data_5WN0
# 
_entry.id   5WN0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5WN0         
WWPDB D_1000229179 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5WN0 
_pdbx_database_status.recvd_initial_deposition_date   2017-07-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Freudenthal, B.D.' 1 ? 
'Whitaker, A.M.'    2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            9 
_citation.language                  ? 
_citation.page_first                399 
_citation.page_last                 399 
_citation.title                     'Molecular snapshots of APE1 proofreading mismatches and removing DNA damage.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-017-02175-y 
_citation.pdbx_database_id_PubMed   29374164 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Whitaker, A.M.'    1 
primary 'Flynn, T.S.'       2 
primary 'Freudenthal, B.D.' 3 
# 
_cell.angle_alpha                  82.590 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   76.880 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  85.890 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5WN0 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     44.264 
_cell.length_a_esd                 ? 
_cell.length_b                     61.942 
_cell.length_b_esd                 ? 
_cell.length_c                     73.765 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5WN0 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA-(apurinic or apyrimidinic site) lyase'                                     31156.477 2  '3.1.-.-, 4.2.99.18' ? 
? ? 
2 polymer syn 
;DNA (5'-D(P*TP*CP*GP*AP*CP*GP*GP*AP*TP*CP*C)-3')
;
3334.186  1  ?                    ? ? ? 
3 polymer syn 
;DNA (5'-D(*GP*CP*TP*GP*AP*TP*GP*CP*GP*C)-3')
;
3061.004  1  ?                    ? ? ? 
4 polymer syn 
;DNA (5'-D(*GP*GP*AP*TP*CP*CP*GP*TP*CP*GP*AP*GP*CP*GP*CP*AP*TP*CP*AP*GP*C)-3')
;
6449.161  1  ?                    ? ? ? 
5 water   nat water                                                                           18.015    72 ?                    ? 
? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'APEX1, APEX nuclease,APEN,Apurinic-apyrimidinic endonuclease 1, APE-1, REF-1, Redox factor-1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAP
SDKEGYSGVGLLSRQAPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASR
KPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRL
DYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
;
;ALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAP
SDKEGYSGVGLLSRQAPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASR
KPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRL
DYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
;
A,B ? 
2 polydeoxyribonucleotide no no '(DT)(DC)(DG)(DA)(DC)(DG)(DG)(DA)(DT)(DC)(DC)' TCGACGGATCC C   ? 
3 polydeoxyribonucleotide no no '(DG)(DC)(DT)(DG)(DA)(DT)(DG)(DC)(DG)(DC)' GCTGATGCGC D   ? 
4 polydeoxyribonucleotide no no 
;(DG)(DG)(DA)(DT)(DC)(DC)(DG)(DT)(DC)(DG)(DA)(DG)(DC)(DG)(DC)(DA)(DT)(DC)(DA)(DG)
(DC)
;
GGATCCGTCGAGCGCATCAGC E   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   LEU n 
1 3   TYR n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   PRO n 
1 8   ASP n 
1 9   GLN n 
1 10  LYS n 
1 11  THR n 
1 12  SER n 
1 13  PRO n 
1 14  SER n 
1 15  GLY n 
1 16  LYS n 
1 17  PRO n 
1 18  ALA n 
1 19  THR n 
1 20  LEU n 
1 21  LYS n 
1 22  ILE n 
1 23  CYS n 
1 24  SER n 
1 25  TRP n 
1 26  ASN n 
1 27  VAL n 
1 28  ASP n 
1 29  GLY n 
1 30  LEU n 
1 31  ARG n 
1 32  ALA n 
1 33  TRP n 
1 34  ILE n 
1 35  LYS n 
1 36  LYS n 
1 37  LYS n 
1 38  GLY n 
1 39  LEU n 
1 40  ASP n 
1 41  TRP n 
1 42  VAL n 
1 43  LYS n 
1 44  GLU n 
1 45  GLU n 
1 46  ALA n 
1 47  PRO n 
1 48  ASP n 
1 49  ILE n 
1 50  LEU n 
1 51  CYS n 
1 52  LEU n 
1 53  GLN n 
1 54  GLU n 
1 55  THR n 
1 56  LYS n 
1 57  CYS n 
1 58  SER n 
1 59  GLU n 
1 60  ASN n 
1 61  LYS n 
1 62  LEU n 
1 63  PRO n 
1 64  ALA n 
1 65  GLU n 
1 66  LEU n 
1 67  GLN n 
1 68  GLU n 
1 69  LEU n 
1 70  PRO n 
1 71  GLY n 
1 72  LEU n 
1 73  SER n 
1 74  HIS n 
1 75  GLN n 
1 76  TYR n 
1 77  TRP n 
1 78  SER n 
1 79  ALA n 
1 80  PRO n 
1 81  SER n 
1 82  ASP n 
1 83  LYS n 
1 84  GLU n 
1 85  GLY n 
1 86  TYR n 
1 87  SER n 
1 88  GLY n 
1 89  VAL n 
1 90  GLY n 
1 91  LEU n 
1 92  LEU n 
1 93  SER n 
1 94  ARG n 
1 95  GLN n 
1 96  ALA n 
1 97  PRO n 
1 98  LEU n 
1 99  LYS n 
1 100 VAL n 
1 101 SER n 
1 102 TYR n 
1 103 GLY n 
1 104 ILE n 
1 105 GLY n 
1 106 ASP n 
1 107 GLU n 
1 108 GLU n 
1 109 HIS n 
1 110 ASP n 
1 111 GLN n 
1 112 GLU n 
1 113 GLY n 
1 114 ARG n 
1 115 VAL n 
1 116 ILE n 
1 117 VAL n 
1 118 ALA n 
1 119 GLU n 
1 120 PHE n 
1 121 ASP n 
1 122 SER n 
1 123 PHE n 
1 124 VAL n 
1 125 LEU n 
1 126 VAL n 
1 127 THR n 
1 128 ALA n 
1 129 TYR n 
1 130 VAL n 
1 131 PRO n 
1 132 ASN n 
1 133 ALA n 
1 134 GLY n 
1 135 ARG n 
1 136 GLY n 
1 137 LEU n 
1 138 VAL n 
1 139 ARG n 
1 140 LEU n 
1 141 GLU n 
1 142 TYR n 
1 143 ARG n 
1 144 GLN n 
1 145 ARG n 
1 146 TRP n 
1 147 ASP n 
1 148 GLU n 
1 149 ALA n 
1 150 PHE n 
1 151 ARG n 
1 152 LYS n 
1 153 PHE n 
1 154 LEU n 
1 155 LYS n 
1 156 GLY n 
1 157 LEU n 
1 158 ALA n 
1 159 SER n 
1 160 ARG n 
1 161 LYS n 
1 162 PRO n 
1 163 LEU n 
1 164 VAL n 
1 165 LEU n 
1 166 CYS n 
1 167 GLY n 
1 168 ASP n 
1 169 LEU n 
1 170 ASN n 
1 171 VAL n 
1 172 ALA n 
1 173 HIS n 
1 174 GLU n 
1 175 GLU n 
1 176 ILE n 
1 177 ASP n 
1 178 LEU n 
1 179 ARG n 
1 180 ASN n 
1 181 PRO n 
1 182 LYS n 
1 183 GLY n 
1 184 ASN n 
1 185 LYS n 
1 186 LYS n 
1 187 ASN n 
1 188 ALA n 
1 189 GLY n 
1 190 PHE n 
1 191 THR n 
1 192 PRO n 
1 193 GLN n 
1 194 GLU n 
1 195 ARG n 
1 196 GLN n 
1 197 GLY n 
1 198 PHE n 
1 199 GLY n 
1 200 GLU n 
1 201 LEU n 
1 202 LEU n 
1 203 GLN n 
1 204 ALA n 
1 205 VAL n 
1 206 PRO n 
1 207 LEU n 
1 208 ALA n 
1 209 ASP n 
1 210 SER n 
1 211 PHE n 
1 212 ARG n 
1 213 HIS n 
1 214 LEU n 
1 215 TYR n 
1 216 PRO n 
1 217 ASN n 
1 218 THR n 
1 219 PRO n 
1 220 TYR n 
1 221 ALA n 
1 222 TYR n 
1 223 THR n 
1 224 PHE n 
1 225 TRP n 
1 226 THR n 
1 227 TYR n 
1 228 MET n 
1 229 MET n 
1 230 ASN n 
1 231 ALA n 
1 232 ARG n 
1 233 SER n 
1 234 LYS n 
1 235 ASN n 
1 236 VAL n 
1 237 GLY n 
1 238 TRP n 
1 239 ARG n 
1 240 LEU n 
1 241 ASP n 
1 242 TYR n 
1 243 PHE n 
1 244 LEU n 
1 245 LEU n 
1 246 SER n 
1 247 HIS n 
1 248 SER n 
1 249 LEU n 
1 250 LEU n 
1 251 PRO n 
1 252 ALA n 
1 253 LEU n 
1 254 CYS n 
1 255 ASP n 
1 256 SER n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LYS n 
1 262 ALA n 
1 263 LEU n 
1 264 GLY n 
1 265 SER n 
1 266 ASP n 
1 267 HIS n 
1 268 CYS n 
1 269 PRO n 
1 270 ILE n 
1 271 THR n 
1 272 LEU n 
1 273 TYR n 
1 274 LEU n 
1 275 ALA n 
1 276 LEU n 
2 1   DT  n 
2 2   DC  n 
2 3   DG  n 
2 4   DA  n 
2 5   DC  n 
2 6   DG  n 
2 7   DG  n 
2 8   DA  n 
2 9   DT  n 
2 10  DC  n 
2 11  DC  n 
3 1   DG  n 
3 2   DC  n 
3 3   DT  n 
3 4   DG  n 
3 5   DA  n 
3 6   DT  n 
3 7   DG  n 
3 8   DC  n 
3 9   DG  n 
3 10  DC  n 
4 1   DG  n 
4 2   DG  n 
4 3   DA  n 
4 4   DT  n 
4 5   DC  n 
4 6   DC  n 
4 7   DG  n 
4 8   DT  n 
4 9   DC  n 
4 10  DG  n 
4 11  DA  n 
4 12  DG  n 
4 13  DC  n 
4 14  DG  n 
4 15  DC  n 
4 16  DA  n 
4 17  DT  n 
4 18  DC  n 
4 19  DA  n 
4 20  DG  n 
4 21  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   276 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'APEX1, APE, APE1, APEX, APX, HAP1, REF1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 11 'synthetic construct' ? 32630 ? 
3 1 sample 1 10 'synthetic construct' ? 32630 ? 
4 1 sample 1 21 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP APEX1_HUMAN P27695 ? 1 
;ALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAP
SDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASR
KPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRL
DYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
;
43 
2 PDB 5WN0        5WN0   ? 2 ? 1  
3 PDB 5WN0        5WN0   ? 3 ? 1  
4 PDB 5WN0        5WN0   ? 4 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5WN0 A 1 ? 276 ? P27695 43 ? 318 ? 43 318 
2 1 5WN0 B 1 ? 276 ? P27695 43 ? 318 ? 43 318 
3 2 5WN0 C 1 ? 11  ? 5WN0   1  ? 11  ? 1  11  
4 3 5WN0 D 1 ? 10  ? 5WN0   1  ? 10  ? 1  10  
5 4 5WN0 E 1 ? 21  ? 5WN0   1  ? 21  ? 1  21  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5WN0 ALA A 96 ? UNP P27695 CYS 138 'engineered mutation' 138 1 
2 5WN0 ALA B 96 ? UNP P27695 CYS 138 'engineered mutation' 138 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5WN0 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.60 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.70 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              0.791 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '7% PEG20000, 100 mM sodium citrate, 15% glycerol, 5 mM calcium chloride' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 200K' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-03-24 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.54 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            41.390 
_reflns.entry_id                         5WN0 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.600 
_reflns.d_resolution_low                 25.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       23502 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.000 
_reflns.pdbx_Rmerge_I_obs                0.126 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.400 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.815 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.146 
_reflns.pdbx_Rpim_I_all                  0.072 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         94168 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.600 2.640  ? ? ? ? ? ? 1170 98.500  ? ? ? ? 0.561 ? ? ? ? ? ? ? ? 3.000 ? 1.007 ? ? 0.676 0.371 ? 1  1 0.771 ? 
2.640 2.690  ? ? ? ? ? ? 1120 98.400  ? ? ? ? 0.719 ? ? ? ? ? ? ? ? 3.100 ? 3.827 ? ? 0.866 0.474 ? 2  1 0.354 ? 
2.690 2.740  ? ? ? ? ? ? 1214 99.400  ? ? ? ? 0.466 ? ? ? ? ? ? ? ? 3.400 ? 1.979 ? ? 0.552 0.291 ? 3  1 0.842 ? 
2.740 2.800  ? ? ? ? ? ? 1139 99.700  ? ? ? ? 0.387 ? ? ? ? ? ? ? ? 3.800 ? 0.965 ? ? 0.449 0.224 ? 4  1 0.910 ? 
2.800 2.860  ? ? ? ? ? ? 1204 99.900  ? ? ? ? 0.321 ? ? ? ? ? ? ? ? 4.100 ? 0.923 ? ? 0.370 0.181 ? 5  1 0.937 ? 
2.860 2.930  ? ? ? ? ? ? 1171 100.000 ? ? ? ? 0.274 ? ? ? ? ? ? ? ? 4.000 ? 1.035 ? ? 0.316 0.155 ? 6  1 0.945 ? 
2.930 3.000  ? ? ? ? ? ? 1183 99.900  ? ? ? ? 0.248 ? ? ? ? ? ? ? ? 4.100 ? 1.043 ? ? 0.285 0.139 ? 7  1 0.953 ? 
3.000 3.080  ? ? ? ? ? ? 1174 100.000 ? ? ? ? 0.206 ? ? ? ? ? ? ? ? 4.200 ? 1.174 ? ? 0.236 0.113 ? 8  1 0.968 ? 
3.080 3.170  ? ? ? ? ? ? 1201 100.000 ? ? ? ? 0.166 ? ? ? ? ? ? ? ? 4.200 ? 1.296 ? ? 0.190 0.091 ? 9  1 0.980 ? 
3.170 3.270  ? ? ? ? ? ? 1155 100.000 ? ? ? ? 0.128 ? ? ? ? ? ? ? ? 4.400 ? 1.378 ? ? 0.146 0.069 ? 10 1 0.986 ? 
3.270 3.390  ? ? ? ? ? ? 1203 100.000 ? ? ? ? 0.125 ? ? ? ? ? ? ? ? 4.400 ? 1.624 ? ? 0.142 0.068 ? 11 1 0.986 ? 
3.390 3.530  ? ? ? ? ? ? 1158 99.100  ? ? ? ? 0.182 ? ? ? ? ? ? ? ? 3.900 ? 2.871 ? ? 0.211 0.104 ? 12 1 0.956 ? 
3.530 3.690  ? ? ? ? ? ? 1173 98.000  ? ? ? ? 0.225 ? ? ? ? ? ? ? ? 3.700 ? 5.494 ? ? 0.262 0.132 ? 13 1 0.842 ? 
3.690 3.880  ? ? ? ? ? ? 1154 99.200  ? ? ? ? 0.159 ? ? ? ? ? ? ? ? 4.200 ? 3.342 ? ? 0.182 0.088 ? 14 1 0.949 ? 
3.880 4.120  ? ? ? ? ? ? 1191 99.800  ? ? ? ? 0.207 ? ? ? ? ? ? ? ? 4.000 ? 3.050 ? ? 0.239 0.119 ? 15 1 0.255 ? 
4.120 4.440  ? ? ? ? ? ? 1174 100.000 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 4.400 ? 1.337 ? ? 0.073 0.034 ? 16 1 0.996 ? 
4.440 4.880  ? ? ? ? ? ? 1185 100.000 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 4.400 ? 1.102 ? ? 0.064 0.030 ? 17 1 0.996 ? 
4.880 5.580  ? ? ? ? ? ? 1182 100.000 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 4.300 ? 1.141 ? ? 0.064 0.030 ? 18 1 0.997 ? 
5.580 7.010  ? ? ? ? ? ? 1167 100.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 4.300 ? 1.192 ? ? 0.066 0.031 ? 19 1 0.996 ? 
7.010 25.000 ? ? ? ? ? ? 1184 99.900  ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 4.000 ? 1.647 ? ? 0.066 0.032 ? 20 1 0.992 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                151.120 
_refine.B_iso_mean                               46.3498 
_refine.B_iso_min                                14.550 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5WN0 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.6 
_refine.ls_d_res_low                             24.9120 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     23443 
_refine.ls_number_reflns_R_free                  3730 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    92.0200 
_refine.ls_percent_reflns_R_free                 8.4800 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2228 
_refine.ls_R_factor_R_free                       0.2868 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2171 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.960 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 5DFF' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 31.6500 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4200 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.6 
_refine_hist.d_res_low                        24.9120 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             72 
_refine_hist.number_atoms_total               5206 
_refine_hist.pdbx_number_residues_total       591 
_refine_hist.pdbx_B_iso_mean_solvent          37.54 
_refine_hist.pdbx_number_atoms_protein        4278 
_refine_hist.pdbx_number_atoms_nucleic_acid   856 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010  ? 5414 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.218  ? 7524 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.058  ? 812  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.008  ? 825  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 20.213 ? 3074 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.5764 2.6089  1036 . 91  945  57.0000 . . . 0.3483 0.0000 0.3002 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 2.6089 2.6432  1455 . 124 1331 84.0000 . . . 0.3979 0.0000 0.2909 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 2.6432 2.6794  1480 . 131 1349 85.0000 . . . 0.3070 0.0000 0.3028 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 2.6794 2.7176  1636 . 136 1500 89.0000 . . . 0.4234 0.0000 0.3036 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 2.7176 2.7581  1612 . 137 1475 93.0000 . . . 0.3572 0.0000 0.2654 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 2.7581 2.8012  1681 . 142 1539 94.0000 . . . 0.3908 0.0000 0.2603 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 2.8012 2.8470  1696 . 139 1557 95.0000 . . . 0.2975 0.0000 0.2682 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 2.8470 2.8961  1640 . 142 1498 95.0000 . . . 0.3621 0.0000 0.2727 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 2.8961 2.9486  1775 . 152 1623 96.0000 . . . 0.3435 0.0000 0.2735 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 2.9486 3.0053  1593 . 135 1458 96.0000 . . . 0.4180 0.0000 0.2980 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 3.0053 3.0665  1746 . 150 1596 97.0000 . . . 0.3892 0.0000 0.2690 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 3.0665 3.1331  1690 . 146 1544 96.0000 . . . 0.2986 0.0000 0.2594 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 3.1331 3.2058  1733 . 146 1587 96.0000 . . . 0.3288 0.0000 0.2464 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 3.2058 3.2858  1647 . 146 1501 96.0000 . . . 0.3089 0.0000 0.2467 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 3.2858 3.3744  1717 . 146 1571 96.0000 . . . 0.3262 0.0000 0.2255 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 3.3744 3.4735  1620 . 135 1485 91.0000 . . . 0.3166 0.0000 0.2533 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 3.4735 3.5853  1429 . 125 1304 83.0000 . . . 0.3000 0.0000 0.3042 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 3.5853 3.7130  1628 . 132 1496 90.0000 . . . 0.3873 0.0000 0.3046 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 3.7130 3.8612  1677 . 143 1534 95.0000 . . . 0.3604 0.0000 0.2379 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 3.8612 4.0362  1630 . 130 1500 92.0000 . . . 0.3240 0.0000 0.2312 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 4.0362 4.2480  1675 . 141 1534 95.0000 . . . 0.2116 0.0000 0.1755 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 4.2480 4.5127  1735 . 146 1589 97.0000 . . . 0.2297 0.0000 0.1408 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 4.5127 4.8587  1727 . 149 1578 97.0000 . . . 0.2145 0.0000 0.1455 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 4.8587 5.3433  1677 . 142 1535 97.0000 . . . 0.1841 0.0000 0.1460 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 5.3433 6.1066  1718 . 142 1576 97.0000 . . . 0.1966 0.0000 0.1402 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 6.1066 7.6564  1679 . 142 1537 95.0000 . . . 0.2324 0.0000 0.1729 . . . . . . 27 . . . 
'X-RAY DIFFRACTION' 7.6564 24.9130 1637 . 140 1497 92.0000 . . . 0.1897 0.0000 0.1445 . . . . . . 27 . . . 
