU A CG  
1443 C CD1 . LEU A 234 ? 0.6016 0.5114 0.7141 -0.1112 -0.0383 -0.0535 1003 LEU A CD1 
1444 C CD2 . LEU A 234 ? 0.6216 0.5049 0.7517 -0.1392 -0.0565 -0.0500 1003 LEU A CD2 
1445 N N   . GLU A 235 ? 0.6661 0.5846 0.7304 -0.2262 -0.0422 0.0081  1004 GLU A N   
1446 C CA  . GLU A 235 ? 0.6788 0.5715 0.7228 -0.2491 -0.0618 0.0403  1004 GLU A CA  
1447 C C   . GLU A 235 ? 0.6722 0.5790 0.6923 -0.2493 -0.0461 0.0374  1004 GLU A C   
1448 O O   . GLU A 235 ? 0.6708 0.5566 0.6923 -0.2424 -0.0628 0.0576  1004 GLU A O   
1449 C CB  . GLU A 235 ? 0.7125 0.5977 0.7254 -0.3062 -0.0753 0.0634  1004 GLU A CB  
1450 C CG  . GLU A 235 ? 0.7340 0.5886 0.7739 -0.3098 -0.1039 0.0801  1004 GLU A CG  
1451 C CD  . GLU A 235 ? 0.7491 0.5590 0.8243 -0.2988 -0.1420 0.1122  1004 GLU A CD  
1452 O OE1 . GLU A 235 ? 0.7426 0.5475 0.8183 -0.2902 -0.1479 0.1239  1004 GLU A OE1 
1453 O OE2 . GLU A 235 ? 0.7694 0.5490 0.8818 -0.2990 -0.1663 0.1245  1004 GLU A OE2 
1454 N N   . ASP A 236 ? 0.6558 0.5984 0.6642 -0.2573 -0.0136 0.0101  1005 ASP A N   
1455 C CA  . ASP A 236 ? 0.6496 0.6057 0.6410 -0.2559 0.0064  0.0002  1005 ASP A CA  
1456 C C   . ASP A 236 ? 0.6287 0.5751 0.6447 -0.2044 0.0023  -0.0033 1005 ASP A C   
1457 O O   . ASP A 236 ? 0.6272 0.5634 0.6282 -0.2032 -0.0012 0.0083  1005 ASP A O   
1458 C CB  . ASP A 236 ? 0.6459 0.6426 0.6457 -0.2680 0.0459  -0.0372 1005 ASP A CB  
1459 C CG  . ASP A 236 ? 0.6961 0.7053 0.6541 -0.3340 0.0635  -0.0403 1005 ASP A CG  
1460 O OD1 . ASP A 236 ? 0.7715 0.7554 0.6756 -0.3758 0.0427  -0.0078 1005 ASP A OD1 
1461 O OD2 . ASP A 236 ? 0.7052 0.7492 0.6873 -0.3485 0.0965  -0.0749 1005 ASP A OD2 
1462 N N   . ASN A 237 ? 0.6232 0.5728 0.6720 -0.1683 0.0024  -0.0191 1006 ASN A N   
1463 C CA  . ASN A 237 ? 0.5981 0.5359 0.6599 -0.1282 -0.0006 -0.0236 1006 ASN A CA  
1464 C C   . ASN A 237 ? 0.5986 0.5046 0.6642 -0.1214 -0.0193 -0.0036 1006 ASN A C   
1465 O O   . ASN A 237 ? 0.5913 0.4900 0.6568 -0.1051 -0.0169 -0.0018 1006 ASN A O   
1466 C CB  . ASN A 237 ? 0.6022 0.5439 0.6853 -0.1053 -0.0032 -0.0397 1006 ASN A CB  
1467 C CG  . ASN A 237 ? 0.6547 0.6295 0.7591 -0.1061 0.0094  -0.0586 1006 ASN A CG  
1468 O OD1 . ASN A 237 ? 0.6313 0.6256 0.7410 -0.1126 0.0276  -0.0681 1006 ASN A OD1 
1469 N ND2 . ASN A 237 ? 0.6152 0.5964 0.7404 -0.1004 -0.0003 -0.0663 1006 ASN A ND2 
1470 N N   . TRP A 238 ? 0.6723 0.5598 0.7514 -0.1347 -0.0379 0.0104  1007 TRP A N   
1471 C CA  . TRP A 238 ? 0.6518 0.5085 0.7616 -0.1281 -0.0581 0.0274  1007 TRP A CA  
1472 C C   . TRP A 238 ? 0.6643 0.5155 0.7646 -0.1468 -0.0718 0.0547  1007 TRP A C   
1473 O O   . TRP A 238 ? 0.6642 0.5035 0.7919 -0.1295 -0.0775 0.0599  1007 TRP A O   
1474 C CB  . TRP A 238 ? 0.6607 0.4966 0.7959 -0.1426 -0.0785 0.0384  1007 TRP A CB  
1475 C CG  . TRP A 238 ? 0.7159 0.5200 0.9108 -0.1260 -0.0934 0.0420  1007 TRP A CG  
1476 C CD1 . TRP A 238 ? 0.7134 0.5087 0.9431 -0.1038 -0.0899 0.0375  1007 TRP A CD1 
1477 C CD2 . TRP A 238 ? 0.7367 0.5141 0.9766 -0.1312 -0.1111 0.0462  1007 TRP A CD2 
1478 N NE1 . TRP A 238 ? 0.6786 0.4455 0.9818 -0.0944 -0.1015 0.0350  1007 TRP A NE1 
1479 C CE2 . TRP A 238 ? 0.7236 0.4770 1.0350 -0.1102 -0.1156 0.0407  1007 TRP A CE2 
1480 C CE3 . TRP A 238 ? 0.7422 0.5135 0.9752 -0.1528 -0.1220 0.0520  1007 TRP A CE3 
1481 C CZ2 . TRP A 238 ? 0.7508 0.4729 1.1343 -0.1084 -0.1298 0.0384  1007 TRP A CZ2 
1482 C CZ3 . TRP A 238 ? 0.7278 0.4657 1.0212 -0.1519 -0.1395 0.0542  1007 TRP A CZ3 
1483 C CH2 . TRP A 238 ? 0.7688 0.4816 1.1403 -0.1289 -0.1430 0.0464  1007 TRP A CH2 
1484 N N   . GLU A 239 ? 0.6815 0.5425 0.7405 -0.1874 -0.0753 0.0698  1008 GLU A N   
1485 C CA  . GLU A 239 ? 0.6835 0.5397 0.7145 -0.2183 -0.0894 0.0966  1008 GLU A CA  
1486 C C   . GLU A 239 ? 0.6955 0.5665 0.7145 -0.1981 -0.0676 0.0811  1008 GLU A C   
1487 O O   . GLU A 239 ? 0.6741 0.5336 0.6994 -0.2009 -0.0843 0.1013  1008 GLU A O   
1488 C CB  . GLU A 239 ? 0.7831 0.6496 0.7549 -0.2760 -0.0867 0.1057  1008 GLU A CB  
1489 C CG  . GLU A 239 ? 0.8603 0.7242 0.7811 -0.3203 -0.0953 0.1280  1008 GLU A CG  
1490 C CD  . GLU A 239 ? 0.9545 0.8246 0.8056 -0.3912 -0.0900 0.1347  1008 GLU A CD  
1491 O OE1 . GLU A 239 ? 0.9744 0.8452 0.8265 -0.4059 -0.0901 0.1324  1008 GLU A OE1 
1492 O OE2 . GLU A 239 ? 1.0019 0.8758 0.7933 -0.4376 -0.0836 0.1404  1008 GLU A OE2 
1493 N N   . THR A 240 ? 0.6521 0.5475 0.6604 -0.1792 -0.0340 0.0473  1009 THR A N   
1494 C CA  . THR A 240 ? 0.6372 0.5438 0.6371 -0.1603 -0.0139 0.0320  1009 THR A CA  
1495 C C   . THR A 240 ? 0.6658 0.5561 0.6987 -0.1244 -0.0226 0.0351  1009 THR A C   
1496 O O   . THR A 240 ? 0.6726 0.5614 0.7004 -0.1207 -0.0212 0.0403  1009 THR A O   
1497 C CB  . THR A 240 ? 0.6524 0.5835 0.6560 -0.1427 0.0154  -0.0017 1009 THR A CB  
1498 O OG1 . THR A 240 ? 0.6583 0.6101 0.6434 -0.1786 0.0324  -0.0132 1009 THR A OG1 
1499 C CG2 . THR A 240 ? 0.7064 0.6424 0.7083 -0.1218 0.0309  -0.0141 1009 THR A CG2 
1500 N N   . LEU A 241 ? 0.6706 0.5495 0.7373 -0.1020 -0.0278 0.0280  1010 LEU A N   
1501 C CA  . LEU A 241 ? 0.6677 0.5313 0.7711 -0.0746 -0.0285 0.0224  1010 LEU A CA  
1502 C C   . LEU A 241 ? 0.6399 0.4872 0.7829 -0.0832 -0.0532 0.0488  1010 LEU A C   
1503 O O   . LEU A 241 ? 0.6454 0.4920 0.8054 -0.0719 -0.0503 0.0494  1010 LEU A O   
1504 C CB  . LEU A 241 ? 0.6572 0.5103 0.7846 -0.0595 -0.0248 0.0037  1010 LEU A CB  
1505 C CG  . LEU A 241 ? 0.6731 0.5385 0.7703 -0.0491 -0.0080 -0.0198 1010 LEU A CG  
1506 C CD1 . LEU A 241 ? 0.7172 0.5697 0.8293 -0.0452 -0.0084 -0.0354 1010 LEU A CD1 
1507 C CD2 . LEU A 241 ? 0.7041 0.5727 0.7823 -0.0328 0.0072  -0.0318 1010 LEU A CD2 
1508 N N   . ASN A 242 ? 0.6885 0.5220 0.8522 -0.1052 -0.0814 0.0733  1011 ASN A N   
1509 C CA  . ASN A 242 ? 0.6689 0.4829 0.8898 -0.1139 -0.1160 0.1043  1011 ASN A CA  
1510 C C   . ASN A 242 ? 0.6884 0.5074 0.8752 -0.1416 -0.1330 0.1332  1011 ASN A C   
1511 O O   . ASN A 242 ? 0.6954 0.5079 0.9300 -0.1352 -0.1501 0.1478  1011 ASN A O   
1512 C CB  . ASN A 242 ? 0.6866 0.4789 0.9397 -0.1341 -0.1489 0.1283  1011 ASN A CB  
1513 C CG  . ASN A 242 ? 0.7280 0.5094 1.0330 -0.1065 -0.1346 0.0986  1011 ASN A CG  
1514 O OD1 . ASN A 242 ? 0.7482 0.5418 1.0357 -0.0819 -0.0982 0.0602  1011 ASN A OD1 
1515 N ND2 . ASN A 242 ? 0.7488 0.5045 1.1159 -0.1148 -0.1650 0.1170  1011 ASN A ND2 
1516 N N   . ASP A 243 ? 0.6951 0.5270 0.8030 -0.1750 -0.1254 0.1374  1012 ASP A N   
1517 C CA  . ASP A 243 ? 0.7527 0.5891 0.8121 -0.2100 -0.1346 0.1580  1012 ASP A CA  
1518 C C   . ASP A 243 ? 0.7407 0.5895 0.8027 -0.1820 -0.1110 0.1387  1012 ASP A C   
1519 O O   . ASP A 243 ? 0.7040 0.5475 0.7773 -0.1932 -0.1321 0.1614  1012 ASP A O   
1520 C CB  . ASP A 243 ? 0.7773 0.6282 0.7531 -0.2531 -0.1153 0.1502  1012 ASP A CB  
1521 N N   . ASN A 244 ? 0.6811 0.5449 0.7333 -0.1490 -0.0716 0.1000  1013 ASN A N   
1522 C CA  . ASN A 244 ? 0.6900 0.5626 0.7363 -0.1272 -0.0496 0.0828  1013 ASN A CA  
1523 C C   . ASN A 244 ? 0.6646 0.5282 0.7751 -0.0979 -0.0562 0.0833  1013 ASN A C   
1524 O O   . ASN A 244 ? 0.6763 0.5442 0.7874 -0.0897 -0.0478 0.0798  1013 ASN A O   
1525 C CB  . ASN A 244 ? 0.6897 0.5762 0.7120 -0.1050 -0.0141 0.0476  1013 ASN A CB  
1526 C CG  . ASN A 244 ? 0.7142 0.6159 0.6878 -0.1321 0.0035  0.0376  1013 ASN A CG  
1527 O OD1 . ASN A 244 ? 0.7488 0.6546 0.6952 -0.1475 0.0122  0.0371  1013 ASN A OD1 
1528 N ND2 . ASN A 244 ? 0.7084 0.6196 0.6756 -0.1410 0.0121  0.0258  1013 ASN A ND2 
1529 N N   . LEU A 245 ? 0.6546 0.5061 0.8240 -0.0841 -0.0676 0.0832  1014 LEU A N   
1530 C CA  . LEU A 245 ? 0.6449 0.4890 0.8944 -0.0626 -0.0713 0.0791  1014 LEU A CA  
1531 C C   . LEU A 245 ? 0.6559 0.4956 0.9427 -0.0827 -0.1090 0.1171  1014 LEU A C   
1532 O O   . LEU A 245 ? 0.6611 0.5048 0.9980 -0.0695 -0.1070 0.1140  1014 LEU A O   
1533 C CB  . LEU A 245 ? 0.6167 0.4468 0.9309 -0.0491 -0.0741 0.0674  1014 LEU A CB  
1534 C CG  . LEU A 245 ? 0.6758 0.5082 0.9705 -0.0272 -0.0347 0.0242  1014 LEU A CG  
1535 C CD1 . LEU A 245 ? 0.6865 0.5041 1.0225 -0.0243 -0.0380 0.0131  1014 LEU A CD1 
1536 C CD2 . LEU A 245 ? 0.7045 0.5402 1.0306 -0.0094 -0.0076 -0.0024 1014 LEU A CD2 
1537 N N   . LYS A 246 ? 0.6763 0.5080 0.9352 -0.1202 -0.1450 0.1542  1015 LYS A N   
1538 C CA  . LYS A 246 ? 0.6991 0.5226 0.9805 -0.1512 -0.1920 0.1994  1015 LYS A CA  
1539 C C   . LYS A 246 ? 0.6998 0.5371 0.9087 -0.1693 -0.1792 0.1999  1015 LYS A C   
1540 O O   . LYS A 246 ? 0.7019 0.5386 0.9422 -0.1795 -0.2049 0.2233  1015 LYS A O   
1541 C CB  . LYS A 246 ? 0.7501 0.5549 1.0096 -0.1973 -0.2383 0.2425  1015 LYS A CB  
1542 N N   . VAL A 247 ? 0.6939 0.5435 0.8155 -0.1737 -0.1404 0.1727  1016 VAL A N   
1543 C CA  . VAL A 247 ? 0.7182 0.5794 0.7784 -0.1871 -0.1203 0.1639  1016 VAL A CA  
1544 C C   . VAL A 247 ? 0.7246 0.5924 0.8312 -0.1484 -0.1023 0.1455  1016 VAL A C   
1545 O O   . VAL A 247 ? 0.6923 0.5631 0.7936 -0.1609 -0.1107 0.1573  1016 VAL A O   
1546 C CB  . VAL A 247 ? 0.7206 0.5939 0.7063 -0.1920 -0.0780 0.1306  1016 VAL A CB  
1547 C CG1 . VAL A 247 ? 0.7045 0.5870 0.6479 -0.1967 -0.0525 0.1138  1016 VAL A CG1 
1548 C CG2 . VAL A 247 ? 0.7851 0.6557 0.7168 -0.2421 -0.0890 0.1446  1016 VAL A CG2 
1549 N N   . ILE A 248 ? 0.6643 0.5335 0.8125 -0.1072 -0.0778 0.1164  1017 ILE A N   
1550 C CA  . ILE A 248 ? 0.6842 0.5587 0.8710 -0.0767 -0.0552 0.0943  1017 ILE A CA  
1551 C C   . ILE A 248 ? 0.6588 0.5322 0.9373 -0.0758 -0.0828 0.1141  1017 ILE A C   
1552 O O   . ILE A 248 ? 0.6288 0.5103 0.9235 -0.0704 -0.0743 0.1095  1017 ILE A O   
1553 C CB  . ILE A 248 ? 0.6656 0.5383 0.8667 -0.0456 -0.0241 0.0587  1017 ILE A CB  
1554 C CG1 . ILE A 248 ? 0.6676 0.5436 0.7907 -0.0439 -0.0006 0.0408  1017 ILE A CG1 
1555 C CG2 . ILE A 248 ? 0.6512 0.5271 0.8935 -0.0246 0.0003  0.0347  1017 ILE A CG2 
1556 C CD1 . ILE A 248 ? 0.6731 0.5447 0.7960 -0.0232 0.0204  0.0131  1017 ILE A CD1 
1557 N N   . GLU A 249 ? 0.6853 0.5484 1.0336 -0.0818 -0.1183 0.1372  1018 GLU A N   
1558 C CA  . GLU A 249 ? 0.6647 0.5270 1.1276 -0.0787 -0.1497 0.1567  1018 GLU A CA  
1559 C C   . GLU A 249 ? 0.6929 0.5587 1.1407 -0.1103 -0.1864 0.1958  1018 GLU A C   
1560 O O   . GLU A 249 ? 0.7183 0.5929 1.2468 -0.1022 -0.1963 0.2001  1018 GLU A O   
1561 C CB  . GLU A 249 ? 0.6436 0.4892 1.1926 -0.0814 -0.1884 0.1787  1018 GLU A CB  
1562 C CG  . GLU A 249 ? 0.7243 0.5682 1.3579 -0.0451 -0.1550 0.1352  1018 GLU A CG  
1563 C CD  . GLU A 249 ? 0.6951 0.5484 1.4653 -0.0239 -0.1480 0.1172  1018 GLU A CD  
1564 O OE1 . GLU A 249 ? 0.6723 0.5173 1.5726 -0.0148 -0.1698 0.1200  1018 GLU A OE1 
1565 O OE2 . GLU A 249 ? 0.6707 0.5413 1.4248 -0.0170 -0.1184 0.0972  1018 GLU A OE2 
1566 N N   . LYS A 250 ? 0.7387 0.5990 1.0829 -0.1504 -0.2032 0.2207  1019 LYS A N   
1567 C CA  . LYS A 250 ? 0.7714 0.6309 1.0855 -0.1929 -0.2413 0.2599  1019 LYS A CA  
1568 C C   . LYS A 250 ? 0.7679 0.6373 0.9724 -0.2062 -0.2037 0.2385  1019 LYS A C   
1569 O O   . LYS A 250 ? 0.7928 0.6593 0.9388 -0.2525 -0.2277 0.2652  1019 LYS A O   
1570 C CB  . LYS A 250 ? 0.8323 0.6732 1.1118 -0.2460 -0.2973 0.3100  1019 LYS A CB  
1571 C CG  . LYS A 250 ? 0.8401 0.6761 1.0096 -0.2682 -0.2711 0.2954  1019 LYS A CG  
1572 C CD  . LYS A 250 ? 0.8996 0.7328 1.0309 -0.3078 -0.3192 0.3295  1019 LYS A CD  
1573 N N   . ALA A 251 ? 0.6749 0.5534 0.8535 -0.1697 -0.1475 0.1914  1020 ALA A N   
1574 C CA  . ALA A 251 ? 0.7023 0.5868 0.7923 -0.1781 -0.1119 0.1687  1020 ALA A CA  
1575 C C   . ALA A 251 ? 0.7191 0.6089 0.8189 -0.1894 -0.1219 0.1803  1020 ALA A C   
1576 O O   . ALA A 251 ? 0.6920 0.5873 0.8813 -0.1721 -0.1390 0.1899  1020 ALA A O   
1577 C CB  . ALA A 251 ? 0.6948 0.5837 0.7734 -0.1365 -0.0618 0.1243  1020 ALA A CB  
1578 N N   . ASP A 252 ? 0.7371 0.6265 0.7511 -0.2199 -0.1081 0.1751  1021 ASP A N   
1579 C CA  . ASP A 252 ? 0.7617 0.6550 0.7685 -0.2348 -0.1129 0.1823  1021 ASP A CA  
1580 C C   . ASP A 252 ? 0.7422 0.6409 0.7487 -0.1967 -0.0663 0.1441  1021 ASP A C   
1581 O O   . ASP A 252 ? 0.7405 0.6447 0.7722 -0.1940 -0.0677 0.1466  1021 ASP A O   
1582 C CB  . ASP A 252 ? 0.8112 0.6976 0.7197 -0.2958 -0.1198 0.1931  1021 ASP A CB  
1583 N N   . ASN A 253 ? 0.6795 0.5753 0.6566 -0.1715 -0.0284 0.1115  1022 ASN A N   
1584 C CA  . ASN A 253 ? 0.6653 0.5599 0.6321 -0.1432 0.0088  0.0814  1022 ASN A CA  
1585 C C   . ASN A 253 ? 0.6564 0.5471 0.6252 -0.1092 0.0339  0.0562  1022 ASN A C   
1586 O O   . ASN A 253 ? 0.6693 0.5604 0.6462 -0.1062 0.0267  0.0582  1022 ASN A O   
1587 C CB  . ASN A 253 ? 0.6576 0.5463 0.5569 -0.1684 0.0265  0.0697  1022 ASN A CB  
1588 C CG  . ASN A 253 ? 0.6995 0.5855 0.5453 -0.1987 0.0328  0.0627  1022 ASN A CG  
1589 O OD1 . ASN A 253 ? 0.6877 0.5732 0.5316 -0.1805 0.0517  0.0428  1022 ASN A OD1 
1590 N ND2 . ASN A 253 ? 0.6962 0.5809 0.4969 -0.2505 0.0174  0.0779  1022 ASN A ND2 
1591 N N   . ALA A 254 ? 0.5569 0.4417 0.5151 -0.0883 0.0595  0.0356  1023 ALA A N   
1592 C CA  . ALA A 254 ? 0.5831 0.4609 0.5398 -0.0616 0.0767  0.0167  1023 ALA A CA  
1593 C C   . ALA A 254 ? 0.6083 0.4826 0.5347 -0.0632 0.0832  0.0065  1023 ALA A C   
1594 O O   . ALA A 254 ? 0.6576 0.5305 0.5920 -0.0477 0.0846  -0.0006 1023 ALA A O   
1595 C CB  . ALA A 254 ? 0.5508 0.4184 0.4954 -0.0493 0.0952  0.0041  1023 ALA A CB  
1596 N N   . ALA A 255 ? 0.6013 0.4755 0.4979 -0.0849 0.0895  0.0023  1024 ALA A N   
1597 C CA  . ALA A 255 ? 0.6214 0.4964 0.5051 -0.0889 0.1029  -0.0155 1024 ALA A CA  
1598 C C   . ALA A 255 ? 0.6184 0.5034 0.5066 -0.0994 0.0915  -0.0083 1024 ALA A C   
1599 O O   . ALA A 255 ? 0.6203 0.5079 0.5204 -0.0857 0.0973  -0.0201 1024 ALA A O   
1600 C CB  . ALA A 255 ? 0.6550 0.5289 0.5106 -0.1178 0.1199  -0.0298 1024 ALA A CB  
1601 N N   . GLN A 256 ? 0.6169 0.5062 0.4984 -0.1262 0.0708  0.0144  1025 GLN A N   
1602 C CA  . GLN A 256 ? 0.6224 0.5164 0.5084 -0.1405 0.0530  0.0282  1025 GLN A CA  
1603 C C   . GLN A 256 ? 0.6919 0.5845 0.6216 -0.1051 0.0459  0.0291  1025 GLN A C   
1604 O O   . GLN A 256 ? 0.6665 0.5619 0.5988 -0.1037 0.0459  0.0244  1025 GLN A O   
1605 C CB  . GLN A 256 ? 0.6761 0.5689 0.5547 -0.1778 0.0201  0.0618  1025 GLN A CB  
1606 C CG  . GLN A 256 ? 0.6825 0.5746 0.4998 -0.2285 0.0255  0.0617  1025 GLN A CG  
1607 C CD  . GLN A 256 ? 0.7504 0.6379 0.5594 -0.2686 -0.0171 0.1026  1025 GLN A CD  
1608 O OE1 . GLN A 256 ? 0.7416 0.6263 0.5950 -0.2651 -0.0547 0.1340  1025 GLN A OE1 
1609 N NE2 . GLN A 256 ? 0.7907 0.6756 0.5481 -0.3096 -0.0141 0.1034  1025 GLN A NE2 
1610 N N   . VAL A 257 ? 0.5913 0.4801 0.5538 -0.0814 0.0435  0.0313  1026 VAL A N   
1611 C CA  . VAL A 257 ? 0.6270 0.5130 0.6260 -0.0548 0.0442  0.0243  1026 VAL A CA  
1612 C C   . VAL A 257 ? 0.6324 0.5149 0.6089 -0.0382 0.0620  0.0032  1026 VAL A C   
1613 O O   . VAL A 257 ? 0.6062 0.4887 0.5919 -0.0311 0.0590  -0.0012 1026 VAL A O   
1614 C CB  . VAL A 257 ? 0.5853 0.4695 0.6226 -0.0397 0.0489  0.0209  1026 VAL A CB  
1615 C CG1 . VAL A 257 ? 0.5467 0.4259 0.6076 -0.0201 0.0607  0.0027  1026 VAL A CG1 
1616 C CG2 . VAL A 257 ? 0.5873 0.4769 0.6755 -0.0528 0.0238  0.0440  1026 VAL A CG2 
1617 N N   . LYS A 258 ? 0.5825 0.4606 0.5348 -0.0339 0.0761  -0.0073 1027 LYS A N   
1618 C CA  . LYS A 258 ? 0.6050 0.4773 0.5489 -0.0197 0.0836  -0.0212 1027 LYS A CA  
1619 C C   . LYS A 258 ? 0.6071 0.4902 0.5564 -0.0265 0.0840  -0.0281 1027 LYS A C   
1620 O O   . LYS A 258 ? 0.5936 0.4765 0.5538 -0.0148 0.0802  -0.0340 1027 LYS A O   
1621 C CB  . LYS A 258 ? 0.5874 0.4495 0.5176 -0.0164 0.0931  -0.0274 1027 LYS A CB  
1622 C CG  . LYS A 258 ? 0.6425 0.4977 0.5819 -0.0047 0.0921  -0.0369 1027 LYS A CG  
1623 C CD  . LYS A 258 ? 0.6671 0.5022 0.5989 0.0018  0.0915  -0.0358 1027 LYS A CD  
1624 C CE  . LYS A 258 ? 0.7092 0.5352 0.6696 0.0126  0.0810  -0.0398 1027 LYS A CE  
1625 N NZ  . LYS A 258 ? 0.7392 0.5408 0.7013 0.0157  0.0753  -0.0351 1027 LYS A NZ  
1626 N N   . ASP A 259 ? 0.5686 0.4613 0.5075 -0.0510 0.0894  -0.0286 1028 ASP A N   
1627 C CA  . ASP A 259 ? 0.5641 0.4696 0.5066 -0.0655 0.0974  -0.0409 1028 ASP A CA  
1628 C C   . ASP A 259 ? 0.6128 0.5219 0.5636 -0.0661 0.0817  -0.0297 1028 ASP A C   
1629 O O   . ASP A 259 ? 0.6008 0.5173 0.5678 -0.0599 0.0842  -0.0404 1028 ASP A O   
1630 C CB  . ASP A 259 ? 0.6507 0.5639 0.5652 -0.1052 0.1103  -0.0462 1028 ASP A CB  
1631 C CG  . ASP A 259 ? 0.7463 0.6557 0.6574 -0.1081 0.1319  -0.0654 1028 ASP A CG  
1632 O OD1 . ASP A 259 ? 0.7494 0.6516 0.6902 -0.0784 0.1366  -0.0764 1028 ASP A OD1 
1633 O OD2 . ASP A 259 ? 0.7853 0.6960 0.6623 -0.1444 0.1415  -0.0680 1028 ASP A OD2 
1634 N N   . ALA A 260 ? 0.5986 0.5021 0.5482 -0.0737 0.0637  -0.0081 1029 ALA A N   
1635 C CA  . ALA A 260 ? 0.6079 0.5101 0.5744 -0.0757 0.0464  0.0039  1029 ALA A CA  
1636 C C   . ALA A 260 ? 0.6373 0.5343 0.6250 -0.0457 0.0479  -0.0073 1029 ALA A C   
1637 O O   . ALA A 260 ? 0.6497 0.5501 0.6453 -0.0455 0.0442  -0.0112 1029 ALA A O   
1638 C CB  . ALA A 260 ? 0.5792 0.4734 0.5624 -0.0868 0.0225  0.0300  1029 ALA A CB  
1639 N N   . LEU A 261 ? 0.5612 0.4493 0.5519 -0.0265 0.0535  -0.0127 1030 LEU A N   
1640 C CA  . LEU A 261 ? 0.5870 0.4665 0.5805 -0.0092 0.0559  -0.0242 1030 LEU A CA  
1641 C C   . LEU A 261 ? 0.5895 0.4735 0.5753 -0.0047 0.0559  -0.0331 1030 LEU A C   
1642 O O   . LEU A 261 ? 0.6006 0.4819 0.5897 -0.0006 0.0495  -0.0376 1030 LEU A O   
1643 C CB  . LEU A 261 ? 0.5827 0.4509 0.5666 -0.0008 0.0651  -0.0295 1030 LEU A CB  
1644 C CG  . LEU A 261 ? 0.5538 0.4190 0.5676 -0.0010 0.0686  -0.0296 1030 LEU A CG  
1645 C CD1 . LEU A 261 ? 0.5583 0.4169 0.5580 0.0008  0.0832  -0.0371 1030 LEU A CD1 
1646 C CD2 . LEU A 261 ? 0.5447 0.4036 0.5809 0.0017  0.0707  -0.0421 1030 LEU A CD2 
1647 N N   . THR A 262 ? 0.5673 0.4581 0.5515 -0.0069 0.0628  -0.0372 1031 THR A N   
1648 C CA  . THR A 262 ? 0.5678 0.4655 0.5706 -0.0011 0.0617  -0.0472 1031 THR A CA  
1649 C C   . THR A 262 ? 0.6073 0.5216 0.6276 -0.0107 0.0607  -0.0522 1031 THR A C   
1650 O O   . THR A 262 ? 0.6019 0.5200 0.6421 -0.0034 0.0512  -0.0564 1031 THR A O   
1651 C CB  . THR A 262 ? 0.5672 0.4702 0.5838 -0.0035 0.0752  -0.0576 1031 THR A CB  
1652 O OG1 . THR A 262 ? 0.5980 0.4835 0.5967 0.0037  0.0746  -0.0513 1031 THR A OG1 
1653 C CG2 . THR A 262 ? 0.5505 0.4616 0.6143 0.0057  0.0723  -0.0702 1031 THR A CG2 
1654 N N   . LYS A 263 ? 0.5984 0.5211 0.6087 -0.0317 0.0669  -0.0487 1032 LYS A N   
1655 C CA  . LYS A 263 ? 0.6156 0.5518 0.6338 -0.0486 0.0666  -0.0514 1032 LYS A CA  
1656 C C   . LYS A 263 ? 0.6238 0.5500 0.6458 -0.0397 0.0490  -0.0421 1032 LYS A C   
1657 O O   . LYS A 263 ? 0.6335 0.5686 0.6701 -0.0423 0.0454  -0.0478 1032 LYS A O   
1658 C CB  . LYS A 263 ? 0.6425 0.5833 0.6351 -0.0836 0.0719  -0.0437 1032 LYS A CB  
1659 C CG  . LYS A 263 ? 0.6423 0.5912 0.6218 -0.1017 0.0942  -0.0579 1032 LYS A CG  
1660 C CD  . LYS A 263 ? 0.7051 0.6572 0.6436 -0.1509 0.0970  -0.0493 1032 LYS A CD  
1661 C CE  . LYS A 263 ? 0.7289 0.6802 0.6367 -0.1753 0.1136  -0.0566 1032 LYS A CE  