# 
_struct.entry_id                     5WN0 
_struct.title                        'APE1 exonuclease substrate complex with a C/G match' 
_struct.pdbx_descriptor              'DNA-(apurinic or apyrimidinic site) lyase/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5WN0 
_struct_keywords.text            'HYDROLASE, LYASE-DNA complex' 
_struct_keywords.pdbx_keywords   'HYDROLASE, LYASE/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 29  ? LYS A 36  ? GLY A 71  LYS A 78  1 ? 8  
HELX_P HELX_P2  AA2 LYS A 37  ? ALA A 46  ? LYS A 79  ALA A 88  1 ? 10 
HELX_P HELX_P3  AA3 SER A 58  ? LEU A 62  ? SER A 100 LEU A 104 5 ? 5  
HELX_P HELX_P4  AA4 PRO A 63  ? GLN A 67  ? PRO A 105 GLN A 109 5 ? 5  
HELX_P HELX_P5  AA5 GLY A 134 ? VAL A 138 ? GLY A 176 VAL A 180 5 ? 5  
HELX_P HELX_P6  AA6 ARG A 139 ? GLY A 156 ? ARG A 181 GLY A 198 1 ? 18 
HELX_P HELX_P7  AA7 GLU A 174 ? LEU A 178 ? GLU A 216 LEU A 220 5 ? 5  
HELX_P HELX_P8  AA8 THR A 191 ? VAL A 205 ? THR A 233 VAL A 247 1 ? 15 
HELX_P HELX_P9  AA9 SER A 210 ? TYR A 215 ? SER A 252 TYR A 257 1 ? 6  
HELX_P HELX_P10 AB1 TYR A 227 ? ALA A 231 ? TYR A 269 ALA A 273 5 ? 5  
HELX_P HELX_P11 AB2 HIS A 247 ? LEU A 250 ? HIS A 289 LEU A 292 5 ? 4  
HELX_P HELX_P12 AB3 GLY B 29  ? LYS B 36  ? GLY B 71  LYS B 78  1 ? 8  
HELX_P HELX_P13 AB4 LYS B 37  ? ALA B 46  ? LYS B 79  ALA B 88  1 ? 10 
HELX_P HELX_P14 AB5 PRO B 63  ? GLN B 67  ? PRO B 105 GLN B 109 5 ? 5  
HELX_P HELX_P15 AB6 LEU B 69  ? SER B 73  ? LEU B 111 SER B 115 5 ? 5  
HELX_P HELX_P16 AB7 GLY B 134 ? VAL B 138 ? GLY B 176 VAL B 180 5 ? 5  
HELX_P HELX_P17 AB8 ARG B 139 ? LEU B 154 ? ARG B 181 LEU B 196 1 ? 16 
HELX_P HELX_P18 AB9 LEU B 154 ? SER B 159 ? LEU B 196 SER B 201 1 ? 6  
HELX_P HELX_P19 AC1 GLU B 174 ? LEU B 178 ? GLU B 216 LEU B 220 5 ? 5  
HELX_P HELX_P20 AC2 PRO B 181 ? LYS B 185 ? PRO B 223 LYS B 227 5 ? 5  
HELX_P HELX_P21 AC3 THR B 191 ? VAL B 205 ? THR B 233 VAL B 247 1 ? 15 
HELX_P HELX_P22 AC4 SER B 210 ? TYR B 215 ? SER B 252 TYR B 257 1 ? 6  
HELX_P HELX_P23 AC5 TYR B 227 ? ALA B 231 ? TYR B 269 ALA B 273 5 ? 5  
HELX_P HELX_P24 AC6 HIS B 247 ? PRO B 251 ? HIS B 289 PRO B 293 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? C DT 1  N3 ? ? ? 1_555 E DA 11 N1 ? ? C DT 1  E DA 11 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog2  hydrog ? ? C DC 2  O2 ? ? ? 1_555 E DG 10 N2 ? ? C DC 2  E DG 10 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog3  hydrog ? ? C DG 3  N1 ? ? ? 1_555 E DC 9  N3 ? ? C DG 3  E DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4  hydrog ? ? C DG 3  N2 ? ? ? 1_555 E DC 9  O2 ? ? C DG 3  E DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5  hydrog ? ? C DG 3  O6 ? ? ? 1_555 E DC 9  N4 ? ? C DG 3  E DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6  hydrog ? ? C DA 4  N6 ? ? ? 1_555 E DG 7  O6 ? ? C DA 4  E DG 7  1_555 ? ? ? ? ? ? 'DA-DG MISPAIR' ? ? 
hydrog7  hydrog ? ? C DC 5  N3 ? ? ? 1_555 E DG 7  N2 ? ? C DC 5  E DG 7  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog8  hydrog ? ? C DG 6  N1 ? ? ? 1_555 E DC 6  N3 ? ? C DG 6  E DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9  hydrog ? ? C DG 6  N2 ? ? ? 1_555 E DC 6  O2 ? ? C DG 6  E DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10 hydrog ? ? C DG 6  O6 ? ? ? 1_555 E DC 6  N4 ? ? C DG 6  E DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11 hydrog ? ? C DG 7  N1 ? ? ? 1_555 E DC 5  N3 ? ? C DG 7  E DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12 hydrog ? ? C DG 7  N2 ? ? ? 1_555 E DC 5  O2 ? ? C DG 7  E DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13 hydrog ? ? C DG 7  O6 ? ? ? 1_555 E DC 5  N4 ? ? C DG 7  E DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14 hydrog ? ? C DA 8  N1 ? ? ? 1_555 E DT 4  N3 ? ? C DA 8  E DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog15 hydrog ? ? C DA 8  N6 ? ? ? 1_555 E DT 4  O4 ? ? C DA 8  E DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog16 hydrog ? ? C DT 9  N3 ? ? ? 1_555 E DA 3  N1 ? ? C DT 9  E DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17 hydrog ? ? C DT 9  O4 ? ? ? 1_555 E DA 3  N6 ? ? C DT 9  E DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog18 hydrog ? ? C DC 10 N3 ? ? ? 1_555 E DG 2  N1 ? ? C DC 10 E DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog19 hydrog ? ? C DC 10 N4 ? ? ? 1_555 E DG 2  O6 ? ? C DC 10 E DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20 hydrog ? ? C DC 10 O2 ? ? ? 1_555 E DG 2  N2 ? ? C DC 10 E DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog21 hydrog ? ? C DC 11 O2 ? ? ? 1_555 E DG 1  N2 ? ? C DC 11 E DG 1  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog22 hydrog ? ? D DG 1  N1 ? ? ? 1_555 E DC 21 N3 ? ? D DG 1  E DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23 hydrog ? ? D DG 1  N2 ? ? ? 1_555 E DC 21 O2 ? ? D DG 1  E DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24 hydrog ? ? D DG 1  O6 ? ? ? 1_555 E DC 21 N4 ? ? D DG 1  E DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25 hydrog ? ? D DC 2  N3 ? ? ? 1_555 E DG 20 N1 ? ? D DC 2  E DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26 hydrog ? ? D DC 2  N4 ? ? ? 1_555 E DG 20 O6 ? ? D DC 2  E DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27 hydrog ? ? D DC 2  O2 ? ? ? 1_555 E DG 20 N2 ? ? D DC 2  E DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog28 hydrog ? ? D DT 3  N3 ? ? ? 1_555 E DA 19 N1 ? ? D DT 3  E DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29 hydrog ? ? D DT 3  O4 ? ? ? 1_555 E DA 19 N6 ? ? D DT 3  E DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30 hydrog ? ? D DG 4  N1 ? ? ? 1_555 E DC 18 N3 ? ? D DG 4  E DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog31 hydrog ? ? D DG 4  N2 ? ? ? 1_555 E DC 18 O2 ? ? D DG 4  E DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog32 hydrog ? ? D DG 4  O6 ? ? ? 1_555 E DC 18 N4 ? ? D DG 4  E DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog33 hydrog ? ? D DA 5  N1 ? ? ? 1_555 E DT 17 N3 ? ? D DA 5  E DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34 hydrog ? ? D DA 5  N6 ? ? ? 1_555 E DT 17 O4 ? ? D DA 5  E DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog35 hydrog ? ? D DT 6  N3 ? ? ? 1_555 E DA 16 N1 ? ? D DT 6  E DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog36 hydrog ? ? D DT 6  O4 ? ? ? 1_555 E DA 16 N6 ? ? D DT 6  E DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37 hydrog ? ? D DG 7  N1 ? ? ? 1_555 E DC 15 N3 ? ? D DG 7  E DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog38 hydrog ? ? D DG 7  N2 ? ? ? 1_555 E DC 15 O2 ? ? D DG 7  E DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39 hydrog ? ? D DG 7  O6 ? ? ? 1_555 E DC 15 N4 ? ? D DG 7  E DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog40 hydrog ? ? D DC 8  N3 ? ? ? 1_555 E DG 14 N1 ? ? D DC 8  E DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog41 hydrog ? ? D DC 8  N4 ? ? ? 1_555 E DG 14 O6 ? ? D DC 8  E DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog42 hydrog ? ? D DC 8  O2 ? ? ? 1_555 E DG 14 N2 ? ? D DC 8  E DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog43 hydrog ? ? D DG 9  N1 ? ? ? 1_555 E DC 13 N3 ? ? D DG 9  E DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog44 hydrog ? ? D DG 9  N2 ? ? ? 1_555 E DC 13 O2 ? ? D DG 9  E DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog45 hydrog ? ? D DG 9  O6 ? ? ? 1_555 E DC 13 N4 ? ? D DG 9  E DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog46 hydrog ? ? D DC 10 N3 ? ? ? 1_555 E DG 12 N1 ? ? D DC 10 E DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog47 hydrog ? ? D DC 10 N4 ? ? ? 1_555 E DG 12 O6 ? ? D DC 10 E DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48 hydrog ? ? D DC 10 O2 ? ? ? 1_555 E DG 12 N2 ? ? D DC 10 E DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 205 A . ? VAL 247 A PRO 206 A ? PRO 248 A 1 -10.96 
2 VAL 205 B . ? VAL 247 B PRO 206 B ? PRO 248 B 1 -0.48  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 6 ? 
AA3 ? 6 ? 
AA4 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? parallel      
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 HIS A 74  ? SER A 78  ? HIS A 116 SER A 120 
AA1 2 VAL A 89  ? SER A 93  ? VAL A 131 SER A 135 
AA1 3 ILE A 49  ? GLN A 53  ? ILE A 91  GLN A 95  
AA1 4 LEU A 20  ? ASN A 26  ? LEU A 62  ASN A 68  
AA1 5 ILE A 270 ? LEU A 274 ? ILE A 312 LEU A 316 
AA1 6 LEU A 253 ? ILE A 258 ? LEU A 295 ILE A 300 
AA2 1 LYS A 99  ? TYR A 102 ? LYS A 141 TYR A 144 
AA2 2 VAL A 115 ? GLU A 119 ? VAL A 157 GLU A 161 
AA2 3 VAL A 124 ? TYR A 129 ? VAL A 166 TYR A 171 
AA2 4 LEU A 163 ? ASP A 168 ? LEU A 205 ASP A 210 
AA2 5 ASP A 241 ? LEU A 245 ? ASP A 283 LEU A 287 
AA2 6 ALA A 208 ? ASP A 209 ? ALA A 250 ASP A 251 
AA3 1 HIS B 74  ? SER B 78  ? HIS B 116 SER B 120 
AA3 2 VAL B 89  ? SER B 93  ? VAL B 131 SER B 135 
AA3 3 ILE B 49  ? GLN B 53  ? ILE B 91  GLN B 95  
AA3 4 LEU B 20  ? ASN B 26  ? LEU B 62  ASN B 68  
AA3 5 ILE B 270 ? LEU B 274 ? ILE B 312 LEU B 316 
AA3 6 LEU B 253 ? ILE B 258 ? LEU B 295 ILE B 300 
AA4 1 LYS B 99  ? TYR B 102 ? LYS B 141 TYR B 144 
AA4 2 VAL B 115 ? GLU B 119 ? VAL B 157 GLU B 161 
AA4 3 VAL B 124 ? TYR B 129 ? VAL B 166 TYR B 171 
AA4 4 LEU B 163 ? ASP B 168 ? LEU B 205 ASP B 210 
AA4 5 ASP B 241 ? LEU B 245 ? ASP B 283 LEU B 287 
AA4 6 ALA B 208 ? ASP B 209 ? ALA B 250 ASP B 251 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N HIS A 74  ? N HIS A 116 O SER A 93  ? O SER A 135 
AA1 2 3 O LEU A 92  ? O LEU A 134 N LEU A 50  ? N LEU A 92  
AA1 3 4 O ILE A 49  ? O ILE A 91  N CYS A 23  ? N CYS A 65  
AA1 4 5 N ILE A 22  ? N ILE A 64  O LEU A 272 ? O LEU A 314 
AA1 5 6 O THR A 271 ? O THR A 313 N LYS A 257 ? N LYS A 299 
AA2 1 2 N LYS A 99  ? N LYS A 141 O GLU A 119 ? O GLU A 161 
AA2 2 3 N ALA A 118 ? N ALA A 160 O LEU A 125 ? O LEU A 167 
AA2 3 4 N VAL A 126 ? N VAL A 168 O VAL A 164 ? O VAL A 206 
AA2 4 5 N LEU A 165 ? N LEU A 207 O LEU A 244 ? O LEU A 286 
AA2 5 6 O LEU A 245 ? O LEU A 287 N ALA A 208 ? N ALA A 250 
AA3 1 2 N TYR B 76  ? N TYR B 118 O LEU B 91  ? O LEU B 133 
AA3 2 3 O LEU B 92  ? O LEU B 134 N LEU B 50  ? N LEU B 92  
AA3 3 4 O CYS B 51  ? O CYS B 93  N TRP B 25  ? N TRP B 67  
AA3 4 5 N ILE B 22  ? N ILE B 64  O LEU B 272 ? O LEU B 314 
AA3 5 6 O THR B 271 ? O THR B 313 N LYS B 257 ? N LYS B 299 
AA4 1 2 N SER B 101 ? N SER B 143 O VAL B 117 ? O VAL B 159 
AA4 2 3 N ALA B 118 ? N ALA B 160 O LEU B 125 ? O LEU B 167 
AA4 3 4 N VAL B 126 ? N VAL B 168 O VAL B 164 ? O VAL B 206 
AA4 4 5 N LEU B 165 ? N LEU B 207 O LEU B 244 ? O LEU B 286 
AA4 5 6 O LEU B 245 ? O LEU B 287 N ALA B 208 ? N ALA B 250 
# 
_atom_sites.entry_id                    5WN0 
_atom_sites.fract_transf_matrix[1][1]   0.022592 
_atom_sites.fract_transf_matrix[1][2]   -0.001623 
_atom_sites.fract_transf_matrix[1][3]   -0.005112 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016186 
_atom_sites.fract_transf_matrix[2][3]   -0.001891 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014015 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ALA A 1 1   ? 3.438   -48.367 -14.118 1.00 51.09  ? 43  ALA A N     1 
ATOM   2    C CA    . ALA A 1 1   ? 4.839   -48.742 -14.321 1.00 54.26  ? 43  ALA A CA    1 
ATOM   3    C C     . ALA A 1 1   ? 5.708   -48.101 -13.235 1.00 61.83  ? 43  ALA A C     1 
ATOM   4    O O     . ALA A 1 1   ? 5.280   -47.134 -12.589 1.00 59.28  ? 43  ALA A O     1 
ATOM   5    C CB    . ALA A 1 1   ? 5.306   -48.331 -15.704 1.00 52.77  ? 43  ALA A CB    1 
ATOM   6    N N     . LEU A 1 2   ? 6.917   -48.626 -13.026 1.00 59.21  ? 44  LEU A N     1 
ATOM   7    C CA    . LEU A 1 2   ? 7.716   -48.156 -11.901 1.00 60.05  ? 44  LEU A CA    1 
ATOM   8    C C     . LEU A 1 2   ? 8.500   -46.904 -12.276 1.00 60.30  ? 44  LEU A C     1 
ATOM   9    O O     . LEU A 1 2   ? 8.663   -46.559 -13.457 1.00 55.49  ? 44  LEU A O     1 
ATOM   10   C CB    . LEU A 1 2   ? 8.673   -49.237 -11.386 1.00 59.49  ? 44  LEU A CB    1 
ATOM   11   C CG    . LEU A 1 2   ? 8.047   -50.530 -10.837 1.00 62.46  ? 44  LEU A CG    1 
ATOM   12   C CD1   . LEU A 1 2   ? 8.888   -51.081 -9.700  1.00 54.64  ? 44  LEU A CD1   1 
ATOM   13   C CD2   . LEU A 1 2   ? 6.584   -50.364 -10.395 1.00 56.70  ? 44  LEU A CD2   1 
ATOM   14   N N     . TYR A 1 3   ? 8.980   -46.216 -11.238 1.00 52.82  ? 45  TYR A N     1 
ATOM   15   C CA    . TYR A 1 3   ? 9.550   -44.882 -11.384 1.00 55.54  ? 45  TYR A CA    1 
ATOM   16   C C     . TYR A 1 3   ? 10.886  -44.765 -10.652 1.00 52.87  ? 45  TYR A C     1 
ATOM   17   O O     . TYR A 1 3   ? 10.990  -45.088 -9.461  1.00 48.54  ? 45  TYR A O     1 
ATOM   18   C CB    . TYR A 1 3   ? 8.571   -43.813 -10.876 1.00 43.60  ? 45  TYR A CB    1 
ATOM   19   C CG    . TYR A 1 3   ? 9.146   -42.408 -10.924 1.00 41.72  ? 45  TYR A CG    1 
ATOM   20   C CD1   . TYR A 1 3   ? 9.172   -41.692 -12.109 1.00 37.60  ? 45  TYR A CD1   1 
ATOM   21   C CD2   . TYR A 1 3   ? 9.677   -41.806 -9.787  1.00 34.72  ? 45  TYR A CD2   1 
ATOM   22   C CE1   . TYR A 1 3   ? 9.702   -40.404 -12.162 1.00 37.42  ? 45  TYR A CE1   1 
ATOM   23   C CE2   . TYR A 1 3   ? 10.206  -40.519 -9.833  1.00 33.89  ? 45  TYR A CE2   1 
ATOM   24   C CZ    . TYR A 1 3   ? 10.213  -39.823 -11.027 1.00 36.85  ? 45  TYR A CZ    1 
ATOM   25   O OH    . TYR A 1 3   ? 10.720  -38.545 -11.115 1.00 33.17  ? 45  TYR A OH    1 
ATOM   26   N N     . GLU A 1 4   ? 11.899  -44.290 -11.368 1.00 43.55  ? 46  GLU A N     1 
ATOM   27   C CA    . GLU A 1 4   ? 13.221  -44.041 -10.806 1.00 42.92  ? 46  GLU A CA    1 
ATOM   28   C C     . GLU A 1 4   ? 13.539  -42.570 -11.063 1.00 42.28  ? 46  GLU A C     1 
ATOM   29   O O     . GLU A 1 4   ? 13.838  -42.173 -12.192 1.00 40.08  ? 46  GLU A O     1 
ATOM   30   C CB    . GLU A 1 4   ? 14.286  -44.985 -11.390 1.00 46.02  ? 46  GLU A CB    1 
ATOM   31   C CG    . GLU A 1 4   ? 15.759  -44.655 -10.945 1.00 68.67  ? 46  GLU A CG    1 
ATOM   32   C CD    . GLU A 1 4   ? 16.193  -45.288 -9.622  1.00 60.63  ? 46  GLU A CD    1 
ATOM   33   O OE1   . GLU A 1 4   ? 16.111  -44.618 -8.590  1.00 56.32  ? 46  GLU A OE1   1 
ATOM   34   O OE2   . GLU A 1 4   ? 16.702  -46.422 -9.622  1.00 58.28  ? 46  GLU A OE2   1 
ATOM   35   N N     . ASP A 1 5   ? 13.445  -41.771 -10.014 1.00 40.38  ? 47  ASP A N     1 
ATOM   36   C CA    . ASP A 1 5   ? 13.689  -40.343 -10.094 1.00 35.98  ? 47  ASP A CA    1 
ATOM   37   C C     . ASP A 1 5   ? 15.024  -40.057 -10.789 1.00 39.07  ? 47  ASP A C     1 
ATOM   38   O O     . ASP A 1 5   ? 16.042  -40.669 -10.435 1.00 37.45  ? 47  ASP A O     1 
ATOM   39   C CB    . ASP A 1 5   ? 13.698  -39.789 -8.673  1.00 26.78  ? 47  ASP A CB    1 
ATOM   40   C CG    . ASP A 1 5   ? 13.368  -38.329 -8.608  1.00 34.84  ? 47  ASP A CG    1 
ATOM   41   O OD1   . ASP A 1 5   ? 12.636  -37.833 -9.488  1.00 34.72  ? 47  ASP A OD1   1 
ATOM   42   O OD2   . ASP A 1 5   ? 13.837  -37.681 -7.650  1.00 33.07  ? 47  ASP A OD2   1 
ATOM   43   N N     . PRO A 1 6   ? 15.065  -39.145 -11.762 1.00 40.75  ? 48  PRO A N     1 
ATOM   44   C CA    . PRO A 1 6   ? 16.343  -38.818 -12.443 1.00 44.51  ? 48  PRO A CA    1 
ATOM   45   C C     . PRO A 1 6   ? 17.352  -38.252 -11.462 1.00 40.92  ? 48  PRO A C     1 
ATOM   46   O O     . PRO A 1 6   ? 16.972  -37.785 -10.379 1.00 45.33  ? 48  PRO A O     1 
ATOM   47   C CB    . PRO A 1 6   ? 15.933  -37.769 -13.498 1.00 38.83  ? 48  PRO A CB    1 
ATOM   48   C CG    . PRO A 1 6   ? 14.615  -37.244 -13.061 1.00 37.39  ? 48  PRO A CG    1 
ATOM   49   C CD    . PRO A 1 6   ? 13.933  -38.381 -12.321 1.00 39.48  ? 48  PRO A CD    1 
ATOM   50   N N     . PRO A 1 7   ? 18.640  -38.281 -11.794 1.00 35.70  ? 49  PRO A N     1 
ATOM   51   C CA    . PRO A 1 7   ? 19.669  -37.914 -10.811 1.00 40.98  ? 49  PRO A CA    1 
ATOM   52   C C     . PRO A 1 7   ? 19.645  -36.433 -10.492 1.00 39.62  ? 49  PRO A C     1 
ATOM   53   O O     . PRO A 1 7   ? 19.127  -35.611 -11.253 1.00 42.71  ? 49  PRO A O     1 
ATOM   54   C CB    . PRO A 1 7   ? 20.985  -38.299 -11.495 1.00 41.99  ? 49  PRO A CB    1 
ATOM   55   C CG    . PRO A 1 7   ? 20.588  -39.289 -12.529 1.00 42.80  ? 49  PRO A CG    1 
ATOM   56   C CD    . PRO A 1 7   ? 19.226  -38.850 -13.010 1.00 37.19  ? 49  PRO A CD    1 
ATOM   57   N N     . ASP A 1 8   ? 20.250  -36.105 -9.350  1.00 37.45  ? 50  ASP A N     1 
ATOM   58   C CA    . ASP A 1 8   ? 20.147  -34.766 -8.782  1.00 30.93  ? 50  ASP A CA    1 
ATOM   59   C C     . ASP A 1 8   ? 20.897  -33.780 -9.662  1.00 33.60  ? 50  ASP A C     1 
ATOM   60   O O     . ASP A 1 8   ? 22.113  -33.904 -9.851  1.00 29.38  ? 50  ASP A O     1 
ATOM   61   C CB    . ASP A 1 8   ? 20.711  -34.734 -7.355  1.00 32.40  ? 50  ASP A CB    1 
ATOM   62   C CG    . ASP A 1 8   ? 19.860  -35.523 -6.338  1.00 36.53  ? 50  ASP A CG    1 
ATOM   63   O OD1   . ASP A 1 8   ? 18.866  -36.171 -6.743  1.00 39.33  ? 50  ASP A OD1   1 
ATOM   64   O OD2   . ASP A 1 8   ? 20.203  -35.525 -5.125  1.00 34.43  ? 50  ASP A OD2   1 
ATOM   65   N N     . GLN A 1 9   ? 20.164  -32.807 -10.197 1.00 38.75  ? 51  GLN A N     1 
ATOM   66   C CA    . GLN A 1 9   ? 20.729  -31.660 -10.902 1.00 31.05  ? 51  GLN A CA    1 
ATOM   67   C C     . GLN A 1 9   ? 21.031  -30.553 -9.895  1.00 36.26  ? 51  GLN A C     1 
ATOM   68   O O     . GLN A 1 9   ? 20.116  -29.891 -9.392  1.00 35.68  ? 51  GLN A O     1 
ATOM   69   C CB    . GLN A 1 9   ? 19.756  -31.167 -11.972 1.00 38.60  ? 51  GLN A CB    1 
ATOM   70   C CG    . GLN A 1 9   ? 20.213  -29.896 -12.700 1.00 45.49  ? 51  GLN A CG    1 
ATOM   71   C CD    . GLN A 1 9   ? 21.521  -30.109 -13.439 1.00 45.90  ? 51  GLN A CD    1 
ATOM   72   O OE1   . GLN A 1 9   ? 22.600  -30.018 -12.849 1.00 42.46  ? 51  GLN A OE1   1 
ATOM   73   N NE2   . GLN A 1 9   ? 21.428  -30.428 -14.735 1.00 54.45  ? 51  GLN A NE2   1 
ATOM   74   N N     . LYS A 1 10  ? 22.311  -30.342 -9.597  1.00 40.16  ? 52  LYS A N     1 
ATOM   75   C CA    . LYS A 1 10  ? 22.689  -29.400 -8.555  1.00 28.47  ? 52  LYS A CA    1 
ATOM   76   C C     . LYS A 1 10  ? 23.292  -28.123 -9.121  1.00 34.29  ? 52  LYS A C     1 
ATOM   77   O O     . LYS A 1 10  ? 23.969  -27.377 -8.396  1.00 32.68  ? 52  LYS A O     1 
ATOM   78   C CB    . LYS A 1 10  ? 23.637  -30.061 -7.558  1.00 36.65  ? 52  LYS A CB    1 
ATOM   79   C CG    . LYS A 1 10  ? 23.038  -31.280 -6.836  1.00 34.43  ? 52  LYS A CG    1 
ATOM   80   C CD    . LYS A 1 10  ? 23.980  -31.762 -5.721  1.00 38.06  ? 52  LYS A CD    1 
ATOM   81   C CE    . LYS A 1 10  ? 23.814  -33.260 -5.428  1.00 41.37  ? 52  LYS A CE    1 
ATOM   82   N NZ    . LYS A 1 10  ? 25.040  -33.878 -4.813  1.00 41.36  ? 52  LYS A NZ    1 
ATOM   83   N N     . THR A 1 11  ? 23.034  -27.832 -10.399 1.00 33.85  ? 53  THR A N     1 
ATOM   84   C CA    . THR A 1 11  ? 23.452  -26.561 -10.980 1.00 39.99  ? 53  THR A CA    1 
ATOM   85   C C     . THR A 1 11  ? 22.263  -25.875 -11.661 1.00 40.41  ? 53  THR A C     1 
ATOM   86   O O     . THR A 1 11  ? 21.420  -26.531 -12.295 1.00 33.28  ? 53  THR A O     1 
ATOM   87   C CB    . THR A 1 11  ? 24.639  -26.737 -11.976 1.00 41.36  ? 53  THR A CB    1 
ATOM   88   O OG1   . THR A 1 11  ? 24.139  -27.004 -13.274 1.00 57.43  ? 53  THR A OG1   1 
ATOM   89   C CG2   . THR A 1 11  ? 25.558  -27.886 -11.572 1.00 31.94  ? 53  THR A CG2   1 
ATOM   90   N N     . SER A 1 12  ? 22.198  -24.544 -11.501 1.00 36.61  ? 54  SER A N     1 
ATOM   91   C CA    . SER A 1 12  ? 21.081  -23.770 -12.023 1.00 40.82  ? 54  SER A CA    1 
ATOM   92   C C     . SER A 1 12  ? 21.164  -23.740 -13.546 1.00 48.57  ? 54  SER A C     1 
ATOM   93   O O     . SER A 1 12  ? 22.234  -23.966 -14.125 1.00 39.30  ? 54  SER A O     1 
ATOM   94   C CB    . SER A 1 12  ? 21.092  -22.339 -11.478 1.00 40.50  ? 54  SER A CB    1 
ATOM   95   O OG    . SER A 1 12  ? 21.938  -21.485 -12.234 1.00 42.84  ? 54  SER A OG    1 
ATOM   96   N N     . PRO A 1 13  ? 20.049  -23.462 -14.229 1.00 51.24  ? 55  PRO A N     1 
ATOM   97   C CA    . PRO A 1 13  ? 20.075  -23.547 -15.698 1.00 42.32  ? 55  PRO A CA    1 
ATOM   98   C C     . PRO A 1 13  ? 21.040  -22.558 -16.330 1.00 40.00  ? 55  PRO A C     1 
ATOM   99   O O     . PRO A 1 13  ? 21.404  -22.749 -17.497 1.00 50.21  ? 55  PRO A O     1 
ATOM   100  C CB    . PRO A 1 13  ? 18.615  -23.292 -16.103 1.00 34.66  ? 55  PRO A CB    1 
ATOM   101  C CG    . PRO A 1 13  ? 18.010  -22.559 -14.936 1.00 47.24  ? 55  PRO A CG    1 
ATOM   102  C CD    . PRO A 1 13  ? 18.730  -23.037 -13.713 1.00 43.91  ? 55  PRO A CD    1 
ATOM   103  N N     . SER A 1 14  ? 21.517  -21.561 -15.583 1.00 39.41  ? 56  SER A N     1 
ATOM   104  C CA    . SER A 1 14  ? 22.557  -20.647 -16.046 1.00 40.67  ? 56  SER A CA    1 
ATOM   105  C C     . SER A 1 14  ? 23.935  -20.970 -15.457 1.00 41.97  ? 56  SER A C     1 
ATOM   106  O O     . SER A 1 14  ? 24.858  -20.153 -15.565 1.00 37.36  ? 56  SER A O     1 
ATOM   107  C CB    . SER A 1 14  ? 22.172  -19.203 -15.722 1.00 43.21  ? 56  SER A CB    1 
ATOM   108  O OG    . SER A 1 14  ? 22.475  -18.884 -14.366 1.00 43.61  ? 56  SER A OG    1 
ATOM   109  N N     . GLY A 1 15  ? 24.079  -22.144 -14.848 1.00 42.44  ? 57  GLY A N     1 
ATOM   110  C CA    . GLY A 1 15  ? 25.357  -22.562 -14.292 1.00 40.78  ? 57  GLY A CA    1 
ATOM   111  C C     . GLY A 1 15  ? 25.716  -22.214 -12.857 1.00 48.82  ? 57  GLY A C     1 
ATOM   112  O O     . GLY A 1 15  ? 26.864  -22.395 -12.453 1.00 52.09  ? 57  GLY A O     1 
ATOM   113  N N     . LYS A 1 16  ? 24.757  -21.722 -12.080 1.00 45.16  ? 58  LYS A N     1 
ATOM   114  C CA    . LYS A 1 16  ? 25.028  -21.376 -10.686 1.00 42.83  ? 58  LYS A CA    1 
ATOM   115  C C     . LYS A 1 16  ? 24.865  -22.610 -9.803  1.00 37.66  ? 58  LYS A C     1 
ATOM   116  O O     . LYS A 1 16  ? 23.895  -23.353 -9.953  1.00 40.56  ? 58  LYS A O     1 
ATOM   117  C CB    . LYS A 1 16  ? 24.092  -20.262 -10.216 1.00 38.46  ? 58  LYS A CB    1 
ATOM   118  C CG    . LYS A 1 16  ? 24.404  -18.897 -10.809 1.00 48.52  ? 58  LYS A CG    1 
ATOM   119  C CD    . LYS A 1 16  ? 25.885  -18.575 -10.703 1.00 57.30  ? 58  LYS A CD    1 
ATOM   120  C CE    . LYS A 1 16  ? 26.496  -18.328 -12.073 1.00 58.32  ? 58  LYS A CE    1 
ATOM   121  N NZ    . LYS A 1 16  ? 27.432  -17.170 -12.063 1.00 55.57  ? 58  LYS A NZ    1 
ATOM   122  N N     . PRO A 1 17  ? 25.804  -22.839 -8.887  1.00 42.01  ? 59  PRO A N     1 
ATOM   123  C CA    . PRO A 1 17  ? 25.699  -24.017 -8.019  1.00 41.48  ? 59  PRO A CA    1 
ATOM   124  C C     . PRO A 1 17  ? 24.591  -23.848 -6.987  1.00 41.48  ? 59  PRO A C     1 
ATOM   125  O O     . PRO A 1 17  ? 24.390  -22.767 -6.427  1.00 38.96  ? 59  PRO A O     1 
ATOM   126  C CB    . PRO A 1 17  ? 27.090  -24.104 -7.364  1.00 35.40  ? 59  PRO A CB    1 
ATOM   127  C CG    . PRO A 1 17  ? 27.667  -22.706 -7.472  1.00 25.59  ? 59  PRO A CG    1 
ATOM   128  C CD    . PRO A 1 17  ? 27.063  -22.084 -8.692  1.00 38.92  ? 59  PRO A CD    1 
ATOM   129  N N     . ALA A 1 18  ? 23.863  -24.929 -6.738  1.00 45.75  ? 60  ALA A N     1 
ATOM   130  C CA    . ALA A 1 18  ? 22.847  -24.864 -5.702  1.00 37.51  ? 60  ALA A CA    1 
ATOM   131  C C     . ALA A 1 18  ? 23.502  -24.613 -4.351  1.00 36.77  ? 60  ALA A C     1 
ATOM   132  O O     . ALA A 1 18  ? 24.565  -25.157 -4.038  1.00 40.65  ? 60  ALA A O     1 
ATOM   133  C CB    . ALA A 1 18  ? 22.008  -26.142 -5.666  1.00 35.56  ? 60  ALA A CB    1 
ATOM   134  N N     . THR A 1 19  ? 22.866  -23.740 -3.571  1.00 38.52  ? 61  THR A N     1 
ATOM   135  C CA    . THR A 1 19  ? 23.324  -23.347 -2.255  1.00 38.32  ? 61  THR A CA    1 
ATOM   136  C C     . THR A 1 19  ? 22.276  -23.564 -1.187  1.00 35.23  ? 61  THR A C     1 
ATOM   137  O O     . THR A 1 19  ? 22.574  -23.373 -0.004  1.00 39.41  ? 61  THR A O     1 
ATOM   138  C CB    . THR A 1 19  ? 23.717  -21.866 -2.243  1.00 38.45  ? 61  THR A CB    1 
ATOM   139  O OG1   . THR A 1 19  ? 22.600  -21.088 -2.692  1.00 37.32  ? 61  THR A OG1   1 
ATOM   140  C CG2   . THR A 1 19  ? 24.901  -21.637 -3.154  1.00 29.43  ? 61  THR A CG2   1 
ATOM   141  N N     . LEU A 1 20  ? 21.062  -23.917 -1.564  1.00 29.87  ? 62  LEU A N     1 
ATOM   142  C CA    . LEU A 1 20  ? 20.006  -24.160 -0.602  1.00 32.85  ? 62  LEU A CA    1 
ATOM   143  C C     . LEU A 1 20  ? 19.301  -25.450 -0.973  1.00 34.02  ? 62  LEU A C     1 
ATOM   144  O O     . LEU A 1 20  ? 18.950  -25.659 -2.140  1.00 32.49  ? 62  LEU A O     1 
ATOM   145  C CB    . LEU A 1 20  ? 19.017  -23.009 -0.573  1.00 28.29  ? 62  LEU A CB    1 
ATOM   146  C CG    . LEU A 1 20  ? 17.944  -23.237 0.464   1.00 31.17  ? 62  LEU A CG    1 
ATOM   147  C CD1   . LEU A 1 20  ? 18.422  -22.706 1.815   1.00 33.37  ? 62  LEU A CD1   1 
ATOM   148  C CD2   . LEU A 1 20  ? 16.638  -22.593 -0.015  1.00 33.19  ? 62  LEU A CD2   1 
ATOM   149  N N     . LYS A 1 21  ? 19.120  -26.314 0.018   1.00 29.77  ? 63  LYS A N     1 
ATOM   150  C CA    . LYS A 1 21  ? 18.462  -27.599 -0.156  1.00 33.15  ? 63  LYS A CA    1 
ATOM   151  C C     . LYS A 1 21  ? 17.356  -27.715 0.890   1.00 28.61  ? 63  LYS A C     1 
ATOM   152  O O     . LYS A 1 21  ? 17.625  -27.690 2.092   1.00 26.40  ? 63  LYS A O     1 
ATOM   153  C CB    . LYS A 1 21  ? 19.483  -28.735 -0.040  1.00 27.25  ? 63  LYS A CB    1 
ATOM   154  C CG    . LYS A 1 21  ? 18.940  -30.121 -0.241  1.00 30.28  ? 63  LYS A CG    1 
ATOM   155  C CD    . LYS A 1 21  ? 20.011  -31.153 0.018   1.00 22.70  ? 63  LYS A CD    1 
ATOM   156  C CE    . LYS A 1 21  ? 19.416  -32.529 0.094   1.00 31.88  ? 63  LYS A CE    1 
ATOM   157  N NZ    . LYS A 1 21  ? 20.404  -33.633 -0.161  1.00 40.22  ? 63  LYS A NZ    1 
ATOM   158  N N     . ILE A 1 22  ? 16.117  -27.820 0.432   1.00 27.82  ? 64  ILE A N     1 
ATOM   159  C CA    . ILE A 1 22  ? 14.947  -27.866 1.300   1.00 28.58  ? 64  ILE A CA    1 
ATOM   160  C C     . ILE A 1 22  ? 14.243  -29.191 1.096   1.00 25.59  ? 64  ILE A C     1 
ATOM   161  O O     . ILE A 1 22  ? 13.875  -29.535 -0.031  1.00 26.60  ? 64  ILE A O     1 
ATOM   162  C CB    . ILE A 1 22  ? 13.957  -26.732 1.011   1.00 19.62  ? 64  ILE A CB    1 
ATOM   163  C CG1   . ILE A 1 22  ? 14.645  -25.389 1.029   1.00 23.67  ? 64  ILE A CG1   1 
ATOM   164  C CG2   . ILE A 1 22  ? 12.874  -26.736 2.050   1.00 26.24  ? 64  ILE A CG2   1 
ATOM   165  C CD1   . ILE A 1 22  ? 13.695  -24.271 0.612   1.00 25.28  ? 64  ILE A CD1   1 
ATOM   166  N N     . CYS A 1 23  ? 13.991  -29.894 2.186   1.00 22.29  ? 65  CYS A N     1 
ATOM   167  C CA    . CYS A 1 23  ? 13.259  -31.145 2.126   1.00 22.11  ? 65  CYS A CA    1 
ATOM   168  C C     . CYS A 1 23  ? 11.956  -31.030 2.918   1.00 27.49  ? 65  CYS A C     1 
ATOM   169  O O     . CYS A 1 23  ? 11.901  -30.412 3.993   1.00 25.75  ? 65  CYS A O     1 
ATOM   170  C CB    . CYS A 1 23  ? 14.156  -32.284 2.606   1.00 23.57  ? 65  CYS A CB    1 
ATOM   171  S SG    . CYS A 1 23  ? 13.334  -33.808 2.953   1.00 34.93  ? 65  CYS A SG    1 
ATOM   172  N N     . SER A 1 24  ? 10.896  -31.580 2.333   1.00 25.45  ? 66  SER A N     1 
ATOM   173  C CA    . SER A 1 24  ? 9.544   -31.554 2.861   1.00 25.39  ? 66  SER A CA    1 
ATOM   174  C C     . SER A 1 24  ? 9.074   -32.993 2.974   1.00 24.78  ? 66  SER A C     1 
ATOM   175  O O     . SER A 1 24  ? 9.406   -33.813 2.118   1.00 26.43  ? 66  SER A O     1 
ATOM   176  C CB    . SER A 1 24  ? 8.615   -30.745 1.928   1.00 23.44  ? 66  SER A CB    1 
ATOM   177  O OG    . SER A 1 24  ? 7.271   -30.683 2.407   1.00 26.74  ? 66  SER A OG    1 
ATOM   178  N N     . TRP A 1 25  ? 8.292   -33.311 4.008   1.00 18.86  ? 67  TRP A N     1 
ATOM   179  C CA    . TRP A 1 25  ? 7.895   -34.704 4.174   1.00 16.55  ? 67  TRP A CA    1 
ATOM   180  C C     . TRP A 1 25  ? 6.676   -34.816 5.073   1.00 25.42  ? 67  TRP A C     1 
ATOM   181  O O     . TRP A 1 25  ? 6.711   -34.410 6.243   1.00 26.78  ? 67  TRP A O     1 
ATOM   182  C CB    . TRP A 1 25  ? 9.059   -35.509 4.731   1.00 17.88  ? 67  TRP A CB    1 
ATOM   183  C CG    . TRP A 1 25  ? 8.910   -37.006 4.633   1.00 26.04  ? 67  TRP A CG    1 
ATOM   184  C CD1   . TRP A 1 25  ? 7.807   -37.704 4.204   1.00 23.22  ? 67  TRP A CD1   1 
ATOM   185  C CD2   . TRP A 1 25  ? 9.907   -37.997 4.964   1.00 25.38  ? 67  TRP A CD2   1 
ATOM   186  N NE1   . TRP A 1 25  ? 8.053   -39.056 4.267   1.00 22.93  ? 67  TRP A NE1   1 
ATOM   187  C CE2   . TRP A 1 25  ? 9.331   -39.266 4.718   1.00 23.99  ? 67  TRP A CE2   1 
ATOM   188  C CE3   . TRP A 1 25  ? 11.223  -37.935 5.456   1.00 23.64  ? 67  TRP A CE3   1 
ATOM   189  C CZ2   . TRP A 1 25  ? 10.031  -40.469 4.948   1.00 28.62  ? 67  TRP A CZ2   1 
ATOM   190  C CZ3   . TRP A 1 25  ? 11.920  -39.133 5.675   1.00 23.03  ? 67  TRP A CZ3   1 
ATOM   191  C CH2   . TRP A 1 25  ? 11.322  -40.380 5.421   1.00 21.30  ? 67  TRP A CH2   1 
ATOM   192  N N     . ASN A 1 26  ? 5.599   -35.378 4.537   1.00 28.39  ? 68  ASN A N     1 
ATOM   193  C CA    . ASN A 1 26  ? 4.475   -35.800 5.364   1.00 24.33  ? 68  ASN A CA    1 
ATOM   194  C C     . ASN A 1 26  ? 4.850   -37.125 6.034   1.00 26.54  ? 68  ASN A C     1 
ATOM   195  O O     . ASN A 1 26  ? 4.863   -38.180 5.387   1.00 23.93  ? 68  ASN A O     1 
ATOM   196  C CB    . ASN A 1 26  ? 3.204   -35.921 4.524   1.00 23.75  ? 68  ASN A CB    1 
ATOM   197  C CG    . ASN A 1 26  ? 1.995   -36.436 5.338   1.00 30.94  ? 68  ASN A CG    1 
ATOM   198  O OD1   . ASN A 1 26  ? 2.132   -37.249 6.264   1.00 23.82  ? 68  ASN A OD1   1 
ATOM   199  N ND2   . ASN A 1 26  ? 0.806   -35.961 4.979   1.00 32.85  ? 68  ASN A ND2   1 
ATOM   200  N N     . VAL A 1 27  ? 5.121   -37.083 7.345   1.00 20.94  ? 69  VAL A N     1 
ATOM   201  C CA    . VAL A 1 27  ? 5.602   -38.261 8.056   1.00 20.26  ? 69  VAL A CA    1 
ATOM   202  C C     . VAL A 1 27  ? 4.475   -39.078 8.669   1.00 26.63  ? 69  VAL A C     1 
ATOM   203  O O     . VAL A 1 27  ? 4.730   -40.166 9.215   1.00 26.28  ? 69  VAL A O     1 
ATOM   204  C CB    . VAL A 1 27  ? 6.637   -37.838 9.116   1.00 27.06  ? 69  VAL A CB    1 
ATOM   205  C CG1   . VAL A 1 27  ? 7.820   -37.178 8.419   1.00 21.10  ? 69  VAL A CG1   1 
ATOM   206  C CG2   . VAL A 1 27  ? 5.986   -36.909 10.204  1.00 25.55  ? 69  VAL A CG2   1 
ATOM   207  N N     . ASP A 1 28  ? 3.236   -38.612 8.544   1.00 28.44  ? 70  ASP A N     1 
ATOM   208  C CA    . ASP A 1 28  ? 2.033   -39.320 8.979   1.00 29.56  ? 70  ASP A CA    1 
ATOM   209  C C     . ASP A 1 28  ? 2.253   -40.026 10.312  1.00 27.34  ? 70  ASP A C     1 
ATOM   210  O O     . ASP A 1 28  ? 2.189   -41.254 10.427  1.00 28.81  ? 70  ASP A O     1 
ATOM   211  C CB    . ASP A 1 28  ? 1.556   -40.293 7.909   1.00 30.91  ? 70  ASP A CB    1 
ATOM   212  C CG    . ASP A 1 28  ? 0.042   -40.455 7.918   1.00 33.64  ? 70  ASP A CG    1 
ATOM   213  O OD1   . ASP A 1 28  ? -0.595  -40.062 8.919   1.00 30.03  ? 70  ASP A OD1   1 
ATOM   214  O OD2   . ASP A 1 28  ? -0.508  -40.966 6.929   1.00 36.54  ? 70  ASP A OD2   1 
ATOM   215  N N     . GLY A 1 29  ? 2.522   -39.214 11.327  1.00 27.06  ? 71  GLY A N     1 
ATOM   216  C CA    . GLY A 1 29  ? 2.871   -39.733 12.631  1.00 29.41  ? 71  GLY A CA    1 