1662 N NZ  . LYS A 263 ? 0.7403 0.6739 0.6320 -0.1694 0.0898  -0.0278 1032 LYS A NZ  
1663 N N   . MET A 264 ? 0.6280 0.5368 0.6433 -0.0310 0.0411  -0.0319 1033 MET A N   
1664 C CA  . MET A 264 ? 0.6194 0.5160 0.6445 -0.0242 0.0313  -0.0312 1033 MET A CA  
1665 C C   . MET A 264 ? 0.6164 0.5101 0.6369 -0.0126 0.0291  -0.0429 1033 MET A C   
1666 O O   . MET A 264 ? 0.6325 0.5243 0.6589 -0.0151 0.0218  -0.0468 1033 MET A O   
1667 C CB  . MET A 264 ? 0.5825 0.4636 0.6166 -0.0181 0.0313  -0.0271 1033 MET A CB  
1668 C CG  . MET A 264 ? 0.5820 0.4623 0.6335 -0.0321 0.0206  -0.0080 1033 MET A CG  
1669 S SD  . MET A 264 ? 0.6349 0.5014 0.7294 -0.0211 0.0200  -0.0076 1033 MET A SD  
1670 C CE  . MET A 264 ? 0.6917 0.5453 0.8150 -0.0125 0.0247  -0.0277 1033 MET A CE  
1671 N N   . ARG A 265 ? 0.5680 0.4584 0.5763 -0.0036 0.0313  -0.0456 1034 ARG A N   
1672 C CA  . ARG A 265 ? 0.6108 0.4940 0.6101 0.0006  0.0195  -0.0486 1034 ARG A CA  
1673 C C   . ARG A 265 ? 0.6108 0.5119 0.6397 -0.0009 0.0094  -0.0510 1034 ARG A C   
1674 O O   . ARG A 265 ? 0.6268 0.5241 0.6535 -0.0043 -0.0051 -0.0515 1034 ARG A O   
1675 C CB  . ARG A 265 ? 0.6214 0.4954 0.6083 0.0065  0.0168  -0.0444 1034 ARG A CB  
1676 C CG  . ARG A 265 ? 0.6833 0.5398 0.6462 0.0016  -0.0038 -0.0392 1034 ARG A CG  
1677 C CD  . ARG A 265 ? 0.7314 0.5727 0.6810 0.0029  -0.0136 -0.0287 1034 ARG A CD  
1678 N NE  . ARG A 265 ? 0.7629 0.5808 0.6718 -0.0137 -0.0384 -0.0182 1034 ARG A NE  
1679 C CZ  . ARG A 265 ? 0.8208 0.6367 0.7492 -0.0172 -0.0727 -0.0046 1034 ARG A CZ  
1680 N NH1 . ARG A 265 ? 0.7967 0.6362 0.7982 -0.0007 -0.0802 -0.0056 1034 ARG A NH1 
1681 N NH2 . ARG A 265 ? 0.8437 0.6339 0.7205 -0.0421 -0.1001 0.0096  1034 ARG A NH2 
1682 N N   . ALA A 266 ? 0.5640 0.4855 0.6218 -0.0025 0.0198  -0.0556 1035 ALA A N   
1683 C CA  . ALA A 266 ? 0.5927 0.5372 0.6933 -0.0060 0.0180  -0.0648 1035 ALA A CA  
1684 C C   . ALA A 266 ? 0.5711 0.5213 0.6682 -0.0185 0.0156  -0.0649 1035 ALA A C   
1685 O O   . ALA A 266 ? 0.5804 0.5410 0.7028 -0.0195 0.0039  -0.0686 1035 ALA A O   
1686 C CB  . ALA A 266 ? 0.5508 0.5160 0.6804 -0.0131 0.0410  -0.0789 1035 ALA A CB  
1687 N N   . ALA A 267 ? 0.5757 0.5175 0.6475 -0.0292 0.0225  -0.0584 1036 ALA A N   
1688 C CA  . ALA A 267 ? 0.5865 0.5277 0.6578 -0.0433 0.0172  -0.0548 1036 ALA A CA  
1689 C C   . ALA A 267 ? 0.6027 0.5257 0.6669 -0.0356 0.0032  -0.0553 1036 ALA A C   
1690 O O   . ALA A 267 ? 0.6227 0.5495 0.6968 -0.0435 -0.0045 -0.0580 1036 ALA A O   
1691 C CB  . ALA A 267 ? 0.5675 0.4991 0.6232 -0.0588 0.0190  -0.0414 1036 ALA A CB  
1692 N N   . ALA A 268 ? 0.6280 0.5312 0.6719 -0.0252 0.0030  -0.0557 1037 ALA A N   
1693 C CA  . ALA A 268 ? 0.6278 0.5117 0.6544 -0.0267 -0.0030 -0.0632 1037 ALA A CA  
1694 C C   . ALA A 268 ? 0.6951 0.5854 0.7188 -0.0302 -0.0208 -0.0643 1037 ALA A C   
1695 O O   . ALA A 268 ? 0.6777 0.5614 0.6950 -0.0405 -0.0293 -0.0698 1037 ALA A O   
1696 C CB  . ALA A 268 ? 0.6434 0.5075 0.6445 -0.0229 0.0069  -0.0683 1037 ALA A CB  
1697 N N   . LEU A 269 ? 0.6447 0.5466 0.6806 -0.0231 -0.0293 -0.0583 1038 LEU A N   
1698 C CA  . LEU A 269 ? 0.6696 0.5780 0.7210 -0.0263 -0.0555 -0.0535 1038 LEU A CA  
1699 C C   . LEU A 269 ? 0.6737 0.6091 0.7727 -0.0299 -0.0591 -0.0584 1038 LEU A C   
1700 O O   . LEU A 269 ? 0.6822 0.6203 0.7908 -0.0380 -0.0820 -0.0557 1038 LEU A O   
1701 C CB  . LEU A 269 ? 0.6487 0.5604 0.7225 -0.0159 -0.0675 -0.0445 1038 LEU A CB  
1702 C CG  . LEU A 269 ? 0.7431 0.6236 0.7610 -0.0225 -0.0792 -0.0341 1038 LEU A CG  
1703 C CD1 . LEU A 269 ? 0.7752 0.6538 0.8084 -0.0097 -0.0765 -0.0275 1038 LEU A CD1 
1704 C CD2 . LEU A 269 ? 0.8124 0.6790 0.8109 -0.0406 -0.1178 -0.0206 1038 LEU A CD2 
1705 N N   . ASP A 270 ? 0.6594 0.6148 0.7846 -0.0296 -0.0369 -0.0653 1039 ASP A N   
1706 C CA  . ASP A 270 ? 0.6284 0.6103 0.7931 -0.0403 -0.0332 -0.0734 1039 ASP A CA  
1707 C C   . ASP A 270 ? 0.6308 0.5989 0.7692 -0.0530 -0.0394 -0.0718 1039 ASP A C   
1708 O O   . ASP A 270 ? 0.6253 0.6047 0.7850 -0.0608 -0.0529 -0.0745 1039 ASP A O   
1709 C CB  . ASP A 270 ? 0.6821 0.6839 0.8618 -0.0495 -0.0047 -0.0823 1039 ASP A CB  
1710 C CG  . ASP A 270 ? 0.7155 0.7516 0.9451 -0.0652 0.0058  -0.0975 1039 ASP A CG  
1711 O OD1 . ASP A 270 ? 0.7438 0.7877 0.9973 -0.0667 -0.0117 -0.0978 1039 ASP A OD1 
1712 O OD2 . ASP A 270 ? 0.7063 0.7623 0.9493 -0.0808 0.0338  -0.1116 1039 ASP A OD2 
1713 N N   . ALA A 271 ? 0.6413 0.5845 0.7435 -0.0547 -0.0308 -0.0683 1040 ALA A N   
1714 C CA  . ALA A 271 ? 0.6613 0.5857 0.7507 -0.0653 -0.0346 -0.0697 1040 ALA A CA  
1715 C C   . ALA A 271 ? 0.7067 0.6156 0.7762 -0.0691 -0.0495 -0.0764 1040 ALA A C   
1716 O O   . ALA A 271 ? 0.7032 0.6064 0.7739 -0.0817 -0.0557 -0.0815 1040 ALA A O   
1717 C CB  . ALA A 271 ? 0.6381 0.5382 0.7154 -0.0631 -0.0246 -0.0658 1040 ALA A CB  
1718 N N   . GLN A 272 ? 0.7411 0.6406 0.7858 -0.0641 -0.0562 -0.0755 1041 GLN A N   
1719 C CA  . GLN A 272 ? 0.7581 0.6401 0.7669 -0.0789 -0.0738 -0.0790 1041 GLN A CA  
1720 C C   . GLN A 272 ? 0.7445 0.6461 0.7793 -0.0881 -0.1011 -0.0727 1041 GLN A C   
1721 O O   . GLN A 272 ? 0.7763 0.6638 0.7809 -0.1083 -0.1186 -0.0749 1041 GLN A O   
1722 C CB  . GLN A 272 ? 0.7970 0.6646 0.7687 -0.0790 -0.0804 -0.0727 1041 GLN A CB  
1723 C CG  . GLN A 272 ? 0.8461 0.6907 0.7615 -0.1069 -0.1018 -0.0725 1041 GLN A CG  
1724 C CD  . GLN A 272 ? 0.9121 0.7378 0.7804 -0.1152 -0.1094 -0.0628 1041 GLN A CD  
1725 O OE1 . GLN A 272 ? 0.8951 0.7323 0.7922 -0.0980 -0.1210 -0.0458 1041 GLN A OE1 
1726 N NE2 . GLN A 272 ? 0.9291 0.7244 0.7244 -0.1462 -0.1006 -0.0764 1041 GLN A NE2 
1727 N N   . LYS A 273 ? 0.7143 0.6495 0.8081 -0.0772 -0.1029 -0.0677 1042 LYS A N   
1728 C CA  . LYS A 273 ? 0.7112 0.6720 0.8529 -0.0836 -0.1279 -0.0639 1042 LYS A CA  
1729 C C   . LYS A 273 ? 0.7001 0.6755 0.8631 -0.0949 -0.1180 -0.0734 1042 LYS A C   
1730 O O   . LYS A 273 ? 0.6840 0.6832 0.8906 -0.1031 -0.1356 -0.0734 1042 LYS A O   
1731 C CB  . LYS A 273 ? 0.7148 0.7068 0.9279 -0.0677 -0.1316 -0.0606 1042 LYS A CB  
1732 C CG  . LYS A 273 ? 0.7608 0.7376 0.9678 -0.0610 -0.1589 -0.0442 1042 LYS A CG  
1733 C CD  . LYS A 273 ? 0.7375 0.7430 1.0359 -0.0434 -0.1633 -0.0439 1042 LYS A CD  
1734 C CE  . LYS A 273 ? 0.7519 0.7654 1.0556 -0.0301 -0.1205 -0.0588 1042 LYS A CE  
1735 N NZ  . LYS A 273 ? 0.7382 0.7713 1.1268 -0.0142 -0.1215 -0.0632 1042 LYS A NZ  
1736 N N   . ALA A 274 ? 0.7233 0.6838 0.8615 -0.0972 -0.0934 -0.0792 1043 ALA A N   
1737 C CA  . ALA A 274 ? 0.7334 0.7010 0.8863 -0.1120 -0.0865 -0.0837 1043 ALA A CA  
1738 C C   . ALA A 274 ? 0.7365 0.6778 0.8593 -0.1266 -0.0993 -0.0889 1043 ALA A C   
1739 O O   . ALA A 274 ? 0.8181 0.7262 0.9102 -0.1285 -0.0887 -0.0950 1043 ALA A O   
1740 C CB  . ALA A 274 ? 0.7222 0.6805 0.8664 -0.1133 -0.0643 -0.0807 1043 ALA A CB  
1741 N N   . THR A 275 ? 0.7632 0.7195 0.9022 -0.1385 -0.1219 -0.0890 1044 THR A N   
1742 C CA  . THR A 275 ? 0.8094 0.7404 0.9131 -0.1587 -0.1350 -0.0962 1044 THR A CA  
1743 C C   . THR A 275 ? 0.8387 0.7715 0.9615 -0.1728 -0.1285 -0.1019 1044 THR A C   
1744 O O   . THR A 275 ? 0.7774 0.7448 0.9458 -0.1779 -0.1325 -0.0985 1044 THR A O   
1745 C CB  . THR A 275 ? 0.8304 0.7715 0.9334 -0.1717 -0.1719 -0.0882 1044 THR A CB  
1746 O OG1 . THR A 275 ? 0.8741 0.8060 0.9531 -0.1639 -0.1831 -0.0780 1044 THR A OG1 
1747 C CG2 . THR A 275 ? 0.8420 0.7544 0.8950 -0.2013 -0.1838 -0.0980 1044 THR A CG2 
1748 N N   . PRO A 276 ? 0.8772 0.7721 0.9723 -0.1809 -0.1167 -0.1127 1045 PRO A N   
1749 C CA  . PRO A 276 ? 0.8742 0.7614 0.9854 -0.1977 -0.1160 -0.1164 1045 PRO A CA  
1750 C C   . PRO A 276 ? 0.8669 0.7668 0.9788 -0.2188 -0.1380 -0.1205 1045 PRO A C   
1751 O O   . PRO A 276 ? 0.8959 0.7923 0.9788 -0.2261 -0.1550 -0.1233 1045 PRO A O   
1752 C CB  . PRO A 276 ? 0.8973 0.7362 0.9902 -0.1993 -0.1010 -0.1315 1045 PRO A CB  
1753 C CG  . PRO A 276 ? 0.9425 0.7669 0.9964 -0.1930 -0.0941 -0.1431 1045 PRO A CG  
1754 C CD  . PRO A 276 ? 0.8936 0.7508 0.9522 -0.1757 -0.1012 -0.1248 1045 PRO A CD  
1755 N N   . PRO A 277 ? 0.8464 0.7599 0.9878 -0.2336 -0.1407 -0.1185 1046 PRO A N   
1756 C CA  . PRO A 277 ? 0.8674 0.7955 1.0175 -0.2559 -0.1625 -0.1220 1046 PRO A CA  
1757 C C   . PRO A 277 ? 0.9368 0.8250 1.0351 -0.2749 -0.1714 -0.1377 1046 PRO A C   
1758 O O   . PRO A 277 ? 0.9801 0.8786 1.0682 -0.2948 -0.1978 -0.1373 1046 PRO A O   
1759 C CB  . PRO A 277 ? 0.8572 0.7925 1.0370 -0.2708 -0.1543 -0.1198 1046 PRO A CB  
1760 C CG  . PRO A 277 ? 0.7844 0.7309 0.9795 -0.2579 -0.1342 -0.1090 1046 PRO A CG  
1761 C CD  . PRO A 277 ? 0.8186 0.7349 0.9840 -0.2357 -0.1256 -0.1097 1046 PRO A CD  
1762 N N   . LYS A 278 ? 0.9736 0.8172 1.0442 -0.2725 -0.1493 -0.1531 1047 LYS A N   
1763 C CA  . LYS A 278 ? 1.0358 0.8386 1.0570 -0.2959 -0.1451 -0.1791 1047 LYS A CA  
1764 C C   . LYS A 278 ? 1.0777 0.8825 1.0433 -0.3092 -0.1617 -0.1790 1047 LYS A C   
1765 O O   . LYS A 278 ? 1.1114 0.8989 1.0282 -0.3444 -0.1746 -0.1921 1047 LYS A O   
1766 C CB  . LYS A 278 ? 1.0227 0.7823 1.0478 -0.2861 -0.1121 -0.2005 1047 LYS A CB  
1767 C CG  . LYS A 278 ? 1.0325 0.7477 1.0324 -0.3148 -0.0966 -0.2380 1047 LYS A CG  
1768 N N   . LEU A 279 ? 1.1214 0.9448 1.0907 -0.2860 -0.1641 -0.1623 1048 LEU A N   
1769 C CA  . LEU A 279 ? 1.1444 0.9661 1.0622 -0.2996 -0.1850 -0.1548 1048 LEU A CA  
1770 C C   . LEU A 279 ? 1.1293 0.9952 1.0894 -0.2908 -0.2252 -0.1227 1048 LEU A C   
1771 O O   . LEU A 279 ? 1.1680 1.0338 1.0999 -0.2998 -0.2528 -0.1067 1048 LEU A O   
1772 C CB  . LEU A 279 ? 1.1288 0.9321 1.0204 -0.2829 -0.1584 -0.1617 1048 LEU A CB  
1773 C CG  . LEU A 279 ? 1.1197 0.8842 0.9991 -0.2839 -0.1143 -0.1961 1048 LEU A CG  
1774 C CD1 . LEU A 279 ? 1.0949 0.8518 0.9629 -0.2651 -0.0916 -0.1990 1048 LEU A CD1 
1775 C CD2 . LEU A 279 ? 1.1933 0.9224 1.0112 -0.3294 -0.1065 -0.2286 1048 LEU A CD2 
1776 N N   . GLU A 280 ? 1.0809 0.9839 1.1149 -0.2761 -0.2283 -0.1142 1049 GLU A N   
1777 C CA  . GLU A 280 ? 1.0521 1.0018 1.1531 -0.2652 -0.2589 -0.0919 1049 GLU A CA  
1778 C C   . GLU A 280 ? 1.0933 1.0481 1.1877 -0.2973 -0.3086 -0.0794 1049 GLU A C   
1779 O O   . GLU A 280 ? 1.0904 1.0696 1.2276 -0.2948 -0.3483 -0.0563 1049 GLU A O   
1780 C CB  . GLU A 280 ? 1.0086 0.9983 1.1898 -0.2494 -0.2403 -0.0943 1049 GLU A CB  
1781 C CG  . GLU A 280 ? 0.9950 1.0058 1.2150 -0.2187 -0.2153 -0.0915 1049 GLU A CG  
1782 C CD  . GLU A 280 ? 0.9806 1.0399 1.2826 -0.2155 -0.2016 -0.0957 1049 GLU A CD  
1783 O OE1 . GLU A 280 ? 0.9174 0.9898 1.2405 -0.2355 -0.2063 -0.1008 1049 GLU A OE1 
1784 O OE2 . GLU A 280 ? 0.9965 1.0806 1.3399 -0.1972 -0.1829 -0.0971 1049 GLU A OE2 
1785 N N   . ASP A 281 ? 1.1598 1.0892 1.2055 -0.3295 -0.3094 -0.0939 1050 ASP A N   
1786 C CA  . ASP A 281 ? 1.2005 1.1279 1.2221 -0.3695 -0.3583 -0.0822 1050 ASP A CA  
1787 C C   . ASP A 281 ? 1.2744 1.1561 1.1870 -0.4045 -0.3732 -0.0814 1050 ASP A C   
1788 O O   . ASP A 281 ? 1.3296 1.1952 1.1881 -0.4518 -0.4108 -0.0749 1050 ASP A O   
1789 C CB  . ASP A 281 ? 1.1920 1.1135 1.2092 -0.3946 -0.3521 -0.1002 1050 ASP A CB  
1790 C CG  . ASP A 281 ? 1.1291 1.0995 1.2492 -0.3747 -0.3472 -0.0970 1050 ASP A CG  
1791 O OD1 . ASP A 281 ? 1.0879 1.1015 1.2885 -0.3467 -0.3528 -0.0827 1050 ASP A OD1 
1792 O OD2 . ASP A 281 ? 1.0917 1.0571 1.2131 -0.3916 -0.3364 -0.1113 1050 ASP A OD2 
1793 N N   . LYS A 282 ? 1.2922 1.1527 1.1678 -0.3870 -0.3430 -0.0886 1051 LYS A N   
1794 C CA  . LYS A 282 ? 1.3167 1.1349 1.0853 -0.4233 -0.3483 -0.0914 1051 LYS A CA  
1795 C C   . LYS A 282 ? 1.3146 1.1441 1.0913 -0.4198 -0.3948 -0.0516 1051 LYS A C   
1796 O O   . LYS A 282 ? 1.2628 1.1296 1.1345 -0.3755 -0.4024 -0.0327 1051 LYS A O   
1797 C CB  . LYS A 282 ? 1.2935 1.0797 1.0204 -0.4110 -0.2845 -0.1274 1051 LYS A CB  
1798 C CG  . LYS A 282 ? 1.3110 1.0530 0.9598 -0.4544 -0.2515 -0.1702 1051 LYS A CG  
1799 C CD  . LYS A 282 ? 1.2767 1.0241 0.9645 -0.4594 -0.2490 -0.1842 1051 LYS A CD  
1800 N N   . SER A 283 ? 1.3446 1.1390 1.0199 -0.4716 -0.4248 -0.0405 1052 SER A N   
1801 C CA  . SER A 283 ? 1.3621 1.1573 1.0356 -0.4751 -0.4745 0.0032  1052 SER A CA  
1802 C C   . SER A 283 ? 1.3843 1.1442 0.9722 -0.4839 -0.4434 -0.0079 1052 SER A C   
1803 O O   . SER A 283 ? 1.3654 1.0955 0.8766 -0.5022 -0.3867 -0.0498 1052 SER A O   
1804 C CB  . SER A 283 ? 1.4375 1.2232 1.0722 -0.5145 -0.5239 0.0401  1052 SER A CB  
1805 O OG  . SER A 283 ? 1.5456 1.2841 1.0420 -0.5652 -0.5013 0.0300  1052 SER A OG  
1806 N N   . PRO A 284 ? 1.3969 1.1621 1.0111 -0.4678 -0.4764 0.0274  1053 PRO A N   
1807 C CA  . PRO A 284 ? 1.4200 1.1521 0.9502 -0.4810 -0.4531 0.0232  1053 PRO A CA  
1808 C C   . PRO A 284 ? 1.5257 1.2181 0.9335 -0.5403 -0.4590 0.0385  1053 PRO A C   
1809 O O   . PRO A 284 ? 1.5838 1.2563 0.9170 -0.5743 -0.4178 0.0046  1053 PRO A O   
1810 C CB  . PRO A 284 ? 1.3795 1.1345 0.9999 -0.4377 -0.4878 0.0629  1053 PRO A CB  
1811 C CG  . PRO A 284 ? 1.3735 1.1602 1.0936 -0.4316 -0.5542 0.0985  1053 PRO A CG  
1812 C CD  . PRO A 284 ? 1.3519 1.1583 1.0967 -0.4286 -0.5269 0.0673  1053 PRO A CD  
1813 N N   . PRO A 287 ? 1.5350 1.1604 0.7708 -0.5873 -0.1864 -0.1728 1056 PRO A N   
1814 C CA  . PRO A 287 ? 1.5573 1.1717 0.7977 -0.5911 -0.1151 -0.2330 1056 PRO A CA  
1815 C C   . PRO A 287 ? 1.4825 1.1082 0.8261 -0.5338 -0.0843 -0.2626 1056 PRO A C   
1816 O O   . PRO A 287 ? 1.4930 1.1168 0.8604 -0.5092 -0.0491 -0.2796 1056 PRO A O   
1817 C CB  . PRO A 287 ? 1.5962 1.2079 0.8145 -0.6231 -0.1345 -0.2311 1056 PRO A CB  
1818 C CG  . PRO A 287 ? 1.5653 1.1979 0.8144 -0.6125 -0.2148 -0.1745 1056 PRO A CG  
1819 C CD  . PRO A 287 ? 1.5605 1.1942 0.7926 -0.6082 -0.2486 -0.1338 1056 PRO A CD  
1820 N N   . GLU A 288 ? 1.4941 1.1300 0.8987 -0.5159 -0.0990 -0.2650 1057 GLU A N   
1821 C CA  . GLU A 288 ? 1.4020 1.0457 0.9052 -0.4673 -0.0784 -0.2818 1057 GLU A CA  
1822 C C   . GLU A 288 ? 1.4158 1.0910 0.9773 -0.4122 -0.0947 -0.2418 1057 GLU A C   
1823 O O   . GLU A 288 ? 1.3889 1.0697 1.0116 -0.3704 -0.0598 -0.2530 1057 GLU A O   
1824 C CB  . GLU A 288 ? 1.3592 1.0189 0.9177 -0.4566 -0.1030 -0.2711 1057 GLU A CB  
1825 C CG  . GLU A 288 ? 1.4134 1.0513 0.9457 -0.4903 -0.0783 -0.3072 1057 GLU A CG  
1826 C CD  . GLU A 288 ? 1.4395 1.0590 1.0288 -0.4691 -0.0156 -0.3546 1057 GLU A CD  
1827 O OE1 . GLU A 288 ? 1.3862 1.0078 1.0435 -0.4299 0.0009  -0.3577 1057 GLU A OE1 
1828 O OE2 . GLU A 288 ? 1.5501 1.1536 1.1234 -0.4920 0.0153  -0.3869 1057 GLU A OE2 
1829 N N   . MET A 289 ? 1.4130 1.1074 0.9618 -0.4145 -0.1505 -0.1949 1058 MET A N   
1830 C CA  . MET A 289 ? 1.3440 1.0679 0.9517 -0.3663 -0.1671 -0.1595 1058 MET A CA  
1831 C C   . MET A 289 ? 1.3326 1.0392 0.8963 -0.3681 -0.1407 -0.1676 1058 MET A C   
1832 O O   . MET A 289 ? 1.2922 1.0165 0.9107 -0.3231 -0.1282 -0.1571 1058 MET A O   
1833 C CB  . MET A 289 ? 1.3212 1.0678 0.9442 -0.3706 -0.2343 -0.1115 1058 MET A CB  
1834 C CG  . MET A 289 ? 1.2730 1.0519 0.9759 -0.3527 -0.2564 -0.1009 1058 MET A CG  
1835 S SD  . MET A 289 ? 1.2516 1.0672 1.0681 -0.2863 -0.2222 -0.1039 1058 MET A SD  
1836 C CE  . MET A 289 ? 1.1320 0.9587 0.9658 -0.2563 -0.2274 -0.0803 1058 MET A CE  
1837 N N   . LYS A 290 ? 1.3880 1.0597 0.8480 -0.4259 -0.1302 -0.1883 1059 LYS A N   
1838 C CA  . LYS A 290 ? 1.4294 1.0827 0.8374 -0.4385 -0.0997 -0.2018 1059 LYS A CA  
1839 C C   . LYS A 290 ? 1.3811 1.0352 0.8503 -0.4033 -0.0333 -0.2447 1059 LYS A C   
1840 O O   . LYS A 290 ? 1.3598 1.0213 0.8530 -0.3750 -0.0161 -0.2401 1059 LYS A O   
1841 C CB  . LYS A 290 ? 1.5020 1.1248 0.7908 -0.5104 -0.0935 -0.2138 1059 LYS A CB  
1842 N N   . ASP A 291 ? 1.3584 1.0038 0.8607 -0.4055 -0.0003 -0.2841 1060 ASP A N   
1843 C CA  . ASP A 291 ? 1.3183 0.9623 0.9014 -0.3717 0.0536  -0.3212 1060 ASP A CA  
1844 C C   . ASP A 291 ? 1.2653 0.9404 0.9453 -0.3054 0.0394  -0.2860 1060 ASP A C   
1845 O O   . ASP A 291 ? 1.2248 0.9036 0.9451 -0.2793 0.0661  -0.2931 1060 ASP A O   
1846 C CB  . ASP A 291 ? 1.4633 1.0905 1.0815 -0.3838 0.0800  -0.3627 1060 ASP A CB  
1847 C CG  . ASP A 291 ? 1.5656 1.1829 1.1127 -0.4326 0.1034  -0.3860 1060 ASP A CG  
1848 O OD1 . ASP A 291 ? 1.6143 1.2298 1.1202 -0.4538 0.1374  -0.4012 1060 ASP A OD1 
1849 O OD2 . ASP A 291 ? 1.6013 1.2136 1.1352 -0.4528 0.0911  -0.3898 1060 ASP A OD2 
1850 N N   . PHE A 292 ? 1.2333 0.9313 0.9490 -0.2838 -0.0011 -0.2503 1061 PHE A N   
1851 C CA  . PHE A 292 ? 1.1739 0.9006 0.9729 -0.2325 -0.0116 -0.2213 1061 PHE A CA  
1852 C C   . PHE A 292 ? 1.1818 0.9236 0.9805 -0.2093 -0.0165 -0.1973 1061 PHE A C   
1853 O O   . PHE A 292 ? 1.1326 0.8810 0.9816 -0.1791 0.0029  -0.1971 1061 PHE A O   
1854 C CB  . PHE A 292 ? 1.1544 0.9055 0.9793 -0.2256 -0.0510 -0.1922 1061 PHE A CB  
1855 N N   . ARG A 293 ? 1.1564 0.9013 0.9010 -0.2264 -0.0472 -0.1747 1062 ARG A N   
1856 C CA  . ARG A 293 ? 1.1089 0.8670 0.8572 -0.2058 -0.0592 -0.1483 1062 ARG A CA  
1857 C C   . ARG A 293 ? 1.1064 0.8447 0.8163 -0.2150 -0.0250 -0.1682 1062 ARG A C   
1858 O O   . ARG A 293 ? 1.0896 0.8389 0.8251 -0.1881 -0.0188 -0.1558 1062 ARG A O   
1859 C CB  . ARG A 293 ? 1.1404 0.9039 0.8574 -0.2231 -0.1102 -0.1149 1062 ARG A CB  
1860 C CG  . ARG A 293 ? 1.1035 0.8888 0.8646 -0.2199 -0.1438 -0.0994 1062 ARG A CG  
1861 C CD  . ARG A 293 ? 1.1302 0.9293 0.9044 -0.2228 -0.1979 -0.0614 1062 ARG A CD  
1862 N N   . HIS A 294 ? 1.1798 0.8900 0.8293 -0.2571 0.0007  -0.2031 1063 HIS A N   
1863 C CA  . HIS A 294 ? 1.2046 0.8965 0.8113 -0.2773 0.0384  -0.2291 1063 HIS A CA  
1864 C C   . HIS A 294 ? 1.1351 0.8389 0.8222 -0.2356 0.0739  -0.2422 1063 HIS A C   
1865 O O   . HIS A 294 ? 1.0971 0.8003 0.7703 -0.2336 0.0885  -0.2418 1063 HIS A O   
1866 C CB  . HIS A 294 ? 1.2371 0.8991 0.7802 -0.3330 0.0736  -0.2783 1063 HIS A CB  
1867 C CG  . HIS A 294 ? 1.2521 0.8999 0.7769 -0.3528 0.1292  -0.3207 1063 HIS A CG  
1868 N ND1 . HIS A 294 ? 1.2777 0.9217 0.7461 -0.3675 0.1277  -0.3062 1063 HIS A ND1 
1869 C CD2 . HIS A 294 ? 1.2627 0.9101 0.8403 -0.3535 0.1866  -0.3693 1063 HIS A CD2 
1870 C CE1 . HIS A 294 ? 1.2716 0.9172 0.7563 -0.3775 0.1845  -0.3443 1063 HIS A CE1 
1871 N NE2 . HIS A 294 ? 1.2900 0.9434 0.8510 -0.3655 0.2197  -0.3793 1063 HIS A NE2 
1872 N N   . GLY A 295 ? 1.0880 0.8005 0.8591 -0.2064 0.0835  -0.2508 1064 GLY A N   
1873 C CA  . GLY A 295 ? 1.0354 0.7583 0.8902 -0.1695 0.1041  -0.2536 1064 GLY A CA  
1874 C C   . GLY A 295 ? 0.9801 0.7251 0.8438 -0.1399 0.0799  -0.2124 1064 GLY A C   
1875 O O   . GLY A 295 ? 0.9673 0.7154 0.8472 -0.1282 0.0973  -0.2145 1064 GLY A O   
1876 N N   . PHE A 296 ? 0.9104 0.6716 0.7685 -0.1301 0.0421  -0.1787 1065 PHE A N   
1877 C CA  . PHE A 296 ? 0.9128 0.6957 0.7872 -0.1045 0.0225  -0.1457 1065 PHE A CA  
1878 C C   . PHE A 296 ? 0.9177 0.6928 0.7357 -0.1164 0.0186  -0.1377 1065 PHE A C   
1879 O O   . PHE A 296 ? 0.9021 0.6879 0.7358 -0.0968 0.0170  -0.1216 1065 PHE A O   
1880 C CB  . PHE A 296 ? 0.9192 0.7229 0.8124 -0.0963 -0.0106 -0.1210 1065 PHE A CB  