ATOM   217  C C     . GLY A 1 29  ? 4.362   -39.671 12.909  1.00 28.69  ? 71  GLY A C     1 
ATOM   218  O O     . GLY A 1 29  ? 5.096   -40.636 12.703  1.00 30.13  ? 71  GLY A O     1 
ATOM   219  N N     . LEU A 1 30  ? 4.796   -38.525 13.425  1.00 27.43  ? 72  LEU A N     1 
ATOM   220  C CA    . LEU A 1 30  ? 6.210   -38.264 13.635  1.00 27.15  ? 72  LEU A CA    1 
ATOM   221  C C     . LEU A 1 30  ? 6.856   -39.336 14.499  1.00 28.98  ? 72  LEU A C     1 
ATOM   222  O O     . LEU A 1 30  ? 7.948   -39.822 14.177  1.00 31.36  ? 72  LEU A O     1 
ATOM   223  C CB    . LEU A 1 30  ? 6.354   -36.880 14.250  1.00 26.46  ? 72  LEU A CB    1 
ATOM   224  C CG    . LEU A 1 30  ? 7.690   -36.306 14.665  1.00 27.52  ? 72  LEU A CG    1 
ATOM   225  C CD1   . LEU A 1 30  ? 8.532   -36.177 13.418  1.00 30.99  ? 72  LEU A CD1   1 
ATOM   226  C CD2   . LEU A 1 30  ? 7.470   -34.933 15.293  1.00 28.73  ? 72  LEU A CD2   1 
ATOM   227  N N     . ARG A 1 31  ? 6.189   -39.734 15.587  1.00 26.49  ? 73  ARG A N     1 
ATOM   228  C CA    . ARG A 1 31  ? 6.765   -40.724 16.494  1.00 28.60  ? 73  ARG A CA    1 
ATOM   229  C C     . ARG A 1 31  ? 6.871   -42.102 15.852  1.00 24.35  ? 73  ARG A C     1 
ATOM   230  O O     . ARG A 1 31  ? 7.824   -42.838 16.124  1.00 25.43  ? 73  ARG A O     1 
ATOM   231  C CB    . ARG A 1 31  ? 5.964   -40.778 17.794  1.00 29.04  ? 73  ARG A CB    1 
ATOM   232  C CG    . ARG A 1 31  ? 6.346   -39.646 18.737  1.00 31.15  ? 73  ARG A CG    1 
ATOM   233  C CD    . ARG A 1 31  ? 5.330   -39.467 19.839  1.00 35.30  ? 73  ARG A CD    1 
ATOM   234  N NE    . ARG A 1 31  ? 3.986   -39.252 19.306  1.00 34.20  ? 73  ARG A NE    1 
ATOM   235  C CZ    . ARG A 1 31  ? 2.910   -39.069 20.060  1.00 38.24  ? 73  ARG A CZ    1 
ATOM   236  N NH1   . ARG A 1 31  ? 3.027   -39.059 21.387  1.00 40.17  ? 73  ARG A NH1   1 
ATOM   237  N NH2   . ARG A 1 31  ? 1.723   -38.899 19.494  1.00 26.64  ? 73  ARG A NH2   1 
ATOM   238  N N     . ALA A 1 32  ? 5.932   -42.464 14.984  1.00 28.36  ? 74  ALA A N     1 
ATOM   239  C CA    . ALA A 1 32  ? 6.099   -43.694 14.214  1.00 30.54  ? 74  ALA A CA    1 
ATOM   240  C C     . ALA A 1 32  ? 7.239   -43.556 13.210  1.00 32.24  ? 74  ALA A C     1 
ATOM   241  O O     . ALA A 1 32  ? 8.097   -44.442 13.087  1.00 33.53  ? 74  ALA A O     1 
ATOM   242  C CB    . ALA A 1 32  ? 4.791   -44.037 13.503  1.00 25.10  ? 74  ALA A CB    1 
ATOM   243  N N     . TRP A 1 33  ? 7.241   -42.447 12.471  1.00 26.47  ? 75  TRP A N     1 
ATOM   244  C CA    . TRP A 1 33  ? 8.281   -42.163 11.502  1.00 27.39  ? 75  TRP A CA    1 
ATOM   245  C C     . TRP A 1 33  ? 9.662   -42.266 12.133  1.00 33.29  ? 75  TRP A C     1 
ATOM   246  O O     . TRP A 1 33  ? 10.563  -42.908 11.583  1.00 32.18  ? 75  TRP A O     1 
ATOM   247  C CB    . TRP A 1 33  ? 8.018   -40.776 10.945  1.00 26.50  ? 75  TRP A CB    1 
ATOM   248  C CG    . TRP A 1 33  ? 9.066   -40.160 10.104  1.00 27.11  ? 75  TRP A CG    1 
ATOM   249  C CD1   . TRP A 1 33  ? 9.365   -40.474 8.827   1.00 27.20  ? 75  TRP A CD1   1 
ATOM   250  C CD2   . TRP A 1 33  ? 9.891   -39.041 10.446  1.00 26.74  ? 75  TRP A CD2   1 
ATOM   251  N NE1   . TRP A 1 33  ? 10.337  -39.645 8.349   1.00 25.68  ? 75  TRP A NE1   1 
ATOM   252  C CE2   . TRP A 1 33  ? 10.679  -38.751 9.325   1.00 26.04  ? 75  TRP A CE2   1 
ATOM   253  C CE3   . TRP A 1 33  ? 10.034  -38.252 11.595  1.00 26.44  ? 75  TRP A CE3   1 
ATOM   254  C CZ2   . TRP A 1 33  ? 11.616  -37.721 9.314   1.00 28.24  ? 75  TRP A CZ2   1 
ATOM   255  C CZ3   . TRP A 1 33  ? 10.955  -37.221 11.581  1.00 27.99  ? 75  TRP A CZ3   1 
ATOM   256  C CH2   . TRP A 1 33  ? 11.738  -36.967 10.449  1.00 30.47  ? 75  TRP A CH2   1 
ATOM   257  N N     . ILE A 1 34  ? 9.834   -41.676 13.314  1.00 29.63  ? 76  ILE A N     1 
ATOM   258  C CA    . ILE A 1 34  ? 11.125  -41.738 13.985  1.00 29.88  ? 76  ILE A CA    1 
ATOM   259  C C     . ILE A 1 34  ? 11.495  -43.179 14.314  1.00 34.32  ? 76  ILE A C     1 
ATOM   260  O O     . ILE A 1 34  ? 12.626  -43.619 14.058  1.00 36.43  ? 76  ILE A O     1 
ATOM   261  C CB    . ILE A 1 34  ? 11.115  -40.852 15.234  1.00 25.37  ? 76  ILE A CB    1 
ATOM   262  C CG1   . ILE A 1 34  ? 11.228  -39.394 14.794  1.00 27.65  ? 76  ILE A CG1   1 
ATOM   263  C CG2   . ILE A 1 34  ? 12.263  -41.243 16.161  1.00 25.10  ? 76  ILE A CG2   1 
ATOM   264  C CD1   . ILE A 1 34  ? 11.001  -38.413 15.874  1.00 32.99  ? 76  ILE A CD1   1 
ATOM   265  N N     . LYS A 1 35  ? 10.550  -43.937 14.881  1.00 32.62  ? 77  LYS A N     1 
ATOM   266  C CA    . LYS A 1 35  ? 10.832  -45.333 15.195  1.00 30.85  ? 77  LYS A CA    1 
ATOM   267  C C     . LYS A 1 35  ? 11.151  -46.112 13.932  1.00 33.58  ? 77  LYS A C     1 
ATOM   268  O O     . LYS A 1 35  ? 12.029  -46.977 13.932  1.00 36.13  ? 77  LYS A O     1 
ATOM   269  C CB    . LYS A 1 35  ? 9.657   -45.959 15.941  1.00 27.87  ? 77  LYS A CB    1 
ATOM   270  C CG    . LYS A 1 35  ? 9.467   -45.398 17.340  1.00 38.64  ? 77  LYS A CG    1 
ATOM   271  C CD    . LYS A 1 35  ? 8.182   -45.903 17.969  1.00 33.35  ? 77  LYS A CD    1 
ATOM   272  C CE    . LYS A 1 35  ? 7.933   -45.262 19.339  1.00 34.14  ? 77  LYS A CE    1 
ATOM   273  N NZ    . LYS A 1 35  ? 6.824   -45.976 20.082  1.00 51.78  ? 77  LYS A NZ    1 
ATOM   274  N N     . LYS A 1 36  ? 10.475  -45.798 12.835  1.00 37.69  ? 78  LYS A N     1 
ATOM   275  C CA    . LYS A 1 36  ? 10.797  -46.425 11.560  1.00 34.48  ? 78  LYS A CA    1 
ATOM   276  C C     . LYS A 1 36  ? 11.990  -45.789 10.884  1.00 33.05  ? 78  LYS A C     1 
ATOM   277  O O     . LYS A 1 36  ? 12.124  -45.898 9.659   1.00 34.62  ? 78  LYS A O     1 
ATOM   278  C CB    . LYS A 1 36  ? 9.582   -46.387 10.642  1.00 35.83  ? 78  LYS A CB    1 
ATOM   279  C CG    . LYS A 1 36  ? 8.442   -47.232 11.167  1.00 31.45  ? 78  LYS A CG    1 
ATOM   280  C CD    . LYS A 1 36  ? 7.218   -47.159 10.282  1.00 34.08  ? 78  LYS A CD    1 
ATOM   281  C CE    . LYS A 1 36  ? 6.587   -45.781 10.370  1.00 37.50  ? 78  LYS A CE    1 
ATOM   282  N NZ    . LYS A 1 36  ? 5.119   -45.866 10.191  1.00 32.61  ? 78  LYS A NZ    1 
ATOM   283  N N     . LYS A 1 37  ? 12.832  -45.103 11.665  1.00 37.52  ? 79  LYS A N     1 
ATOM   284  C CA    . LYS A 1 37  ? 14.176  -44.693 11.250  1.00 39.57  ? 79  LYS A CA    1 
ATOM   285  C C     . LYS A 1 37  ? 14.161  -43.495 10.308  1.00 34.88  ? 79  LYS A C     1 
ATOM   286  O O     . LYS A 1 37  ? 15.121  -43.262 9.573   1.00 32.66  ? 79  LYS A O     1 
ATOM   287  C CB    . LYS A 1 37  ? 14.966  -45.863 10.634  1.00 41.41  ? 79  LYS A CB    1 
ATOM   288  C CG    . LYS A 1 37  ? 15.202  -47.064 11.622  1.00 38.96  ? 79  LYS A CG    1 
ATOM   289  C CD    . LYS A 1 37  ? 15.704  -46.543 12.992  1.00 40.87  ? 79  LYS A CD    1 
ATOM   290  C CE    . LYS A 1 37  ? 15.875  -47.581 14.086  1.00 52.91  ? 79  LYS A CE    1 
ATOM   291  N NZ    . LYS A 1 37  ? 16.215  -46.917 15.402  1.00 61.88  ? 79  LYS A NZ    1 
ATOM   292  N N     . GLY A 1 38  ? 13.115  -42.677 10.365  1.00 30.37  ? 80  GLY A N     1 
ATOM   293  C CA    . GLY A 1 38  ? 13.050  -41.559 9.441   1.00 32.92  ? 80  GLY A CA    1 
ATOM   294  C C     . GLY A 1 38  ? 14.158  -40.543 9.632   1.00 34.54  ? 80  GLY A C     1 
ATOM   295  O O     . GLY A 1 38  ? 14.584  -39.893 8.671   1.00 31.55  ? 80  GLY A O     1 
ATOM   296  N N     . LEU A 1 39  ? 14.617  -40.361 10.871  1.00 36.52  ? 81  LEU A N     1 
ATOM   297  C CA    . LEU A 1 39  ? 15.645  -39.360 11.101  1.00 30.47  ? 81  LEU A CA    1 
ATOM   298  C C     . LEU A 1 39  ? 16.951  -39.782 10.475  1.00 36.28  ? 81  LEU A C     1 
ATOM   299  O O     . LEU A 1 39  ? 17.742  -38.924 10.085  1.00 36.75  ? 81  LEU A O     1 
ATOM   300  C CB    . LEU A 1 39  ? 15.842  -39.105 12.591  1.00 36.56  ? 81  LEU A CB    1 
ATOM   301  C CG    . LEU A 1 39  ? 14.892  -38.121 13.277  1.00 33.35  ? 81  LEU A CG    1 
ATOM   302  C CD1   . LEU A 1 39  ? 15.388  -37.845 14.679  1.00 34.81  ? 81  LEU A CD1   1 
ATOM   303  C CD2   . LEU A 1 39  ? 14.808  -36.831 12.480  1.00 29.40  ? 81  LEU A CD2   1 
ATOM   304  N N     . ASP A 1 40  ? 17.182  -41.093 10.361  1.00 36.33  ? 82  ASP A N     1 
ATOM   305  C CA    . ASP A 1 40  ? 18.357  -41.581 9.651   1.00 35.84  ? 82  ASP A CA    1 
ATOM   306  C C     . ASP A 1 40  ? 18.369  -41.064 8.221   1.00 33.21  ? 82  ASP A C     1 
ATOM   307  O O     . ASP A 1 40  ? 19.388  -40.555 7.737   1.00 37.61  ? 82  ASP A O     1 
ATOM   308  C CB    . ASP A 1 40  ? 18.396  -43.115 9.651   1.00 43.37  ? 82  ASP A CB    1 
ATOM   309  C CG    . ASP A 1 40  ? 18.437  -43.724 11.057  1.00 43.33  ? 82  ASP A CG    1 
ATOM   310  O OD1   . ASP A 1 40  ? 18.822  -43.041 12.031  1.00 42.34  ? 82  ASP A OD1   1 
ATOM   311  O OD2   . ASP A 1 40  ? 18.090  -44.920 11.172  1.00 45.63  ? 82  ASP A OD2   1 
ATOM   312  N N     . TRP A 1 41  ? 17.232  -41.178 7.532   1.00 27.26  ? 83  TRP A N     1 
ATOM   313  C CA    . TRP A 1 41  ? 17.168  -40.763 6.142   1.00 25.87  ? 83  TRP A CA    1 
ATOM   314  C C     . TRP A 1 41  ? 17.438  -39.275 5.990   1.00 33.86  ? 83  TRP A C     1 
ATOM   315  O O     . TRP A 1 41  ? 17.991  -38.851 4.966   1.00 29.49  ? 83  TRP A O     1 
ATOM   316  C CB    . TRP A 1 41  ? 15.816  -41.097 5.525   1.00 17.20  ? 83  TRP A CB    1 
ATOM   317  C CG    . TRP A 1 41  ? 15.841  -40.738 4.090   1.00 29.15  ? 83  TRP A CG    1 
ATOM   318  C CD1   . TRP A 1 41  ? 16.219  -41.544 3.052   1.00 25.13  ? 83  TRP A CD1   1 
ATOM   319  C CD2   . TRP A 1 41  ? 15.553  -39.454 3.514   1.00 27.72  ? 83  TRP A CD2   1 
ATOM   320  N NE1   . TRP A 1 41  ? 16.147  -40.855 1.874   1.00 25.75  ? 83  TRP A NE1   1 
ATOM   321  C CE2   . TRP A 1 41  ? 15.749  -39.570 2.127   1.00 22.96  ? 83  TRP A CE2   1 
ATOM   322  C CE3   . TRP A 1 41  ? 15.127  -38.228 4.037   1.00 30.37  ? 83  TRP A CE3   1 
ATOM   323  C CZ2   . TRP A 1 41  ? 15.543  -38.506 1.250   1.00 25.97  ? 83  TRP A CZ2   1 
ATOM   324  C CZ3   . TRP A 1 41  ? 14.932  -37.169 3.166   1.00 33.75  ? 83  TRP A CZ3   1 
ATOM   325  C CH2   . TRP A 1 41  ? 15.138  -37.319 1.780   1.00 28.84  ? 83  TRP A CH2   1 
ATOM   326  N N     . VAL A 1 42  ? 17.053  -38.476 6.993   1.00 31.86  ? 84  VAL A N     1 
ATOM   327  C CA    . VAL A 1 42  ? 17.217  -37.025 6.924   1.00 32.79  ? 84  VAL A CA    1 
ATOM   328  C C     . VAL A 1 42  ? 18.680  -36.634 7.126   1.00 30.10  ? 84  VAL A C     1 
ATOM   329  O O     . VAL A 1 42  ? 19.191  -35.715 6.470   1.00 29.37  ? 84  VAL A O     1 
ATOM   330  C CB    . VAL A 1 42  ? 16.288  -36.343 7.953   1.00 32.44  ? 84  VAL A CB    1 
ATOM   331  C CG1   . VAL A 1 42  ? 16.469  -34.828 7.953   1.00 28.55  ? 84  VAL A CG1   1 
ATOM   332  C CG2   . VAL A 1 42  ? 14.826  -36.713 7.685   1.00 28.61  ? 84  VAL A CG2   1 
ATOM   333  N N     . LYS A 1 43  ? 19.375  -37.323 8.034   1.00 26.18  ? 85  LYS A N     1 
ATOM   334  C CA    . LYS A 1 43  ? 20.806  -37.089 8.207   1.00 33.68  ? 85  LYS A CA    1 
ATOM   335  C C     . LYS A 1 43  ? 21.590  -37.417 6.936   1.00 33.30  ? 85  LYS A C     1 
ATOM   336  O O     . LYS A 1 43  ? 22.536  -36.702 6.578   1.00 31.19  ? 85  LYS A O     1 
ATOM   337  C CB    . LYS A 1 43  ? 21.338  -37.891 9.389   1.00 34.47  ? 85  LYS A CB    1 
ATOM   338  C CG    . LYS A 1 43  ? 20.557  -37.657 10.665  1.00 49.27  ? 85  LYS A CG    1 
ATOM   339  C CD    . LYS A 1 43  ? 20.946  -38.602 11.829  1.00 37.94  ? 85  LYS A CD    1 
ATOM   340  C CE    . LYS A 1 43  ? 20.452  -38.054 13.186  1.00 52.32  ? 85  LYS A CE    1 
ATOM   341  N NZ    . LYS A 1 43  ? 21.373  -37.230 14.050  1.00 60.48  ? 85  LYS A NZ    1 
ATOM   342  N N     . GLU A 1 44  ? 21.226  -38.505 6.247   1.00 34.35  ? 86  GLU A N     1 
ATOM   343  C CA    . GLU A 1 44  ? 21.818  -38.804 4.944   1.00 31.33  ? 86  GLU A CA    1 
ATOM   344  C C     . GLU A 1 44  ? 21.491  -37.717 3.935   1.00 31.81  ? 86  GLU A C     1 
ATOM   345  O O     . GLU A 1 44  ? 22.374  -37.271 3.200   1.00 38.43  ? 86  GLU A O     1 
ATOM   346  C CB    . GLU A 1 44  ? 21.330  -40.170 4.431   1.00 29.28  ? 86  GLU A CB    1 
ATOM   347  N N     . GLU A 1 45  ? 20.233  -37.254 3.908   1.00 33.24  ? 87  GLU A N     1 
ATOM   348  C CA    . GLU A 1 45  ? 19.824  -36.239 2.946   1.00 29.96  ? 87  GLU A CA    1 
ATOM   349  C C     . GLU A 1 45  ? 20.384  -34.869 3.307   1.00 29.68  ? 87  GLU A C     1 
ATOM   350  O O     . GLU A 1 45  ? 20.592  -34.039 2.416   1.00 28.95  ? 87  GLU A O     1 
ATOM   351  C CB    . GLU A 1 45  ? 18.296  -36.178 2.852   1.00 27.56  ? 87  GLU A CB    1 
ATOM   352  C CG    . GLU A 1 45  ? 17.740  -35.225 1.767   1.00 30.60  ? 87  GLU A CG    1 
ATOM   353  C CD    . GLU A 1 45  ? 17.816  -35.834 0.344   1.00 37.48  ? 87  GLU A CD    1 
ATOM   354  O OE1   . GLU A 1 45  ? 18.612  -36.781 0.146   1.00 36.17  ? 87  GLU A OE1   1 
ATOM   355  O OE2   . GLU A 1 45  ? 17.068  -35.393 -0.567  1.00 32.43  ? 87  GLU A OE2   1 
ATOM   356  N N     . ALA A 1 46  ? 20.591  -34.615 4.600   1.00 30.45  ? 88  ALA A N     1 
ATOM   357  C CA    . ALA A 1 46  ? 21.200  -33.403 5.139   1.00 26.84  ? 88  ALA A CA    1 
ATOM   358  C C     . ALA A 1 46  ? 20.705  -32.111 4.461   1.00 32.87  ? 88  ALA A C     1 
ATOM   359  O O     . ALA A 1 46  ? 21.483  -31.407 3.827   1.00 35.48  ? 88  ALA A O     1 
ATOM   360  C CB    . ALA A 1 46  ? 22.720  -33.491 5.069   1.00 29.32  ? 88  ALA A CB    1 
ATOM   361  N N     . PRO A 1 47  ? 19.423  -31.792 4.604   1.00 35.25  ? 89  PRO A N     1 
ATOM   362  C CA    . PRO A 1 47  ? 18.919  -30.538 4.033   1.00 34.79  ? 89  PRO A CA    1 
ATOM   363  C C     . PRO A 1 47  ? 19.256  -29.354 4.933   1.00 30.37  ? 89  PRO A C     1 
ATOM   364  O O     . PRO A 1 47  ? 19.590  -29.507 6.109   1.00 31.88  ? 89  PRO A O     1 
ATOM   365  C CB    . PRO A 1 47  ? 17.408  -30.768 3.980   1.00 24.41  ? 89  PRO A CB    1 
ATOM   366  C CG    . PRO A 1 47  ? 17.164  -31.614 5.220   1.00 23.64  ? 89  PRO A CG    1 
ATOM   367  C CD    . PRO A 1 47  ? 18.373  -32.517 5.345   1.00 29.09  ? 89  PRO A CD    1 
ATOM   368  N N     . ASP A 1 48  ? 19.146  -28.155 4.352   1.00 30.25  ? 90  ASP A N     1 
ATOM   369  C CA    . ASP A 1 48  ? 19.220  -26.930 5.144   1.00 33.39  ? 90  ASP A CA    1 
ATOM   370  C C     . ASP A 1 48  ? 17.928  -26.672 5.890   1.00 25.42  ? 90  ASP A C     1 
ATOM   371  O O     . ASP A 1 48  ? 17.927  -25.995 6.923   1.00 21.73  ? 90  ASP A O     1 
ATOM   372  C CB    . ASP A 1 48  ? 19.509  -25.717 4.259   1.00 29.18  ? 90  ASP A CB    1 
ATOM   373  C CG    . ASP A 1 48  ? 20.901  -25.755 3.645   1.00 46.41  ? 90  ASP A CG    1 
ATOM   374  O OD1   . ASP A 1 48  ? 21.920  -25.604 4.378   1.00 40.10  ? 90  ASP A OD1   1 
ATOM   375  O OD2   . ASP A 1 48  ? 20.953  -25.926 2.404   1.00 43.69  ? 90  ASP A OD2   1 
ATOM   376  N N     . ILE A 1 49  ? 16.820  -27.146 5.353   1.00 24.79  ? 91  ILE A N     1 
ATOM   377  C CA    . ILE A 1 49  ? 15.521  -26.933 5.961   1.00 24.02  ? 91  ILE A CA    1 
ATOM   378  C C     . ILE A 1 49  ? 14.728  -28.209 5.768   1.00 26.94  ? 91  ILE A C     1 
ATOM   379  O O     . ILE A 1 49  ? 14.770  -28.820 4.690   1.00 27.28  ? 91  ILE A O     1 
ATOM   380  C CB    . ILE A 1 49  ? 14.781  -25.733 5.352   1.00 23.54  ? 91  ILE A CB    1 
ATOM   381  C CG1   . ILE A 1 49  ? 15.528  -24.421 5.647   1.00 25.31  ? 91  ILE A CG1   1 
ATOM   382  C CG2   . ILE A 1 49  ? 13.364  -25.710 5.866   1.00 22.36  ? 91  ILE A CG2   1 
ATOM   383  C CD1   . ILE A 1 49  ? 15.111  -23.197 4.761   1.00 21.32  ? 91  ILE A CD1   1 
ATOM   384  N N     . LEU A 1 50  ? 14.065  -28.648 6.829   1.00 24.46  ? 92  LEU A N     1 