1881 C CG  . PHE A 296 ? 0.9291 0.7428 0.8759 -0.0857 -0.0091 -0.1216 1065 PHE A CG  
1882 C CD1 . PHE A 296 ? 0.8812 0.7051 0.8743 -0.0663 -0.0009 -0.1123 1065 PHE A CD1 
1883 C CD2 . PHE A 296 ? 0.9898 0.8005 0.9355 -0.1008 -0.0198 -0.1281 1065 PHE A CD2 
1884 C CE1 . PHE A 296 ? 0.8544 0.6827 0.8879 -0.0649 -0.0052 -0.1070 1065 PHE A CE1 
1885 C CE2 . PHE A 296 ? 0.9667 0.7835 0.9583 -0.0952 -0.0204 -0.1260 1065 PHE A CE2 
1886 C CZ  . PHE A 296 ? 0.9308 0.7552 0.9646 -0.0786 -0.0142 -0.1141 1065 PHE A CZ  
1887 N N   . ASP A 297 ? 0.9634 0.7172 0.7102 -0.1542 0.0149  -0.1477 1066 ASP A N   
1888 C CA  . ASP A 297 ? 1.0210 0.7606 0.7028 -0.1759 0.0073  -0.1371 1066 ASP A CA  
1889 C C   . ASP A 297 ? 0.9952 0.7275 0.6747 -0.1771 0.0510  -0.1623 1066 ASP A C   
1890 O O   . ASP A 297 ? 0.9788 0.7118 0.6459 -0.1708 0.0481  -0.1467 1066 ASP A O   
1891 C CB  . ASP A 297 ? 1.1097 0.8243 0.7032 -0.2286 -0.0116 -0.1386 1066 ASP A CB  
1892 C CG  . ASP A 297 ? 1.1869 0.9107 0.7910 -0.2281 -0.0641 -0.1069 1066 ASP A CG  
1893 O OD1 . ASP A 297 ? 1.1618 0.9053 0.8168 -0.1970 -0.0940 -0.0752 1066 ASP A OD1 
1894 O OD2 . ASP A 297 ? 1.2356 0.9483 0.8043 -0.2601 -0.0734 -0.1169 1066 ASP A OD2 
1895 N N   . ILE A 298 ? 1.0252 0.7510 0.7277 -0.1850 0.0916  -0.2030 1067 ILE A N   
1896 C CA  . ILE A 298 ? 0.9908 0.7153 0.7205 -0.1828 0.1361  -0.2323 1067 ILE A CA  
1897 C C   . ILE A 298 ? 0.9538 0.7009 0.7594 -0.1360 0.1295  -0.2088 1067 ILE A C   
1898 O O   . ILE A 298 ? 0.9326 0.6824 0.7376 -0.1324 0.1437  -0.2083 1067 ILE A O   
1899 C CB  . ILE A 298 ? 1.0112 0.7269 0.7862 -0.1945 0.1801  -0.2837 1067 ILE A CB  
1900 C CG1 . ILE A 298 ? 1.0916 0.7819 0.7778 -0.2523 0.1964  -0.3162 1067 ILE A CG1 
1901 C CG2 . ILE A 298 ? 0.9389 0.6598 0.7758 -0.1850 0.2235  -0.3132 1067 ILE A CG2 
1902 C CD1 . ILE A 298 ? 1.0904 0.7740 0.8244 -0.2693 0.2505  -0.3748 1067 ILE A CD1 
1903 N N   . LEU A 299 ? 0.8922 0.6546 0.7560 -0.1066 0.1078  -0.1891 1068 LEU A N   
1904 C CA  . LEU A 299 ? 0.8535 0.6352 0.7777 -0.0726 0.0987  -0.1656 1068 LEU A CA  
1905 C C   . LEU A 299 ? 0.8492 0.6393 0.7399 -0.0648 0.0802  -0.1371 1068 LEU A C   
1906 O O   . LEU A 299 ? 0.8264 0.6225 0.7350 -0.0532 0.0898  -0.1321 1068 LEU A O   
1907 C CB  . LEU A 299 ? 0.8505 0.6435 0.8220 -0.0562 0.0773  -0.1490 1068 LEU A CB  
1908 C CG  . LEU A 299 ? 0.8056 0.6124 0.8393 -0.0339 0.0710  -0.1297 1068 LEU A CG  
1909 C CD1 . LEU A 299 ? 0.7998 0.5978 0.8991 -0.0307 0.0915  -0.1495 1068 LEU A CD1 
1910 C CD2 . LEU A 299 ? 0.8359 0.6534 0.8903 -0.0293 0.0471  -0.1088 1068 LEU A CD2 
1911 N N   . VAL A 300 ? 0.8196 0.6097 0.6718 -0.0713 0.0518  -0.1184 1069 VAL A N   
1912 C CA  . VAL A 300 ? 0.8173 0.6128 0.6546 -0.0629 0.0317  -0.0929 1069 VAL A CA  
1913 C C   . VAL A 300 ? 0.8375 0.6157 0.6259 -0.0799 0.0450  -0.0976 1069 VAL A C   
1914 O O   . VAL A 300 ? 0.8455 0.6282 0.6417 -0.0671 0.0446  -0.0847 1069 VAL A O   
1915 C CB  . VAL A 300 ? 0.8686 0.6650 0.6910 -0.0693 -0.0052 -0.0734 1069 VAL A CB  
1916 C CG1 . VAL A 300 ? 0.8947 0.6898 0.7125 -0.0635 -0.0269 -0.0499 1069 VAL A CG1 
1917 C CG2 . VAL A 300 ? 0.8356 0.6549 0.7131 -0.0524 -0.0146 -0.0694 1069 VAL A CG2 
1918 N N   . GLY A 301 ? 0.9100 0.6676 0.6444 -0.1140 0.0599  -0.1189 1070 GLY A N   
1919 C CA  . GLY A 301 ? 0.9513 0.6912 0.6288 -0.1412 0.0778  -0.1279 1070 GLY A CA  
1920 C C   . GLY A 301 ? 0.9071 0.6588 0.6328 -0.1233 0.1129  -0.1443 1070 GLY A C   
1921 O O   . GLY A 301 ? 0.9043 0.6526 0.6097 -0.1263 0.1171  -0.1362 1070 GLY A O   
1922 N N   . GLN A 302 ? 0.9086 0.6732 0.7046 -0.1058 0.1338  -0.1650 1071 GLN A N   
1923 C CA  . GLN A 302 ? 0.8624 0.6398 0.7225 -0.0883 0.1586  -0.1760 1071 GLN A CA  
1924 C C   . GLN A 302 ? 0.8595 0.6533 0.7505 -0.0581 0.1347  -0.1416 1071 GLN A C   
1925 O O   . GLN A 302 ? 0.8763 0.6759 0.7825 -0.0527 0.1458  -0.1397 1071 GLN A O   
1926 C CB  . GLN A 302 ? 0.8321 0.6151 0.7739 -0.0789 0.1780  -0.2020 1071 GLN A CB  
1927 C CG  . GLN A 302 ? 0.8818 0.6495 0.8107 -0.1109 0.2157  -0.2496 1071 GLN A CG  
1928 C CD  . GLN A 302 ? 0.8703 0.6417 0.9029 -0.0966 0.2315  -0.2746 1071 GLN A CD  
1929 O OE1 . GLN A 302 ? 0.8653 0.6393 0.9323 -0.0781 0.2039  -0.2547 1071 GLN A OE1 
1930 N NE2 . GLN A 302 ? 0.8697 0.6413 0.9619 -0.1066 0.2760  -0.3190 1071 GLN A NE2 
1931 N N   . ILE A 303 ? 0.7610 0.5631 0.6614 -0.0426 0.1054  -0.1181 1072 ILE A N   
1932 C CA  . ILE A 303 ? 0.7286 0.5452 0.6485 -0.0230 0.0881  -0.0918 1072 ILE A CA  
1933 C C   . ILE A 303 ? 0.7887 0.5971 0.6632 -0.0279 0.0825  -0.0802 1072 ILE A C   
1934 O O   . ILE A 303 ? 0.7266 0.5421 0.6146 -0.0182 0.0846  -0.0704 1072 ILE A O   
1935 C CB  . ILE A 303 ? 0.7661 0.5939 0.7004 -0.0138 0.0649  -0.0767 1072 ILE A CB  
1936 C CG1 . ILE A 303 ? 0.7495 0.5842 0.7327 -0.0096 0.0658  -0.0803 1072 ILE A CG1 
1937 C CG2 . ILE A 303 ? 0.7487 0.5893 0.6907 -0.0030 0.0544  -0.0584 1072 ILE A CG2 
1938 C CD1 . ILE A 303 ? 0.7659 0.6132 0.7606 -0.0068 0.0473  -0.0670 1072 ILE A CD1 
1939 N N   . ASP A 304 ? 0.7846 0.5753 0.6043 -0.0470 0.0718  -0.0788 1073 ASP A N   
1940 C CA  . ASP A 304 ? 0.8440 0.6204 0.6231 -0.0552 0.0577  -0.0616 1073 ASP A CA  
1941 C C   . ASP A 304 ? 0.8281 0.5969 0.5853 -0.0679 0.0846  -0.0731 1073 ASP A C   
1942 O O   . ASP A 304 ? 0.8073 0.5734 0.5610 -0.0624 0.0802  -0.0594 1073 ASP A O   
1943 C CB  . ASP A 304 ? 0.9116 0.6660 0.6350 -0.0808 0.0304  -0.0504 1073 ASP A CB  
1944 C CG  . ASP A 304 ? 0.9676 0.7313 0.7263 -0.0650 -0.0049 -0.0311 1073 ASP A CG  
1945 O OD1 . ASP A 304 ? 0.9431 0.7289 0.7610 -0.0371 -0.0034 -0.0284 1073 ASP A OD1 
1946 O OD2 . ASP A 304 ? 0.9870 0.7363 0.7150 -0.0851 -0.0339 -0.0196 1073 ASP A OD2 
1947 N N   . ASP A 305 ? 0.8433 0.6091 0.5927 -0.0864 0.1154  -0.1021 1074 ASP A N   
1948 C CA  . ASP A 305 ? 0.8260 0.5906 0.5711 -0.0996 0.1482  -0.1204 1074 ASP A CA  
1949 C C   . ASP A 305 ? 0.7899 0.5770 0.6062 -0.0693 0.1531  -0.1140 1074 ASP A C   
1950 O O   . ASP A 305 ? 0.7654 0.5522 0.5743 -0.0718 0.1605  -0.1091 1074 ASP A O   
1951 C CB  . ASP A 305 ? 0.8852 0.6470 0.6311 -0.1252 0.1874  -0.1626 1074 ASP A CB  
1952 C CG  . ASP A 305 ? 1.0288 0.7638 0.6805 -0.1707 0.1861  -0.1709 1074 ASP A CG  
1953 O OD1 . ASP A 305 ? 1.0797 0.7959 0.6644 -0.1856 0.1528  -0.1396 1074 ASP A OD1 
1954 O OD2 . ASP A 305 ? 1.0837 0.8144 0.7303 -0.1951 0.2160  -0.2080 1074 ASP A OD2 
1955 N N   . ALA A 306 ? 0.7252 0.5295 0.6047 -0.0460 0.1451  -0.1108 1075 ALA A N   
1956 C CA  . ALA A 306 ? 0.6858 0.5084 0.6244 -0.0259 0.1408  -0.0984 1075 ALA A CA  
1957 C C   . ALA A 306 ? 0.6712 0.4948 0.5865 -0.0174 0.1209  -0.0724 1075 ALA A C   
1958 O O   . ALA A 306 ? 0.6384 0.4703 0.5728 -0.0133 0.1232  -0.0649 1075 ALA A O   
1959 C CB  . ALA A 306 ? 0.6265 0.4607 0.6243 -0.0128 0.1296  -0.0951 1075 ALA A CB  
1960 N N   . LEU A 307 ? 0.6565 0.4723 0.5396 -0.0161 0.1016  -0.0610 1076 LEU A N   
1961 C CA  . LEU A 307 ? 0.6605 0.4765 0.5378 -0.0081 0.0871  -0.0441 1076 LEU A CA  
1962 C C   . LEU A 307 ? 0.6949 0.4956 0.5397 -0.0172 0.0924  -0.0405 1076 LEU A C   
1963 O O   . LEU A 307 ? 0.6488 0.4533 0.5039 -0.0120 0.0937  -0.0338 1076 LEU A O   
1964 C CB  . LEU A 307 ? 0.7131 0.5249 0.5845 -0.0045 0.0650  -0.0362 1076 LEU A CB  
1965 C CG  . LEU A 307 ? 0.6897 0.5218 0.6002 0.0059  0.0593  -0.0357 1076 LEU A CG  
1966 C CD1 . LEU A 307 ? 0.7551 0.5855 0.6687 0.0068  0.0401  -0.0334 1076 LEU A CD1 
1967 C CD2 . LEU A 307 ? 0.6515 0.4944 0.5821 0.0104  0.0633  -0.0327 1076 LEU A CD2 
1968 N N   . LYS A 308 ? 0.7323 0.5140 0.5315 -0.0368 0.0964  -0.0457 1077 LYS A N   
1969 C CA  . LYS A 308 ? 0.7900 0.5536 0.5489 -0.0533 0.1013  -0.0411 1077 LYS A CA  
1970 C C   . LYS A 308 ? 0.7371 0.5156 0.5238 -0.0509 0.1268  -0.0515 1077 LYS A C   
1971 O O   . LYS A 308 ? 0.7062 0.4792 0.4852 -0.0514 0.1258  -0.0419 1077 LYS A O   
1972 C CB  . LYS A 308 ? 0.8455 0.5860 0.5391 -0.0875 0.1056  -0.0482 1077 LYS A CB  
1973 C CG  . LYS A 308 ? 0.9203 0.6390 0.5607 -0.1142 0.1114  -0.0428 1077 LYS A CG  
1974 C CD  . LYS A 308 ? 1.0179 0.7094 0.5758 -0.1604 0.1112  -0.0468 1077 LYS A CD  
1975 C CE  . LYS A 308 ? 1.1001 0.7715 0.5987 -0.1966 0.1258  -0.0467 1077 LYS A CE  
1976 N NZ  . LYS A 308 ? 1.1061 0.7742 0.6306 -0.1745 0.1093  -0.0230 1077 LYS A NZ  
1977 N N   . LEU A 309 ? 0.7024 0.4993 0.5311 -0.0484 0.1469  -0.0705 1078 LEU A N   
1978 C CA  . LEU A 309 ? 0.6510 0.4658 0.5279 -0.0453 0.1649  -0.0783 1078 LEU A CA  
1979 C C   . LEU A 309 ? 0.6468 0.4739 0.5528 -0.0290 0.1467  -0.0575 1078 LEU A C   
1980 O O   . LEU A 309 ? 0.6556 0.4856 0.5649 -0.0325 0.1510  -0.0524 1078 LEU A O   
1981 C CB  . LEU A 309 ? 0.6287 0.4596 0.5694 -0.0434 0.1830  -0.1012 1078 LEU A CB  
1982 C CG  . LEU A 309 ? 0.6581 0.4795 0.5771 -0.0673 0.2139  -0.1343 1078 LEU A CG  
1983 C CD1 . LEU A 309 ? 0.6376 0.4731 0.6376 -0.0599 0.2287  -0.1588 1078 LEU A CD1 
1984 C CD2 . LEU A 309 ? 0.6795 0.4986 0.5783 -0.0914 0.2442  -0.1517 1078 LEU A CD2 
1985 N N   . ALA A 310 ? 0.5925 0.4264 0.5145 -0.0171 0.1286  -0.0476 1079 ALA A N   
1986 C CA  . ALA A 310 ? 0.5703 0.4146 0.5073 -0.0128 0.1151  -0.0322 1079 ALA A CA  
1987 C C   . ALA A 310 ? 0.5908 0.4225 0.4921 -0.0148 0.1134  -0.0263 1079 ALA A C   
1988 O O   . ALA A 310 ? 0.5763 0.4126 0.4812 -0.0200 0.1139  -0.0205 1079 ALA A O   
1989 C CB  . ALA A 310 ? 0.5726 0.4244 0.5221 -0.0080 0.1010  -0.0269 1079 ALA A CB  
1990 N N   . ASN A 311 ? 0.6271 0.4406 0.4983 -0.0133 0.1083  -0.0267 1080 ASN A N   
1991 C CA  . ASN A 311 ? 0.6685 0.4650 0.5222 -0.0132 0.1017  -0.0202 1080 ASN A CA  
1992 C C   . ASN A 311 ? 0.6546 0.4400 0.4877 -0.0239 0.1115  -0.0181 1080 ASN A C   
1993 O O   . ASN A 311 ? 0.6495 0.4265 0.4819 -0.0245 0.1104  -0.0143 1080 ASN A O   
1994 C CB  . ASN A 311 ? 0.7177 0.4940 0.5541 -0.0120 0.0839  -0.0144 1080 ASN A CB  
1995 C CG  . ASN A 311 ? 0.7718 0.5316 0.6206 -0.0068 0.0703  -0.0070 1080 ASN A CG  
1996 O OD1 . ASN A 311 ? 0.7007 0.4724 0.5840 0.0009  0.0765  -0.0150 1080 ASN A OD1 
1997 N ND2 . ASN A 311 ? 0.8476 0.5778 0.6706 -0.0156 0.0515  0.0073  1080 ASN A ND2 
1998 N N   . GLU A 312 ? 0.7214 0.5074 0.5417 -0.0349 0.1248  -0.0246 1081 GLU A N   
1999 C CA  . GLU A 312 ? 0.7195 0.4991 0.5229 -0.0492 0.1387  -0.0261 1081 GLU A CA  
2000 C C   . GLU A 312 ? 0.6832 0.4879 0.5298 -0.0472 0.1483  -0.0289 1081 GLU A C   
2001 O O   . GLU A 312 ? 0.6921 0.4980 0.5379 -0.0584 0.1605  -0.0313 1081 GLU A O   
2002 C CB  . GLU A 312 ? 0.7476 0.5178 0.5183 -0.0700 0.1549  -0.0383 1081 GLU A CB  
2003 C CG  . GLU A 312 ? 0.8313 0.5682 0.5415 -0.0846 0.1365  -0.0263 1081 GLU A CG  
2004 C CD  . GLU A 312 ? 0.9398 0.6685 0.6083 -0.1115 0.1500  -0.0409 1081 GLU A CD  
2005 O OE1 . GLU A 312 ? 0.9306 0.6818 0.6316 -0.1119 0.1770  -0.0664 1081 GLU A OE1 
2006 O OE2 . GLU A 312 ? 1.0166 0.7138 0.6211 -0.1363 0.1320  -0.0269 1081 GLU A OE2 
2007 N N   . GLY A 313 ? 0.5771 0.4007 0.4606 -0.0372 0.1390  -0.0257 1082 GLY A N   
2008 C CA  . GLY A 313 ? 0.5822 0.4266 0.5061 -0.0411 0.1359  -0.0198 1082 GLY A CA  
2009 C C   . GLY A 313 ? 0.5936 0.4568 0.5755 -0.0413 0.1433  -0.0276 1082 GLY A C   
2010 O O   . GLY A 313 ? 0.6209 0.5008 0.6491 -0.0465 0.1360  -0.0196 1082 GLY A O   
2011 N N   . LYS A 314 ? 0.5994 0.4596 0.5862 -0.0383 0.1571  -0.0447 1083 LYS A N   
2012 C CA  . LYS A 314 ? 0.5939 0.4712 0.6514 -0.0390 0.1723  -0.0622 1083 LYS A CA  
2013 C C   . LYS A 314 ? 0.6163 0.5051 0.7335 -0.0277 0.1516  -0.0536 1083 LYS A C   
2014 O O   . LYS A 314 ? 0.5975 0.4823 0.7231 -0.0228 0.1580  -0.0673 1083 LYS A O   
2015 C CB  . LYS A 314 ? 0.6013 0.4681 0.6317 -0.0502 0.2037  -0.0915 1083 LYS A CB  
2016 C CG  . LYS A 314 ? 0.6249 0.4784 0.5973 -0.0707 0.2234  -0.0982 1083 LYS A CG  
2017 C CD  . LYS A 314 ? 0.6522 0.4907 0.5765 -0.0950 0.2523  -0.1253 1083 LYS A CD  
2018 C CE  . LYS A 314 ? 0.7393 0.5557 0.5836 -0.1226 0.2618  -0.1219 1083 LYS A CE  
2019 N NZ  . LYS A 314 ? 0.7827 0.6169 0.6651 -0.1392 0.2951  -0.1437 1083 LYS A NZ  
2020 N N   . VAL A 315 ? 0.5696 0.4696 0.7217 -0.0289 0.1241  -0.0287 1084 VAL A N   
2021 C CA  . VAL A 315 ? 0.5721 0.4766 0.7627 -0.0263 0.0946  -0.0101 1084 VAL A CA  
2022 C C   . VAL A 315 ? 0.5535 0.4663 0.8404 -0.0175 0.0975  -0.0237 1084 VAL A C   
2023 O O   . VAL A 315 ? 0.5332 0.4398 0.8284 -0.0114 0.0910  -0.0255 1084 VAL A O   
2024 C CB  . VAL A 315 ? 0.5697 0.4815 0.7709 -0.0420 0.0606  0.0230  1084 VAL A CB  
2025 C CG1 . VAL A 315 ? 0.5618 0.4737 0.7931 -0.0488 0.0256  0.0472  1084 VAL A CG1 
2026 C CG2 . VAL A 315 ? 0.5927 0.4951 0.7042 -0.0536 0.0640  0.0284  1084 VAL A CG2 
2027 N N   . LYS A 316 ? 0.5500 0.4773 0.9169 -0.0176 0.1097  -0.0367 1085 LYS A N   
2028 C CA  . LYS A 316 ? 0.5446 0.4820 1.0309 -0.0090 0.1186  -0.0579 1085 LYS A CA  
2029 C C   . LYS A 316 ? 0.5334 0.4596 0.9933 -0.0054 0.1555  -0.0965 1085 LYS A C   
2030 O O   . LYS A 316 ? 0.5007 0.4231 1.0170 0.0024  0.1494  -0.1034 1085 LYS A O   
2031 C CB  . LYS A 316 ? 0.5276 0.4856 1.1033 -0.0118 0.1386  -0.0770 1085 LYS A CB  
2032 C CG  . LYS A 316 ? 0.5669 0.5414 1.2577 -0.0120 0.0936  -0.0440 1085 LYS A CG  
2033 C CD  . LYS A 316 ? 0.6016 0.5674 1.3446 -0.0075 0.0460  -0.0127 1085 LYS A CD  
2034 C CE  . LYS A 316 ? 0.5941 0.5701 1.4330 -0.0170 -0.0133 0.0335  1085 LYS A CE  
2035 N NZ  . LYS A 316 ? 0.5840 0.5433 1.4274 -0.0250 -0.0692 0.0771  1085 LYS A NZ  
2036 N N   . GLU A 317 ? 0.5814 0.4993 0.9538 -0.0158 0.1908  -0.1196 1086 GLU A N   
2037 C CA  . GLU A 317 ? 0.6061 0.5099 0.9301 -0.0237 0.2237  -0.1537 1086 GLU A CA  
2038 C C   . GLU A 317 ? 0.6008 0.4896 0.8726 -0.0160 0.1984  -0.1355 1086 GLU A C   
2039 O O   . GLU A 317 ? 0.6145 0.4971 0.9057 -0.0161 0.2100  -0.1572 1086 GLU A O   
2040 C CB  . GLU A 317 ? 0.6097 0.5015 0.8318 -0.0449 0.2525  -0.1683 1086 GLU A CB  
2041 C CG  . GLU A 317 ? 0.6135 0.5188 0.8775 -0.0622 0.2940  -0.2019 1086 GLU A CG  
2042 C CD  . GLU A 317 ? 0.7296 0.6435 0.9867 -0.0624 0.2812  -0.1778 1086 GLU A CD  
2043 O OE1 . GLU A 317 ? 0.7602 0.6774 1.0267 -0.0462 0.2394  -0.1386 1086 GLU A OE1 
2044 O OE2 . GLU A 317 ? 0.7690 0.6847 1.0031 -0.0841 0.3140  -0.1990 1086 GLU A OE2 
2045 N N   . ALA A 318 ? 0.5998 0.4835 0.8091 -0.0119 0.1676  -0.1001 1087 ALA A N   
2046 C CA  . ALA A 318 ? 0.6009 0.4746 0.7664 -0.0066 0.1461  -0.0849 1087 ALA A CA  
2047 C C   . ALA A 318 ? 0.6056 0.4847 0.8481 0.0012  0.1244  -0.0752 1087 ALA A C   
2048 O O   . ALA A 318 ? 0.5946 0.4658 0.8268 0.0036  0.1201  -0.0793 1087 ALA A O   
2049 C CB  . ALA A 318 ? 0.6112 0.4823 0.7137 -0.0069 0.1247  -0.0569 1087 ALA A CB  
2050 N N   . GLN A 319 ? 0.5941 0.4848 0.9155 0.0026  0.1057  -0.0587 1088 GLN A N   
2051 C CA  . GLN A 319 ? 0.6070 0.4980 1.0100 0.0061  0.0758  -0.0419 1088 GLN A CA  
2052 C C   . GLN A 319 ? 0.5788 0.4672 1.0633 0.0139  0.1005  -0.0787 1088 GLN A C   
2053 O O   . GLN A 319 ? 0.5690 0.4477 1.0778 0.0172  0.0876  -0.0768 1088 GLN A O   
2054 C CB  . GLN A 319 ? 0.5967 0.4980 1.0678 0.0002  0.0405  -0.0089 1088 GLN A CB  
2055 C CG  . GLN A 319 ? 0.6236 0.5237 1.0099 -0.0165 0.0130  0.0275  1088 GLN A CG  
2056 C CD  . GLN A 319 ? 0.6096 0.5175 1.0473 -0.0316 -0.0245 0.0621  1088 GLN A CD  
2057 O OE1 . GLN A 319 ? 0.5718 0.4918 1.0786 -0.0265 -0.0172 0.0537  1088 GLN A OE1 
2058 N NE2 . GLN A 319 ? 0.6161 0.5175 1.0192 -0.0557 -0.0655 0.1013  1088 GLN A NE2 
2059 N N   . ALA A 320 ? 0.5798 0.4761 1.1041 0.0130  0.1404  -0.1167 1089 ALA A N   
2060 C CA  . ALA A 320 ? 0.5869 0.4808 1.1886 0.0141  0.1759  -0.1640 1089 ALA A CA  
2061 C C   . ALA A 320 ? 0.5880 0.4643 1.0977 0.0060  0.1958  -0.1854 1089 ALA A C   
2062 O O   . ALA A 320 ? 0.5903 0.4583 1.1514 0.0073  0.2059  -0.2092 1089 ALA A O   
2063 C CB  . ALA A 320 ? 0.5705 0.4784 1.2210 0.0057  0.2240  -0.2076 1089 ALA A CB  
2064 N N   . ALA A 321 ? 0.6493 0.5186 1.0297 -0.0034 0.1982  -0.1757 1090 ALA A N   
2065 C CA  . ALA A 321 ? 0.6848 0.5376 0.9768 -0.0137 0.2064  -0.1873 1090 ALA A CA  
2066 C C   . ALA A 321 ? 0.7406 0.5884 1.0392 -0.0021 0.1697  -0.1601 1090 ALA A C   
2067 O O   . ALA A 321 ? 0.7441 0.5806 1.0288 -0.0074 0.1765  -0.1772 1090 ALA A O   
2068 C CB  . ALA A 321 ? 0.7008 0.5461 0.8724 -0.0256 0.2063  -0.1753 1090 ALA A CB  
2069 N N   . ALA A 322 ? 0.7197 0.5751 1.0338 0.0076  0.1321  -0.1188 1091 ALA A N   
2070 C CA  . ALA A 322 ? 0.7163 0.5676 1.0325 0.0108  0.0981  -0.0917 1091 ALA A CA  
2071 C C   . ALA A 322 ? 0.7153 0.5601 1.1365 0.0155  0.0913  -0.1002 1091 ALA A C   
2072 O O   . ALA A 322 ? 0.6961 0.5315 1.1147 0.0144  0.0746  -0.0917 1091 ALA A O   
2073 C CB  . ALA A 322 ? 0.7010 0.5603 1.0000 0.0081  0.0639  -0.0492 1091 ALA A CB  
2074 N N   . GLU A 323 ? 0.6843 0.5340 1.2074 0.0204  0.1043  -0.1183 1092 GLU A N   
2075 C CA  . GLU A 323 ? 0.7346 0.5767 1.3846 0.0271  0.0982  -0.1301 1092 GLU A CA  
2076 C C   . GLU A 323 ? 0.7155 0.5458 1.3618 0.0223  0.1412  -0.1828 1092 GLU A C   
2077 O O   . GLU A 323 ? 0.6715 0.4928 1.3787 0.0243  0.1322  -0.1883 1092 GLU A O   
2078 C CB  . GLU A 323 ? 0.7426 0.5966 1.5257 0.0345  0.0994  -0.1367 1092 GLU A CB  
2079 N N   . GLN A 324 ? 0.8102 0.6426 1.3746 0.0094  0.1848  -0.2179 1093 GLN A N   
2080 C CA  . GLN A 324 ? 0.7742 0.5966 1.3027 -0.0084 0.2255  -0.2659 1093 GLN A CA  
2081 C C   . GLN A 324 ? 0.7903 0.5970 1.2271 -0.0126 0.2039  -0.2483 1093 GLN A C   
2082 O O   . GLN A 324 ? 0.8367 0.6294 1.2549 -0.0269 0.2247  -0.2806 1093 GLN A O   
2083 C CB  . GLN A 324 ? 0.7806 0.6098 1.2314 -0.0326 0.2696  -0.2978 1093 GLN A CB  
2084 N N   . LEU A 325 ? 0.7853 0.5982 1.1664 -0.0038 0.1630  -0.1983 1094 LEU A N   
2085 C CA  . LEU A 325 ? 0.8137 0.6204 1.1248 -0.0067 0.1390  -0.1776 1094 LEU A CA  
2086 C C   . LEU A 325 ? 0.8415 0.6395 1.2291 -0.0003 0.1165  -0.1680 1094 LEU A C   
2087 O O   . LEU A 325 ? 0.8977 0.6859 1.2565 -0.0070 0.1122  -0.1731 1094 LEU A O   
2088 C CB  . LEU A 325 ? 0.8163 0.6348 1.0614 -0.0020 0.1098  -0.1353 1094 LEU A CB  
2089 C CG  . LEU A 325 ? 0.8742 0.6949 1.0284 -0.0097 0.1222  -0.1384 1094 LEU A CG  
2090 C CD1 . LEU A 325 ? 0.8785 0.7116 1.0088 -0.0020 0.1013  -0.1045 1094 LEU A CD1 
2091 C CD2 . LEU A 325 ? 0.9171 0.7294 1.0022 -0.0208 0.1183  -0.1433 1094 LEU A CD2 
2092 N N   . LYS A 326 ? 0.8379 0.6380 1.3263 0.0102  0.0975  -0.1509 1095 LYS A N   
2093 C CA  . LYS A 326 ? 0.8738 0.6603 1.4480 0.0136  0.0681  -0.1351 1095 LYS A CA  
2094 C C   . LYS A 326 ? 0.9111 0.6810 1.5385 0.0109  0.1001  -0.1847 1095 LYS A C   
2095 O O   . LYS A 326 ? 0.9344 0.6893 1.5703 0.0074  0.0840  -0.1794 1095 LYS A O   
2096 C CB  . LYS A 326 ? 0.8266 0.6153 1.5126 0.0217  0.0373  -0.1066 1095 LYS A CB  
2097 C CG  . LYS A 326 ? 0.8270 0.6067 1.6136 0.0222  0.0012  -0.0862 1095 LYS A CG  
2098 C CD  . LYS A 326 ? 0.8060 0.5983 1.6646 0.0208  -0.0481 -0.0373 1095 LYS A CD  
2099 C CE  . LYS A 326 ? 0.8103 0.5929 1.5750 0.0073  -0.0767 0.0080  1095 LYS A CE  
2100 N NZ  . LYS A 326 ? 0.7802 0.5702 1.5990 -0.0041 -0.1309 0.0601  1095 LYS A NZ  
2101 N N   . THR A 327 ? 0.8853 0.6707 1.5308 0.0060  0.1456  -0.2293 1096 THR A N   
2102 C CA  . THR A 327 ? 0.9042 0.6961 1.5824 -0.0061 0.1796  -0.2731 1096 THR A CA  
2103 C C   . THR A 327 ? 0.8941 0.6650 1.4598 -0.0249 0.1969  -0.2954 1096 THR A C   
2104 O O   . THR A 327 ? 0.8646 0.6289 1.4493 -0.0328 0.2026  -0.3127 1096 THR A O   
2105 C CB  . THR A 327 ? 0.8079 0.6268 1.5280 -0.0177 0.2273  -0.3146 1096 THR A CB  
2106 N N   . THR A 328 ? 0.9364 0.6972 1.3883 -0.0341 0.2024  -0.2939 1097 THR A N   
2107 C CA  . THR A 328 ? 0.9764 0.7237 1.3149 -0.0558 0.2063  -0.3036 1097 THR A CA  
2108 C C   . THR A 328 ? 0.9936 0.7367 1.3304 -0.0476 0.1653  -0.2695 1097 THR A C   
2109 O O   . THR A 328 ? 0.9903 0.7193 1.3047 -0.0632 0.1714  -0.2897 1097 THR A O   
2110 C CB  . THR A 328 ? 0.9777 0.7358 1.1989 -0.0644 0.1993  -0.2818 1097 THR A CB  
2111 O OG1 . THR A 328 ? 1.0018 0.7622 1.2159 -0.0773 0.2376  -0.3120 1097 THR A OG1 
2112 C CG2 . THR A 328 ? 0.9997 0.7482 1.1137 -0.0890 0.1921  -0.2828 1097 THR A CG2 
2113 N N   . ARG A 329 ? 0.9890 0.7442 1.3448 -0.0288 0.1254  -0.2195 1098 ARG A N   
2114 C CA  . ARG A 329 ? 0.9762 0.7292 1.3336 -0.0264 0.0879  -0.1856 1098 ARG A CA  
2115 C C   . ARG A 329 ? 0.9282 0.6590 1.3777 -0.0272 0.0875  -0.2030 1098 ARG A C   
2116 O O   . ARG A 329 ? 0.9876 0.7092 1.4166 -0.0361 0.0750  -0.1996 1098 ARG A O   
2117 C CB  . ARG A 329 ? 0.9281 0.6950 1.2949 -0.0164 0.0516  -0.1349 1098 ARG A CB  
2118 N N   . ASN A 330 ? 0.8861 0.6080 1.4466 -0.0181 0.1015  -0.2235 1099 ASN A N   
2119 C CA  . ASN A 330 ? 0.9221 0.6431 1.5713 -0.0166 0.0983  -0.2324 1099 ASN A CA  
2120 C C   . ASN A 330 ? 0.9250 0.6411 1.5370 -0.0346 0.1387  -0.2829 1099 ASN A C   
2121 O O   . ASN A 330 ? 0.9273 0.6317 1.5654 -0.0393 0.1312  -0.2873 1099 ASN A O   
2122 C CB  . ASN A 330 ? 0.8950 0.6403 1.6661 -0.0034 0.1000  -0.2328 1099 ASN A CB  
2123 C CG  . ASN A 330 ? 0.8707 0.6220 1.6739 0.0082  0.0566  -0.1809 1099 ASN A CG  
2124 O OD1 . ASN A 330 ? 0.8874 0.6223 1.6355 0.0045  0.0198  -0.1388 1099 ASN A OD1 
2125 N ND2 . ASN A 330 ? 0.8466 0.6231 1.7395 0.0166  0.0607  -0.1837 1099 ASN A ND2 
2126 N N   . ALA A 331 ? 0.9359 0.6597 1.4787 -0.0497 0.1794  -0.3183 1100 ALA A N   
2127 C CA  . ALA A 331 ? 0.9978 0.7200 1.4995 -0.0767 0.2206  -0.3662 1100 ALA A CA  
2128 C C   . ALA A 331 ? 1.0320 0.7312 1.4306 -0.0969 0.2087  -0.3665 1100 ALA A C   
2129 O O   . ALA A 331 ? 1.0259 0.7147 1.4396 -0.1067 0.2105  -0.3808 1100 ALA A O   
2130 C CB  . ALA A 331 ? 1.0400 0.7782 1.4929 -0.0962 0.2639  -0.3972 1100 ALA A CB  
2131 N N   . TYR A 332 ? 1.0146 0.7073 1.3148 -0.1046 0.1951  -0.3510 1101 TYR A N   
2132 C CA  . TYR A 332 ? 1.0823 0.7675 1.2805 -0.1281 0.1801  -0.3464 1101 TYR A CA  
2133 C C   . TYR A 332 ? 1.0827 0.7824 1.2737 -0.1097 0.1292  -0.2906 1101 TYR A C   
2134 O O   . TYR A 332 ? 1.0943 0.7948 1.2267 -0.1249 0.1117  -0.2823 1101 TYR A O   
2135 C CB  . TYR A 332 ? 1.1541 0.8456 1.2359 -0.1528 0.1889  -0.3490 1101 TYR A CB  
2136 N N   . ILE A 333 ? 1.0335 0.7451 1.2843 -0.0824 0.1065  -0.2543 1102 ILE A N   
2137 C CA  . ILE A 333 ? 1.0394 0.7688 1.2691 -0.0729 0.0661  -0.2049 1102 ILE A CA  
2138 C C   . ILE A 333 ? 0.9678 0.6882 1.2734 -0.0658 0.0399  -0.1803 1102 ILE A C   
2139 O O   . ILE A 333 ? 0.9760 0.6949 1.2661 -0.0757 0.0218  -0.1687 1102 ILE A O   
2140 C CB  . ILE A 333 ? 0.9775 0.7300 1.1791 -0.0593 0.0568  -0.1758 1102 ILE A CB  
2141 C CG1 . ILE A 333 ? 0.9941 0.7537 1.1109 -0.0700 0.0694  -0.1876 1102 ILE A CG1 
2142 C CG2 . ILE A 333 ? 0.9669 0.7378 1.1597 -0.0546 0.0240  -0.1330 1102 ILE A CG2 
2143 C CD1 . ILE A 333 ? 0.9689 0.7449 1.0660 -0.0573 0.0668  -0.1674 1102 ILE A CD1 
2144 N N   . GLN A 334 ? 0.9038 0.6168 1.2922 -0.0523 0.0343  -0.1699 1103 GLN A N   
2145 C CA  . GLN A 334 ? 0.9053 0.6093 1.3547 -0.0509 -0.0042 -0.1296 1103 GLN A CA  
2146 C C   . GLN A 334 ? 0.9096 0.5902 1.3920 -0.0626 -0.0161 -0.1338 1103 GLN A C   
2147 O O   . GLN A 334 ? 0.8645 0.5458 1.3307 -0.0743 -0.0484 -0.0971 1103 GLN A O   
2148 C CB  . GLN A 334 ? 0.9040 0.5978 1.4564 -0.0374 -0.0116 -0.1218 1103 GLN A CB  
2149 C CG  . GLN A 334 ? 0.9006 0.5902 1.4877 -0.0428 -0.0624 -0.0632 1103 GLN A CG  
2150 C CD  . GLN A 334 ? 0.9257 0.6418 1.4418 -0.0460 -0.0733 -0.0310 1103 GLN A CD  
2151 O OE1 . GLN A 334 ? 0.9807 0.7195 1.4144 -0.0431 -0.0483 -0.0466 1103 GLN A OE1 
2152 N NE2 . GLN A 334 ? 0.9091 0.6198 1.4593 -0.0556 -0.1133 0.0151  1103 GLN A NE2 
2153 N N   . LYS A 335 ? 0.8359 0.4951 1.3613 -0.0643 0.0129  -0.1814 1104 LYS A N   
2154 C CA  . LYS A 335 ? 0.8663 0.4998 1.4273 -0.0760 0.0047  -0.1907 1104 LYS A CA  
2155 C C   . LYS A 335 ? 0.9525 0.6005 1.4140 -0.0932 -0.0063 -0.1781 1104 LYS A C   
2156 O O   . LYS A 335 ? 1.0138 0.6509 1.4880 -0.1043 -0.0325 -0.1561 1104 LYS A O   
2157 C CB  . LYS A 335 ? 0.8981 0.5305 1.4890 -0.0757 0.0471  -0.2441 1104 LYS A CB  
2158 N N   . TYR A 336 ? 0.9291 0.6015 1.2981 -0.0973 0.0105  -0.1899 1105 TYR A N   
2159 C CA  . TYR A 336 ? 0.9434 0.6326 1.2357 -0.1127 -0.0013 -0.1806 1105 TYR A CA  
2160 C C   . TYR A 336 ? 0.8474 0.5640 1.1157 -0.1109 -0.0304 -0.1333 1105 TYR A C   
2161 O O   . TYR A 336 ? 0.8548 0.5818 1.0992 -0.1249 -0.0459 -0.1201 1105 TYR A O   
2162 C CB  . TYR A 336 ? 1.0002 0.7013 1.2122 -0.1223 0.0192  -0.2068 1105 TYR A CB  
2163 N N   . LEU A 337 ? 0.8065 0.5352 1.0818 -0.0980 -0.0344 -0.1118 1106 LEU A N   
2164 C CA  . LEU A 337 ? 0.7925 0.5443 1.0449 -0.1041 -0.0558 -0.0729 1106 LEU A CA  
2165 C C   . LEU A 337 ? 0.8171 0.5510 1.1059 -0.1223 -0.0830 -0.0458 1106 LEU A C   
2166 O O   . LEU A 337 ? 0.8115 0.5611 1.0679 -0.1421 -0.0946 -0.0281 1106 LEU A O   
2167 C CB  . LEU A 337 ? 0.7740 0.5362 1.0282 -0.0922 -0.0552 -0.0565 1106 LEU A CB  
2168 C CG  . LEU A 337 ? 0.8022 0.5913 1.0029 -0.0815 -0.0382 -0.0653 1106 LEU A CG  
2169 C CD1 . LEU A 337 ? 0.7683 0.5660 0.9725 -0.0747 -0.0409 -0.0451 1106 LEU A CD1 
2170 C CD2 . LEU A 337 ? 0.8275 0.6445 0.9828 -0.0911 -0.0410 -0.0623 1106 LEU A CD2 
2171 N N   . ALA A 338 ? 0.9729 0.3408 1.0824 -0.0685 -0.0617 0.1490  383  ALA A N   
2172 C CA  . ALA A 338 ? 0.9104 0.3096 1.0234 -0.0646 -0.0672 0.1260  383  ALA A CA  
2173 C C   . ALA A 338 ? 0.9094 0.3328 1.0000 -0.0416 -0.0657 0.1291  383  ALA A C   
2174 O O   . ALA A 338 ? 0.8922 0.3400 0.9752 -0.0280 -0.0690 0.1043  383  ALA A O   
2175 C CB  . ALA A 338 ? 0.9334 0.3666 1.0637 -0.0891 -0.0596 0.1290  383  ALA A CB  
2176 N N   . LYS A 339 ? 0.9422 0.3665 1.0175 -0.0367 -0.0584 0.1579  384  LYS A N   
2177 C CA  . LYS A 339 ? 0.9645 0.4189 1.0162 -0.0144 -0.0566 0.1592  384  LYS A CA  
2178 C C   . LYS A 339 ? 0.9511 0.3782 0.9989 0.0115  -0.0688 0.1471  384  LYS A C   
2179 O O   . LYS A 339 ? 0.9051 0.3561 0.9484 0.0288  -0.0717 0.1253  384  LYS A O   
2180 C CB  . LYS A 339 ? 0.9626 0.4241 0.9961 -0.0164 -0.0471 0.1929  384  LYS A CB  
2181 C CG  . LYS A 339 ? 0.9386 0.4460 0.9502 -0.0025 -0.0431 0.1927  384  LYS A CG  
2182 C CD  . LYS A 339 ? 1.0237 0.5281 1.0117 -0.0009 -0.0372 0.2254  384  LYS A CD  
2183 C CE  . LYS A 339 ? 1.0834 0.5869 1.0750 -0.0264 -0.0223 0.2466  384  LYS A CE  
2184 N NZ  . LYS A 339 ? 1.1512 0.6308 1.1189 -0.0242 -0.0178 0.2809  384  LYS A NZ  
2185 N N   . ILE A 340 ? 0.9191 0.2987 0.9694 0.0140  -0.0738 0.1603  385  ILE A N   
2186 C CA  . ILE A 340 ? 0.9464 0.3042 0.9913 0.0407  -0.0823 0.1528  385  ILE A CA  
2187 C C   . ILE A 340 ? 0.9520 0.2952 1.0094 0.0495  -0.0898 0.1181  385  ILE A C   
2188 O O   . ILE A 340 ? 0.9635 0.2997 1.0187 0.0742  -0.0951 0.1065  385  ILE A O   
2189 C CB  . ILE A 340 ? 1.0049 0.3273 1.0419 0.0418  -0.0802 0.1769  385  ILE A CB  
2190 C CG1 . ILE A 340 ? 1.0448 0.3330 1.0960 0.0215  -0.0780 0.1735  385  ILE A CG1 
2191 C CG2 . ILE A 340 ? 1.0043 0.3423 1.0213 0.0360  -0.0717 0.2101  385  ILE A CG2 
2192 C CD1 . ILE A 340 ? 1.1200 0.3736 1.1620 0.0177  -0.0732 0.2011  385  ILE A CD1 
2193 N N   . THR A 341 ? 0.9445 0.2868 1.0141 0.0304  -0.0898 0.1010  386  THR A N   
2194 C CA  . THR A 341 ? 0.9485 0.2818 1.0235 0.0383  -0.0966 0.0658  386  THR A CA  
2195 C C   . THR A 341 ? 0.8969 0.2673 0.9668 0.0471  -0.0970 0.0454  386  THR A C   
2196 O O   . THR A 341 ? 0.8984 0.2663 0.9663 0.0590  -0.1010 0.0161  386  THR A O   
2197 C CB  . THR A 341 ? 0.9706 0.2856 1.0590 0.0144  -0.0990 0.0539  386  THR A CB  
2198 O OG1 . THR A 341 ? 0.9344 0.2780 1.0306 -0.0092 -0.0947 0.0608  386  THR A OG1 
2199 C CG2 . THR A 341 ? 1.0282 0.3033 1.1225 0.0059  -0.0983 0.0706  386  THR A CG2 
2200 N N   . GLY A 342 ? 0.8619 0.2795 0.9242 0.0406  -0.0871 0.0594  387  GLY A N   
2201 C CA  . GLY A 342 ? 0.8208 0.2881 0.8745 0.0468  -0.0812 0.0420  387  GLY A CA  
2202 C C   . GLY A 342 ? 0.7989 0.2873 0.8569 0.0252  -0.0788 0.0306  387  GLY A C   
2203 O O   . GLY A 342 ? 0.7697 0.2949 0.8202 0.0287  -0.0747 0.0156  387  GLY A O   
2204 N N   . ARG A 343 ? 0.8243 0.2893 0.8965 0.0027  -0.0818 0.0386  388  ARG A N   
2205 C CA  . ARG A 343 ? 0.7949 0.2794 0.8765 -0.0183 -0.0819 0.0280  388  ARG A CA  
2206 C C   . ARG A 343 ? 0.7686 0.3035 0.8470 -0.0277 -0.0700 0.0419  388  ARG A C   
2207 O O   . ARG A 343 ? 0.7549 0.3216 0.8321 -0.0322 -0.0689 0.0273  388  ARG A O   
2208 C CB  . ARG A 343 ? 0.8213 0.2683 0.9256 -0.0411 -0.0887 0.0339  388  ARG A CB  
2209 C CG  . ARG A 343 ? 0.8654 0.2613 0.9741 -0.0342 -0.1029 0.0136  388  ARG A CG  
2210 C CD  . ARG A 343 ? 0.9219 0.3109 1.0475 -0.0569 -0.1094 0.0007  388  ARG A CD  
2211 N NE  . ARG A 343 ? 0.9753 0.3266 1.0991 -0.0507 -0.1179 -0.0178 388  ARG A NE  
2212 C CZ  . ARG A 343 ? 1.0403 0.3811 1.1759 -0.0662 -0.1269 -0.0340 388  ARG A CZ  
2213 N NH1 . ARG A 343 ? 1.0204 0.3883 1.1722 -0.0878 -0.1286 -0.0343 388  ARG A NH1 
2214 N NH2 . ARG A 343 ? 1.0775 0.3821 1.2099 -0.0596 -0.1346 -0.0504 388  ARG A NH2 
2215 N N   . GLU A 344 ? 0.7665 0.3072 0.8413 -0.0296 -0.0614 0.0699  389  GLU A N   
2216 C CA  . GLU A 344 ? 0.7212 0.3070 0.7912 -0.0376 -0.0496 0.0826  389  GLU A CA  
2217 C C   . GLU A 344 ? 0.7272 0.3516 0.7811 -0.0212 -0.0469 0.0691  389  GLU A C   
2218 O O   . GLU A 344 ? 0.6668 0.3285 0.7203 -0.0282 -0.0412 0.0646  389  GLU A O   
2219 C CB  . GLU A 344 ? 0.7860 0.3666 0.8490 -0.0402 -0.0411 0.1146  389  GLU A CB  
2220 C CG  . GLU A 344 ? 0.8337 0.4585 0.8888 -0.0472 -0.0281 0.1268  389  GLU A CG  
2221 C CD  . GLU A 344 ? 0.9265 0.5430 0.9713 -0.0516 -0.0188 0.1587  389  GLU A CD  
2222 O OE1 . GLU A 344 ? 0.9704 0.5466 1.0219 -0.0574 -0.0209 0.1736  389  GLU A OE1 
2223 O OE2 . GLU A 344 ? 0.9218 0.5701 0.9500 -0.0489 -0.0095 0.1686  389  GLU A OE2 
2224 N N   . ARG A 345 ? 0.7271 0.3428 0.7704 0.0006  -0.0509 0.0628  390  ARG A N   
2225 C CA  . ARG A 345 ? 0.7264 0.3775 0.7587 0.0158  -0.0480 0.0500  390  ARG A CA  
2226 C C   . ARG A 345 ? 0.7018 0.3644 0.7354 0.0139  -0.0500 0.0239  390  ARG A C   
2227 O O   . ARG A 345 ? 0.6982 0.3971 0.7262 0.0138  -0.0447 0.0177  390  ARG A O   
2228 C CB  . ARG A 345 ? 0.7447 0.3852 0.7715 0.0397  -0.0518 0.0488  390  ARG A CB  
2229 C CG  . ARG A 345 ? 0.7524 0.4335 0.7707 0.0516  -0.0469 0.0509  390  ARG A CG  
2230 C CD  . ARG A 345 ? 0.7058 0.3935 0.7259 0.0733  -0.0487 0.0332  390  ARG A CD  
2231 N NE  . ARG A 345 ? 0.7404 0.3909 0.7660 0.0885  -0.0560 0.0315  390  ARG A NE  
2232 C CZ  . ARG A 345 ? 0.7906 0.4413 0.8207 0.1079  -0.0566 0.0135  390  ARG A CZ  
2233 N NH1 . ARG A 345 ? 0.8043 0.4899 0.8329 0.1122  -0.0494 -0.0017 390  ARG A NH1 
2234 N NH2 . ARG A 345 ? 0.7950 0.4114 0.8313 0.1235  -0.0631 0.0111  390  ARG A NH2 
2235 N N   . LYS A 346 ? 0.7188 0.3481 0.7582 0.0125  -0.0585 0.0089  391  LYS A N   
2236 C CA  . LYS A 346 ? 0.6899 0.3235 0.7262 0.0107  -0.0629 -0.0164 391  LYS A CA  
2237 C C   . LYS A 346 ? 0.6867 0.3457 0.7300 -0.0098 -0.0616 -0.0146 391  LYS A C   
2238 O O   . LYS A 346 ? 0.7229 0.4063 0.7582 -0.0087 -0.0612 -0.0289 391  LYS A O   
2239 C CB  . LYS A 346 ? 0.7151 0.3017 0.7558 0.0117  -0.0745 -0.0323 391  LYS A CB  
2240 N N   . ALA A 347 ? 0.7131 0.3674 0.7720 -0.0277 -0.0601 0.0042  392  ALA A N   
2241 C CA  . ALA A 347 ? 0.6737 0.3524 0.7457 -0.0472 -0.0586 0.0067  392  ALA A CA  
2242 C C   . ALA A 347 ? 0.7034 0.4268 0.7669 -0.0447 -0.0476 0.0144  392  ALA A C   
2243 O O   . ALA A 347 ? 0.6874 0.4366 0.7596 -0.0564 -0.0460 0.0133  392  ALA A O   
2244 C CB  . ALA A 347 ? 0.6839 0.3454 0.7784 -0.0671 -0.0575 0.0260  392  ALA A CB  
2245 N N   . MET A 348 ? 0.7030 0.4355 0.7516 -0.0293 -0.0412 0.0217  393  MET A N   
2246 C CA  . MET A 348 ? 0.6843 0.4558 0.7245 -0.0264 -0.0319 0.0282  393  MET A CA  
2247 C C   . MET A 348 ? 0.6432 0.4344 0.6715 -0.0142 -0.0323 0.0098  393  MET A C   
2248 O O   . MET A 348 ? 0.6346 0.4565 0.6569 -0.0113 -0.0258 0.0124  393  MET A O   
2249 C CB  . MET A 348 ? 0.6904 0.4630 0.7214 -0.0177 -0.0261 0.0468  393  MET A CB  
2250 C CG  . MET A 348 ? 0.6981 0.4703 0.7338 -0.0312 -0.0192 0.0696  393  MET A CG  
2251 S SD  . MET A 348 ? 0.8491 0.6184 0.8662 -0.0184 -0.0155 0.0908  393  MET A SD  
2252 C CE  . MET A 348 ? 0.7730 0.5776 0.7781 -0.0026 -0.0153 0.0778  393  MET A CE  
2253 N N   . ARG A 349 ? 0.6436 0.4154 0.6681 -0.0073 -0.0396 -0.0087 394  ARG A N   
2254 C CA  . ARG A 349 ? 0.6536 0.4396 0.6641 0.0056  -0.0384 -0.0258 394  ARG A CA  
2255 C C   . ARG A 349 ? 0.6219 0.4391 0.6295 -0.0016 -0.0357 -0.0291 394  ARG A C   
2256 O O   . ARG A 349 ? 0.6244 0.4636 0.6217 0.0076  -0.0298 -0.0332 394  ARG A O   
2257 C CB  . ARG A 349 ? 0.7160 0.4728 0.7199 0.0121  -0.0468 -0.0463 394  ARG A CB  
2258 N N   . VAL A 350 ? 0.5637 0.3833 0.5830 -0.0179 -0.0400 -0.0266 395  VAL A N   
2259 C CA  . VAL A 350 ? 0.5544 0.4020 0.5729 -0.0235 -0.0393 -0.0299 395  VAL A CA  
2260 C C   . VAL A 350 ? 0.5519 0.4301 0.5699 -0.0222 -0.0282 -0.0165 395  VAL A C   
2261 O O   . VAL A 350 ? 0.5466 0.4472 0.5581 -0.0201 -0.0257 -0.0206 395  VAL A O   
2262 C CB  . VAL A 350 ? 0.5734 0.4194 0.6105 -0.0410 -0.0474 -0.0302 395  VAL A CB  
2263 C CG1 . VAL A 350 ? 0.5707 0.4229 0.6274 -0.0531 -0.0405 -0.0102 395  VAL A CG1 
2264 C CG2 . VAL A 350 ? 0.5590 0.4290 0.5932 -0.0432 -0.0507 -0.0382 395  VAL A CG2 
2265 N N   . LEU A 351 ? 0.5331 0.4100 0.5554 -0.0226 -0.0223 -0.0009 396  LEU A N   
2266 C CA  . LEU A 351 ? 0.5240 0.4272 0.5447 -0.0225 -0.0134 0.0107  396  LEU A CA  
2267 C C   . LEU A 351 ? 0.5182 0.4386 0.5265 -0.0096 -0.0098 0.0048  396  LEU A C   
2268 O O   . LEU A 351 ? 0.5178 0.4613 0.5249 -0.0113 -0.0057 0.0054  396  LEU A O   
2269 C CB  . LEU A 351 ? 0.5011 0.3962 0.5232 -0.0242 -0.0090 0.0284  396  LEU A CB  
2270 C CG  . LEU A 351 ? 0.5661 0.4491 0.6034 -0.0396 -0.0087 0.0384  396  LEU A CG  
2271 C CD1 . LEU A 351 ? 0.5501 0.4206 0.5836 -0.0401 -0.0033 0.0581  396  LEU A CD1 
2272 C CD2 . LEU A 351 ? 0.5597 0.4676 0.6094 -0.0511 -0.0047 0.0388  396  LEU A CD2 
2273 N N   . PRO A 352 ? 0.5493 0.4588 0.5511 0.0031  -0.0109 -0.0009 397  PRO A N   
2274 C CA  . PRO A 352 ? 0.5354 0.4636 0.5307 0.0137  -0.0063 -0.0062 397  PRO A CA  
2275 C C   . PRO A 352 ? 0.5308 0.4701 0.5198 0.0126  -0.0054 -0.0174 397  PRO A C   
2276 O O   . PRO A 352 ? 0.5040 0.4638 0.4904 0.0154  -0.0001 -0.0173 397  PRO A O   
2277 C CB  . PRO A 352 ? 0.5323 0.4448 0.5263 0.0272  -0.0076 -0.0118 397  PRO A CB  
2278 C CG  . PRO A 352 ? 0.5510 0.4386 0.5497 0.0248  -0.0126 -0.0037 397  PRO A CG  
2279 C CD  . PRO A 352 ? 0.5700 0.4513 0.5730 0.0088  -0.0152 -0.0002 397  PRO A CD  
2280 N N   . VAL A 353 ? 0.5196 0.4437 0.5054 0.0086  -0.0115 -0.0267 398  VAL A N   
2281 C CA  . VAL A 353 ? 0.5228 0.4556 0.4986 0.0082  -0.0125 -0.0362 398  VAL A CA  
2282 C C   . VAL A 353 ? 0.5262 0.4798 0.5087 -0.0014 -0.0118 -0.0291 398  VAL A C   
2283 O O   . VAL A 353 ? 0.5047 0.4740 0.4803 0.0013  -0.0080 -0.0302 398  VAL A O   
2284 C CB  . VAL A 353 ? 0.5431 0.4540 0.5118 0.0064  -0.0223 -0.0494 398  VAL A CB  
2285 C CG1 . VAL A 353 ? 0.5288 0.4477 0.4809 0.0086  -0.0241 -0.0588 398  VAL A CG1 
2286 C CG2 . VAL A 353 ? 0.5473 0.4345 0.5099 0.0172  -0.0227 -0.0577 398  VAL A CG2 
2287 N N   . VAL A 354 ? 0.4790 0.4321 0.4758 -0.0121 -0.0145 -0.0213 399  VAL A N   
2288 C CA  . VAL A 354 ? 0.4655 0.4396 0.4714 -0.0195 -0.0120 -0.0144 399  VAL A CA  
2289 C C   . VAL A 354 ? 0.4727 0.4648 0.4750 -0.0142 -0.0032 -0.0078 399  VAL A C   
2290 O O   . VAL A 354 ? 0.4295 0.4372 0.4305 -0.0141 -0.0012 -0.0084 399  VAL A O   
2291 C CB  . VAL A 354 ? 0.4743 0.4468 0.4982 -0.0312 -0.0125 -0.0054 399  VAL A CB  
2292 C CG1 . VAL A 354 ? 0.4261 0.4227 0.4602 -0.0364 -0.0072 0.0014  399  VAL A CG1 
2293 C CG2 . VAL A 354 ? 0.4963 0.4532 0.5294 -0.0390 -0.0233 -0.0130 399  VAL A CG2 
2294 N N   . VAL A 355 ? 0.4695 0.4577 0.4704 -0.0096 0.0006  -0.0017 400  VAL A N   
2295 C CA  . VAL A 355 ? 0.4479 0.4517 0.4460 -0.0047 0.0061  0.0029  400  VAL A CA  
2296 C C   . VAL A 355 ? 0.4289 0.4404 0.4211 0.0024  0.0081  -0.0046 400  VAL A C   
2297 O O   . VAL A 355 ? 0.3988 0.4253 0.3912 0.0021  0.0112  -0.0038 400  VAL A O   
2298 C CB  . VAL A 355 ? 0.4683 0.4652 0.4653 0.0002  0.0066  0.0104  400  VAL A CB  
2299 C CG1 . VAL A 355 ? 0.4427 0.4556 0.4374 0.0060  0.0090  0.0122  400  VAL A CG1 
2300 C CG2 . VAL A 355 ? 0.4742 0.4638 0.4741 -0.0075 0.0072  0.0212  400  VAL A CG2 
2301 N N   . GLY A 356 ? 0.4824 0.4828 0.4693 0.0088  0.0071  -0.0120 401  GLY A N   
2302 C CA  . GLY A 356 ? 0.4564 0.4642 0.4370 0.0154  0.0119  -0.0179 401  GLY A CA  
2303 C C   . GLY A 356 ? 0.4610 0.4765 0.4350 0.0115  0.0122  -0.0201 401  GLY A C   
2304 O O   . GLY A 356 ? 0.4550 0.4831 0.4285 0.0131  0.0176  -0.0184 401  GLY A O   
2305 N N   . ALA A 357 ? 0.4425 0.4496 0.4128 0.0064  0.0053  -0.0235 402  ALA A N   
2306 C CA  . ALA A 357 ? 0.4575 0.4707 0.4218 0.0036  0.0026  -0.0249 402  ALA A CA  
2307 C C   . ALA A 357 ? 0.4641 0.4937 0.4391 -0.0006 0.0054  -0.0173 402  ALA A C   
2308 O O   . ALA A 357 ? 0.4267 0.4636 0.3971 0.0006  0.0072  -0.0163 402  ALA A O   
2309 C CB  . ALA A 357 ? 0.4562 0.4594 0.4202 -0.0018 -0.0083 -0.0302 402  ALA A CB  
2310 N N   . PHE A 358 ? 0.4684 0.5017 0.4557 -0.0049 0.0059  -0.0118 403  PHE A N   
2311 C CA  . PHE A 358 ? 0.4226 0.4699 0.4177 -0.0075 0.0092  -0.0063 403  PHE A CA  
2312 C C   . PHE A 358 ? 0.4259 0.4806 0.4183 -0.0028 0.0146  -0.0053 403  PHE A C   
2313 O O   . PHE A 358 ? 0.3977 0.4601 0.3914 -0.0031 0.0161  -0.0046 403  PHE A O   
2314 C CB  . PHE A 358 ? 0.4251 0.4739 0.4288 -0.0118 0.0107  -0.0003 403  PHE A CB  
2315 C CG  . PHE A 358 ? 0.4284 0.4907 0.4386 -0.0141 0.0142  0.0031  403  PHE A CG  
2316 C CD1 . PHE A 358 ? 0.4255 0.4947 0.4321 -0.0107 0.0183  0.0047  403  PHE A CD1 
2317 C CD2 . PHE A 358 ? 0.4492 0.5180 0.4704 -0.0188 0.0126  0.0034  403  PHE A CD2 
2318 C CE1 . PHE A 358 ? 0.4715 0.5511 0.4819 -0.0113 0.0217  0.0056  403  PHE A CE1 
2319 C CE2 . PHE A 358 ? 0.4602 0.5423 0.4887 -0.0191 0.0170  0.0054  403  PHE A CE2 