ATOM   385  C CA    . LEU A 1 50  ? 13.166  -29.790 6.785   1.00 25.10  ? 92  LEU A CA    1 
ATOM   386  C C     . LEU A 1 50  ? 11.794  -29.309 7.219   1.00 26.14  ? 92  LEU A C     1 
ATOM   387  O O     . LEU A 1 50  ? 11.639  -28.752 8.316   1.00 23.49  ? 92  LEU A O     1 
ATOM   388  C CB    . LEU A 1 50  ? 13.671  -30.929 7.679   1.00 24.67  ? 92  LEU A CB    1 
ATOM   389  C CG    . LEU A 1 50  ? 12.907  -32.254 7.791   1.00 26.31  ? 92  LEU A CG    1 
ATOM   390  C CD1   . LEU A 1 50  ? 12.933  -33.067 6.478   1.00 24.41  ? 92  LEU A CD1   1 
ATOM   391  C CD2   . LEU A 1 50  ? 13.385  -33.117 8.990   1.00 24.22  ? 92  LEU A CD2   1 
ATOM   392  N N     . CYS A 1 51  ? 10.816  -29.475 6.334   1.00 31.75  ? 93  CYS A N     1 
ATOM   393  C CA    . CYS A 1 51  ? 9.419   -29.222 6.655   1.00 26.20  ? 93  CYS A CA    1 
ATOM   394  C C     . CYS A 1 51  ? 8.741   -30.568 6.821   1.00 27.15  ? 93  CYS A C     1 
ATOM   395  O O     . CYS A 1 51  ? 8.915   -31.462 5.984   1.00 25.56  ? 93  CYS A O     1 
ATOM   396  C CB    . CYS A 1 51  ? 8.735   -28.398 5.571   1.00 22.48  ? 93  CYS A CB    1 
ATOM   397  S SG    . CYS A 1 51  ? 9.675   -26.936 5.082   1.00 34.22  ? 93  CYS A SG    1 
ATOM   398  N N     . LEU A 1 52  ? 8.016   -30.722 7.922   1.00 25.11  ? 94  LEU A N     1 
ATOM   399  C CA    . LEU A 1 52  ? 7.347   -31.967 8.250   1.00 27.55  ? 94  LEU A CA    1 
ATOM   400  C C     . LEU A 1 52  ? 5.859   -31.695 8.255   1.00 30.15  ? 94  LEU A C     1 
ATOM   401  O O     . LEU A 1 52  ? 5.436   -30.615 8.684   1.00 27.80  ? 94  LEU A O     1 
ATOM   402  C CB    . LEU A 1 52  ? 7.791   -32.489 9.615   1.00 22.64  ? 94  LEU A CB    1 
ATOM   403  C CG    . LEU A 1 52  ? 9.314   -32.581 9.649   1.00 31.33  ? 94  LEU A CG    1 
ATOM   404  C CD1   . LEU A 1 52  ? 9.822   -32.998 11.033  1.00 16.70  ? 94  LEU A CD1   1 
ATOM   405  C CD2   . LEU A 1 52  ? 9.759   -33.529 8.517   1.00 21.66  ? 94  LEU A CD2   1 
ATOM   406  N N     . GLN A 1 53  ? 5.065   -32.662 7.766   1.00 28.00  ? 95  GLN A N     1 
ATOM   407  C CA    . GLN A 1 53  ? 3.613   -32.531 7.794   1.00 26.26  ? 95  GLN A CA    1 
ATOM   408  C C     . GLN A 1 53  ? 2.957   -33.767 8.395   1.00 30.35  ? 95  GLN A C     1 
ATOM   409  O O     . GLN A 1 53  ? 3.483   -34.887 8.298   1.00 26.87  ? 95  GLN A O     1 
ATOM   410  C CB    . GLN A 1 53  ? 3.038   -32.275 6.408   1.00 24.15  ? 95  GLN A CB    1 
ATOM   411  C CG    . GLN A 1 53  ? 3.517   -30.975 5.794   1.00 24.71  ? 95  GLN A CG    1 
ATOM   412  C CD    . GLN A 1 53  ? 4.767   -31.191 4.954   1.00 28.25  ? 95  GLN A CD    1 
ATOM   413  O OE1   . GLN A 1 53  ? 4.862   -32.185 4.225   1.00 30.15  ? 95  GLN A OE1   1 
ATOM   414  N NE2   . GLN A 1 53  ? 5.725   -30.271 5.046   1.00 24.88  ? 95  GLN A NE2   1 
ATOM   415  N N     . GLU A 1 54  ? 1.783   -33.531 9.010   1.00 25.30  ? 96  GLU A N     1 
ATOM   416  C CA    . GLU A 1 54  ? 0.993   -34.546 9.714   1.00 23.44  ? 96  GLU A CA    1 
ATOM   417  C C     . GLU A 1 54  ? 1.799   -35.198 10.847  1.00 27.33  ? 96  GLU A C     1 
ATOM   418  O O     . GLU A 1 54  ? 1.921   -36.434 10.942  1.00 23.82  ? 96  GLU A O     1 
ATOM   419  C CB    . GLU A 1 54  ? 0.456   -35.596 8.735   1.00 25.99  ? 96  GLU A CB    1 
ATOM   420  C CG    . GLU A 1 54  ? -0.955  -35.974 9.023   1.00 25.18  ? 96  GLU A CG    1 
ATOM   421  C CD    . GLU A 1 54  ? -1.526  -37.063 8.124   1.00 26.31  ? 96  GLU A CD    1 
ATOM   422  O OE1   . GLU A 1 54  ? -2.432  -37.782 8.603   1.00 23.42  ? 96  GLU A OE1   1 
ATOM   423  O OE2   . GLU A 1 54  ? -1.120  -37.189 6.940   1.00 29.02  ? 96  GLU A OE2   1 
ATOM   424  N N     . THR A 1 55  ? 2.326   -34.340 11.738  1.00 20.71  ? 97  THR A N     1 
ATOM   425  C CA    . THR A 1 55  ? 3.169   -34.844 12.818  1.00 24.07  ? 97  THR A CA    1 
ATOM   426  C C     . THR A 1 55  ? 2.364   -35.658 13.829  1.00 26.70  ? 97  THR A C     1 
ATOM   427  O O     . THR A 1 55  ? 2.861   -36.661 14.358  1.00 25.21  ? 97  THR A O     1 
ATOM   428  C CB    . THR A 1 55  ? 3.894   -33.690 13.515  1.00 26.13  ? 97  THR A CB    1 
ATOM   429  O OG1   . THR A 1 55  ? 2.937   -32.806 14.116  1.00 28.71  ? 97  THR A OG1   1 
ATOM   430  C CG2   . THR A 1 55  ? 4.750   -32.908 12.509  1.00 27.79  ? 97  THR A CG2   1 
ATOM   431  N N     . LYS A 1 56  ? 1.123   -35.247 14.110  1.00 24.75  ? 98  LYS A N     1 
ATOM   432  C CA    . LYS A 1 56  ? 0.298   -35.920 15.112  1.00 31.03  ? 98  LYS A CA    1 
ATOM   433  C C     . LYS A 1 56  ? 1.019   -35.985 16.460  1.00 32.46  ? 98  LYS A C     1 
ATOM   434  O O     . LYS A 1 56  ? 0.967   -36.983 17.176  1.00 34.54  ? 98  LYS A O     1 
ATOM   435  C CB    . LYS A 1 56  ? -0.101  -37.320 14.645  1.00 32.35  ? 98  LYS A CB    1 
ATOM   436  C CG    . LYS A 1 56  ? -0.921  -37.324 13.374  1.00 30.69  ? 98  LYS A CG    1 
ATOM   437  C CD    . LYS A 1 56  ? -1.395  -38.718 13.015  1.00 32.62  ? 98  LYS A CD    1 
ATOM   438  C CE    . LYS A 1 56  ? -2.428  -38.637 11.906  1.00 26.60  ? 98  LYS A CE    1 
ATOM   439  N NZ    . LYS A 1 56  ? -2.780  -39.954 11.366  1.00 29.85  ? 98  LYS A NZ    1 
ATOM   440  N N     . CYS A 1 57  ? 1.706   -34.914 16.808  1.00 24.86  ? 99  CYS A N     1 
ATOM   441  C CA    . CYS A 1 57  ? 2.481   -34.927 18.028  1.00 29.93  ? 99  CYS A CA    1 
ATOM   442  C C     . CYS A 1 57  ? 2.611   -33.494 18.523  1.00 37.49  ? 99  CYS A C     1 
ATOM   443  O O     . CYS A 1 57  ? 2.946   -32.595 17.743  1.00 39.68  ? 99  CYS A O     1 
ATOM   444  C CB    . CYS A 1 57  ? 3.841   -35.558 17.761  1.00 35.09  ? 99  CYS A CB    1 
ATOM   445  S SG    . CYS A 1 57  ? 4.753   -35.869 19.212  1.00 36.18  ? 99  CYS A SG    1 
ATOM   446  N N     . SER A 1 58  ? 2.298   -33.275 19.796  1.00 37.49  ? 100 SER A N     1 
ATOM   447  C CA    . SER A 1 58  ? 2.464   -31.962 20.403  1.00 34.41  ? 100 SER A CA    1 
ATOM   448  C C     . SER A 1 58  ? 3.925   -31.723 20.775  1.00 34.85  ? 100 SER A C     1 
ATOM   449  O O     . SER A 1 58  ? 4.722   -32.656 20.923  1.00 37.36  ? 100 SER A O     1 
ATOM   450  C CB    . SER A 1 58  ? 1.591   -31.842 21.638  1.00 40.00  ? 100 SER A CB    1 
ATOM   451  O OG    . SER A 1 58  ? 1.886   -32.891 22.546  1.00 49.27  ? 100 SER A OG    1 
ATOM   452  N N     . GLU A 1 59  ? 4.269   -30.448 20.936  1.00 32.53  ? 101 GLU A N     1 
ATOM   453  C CA    . GLU A 1 59  ? 5.668   -30.096 21.133  1.00 35.09  ? 101 GLU A CA    1 
ATOM   454  C C     . GLU A 1 59  ? 6.280   -30.844 22.306  1.00 41.16  ? 101 GLU A C     1 
ATOM   455  O O     . GLU A 1 59  ? 7.414   -31.326 22.210  1.00 43.11  ? 101 GLU A O     1 
ATOM   456  C CB    . GLU A 1 59  ? 5.827   -28.588 21.329  1.00 30.87  ? 101 GLU A CB    1 
ATOM   457  C CG    . GLU A 1 59  ? 6.726   -27.992 20.274  1.00 38.52  ? 101 GLU A CG    1 
ATOM   458  C CD    . GLU A 1 59  ? 7.087   -26.546 20.516  1.00 39.15  ? 101 GLU A CD    1 
ATOM   459  O OE1   . GLU A 1 59  ? 8.303   -26.245 20.506  1.00 36.49  ? 101 GLU A OE1   1 
ATOM   460  O OE2   . GLU A 1 59  ? 6.160   -25.721 20.713  1.00 40.94  ? 101 GLU A OE2   1 
ATOM   461  N N     . ASN A 1 60  ? 5.550   -30.965 23.419  1.00 41.12  ? 102 ASN A N     1 
ATOM   462  C CA    . ASN A 1 60  ? 6.163   -31.559 24.601  1.00 47.23  ? 102 ASN A CA    1 
ATOM   463  C C     . ASN A 1 60  ? 6.299   -33.075 24.497  1.00 41.64  ? 102 ASN A C     1 
ATOM   464  O O     . ASN A 1 60  ? 6.932   -33.678 25.369  1.00 50.51  ? 102 ASN A O     1 
ATOM   465  C CB    . ASN A 1 60  ? 5.392   -31.170 25.872  1.00 44.70  ? 102 ASN A CB    1 
ATOM   466  C CG    . ASN A 1 60  ? 4.001   -31.769 25.920  1.00 47.74  ? 102 ASN A CG    1 
ATOM   467  O OD1   . ASN A 1 60  ? 3.366   -31.977 24.892  1.00 48.61  ? 102 ASN A OD1   1 
ATOM   468  N ND2   . ASN A 1 60  ? 3.523   -32.053 27.120  1.00 55.11  ? 102 ASN A ND2   1 
ATOM   469  N N     . LYS A 1 61  ? 5.774   -33.702 23.443  1.00 41.71  ? 103 LYS A N     1 
ATOM   470  C CA    . LYS A 1 61  ? 5.925   -35.142 23.255  1.00 39.51  ? 103 LYS A CA    1 
ATOM   471  C C     . LYS A 1 61  ? 6.961   -35.507 22.204  1.00 35.96  ? 103 LYS A C     1 
ATOM   472  O O     . LYS A 1 61  ? 7.210   -36.704 21.991  1.00 38.98  ? 103 LYS A O     1 
ATOM   473  C CB    . LYS A 1 61  ? 4.578   -35.769 22.907  1.00 36.66  ? 103 LYS A CB    1 
ATOM   474  C CG    . LYS A 1 61  ? 3.621   -35.786 24.093  1.00 40.89  ? 103 LYS A CG    1 
ATOM   475  C CD    . LYS A 1 61  ? 2.186   -35.997 23.655  1.00 49.28  ? 103 LYS A CD    1 
ATOM   476  C CE    . LYS A 1 61  ? 1.394   -36.776 24.688  1.00 53.30  ? 103 LYS A CE    1 
ATOM   477  N NZ    . LYS A 1 61  ? -0.020  -36.295 24.797  1.00 52.42  ? 103 LYS A NZ    1 
ATOM   478  N N     . LEU A 1 62  ? 7.573   -34.510 21.569  1.00 33.23  ? 104 LEU A N     1 
ATOM   479  C CA    . LEU A 1 62  ? 8.631   -34.736 20.593  1.00 39.06  ? 104 LEU A CA    1 
ATOM   480  C C     . LEU A 1 62  ? 9.752   -35.577 21.205  1.00 38.63  ? 104 LEU A C     1 
ATOM   481  O O     . LEU A 1 62  ? 10.199  -35.285 22.320  1.00 37.89  ? 104 LEU A O     1 
ATOM   482  C CB    . LEU A 1 62  ? 9.177   -33.390 20.104  1.00 37.34  ? 104 LEU A CB    1 
ATOM   483  C CG    . LEU A 1 62  ? 8.183   -32.429 19.409  1.00 38.44  ? 104 LEU A CG    1 
ATOM   484  C CD1   . LEU A 1 62  ? 8.708   -30.991 19.307  1.00 35.01  ? 104 LEU A CD1   1 
ATOM   485  C CD2   . LEU A 1 62  ? 7.797   -32.936 18.027  1.00 32.51  ? 104 LEU A CD2   1 
ATOM   486  N N     . PRO A 1 63  ? 10.208  -36.633 20.528  1.00 41.77  ? 105 PRO A N     1 
ATOM   487  C CA    . PRO A 1 63  ? 11.307  -37.452 21.058  1.00 42.46  ? 105 PRO A CA    1 
ATOM   488  C C     . PRO A 1 63  ? 12.600  -36.661 21.168  1.00 46.74  ? 105 PRO A C     1 
ATOM   489  O O     . PRO A 1 63  ? 12.765  -35.577 20.607  1.00 49.57  ? 105 PRO A O     1 
ATOM   490  C CB    . PRO A 1 63  ? 11.451  -38.582 20.030  1.00 41.23  ? 105 PRO A CB    1 
ATOM   491  C CG    . PRO A 1 63  ? 10.156  -38.631 19.318  1.00 37.38  ? 105 PRO A CG    1 
ATOM   492  C CD    . PRO A 1 63  ? 9.618   -37.216 19.310  1.00 42.69  ? 105 PRO A CD    1 
ATOM   493  N N     . ALA A 1 64  ? 13.554  -37.246 21.888  1.00 45.62  ? 106 ALA A N     1 
ATOM   494  C CA    . ALA A 1 64  ? 14.804  -36.539 22.118  1.00 48.90  ? 106 ALA A CA    1 
ATOM   495  C C     . ALA A 1 64  ? 15.674  -36.503 20.871  1.00 51.32  ? 106 ALA A C     1 
ATOM   496  O O     . ALA A 1 64  ? 16.349  -35.503 20.634  1.00 48.61  ? 106 ALA A O     1 
ATOM   497  C CB    . ALA A 1 64  ? 15.571  -37.166 23.280  1.00 48.81  ? 106 ALA A CB    1 
ATOM   498  N N     . GLU A 1 65  ? 15.671  -37.557 20.051  1.00 48.43  ? 107 GLU A N     1 
ATOM   499  C CA    . GLU A 1 65  ? 16.548  -37.537 18.884  1.00 51.12  ? 107 GLU A CA    1 
ATOM   500  C C     . GLU A 1 65  ? 16.307  -36.309 18.005  1.00 53.28  ? 107 GLU A C     1 
ATOM   501  O O     . GLU A 1 65  ? 17.215  -35.895 17.268  1.00 47.95  ? 107 GLU A O     1 
ATOM   502  C CB    . GLU A 1 65  ? 16.416  -38.835 18.069  1.00 53.92  ? 107 GLU A CB    1 
ATOM   503  C CG    . GLU A 1 65  ? 15.034  -39.489 18.070  1.00 56.74  ? 107 GLU A CG    1 
ATOM   504  C CD    . GLU A 1 65  ? 14.845  -40.513 19.194  1.00 68.95  ? 107 GLU A CD    1 
ATOM   505  O OE1   . GLU A 1 65  ? 14.959  -40.134 20.393  1.00 61.89  ? 107 GLU A OE1   1 
ATOM   506  O OE2   . GLU A 1 65  ? 14.568  -41.693 18.872  1.00 72.14  ? 107 GLU A OE2   1 
ATOM   507  N N     . LEU A 1 66  ? 15.132  -35.679 18.119  1.00 45.73  ? 108 LEU A N     1 
ATOM   508  C CA    . LEU A 1 66  ? 14.870  -34.466 17.350  1.00 50.35  ? 108 LEU A CA    1 
ATOM   509  C C     . LEU A 1 66  ? 15.743  -33.292 17.784  1.00 57.37  ? 108 LEU A C     1 
ATOM   510  O O     . LEU A 1 66  ? 16.100  -32.456 16.947  1.00 60.90  ? 108 LEU A O     1 
ATOM   511  C CB    . LEU A 1 66  ? 13.398  -34.094 17.442  1.00 51.38  ? 108 LEU A CB    1 
ATOM   512  C CG    . LEU A 1 66  ? 12.645  -34.751 16.287  1.00 52.44  ? 108 LEU A CG    1 
ATOM   513  C CD1   . LEU A 1 66  ? 11.141  -34.536 16.422  1.00 42.99  ? 108 LEU A CD1   1 
ATOM   514  C CD2   . LEU A 1 66  ? 13.183  -34.229 14.945  1.00 28.20  ? 108 LEU A CD2   1 
ATOM   515  N N     . GLN A 1 67  ? 16.100  -33.196 19.067  1.00 61.15  ? 109 GLN A N     1 
ATOM   516  C CA    . GLN A 1 67  ? 17.029  -32.139 19.450  1.00 59.26  ? 109 GLN A CA    1 
ATOM   517  C C     . GLN A 1 67  ? 18.469  -32.395 19.010  1.00 63.57  ? 109 GLN A C     1 
ATOM   518  O O     . GLN A 1 67  ? 19.171  -31.454 18.614  1.00 70.20  ? 109 GLN A O     1 
ATOM   519  C CB    . GLN A 1 67  ? 17.025  -31.936 20.972  1.00 72.25  ? 109 GLN A CB    1 
ATOM   520  C CG    . GLN A 1 67  ? 17.362  -33.151 21.835  1.00 72.16  ? 109 GLN A CG    1 
ATOM   521  C CD    . GLN A 1 67  ? 17.003  -32.971 23.321  1.00 79.10  ? 109 GLN A CD    1 
ATOM   522  O OE1   . GLN A 1 67  ? 16.686  -31.863 23.767  1.00 84.76  ? 109 GLN A OE1   1 
ATOM   523  N NE2   . GLN A 1 67  ? 17.034  -34.074 24.082  1.00 66.34  ? 109 GLN A NE2   1 
ATOM   524  N N     . GLU A 1 68  ? 18.911  -33.660 18.994  1.00 61.53  ? 110 GLU A N     1 
ATOM   525  C CA    . GLU A 1 68  ? 20.322  -33.958 18.737  1.00 65.56  ? 110 GLU A CA    1 
ATOM   526  C C     . GLU A 1 68  ? 20.600  -33.840 17.240  1.00 64.01  ? 110 GLU A C     1 
ATOM   527  O O     . GLU A 1 68  ? 21.521  -34.481 16.724  1.00 70.63  ? 110 GLU A O     1 
ATOM   528  C CB    . GLU A 1 68  ? 20.753  -35.352 19.236  1.00 61.86  ? 110 GLU A CB    1 
ATOM   529  C CG    . GLU A 1 68  ? 20.061  -36.573 18.611  1.00 63.96  ? 110 GLU A CG    1 
ATOM   530  C CD    . GLU A 1 68  ? 20.600  -37.916 19.153  1.00 71.61  ? 110 GLU A CD    1 
ATOM   531  O OE1   . GLU A 1 68  ? 20.674  -38.909 18.376  1.00 58.13  ? 110 GLU A OE1   1 
ATOM   532  O OE2   . GLU A 1 68  ? 20.961  -37.973 20.354  1.00 76.68  ? 110 GLU A OE2   1 
ATOM   533  N N     . LEU A 1 69  ? 19.831  -33.013 16.531  1.00 62.91  ? 111 LEU A N     1 
ATOM   534  C CA    . LEU A 1 69  ? 20.185  -32.634 15.171  1.00 67.21  ? 111 LEU A CA    1 
ATOM   535  C C     . LEU A 1 69  ? 20.993  -31.347 15.234  1.00 63.98  ? 111 LEU A C     1 
ATOM   536  O O     . LEU A 1 69  ? 20.426  -30.286 15.567  1.00 53.36  ? 111 LEU A O     1 
ATOM   537  C CB    . LEU A 1 69  ? 18.945  -32.449 14.307  1.00 60.84  ? 111 LEU A CB    1 
ATOM   538  C CG    . LEU A 1 69  ? 18.229  -33.734 13.899  1.00 61.24  ? 111 LEU A CG    1 
ATOM   539  C CD1   . LEU A 1 69  ? 17.164  -33.458 12.854  1.00 54.03  ? 111 LEU A CD1   1 
ATOM   540  C CD2   . LEU A 1 69  ? 19.256  -34.698 13.354  1.00 62.14  ? 111 LEU A CD2   1 
ATOM   541  N N     . PRO A 1 70  ? 22.308  -31.382 14.956  1.00 70.24  ? 112 PRO A N     1 
ATOM   542  C CA    . PRO A 1 70  ? 23.099  -30.143 15.003  1.00 68.37  ? 112 PRO A CA    1 
ATOM   543  C C     . PRO A 1 70  ? 22.761  -29.239 13.825  1.00 62.00  ? 112 PRO A C     1 
ATOM   544  O O     . PRO A 1 70  ? 22.427  -28.064 14.032  1.00 60.50  ? 112 PRO A O     1 
ATOM   545  C CB    . PRO A 1 70  ? 24.559  -30.635 14.955  1.00 63.72  ? 112 PRO A CB    1 
ATOM   546  C CG    . PRO A 1 70  ? 24.491  -32.130 15.151  1.00 66.03  ? 112 PRO A CG    1 
ATOM   547  C CD    . PRO A 1 70  ? 23.141  -32.557 14.653  1.00 65.35  ? 112 PRO A CD    1 
ATOM   548  N N     . GLY A 1 71  ? 22.794  -29.789 12.599  1.00 48.29  ? 113 GLY A N     1 
ATOM   549  C CA    . GLY A 1 71  ? 22.582  -29.014 11.387  1.00 43.25  ? 113 GLY A CA    1 
ATOM   550  C C     . GLY A 1 71  ? 21.156  -28.550 11.140  1.00 40.74  ? 113 GLY A C     1 
ATOM   551  O O     . GLY A 1 71  ? 20.863  -27.955 10.095  1.00 37.08  ? 113 GLY A O     1 