2320 C CZ  . PHE A 358 ? 0.4724 0.5586 0.4936 -0.0148 0.0220  0.0061  403  PHE A CZ  
2321 N N   . LEU A 359 ? 0.4184 0.4704 0.4099 0.0014  0.0169  -0.0055 404  LEU A N   
2322 C CA  . LEU A 359 ? 0.4061 0.4671 0.4007 0.0047  0.0210  -0.0050 404  LEU A CA  
2323 C C   . LEU A 359 ? 0.4040 0.4664 0.3937 0.0062  0.0248  -0.0071 404  LEU A C   
2324 O O   . LEU A 359 ? 0.4154 0.4854 0.4097 0.0051  0.0278  -0.0053 404  LEU A O   
2325 C CB  . LEU A 359 ? 0.4076 0.4674 0.4061 0.0101  0.0214  -0.0051 404  LEU A CB  
2326 C CG  . LEU A 359 ? 0.4306 0.4875 0.4305 0.0095  0.0174  -0.0005 404  LEU A CG  
2327 C CD1 . LEU A 359 ? 0.4475 0.5021 0.4518 0.0167  0.0158  0.0001  404  LEU A CD1 
2328 C CD2 . LEU A 359 ? 0.4550 0.5213 0.4557 0.0064  0.0169  0.0024  404  LEU A CD2 
2329 N N   . LEU A 360 ? 0.4014 0.4548 0.3804 0.0088  0.0248  -0.0108 405  LEU A N   
2330 C CA  . LEU A 360 ? 0.4451 0.4979 0.4132 0.0112  0.0294  -0.0115 405  LEU A CA  
2331 C C   . LEU A 360 ? 0.4222 0.4768 0.3877 0.0074  0.0266  -0.0082 405  LEU A C   
2332 O O   . LEU A 360 ? 0.4243 0.4821 0.3883 0.0075  0.0317  -0.0044 405  LEU A O   
2333 C CB  . LEU A 360 ? 0.4909 0.5314 0.4421 0.0157  0.0284  -0.0178 405  LEU A CB  
2334 C CG  . LEU A 360 ? 0.5643 0.6025 0.5150 0.0230  0.0350  -0.0220 405  LEU A CG  
2335 C CD1 . LEU A 360 ? 0.5670 0.5892 0.4974 0.0281  0.0324  -0.0308 405  LEU A CD1 
2336 C CD2 . LEU A 360 ? 0.5356 0.5861 0.4912 0.0259  0.0471  -0.0184 405  LEU A CD2 
2337 N N   . CYS A 361 ? 0.3981 0.4508 0.3658 0.0041  0.0187  -0.0090 406  CYS A N   
2338 C CA  . CYS A 361 ? 0.4153 0.4703 0.3833 0.0022  0.0142  -0.0067 406  CYS A CA  
2339 C C   . CYS A 361 ? 0.3866 0.4501 0.3673 0.0002  0.0166  -0.0030 406  CYS A C   
2340 O O   . CYS A 361 ? 0.4007 0.4641 0.3806 0.0009  0.0155  -0.0003 406  CYS A O   
2341 C CB  . CYS A 361 ? 0.4160 0.4694 0.3879 -0.0008 0.0050  -0.0095 406  CYS A CB  
2342 S SG  . CYS A 361 ? 0.4779 0.5181 0.4307 0.0018  -0.0026 -0.0160 406  CYS A SG  
2343 N N   . TRP A 362 ? 0.3605 0.4293 0.3510 -0.0013 0.0189  -0.0031 407  TRP A N   
2344 C CA  . TRP A 362 ? 0.3548 0.4300 0.3543 -0.0024 0.0201  -0.0020 407  TRP A CA  
2345 C C   . TRP A 362 ? 0.3570 0.4350 0.3608 -0.0022 0.0238  -0.0020 407  TRP A C   
2346 O O   . TRP A 362 ? 0.3651 0.4454 0.3745 -0.0029 0.0235  -0.0027 407  TRP A O   
2347 C CB  . TRP A 362 ? 0.3348 0.4144 0.3397 -0.0041 0.0192  -0.0023 407  TRP A CB  
2348 C CG  . TRP A 362 ? 0.3688 0.4507 0.3787 -0.0057 0.0159  -0.0021 407  TRP A CG  
2349 C CD1 . TRP A 362 ? 0.3999 0.4797 0.4120 -0.0085 0.0124  -0.0022 407  TRP A CD1 
2350 C CD2 . TRP A 362 ? 0.3729 0.4601 0.3899 -0.0043 0.0149  -0.0023 407  TRP A CD2 
2351 N NE1 . TRP A 362 ? 0.3947 0.4813 0.4175 -0.0098 0.0089  -0.0023 407  TRP A NE1 
2352 C CE2 . TRP A 362 ? 0.3700 0.4616 0.3956 -0.0063 0.0107  -0.0022 407  TRP A CE2 
2353 C CE3 . TRP A 362 ? 0.3376 0.4256 0.3567 -0.0014 0.0165  -0.0030 407  TRP A CE3 
2354 C CZ2 . TRP A 362 ? 0.3757 0.4753 0.4133 -0.0043 0.0083  -0.0024 407  TRP A CZ2 
2355 C CZ3 . TRP A 362 ? 0.3463 0.4387 0.3744 0.0012  0.0145  -0.0034 407  TRP A CZ3 
2356 C CH2 . TRP A 362 ? 0.3732 0.4728 0.4112 0.0003  0.0105  -0.0029 407  TRP A CH2 
2357 N N   . THR A 363 ? 0.3467 0.4250 0.3503 -0.0010 0.0265  -0.0020 408  THR A N   
2358 C CA  . THR A 363 ? 0.3404 0.4247 0.3542 -0.0017 0.0287  -0.0022 408  THR A CA  
2359 C C   . THR A 363 ? 0.3546 0.4372 0.3722 -0.0041 0.0318  0.0002  408  THR A C   
2360 O O   . THR A 363 ? 0.3571 0.4416 0.3842 -0.0066 0.0299  -0.0013 408  THR A O   
2361 C CB  . THR A 363 ? 0.3426 0.4306 0.3605 0.0011  0.0317  -0.0026 408  THR A CB  
2362 O OG1 . THR A 363 ? 0.3571 0.4436 0.3724 0.0035  0.0274  -0.0038 408  THR A OG1 
2363 C CG2 . THR A 363 ? 0.3579 0.4556 0.3926 -0.0003 0.0328  -0.0029 408  THR A CG2 
2364 N N   . PRO A 364 ? 0.3304 0.4073 0.3388 -0.0033 0.0358  0.0039  409  PRO A N   
2365 C CA  . PRO A 364 ? 0.3519 0.4243 0.3631 -0.0059 0.0388  0.0086  409  PRO A CA  
2366 C C   . PRO A 364 ? 0.3791 0.4474 0.3944 -0.0067 0.0328  0.0071  409  PRO A C   
2367 O O   . PRO A 364 ? 0.3725 0.4382 0.3982 -0.0098 0.0333  0.0077  409  PRO A O   
2368 C CB  . PRO A 364 ? 0.3541 0.4186 0.3470 -0.0031 0.0421  0.0135  409  PRO A CB  
2369 C CG  . PRO A 364 ? 0.3527 0.4198 0.3370 0.0006  0.0438  0.0095  409  PRO A CG  
2370 C CD  . PRO A 364 ? 0.3389 0.4106 0.3318 0.0002  0.0369  0.0040  409  PRO A CD  
2371 N N   . PHE A 365 ? 0.3459 0.4137 0.3552 -0.0039 0.0277  0.0048  410  PHE A N   
2372 C CA  . PHE A 365 ? 0.3450 0.4110 0.3593 -0.0027 0.0236  0.0024  410  PHE A CA  
2373 C C   . PHE A 365 ? 0.3485 0.4177 0.3720 -0.0042 0.0229  -0.0033 410  PHE A C   
2374 O O   . PHE A 365 ? 0.3511 0.4145 0.3807 -0.0044 0.0215  -0.0054 410  PHE A O   
2375 C CB  . PHE A 365 ? 0.3395 0.4099 0.3514 -0.0001 0.0199  0.0006  410  PHE A CB  
2376 C CG  . PHE A 365 ? 0.3537 0.4254 0.3731 0.0029  0.0176  -0.0021 410  PHE A CG  
2377 C CD1 . PHE A 365 ? 0.3215 0.3990 0.3455 0.0034  0.0192  -0.0077 410  PHE A CD1 
2378 C CD2 . PHE A 365 ? 0.3579 0.4248 0.3786 0.0065  0.0140  0.0007  410  PHE A CD2 
2379 C CE1 . PHE A 365 ? 0.3396 0.4189 0.3701 0.0079  0.0192  -0.0115 410  PHE A CE1 
2380 C CE2 . PHE A 365 ? 0.3671 0.4363 0.3979 0.0111  0.0124  -0.0025 410  PHE A CE2 
2381 C CZ  . PHE A 365 ? 0.3461 0.4219 0.3822 0.0119  0.0160  -0.0092 410  PHE A CZ  
2382 N N   . PHE A 366 ? 0.3480 0.4247 0.3712 -0.0047 0.0226  -0.0063 411  PHE A N   
2383 C CA  . PHE A 366 ? 0.3664 0.4456 0.3933 -0.0050 0.0197  -0.0125 411  PHE A CA  
2384 C C   . PHE A 366 ? 0.3843 0.4627 0.4225 -0.0090 0.0184  -0.0139 411  PHE A C   
2385 O O   . PHE A 366 ? 0.3817 0.4575 0.4244 -0.0098 0.0140  -0.0203 411  PHE A O   
2386 C CB  . PHE A 366 ? 0.3164 0.4023 0.3368 -0.0034 0.0186  -0.0138 411  PHE A CB  
2387 C CG  . PHE A 366 ? 0.3316 0.4191 0.3454 -0.0010 0.0204  -0.0135 411  PHE A CG  
2388 C CD1 . PHE A 366 ? 0.3401 0.4279 0.3524 0.0018  0.0209  -0.0185 411  PHE A CD1 
2389 C CD2 . PHE A 366 ? 0.3260 0.4150 0.3376 -0.0015 0.0219  -0.0090 411  PHE A CD2 
2390 C CE1 . PHE A 366 ? 0.3418 0.4345 0.3525 0.0040  0.0248  -0.0176 411  PHE A CE1 
2391 C CE2 . PHE A 366 ? 0.3328 0.4255 0.3443 -0.0009 0.0241  -0.0081 411  PHE A CE2 
2392 C CZ  . PHE A 366 ? 0.3428 0.4391 0.3551 0.0019  0.0265  -0.0117 411  PHE A CZ  
2393 N N   . VAL A 367 ? 0.3503 0.4314 0.3942 -0.0115 0.0223  -0.0088 412  VAL A N   
2394 C CA  . VAL A 367 ? 0.3511 0.4339 0.4120 -0.0168 0.0226  -0.0089 412  VAL A CA  
2395 C C   . VAL A 367 ? 0.3849 0.4552 0.4504 -0.0198 0.0231  -0.0072 412  VAL A C   
2396 O O   . VAL A 367 ? 0.3998 0.4664 0.4775 -0.0237 0.0183  -0.0125 412  VAL A O   
2397 C CB  . VAL A 367 ? 0.3323 0.4227 0.4002 -0.0181 0.0299  -0.0030 412  VAL A CB  
2398 C CG1 . VAL A 367 ? 0.3430 0.4366 0.4339 -0.0254 0.0327  -0.0009 412  VAL A CG1 
2399 C CG2 . VAL A 367 ? 0.3180 0.4190 0.3851 -0.0141 0.0272  -0.0059 412  VAL A CG2 
2400 N N   . VAL A 368 ? 0.3393 0.4014 0.3945 -0.0176 0.0273  -0.0005 413  VAL A N   
2401 C CA  . VAL A 368 ? 0.3740 0.4213 0.4322 -0.0190 0.0271  0.0027  413  VAL A CA  
2402 C C   . VAL A 368 ? 0.3959 0.4371 0.4561 -0.0162 0.0197  -0.0071 413  VAL A C   
2403 O O   . VAL A 368 ? 0.4044 0.4350 0.4759 -0.0197 0.0167  -0.0103 413  VAL A O   
2404 C CB  . VAL A 368 ? 0.3896 0.4291 0.4331 -0.0147 0.0300  0.0116  413  VAL A CB  
2405 C CG1 . VAL A 368 ? 0.4275 0.4503 0.4729 -0.0132 0.0270  0.0141  413  VAL A CG1 
2406 C CG2 . VAL A 368 ? 0.3808 0.4217 0.4191 -0.0173 0.0388  0.0214  413  VAL A CG2 
2407 N N   . HIS A 369 ? 0.3817 0.4293 0.4318 -0.0102 0.0175  -0.0125 414  HIS A N   
2408 C CA  . HIS A 369 ? 0.4060 0.4480 0.4555 -0.0055 0.0134  -0.0215 414  HIS A CA  
2409 C C   . HIS A 369 ? 0.3962 0.4388 0.4493 -0.0077 0.0081  -0.0324 414  HIS A C   
2410 O O   . HIS A 369 ? 0.3924 0.4238 0.4487 -0.0063 0.0040  -0.0405 414  HIS A O   
2411 C CB  . HIS A 369 ? 0.3567 0.4069 0.3967 0.0013  0.0149  -0.0228 414  HIS A CB  
2412 C CG  . HIS A 369 ? 0.3928 0.4388 0.4329 0.0054  0.0155  -0.0163 414  HIS A CG  
2413 N ND1 . HIS A 369 ? 0.3812 0.4290 0.4165 0.0040  0.0168  -0.0071 414  HIS A ND1 
2414 C CD2 . HIS A 369 ? 0.3918 0.4307 0.4362 0.0117  0.0138  -0.0181 414  HIS A CD2 
2415 C CE1 . HIS A 369 ? 0.4075 0.4501 0.4429 0.0090  0.0143  -0.0032 414  HIS A CE1 
2416 N NE2 . HIS A 369 ? 0.3955 0.4335 0.4383 0.0140  0.0126  -0.0092 414  HIS A NE2 
2417 N N   . ILE A 370 ? 0.3708 0.4251 0.4231 -0.0103 0.0067  -0.0333 415  ILE A N   
2418 C CA  . ILE A 370 ? 0.3900 0.4449 0.4441 -0.0116 -0.0013 -0.0441 415  ILE A CA  
2419 C C   . ILE A 370 ? 0.3930 0.4403 0.4678 -0.0199 -0.0055 -0.0455 415  ILE A C   
2420 O O   . ILE A 370 ? 0.3942 0.4333 0.4730 -0.0212 -0.0139 -0.0567 415  ILE A O   
2421 C CB  . ILE A 370 ? 0.3666 0.4356 0.4141 -0.0108 -0.0039 -0.0441 415  ILE A CB  
2422 C CG1 . ILE A 370 ? 0.4028 0.4709 0.4397 -0.0078 -0.0131 -0.0564 415  ILE A CG1 
2423 C CG2 . ILE A 370 ? 0.3396 0.4173 0.4044 -0.0169 -0.0038 -0.0382 415  ILE A CG2 
2424 C CD1 . ILE A 370 ? 0.4315 0.5111 0.4599 -0.0058 -0.0180 -0.0556 415  ILE A CD1 
2425 N N   . THR A 371 ? 0.3990 0.4479 0.4866 -0.0256 0.0008  -0.0343 416  THR A N   
2426 C CA  . THR A 371 ? 0.3993 0.4417 0.5100 -0.0351 -0.0005 -0.0328 416  THR A CA  
2427 C C   . THR A 371 ? 0.4237 0.4439 0.5364 -0.0352 -0.0035 -0.0368 416  THR A C   
2428 O O   . THR A 371 ? 0.4333 0.4444 0.5596 -0.0404 -0.0119 -0.0461 416  THR A O   
2429 C CB  . THR A 371 ? 0.3679 0.4153 0.4878 -0.0400 0.0107  -0.0180 416  THR A CB  
2430 O OG1 . THR A 371 ? 0.3844 0.4517 0.5078 -0.0398 0.0127  -0.0167 416  THR A OG1 
2431 C CG2 . THR A 371 ? 0.4153 0.4545 0.5604 -0.0509 0.0120  -0.0140 416  THR A CG2 
2432 N N   . GLN A 372 ? 0.4227 0.4336 0.5230 -0.0290 0.0020  -0.0304 417  GLN A N   
2433 C CA  . GLN A 372 ? 0.4545 0.4436 0.5556 -0.0258 -0.0009 -0.0338 417  GLN A CA  
2434 C C   . GLN A 372 ? 0.4631 0.4462 0.5601 -0.0212 -0.0100 -0.0521 417  GLN A C   
2435 O O   . GLN A 372 ? 0.4594 0.4235 0.5665 -0.0235 -0.0163 -0.0600 417  GLN A O   
2436 C CB  . GLN A 372 ? 0.4781 0.4641 0.5651 -0.0166 0.0040  -0.0262 417  GLN A CB  
2437 C CG  . GLN A 372 ? 0.5227 0.5051 0.6090 -0.0194 0.0111  -0.0087 417  GLN A CG  
2438 C CD  . GLN A 372 ? 0.5794 0.5581 0.6524 -0.0092 0.0116  -0.0034 417  GLN A CD  
2439 O OE1 . GLN A 372 ? 0.6191 0.6100 0.6837 -0.0018 0.0105  -0.0094 417  GLN A OE1 
2440 N NE2 . GLN A 372 ? 0.5252 0.4863 0.5982 -0.0086 0.0126  0.0081  417  GLN A NE2 
2441 N N   . ALA A 373 ? 0.4378 0.4356 0.5184 -0.0144 -0.0105 -0.0589 418  ALA A N   
2442 C CA  . ALA A 373 ? 0.4483 0.4416 0.5174 -0.0077 -0.0169 -0.0760 418  ALA A CA  
2443 C C   . ALA A 373 ? 0.4370 0.4278 0.5142 -0.0148 -0.0285 -0.0875 418  ALA A C   
2444 O O   . ALA A 373 ? 0.4680 0.4437 0.5427 -0.0125 -0.0367 -0.1028 418  ALA A O   
2445 C CB  . ALA A 373 ? 0.4217 0.4320 0.4695 0.0009  -0.0123 -0.0773 418  ALA A CB  
2446 N N   . LEU A 374 ? 0.4303 0.4359 0.5185 -0.0230 -0.0302 -0.0814 419  LEU A N   
2447 C CA  . LEU A 374 ? 0.4318 0.4392 0.5329 -0.0303 -0.0433 -0.0919 419  LEU A CA  
2448 C C   . LEU A 374 ? 0.4485 0.4400 0.5786 -0.0416 -0.0473 -0.0921 419  LEU A C   
2449 O O   . LEU A 374 ? 0.4744 0.4574 0.6149 -0.0466 -0.0610 -0.1062 419  LEU A O   
2450 C CB  . LEU A 374 ? 0.4475 0.4781 0.5558 -0.0341 -0.0438 -0.0847 419  LEU A CB  
2451 C CG  . LEU A 374 ? 0.4418 0.4868 0.5241 -0.0249 -0.0437 -0.0854 419  LEU A CG  
2452 C CD1 . LEU A 374 ? 0.4156 0.4803 0.5103 -0.0283 -0.0412 -0.0745 419  LEU A CD1 
2453 C CD2 . LEU A 374 ? 0.4466 0.4886 0.5120 -0.0203 -0.0580 -0.1022 419  LEU A CD2 
2454 N N   . CYS A 375 ? 0.4959 0.4822 0.6378 -0.0459 -0.0360 -0.0761 420  CYS A N   
2455 C CA  . CYS A 375 ? 0.5025 0.4760 0.6746 -0.0589 -0.0362 -0.0703 420  CYS A CA  
2456 C C   . CYS A 375 ? 0.4756 0.4285 0.6451 -0.0569 -0.0267 -0.0581 420  CYS A C   
2457 O O   . CYS A 375 ? 0.5083 0.4672 0.6776 -0.0583 -0.0145 -0.0403 420  CYS A O   
2458 C CB  . CYS A 375 ? 0.4853 0.4805 0.6808 -0.0694 -0.0306 -0.0583 420  CYS A CB  
2459 S SG  . CYS A 375 ? 0.5061 0.4911 0.7445 -0.0882 -0.0276 -0.0484 420  CYS A SG  
2460 N N   . PRO A 376 ? 0.5233 0.4508 0.6889 -0.0522 -0.0328 -0.0682 421  PRO A N   
2461 C CA  . PRO A 376 ? 0.5358 0.4404 0.7001 -0.0487 -0.0264 -0.0571 421  PRO A CA  
2462 C C   . PRO A 376 ? 0.5707 0.4665 0.7577 -0.0623 -0.0194 -0.0384 421  PRO A C   
2463 O O   . PRO A 376 ? 0.5843 0.4721 0.7634 -0.0591 -0.0101 -0.0214 421  PRO A O   
2464 C CB  . PRO A 376 ? 0.5597 0.4375 0.7238 -0.0434 -0.0373 -0.0754 421  PRO A CB  
2465 C CG  . PRO A 376 ? 0.6083 0.5005 0.7577 -0.0376 -0.0458 -0.0957 421  PRO A CG  
2466 C CD  . PRO A 376 ? 0.5485 0.4660 0.7091 -0.0486 -0.0469 -0.0914 421  PRO A CD  
2467 N N   . ALA A 377 ? 0.5229 0.4209 0.7375 -0.0772 -0.0239 -0.0410 422  ALA A N   
2468 C CA  . ALA A 377 ? 0.5422 0.4344 0.7821 -0.0918 -0.0148 -0.0223 422  ALA A CA  
2469 C C   . ALA A 377 ? 0.5029 0.4208 0.7374 -0.0928 0.0009  -0.0039 422  ALA A C   
2470 O O   . ALA A 377 ? 0.5136 0.4262 0.7584 -0.1011 0.0133  0.0155  422  ALA A O   
2471 C CB  . ALA A 377 ? 0.5264 0.4180 0.8034 -0.1084 -0.0243 -0.0314 422  ALA A CB  
2472 N N   . CYS A 378 ? 0.4659 0.4099 0.6832 -0.0843 0.0009  -0.0099 423  CYS A N   
2473 C CA  . CYS A 378 ? 0.4934 0.4598 0.7024 -0.0830 0.0147  0.0045  423  CYS A CA  
2474 C C   . CYS A 378 ? 0.5312 0.4867 0.7103 -0.0720 0.0224  0.0163  423  CYS A C   
2475 O O   . CYS A 378 ? 0.5268 0.4917 0.6821 -0.0603 0.0209  0.0117  423  CYS A O   
2476 C CB  . CYS A 378 ? 0.4483 0.4432 0.6510 -0.0776 0.0104  -0.0063 423  CYS A CB  
2477 S SG  . CYS A 378 ? 0.4717 0.4811 0.7071 -0.0877 -0.0040 -0.0225 423  CYS A SG  
2478 N N   . SER A 379 ? 0.5390 0.4740 0.7204 -0.0764 0.0298  0.0323  424  SER A N   
2479 C CA  . SER A 379 ? 0.5260 0.4453 0.6807 -0.0659 0.0332  0.0436  424  SER A CA  
2480 C C   . SER A 379 ? 0.5287 0.4659 0.6601 -0.0598 0.0431  0.0537  424  SER A C   
2481 O O   . SER A 379 ? 0.5705 0.5152 0.7048 -0.0665 0.0558  0.0670  424  SER A O   
2482 C CB  . SER A 379 ? 0.5934 0.4836 0.7565 -0.0729 0.0381  0.0602  424  SER A CB  
2483 O OG  . SER A 379 ? 0.6305 0.5071 0.7659 -0.0621 0.0410  0.0737  424  SER A OG  
2484 N N   . VAL A 380 ? 0.5135 0.4576 0.6225 -0.0471 0.0377  0.0468  425  VAL A N   
2485 C CA  . VAL A 380 ? 0.4894 0.4466 0.5747 -0.0406 0.0443  0.0545  425  VAL A CA  
2486 C C   . VAL A 380 ? 0.5489 0.4870 0.6128 -0.0335 0.0449  0.0684  425  VAL A C   
2487 O O   . VAL A 380 ? 0.5712 0.4945 0.6334 -0.0265 0.0356  0.0650  425  VAL A O   
2488 C CB  . VAL A 380 ? 0.5111 0.4865 0.5861 -0.0321 0.0376  0.0404  425  VAL A CB  
2489 C CG1 . VAL A 380 ? 0.5133 0.5000 0.5657 -0.0265 0.0429  0.0468  425  VAL A CG1 
2490 C CG2 . VAL A 380 ? 0.5362 0.5281 0.6291 -0.0376 0.0348  0.0274  425  VAL A CG2 
2491 N N   . PRO A 381 ? 0.5364 0.4748 0.5829 -0.0340 0.0554  0.0837  426  PRO A N   
2492 C CA  . PRO A 381 ? 0.5398 0.4591 0.5614 -0.0262 0.0539  0.0978  426  PRO A CA  
2493 C C   . PRO A 381 ? 0.5473 0.4708 0.5545 -0.0131 0.0408  0.0888  426  PRO A C   
2494 O O   . PRO A 381 ? 0.5256 0.4691 0.5254 -0.0098 0.0395  0.0796  426  PRO A O   
2495 C CB  . PRO A 381 ? 0.5685 0.4937 0.5689 -0.0279 0.0679  0.1116  426  PRO A CB  
2496 C CG  . PRO A 381 ? 0.5461 0.4876 0.5711 -0.0397 0.0796  0.1089  426  PRO A CG  
2497 C CD  . PRO A 381 ? 0.5093 0.4655 0.5557 -0.0400 0.0688  0.0884  426  PRO A CD  
2498 N N   . PRO A 382 ? 0.5236 0.4286 0.5306 -0.0058 0.0311  0.0909  427  PRO A N   
2499 C CA  . PRO A 382 ? 0.5319 0.4439 0.5320 0.0066  0.0190  0.0825  427  PRO A CA  
2500 C C   . PRO A 382 ? 0.5296 0.4550 0.5046 0.0116  0.0182  0.0855  427  PRO A C   
2501 O O   . PRO A 382 ? 0.5039 0.4465 0.4803 0.0164  0.0117  0.0739  427  PRO A O   
2502 C CB  . PRO A 382 ? 0.5282 0.4142 0.5278 0.0145  0.0110  0.0916  427  PRO A CB  
2503 C CG  . PRO A 382 ? 0.5474 0.4145 0.5656 0.0048  0.0166  0.0946  427  PRO A CG  
2504 C CD  . PRO A 382 ? 0.5138 0.3902 0.5302 -0.0083 0.0307  0.1013  427  PRO A CD  
2505 N N   . ARG A 383 ? 0.5918 0.5087 0.5440 0.0099  0.0254  0.1005  428  ARG A N   
2506 C CA  . ARG A 383 ? 0.6130 0.5390 0.5368 0.0147  0.0248  0.1025  428  ARG A CA  
2507 C C   . ARG A 383 ? 0.5728 0.5231 0.5024 0.0109  0.0290  0.0883  428  ARG A C   
2508 O O   . ARG A 383 ? 0.5778 0.5382 0.4942 0.0161  0.0222  0.0818  428  ARG A O   
2509 C CB  . ARG A 383 ? 0.6301 0.5414 0.5273 0.0128  0.0360  0.1212  428  ARG A CB  
2510 C CG  . ARG A 383 ? 0.7338 0.6498 0.5949 0.0183  0.0370  0.1238  428  ARG A CG  
2511 C CD  . ARG A 383 ? 0.8028 0.7046 0.6396 0.0151  0.0534  0.1431  428  ARG A CD  
2512 N NE  . ARG A 383 ? 0.8480 0.7648 0.6737 0.0117  0.0688  0.1399  428  ARG A NE  
2513 C CZ  . ARG A 383 ? 0.8976 0.8090 0.7065 0.0080  0.0881  0.1545  428  ARG A CZ  
2514 N NH1 . ARG A 383 ? 0.9334 0.8231 0.7338 0.0058  0.0944  0.1749  428  ARG A NH1 
2515 N NH2 . ARG A 383 ? 0.8814 0.8087 0.6830 0.0069  0.1022  0.1492  428  ARG A NH2 
2516 N N   . LEU A 384 ? 0.5192 0.4773 0.4703 0.0018  0.0384  0.0834  429  LEU A N   
2517 C CA  . LEU A 384 ? 0.4989 0.4779 0.4569 -0.0014 0.0423  0.0715  429  LEU A CA  
2518 C C   . LEU A 384 ? 0.5176 0.5075 0.4909 0.0014  0.0317  0.0570  429  LEU A C   
2519 O O   . LEU A 384 ? 0.4804 0.4839 0.4502 0.0032  0.0293  0.0487  429  LEU A O   
2520 C CB  . LEU A 384 ? 0.5183 0.5034 0.4960 -0.0115 0.0545  0.0722  429  LEU A CB  
2521 C CG  . LEU A 384 ? 0.5751 0.5813 0.5628 -0.0135 0.0572  0.0604  429  LEU A CG  
2522 C CD1 . LEU A 384 ? 0.5795 0.5913 0.5422 -0.0079 0.0604  0.0606  429  LEU A CD1 
2523 C CD2 . LEU A 384 ? 0.5825 0.5974 0.5946 -0.0228 0.0670  0.0607  429  LEU A CD2 
2524 N N   . VAL A 385 ? 0.4886 0.4711 0.4787 0.0018  0.0265  0.0541  430  VAL A N   
2525 C CA  . VAL A 385 ? 0.4648 0.4571 0.4674 0.0058  0.0186  0.0412  430  VAL A CA  
2526 C C   . VAL A 385 ? 0.4362 0.4350 0.4272 0.0135  0.0106  0.0405  430  VAL A C   
2527 O O   . VAL A 385 ? 0.4417 0.4559 0.4365 0.0139  0.0085  0.0316  430  VAL A O   
2528 C CB  . VAL A 385 ? 0.5098 0.4897 0.5279 0.0081  0.0143  0.0382  430  VAL A CB  
2529 C CG1 . VAL A 385 ? 0.4750 0.4674 0.5035 0.0137  0.0090  0.0248  430  VAL A CG1 
2530 C CG2 . VAL A 385 ? 0.5111 0.4832 0.5429 -0.0011 0.0200  0.0377  430  VAL A CG2 
2531 N N   . SER A 386 ? 0.5406 0.5270 0.5175 0.0190  0.0055  0.0505  431  SER A N   
2532 C CA  A SER A 386 ? 0.5636 0.5557 0.5302 0.0261  -0.0050 0.0500  431  SER A CA  
2533 C CA  B SER A 386 ? 0.5734 0.5657 0.5402 0.0261  -0.0051 0.0499  431  SER A CA  
2534 C C   . SER A 386 ? 0.5483 0.5504 0.4993 0.0233  -0.0032 0.0468  431  SER A C   
2535 O O   . SER A 386 ? 0.5295 0.5441 0.4848 0.0249  -0.0102 0.0390  431  SER A O   
2536 C CB  A SER A 386 ? 0.5642 0.5389 0.5145 0.0331  -0.0122 0.0627  431  SER A CB  
2537 C CB  B SER A 386 ? 0.5647 0.5397 0.5157 0.0334  -0.0126 0.0624  431  SER A CB  
2538 O OG  A SER A 386 ? 0.5297 0.5110 0.4701 0.0400  -0.0252 0.0613  431  SER A OG  
2539 O OG  B SER A 386 ? 0.5811 0.5463 0.5493 0.0383  -0.0170 0.0638  431  SER A OG  
2540 N N   . ALA A 387 ? 0.5097 0.5059 0.4444 0.0193  0.0069  0.0528  432  ALA A N   
2541 C CA  . ALA A 387 ? 0.4903 0.4934 0.4086 0.0183  0.0098  0.0487  432  ALA A CA  
2542 C C   . ALA A 387 ? 0.4975 0.5165 0.4333 0.0144  0.0108  0.0365  432  ALA A C   
2543 O O   . ALA A 387 ? 0.4837 0.5086 0.4138 0.0157  0.0048  0.0299  432  ALA A O   
2544 C CB  . ALA A 387 ? 0.5053 0.5019 0.4079 0.0153  0.0239  0.0568  432  ALA A CB  
2545 N N   . VAL A 388 ? 0.4251 0.4494 0.3812 0.0095  0.0174  0.0336  433  VAL A N   
2546 C CA  . VAL A 388 ? 0.4227 0.4602 0.3914 0.0065  0.0185  0.0240  433  VAL A CA  
2547 C C   . VAL A 388 ? 0.4339 0.4792 0.4137 0.0087  0.0097  0.0177  433  VAL A C   
2548 O O   . VAL A 388 ? 0.4261 0.4806 0.4109 0.0068  0.0092  0.0117  433  VAL A O   
2549 C CB  . VAL A 388 ? 0.4004 0.4420 0.3860 0.0014  0.0255  0.0218  433  VAL A CB  
2550 C CG1 . VAL A 388 ? 0.4059 0.4444 0.3879 -0.0020 0.0355  0.0280  433  VAL A CG1 
2551 C CG2 . VAL A 388 ? 0.4203 0.4577 0.4199 0.0017  0.0222  0.0205  433  VAL A CG2 
2552 N N   . THR A 389 ? 0.4314 0.4735 0.4167 0.0129  0.0035  0.0198  434  THR A N   
2553 C CA  . THR A 389 ? 0.4107 0.4636 0.4101 0.0155  -0.0034 0.0145  434  THR A CA  
2554 C C   . THR A 389 ? 0.4137 0.4705 0.4054 0.0162  -0.0119 0.0134  434  THR A C   
2555 O O   . THR A 389 ? 0.4139 0.4814 0.4152 0.0132  -0.0133 0.0079  434  THR A O   
2556 C CB  . THR A 389 ? 0.4389 0.4883 0.4494 0.0216  -0.0079 0.0163  434  THR A CB  
2557 O OG1 . THR A 389 ? 0.4361 0.4801 0.4540 0.0203  -0.0011 0.0147  434  THR A OG1 
2558 C CG2 . THR A 389 ? 0.3973 0.4622 0.4269 0.0250  -0.0132 0.0109  434  THR A CG2 
2559 N N   . TRP A 390 ? 0.4650 0.5112 0.4375 0.0198  -0.0177 0.0188  435  TRP A N   
2560 C CA  . TRP A 390 ? 0.4945 0.5411 0.4547 0.0210  -0.0281 0.0163  435  TRP A CA  
2561 C C   . TRP A 390 ? 0.4826 0.5314 0.4376 0.0157  -0.0232 0.0100  435  TRP A C   
2562 O O   . TRP A 390 ? 0.4622 0.5168 0.4234 0.0135  -0.0308 0.0039  435  TRP A O   
2563 C CB  . TRP A 390 ? 0.4751 0.5067 0.4061 0.0265  -0.0333 0.0236  435  TRP A CB  
2564 C CG  . TRP A 390 ? 0.5076 0.5360 0.4420 0.0337  -0.0452 0.0295  435  TRP A CG  
2565 C CD1 . TRP A 390 ? 0.5348 0.5524 0.4679 0.0376  -0.0421 0.0388  435  TRP A CD1 
2566 C CD2 . TRP A 390 ? 0.5145 0.5505 0.4569 0.0383  -0.0630 0.0264  435  TRP A CD2 
2567 N NE1 . TRP A 390 ? 0.5485 0.5651 0.4865 0.0456  -0.0566 0.0422  435  TRP A NE1 
2568 C CE2 . TRP A 390 ? 0.5140 0.5438 0.4590 0.0464  -0.0701 0.0345  435  TRP A CE2 
2569 C CE3 . TRP A 390 ? 0.4944 0.5417 0.4450 0.0359  -0.0746 0.0175  435  TRP A CE3 
2570 C CZ2 . TRP A 390 ? 0.5108 0.5477 0.4668 0.0535  -0.0887 0.0340  435  TRP A CZ2 
2571 C CZ3 . TRP A 390 ? 0.4763 0.5316 0.4396 0.0413  -0.0934 0.0165  435  TRP A CZ3 
2572 C CH2 . TRP A 390 ? 0.4805 0.5318 0.4466 0.0505  -0.1004 0.0246  435  TRP A CH2 
2573 N N   . LEU A 391 ? 0.4321 0.4762 0.3784 0.0136  -0.0111 0.0117  436  LEU A N   
2574 C CA  . LEU A 391 ? 0.4376 0.4824 0.3793 0.0106  -0.0064 0.0060  436  LEU A CA  
2575 C C   . LEU A 391 ? 0.4358 0.4912 0.3998 0.0061  -0.0068 0.0009  436  LEU A C   
2576 O O   . LEU A 391 ? 0.4236 0.4787 0.3876 0.0039  -0.0107 -0.0042 436  LEU A O   
2577 C CB  . LEU A 391 ? 0.4114 0.4530 0.3463 0.0101  0.0070  0.0092  436  LEU A CB  
2578 C CG  . LEU A 391 ? 0.4187 0.4617 0.3522 0.0090  0.0128  0.0037  436  LEU A CG  
2579 C CD1 . LEU A 391 ? 0.4402 0.4747 0.3525 0.0124  0.0073  -0.0019 436  LEU A CD1 
2580 C CD2 . LEU A 391 ? 0.4066 0.4511 0.3410 0.0088  0.0260  0.0078  436  LEU A CD2 
2581 N N   . GLY A 392 ? 0.4034 0.4664 0.3847 0.0048  -0.0025 0.0025  437  GLY A N   
2582 C CA  . GLY A 392 ? 0.3896 0.4627 0.3888 0.0014  -0.0016 -0.0005 437  GLY A CA  
2583 C C   . GLY A 392 ? 0.3819 0.4616 0.3924 -0.0002 -0.0105 -0.0029 437  GLY A C   
2584 O O   . GLY A 392 ? 0.3745 0.4571 0.3923 -0.0049 -0.0105 -0.0051 437  GLY A O   
2585 N N   . TYR A 393 ? 0.3880 0.4697 0.4018 0.0034  -0.0189 -0.0018 438  TYR A N   
2586 C CA  . TYR A 393 ? 0.4020 0.4936 0.4330 0.0019  -0.0291 -0.0043 438  TYR A CA  
2587 C C   . TYR A 393 ? 0.4082 0.4925 0.4287 -0.0011 -0.0391 -0.0087 438  TYR A C   
2588 O O   . TYR A 393 ? 0.4039 0.4956 0.4421 -0.0065 -0.0450 -0.0120 438  TYR A O   
2589 C CB  . TYR A 393 ? 0.4071 0.5033 0.4459 0.0085  -0.0375 -0.0020 438  TYR A CB  
2590 C CG  . TYR A 393 ? 0.4020 0.5067 0.4578 0.0120  -0.0292 -0.0003 438  TYR A CG  
2591 C CD1 . TYR A 393 ? 0.3731 0.4863 0.4405 0.0083  -0.0175 -0.0020 438  TYR A CD1 
2592 C CD2 . TYR A 393 ? 0.3938 0.4960 0.4518 0.0200  -0.0337 0.0027  438  TYR A CD2 
2593 C CE1 . TYR A 393 ? 0.3696 0.4893 0.4486 0.0127  -0.0099 -0.0026 438  TYR A CE1 
2594 C CE2 . TYR A 393 ? 0.3963 0.5040 0.4695 0.0245  -0.0265 0.0021  438  TYR A CE2 
2595 C CZ  . TYR A 393 ? 0.3713 0.4879 0.4541 0.0209  -0.0144 -0.0015 438  TYR A CZ  
2596 O OH  . TYR A 393 ? 0.4128 0.5335 0.5070 0.0266  -0.0072 -0.0041 438  TYR A OH  
2597 N N   . VAL A 394 ? 0.4106 0.4800 0.4025 0.0023  -0.0402 -0.0091 439  VAL A N   
2598 C CA  . VAL A 394 ? 0.4411 0.4997 0.4163 0.0013  -0.0488 -0.0155 439  VAL A CA  
2599 C C   . VAL A 394 ? 0.4410 0.4980 0.4254 -0.0054 -0.0444 -0.0199 439  VAL A C   
2600 O O   . VAL A 394 ? 0.4424 0.4942 0.4284 -0.0090 -0.0546 -0.0266 439  VAL A O   
2601 C CB  . VAL A 394 ? 0.4738 0.5172 0.4137 0.0075  -0.0453 -0.0146 439  VAL A CB  
2602 C CG1 . VAL A 394 ? 0.5212 0.5521 0.4426 0.0073  -0.0476 -0.0230 439  VAL A CG1 
2603 C CG2 . VAL A 394 ? 0.4867 0.5262 0.4108 0.0141  -0.0554 -0.0107 439  VAL A CG2 
2604 N N   . ASN A 395 ? 0.4306 0.4908 0.4219 -0.0070 -0.0309 -0.0161 440  ASN A N   
2605 C CA  . ASN A 395 ? 0.4291 0.4869 0.4297 -0.0126 -0.0271 -0.0178 440  ASN A CA  
2606 C C   . ASN A 395 ? 0.4177 0.4826 0.4428 -0.0204 -0.0346 -0.0191 440  ASN A C   
2607 O O   . ASN A 395 ? 0.4388 0.4947 0.4672 -0.0255 -0.0379 -0.0225 440  ASN A O   
2608 C CB  . ASN A 395 ? 0.4103 0.4737 0.4168 -0.0128 -0.0139 -0.0123 440  ASN A CB  
2609 C CG  . ASN A 395 ? 0.4485 0.5063 0.4600 -0.0170 -0.0105 -0.0120 440  ASN A CG  
2610 O OD1 . ASN A 395 ? 0.4787 0.5439 0.5064 -0.0221 -0.0072 -0.0078 440  ASN A OD1 
2611 N ND2 . ASN A 395 ? 0.4543 0.4983 0.4514 -0.0143 -0.0107 -0.0159 440  ASN A ND2 
2612 N N   . SER A 396 ? 0.4231 0.5039 0.4678 -0.0212 -0.0372 -0.0164 441  SER A N   
2613 C CA  . SER A 396 ? 0.4149 0.5078 0.4899 -0.0292 -0.0421 -0.0164 441  SER A CA  
2614 C C   . SER A 396 ? 0.4293 0.5150 0.5064 -0.0333 -0.0595 -0.0242 441  SER A C   
2615 O O   . SER A 396 ? 0.4458 0.5375 0.5493 -0.0425 -0.0644 -0.0252 441  SER A O   
2616 C CB  . SER A 396 ? 0.4225 0.5364 0.5196 -0.0267 -0.0405 -0.0128 441  SER A CB  
2617 O OG  . SER A 396 ? 0.4333 0.5539 0.5328 -0.0251 -0.0243 -0.0073 441  SER A OG  
2618 N N   . ALA A 397 ? 0.4337 0.5061 0.4827 -0.0266 -0.0689 -0.0298 442  ALA A N   
2619 C CA  . ALA A 397 ? 0.4627 0.5244 0.5053 -0.0287 -0.0872 -0.0397 442  ALA A CA  
2620 C C   . ALA A 397 ? 0.5085 0.5476 0.5317 -0.0301 -0.0862 -0.0466 442  ALA A C   
2621 O O   . ALA A 397 ? 0.5014 0.5291 0.5236 -0.0340 -0.1011 -0.0565 442  ALA A O   
2622 C CB  . ALA A 397 ? 0.4485 0.5067 0.4664 -0.0193 -0.0989 -0.0423 442  ALA A CB  
2623 N N   . LEU A 398 ? 0.4968 0.5291 0.5061 -0.0265 -0.0701 -0.0423 443  LEU A N   
2624 C CA  . LEU A 398 ? 0.4971 0.5080 0.4857 -0.0240 -0.0680 -0.0489 443  LEU A CA  
2625 C C   . LEU A 398 ? 0.5066 0.5089 0.5147 -0.0329 -0.0681 -0.0497 443  LEU A C   
2626 O O   . LEU A 398 ? 0.5138 0.4956 0.5112 -0.0329 -0.0752 -0.0594 443  LEU A O   
2627 C CB  . LEU A 398 ? 0.5157 0.5248 0.4859 -0.0159 -0.0515 -0.0438 443  LEU A CB  
2628 C CG  . LEU A 398 ? 0.5278 0.5413 0.4766 -0.0074 -0.0477 -0.0412 443  LEU A CG  
2629 C CD1 . LEU A 398 ? 0.5272 0.5409 0.4668 -0.0020 -0.0311 -0.0362 443  LEU A CD1 
2630 C CD2 . LEU A 398 ? 0.5224 0.5226 0.4426 -0.0019 -0.0591 -0.0504 443  LEU A CD2 
2631 N N   . ASN A 399 ? 0.5081 0.5237 0.5427 -0.0399 -0.0593 -0.0394 444  ASN A N   
2632 C CA  . ASN A 399 ? 0.5376 0.5426 0.5883 -0.0483 -0.0566 -0.0366 444  ASN A CA  
2633 C C   . ASN A 399 ? 0.5352 0.5274 0.6001 -0.0577 -0.0725 -0.0454 444  ASN A C   
2634 O O   . ASN A 399 ? 0.5727 0.5425 0.6344 -0.0598 -0.0741 -0.0490 444  ASN A O   
2635 C CB  . ASN A 399 ? 0.5254 0.5482 0.6001 -0.0546 -0.0443 -0.0231 444  ASN A CB  
2636 C CG  . ASN A 399 ? 0.5610 0.5856 0.6204 -0.0470 -0.0293 -0.0155 444  ASN A CG  
2637 O OD1 . ASN A 399 ? 0.5407 0.5575 0.5770 -0.0377 -0.0278 -0.0196 444  ASN A OD1 
2638 N ND2 . ASN A 399 ? 0.5673 0.6036 0.6401 -0.0509 -0.0183 -0.0045 444  ASN A ND2 
2639 N N   . PRO A 400 ? 0.5102 0.5157 0.5931 -0.0633 -0.0855 -0.0493 445  PRO A N   
2640 C CA  . PRO A 400 ? 0.5309 0.5227 0.6284 -0.0730 -0.1031 -0.0595 445  PRO A CA  
2641 C C   . PRO A 400 ? 0.5547 0.5172 0.6179 -0.0654 -0.1136 -0.0750 445  PRO A C   
2642 O O   . PRO A 400 ? 0.5897 0.5298 0.6585 -0.0718 -0.1219 -0.0827 445  PRO A O   
2643 C CB  . PRO A 400 ? 0.5091 0.5231 0.6274 -0.0766 -0.1175 -0.0625 445  PRO A CB  
2644 C CG  . PRO A 400 ? 0.4629 0.5046 0.5952 -0.0742 -0.1015 -0.0486 445  PRO A CG  
2645 C CD  . PRO A 400 ? 0.4860 0.5189 0.5836 -0.0624 -0.0857 -0.0443 445  PRO A CD  
2646 N N   . VAL A 401 ? 0.5665 0.5280 0.5942 -0.0517 -0.1120 -0.0793 446  VAL A N   
2647 C CA  . VAL A 401 ? 0.5950 0.5307 0.5858 -0.0422 -0.1181 -0.0937 446  VAL A CA  
2648 C C   . VAL A 401 ? 0.5995 0.5166 0.5834 -0.0386 -0.1049 -0.0924 446  VAL A C   
2649 O O   . VAL A 401 ? 0.6189 0.5097 0.5919 -0.0371 -0.1124 -0.1050 446  VAL A O   
2650 C CB  . VAL A 401 ? 0.6281 0.5689 0.5824 -0.0283 -0.1150 -0.0952 446  VAL A CB  
2651 C CG1 . VAL A 401 ? 0.6271 0.5420 0.5416 -0.0179 -0.1196 -0.1107 446  VAL A CG1 
2652 C CG2 . VAL A 401 ? 0.5841 0.5427 0.5447 -0.0300 -0.1288 -0.0944 446  VAL A CG2 
2653 N N   . ILE A 402 ? 0.5609 0.4909 0.5512 -0.0364 -0.0866 -0.0780 447  ILE A N   
2654 C CA  . ILE A 402 ? 0.5872 0.5026 0.5731 -0.0317 -0.0748 -0.0749 447  ILE A CA  
2655 C C   . ILE A 402 ? 0.6163 0.5120 0.6239 -0.0421 -0.0809 -0.0753 447  ILE A C   
2656 O O   . ILE A 402 ? 0.6709 0.5406 0.6677 -0.0369 -0.0823 -0.0832 447  ILE A O   
2657 C CB  . ILE A 402 ? 0.5693 0.5041 0.5615 -0.0292 -0.0575 -0.0590 447  ILE A CB  
2658 C CG1 . ILE A 402 ? 0.5616 0.5104 0.5322 -0.0187 -0.0507 -0.0591 447  ILE A CG1 
2659 C CG2 . ILE A 402 ? 0.5726 0.4930 0.5645 -0.0249 -0.0486 -0.0547 447  ILE A CG2 
2660 C CD1 . ILE A 402 ? 0.5444 0.5109 0.5208 -0.0161 -0.0357 -0.0460 447  ILE A CD1 
2661 N N   . TYR A 403 ? 0.6111 0.5182 0.6506 -0.0567 -0.0841 -0.0669 448  TYR A N   
2662 C CA  . TYR A 403 ? 0.6119 0.5001 0.6758 -0.0691 -0.0893 -0.0652 448  TYR A CA  
2663 C C   . TYR A 403 ? 0.6420 0.5022 0.6986 -0.0704 -0.1081 -0.0847 448  TYR A C   
2664 O O   . TYR A 403 ? 0.6732 0.5040 0.7306 -0.0713 -0.1105 -0.0886 448  TYR A O   
2665 C CB  . TYR A 403 ? 0.6156 0.5246 0.7178 -0.0855 -0.0891 -0.0536 448  TYR A CB  
2666 C CG  . TYR A 403 ? 0.5745 0.5110 0.6830 -0.0843 -0.0714 -0.0365 448  TYR A CG  
2667 C CD1 . TYR A 403 ? 0.5877 0.5209 0.6789 -0.0752 -0.0567 -0.0272 448  TYR A CD1 
2668 C CD2 . TYR A 403 ? 0.5658 0.5319 0.6978 -0.0912 -0.0705 -0.0309 448  TYR A CD2 
2669 C CE1 . TYR A 403 ? 0.5889 0.5456 0.6828 -0.0735 -0.0422 -0.0137 448  TYR A CE1 
2670 C CE2 . TYR A 403 ? 0.5684 0.5579 0.7037 -0.0887 -0.0542 -0.0174 448  TYR A CE2 
2671 C CZ  . TYR A 403 ? 0.5664 0.5500 0.6808 -0.0801 -0.0405 -0.0094 448  TYR A CZ  
2672 O OH  . TYR A 403 ? 0.5823 0.5872 0.6974 -0.0774 -0.0261 0.0020  448  TYR A OH  
2673 N N   . THR A 404 ? 0.7099 0.5781 0.7589 -0.0699 -0.1226 -0.0971 449  THR A N   
2674 C CA  . THR A 404 ? 0.7193 0.5630 0.7603 -0.0719 -0.1441 -0.1177 449  THR A CA  
2675 C C   . THR A 404 ? 0.7473 0.5612 0.7497 -0.0562 -0.1425 -0.1317 449  THR A C   
2676 O O   . THR A 404 ? 0.7961 0.5787 0.7958 -0.0579 -0.1550 -0.1465 449  THR A O   
2677 C CB  . THR A 404 ? 0.6829 0.5431 0.7168 -0.0715 -0.1608 -0.1275 449  THR A CB  
2678 O OG1 . THR A 404 ? 0.7164 0.6074 0.7898 -0.0842 -0.1611 -0.1147 449  THR A OG1 
2679 C CG2 . THR A 404 ? 0.7206 0.5548 0.7474 -0.0749 -0.1864 -0.1501 449  THR A CG2 
2680 N N   . VAL A 405 ? 0.7434 0.5676 0.7182 -0.0409 -0.1268 -0.1274 450  VAL A N   
2681 C CA  . VAL A 405 ? 0.7545 0.5565 0.6951 -0.0243 -0.1213 -0.1395 450  VAL A CA  
2682 C C   . VAL A 405 ? 0.7766 0.5618 0.7290 -0.0220 -0.1101 -0.1323 450  VAL A C   
2683 O O   . VAL A 405 ? 0.8057 0.5596 0.7474 -0.0157 -0.1148 -0.1458 450  VAL A O   
2684 C CB  . VAL A 405 ? 0.7673 0.5889 0.6776 -0.0094 -0.1075 -0.1366 450  VAL A CB  
2685 C CG1 . VAL A 405 ? 0.7783 0.5809 0.6587 0.0080  -0.0980 -0.1474 450  VAL A CG1 
2686 C CG2 . VAL A 405 ? 0.7533 0.5861 0.6452 -0.0091 -0.1196 -0.1435 450  VAL A CG2 
2687 N N   . PHE A 406 ? 0.7411 0.5453 0.7142 -0.0263 -0.0963 -0.1116 451  PHE A N   
2688 C CA  . PHE A 406 ? 0.7487 0.5405 0.7256 -0.0197 -0.0846 -0.1032 451  PHE A CA  
2689 C C   . PHE A 406 ? 0.7732 0.5501 0.7797 -0.0328 -0.0864 -0.0911 451  PHE A C   
2690 O O   . PHE A 406 ? 0.8171 0.5787 0.8248 -0.0264 -0.0795 -0.0844 451  PHE A O   
2691 C CB  . PHE A 406 ? 0.7058 0.5256 0.6780 -0.0115 -0.0672 -0.0890 451  PHE A CB  
2692 C CG  . PHE A 406 ? 0.7553 0.5861 0.6993 0.0029  -0.0613 -0.0982 451  PHE A CG  
2693 C CD1 . PHE A 406 ? 0.8087 0.6248 0.7343 0.0188  -0.0554 -0.1082 451  PHE A CD1 
2694 C CD2 . PHE A 406 ? 0.7452 0.6008 0.6818 0.0009  -0.0603 -0.0958 451  PHE A CD2 
2695 C CE1 . PHE A 406 ? 0.7975 0.6253 0.6980 0.0315  -0.0470 -0.1151 451  PHE A CE1 
2696 C CE2 . PHE A 406 ? 0.7459 0.6099 0.6558 0.0133  -0.0533 -0.1017 451  PHE A CE2 
2697 C CZ  . PHE A 406 ? 0.7511 0.6020 0.6429 0.0280  -0.0457 -0.1110 451  PHE A CZ  
2698 N N   . ASN A 407 ? 0.7654 0.5471 0.7969 -0.0508 -0.0950 -0.0870 452  ASN A N   
2699 C CA  . ASN A 407 ? 0.7503 0.5153 0.8102 -0.0645 -0.0955 -0.0745 452  ASN A CA  
2700 C C   . ASN A 407 ? 0.7812 0.5174 0.8558 -0.0765 -0.1141 -0.0885 452  ASN A C   
2701 O O   . ASN A 407 ? 0.7851 0.5316 0.8686 -0.0857 -0.1271 -0.0983 452  ASN A O   
2702 C CB  . ASN A 407 ? 0.7561 0.5509 0.8413 -0.0780 -0.0860 -0.0535 452  ASN A CB  
2703 C CG  . ASN A 407 ? 0.7816 0.5592 0.8951 -0.0933 -0.0842 -0.0385 452  ASN A CG  
2704 O OD1 . ASN A 407 ? 0.7314 0.5048 0.8724 -0.1103 -0.0939 -0.0403 452  ASN A OD1 
2705 N ND2 . ASN A 407 ? 0.7672 0.5338 0.8747 -0.0873 -0.0725 -0.0232 452  ASN A ND2 
2706 N N   . ALA A 408 ? 0.8541 0.5532 0.9331 -0.0765 -0.1167 -0.0892 453  ALA A N   
2707 C CA  . ALA A 408 ? 0.8396 0.5040 0.9296 -0.0858 -0.1357 -0.1058 453  ALA A CA  
2708 C C   . ALA A 408 ? 0.8509 0.5261 0.9802 -0.1107 -0.1452 -0.1002 453  ALA A C   
2709 O O   . ALA A 408 ? 0.8535 0.5219 0.9889 -0.1182 -0.1648 -0.1190 453  ALA A O   
2710 C CB  . ALA A 408 ? 0.9107 0.5325 1.0028 -0.0820 -0.1347 -0.1031 453  ALA A CB  
2711 N N   . GLU A 409 ? 0.8355 0.5280 0.9918 -0.1231 -0.1316 -0.0747 454  GLU A N   
2712 C CA  . GLU A 409 ? 0.8391 0.5421 1.0391 -0.1474 -0.1375 -0.0672 454  GLU A CA  
2713 C C   . GLU A 409 ? 0.7700 0.5116 0.9763 -0.1506 -0.1455 -0.0761 454  GLU A C   
2714 O O   . GLU A 409 ? 0.7639 0.5042 0.9949 -0.1644 -0.1641 -0.0882 454  GLU A O   
2715 C CB  . GLU A 409 ? 0.8567 0.5713 1.0803 -0.1583 -0.1174 -0.0365 454  GLU A CB  
2716 N N   . PHE A 410 ? 0.7362 0.5102 0.9208 -0.1374 -0.1332 -0.0708 455  PHE A N   
2717 C CA  . PHE A 410 ? 0.7365 0.5443 0.9236 -0.1375 -0.1413 -0.0788 455  PHE A CA  
2718 C C   . PHE A 410 ? 0.7756 0.5653 0.9403 -0.1310 -0.1647 -0.1065 455  PHE A C   
2719 O O   . PHE A 410 ? 0.7281 0.5290 0.9112 -0.1405 -0.1830 -0.1169 455  PHE A O   
2720 C CB  . PHE A 410 ? 0.7101 0.5487 0.8736 -0.1228 -0.1243 -0.0692 455  PHE A CB  
2721 C CG  . PHE A 410 ? 0.7014 0.5710 0.8909 -0.1311 -0.1063 -0.0463 455  PHE A CG  
2722 C CD1 . PHE A 410 ? 0.6930 0.5931 0.9173 -0.1436 -0.1098 -0.0428 455  PHE A CD1 
2723 C CD2 . PHE A 410 ? 0.6902 0.5591 0.8685 -0.1251 -0.0863 -0.0289 455  PHE A CD2 
2724 C CE1 . PHE A 410 ? 0.6190 0.5480 0.8655 -0.1496 -0.0913 -0.0229 455  PHE A CE1 
2725 C CE2 . PHE A 410 ? 0.6836 0.5797 0.8801 -0.1314 -0.0694 -0.0092 455  PHE A CE2 
2726 C CZ  . PHE A 410 ? 0.6374 0.5634 0.8673 -0.1433 -0.0707 -0.0064 455  PHE A CZ  
2727 N N   . ARG A 411 ? 0.8473 0.6100 0.9722 -0.1139 -0.1640 -0.1184 456  ARG A N   
2728 C CA  . ARG A 411 ? 0.8749 0.6164 0.9695 -0.1046 -0.1834 -0.1455 456  ARG A CA  
2729 C C   . ARG A 411 ? 0.8766 0.5916 0.9954 -0.1204 -0.2080 -0.1613 456  ARG A C   
2730 O O   . ARG A 411 ? 0.9247 0.6457 1.0325 -0.1190 -0.2245 -0.1769 456  ARG A O   
2731 C CB  . ARG A 411 ? 0.9138 0.6290 0.9674 -0.0839 -0.1742 -0.1536 456  ARG A CB  
2732 C CG  . ARG A 411 ? 0.9442 0.6387 0.9580 -0.0705 -0.1894 -0.1814 456  ARG A CG  
2733 C CD  . ARG A 411 ? 0.9577 0.6359 0.9345 -0.0484 -0.1746 -0.1864 456  ARG A CD  
2734 N N   . ASN A 412 ? 0.8832 0.5773 1.0299 -0.1322 -0.2034 -0.1513 457  ASN A N   
2735 C CA  . ASN A 412 ? 0.9057 0.5852 1.0723 -0.1443 -0.2164 -0.1591 457  ASN A CA  
2736 C C   . ASN A 412 ? 0.9057 0.6210 1.1135 -0.1624 -0.2227 -0.1514 457  ASN A C   
2737 O O   . ASN A 412 ? 0.9242 0.6397 1.1386 -0.1677 -0.2401 -0.1651 457  ASN A O   
2738 C CB  . ASN A 412 ? 0.9476 0.5946 1.1310 -0.1512 -0.2078 -0.1483 457  ASN A CB  
2739 N N   . VAL A 413 ? 0.8459 0.5927 1.0816 -0.1709 -0.2083 -0.1297 458  VAL A N   
2740 C CA  . VAL A 413 ? 0.8883 0.6743 1.1642 -0.1853 -0.2112 -0.1218 458  VAL A CA  
2741 C C   . VAL A 413 ? 0.8844 0.6927 1.1415 -0.1756 -0.2278 -0.1379 458  VAL A C   
2742 O O   . VAL A 413 ? 0.8759 0.7014 1.1548 -0.1834 -0.2417 -0.1436 458  VAL A O   
2743 C CB  . VAL A 413 ? 0.8666 0.6833 1.1714 -0.1931 -0.1888 -0.0952 458  VAL A CB  
2744 C CG1 . VAL A 413 ? 0.8514 0.7142 1.1917 -0.2020 -0.1909 -0.0900 458  VAL A CG1 
2745 C CG2 . VAL A 413 ? 0.8788 0.6767 1.2056 -0.2052 -0.1729 -0.0763 458  VAL A CG2 
2746 N N   . PHE A 414 ? 0.9161 0.7224 1.1310 -0.1579 -0.2262 -0.1445 459  PHE A N   
2747 C CA  . PHE A 414 ? 0.8976 0.7179 1.0829 -0.1455 -0.2409 -0.1594 459  PHE A CA  
2748 C C   . PHE A 414 ? 0.9714 0.7664 1.1335 -0.1413 -0.2609 -0.1816 459  PHE A C   
2749 O O   . PHE A 414 ? 0.9636 0.7739 1.1382 -0.1460 -0.2776 -0.1885 459  PHE A O   
2750 C CB  . PHE A 414 ? 0.9312 0.7494 1.0720 -0.1270 -0.2323 -0.1612 459  PHE A CB  
2751 C CG  . PHE A 414 ? 0.9444 0.7742 1.0477 -0.1126 -0.2445 -0.1737 459  PHE A CG  
2752 C CD1 . PHE A 414 ? 0.9028 0.7701 1.0194 -0.1128 -0.2460 -0.1649 459  PHE A CD1 
2753 C CD2 . PHE A 414 ? 0.9729 0.7758 1.0259 -0.0976 -0.2526 -0.1928 459  PHE A CD2 
2754 C CE1 . PHE A 414 ? 0.8721 0.7477 0.9519 -0.0988 -0.2567 -0.1736 459  PHE A CE1 
2755 C CE2 . PHE A 414 ? 0.9643 0.7769 0.9791 -0.0840 -0.2615 -0.2012 459  PHE A CE2 
2756 C CZ  . PHE A 414 ? 0.9337 0.7815 0.9614 -0.0848 -0.2641 -0.1909 459  PHE A CZ  
2757 N N   . ARG A 415 ? 1.0085 0.7650 1.1380 -0.1318 -0.2589 -0.1927 460  ARG A N   