ATOM   552  N N     . LEU A 1 72  ? 20.262  -28.818 12.088  1.00 37.99  ? 114 LEU A N     1 
ATOM   553  C CA    . LEU A 1 72  ? 18.860  -28.437 12.011  1.00 35.41  ? 114 LEU A CA    1 
ATOM   554  C C     . LEU A 1 72  ? 18.367  -28.086 13.412  1.00 36.19  ? 114 LEU A C     1 
ATOM   555  O O     . LEU A 1 72  ? 17.407  -28.651 13.925  1.00 39.56  ? 114 LEU A O     1 
ATOM   556  C CB    . LEU A 1 72  ? 18.036  -29.562 11.389  1.00 35.77  ? 114 LEU A CB    1 
ATOM   557  C CG    . LEU A 1 72  ? 18.253  -29.839 9.896   1.00 36.12  ? 114 LEU A CG    1 
ATOM   558  C CD1   . LEU A 1 72  ? 17.639  -31.168 9.491   1.00 30.75  ? 114 LEU A CD1   1 
ATOM   559  C CD2   . LEU A 1 72  ? 17.670  -28.722 9.061   1.00 30.96  ? 114 LEU A CD2   1 
ATOM   560  N N     . SER A 1 73  ? 19.022  -27.126 14.057  1.00 35.57  ? 115 SER A N     1 
ATOM   561  C CA    . SER A 1 73  ? 18.774  -26.879 15.474  1.00 39.97  ? 115 SER A CA    1 
ATOM   562  C C     . SER A 1 73  ? 17.636  -25.901 15.731  1.00 36.73  ? 115 SER A C     1 
ATOM   563  O O     . SER A 1 73  ? 17.134  -25.846 16.862  1.00 36.63  ? 115 SER A O     1 
ATOM   564  C CB    . SER A 1 73  ? 20.047  -26.354 16.148  1.00 37.97  ? 115 SER A CB    1 
ATOM   565  O OG    . SER A 1 73  ? 20.303  -24.998 15.811  1.00 28.86  ? 115 SER A OG    1 
ATOM   566  N N     . HIS A 1 74  ? 17.236  -25.123 14.723  1.00 32.70  ? 116 HIS A N     1 
ATOM   567  C CA    . HIS A 1 74  ? 16.130  -24.177 14.839  1.00 27.18  ? 116 HIS A CA    1 
ATOM   568  C C     . HIS A 1 74  ? 14.850  -24.888 14.416  1.00 30.96  ? 116 HIS A C     1 
ATOM   569  O O     . HIS A 1 74  ? 14.673  -25.220 13.232  1.00 31.83  ? 116 HIS A O     1 
ATOM   570  C CB    . HIS A 1 74  ? 16.391  -22.948 13.974  1.00 28.07  ? 116 HIS A CB    1 
ATOM   571  C CG    . HIS A 1 74  ? 17.714  -22.307 14.238  1.00 36.72  ? 116 HIS A CG    1 
ATOM   572  N ND1   . HIS A 1 74  ? 18.854  -22.636 13.533  1.00 38.03  ? 116 HIS A ND1   1 
ATOM   573  C CD2   . HIS A 1 74  ? 18.090  -21.377 15.151  1.00 34.62  ? 116 HIS A CD2   1 
ATOM   574  C CE1   . HIS A 1 74  ? 19.869  -21.921 13.987  1.00 34.61  ? 116 HIS A CE1   1 
ATOM   575  N NE2   . HIS A 1 74  ? 19.433  -21.152 14.971  1.00 33.56  ? 116 HIS A NE2   1 
ATOM   576  N N     . GLN A 1 75  ? 13.956  -25.111 15.377  1.00 34.92  ? 117 GLN A N     1 
ATOM   577  C CA    . GLN A 1 75  ? 12.778  -25.949 15.201  1.00 30.76  ? 117 GLN A CA    1 
ATOM   578  C C     . GLN A 1 75  ? 11.550  -25.210 15.694  1.00 23.96  ? 117 GLN A C     1 
ATOM   579  O O     . GLN A 1 75  ? 11.610  -24.501 16.693  1.00 29.39  ? 117 GLN A O     1 
ATOM   580  C CB    . GLN A 1 75  ? 12.945  -27.256 15.952  1.00 29.55  ? 117 GLN A CB    1 
ATOM   581  C CG    . GLN A 1 75  ? 14.284  -27.924 15.681  1.00 27.05  ? 117 GLN A CG    1 
ATOM   582  C CD    . GLN A 1 75  ? 14.372  -29.262 16.348  1.00 36.99  ? 117 GLN A CD    1 
ATOM   583  O OE1   . GLN A 1 75  ? 13.499  -29.621 17.165  1.00 38.07  ? 117 GLN A OE1   1 
ATOM   584  N NE2   . GLN A 1 75  ? 15.421  -30.024 16.016  1.00 31.32  ? 117 GLN A NE2   1 
ATOM   585  N N     . TYR A 1 76  ? 10.450  -25.346 14.969  1.00 24.35  ? 118 TYR A N     1 
ATOM   586  C CA    . TYR A 1 76  ? 9.228   -24.596 15.219  1.00 20.75  ? 118 TYR A CA    1 
ATOM   587  C C     . TYR A 1 76  ? 8.074   -25.525 14.915  1.00 25.17  ? 118 TYR A C     1 
ATOM   588  O O     . TYR A 1 76  ? 8.040   -26.171 13.865  1.00 24.85  ? 118 TYR A O     1 
ATOM   589  C CB    . TYR A 1 76  ? 9.126   -23.332 14.353  1.00 25.09  ? 118 TYR A CB    1 
ATOM   590  C CG    . TYR A 1 76  ? 10.401  -22.555 14.299  1.00 31.15  ? 118 TYR A CG    1 
ATOM   591  C CD1   . TYR A 1 76  ? 11.392  -22.874 13.374  1.00 29.39  ? 118 TYR A CD1   1 
ATOM   592  C CD2   . TYR A 1 76  ? 10.644  -21.524 15.199  1.00 31.18  ? 118 TYR A CD2   1 
ATOM   593  C CE1   . TYR A 1 76  ? 12.578  -22.175 13.337  1.00 31.43  ? 118 TYR A CE1   1 
ATOM   594  C CE2   . TYR A 1 76  ? 11.824  -20.813 15.163  1.00 31.28  ? 118 TYR A CE2   1 
ATOM   595  C CZ    . TYR A 1 76  ? 12.789  -21.143 14.236  1.00 37.68  ? 118 TYR A CZ    1 
ATOM   596  O OH    . TYR A 1 76  ? 13.969  -20.429 14.212  1.00 46.10  ? 118 TYR A OH    1 
ATOM   597  N N     . TRP A 1 77  ? 7.147   -25.612 15.833  1.00 31.64  ? 119 TRP A N     1 
ATOM   598  C CA    . TRP A 1 77  ? 6.133   -26.636 15.750  1.00 31.39  ? 119 TRP A CA    1 
ATOM   599  C C     . TRP A 1 77  ? 4.781   -25.975 15.903  1.00 28.47  ? 119 TRP A C     1 
ATOM   600  O O     . TRP A 1 77  ? 4.637   -24.956 16.579  1.00 27.19  ? 119 TRP A O     1 
ATOM   601  C CB    . TRP A 1 77  ? 6.368   -27.725 16.804  1.00 26.94  ? 119 TRP A CB    1 
ATOM   602  C CG    . TRP A 1 77  ? 7.802   -28.262 16.774  1.00 30.63  ? 119 TRP A CG    1 
ATOM   603  C CD1   . TRP A 1 77  ? 8.874   -27.780 17.477  1.00 24.91  ? 119 TRP A CD1   1 
ATOM   604  C CD2   . TRP A 1 77  ? 8.300   -29.364 16.009  1.00 25.47  ? 119 TRP A CD2   1 
ATOM   605  N NE1   . TRP A 1 77  ? 9.989   -28.523 17.217  1.00 25.75  ? 119 TRP A NE1   1 
ATOM   606  C CE2   . TRP A 1 77  ? 9.672   -29.500 16.314  1.00 29.81  ? 119 TRP A CE2   1 
ATOM   607  C CE3   . TRP A 1 77  ? 7.723   -30.254 15.108  1.00 27.15  ? 119 TRP A CE3   1 
ATOM   608  C CZ2   . TRP A 1 77  ? 10.480  -30.480 15.729  1.00 32.44  ? 119 TRP A CZ2   1 
ATOM   609  C CZ3   . TRP A 1 77  ? 8.526   -31.248 14.542  1.00 28.97  ? 119 TRP A CZ3   1 
ATOM   610  C CH2   . TRP A 1 77  ? 9.887   -31.350 14.854  1.00 24.43  ? 119 TRP A CH2   1 
ATOM   611  N N     . SER A 1 78  ? 3.803   -26.532 15.215  1.00 33.52  ? 120 SER A N     1 
ATOM   612  C CA    . SER A 1 78  ? 2.441   -26.018 15.275  1.00 34.96  ? 120 SER A CA    1 
ATOM   613  C C     . SER A 1 78  ? 1.516   -27.219 15.242  1.00 34.33  ? 120 SER A C     1 
ATOM   614  O O     . SER A 1 78  ? 1.458   -27.929 14.232  1.00 31.42  ? 120 SER A O     1 
ATOM   615  C CB    . SER A 1 78  ? 2.157   -25.057 14.124  1.00 33.78  ? 120 SER A CB    1 
ATOM   616  O OG    . SER A 1 78  ? 0.808   -24.614 14.128  1.00 44.81  ? 120 SER A OG    1 
ATOM   617  N N     . ALA A 1 79  ? 0.838   -27.464 16.351  1.00 40.74  ? 121 ALA A N     1 
ATOM   618  C CA    . ALA A 1 79  ? -0.176  -28.496 16.452  1.00 42.55  ? 121 ALA A CA    1 
ATOM   619  C C     . ALA A 1 79  ? -1.544  -27.862 16.687  1.00 44.15  ? 121 ALA A C     1 
ATOM   620  O O     . ALA A 1 79  ? -1.639  -26.681 17.051  1.00 34.05  ? 121 ALA A O     1 
ATOM   621  C CB    . ALA A 1 79  ? 0.155   -29.476 17.585  1.00 41.57  ? 121 ALA A CB    1 
ATOM   622  N N     . PRO A 1 80  ? -2.628  -28.610 16.451  1.00 44.12  ? 122 PRO A N     1 
ATOM   623  C CA    . PRO A 1 80  ? -3.972  -28.077 16.713  1.00 48.22  ? 122 PRO A CA    1 
ATOM   624  C C     . PRO A 1 80  ? -4.307  -28.011 18.197  1.00 52.13  ? 122 PRO A C     1 
ATOM   625  O O     . PRO A 1 80  ? -3.774  -28.741 19.034  1.00 43.70  ? 122 PRO A O     1 
ATOM   626  C CB    . PRO A 1 80  ? -4.900  -29.058 15.984  1.00 49.35  ? 122 PRO A CB    1 
ATOM   627  C CG    . PRO A 1 80  ? -4.113  -30.303 15.860  1.00 49.27  ? 122 PRO A CG    1 
ATOM   628  C CD    . PRO A 1 80  ? -2.683  -29.874 15.695  1.00 38.45  ? 122 PRO A CD    1 
ATOM   629  N N     . SER A 1 81  ? -5.242  -27.116 18.500  1.00 62.40  ? 123 SER A N     1 
ATOM   630  C CA    . SER A 1 81  ? -5.586  -26.797 19.878  1.00 72.66  ? 123 SER A CA    1 
ATOM   631  C C     . SER A 1 81  ? -6.595  -27.767 20.479  1.00 72.84  ? 123 SER A C     1 
ATOM   632  O O     . SER A 1 81  ? -6.603  -27.965 21.700  1.00 67.33  ? 123 SER A O     1 
ATOM   633  C CB    . SER A 1 81  ? -6.100  -25.356 19.937  1.00 65.73  ? 123 SER A CB    1 
ATOM   634  O OG    . SER A 1 81  ? -6.993  -25.113 18.860  1.00 57.65  ? 123 SER A OG    1 
ATOM   635  N N     . ASP A 1 82  ? -7.437  -28.386 19.658  1.00 65.44  ? 124 ASP A N     1 
ATOM   636  C CA    . ASP A 1 82  ? -8.503  -29.228 20.184  1.00 63.40  ? 124 ASP A CA    1 
ATOM   637  C C     . ASP A 1 82  ? -8.251  -30.714 19.993  1.00 62.57  ? 124 ASP A C     1 
ATOM   638  O O     . ASP A 1 82  ? -8.499  -31.497 20.914  1.00 64.44  ? 124 ASP A O     1 
ATOM   639  C CB    . ASP A 1 82  ? -9.842  -28.846 19.536  1.00 57.57  ? 124 ASP A CB    1 
ATOM   640  N N     . LYS A 1 83  ? -7.727  -31.117 18.833  1.00 59.51  ? 125 LYS A N     1 
ATOM   641  C CA    . LYS A 1 83  ? -7.650  -32.523 18.431  1.00 58.07  ? 125 LYS A CA    1 
ATOM   642  C C     . LYS A 1 83  ? -6.230  -33.044 18.657  1.00 54.53  ? 125 LYS A C     1 
ATOM   643  O O     . LYS A 1 83  ? -5.316  -32.771 17.873  1.00 53.81  ? 125 LYS A O     1 
ATOM   644  C CB    . LYS A 1 83  ? -8.083  -32.680 16.975  1.00 51.79  ? 125 LYS A CB    1 
ATOM   645  N N     . GLU A 1 84  ? -6.059  -33.814 19.725  1.00 48.86  ? 126 GLU A N     1 
ATOM   646  C CA    . GLU A 1 84  ? -4.786  -34.466 20.009  1.00 55.77  ? 126 GLU A CA    1 
ATOM   647  C C     . GLU A 1 84  ? -4.511  -35.548 18.974  1.00 50.22  ? 126 GLU A C     1 
ATOM   648  O O     . GLU A 1 84  ? -5.420  -36.279 18.573  1.00 55.21  ? 126 GLU A O     1 
ATOM   649  C CB    . GLU A 1 84  ? -4.820  -35.085 21.416  1.00 57.17  ? 126 GLU A CB    1 
ATOM   650  C CG    . GLU A 1 84  ? -3.464  -35.297 22.080  1.00 56.15  ? 126 GLU A CG    1 
ATOM   651  C CD    . GLU A 1 84  ? -2.795  -33.986 22.407  1.00 58.97  ? 126 GLU A CD    1 
ATOM   652  O OE1   . GLU A 1 84  ? -1.549  -33.882 22.248  1.00 60.24  ? 126 GLU A OE1   1 
ATOM   653  O OE2   . GLU A 1 84  ? -3.534  -33.056 22.803  1.00 58.55  ? 126 GLU A OE2   1 
ATOM   654  N N     . GLY A 1 85  ? -3.254  -35.660 18.546  1.00 49.90  ? 127 GLY A N     1 
ATOM   655  C CA    . GLY A 1 85  ? -2.886  -36.719 17.614  1.00 44.76  ? 127 GLY A CA    1 
ATOM   656  C C     . GLY A 1 85  ? -3.454  -36.548 16.217  1.00 43.13  ? 127 GLY A C     1 
ATOM   657  O O     . GLY A 1 85  ? -3.706  -37.544 15.520  1.00 32.51  ? 127 GLY A O     1 
ATOM   658  N N     . TYR A 1 86  ? -3.639  -35.299 15.787  1.00 43.56  ? 128 TYR A N     1 
ATOM   659  C CA    . TYR A 1 86  ? -4.241  -34.939 14.513  1.00 38.97  ? 128 TYR A CA    1 
ATOM   660  C C     . TYR A 1 86  ? -3.439  -33.799 13.894  1.00 35.82  ? 128 TYR A C     1 
ATOM   661  O O     . TYR A 1 86  ? -3.038  -32.870 14.600  1.00 36.61  ? 128 TYR A O     1 
ATOM   662  C CB    . TYR A 1 86  ? -5.693  -34.512 14.737  1.00 44.19  ? 128 TYR A CB    1 
ATOM   663  C CG    . TYR A 1 86  ? -6.475  -34.039 13.517  1.00 49.03  ? 128 TYR A CG    1 
ATOM   664  C CD1   . TYR A 1 86  ? -6.843  -34.933 12.509  1.00 36.42  ? 128 TYR A CD1   1 
ATOM   665  C CD2   . TYR A 1 86  ? -6.914  -32.711 13.415  1.00 44.14  ? 128 TYR A CD2   1 
ATOM   666  C CE1   . TYR A 1 86  ? -7.599  -34.515 11.417  1.00 39.91  ? 128 TYR A CE1   1 
ATOM   667  C CE2   . TYR A 1 86  ? -7.665  -32.283 12.319  1.00 47.87  ? 128 TYR A CE2   1 
ATOM   668  C CZ    . TYR A 1 86  ? -8.003  -33.195 11.320  1.00 49.36  ? 128 TYR A CZ    1 
ATOM   669  O OH    . TYR A 1 86  ? -8.748  -32.798 10.222  1.00 52.99  ? 128 TYR A OH    1 
ATOM   670  N N     . SER A 1 87  ? -3.192  -33.879 12.591  1.00 34.30  ? 129 SER A N     1 
ATOM   671  C CA    . SER A 1 87  ? -2.595  -32.757 11.827  1.00 32.46  ? 129 SER A CA    1 
ATOM   672  C C     . SER A 1 87  ? -1.233  -32.393 12.441  1.00 27.46  ? 129 SER A C     1 
ATOM   673  O O     . SER A 1 87  ? -0.506  -33.279 12.916  1.00 24.86  ? 129 SER A O     1 
ATOM   674  C CB    . SER A 1 87  ? -3.608  -31.612 11.759  1.00 30.68  ? 129 SER A CB    1 
ATOM   675  O OG    . SER A 1 87  ? -3.059  -30.474 11.121  1.00 30.08  ? 129 SER A OG    1 
ATOM   676  N N     . GLY A 1 88  ? -0.851  -31.115 12.447  1.00 24.51  ? 130 GLY A N     1 
ATOM   677  C CA    . GLY A 1 88  ? 0.443   -30.724 12.971  1.00 30.88  ? 130 GLY A CA    1 
ATOM   678  C C     . GLY A 1 88  ? 1.572   -30.666 11.955  1.00 27.08  ? 130 GLY A C     1 
ATOM   679  O O     . GLY A 1 88  ? 1.840   -31.653 11.264  1.00 21.17  ? 130 GLY A O     1 
ATOM   680  N N     . VAL A 1 89  ? 2.257   -29.517 11.881  1.00 24.32  ? 131 VAL A N     1 
ATOM   681  C CA    . VAL A 1 89  ? 3.390   -29.325 10.984  1.00 25.56  ? 131 VAL A CA    1 
ATOM   682  C C     . VAL A 1 89  ? 4.635   -28.882 11.756  1.00 28.22  ? 131 VAL A C     1 
ATOM   683  O O     . VAL A 1 89  ? 4.570   -28.379 12.885  1.00 31.59  ? 131 VAL A O     1 
ATOM   684  C CB    . VAL A 1 89  ? 3.075   -28.317 9.867   1.00 23.86  ? 131 VAL A CB    1 
ATOM   685  C CG1   . VAL A 1 89  ? 2.029   -28.907 8.939   1.00 24.29  ? 131 VAL A CG1   1 
ATOM   686  C CG2   . VAL A 1 89  ? 2.616   -27.000 10.463  1.00 22.86  ? 131 VAL A CG2   1 
ATOM   687  N N     . GLY A 1 90  ? 5.781   -29.069 11.112  1.00 25.83  ? 132 GLY A N     1 
ATOM   688  C CA    . GLY A 1 90  ? 7.057   -28.723 11.707  1.00 26.21  ? 132 GLY A CA    1 
ATOM   689  C C     . GLY A 1 90  ? 7.985   -28.082 10.694  1.00 25.55  ? 132 GLY A C     1 
ATOM   690  O O     . GLY A 1 90  ? 7.926   -28.350 9.497   1.00 27.28  ? 132 GLY A O     1 
ATOM   691  N N     . LEU A 1 91  ? 8.865   -27.237 11.198  1.00 24.77  ? 133 LEU A N     1 
ATOM   692  C CA    . LEU A 1 91  ? 9.857   -26.596 10.359  1.00 27.29  ? 133 LEU A CA    1 
ATOM   693  C C     . LEU A 1 91  ? 11.162  -26.553 11.138  1.00 31.75  ? 133 LEU A C     1 
ATOM   694  O O     . LEU A 1 91  ? 11.211  -25.994 12.236  1.00 29.70  ? 133 LEU A O     1 
ATOM   695  C CB    . LEU A 1 91  ? 9.401   -25.200 9.950   1.00 27.58  ? 133 LEU A CB    1 
ATOM   696  C CG    . LEU A 1 91  ? 10.176  -24.564 8.797   1.00 34.18  ? 133 LEU A CG    1 
ATOM   697  C CD1   . LEU A 1 91  ? 9.213   -23.814 7.899   1.00 37.16  ? 133 LEU A CD1   1 
ATOM   698  C CD2   . LEU A 1 91  ? 11.267  -23.640 9.320   1.00 26.56  ? 133 LEU A CD2   1 
ATOM   699  N N     . LEU A 1 92  ? 12.204  -27.165 10.577  1.00 27.99  ? 134 LEU A N     1 
ATOM   700  C CA    . LEU A 1 92  ? 13.519  -27.214 11.192  1.00 30.39  ? 134 LEU A CA    1 
ATOM   701  C C     . LEU A 1 92  ? 14.509  -26.650 10.194  1.00 32.35  ? 134 LEU A C     1 
ATOM   702  O O     . LEU A 1 92  ? 14.517  -27.078 9.038   1.00 29.67  ? 134 LEU A O     1 
ATOM   703  C CB    . LEU A 1 92  ? 13.913  -28.645 11.558  1.00 29.96  ? 134 LEU A CB    1 
ATOM   704  C CG    . LEU A 1 92  ? 13.130  -29.439 12.599  1.00 27.56  ? 134 LEU A CG    1 
ATOM   705  C CD1   . LEU A 1 92  ? 11.737  -29.712 12.159  1.00 27.64  ? 134 LEU A CD1   1 
ATOM   706  C CD2   . LEU A 1 92  ? 13.824  -30.748 12.805  1.00 26.64  ? 134 LEU A CD2   1 
ATOM   707  N N     . SER A 1 93  ? 15.363  -25.721 10.621  1.00 34.71  ? 135 SER A N     1 
ATOM   708  C CA    A SER A 1 93  ? 16.336  -25.150 9.702   0.26 36.74  ? 135 SER A CA    1 
ATOM   709  C CA    B SER A 1 93  ? 16.327  -25.112 9.713   0.74 36.98  ? 135 SER A CA    1 
ATOM   710  C C     . SER A 1 93  ? 17.710  -25.037 10.350  1.00 32.93  ? 135 SER A C     1 
ATOM   711  O O     . SER A 1 93  ? 17.847  -24.867 11.569  1.00 33.67  ? 135 SER A O     1 
ATOM   712  C CB    A SER A 1 93  ? 15.880  -23.778 9.181   0.26 35.63  ? 135 SER A CB    1 
ATOM   713  C CB    B SER A 1 93  ? 15.886  -23.702 9.286   0.74 34.99  ? 135 SER A CB    1 
ATOM   714  O OG    A SER A 1 93  ? 15.710  -22.857 10.237  0.26 33.48  ? 135 SER A OG    1 
ATOM   715  O OG    B SER A 1 93  ? 16.976  -22.997 8.706   0.74 38.22  ? 135 SER A OG    1 
ATOM   716  N N     . ARG A 1 94  ? 18.734  -25.141 9.499   1.00 34.44  ? 136 ARG A N     1 
ATOM   717  C CA    . ARG A 1 94  ? 20.111  -24.942 9.931   1.00 34.25  ? 136 ARG A CA    1 
ATOM   718  C C     . ARG A 1 94  ? 20.319  -23.519 10.422  1.00 31.84  ? 136 ARG A C     1 