2758 C CA  . ARG A 415 ? 1.0268 0.7556 1.1258 -0.1243 -0.2752 -0.2155 460  ARG A CA  
2759 C C   . ARG A 415 ? 1.1123 0.8427 1.2453 -0.1403 -0.2936 -0.2214 460  ARG A C   
2760 O O   . ARG A 415 ? 1.1705 0.8895 1.2801 -0.1347 -0.3116 -0.2403 460  ARG A O   
2761 C CB  . ARG A 415 ? 1.0295 0.7169 1.1050 -0.1156 -0.2666 -0.2225 460  ARG A CB  
2762 N N   . LYS A 416 ? 1.0769 0.8211 1.2644 -0.1600 -0.2884 -0.2052 461  LYS A N   
2763 C CA  . LYS A 416 ? 1.1108 0.8662 1.3367 -0.1760 -0.3050 -0.2087 461  LYS A CA  
2764 C C   . LYS A 416 ? 1.0903 0.8910 1.3330 -0.1769 -0.3106 -0.2026 461  LYS A C   
2765 O O   . LYS A 416 ? 1.0828 0.9143 1.3730 -0.1904 -0.3024 -0.1855 461  LYS A O   
2766 C CB  . LYS A 416 ? 1.0919 0.8405 1.3680 -0.1967 -0.2960 -0.1942 461  LYS A CB  
2767 C CG  . LYS A 416 ? 1.0278 0.7981 1.3332 -0.2044 -0.2713 -0.1674 461  LYS A CG  
2768 C CD  . LYS A 416 ? 1.0252 0.8012 1.3857 -0.2270 -0.2654 -0.1526 461  LYS A CD  
2769 C CE  . LYS A 416 ? 1.0635 0.7938 1.4219 -0.2327 -0.2680 -0.1581 461  LYS A CE  
2770 N N   . ALA A 417 ? 1.1224 0.9261 1.3227 -0.1608 -0.3230 -0.2161 462  ALA A N   
2771 C CA  . ALA A 417 ? 1.0848 0.9259 1.2938 -0.1585 -0.3324 -0.2133 462  ALA A CA  
2772 C C   . ALA A 417 ? 1.1299 0.9842 1.3818 -0.1735 -0.3515 -0.2178 462  ALA A C   
2773 O O   . ALA A 417 ? 1.1516 1.0381 1.4552 -0.1865 -0.3466 -0.2034 462  ALA A O   
2774 C CB  . ALA A 417 ? 1.0961 0.9307 1.2445 -0.1375 -0.3417 -0.2265 462  ALA A CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -3   ?    ?   ?   A . n 
A 1 2   GLY 2   -2   ?    ?   ?   A . n 
A 1 3   THR 3   -1   ?    ?   ?   A . n 
A 1 4   THR 4   0    ?    ?   ?   A . n 
A 1 5   MET 5   1    ?    ?   ?   A . n 
A 1 6   GLY 6   2    ?    ?   ?   A . n 
A 1 7   ASN 7   3    ?    ?   ?   A . n 
A 1 8   ARG 8   4    ?    ?   ?   A . n 
A 1 9   SER 9   5    ?    ?   ?   A . n 
A 1 10  THR 10  6    ?    ?   ?   A . n 
A 1 11  ALA 11  7    ?    ?   ?   A . n 
A 1 12  ASP 12  8    ?    ?   ?   A . n 
A 1 13  ALA 13  9    ?    ?   ?   A . n 
A 1 14  ASP 14  10   ?    ?   ?   A . n 
A 1 15  GLY 15  11   ?    ?   ?   A . n 
A 1 16  LEU 16  12   ?    ?   ?   A . n 
A 1 17  LEU 17  13   ?    ?   ?   A . n 
A 1 18  ALA 18  14   ?    ?   ?   A . n 
A 1 19  GLY 19  15   ?    ?   ?   A . n 
A 1 20  ARG 20  16   ?    ?   ?   A . n 
A 1 21  GLY 21  17   ?    ?   ?   A . n 
A 1 22  PRO 22  18   ?    ?   ?   A . n 
A 1 23  ALA 23  19   ?    ?   ?   A . n 
A 1 24  ALA 24  20   ?    ?   ?   A . n 
A 1 25  GLY 25  21   ?    ?   ?   A . n 
A 1 26  ALA 26  22   ?    ?   ?   A . n 
A 1 27  SER 27  23   ?    ?   ?   A . n 
A 1 28  ALA 28  24   ?    ?   ?   A . n 
A 1 29  GLY 29  25   ?    ?   ?   A . n 
A 1 30  ALA 30  26   ?    ?   ?   A . n 
A 1 31  SER 31  27   ?    ?   ?   A . n 
A 1 32  ALA 32  28   ?    ?   ?   A . n 
A 1 33  GLY 33  29   ?    ?   ?   A . n 
A 1 34  LEU 34  30   ?    ?   ?   A . n 
A 1 35  ALA 35  31   ?    ?   ?   A . n 
A 1 36  GLY 36  32   ?    ?   ?   A . n 
A 1 37  GLN 37  33   ?    ?   ?   A . n 
A 1 38  GLY 38  34   34   GLY GLY A . n 
A 1 39  ALA 39  35   35   ALA ALA A . n 
A 1 40  ALA 40  36   36   ALA ALA A . n 
A 1 41  ALA 41  37   37   ALA ALA A . n 
A 1 42  LEU 42  38   38   LEU LEU A . n 
A 1 43  VAL 43  39   39   VAL VAL A . n 
A 1 44  GLY 44  40   40   GLY GLY A . n 
A 1 45  GLY 45  41   41   GLY GLY A . n 
A 1 46  VAL 46  42   42   VAL VAL A . n 
A 1 47  LEU 47  43   43   LEU LEU A . n 
A 1 48  LEU 48  44   44   LEU LEU A . n 
A 1 49  ILE 49  45   45   ILE ILE A . n 
A 1 50  GLY 50  46   46   GLY GLY A . n 
A 1 51  ALA 51  47   47   ALA ALA A . n 
A 1 52  VAL 52  48   48   VAL VAL A . n 
A 1 53  LEU 53  49   49   LEU LEU A . n 
A 1 54  ALA 54  50   50   ALA ALA A . n 
A 1 55  GLY 55  51   51   GLY GLY A . n 
A 1 56  ASN 56  52   52   ASN ASN A . n 
A 1 57  SER 57  53   53   SER SER A . n 
A 1 58  LEU 58  54   54   LEU LEU A . n 
A 1 59  VAL 59  55   55   VAL VAL A . n 
A 1 60  CYS 60  56   56   CYS CYS A . n 
A 1 61  VAL 61  57   57   VAL VAL A . n 
A 1 62  SER 62  58   58   SER SER A . n 
A 1 63  VAL 63  59   59   VAL VAL A . n 
A 1 64  ALA 64  60   60   ALA ALA A . n 
A 1 65  THR 65  61   61   THR THR A . n 
A 1 66  GLU 66  62   62   GLU GLU A . n 
A 1 67  ARG 67  63   63   ARG ARG A . n 
A 1 68  ALA 68  64   64   ALA ALA A . n 
A 1 69  LEU 69  65   65   LEU LEU A . n 
A 1 70  GLN 70  66   66   GLN GLN A . n 
A 1 71  THR 71  67   67   THR THR A . n 
A 1 72  PRO 72  68   68   PRO PRO A . n 
A 1 73  THR 73  69   69   THR THR A . n 
A 1 74  ASN 74  70   70   ASN ASN A . n 
A 1 75  SER 75  71   71   SER SER A . n 
A 1 76  PHE 76  72   72   PHE PHE A . n 
A 1 77  ILE 77  73   73   ILE ILE A . n 
A 1 78  VAL 78  74   74   VAL VAL A . n 
A 1 79  SER 79  75   75   SER SER A . n 
A 1 80  LEU 80  76   76   LEU LEU A . n 
A 1 81  ALA 81  77   77   ALA ALA A . n 
A 1 82  ALA 82  78   78   ALA ALA A . n 
A 1 83  ALA 83  79   79   ALA ALA A . n 
A 1 84  ASP 84  80   80   ASP ASP A . n 
A 1 85  LEU 85  81   81   LEU LEU A . n 
A 1 86  LEU 86  82   82   LEU LEU A . n 
A 1 87  LEU 87  83   83   LEU LEU A . n 
A 1 88  ALA 88  84   84   ALA ALA A . n 
A 1 89  LEU 89  85   85   LEU LEU A . n 
A 1 90  LEU 90  86   86   LEU LEU A . n 
A 1 91  VAL 91  87   87   VAL VAL A . n 
A 1 92  LEU 92  88   88   LEU LEU A . n 
A 1 93  PRO 93  89   89   PRO PRO A . n 
A 1 94  LEU 94  90   90   LEU LEU A . n 
A 1 95  PHE 95  91   91   PHE PHE A . n 
A 1 96  VAL 96  92   92   VAL VAL A . n 
A 1 97  TYR 97  93   93   TYR TYR A . n 
A 1 98  SER 98  94   94   SER SER A . n 
A 1 99  GLU 99  95   95   GLU GLU A . n 
A 1 100 VAL 100 96   96   VAL VAL A . n 
A 1 101 GLN 101 97   97   GLN GLN A . n 
A 1 102 GLY 102 98   98   GLY GLY A . n 
A 1 103 GLY 103 99   99   GLY GLY A . n 
A 1 104 ALA 104 100  100  ALA ALA A . n 
A 1 105 TRP 105 101  101  TRP TRP A . n 
A 1 106 LEU 106 102  102  LEU LEU A . n 
A 1 107 LEU 107 103  103  LEU LEU A . n 
A 1 108 SER 108 104  104  SER SER A . n 
A 1 109 PRO 109 105  105  PRO PRO A . n 
A 1 110 ARG 110 106  106  ARG ARG A . n 
A 1 111 LEU 111 107  107  LEU LEU A . n 
A 1 112 CYS 112 108  108  CYS CYS A . n 
A 1 113 ASP 113 109  109  ASP ASP A . n 
A 1 114 ALA 114 110  110  ALA ALA A . n 
A 1 115 LEU 115 111  111  LEU LEU A . n 
A 1 116 MET 116 112  112  MET MET A . n 
A 1 117 ALA 117 113  113  ALA ALA A . n 
A 1 118 MET 118 114  114  MET MET A . n 
A 1 119 ASP 119 115  115  ASP ASP A . n 
A 1 120 VAL 120 116  116  VAL VAL A . n 
A 1 121 MET 121 117  117  MET MET A . n 
A 1 122 LEU 122 118  118  LEU LEU A . n 
A 1 123 CYS 123 119  119  CYS CYS A . n 
A 1 124 THR 124 120  120  THR THR A . n 
A 1 125 ALA 125 121  121  ALA ALA A . n 
A 1 126 SER 126 122  122  SER SER A . n 
A 1 127 ILE 127 123  123  ILE ILE A . n 
A 1 128 PHE 128 124  124  PHE PHE A . n 
A 1 129 ASN 129 125  125  ASN ASN A . n 
A 1 130 LEU 130 126  126  LEU LEU A . n 
A 1 131 CYS 131 127  127  CYS CYS A . n 
A 1 132 ALA 132 128  128  ALA ALA A . n 
A 1 133 ILE 133 129  129  ILE ILE A . n 
A 1 134 SER 134 130  130  SER SER A . n 
A 1 135 VAL 135 131  131  VAL VAL A . n 
A 1 136 ASP 136 132  132  ASP ASP A . n 
A 1 137 ARG 137 133  133  ARG ARG A . n 
A 1 138 PHE 138 134  134  PHE PHE A . n 
A 1 139 VAL 139 135  135  VAL VAL A . n 
A 1 140 ALA 140 136  136  ALA ALA A . n 
A 1 141 VAL 141 137  137  VAL VAL A . n 
A 1 142 ALA 142 138  138  ALA ALA A . n 
A 1 143 VAL 143 139  139  VAL VAL A . n 
A 1 144 PRO 144 140  140  PRO PRO A . n 
A 1 145 LEU 145 141  141  LEU LEU A . n 
A 1 146 ARG 146 142  142  ARG ARG A . n 
A 1 147 TYR 147 143  143  TYR TYR A . n 
A 1 148 ASN 148 144  144  ASN ASN A . n 
A 1 149 ARG 149 145  145  ARG ARG A . n 
A 1 150 GLN 150 146  146  GLN GLN A . n 
A 1 151 GLY 151 147  147  GLY GLY A . n 
A 1 152 GLY 152 148  148  GLY GLY A . n 
A 1 153 SER 153 149  149  SER SER A . n 
A 1 154 ARG 154 150  150  ARG ARG A . n 
A 1 155 ARG 155 151  151  ARG ARG A . n 
A 1 156 GLN 156 152  152  GLN GLN A . n 
A 1 157 LEU 157 153  153  LEU LEU A . n 
A 1 158 LEU 158 154  154  LEU LEU A . n 
A 1 159 LEU 159 155  155  LEU LEU A . n 
A 1 160 ILE 160 156  156  ILE ILE A . n 
A 1 161 GLY 161 157  157  GLY GLY A . n 
A 1 162 ALA 162 158  158  ALA ALA A . n 
A 1 163 THR 163 159  159  THR THR A . n 
A 1 164 TRP 164 160  160  TRP TRP A . n 
A 1 165 LEU 165 161  161  LEU LEU A . n 
A 1 166 LEU 166 162  162  LEU LEU A . n 
A 1 167 SER 167 163  163  SER SER A . n 
A 1 168 ALA 168 164  164  ALA ALA A . n 
A 1 169 ALA 169 165  165  ALA ALA A . n 
A 1 170 VAL 170 166  166  VAL VAL A . n 
A 1 171 ALA 171 167  167  ALA ALA A . n 
A 1 172 ALA 172 168  168  ALA ALA A . n 
A 1 173 PRO 173 169  169  PRO PRO A . n 
A 1 174 VAL 174 170  170  VAL VAL A . n 
A 1 175 LEU 175 171  171  LEU LEU A . n 
A 1 176 CYS 176 172  172  CYS CYS A . n 
A 1 177 GLY 177 173  173  GLY GLY A . n 
A 1 178 LEU 178 174  174  LEU LEU A . n 
A 1 179 ASN 179 175  175  ASN ASN A . n 
A 1 180 ASP 180 176  176  ASP ASP A . n 
A 1 181 VAL 181 177  ?    ?   ?   A . n 
A 1 182 ARG 182 178  ?    ?   ?   A . n 
A 1 183 GLY 183 179  ?    ?   ?   A . n 
A 1 184 ARG 184 180  ?    ?   ?   A . n 
A 1 185 ASP 185 181  ?    ?   ?   A . n 
A 1 186 PRO 186 182  182  PRO PRO A . n 
A 1 187 ALA 187 183  183  ALA ALA A . n 
A 1 188 VAL 188 184  184  VAL VAL A . n 
A 1 189 CYS 189 185  185  CYS CYS A . n 
A 1 190 ARG 190 186  186  ARG ARG A . n 
A 1 191 LEU 191 187  187  LEU LEU A . n 
A 1 192 GLU 192 188  188  GLU GLU A . n 
A 1 193 ASP 193 189  189  ASP ASP A . n 
A 1 194 ARG 194 190  190  ARG ARG A . n 
A 1 195 ASP 195 191  191  ASP ASP A . n 
A 1 196 TYR 196 192  192  TYR TYR A . n 
A 1 197 VAL 197 193  193  VAL VAL A . n 
A 1 198 VAL 198 194  194  VAL VAL A . n 
A 1 199 TYR 199 195  195  TYR TYR A . n 
A 1 200 SER 200 196  196  SER SER A . n 
A 1 201 SER 201 197  197  SER SER A . n 
A 1 202 VAL 202 198  198  VAL VAL A . n 
A 1 203 CYS 203 199  199  CYS CYS A . n 
A 1 204 SER 204 200  200  SER SER A . n 
A 1 205 PHE 205 201  201  PHE PHE A . n 
A 1 206 PHE 206 202  202  PHE PHE A . n 
A 1 207 LEU 207 203  203  LEU LEU A . n 
A 1 208 PRO 208 204  204  PRO PRO A . n 
A 1 209 CYS 209 205  205  CYS CYS A . n 
A 1 210 PRO 210 206  206  PRO PRO A . n 
A 1 211 LEU 211 207  207  LEU LEU A . n 
A 1 212 MET 212 208  208  MET MET A . n 
A 1 213 LEU 213 209  209  LEU LEU A . n 
A 1 214 LEU 214 210  210  LEU LEU A . n 
A 1 215 LEU 215 211  211  LEU LEU A . n 
A 1 216 TYR 216 212  212  TYR TYR A . n 
A 1 217 TRP 217 213  213  TRP TRP A . n 
A 1 218 ALA 218 214  214  ALA ALA A . n 
A 1 219 THR 219 215  215  THR THR A . n 
A 1 220 PHE 220 216  216  PHE PHE A . n 
A 1 221 ARG 221 217  217  ARG ARG A . n 
A 1 222 GLY 222 218  218  GLY GLY A . n 
A 1 223 LEU 223 219  219  LEU LEU A . n 
A 1 224 GLN 224 220  220  GLN GLN A . n 
A 1 225 ARG 225 221  221  ARG ARG A . n 
A 1 226 TRP 226 222  222  TRP TRP A . n 
A 1 227 GLU 227 223  223  GLU GLU A . n 
A 1 228 VAL 228 224  224  VAL VAL A . n 
A 1 229 ALA 229 225  225  ALA ALA A . n 
A 1 230 ARG 230 226  226  ARG ARG A . n 
A 1 231 ARG 231 227  227  ARG ARG A . n 
A 1 232 ALA 232 1001 1001 ALA ALA A . n 
A 1 233 ASP 233 1002 1002 ASP ASP A . n 
A 1 234 LEU 234 1003 1003 LEU LEU A . n 
A 1 235 GLU 235 1004 1004 GLU GLU A . n 
A 1 236 ASP 236 1005 1005 ASP ASP A . n 
A 1 237 ASN 237 1006 1006 ASN ASN A . n 
A 1 238 TRP 238 1007 1007 TRP TRP A . n 
A 1 239 GLU 239 1008 1008 GLU GLU A . n 
A 1 240 THR 240 1009 1009 THR THR A . n 
A 1 241 LEU 241 1010 1010 LEU LEU A . n 
A 1 242 ASN 242 1011 1011 ASN ASN A . n 
A 1 243 ASP 243 1012 1012 ASP ASP A . n 
A 1 244 ASN 244 1013 1013 ASN ASN A . n 
A 1 245 LEU 245 1014 1014 LEU LEU A . n 
A 1 246 LYS 246 1015 1015 LYS LYS A . n 
A 1 247 VAL 247 1016 1016 VAL VAL A . n 
A 1 248 ILE 248 1017 1017 ILE ILE A . n 
A 1 249 GLU 249 1018 1018 GLU GLU A . n 
A 1 250 LYS 250 1019 1019 LYS LYS A . n 
A 1 251 ALA 251 1020 1020 ALA ALA A . n 
A 1 252 ASP 252 1021 1021 ASP ASP A . n 
A 1 253 ASN 253 1022 1022 ASN ASN A . n 
A 1 254 ALA 254 1023 1023 ALA ALA A . n 
A 1 255 ALA 255 1024 1024 ALA ALA A . n 
A 1 256 GLN 256 1025 1025 GLN GLN A . n 
A 1 257 VAL 257 1026 1026 VAL VAL A . n 
A 1 258 LYS 258 1027 1027 LYS LYS A . n 
A 1 259 ASP 259 1028 1028 ASP ASP A . n 
A 1 260 ALA 260 1029 1029 ALA ALA A . n 
A 1 261 LEU 261 1030 1030 LEU LEU A . n 
A 1 262 THR 262 1031 1031 THR THR A . n 
A 1 263 LYS 263 1032 1032 LYS LYS A . n 
A 1 264 MET 264 1033 1033 MET MET A . n 
A 1 265 ARG 265 1034 1034 ARG ARG A . n 
A 1 266 ALA 266 1035 1035 ALA ALA A . n 
A 1 267 ALA 267 1036 1036 ALA ALA A . n 
A 1 268 ALA 268 1037 1037 ALA ALA A . n 
A 1 269 LEU 269 1038 1038 LEU LEU A . n 
A 1 270 ASP 270 1039 1039 ASP ASP A . n 
A 1 271 ALA 271 1040 1040 ALA ALA A . n 
A 1 272 GLN 272 1041 1041 GLN GLN A . n 
A 1 273 LYS 273 1042 1042 LYS LYS A . n 
A 1 274 ALA 274 1043 1043 ALA ALA A . n 
A 1 275 THR 275 1044 1044 THR THR A . n 
A 1 276 PRO 276 1045 1045 PRO PRO A . n 
A 1 277 PRO 277 1046 1046 PRO PRO A . n 
A 1 278 LYS 278 1047 1047 LYS LYS A . n 
A 1 279 LEU 279 1048 1048 LEU LEU A . n 
A 1 280 GLU 280 1049 1049 GLU GLU A . n 
A 1 281 ASP 281 1050 1050 ASP ASP A . n 
A 1 282 LYS 282 1051 1051 LYS LYS A . n 
A 1 283 SER 283 1052 1052 SER SER A . n 
A 1 284 PRO 284 1053 1053 PRO PRO A . n 
A 1 285 ASP 285 1054 ?    ?   ?   A . n 
A 1 286 SER 286 1055 ?    ?   ?   A . n 
A 1 287 PRO 287 1056 1056 PRO PRO A . n 
A 1 288 GLU 288 1057 1057 GLU GLU A . n 
A 1 289 MET 289 1058 1058 MET MET A . n 
A 1 290 LYS 290 1059 1059 LYS LYS A . n 
A 1 291 ASP 291 1060 1060 ASP ASP A . n 
A 1 292 PHE 292 1061 1061 PHE PHE A . n 
A 1 293 ARG 293 1062 1062 ARG ARG A . n 
A 1 294 HIS 294 1063 1063 HIS HIS A . n 
A 1 295 GLY 295 1064 1064 GLY GLY A . n 
A 1 296 PHE 296 1065 1065 PHE PHE A . n 
A 1 297 ASP 297 1066 1066 ASP ASP A . n 
A 1 298 ILE 298 1067 1067 ILE ILE A . n 
A 1 299 LEU 299 1068 1068 LEU LEU A . n 
A 1 300 VAL 300 1069 1069 VAL VAL A . n 
A 1 301 GLY 301 1070 1070 GLY GLY A . n 
A 1 302 GLN 302 1071 1071 GLN GLN A . n 
A 1 303 ILE 303 1072 1072 ILE ILE A . n 
A 1 304 ASP 304 1073 1073 ASP ASP A . n 
A 1 305 ASP 305 1074 1074 ASP ASP A . n 
A 1 306 ALA 306 1075 1075 ALA ALA A . n 
A 1 307 LEU 307 1076 1076 LEU LEU A . n 
A 1 308 LYS 308 1077 1077 LYS LYS A . n 
A 1 309 LEU 309 1078 1078 LEU LEU A . n 
A 1 310 ALA 310 1079 1079 ALA ALA A . n 
A 1 311 ASN 311 1080 1080 ASN ASN A . n 
A 1 312 GLU 312 1081 1081 GLU GLU A . n 
A 1 313 GLY 313 1082 1082 GLY GLY A . n 
A 1 314 LYS 314 1083 1083 LYS LYS A . n 
A 1 315 VAL 315 1084 1084 VAL VAL A . n 
A 1 316 LYS 316 1085 1085 LYS LYS A . n 
A 1 317 GLU 317 1086 1086 GLU GLU A . n 
A 1 318 ALA 318 1087 1087 ALA ALA A . n 
A 1 319 GLN 319 1088 1088 GLN GLN A . n 
A 1 320 ALA 320 1089 1089 ALA ALA A . n 
A 1 321 ALA 321 1090 1090 ALA ALA A . n 
A 1 322 ALA 322 1091 1091 ALA ALA A . n 
A 1 323 GLU 323 1092 1092 GLU GLU A . n 
A 1 324 GLN 324 1093 1093 GLN GLN A . n 
A 1 325 LEU 325 1094 1094 LEU LEU A . n 
A 1 326 LYS 326 1095 1095 LYS LYS A . n 
A 1 327 THR 327 1096 1096 THR THR A . n 
A 1 328 THR 328 1097 1097 THR THR A . n 
A 1 329 ARG 329 1098 1098 ARG ARG A . n 
A 1 330 ASN 330 1099 1099 ASN ASN A . n 
A 1 331 ALA 331 1100 1100 ALA ALA A . n 
A 1 332 TYR 332 1101 1101 TYR TYR A . n 
A 1 333 ILE 333 1102 1102 ILE ILE A . n 
A 1 334 GLN 334 1103 1103 GLN GLN A . n 
A 1 335 LYS 335 1104 1104 LYS LYS A . n 
A 1 336 TYR 336 1105 1105 TYR TYR A . n 
A 1 337 LEU 337 1106 1106 LEU LEU A . n 
A 1 338 ALA 338 383  383  ALA ALA A . n 
A 1 339 LYS 339 384  384  LYS LYS A . n 
A 1 340 ILE 340 385  385  ILE ILE A . n 
A 1 341 THR 341 386  386  THR THR A . n 
A 1 342 GLY 342 387  387  GLY GLY A . n 
A 1 343 ARG 343 388  388  ARG ARG A . n 
A 1 344 GLU 344 389  389  GLU GLU A . n 
A 1 345 ARG 345 390  390  ARG ARG A . n 
A 1 346 LYS 346 391  391  LYS LYS A . n 
A 1 347 ALA 347 392  392  ALA ALA A . n 
A 1 348 MET 348 393  393  MET MET A . n 
A 1 349 ARG 349 394  394  ARG ARG A . n 
A 1 350 VAL 350 395  395  VAL VAL A . n 
A 1 351 LEU 351 396  396  LEU LEU A . n 
A 1 352 PRO 352 397  397  PRO PRO A . n 
A 1 353 VAL 353 398  398  VAL VAL A . n 
A 1 354 VAL 354 399  399  VAL VAL A . n 
A 1 355 VAL 355 400  400  VAL VAL A . n 
A 1 356 GLY 356 401  401  GLY GLY A . n 
A 1 357 ALA 357 402  402  ALA ALA A . n 
A 1 358 PHE 358 403  403  PHE PHE A . n 
A 1 359 LEU 359 404  404  LEU LEU A . n 
A 1 360 LEU 360 405  405  LEU LEU A . n 
A 1 361 CYS 361 406  406  CYS CYS A . n 
A 1 362 TRP 362 407  407  TRP TRP A . n 
A 1 363 THR 363 408  408  THR THR A . n 
A 1 364 PRO 364 409  409  PRO PRO A . n 
A 1 365 PHE 365 410  410  PHE PHE A . n 
A 1 366 PHE 366 411  411  PHE PHE A . n 
A 1 367 VAL 367 412  412  VAL VAL A . n 
A 1 368 VAL 368 413  413  VAL VAL A . n 
A 1 369 HIS 369 414  414  HIS HIS A . n 
A 1 370 ILE 370 415  415  ILE ILE A . n 
A 1 371 THR 371 416  416  THR THR A . n 
A 1 372 GLN 372 417  417  GLN GLN A . n 
A 1 373 ALA 373 418  418  ALA ALA A . n 
A 1 374 LEU 374 419  419  LEU LEU A . n 
A 1 375 CYS 375 420  420  CYS CYS A . n 
A 1 376 PRO 376 421  421  PRO PRO A . n 
A 1 377 ALA 377 422  422  ALA ALA A . n 
A 1 378 CYS 378 423  423  CYS CYS A . n 
A 1 379 SER 379 424  424  SER SER A . n 
A 1 380 VAL 380 425  425  VAL VAL A . n 
A 1 381 PRO 381 426  426  PRO PRO A . n 
A 1 382 PRO 382 427  427  PRO PRO A . n 
A 1 383 ARG 383 428  428  ARG ARG A . n 
A 1 384 LEU 384 429  429  LEU LEU A . n 
A 1 385 VAL 385 430  430  VAL VAL A . n 
A 1 386 SER 386 431  431  SER SER A . n 
A 1 387 ALA 387 432  432  ALA ALA A . n 
A 1 388 VAL 388 433  433  VAL VAL A . n 
A 1 389 THR 389 434  434  THR THR A . n 
A 1 390 TRP 390 435  435  TRP TRP A . n 
A 1 391 LEU 391 436  436  LEU LEU A . n 
A 1 392 GLY 392 437  437  GLY GLY A . n 
A 1 393 TYR 393 438  438  TYR TYR A . n 
A 1 394 VAL 394 439  439  VAL VAL A . n 
A 1 395 ASN 395 440  440  ASN ASN A . n 
A 1 396 SER 396 441  441  SER SER A . n 
A 1 397 ALA 397 442  442  ALA ALA A . n 
A 1 398 LEU 398 443  443  LEU LEU A . n 
A 1 399 ASN 399 444  444  ASN ASN A . n 
A 1 400 PRO 400 445  445  PRO PRO A . n 
A 1 401 VAL 401 446  446  VAL VAL A . n 
A 1 402 ILE 402 447  447  ILE ILE A . n 
A 1 403 TYR 403 448  448  TYR TYR A . n 
A 1 404 THR 404 449  449  THR THR A . n 
A 1 405 VAL 405 450  450  VAL VAL A . n 
A 1 406 PHE 406 451  451  PHE PHE A . n 
A 1 407 ASN 407 452  452  ASN ASN A . n 
A 1 408 ALA 408 453  453  ALA ALA A . n 
A 1 409 GLU 409 454  454  GLU GLU A . n 
A 1 410 PHE 410 455  455  PHE PHE A . n 
A 1 411 ARG 411 456  456  ARG ARG A . n 
A 1 412 ASN 412 457  457  ASN ASN A . n 
A 1 413 VAL 413 458  458  VAL VAL A . n 
A 1 414 PHE 414 459  459  PHE PHE A . n 
A 1 415 ARG 415 460  460  ARG ARG A . n 
A 1 416 LYS 416 461  461  LYS LYS A . n 
A 1 417 ALA 417 462  462  ALA ALA A . n 
A 1 418 LEU 418 463  ?    ?   ?   A . n 
A 1 419 ARG 419 464  ?    ?   ?   A . n 
A 1 420 ALA 420 465  ?    ?   ?   A . n 
A 1 421 CYS 421 466  ?    ?   ?   A . n 
A 1 422 CYS 422 467  ?    ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 AQD 1  1201 1    AQD DRG A . 