ATOM   719  O O     . ARG A 1 94  ? 20.880  -23.299 11.498  1.00 35.00  ? 136 ARG A O     1 
ATOM   720  C CB    . ARG A 1 94  ? 21.077  -25.260 8.781   1.00 31.50  ? 136 ARG A CB    1 
ATOM   721  C CG    . ARG A 1 94  ? 22.495  -24.728 8.977   1.00 29.51  ? 136 ARG A CG    1 
ATOM   722  C CD    . ARG A 1 94  ? 23.446  -25.129 7.844   1.00 33.22  ? 136 ARG A CD    1 
ATOM   723  N NE    . ARG A 1 94  ? 23.249  -24.403 6.582   1.00 33.89  ? 136 ARG A NE    1 
ATOM   724  C CZ    . ARG A 1 94  ? 23.779  -23.210 6.296   1.00 37.79  ? 136 ARG A CZ    1 
ATOM   725  N NH1   . ARG A 1 94  ? 24.530  -22.568 7.189   1.00 40.90  ? 136 ARG A NH1   1 
ATOM   726  N NH2   . ARG A 1 94  ? 23.551  -22.649 5.118   1.00 29.38  ? 136 ARG A NH2   1 
ATOM   727  N N     . GLN A 1 95  ? 19.885  -22.537 9.645   1.00 28.99  ? 137 GLN A N     1 
ATOM   728  C CA    . GLN A 1 95  ? 20.031  -21.144 10.031  1.00 36.20  ? 137 GLN A CA    1 
ATOM   729  C C     . GLN A 1 95  ? 18.684  -20.624 10.494  1.00 35.99  ? 137 GLN A C     1 
ATOM   730  O O     . GLN A 1 95  ? 17.671  -20.873 9.837   1.00 33.06  ? 137 GLN A O     1 
ATOM   731  C CB    . GLN A 1 95  ? 20.537  -20.287 8.881   1.00 28.68  ? 137 GLN A CB    1 
ATOM   732  C CG    . GLN A 1 95  ? 22.008  -20.444 8.573   1.00 37.79  ? 137 GLN A CG    1 
ATOM   733  C CD    . GLN A 1 95  ? 22.451  -19.443 7.524   1.00 41.39  ? 137 GLN A CD    1 
ATOM   734  O OE1   . GLN A 1 95  ? 21.981  -19.478 6.370   1.00 36.18  ? 137 GLN A OE1   1 
ATOM   735  N NE2   . GLN A 1 95  ? 23.325  -18.513 7.927   1.00 43.03  ? 137 GLN A NE2   1 
ATOM   736  N N     . ALA A 1 96  ? 18.690  -19.909 11.620  1.00 31.43  ? 138 ALA A N     1 
ATOM   737  C CA    . ALA A 1 96  ? 17.484  -19.303 12.163  1.00 34.33  ? 138 ALA A CA    1 
ATOM   738  C C     . ALA A 1 96  ? 16.850  -18.356 11.147  1.00 31.14  ? 138 ALA A C     1 
ATOM   739  O O     . ALA A 1 96  ? 17.548  -17.580 10.488  1.00 32.04  ? 138 ALA A O     1 
ATOM   740  C CB    . ALA A 1 96  ? 17.808  -18.533 13.446  1.00 36.58  ? 138 ALA A CB    1 
ATOM   741  N N     . PRO A 1 97  ? 15.544  -18.396 10.986  1.00 32.01  ? 139 PRO A N     1 
ATOM   742  C CA    . PRO A 1 97  ? 14.888  -17.461 10.076  1.00 37.15  ? 139 PRO A CA    1 
ATOM   743  C C     . PRO A 1 97  ? 14.769  -16.072 10.697  1.00 36.96  ? 139 PRO A C     1 
ATOM   744  O O     . PRO A 1 97  ? 15.129  -15.834 11.847  1.00 38.79  ? 139 PRO A O     1 
ATOM   745  C CB    . PRO A 1 97  ? 13.515  -18.102 9.826   1.00 31.66  ? 139 PRO A CB    1 
ATOM   746  C CG    . PRO A 1 97  ? 13.352  -19.109 10.863  1.00 32.85  ? 139 PRO A CG    1 
ATOM   747  C CD    . PRO A 1 97  ? 14.690  -19.532 11.344  1.00 32.35  ? 139 PRO A CD    1 
ATOM   748  N N     . LEU A 1 98  ? 14.291  -15.136 9.880   1.00 38.85  ? 140 LEU A N     1 
ATOM   749  C CA    . LEU A 1 98  ? 14.032  -13.789 10.364  1.00 35.95  ? 140 LEU A CA    1 
ATOM   750  C C     . LEU A 1 98  ? 12.698  -13.707 11.084  1.00 38.45  ? 140 LEU A C     1 
ATOM   751  O O     . LEU A 1 98  ? 12.596  -13.029 12.112  1.00 44.42  ? 140 LEU A O     1 
ATOM   752  C CB    . LEU A 1 98  ? 14.046  -12.804 9.202   1.00 43.82  ? 140 LEU A CB    1 
ATOM   753  C CG    . LEU A 1 98  ? 15.350  -12.740 8.409   1.00 44.81  ? 140 LEU A CG    1 
ATOM   754  C CD1   . LEU A 1 98  ? 15.095  -12.099 7.063   1.00 49.20  ? 140 LEU A CD1   1 
ATOM   755  C CD2   . LEU A 1 98  ? 16.383  -11.943 9.156   1.00 35.88  ? 140 LEU A CD2   1 
ATOM   756  N N     . LYS A 1 99  ? 11.664  -14.364 10.546  1.00 33.13  ? 141 LYS A N     1 
ATOM   757  C CA    . LYS A 1 99  ? 10.316  -14.338 11.101  1.00 32.16  ? 141 LYS A CA    1 
ATOM   758  C C     . LYS A 1 99  ? 9.719   -15.729 11.015  1.00 32.56  ? 141 LYS A C     1 
ATOM   759  O O     . LYS A 1 99  ? 9.856   -16.405 9.994   1.00 34.89  ? 141 LYS A O     1 
ATOM   760  C CB    . LYS A 1 99  ? 9.373   -13.361 10.360  1.00 31.94  ? 141 LYS A CB    1 
ATOM   761  C CG    . LYS A 1 99  ? 9.811   -11.912 10.375  1.00 42.77  ? 141 LYS A CG    1 
ATOM   762  C CD    . LYS A 1 99  ? 8.828   -10.986 9.672   1.00 43.32  ? 141 LYS A CD    1 
ATOM   763  C CE    . LYS A 1 99  ? 9.383   -9.563  9.665   1.00 37.36  ? 141 LYS A CE    1 
ATOM   764  N NZ    . LYS A 1 99  ? 9.331   -8.978  8.301   1.00 41.31  ? 141 LYS A NZ    1 
ATOM   765  N N     . VAL A 1 100 ? 9.044   -16.149 12.077  1.00 29.09  ? 142 VAL A N     1 
ATOM   766  C CA    . VAL A 1 100 ? 8.217   -17.343 12.036  1.00 29.63  ? 142 VAL A CA    1 
ATOM   767  C C     . VAL A 1 100 ? 6.817   -16.949 12.479  1.00 30.65  ? 142 VAL A C     1 
ATOM   768  O O     . VAL A 1 100 ? 6.650   -16.130 13.385  1.00 37.30  ? 142 VAL A O     1 
ATOM   769  C CB    . VAL A 1 100 ? 8.800   -18.477 12.914  1.00 32.88  ? 142 VAL A CB    1 
ATOM   770  C CG1   . VAL A 1 100 ? 7.898   -19.729 12.906  1.00 26.48  ? 142 VAL A CG1   1 
ATOM   771  C CG2   . VAL A 1 100 ? 10.196  -18.832 12.440  1.00 31.31  ? 142 VAL A CG2   1 
ATOM   772  N N     . SER A 1 101 ? 5.807   -17.501 11.823  1.00 29.45  ? 143 SER A N     1 
ATOM   773  C CA    . SER A 1 101 ? 4.446   -17.257 12.263  1.00 23.59  ? 143 SER A CA    1 
ATOM   774  C C     . SER A 1 101 ? 3.605   -18.469 11.906  1.00 25.76  ? 143 SER A C     1 
ATOM   775  O O     . SER A 1 101 ? 4.003   -19.299 11.089  1.00 32.17  ? 143 SER A O     1 
ATOM   776  C CB    . SER A 1 101 ? 3.885   -15.975 11.650  1.00 21.60  ? 143 SER A CB    1 
ATOM   777  O OG    . SER A 1 101 ? 3.884   -16.047 10.249  1.00 29.38  ? 143 SER A OG    1 
ATOM   778  N N     . TYR A 1 102 ? 2.440   -18.581 12.539  1.00 30.52  ? 144 TYR A N     1 
ATOM   779  C CA    . TYR A 1 102 ? 1.579   -19.746 12.369  1.00 30.54  ? 144 TYR A CA    1 
ATOM   780  C C     . TYR A 1 102 ? 0.229   -19.312 11.831  1.00 29.89  ? 144 TYR A C     1 
ATOM   781  O O     . TYR A 1 102 ? -0.280  -18.252 12.189  1.00 34.40  ? 144 TYR A O     1 
ATOM   782  C CB    . TYR A 1 102 ? 1.435   -20.510 13.675  1.00 18.44  ? 144 TYR A CB    1 
ATOM   783  C CG    . TYR A 1 102 ? 2.797   -20.784 14.244  1.00 24.29  ? 144 TYR A CG    1 
ATOM   784  C CD1   . TYR A 1 102 ? 3.405   -19.883 15.104  1.00 28.12  ? 144 TYR A CD1   1 
ATOM   785  C CD2   . TYR A 1 102 ? 3.504   -21.916 13.888  1.00 26.81  ? 144 TYR A CD2   1 
ATOM   786  C CE1   . TYR A 1 102 ? 4.670   -20.119 15.615  1.00 33.14  ? 144 TYR A CE1   1 
ATOM   787  C CE2   . TYR A 1 102 ? 4.770   -22.169 14.396  1.00 27.67  ? 144 TYR A CE2   1 
ATOM   788  C CZ    . TYR A 1 102 ? 5.350   -21.267 15.256  1.00 32.70  ? 144 TYR A CZ    1 
ATOM   789  O OH    . TYR A 1 102 ? 6.613   -21.501 15.764  1.00 28.77  ? 144 TYR A OH    1 
ATOM   790  N N     . GLY A 1 103 ? -0.311  -20.107 10.916  1.00 34.71  ? 145 GLY A N     1 
ATOM   791  C CA    . GLY A 1 103 ? -1.600  -19.833 10.327  1.00 35.77  ? 145 GLY A CA    1 
ATOM   792  C C     . GLY A 1 103 ? -1.542  -18.887 9.142   1.00 41.06  ? 145 GLY A C     1 
ATOM   793  O O     . GLY A 1 103 ? -0.511  -18.289 8.811   1.00 37.43  ? 145 GLY A O     1 
ATOM   794  N N     . ILE A 1 104 ? -2.705  -18.734 8.510   1.00 44.45  ? 146 ILE A N     1 
ATOM   795  C CA    . ILE A 1 104 ? -2.872  -17.915 7.314   1.00 44.00  ? 146 ILE A CA    1 
ATOM   796  C C     . ILE A 1 104 ? -3.781  -16.724 7.607   1.00 48.47  ? 146 ILE A C     1 
ATOM   797  O O     . ILE A 1 104 ? -4.518  -16.255 6.728   1.00 50.73  ? 146 ILE A O     1 
ATOM   798  C CB    . ILE A 1 104 ? -3.432  -18.748 6.150   1.00 43.05  ? 146 ILE A CB    1 
ATOM   799  C CG1   . ILE A 1 104 ? -4.855  -19.220 6.464   1.00 45.36  ? 146 ILE A CG1   1 
ATOM   800  C CG2   . ILE A 1 104 ? -2.501  -19.939 5.842   1.00 40.92  ? 146 ILE A CG2   1 
ATOM   801  C CD1   . ILE A 1 104 ? -5.505  -20.017 5.350   1.00 43.97  ? 146 ILE A CD1   1 
ATOM   802  N N     . GLY A 1 105 ? -3.737  -16.212 8.833   1.00 49.50  ? 147 GLY A N     1 
ATOM   803  C CA    . GLY A 1 105 ? -4.463  -14.985 9.095   1.00 55.17  ? 147 GLY A CA    1 
ATOM   804  C C     . GLY A 1 105 ? -5.957  -15.081 9.376   1.00 54.14  ? 147 GLY A C     1 
ATOM   805  O O     . GLY A 1 105 ? -6.432  -14.319 10.217  1.00 58.51  ? 147 GLY A O     1 
ATOM   806  N N     . ASP A 1 106 ? -6.712  -15.974 8.713   1.00 59.90  ? 148 ASP A N     1 
ATOM   807  C CA    . ASP A 1 106 ? -8.123  -16.205 9.045   1.00 65.63  ? 148 ASP A CA    1 
ATOM   808  C C     . ASP A 1 106 ? -8.246  -16.769 10.466  1.00 66.83  ? 148 ASP A C     1 
ATOM   809  O O     . ASP A 1 106 ? -7.241  -17.007 11.140  1.00 76.71  ? 148 ASP A O     1 
ATOM   810  C CB    . ASP A 1 106 ? -8.752  -17.254 8.111   1.00 53.62  ? 148 ASP A CB    1 
ATOM   811  N N     . GLU A 1 107 ? -9.452  -16.927 10.985  1.00 69.34  ? 149 GLU A N     1 
ATOM   812  C CA    . GLU A 1 107 ? -9.626  -17.701 12.213  1.00 68.31  ? 149 GLU A CA    1 
ATOM   813  C C     . GLU A 1 107 ? -10.357 -19.012 12.096  1.00 67.82  ? 149 GLU A C     1 
ATOM   814  O O     . GLU A 1 107 ? -10.023 -19.968 12.811  1.00 56.84  ? 149 GLU A O     1 
ATOM   815  C CB    . GLU A 1 107 ? -10.362 -16.813 13.235  1.00 55.55  ? 149 GLU A CB    1 
ATOM   816  N N     . GLU A 1 108 ? -11.311 -19.088 11.169  1.00 60.08  ? 150 GLU A N     1 
ATOM   817  C CA    . GLU A 1 108 ? -11.917 -20.345 10.769  1.00 68.31  ? 150 GLU A CA    1 
ATOM   818  C C     . GLU A 1 108 ? -10.894 -21.342 10.244  1.00 61.97  ? 150 GLU A C     1 
ATOM   819  O O     . GLU A 1 108 ? -11.244 -22.515 10.088  1.00 55.37  ? 150 GLU A O     1 
ATOM   820  C CB    . GLU A 1 108 ? -12.996 -20.091 9.702   1.00 56.53  ? 150 GLU A CB    1 
ATOM   821  N N     . HIS A 1 109 ? -9.637  -20.922 9.997   1.00 61.67  ? 151 HIS A N     1 
ATOM   822  C CA    . HIS A 1 109 ? -8.689  -21.767 9.277   1.00 55.81  ? 151 HIS A CA    1 
ATOM   823  C C     . HIS A 1 109 ? -7.337  -22.009 9.946   1.00 59.56  ? 151 HIS A C     1 
ATOM   824  O O     . HIS A 1 109 ? -6.641  -22.938 9.517   1.00 49.18  ? 151 HIS A O     1 
ATOM   825  C CB    . HIS A 1 109 ? -8.443  -21.203 7.866   1.00 56.89  ? 151 HIS A CB    1 
ATOM   826  C CG    . HIS A 1 109 ? -9.657  -21.237 6.993   1.00 54.15  ? 151 HIS A CG    1 
ATOM   827  N ND1   . HIS A 1 109 ? -10.308 -22.412 6.680   1.00 48.77  ? 151 HIS A ND1   1 
ATOM   828  C CD2   . HIS A 1 109 ? -10.348 -20.245 6.382   1.00 43.86  ? 151 HIS A CD2   1 
ATOM   829  C CE1   . HIS A 1 109 ? -11.348 -22.142 5.910   1.00 46.16  ? 151 HIS A CE1   1 
ATOM   830  N NE2   . HIS A 1 109 ? -11.392 -20.836 5.712   1.00 45.01  ? 151 HIS A NE2   1 
ATOM   831  N N     . ASP A 1 110 ? -6.927  -21.213 10.952  1.00 67.67  ? 152 ASP A N     1 
ATOM   832  C CA    . ASP A 1 110 ? -5.691  -21.467 11.701  1.00 65.66  ? 152 ASP A CA    1 
ATOM   833  C C     . ASP A 1 110 ? -5.974  -22.088 13.065  1.00 59.62  ? 152 ASP A C     1 
ATOM   834  O O     . ASP A 1 110 ? -5.321  -21.763 14.059  1.00 67.29  ? 152 ASP A O     1 
ATOM   835  C CB    . ASP A 1 110 ? -4.839  -20.209 11.890  1.00 57.12  ? 152 ASP A CB    1 
ATOM   836  C CG    . ASP A 1 110 ? -4.828  -19.327 10.726  1.00 62.17  ? 152 ASP A CG    1 
ATOM   837  O OD1   . ASP A 1 110 ? -4.141  -19.604 9.784   1.00 72.27  ? 152 ASP A OD1   1 
ATOM   838  O OD2   . ASP A 1 110 ? -5.482  -18.325 10.765  1.00 52.81  ? 152 ASP A OD2   1 
ATOM   839  N N     . GLN A 1 111 ? -6.919  -23.018 13.117  1.00 54.64  ? 153 GLN A N     1 
ATOM   840  C CA    . GLN A 1 111 ? -7.206  -23.738 14.346  1.00 60.35  ? 153 GLN A CA    1 
ATOM   841  C C     . GLN A 1 111 ? -6.607  -25.141 14.362  1.00 57.41  ? 153 GLN A C     1 
ATOM   842  O O     . GLN A 1 111 ? -6.786  -25.865 15.341  1.00 54.64  ? 153 GLN A O     1 
ATOM   843  C CB    . GLN A 1 111 ? -8.720  -23.800 14.581  1.00 73.53  ? 153 GLN A CB    1 
ATOM   844  N N     . GLU A 1 112 ? -5.873  -25.542 13.323  1.00 58.37  ? 154 GLU A N     1 
ATOM   845  C CA    . GLU A 1 112 ? -5.473  -26.939 13.208  1.00 48.90  ? 154 GLU A CA    1 
ATOM   846  C C     . GLU A 1 112 ? -3.981  -27.171 13.053  1.00 33.47  ? 154 GLU A C     1 
ATOM   847  O O     . GLU A 1 112 ? -3.574  -28.313 12.835  1.00 36.96  ? 154 GLU A O     1 
ATOM   848  C CB    . GLU A 1 112 ? -6.201  -27.606 12.042  1.00 46.37  ? 154 GLU A CB    1 
ATOM   849  C CG    . GLU A 1 112 ? -7.401  -28.363 12.496  1.00 46.66  ? 154 GLU A CG    1 
ATOM   850  C CD    . GLU A 1 112 ? -8.348  -28.633 11.375  1.00 54.84  ? 154 GLU A CD    1 
ATOM   851  O OE1   . GLU A 1 112 ? -7.939  -28.469 10.205  1.00 55.76  ? 154 GLU A OE1   1 
ATOM   852  O OE2   . GLU A 1 112 ? -9.512  -29.001 11.662  1.00 64.57  ? 154 GLU A OE2   1 
ATOM   853  N N     . GLY A 1 113 ? -3.161  -26.142 13.165  1.00 31.30  ? 155 GLY A N     1 
ATOM   854  C CA    . GLY A 1 113 ? -1.743  -26.334 12.987  1.00 28.47  ? 155 GLY A CA    1 
ATOM   855  C C     . GLY A 1 113 ? -1.401  -26.905 11.631  1.00 27.08  ? 155 GLY A C     1 
ATOM   856  O O     . GLY A 1 113 ? -0.819  -27.996 11.543  1.00 27.25  ? 155 GLY A O     1 
ATOM   857  N N     . ARG A 1 114 ? -1.753  -26.187 10.562  1.00 22.65  ? 156 ARG A N     1 
ATOM   858  C CA    . ARG A 1 114 ? -1.494  -26.685 9.213   1.00 21.41  ? 156 ARG A CA    1 
ATOM   859  C C     . ARG A 1 114 ? -0.452  -25.888 8.450   1.00 19.63  ? 156 ARG A C     1 
ATOM   860  O O     . ARG A 1 114 ? -0.065  -26.310 7.362   1.00 26.34  ? 156 ARG A O     1 
ATOM   861  C CB    . ARG A 1 114 ? -2.786  -26.708 8.388   1.00 19.79  ? 156 ARG A CB    1 
ATOM   862  C CG    . ARG A 1 114 ? -3.889  -27.525 9.003   1.00 24.88  ? 156 ARG A CG    1 
ATOM   863  C CD    . ARG A 1 114 ? -5.028  -27.671 8.013   1.00 33.92  ? 156 ARG A CD    1 
ATOM   864  N NE    . ARG A 1 114 ? -5.924  -28.752 8.395   1.00 34.89  ? 156 ARG A NE    1 
ATOM   865  C CZ    . ARG A 1 114 ? -5.793  -30.024 8.031   1.00 30.81  ? 156 ARG A CZ    1 
ATOM   866  N NH1   . ARG A 1 114 ? -4.798  -30.414 7.236   1.00 25.77  ? 156 ARG A NH1   1 
ATOM   867  N NH2   . ARG A 1 114 ? -6.685  -30.914 8.468   1.00 34.24  ? 156 ARG A NH2   1 
ATOM   868  N N     . VAL A 1 115 ? 0.010   -24.761 8.974   1.00 20.05  ? 157 VAL A N     1 
ATOM   869  C CA    . VAL A 1 115 ? 0.795   -23.812 8.193   1.00 23.07  ? 157 VAL A CA    1 
ATOM   870  C C     . VAL A 1 115 ? 1.830   -23.151 9.088   1.00 25.23  ? 157 VAL A C     1 
ATOM   871  O O     . VAL A 1 115 ? 1.502   -22.658 10.173  1.00 20.78  ? 157 VAL A O     1 
ATOM   872  C CB    . VAL A 1 115 ? -0.098  -22.740 7.535   1.00 22.30  ? 157 VAL A CB    1 
ATOM   873  C CG1   . VAL A 1 115 ? 0.760   -21.524 7.137   1.00 26.20  ? 157 VAL A CG1   1 
ATOM   874  C CG2   . VAL A 1 115 ? -0.813  -23.315 6.320   1.00 21.01  ? 157 VAL A CG2   1 
ATOM   875  N N     . ILE A 1 116 ? 3.080   -23.135 8.628   1.00 25.62  ? 158 ILE A N     1 
ATOM   876  C CA    . ILE A 1 116 ? 4.144   -22.368 9.265   1.00 23.14  ? 158 ILE A CA    1 
ATOM   877  C C     . ILE A 1 116 ? 4.735   -21.470 8.201   1.00 20.24  ? 158 ILE A C     1 
ATOM   878  O O     . ILE A 1 116 ? 5.005   -21.929 7.091   1.00 26.75  ? 158 ILE A O     1 
ATOM   879  C CB    . ILE A 1 116 ? 5.230   -23.275 9.868   1.00 27.84  ? 158 ILE A CB    1 
ATOM   880  C CG1   . ILE A 1 116 ? 4.633   -24.181 10.934  1.00 24.29  ? 158 ILE A CG1   1 
ATOM   881  C CG2   . ILE A 1 116 ? 6.390   -22.438 10.449  1.00 31.09  ? 158 ILE A CG2   1 
ATOM   882  C CD1   . ILE A 1 116 ? 5.619   -25.228 11.453  1.00 32.97  ? 158 ILE A CD1   1 
ATOM   883  N N     . VAL A 1 117 ? 4.910   -20.195 8.514   1.00 27.81  ? 159 VAL A N     1 
ATOM   884  C CA    . VAL A 1 117 ? 5.542   -19.256 7.593   1.00 27.72  ? 159 VAL A CA    1 
ATOM   885  C C     . VAL A 1 117 ? 6.889   -18.873 8.176   1.00 27.19  ? 159 VAL A C     1 
ATOM   886  O O     . VAL A 1 117 ? 6.957   -18.290 9.266   1.00 33.02  ? 159 VAL A O     1 