C 3 PO4 1  1202 1    PO4 PO4 A . 
D 3 PO4 1  1203 2    PO4 PO4 A . 
E 3 PO4 1  1204 3    PO4 PO4 A . 
F 4 OLA 1  1205 2009 OLA OLA A . 
G 4 OLA 1  1206 2010 OLA OLA A . 
H 4 OLA 1  1207 2011 OLA OLA A . 
I 4 OLA 1  1208 2012 OLA OLA A . 
J 4 OLA 1  1209 2013 OLA OLA A . 
K 4 OLA 1  1210 2014 OLA OLA A . 
L 4 OLA 1  1211 2015 OLA OLA A . 
M 4 OLA 1  1212 2017 OLA OLA A . 
N 4 OLA 1  1213 2018 OLA OLA A . 
O 5 PEG 1  1214 2013 PEG PEG A . 
P 5 PEG 1  1215 2014 PEG PEG A . 
Q 5 PEG 1  1216 2017 PEG PEG A . 
R 5 PEG 1  1217 2018 PEG PEG A . 
S 5 PEG 1  1218 2019 PEG PEG A . 
T 5 PEG 1  1219 2020 PEG PEG A . 
U 5 PEG 1  1220 2021 PEG PEG A . 
V 5 PEG 1  1221 2022 PEG PEG A . 
W 5 PEG 1  1222 2023 PEG PEG A . 
X 6 GOL 1  1223 1    GOL GOL A . 
Y 7 HOH 1  1301 127  HOH HOH A . 
Y 7 HOH 2  1302 26   HOH HOH A . 
Y 7 HOH 3  1303 34   HOH HOH A . 
Y 7 HOH 4  1304 115  HOH HOH A . 
Y 7 HOH 5  1305 73   HOH HOH A . 
Y 7 HOH 6  1306 130  HOH HOH A . 
Y 7 HOH 7  1307 16   HOH HOH A . 
Y 7 HOH 8  1308 112  HOH HOH A . 
Y 7 HOH 9  1309 56   HOH HOH A . 
Y 7 HOH 10 1310 96   HOH HOH A . 
Y 7 HOH 11 1311 52   HOH HOH A . 
Y 7 HOH 12 1312 64   HOH HOH A . 
Y 7 HOH 13 1313 33   HOH HOH A . 
Y 7 HOH 14 1314 32   HOH HOH A . 
Y 7 HOH 15 1315 100  HOH HOH A . 
Y 7 HOH 16 1316 92   HOH HOH A . 
Y 7 HOH 17 1317 105  HOH HOH A . 
Y 7 HOH 18 1318 1    HOH HOH A . 
Y 7 HOH 19 1319 39   HOH HOH A . 
Y 7 HOH 20 1320 17   HOH HOH A . 
Y 7 HOH 21 1321 74   HOH HOH A . 
Y 7 HOH 22 1322 103  HOH HOH A . 
Y 7 HOH 23 1323 63   HOH HOH A . 
Y 7 HOH 24 1324 7    HOH HOH A . 
Y 7 HOH 25 1325 108  HOH HOH A . 
Y 7 HOH 26 1326 19   HOH HOH A . 
Y 7 HOH 27 1327 84   HOH HOH A . 
Y 7 HOH 28 1328 15   HOH HOH A . 
Y 7 HOH 29 1329 125  HOH HOH A . 
Y 7 HOH 30 1330 22   HOH HOH A . 
Y 7 HOH 31 1331 41   HOH HOH A . 
Y 7 HOH 32 1332 72   HOH HOH A . 
Y 7 HOH 33 1333 89   HOH HOH A . 
Y 7 HOH 34 1334 123  HOH HOH A . 
Y 7 HOH 35 1335 95   HOH HOH A . 
Y 7 HOH 36 1336 49   HOH HOH A . 
Y 7 HOH 37 1337 119  HOH HOH A . 
Y 7 HOH 38 1338 5    HOH HOH A . 
Y 7 HOH 39 1339 97   HOH HOH A . 
Y 7 HOH 40 1340 44   HOH HOH A . 
Y 7 HOH 41 1341 83   HOH HOH A . 
Y 7 HOH 42 1342 86   HOH HOH A . 
Y 7 HOH 43 1343 82   HOH HOH A . 
Y 7 HOH 44 1344 90   HOH HOH A . 
Y 7 HOH 45 1345 37   HOH HOH A . 
Y 7 HOH 46 1346 8    HOH HOH A . 
Y 7 HOH 47 1347 114  HOH HOH A . 
Y 7 HOH 48 1348 43   HOH HOH A . 
Y 7 HOH 49 1349 28   HOH HOH A . 
Y 7 HOH 50 1350 25   HOH HOH A . 
Y 7 HOH 51 1351 23   HOH HOH A . 
Y 7 HOH 52 1352 69   HOH HOH A . 
Y 7 HOH 53 1353 11   HOH HOH A . 
Y 7 HOH 54 1354 54   HOH HOH A . 
Y 7 HOH 55 1355 36   HOH HOH A . 
Y 7 HOH 56 1356 13   HOH HOH A . 
Y 7 HOH 57 1357 60   HOH HOH A . 
Y 7 HOH 58 1358 29   HOH HOH A . 
Y 7 HOH 59 1359 46   HOH HOH A . 
Y 7 HOH 60 1360 38   HOH HOH A . 
Y 7 HOH 61 1361 67   HOH HOH A . 
Y 7 HOH 62 1362 68   HOH HOH A . 
Y 7 HOH 63 1363 118  HOH HOH A . 
Y 7 HOH 64 1364 14   HOH HOH A . 
Y 7 HOH 65 1365 106  HOH HOH A . 
Y 7 HOH 66 1366 12   HOH HOH A . 
Y 7 HOH 67 1367 70   HOH HOH A . 
Y 7 HOH 68 1368 71   HOH HOH A . 
Y 7 HOH 69 1369 24   HOH HOH A . 
Y 7 HOH 70 1370 85   HOH HOH A . 
Y 7 HOH 71 1371 129  HOH HOH A . 
Y 7 HOH 72 1372 10   HOH HOH A . 
Y 7 HOH 73 1373 107  HOH HOH A . 
Y 7 HOH 74 1374 18   HOH HOH A . 
Y 7 HOH 75 1375 91   HOH HOH A . 
Y 7 HOH 76 1376 27   HOH HOH A . 
Y 7 HOH 77 1377 57   HOH HOH A . 
Y 7 HOH 78 1378 101  HOH HOH A . 
Y 7 HOH 79 1379 126  HOH HOH A . 
Y 7 HOH 80 1380 50   HOH HOH A . 
Y 7 HOH 81 1381 35   HOH HOH A . 
Y 7 HOH 82 1382 122  HOH HOH A . 
Y 7 HOH 83 1383 121  HOH HOH A . 
Y 7 HOH 84 1384 113  HOH HOH A . 
Y 7 HOH 85 1385 81   HOH HOH A . 
Y 7 HOH 86 1386 21   HOH HOH A . 
Y 7 HOH 87 1387 78   HOH HOH A . 
Y 7 HOH 88 1388 80   HOH HOH A . 
Y 7 HOH 89 1389 111  HOH HOH A . 
Y 7 HOH 90 1390 20   HOH HOH A . 
Y 7 HOH 91 1391 77   HOH HOH A . 
Y 7 HOH 92 1392 48   HOH HOH A . 
Y 7 HOH 93 1393 128  HOH HOH A . 
Y 7 HOH 94 1394 102  HOH HOH A . 
Y 7 HOH 95 1395 98   HOH HOH A . 
Y 7 HOH 96 1396 76   HOH HOH A . 
Y 7 HOH 97 1397 4    HOH HOH A . 
Y 7 HOH 98 1398 110  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7270  ? 
1 MORE         10    ? 
1 'SSA (A^2)'  19540 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A PO4 1203 ? D PO4 . 
2 1 A PO4 1204 ? E PO4 . 
3 1 A HOH 1393 ? Y HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-10-18 
2 'Structure model' 1 1 2017-11-01 
3 'Structure model' 1 2 2018-01-17 
4 'Structure model' 1 3 2019-11-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Author supporting evidence' 
3 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation           
2 2 'Structure model' citation_author    
3 3 'Structure model' pdbx_audit_support 
4 4 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'                 
2 2 'Structure model' '_citation.page_first'                     
3 2 'Structure model' '_citation.page_last'                      
4 2 'Structure model' '_citation.pdbx_database_id_PubMed'        
5 2 'Structure model' '_citation.title'                          
6 2 'Structure model' '_citation_author.name'                    
7 3 'Structure model' '_pdbx_audit_support.funding_organization' 
8 4 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined -17.8857 1.1583   -13.2564 0.2301 0.2652 0.2409 -0.0315 -0.0296 0.0189  1.6322 2.0760 1.8375 
-0.7391 0.2226 -0.1478 0.0449 0.1064  -0.1399 0.0656  -0.0783 0.2173 -0.0491 0.0899  -0.1163 
'X-RAY DIFFRACTION' 2 ? refined -15.9784 -40.6783 -10.9566 0.5216 0.3652 0.5651 -0.0160 0.0349  -0.0738 6.6860 8.2508 2.0694 
6.4029  0.8949 0.9673  0.0204 -0.1074 0.2054  -0.2545 0.8277  0.4157 0.5227  -0.1720 0.1797  
'X-RAY DIFFRACTION' 3 ? refined -11.7775 0.5159   -21.6447 0.2321 0.2682 0.2217 -0.0097 -0.0011 -0.0141 2.4309 3.0959 1.9428 
-0.5832 0.3195 0.0197  0.0860 -0.0366 -0.0326 0.1057  -0.2739 0.2063 -0.2537 0.2583  -0.0717 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 34  A 227 
;chain 'A' and (resid 34 through 227 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 0   A 0   
;chain 'A' and (resid 1001 through 1106 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 383 A 462 
;chain 'A' and (resid 383 through 462 )
;
? ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? .    1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .    5 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    PHE 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     201 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -136.08 
_pdbx_validate_torsion.psi             -61.30 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 62   ? CG  ? A GLU 66  CG  
2   1 Y 1 A GLU 62   ? CD  ? A GLU 66  CD  
3   1 Y 1 A GLU 62   ? OE1 ? A GLU 66  OE1 
4   1 Y 1 A GLU 62   ? OE2 ? A GLU 66  OE2 
5   1 Y 1 A ARG 63   ? CG  ? A ARG 67  CG  
6   1 Y 1 A ARG 63   ? CD  ? A ARG 67  CD  
7   1 Y 1 A ARG 63   ? NE  ? A ARG 67  NE  
8   1 Y 1 A ARG 63   ? CZ  ? A ARG 67  CZ  
9   1 Y 1 A ARG 63   ? NH1 ? A ARG 67  NH1 
10  1 Y 1 A ARG 63   ? NH2 ? A ARG 67  NH2 
11  1 Y 1 A GLN 97   ? CG  ? A GLN 101 CG  
12  1 Y 1 A GLN 97   ? CD  ? A GLN 101 CD  
13  1 Y 1 A GLN 97   ? OE1 ? A GLN 101 OE1 
14  1 Y 1 A GLN 97   ? NE2 ? A GLN 101 NE2 
15  1 Y 1 A LEU 102  ? CG  ? A LEU 106 CG  
16  1 Y 1 A LEU 102  ? CD1 ? A LEU 106 CD1 
17  1 Y 1 A LEU 102  ? CD2 ? A LEU 106 CD2 
18  1 Y 1 A GLN 146  ? CG  ? A GLN 150 CG  
19  1 Y 1 A GLN 146  ? CD  ? A GLN 150 CD  
20  1 Y 1 A GLN 146  ? OE1 ? A GLN 150 OE1 
21  1 Y 1 A GLN 146  ? NE2 ? A GLN 150 NE2 
22  1 Y 1 A ARG 150  ? NE  ? A ARG 154 NE  
23  1 Y 1 A ARG 150  ? CZ  ? A ARG 154 CZ  
24  1 Y 1 A ARG 150  ? NH1 ? A ARG 154 NH1 
25  1 Y 1 A ARG 150  ? NH2 ? A ARG 154 NH2 
26  1 Y 1 A ASP 176  ? CG  ? A ASP 180 CG  
27  1 Y 1 A ASP 176  ? OD1 ? A ASP 180 OD1 
28  1 Y 1 A ASP 176  ? OD2 ? A ASP 180 OD2 
29  1 Y 1 A ARG 217  ? CD  ? A ARG 221 CD  
30  1 Y 1 A ARG 217  ? NE  ? A ARG 221 NE  
31  1 Y 1 A ARG 217  ? CZ  ? A ARG 221 CZ  
32  1 Y 1 A ARG 217  ? NH1 ? A ARG 221 NH1 
33  1 Y 1 A ARG 217  ? NH2 ? A ARG 221 NH2 
34  1 Y 1 A ASP 1012 ? CG  ? A ASP 243 CG  
35  1 Y 1 A ASP 1012 ? OD1 ? A ASP 243 OD1 
36  1 Y 1 A ASP 1012 ? OD2 ? A ASP 243 OD2 
37  1 Y 1 A LYS 1015 ? CG  ? A LYS 246 CG  
38  1 Y 1 A LYS 1015 ? CD  ? A LYS 246 CD  
39  1 Y 1 A LYS 1015 ? CE  ? A LYS 246 CE  
40  1 Y 1 A LYS 1015 ? NZ  ? A LYS 246 NZ  
41  1 Y 1 A LYS 1019 ? CE  ? A LYS 250 CE  
42  1 Y 1 A LYS 1019 ? NZ  ? A LYS 250 NZ  
43  1 Y 1 A ASP 1021 ? CG  ? A ASP 252 CG  
44  1 Y 1 A ASP 1021 ? OD1 ? A ASP 252 OD1 
45  1 Y 1 A ASP 1021 ? OD2 ? A ASP 252 OD2 
46  1 Y 1 A LYS 1047 ? CD  ? A LYS 278 CD  
47  1 Y 1 A LYS 1047 ? CE  ? A LYS 278 CE  
48  1 Y 1 A LYS 1047 ? NZ  ? A LYS 278 NZ  
49  1 Y 1 A LYS 1051 ? CE  ? A LYS 282 CE  
50  1 Y 1 A LYS 1051 ? NZ  ? A LYS 282 NZ  
51  1 Y 1 A LYS 1059 ? CG  ? A LYS 290 CG  
52  1 Y 1 A LYS 1059 ? CD  ? A LYS 290 CD  
53  1 Y 1 A LYS 1059 ? CE  ? A LYS 290 CE  
54  1 Y 1 A LYS 1059 ? NZ  ? A LYS 290 NZ  
55  1 Y 1 A PHE 1061 ? CG  ? A PHE 292 CG  
56  1 Y 1 A PHE 1061 ? CD1 ? A PHE 292 CD1 
57  1 Y 1 A PHE 1061 ? CD2 ? A PHE 292 CD2 
58  1 Y 1 A PHE 1061 ? CE1 ? A PHE 292 CE1 
59  1 Y 1 A PHE 1061 ? CE2 ? A PHE 292 CE2 
60  1 Y 1 A PHE 1061 ? CZ  ? A PHE 292 CZ  
61  1 Y 1 A ARG 1062 ? NE  ? A ARG 293 NE  
62  1 Y 1 A ARG 1062 ? CZ  ? A ARG 293 CZ  
63  1 Y 1 A ARG 1062 ? NH1 ? A ARG 293 NH1 
64  1 Y 1 A ARG 1062 ? NH2 ? A ARG 293 NH2 
65  1 Y 1 A GLU 1092 ? CG  ? A GLU 323 CG  
66  1 Y 1 A GLU 1092 ? CD  ? A GLU 323 CD  
67  1 Y 1 A GLU 1092 ? OE1 ? A GLU 323 OE1 
68  1 Y 1 A GLU 1092 ? OE2 ? A GLU 323 OE2 
69  1 Y 1 A GLN 1093 ? CG  ? A GLN 324 CG  
70  1 Y 1 A GLN 1093 ? CD  ? A GLN 324 CD  
71  1 Y 1 A GLN 1093 ? OE1 ? A GLN 324 OE1 
72  1 Y 1 A GLN 1093 ? NE2 ? A GLN 324 NE2 
73  1 Y 1 A THR 1096 ? OG1 ? A THR 327 OG1 
74  1 Y 1 A THR 1096 ? CG2 ? A THR 327 CG2 
75  1 Y 1 A ARG 1098 ? CG  ? A ARG 329 CG  
76  1 Y 1 A ARG 1098 ? CD  ? A ARG 329 CD  
77  1 Y 1 A ARG 1098 ? NE  ? A ARG 329 NE  
78  1 Y 1 A ARG 1098 ? CZ  ? A ARG 329 CZ  
79  1 Y 1 A ARG 1098 ? NH1 ? A ARG 329 NH1 
80  1 Y 1 A ARG 1098 ? NH2 ? A ARG 329 NH2 
81  1 Y 1 A TYR 1101 ? CG  ? A TYR 332 CG  
82  1 Y 1 A TYR 1101 ? CD1 ? A TYR 332 CD1 
83  1 Y 1 A TYR 1101 ? CD2 ? A TYR 332 CD2 
84  1 Y 1 A TYR 1101 ? CE1 ? A TYR 332 CE1 
85  1 Y 1 A TYR 1101 ? CE2 ? A TYR 332 CE2 
86  1 Y 1 A TYR 1101 ? CZ  ? A TYR 332 CZ  
87  1 Y 1 A TYR 1101 ? OH  ? A TYR 332 OH  
88  1 Y 1 A LYS 1104 ? CG  ? A LYS 335 CG  
89  1 Y 1 A LYS 1104 ? CD  ? A LYS 335 CD  
90  1 Y 1 A LYS 1104 ? CE  ? A LYS 335 CE  
91  1 Y 1 A LYS 1104 ? NZ  ? A LYS 335 NZ  
92  1 Y 1 A TYR 1105 ? CG  ? A TYR 336 CG  
93  1 Y 1 A TYR 1105 ? CD1 ? A TYR 336 CD1 
94  1 Y 1 A TYR 1105 ? CD2 ? A TYR 336 CD2 
95  1 Y 1 A TYR 1105 ? CE1 ? A TYR 336 CE1 
96  1 Y 1 A TYR 1105 ? CE2 ? A TYR 336 CE2 
97  1 Y 1 A TYR 1105 ? CZ  ? A TYR 336 CZ  
98  1 Y 1 A TYR 1105 ? OH  ? A TYR 336 OH  
99  1 Y 1 A LYS 391  ? CG  ? A LYS 346 CG  
100 1 Y 1 A LYS 391  ? CD  ? A LYS 346 CD  
101 1 Y 1 A LYS 391  ? CE  ? A LYS 346 CE  
102 1 Y 1 A LYS 391  ? NZ  ? A LYS 346 NZ  
103 1 Y 1 A ARG 394  ? CG  ? A ARG 349 CG  
104 1 Y 1 A ARG 394  ? CD  ? A ARG 349 CD  
105 1 Y 1 A ARG 394  ? NE  ? A ARG 349 NE  
106 1 Y 1 A ARG 394  ? CZ  ? A ARG 349 CZ  
107 1 Y 1 A ARG 394  ? NH1 ? A ARG 349 NH1 
108 1 Y 1 A ARG 394  ? NH2 ? A ARG 349 NH2 
109 1 Y 1 A GLU 454  ? CG  ? A GLU 409 CG  
110 1 Y 1 A GLU 454  ? CD  ? A GLU 409 CD  
111 1 Y 1 A GLU 454  ? OE1 ? A GLU 409 OE1 
112 1 Y 1 A GLU 454  ? OE2 ? A GLU 409 OE2 
113 1 Y 1 A ARG 456  ? NE  ? A ARG 411 NE  
114 1 Y 1 A ARG 456  ? CZ  ? A ARG 411 CZ  
115 1 Y 1 A ARG 456  ? NH1 ? A ARG 411 NH1 
116 1 Y 1 A ARG 456  ? NH2 ? A ARG 411 NH2 
117 1 Y 1 A ASN 457  ? CG  ? A ASN 412 CG  
118 1 Y 1 A ASN 457  ? OD1 ? A ASN 412 OD1 
119 1 Y 1 A ASN 457  ? ND2 ? A ASN 412 ND2 
120 1 Y 1 A ARG 460  ? CG  ? A ARG 415 CG  
121 1 Y 1 A ARG 460  ? CD  ? A ARG 415 CD  
122 1 Y 1 A ARG 460  ? NE  ? A ARG 415 NE  
123 1 Y 1 A ARG 460  ? CZ  ? A ARG 415 CZ  
124 1 Y 1 A ARG 460  ? NH1 ? A ARG 415 NH1 
125 1 Y 1 A ARG 460  ? NH2 ? A ARG 415 NH2 
126 1 Y 1 A LYS 461  ? NZ  ? A LYS 416 NZ  
127 1 N 1 A OLA 1205 ? C16 ? F OLA 1   C16 
128 1 N 1 A OLA 1205 ? C17 ? F OLA 1   C17 
129 1 N 1 A OLA 1205 ? C18 ? F OLA 1   C18 
130 1 N 1 A OLA 1206 ? C16 ? G OLA 1   C16 
131 1 N 1 A OLA 1206 ? C17 ? G OLA 1   C17 
132 1 N 1 A OLA 1206 ? C18 ? G OLA 1   C18 
133 1 N 1 A OLA 1207 ? C16 ? H OLA 1   C16 
134 1 N 1 A OLA 1207 ? C17 ? H OLA 1   C17 
135 1 N 1 A OLA 1207 ? C18 ? H OLA 1   C18 
136 1 N 1 A OLA 1208 ? C16 ? I OLA 1   C16 
137 1 N 1 A OLA 1208 ? C17 ? I OLA 1   C17 
138 1 N 1 A OLA 1208 ? C18 ? I OLA 1   C18 
139 1 N 1 A OLA 1211 ? C15 ? L OLA 1   C15 
140 1 N 1 A OLA 1211 ? C16 ? L OLA 1   C16 
141 1 N 1 A OLA 1211 ? C17 ? L OLA 1   C17 
142 1 N 1 A OLA 1211 ? C18 ? L OLA 1   C18 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -3   ? A GLY 1   
2  1 Y 1 A GLY -2   ? A GLY 2   
3  1 Y 1 A THR -1   ? A THR 3   
4  1 Y 1 A THR 0    ? A THR 4   
5  1 Y 1 A MET 1    ? A MET 5   
6  1 Y 1 A GLY 2    ? A GLY 6   
7  1 Y 1 A ASN 3    ? A ASN 7   
8  1 Y 1 A ARG 4    ? A ARG 8   
9  1 Y 1 A SER 5    ? A SER 9   
10 1 Y 1 A THR 6    ? A THR 10  
11 1 Y 1 A ALA 7    ? A ALA 11  
12 1 Y 1 A ASP 8    ? A ASP 12  
13 1 Y 1 A ALA 9    ? A ALA 13  
14 1 Y 1 A ASP 10   ? A ASP 14  
15 1 Y 1 A GLY 11   ? A GLY 15  
16 1 Y 1 A LEU 12   ? A LEU 16  
17 1 Y 1 A LEU 13   ? A LEU 17  
18 1 Y 1 A ALA 14   ? A ALA 18  
19 1 Y 1 A GLY 15   ? A GLY 19  
20 1 Y 1 A ARG 16   ? A ARG 20  
21 1 Y 1 A GLY 17   ? A GLY 21  
22 1 Y 1 A PRO 18   ? A PRO 22  
23 1 Y 1 A ALA 19   ? A ALA 23  
24 1 Y 1 A ALA 20   ? A ALA 24  
25 1 Y 1 A GLY 21   ? A GLY 25  
26 1 Y 1 A ALA 22   ? A ALA 26  
27 1 Y 1 A SER 23   ? A SER 27  
28 1 Y 1 A ALA 24   ? A ALA 28  
29 1 Y 1 A GLY 25   ? A GLY 29  
30 1 Y 1 A ALA 26   ? A ALA 30  
31 1 Y 1 A SER 27   ? A SER 31  
32 1 Y 1 A ALA 28   ? A ALA 32  
33 1 Y 1 A GLY 29   ? A GLY 33  
34 1 Y 1 A LEU 30   ? A LEU 34  
35 1 Y 1 A ALA 31   ? A ALA 35  
36 1 Y 1 A GLY 32   ? A GLY 36  
37 1 Y 1 A GLN 33   ? A GLN 37  
38 1 Y 1 A VAL 177  ? A VAL 181 
39 1 Y 1 A ARG 178  ? A ARG 182 
40 1 Y 1 A GLY 179  ? A GLY 183 
41 1 Y 1 A ARG 180  ? A ARG 184 
42 1 Y 1 A ASP 181  ? A ASP 185 
43 1 Y 1 A ASP 1054 ? A ASP 285 
44 1 Y 1 A SER 1055 ? A SER 286 
45 1 Y 1 A LEU 463  ? A LEU 418 
46 1 Y 1 A ARG 464  ? A ARG 419 
47 1 Y 1 A ALA 465  ? A ALA 420 
48 1 Y 1 A CYS 466  ? A CYS 421 
49 1 Y 1 A CYS 467  ? A CYS 422 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of Mental Health (NIH/NIMH)' 'United States' R01MH112205 1 
'National Institutes of Health/National Institute of Mental Health (NIH/NIMH)' 'United States' HHSN-271-2013-00017-C 2 
'National Institutes of Health/National Institute of Mental Health (NIH/NIMH)' 'United States' U19MH082441 3 
'University of North Carolina'                                                 'United States' 
'UNC Michael Hooker Chair for Protein Therapeutics and Translational Proteomics' 4 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 Nemonapride             AQD 
3 'PHOSPHATE ION'         PO4 
4 'OLEIC ACID'            OLA 
5 'DI(HYDROXYETHYL)ETHER' PEG 
6 GLYCEROL                GOL 
7 water                   HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#