ATOM   887  C CB    . VAL A 1 117 ? 4.684   -18.010 7.337   1.00 22.98  ? 159 VAL A CB    1 
ATOM   888  C CG1   . VAL A 1 117 ? 5.401   -17.086 6.329   1.00 18.34  ? 159 VAL A CG1   1 
ATOM   889  C CG2   . VAL A 1 117 ? 3.314   -18.414 6.849   1.00 19.15  ? 159 VAL A CG2   1 
ATOM   890  N N     . ALA A 1 118 ? 7.951   -19.198 7.447   1.00 25.84  ? 160 ALA A N     1 
ATOM   891  C CA    . ALA A 1 118 ? 9.332   -18.887 7.815   1.00 28.79  ? 160 ALA A CA    1 
ATOM   892  C C     . ALA A 1 118 ? 9.903   -17.908 6.795   1.00 29.22  ? 160 ALA A C     1 
ATOM   893  O O     . ALA A 1 118 ? 9.924   -18.197 5.590   1.00 30.20  ? 160 ALA A O     1 
ATOM   894  C CB    . ALA A 1 118 ? 10.198  -20.155 7.870   1.00 26.55  ? 160 ALA A CB    1 
ATOM   895  N N     . GLU A 1 119 ? 10.364  -16.759 7.270   1.00 26.54  ? 161 GLU A N     1 
ATOM   896  C CA    . GLU A 1 119 ? 10.957  -15.752 6.400   1.00 33.67  ? 161 GLU A CA    1 
ATOM   897  C C     . GLU A 1 119 ? 12.482  -15.742 6.514   1.00 35.22  ? 161 GLU A C     1 
ATOM   898  O O     . GLU A 1 119 ? 13.036  -15.718 7.629   1.00 33.13  ? 161 GLU A O     1 
ATOM   899  C CB    . GLU A 1 119 ? 10.391  -14.364 6.714   1.00 30.53  ? 161 GLU A CB    1 
ATOM   900  C CG    . GLU A 1 119 ? 10.765  -13.345 5.648   1.00 43.75  ? 161 GLU A CG    1 
ATOM   901  C CD    . GLU A 1 119 ? 10.352  -11.919 5.942   1.00 47.00  ? 161 GLU A CD    1 
ATOM   902  O OE1   . GLU A 1 119 ? 9.137   -11.648 6.186   1.00 51.33  ? 161 GLU A OE1   1 
ATOM   903  O OE2   . GLU A 1 119 ? 11.247  -11.068 5.923   1.00 58.82  ? 161 GLU A OE2   1 
ATOM   904  N N     . PHE A 1 120 ? 13.152  -15.772 5.360   1.00 29.38  ? 162 PHE A N     1 
ATOM   905  C CA    . PHE A 1 120 ? 14.620  -15.718 5.279   1.00 41.30  ? 162 PHE A CA    1 
ATOM   906  C C     . PHE A 1 120 ? 15.049  -14.504 4.447   1.00 39.26  ? 162 PHE A C     1 
ATOM   907  O O     . PHE A 1 120 ? 14.220  -13.777 3.893   1.00 41.52  ? 162 PHE A O     1 
ATOM   908  C CB    . PHE A 1 120 ? 15.206  -17.023 4.715   1.00 25.96  ? 162 PHE A CB    1 
ATOM   909  C CG    . PHE A 1 120 ? 14.930  -18.237 5.574   1.00 28.63  ? 162 PHE A CG    1 
ATOM   910  C CD1   . PHE A 1 120 ? 15.760  -18.566 6.623   1.00 34.85  ? 162 PHE A CD1   1 
ATOM   911  C CD2   . PHE A 1 120 ? 13.831  -19.049 5.332   1.00 28.97  ? 162 PHE A CD2   1 
ATOM   912  C CE1   . PHE A 1 120 ? 15.505  -19.688 7.410   1.00 28.47  ? 162 PHE A CE1   1 
ATOM   913  C CE2   . PHE A 1 120 ? 13.577  -20.146 6.105   1.00 22.64  ? 162 PHE A CE2   1 
ATOM   914  C CZ    . PHE A 1 120 ? 14.416  -20.469 7.144   1.00 26.40  ? 162 PHE A CZ    1 
ATOM   915  N N     . ASP A 1 121 ? 16.366  -14.292 4.387   1.00 45.23  ? 163 ASP A N     1 
ATOM   916  C CA    . ASP A 1 121 ? 16.927  -13.076 3.799   1.00 49.14  ? 163 ASP A CA    1 
ATOM   917  C C     . ASP A 1 121 ? 16.372  -12.818 2.401   1.00 47.31  ? 163 ASP A C     1 
ATOM   918  O O     . ASP A 1 121 ? 15.917  -11.710 2.089   1.00 46.57  ? 163 ASP A O     1 
ATOM   919  C CB    . ASP A 1 121 ? 18.460  -13.175 3.777   1.00 39.97  ? 163 ASP A CB    1 
ATOM   920  C CG    . ASP A 1 121 ? 19.101  -12.778 5.126   1.00 57.06  ? 163 ASP A CG    1 
ATOM   921  O OD1   . ASP A 1 121 ? 18.421  -12.143 5.961   1.00 54.19  ? 163 ASP A OD1   1 
ATOM   922  O OD2   . ASP A 1 121 ? 20.294  -13.075 5.358   1.00 61.33  ? 163 ASP A OD2   1 
ATOM   923  N N     . SER A 1 122 ? 16.365  -13.844 1.556   1.00 45.77  ? 164 SER A N     1 
ATOM   924  C CA    . SER A 1 122 ? 15.994  -13.691 0.157   1.00 47.02  ? 164 SER A CA    1 
ATOM   925  C C     . SER A 1 122 ? 14.631  -14.266 -0.210  1.00 42.54  ? 164 SER A C     1 
ATOM   926  O O     . SER A 1 122 ? 14.060  -13.848 -1.216  1.00 43.76  ? 164 SER A O     1 
ATOM   927  C CB    . SER A 1 122 ? 17.061  -14.342 -0.727  1.00 45.94  ? 164 SER A CB    1 
ATOM   928  O OG    . SER A 1 122 ? 17.569  -15.493 -0.075  1.00 52.06  ? 164 SER A OG    1 
ATOM   929  N N     . PHE A 1 123 ? 14.082  -15.189 0.572   1.00 43.79  ? 165 PHE A N     1 
ATOM   930  C CA    . PHE A 1 123 ? 12.815  -15.812 0.225   1.00 40.44  ? 165 PHE A CA    1 
ATOM   931  C C     . PHE A 1 123 ? 11.965  -16.016 1.476   1.00 40.94  ? 165 PHE A C     1 
ATOM   932  O O     . PHE A 1 123 ? 12.452  -15.960 2.608   1.00 37.30  ? 165 PHE A O     1 
ATOM   933  C CB    . PHE A 1 123 ? 13.042  -17.149 -0.441  1.00 32.06  ? 165 PHE A CB    1 
ATOM   934  C CG    . PHE A 1 123 ? 13.578  -18.179 0.494   1.00 33.53  ? 165 PHE A CG    1 
ATOM   935  C CD1   . PHE A 1 123 ? 14.881  -18.123 0.918   1.00 32.83  ? 165 PHE A CD1   1 
ATOM   936  C CD2   . PHE A 1 123 ? 12.781  -19.209 0.944   1.00 37.13  ? 165 PHE A CD2   1 
ATOM   937  C CE1   . PHE A 1 123 ? 15.385  -19.080 1.768   1.00 32.83  ? 165 PHE A CE1   1 
ATOM   938  C CE2   . PHE A 1 123 ? 13.289  -20.167 1.809   1.00 34.39  ? 165 PHE A CE2   1 
ATOM   939  C CZ    . PHE A 1 123 ? 14.596  -20.100 2.210   1.00 27.17  ? 165 PHE A CZ    1 
ATOM   940  N N     . VAL A 1 124 ? 10.676  -16.269 1.245   1.00 38.11  ? 166 VAL A N     1 
ATOM   941  C CA    . VAL A 1 124 ? 9.728   -16.647 2.284   1.00 35.20  ? 166 VAL A CA    1 
ATOM   942  C C     . VAL A 1 124 ? 9.316   -18.091 2.051   1.00 34.17  ? 166 VAL A C     1 
ATOM   943  O O     . VAL A 1 124 ? 8.848   -18.444 0.957   1.00 31.04  ? 166 VAL A O     1 
ATOM   944  C CB    . VAL A 1 124 ? 8.504   -15.721 2.291   1.00 31.92  ? 166 VAL A CB    1 
ATOM   945  C CG1   . VAL A 1 124 ? 7.615   -16.032 3.500   1.00 33.21  ? 166 VAL A CG1   1 
ATOM   946  C CG2   . VAL A 1 124 ? 8.968   -14.306 2.327   1.00 34.41  ? 166 VAL A CG2   1 
ATOM   947  N N     . LEU A 1 125 ? 9.487   -18.926 3.078   1.00 31.47  ? 167 LEU A N     1 
ATOM   948  C CA    . LEU A 1 125 ? 9.102   -20.330 3.012   1.00 30.80  ? 167 LEU A CA    1 
ATOM   949  C C     . LEU A 1 125 ? 7.799   -20.546 3.788   1.00 27.98  ? 167 LEU A C     1 
ATOM   950  O O     . LEU A 1 125 ? 7.690   -20.154 4.953   1.00 26.27  ? 167 LEU A O     1 
ATOM   951  C CB    . LEU A 1 125 ? 10.238  -21.207 3.542   1.00 25.58  ? 167 LEU A CB    1 
ATOM   952  C CG    . LEU A 1 125 ? 10.032  -22.724 3.653   1.00 31.52  ? 167 LEU A CG    1 
ATOM   953  C CD1   . LEU A 1 125 ? 9.341   -23.279 2.425   1.00 29.67  ? 167 LEU A CD1   1 
ATOM   954  C CD2   . LEU A 1 125 ? 11.373  -23.439 3.850   1.00 29.39  ? 167 LEU A CD2   1 
ATOM   955  N N     . VAL A 1 126 ? 6.805   -21.122 3.124   1.00 23.63  ? 168 VAL A N     1 
ATOM   956  C CA    . VAL A 1 126 ? 5.547   -21.535 3.742   1.00 26.02  ? 168 VAL A CA    1 
ATOM   957  C C     . VAL A 1 126 ? 5.475   -23.044 3.648   1.00 27.19  ? 168 VAL A C     1 
ATOM   958  O O     . VAL A 1 126 ? 5.833   -23.617 2.618   1.00 31.31  ? 168 VAL A O     1 
ATOM   959  C CB    . VAL A 1 126 ? 4.314   -20.911 3.054   1.00 28.02  ? 168 VAL A CB    1 
ATOM   960  C CG1   . VAL A 1 126 ? 3.021   -21.464 3.659   1.00 22.69  ? 168 VAL A CG1   1 
ATOM   961  C CG2   . VAL A 1 126 ? 4.341   -19.381 3.125   1.00 27.23  ? 168 VAL A CG2   1 
ATOM   962  N N     . THR A 1 127 ? 5.009   -23.701 4.703   1.00 25.48  ? 169 THR A N     1 
ATOM   963  C CA    . THR A 1 127 ? 4.772   -25.133 4.593   1.00 25.02  ? 169 THR A CA    1 
ATOM   964  C C     . THR A 1 127 ? 3.352   -25.437 5.067   1.00 22.83  ? 169 THR A C     1 
ATOM   965  O O     . THR A 1 127 ? 2.889   -24.884 6.069   1.00 21.93  ? 169 THR A O     1 
ATOM   966  C CB    . THR A 1 127 ? 5.859   -25.943 5.334   1.00 25.62  ? 169 THR A CB    1 
ATOM   967  O OG1   . THR A 1 127 ? 5.879   -27.289 4.842   1.00 29.58  ? 169 THR A OG1   1 
ATOM   968  C CG2   . THR A 1 127 ? 5.643   -25.962 6.828   1.00 26.40  ? 169 THR A CG2   1 
ATOM   969  N N     . ALA A 1 128 ? 2.646   -26.269 4.302   1.00 20.11  ? 170 ALA A N     1 
ATOM   970  C CA    . ALA A 1 128 ? 1.231   -26.503 4.493   1.00 24.14  ? 170 ALA A CA    1 
ATOM   971  C C     . ALA A 1 128 ? 0.941   -27.988 4.601   1.00 25.53  ? 170 ALA A C     1 
ATOM   972  O O     . ALA A 1 128 ? 1.661   -28.825 4.055   1.00 31.99  ? 170 ALA A O     1 
ATOM   973  C CB    . ALA A 1 128 ? 0.401   -25.918 3.349   1.00 30.48  ? 170 ALA A CB    1 
ATOM   974  N N     . TYR A 1 129 ? -0.116  -28.296 5.353   1.00 26.80  ? 171 TYR A N     1 
ATOM   975  C CA    . TYR A 1 129 ? -0.759  -29.607 5.396   1.00 26.76  ? 171 TYR A CA    1 
ATOM   976  C C     . TYR A 1 129 ? -2.223  -29.291 5.128   1.00 27.59  ? 171 TYR A C     1 
ATOM   977  O O     . TYR A 1 129 ? -3.011  -29.084 6.048   1.00 22.86  ? 171 TYR A O     1 
ATOM   978  C CB    . TYR A 1 129 ? -0.537  -30.328 6.722   1.00 20.49  ? 171 TYR A CB    1 
ATOM   979  C CG    . TYR A 1 129 ? -1.330  -31.599 6.841   1.00 24.62  ? 171 TYR A CG    1 
ATOM   980  C CD1   . TYR A 1 129 ? -1.357  -32.501 5.801   1.00 27.33  ? 171 TYR A CD1   1 
ATOM   981  C CD2   . TYR A 1 129 ? -2.072  -31.898 8.004   1.00 26.28  ? 171 TYR A CD2   1 
ATOM   982  C CE1   . TYR A 1 129 ? -2.096  -33.667 5.885   1.00 25.43  ? 171 TYR A CE1   1 
ATOM   983  C CE2   . TYR A 1 129 ? -2.804  -33.067 8.104   1.00 21.68  ? 171 TYR A CE2   1 
ATOM   984  C CZ    . TYR A 1 129 ? -2.804  -33.949 7.027   1.00 26.37  ? 171 TYR A CZ    1 
ATOM   985  O OH    . TYR A 1 129 ? -3.510  -35.127 7.056   1.00 31.19  ? 171 TYR A OH    1 
ATOM   986  N N     . VAL A 1 130 ? -2.550  -29.210 3.846   1.00 29.52  ? 172 VAL A N     1 
ATOM   987  C CA    . VAL A 1 130 ? -3.831  -28.704 3.343   1.00 33.75  ? 172 VAL A CA    1 
ATOM   988  C C     . VAL A 1 130 ? -4.952  -29.639 3.785   1.00 32.19  ? 172 VAL A C     1 
ATOM   989  O O     . VAL A 1 130 ? -4.745  -30.861 3.850   1.00 28.92  ? 172 VAL A O     1 
ATOM   990  C CB    . VAL A 1 130 ? -3.760  -28.586 1.819   1.00 31.50  ? 172 VAL A CB    1 
ATOM   991  C CG1   . VAL A 1 130 ? -5.131  -28.386 1.207   1.00 29.06  ? 172 VAL A CG1   1 
ATOM   992  C CG2   . VAL A 1 130 ? -2.800  -27.463 1.458   1.00 27.95  ? 172 VAL A CG2   1 
ATOM   993  N N     . PRO A 1 131 ? -6.116  -29.132 4.159   1.00 31.33  ? 173 PRO A N     1 
ATOM   994  C CA    . PRO A 1 131 ? -7.131  -30.023 4.730   1.00 32.36  ? 173 PRO A CA    1 
ATOM   995  C C     . PRO A 1 131 ? -7.657  -30.982 3.684   1.00 36.78  ? 173 PRO A C     1 
ATOM   996  O O     . PRO A 1 131 ? -7.897  -30.610 2.535   1.00 38.12  ? 173 PRO A O     1 
ATOM   997  C CB    . PRO A 1 131 ? -8.222  -29.070 5.239   1.00 29.07  ? 173 PRO A CB    1 
ATOM   998  C CG    . PRO A 1 131 ? -7.893  -27.746 4.682   1.00 37.66  ? 173 PRO A CG    1 
ATOM   999  C CD    . PRO A 1 131 ? -6.417  -27.717 4.396   1.00 34.70  ? 173 PRO A CD    1 
ATOM   1000 N N     . ASN A 1 132 ? -7.807  -32.235 4.098   1.00 34.84  ? 174 ASN A N     1 
ATOM   1001 C CA    . ASN A 1 132 ? -8.284  -33.297 3.229   1.00 35.79  ? 174 ASN A CA    1 
ATOM   1002 C C     . ASN A 1 132 ? -9.813  -33.269 3.079   1.00 40.53  ? 174 ASN A C     1 
ATOM   1003 O O     . ASN A 1 132 ? -10.552 -33.036 4.044   1.00 42.92  ? 174 ASN A O     1 
ATOM   1004 C CB    . ASN A 1 132 ? -7.813  -34.634 3.798   1.00 35.14  ? 174 ASN A CB    1 
ATOM   1005 C CG    . ASN A 1 132 ? -8.083  -35.788 2.879   1.00 40.54  ? 174 ASN A CG    1 
ATOM   1006 O OD1   . ASN A 1 132 ? -9.240  -36.125 2.603   1.00 41.39  ? 174 ASN A OD1   1 
ATOM   1007 N ND2   . ASN A 1 132 ? -7.010  -36.411 2.388   1.00 39.93  ? 174 ASN A ND2   1 
ATOM   1008 N N     . ALA A 1 133 ? -10.291 -33.518 1.857   1.00 38.47  ? 175 ALA A N     1 
ATOM   1009 C CA    . ALA A 1 133 ? -11.729 -33.505 1.624   1.00 40.41  ? 175 ALA A CA    1 
ATOM   1010 C C     . ALA A 1 133 ? -12.435 -34.706 2.252   1.00 42.69  ? 175 ALA A C     1 
ATOM   1011 O O     . ALA A 1 133 ? -13.670 -34.757 2.255   1.00 36.76  ? 175 ALA A O     1 
ATOM   1012 C CB    . ALA A 1 133 ? -12.013 -33.433 0.121   1.00 34.96  ? 175 ALA A CB    1 
ATOM   1013 N N     . GLY A 1 134 ? -11.688 -35.669 2.779   1.00 40.80  ? 176 GLY A N     1 
ATOM   1014 C CA    . GLY A 1 134 ? -12.281 -36.745 3.543   1.00 31.53  ? 176 GLY A CA    1 
ATOM   1015 C C     . GLY A 1 134 ? -13.021 -37.801 2.756   1.00 29.28  ? 176 GLY A C     1 
ATOM   1016 O O     . GLY A 1 134 ? -13.416 -37.579 1.605   1.00 31.12  ? 176 GLY A O     1 
ATOM   1017 N N     . ARG A 1 135 ? -13.197 -38.964 3.393   1.00 30.98  ? 177 ARG A N     1 
ATOM   1018 C CA    . ARG A 1 135 ? -13.992 -40.053 2.845   1.00 27.78  ? 177 ARG A CA    1 
ATOM   1019 C C     . ARG A 1 135 ? -15.411 -39.576 2.553   1.00 37.72  ? 177 ARG A C     1 
ATOM   1020 O O     . ARG A 1 135 ? -16.075 -38.990 3.414   1.00 35.19  ? 177 ARG A O     1 
ATOM   1021 C CB    . ARG A 1 135 ? -14.015 -41.226 3.822   1.00 24.71  ? 177 ARG A CB    1 
ATOM   1022 C CG    . ARG A 1 135 ? -12.709 -41.994 3.956   1.00 37.87  ? 177 ARG A CG    1 
ATOM   1023 C CD    . ARG A 1 135 ? -12.846 -43.467 3.476   1.00 42.61  ? 177 ARG A CD    1 
ATOM   1024 N NE    . ARG A 1 135 ? -11.662 -44.304 3.719   1.00 46.40  ? 177 ARG A NE    1 
ATOM   1025 C CZ    . ARG A 1 135 ? -10.489 -44.152 3.098   1.00 57.70  ? 177 ARG A CZ    1 
ATOM   1026 N NH1   . ARG A 1 135 ? -9.468  -44.965 3.361   1.00 54.37  ? 177 ARG A NH1   1 
ATOM   1027 N NH2   . ARG A 1 135 ? -10.329 -43.179 2.211   1.00 61.97  ? 177 ARG A NH2   1 
ATOM   1028 N N     . GLY A 1 136 ? -15.867 -39.807 1.322   1.00 38.90  ? 178 GLY A N     1 
ATOM   1029 C CA    . GLY A 1 136 ? -17.170 -39.326 0.906   1.00 32.95  ? 178 GLY A CA    1 
ATOM   1030 C C     . GLY A 1 136 ? -17.317 -37.825 0.833   1.00 35.76  ? 178 GLY A C     1 
ATOM   1031 O O     . GLY A 1 136 ? -18.436 -37.318 0.937   1.00 39.71  ? 178 GLY A O     1 
ATOM   1032 N N     . LEU A 1 137 ? -16.213 -37.098 0.686   1.00 40.17  ? 179 LEU A N     1 
ATOM   1033 C CA    . LEU A 1 137 ? -16.223 -35.647 0.464   1.00 40.98  ? 179 LEU A CA    1 
ATOM   1034 C C     . LEU A 1 137 ? -16.898 -34.877 1.596   1.00 37.84  ? 179 LEU A C     1 
ATOM   1035 O O     . LEU A 1 137 ? -17.313 -33.731 1.415   1.00 34.66  ? 179 LEU A O     1 
ATOM   1036 C CB    . LEU A 1 137 ? -16.860 -35.309 -0.883  1.00 32.25  ? 179 LEU A CB    1 
ATOM   1037 C CG    . LEU A 1 137 ? -16.126 -35.959 -2.060  1.00 44.93  ? 179 LEU A CG    1 
ATOM   1038 C CD1   . LEU A 1 137 ? -16.782 -35.627 -3.410  1.00 38.82  ? 179 LEU A CD1   1 
ATOM   1039 C CD2   . LEU A 1 137 ? -14.590 -35.690 -2.006  1.00 39.31  ? 179 LEU A CD2   1 
ATOM   1040 N N     . VAL A 1 138 ? -16.975 -35.485 2.779   1.00 35.30  ? 180 VAL A N     1 
ATOM   1041 C CA    . VAL A 1 138 ? -17.614 -34.837 3.924   1.00 39.50  ? 180 VAL A CA    1 
ATOM   1042 C C     . VAL A 1 138 ? -17.072 -33.434 4.200   1.00 48.24  ? 180 VAL A C     1 
ATOM   1043 O O     . VAL A 1 138 ? -17.797 -32.564 4.709   1.00 46.58  ? 180 VAL A O     1 
ATOM   1044 C CB    . VAL A 1 138 ? -17.457 -35.740 5.156   1.00 38.37  ? 180 VAL A CB    1 
ATOM   1045 C CG1   . VAL A 1 138 ? -17.961 -35.016 6.408   1.00 44.62  ? 180 VAL A CG1   1 
ATOM   1046 C CG2   . VAL A 1 138 ? -18.172 -37.042 4.911   1.00 31.93  ? 180 VAL A CG2   1 
ATOM   1047 N N     . ARG A 1 139 ? -15.802 -33.183 3.867   1.00 48.45  ? 181 ARG A N     1 
ATOM   1048 C CA    . ARG A 1 139 ? -15.171 -31.904 4.164   1.00 43.44  ? 181 ARG A CA    1 
ATOM   1049 C C     . ARG A 1 139 ? -14.761 -31.140 2.906   1.00 40.27  ? 181 ARG A C     1 
ATOM   1050 O O     . ARG A 1 139 ? -13.996 -30.177 2.990   1.00 39.24  ? 181 ARG A O     1 
ATOM   1051 C CB    . ARG A 1 139 ? -13.973 -32.112 5.074   1.00 44.40  ? 181 ARG A CB    1 
ATOM   1052 C CG    . ARG A 1 139 ? -14.139 -31.512 6.439   1.00 51.84  ? 181 ARG A CG    1 
ATOM   1053 C CD    . ARG A 1 139 ? -12.785 -31.344 7.084   1.00 52.56  ? 181 ARG A CD    1 
ATOM   1054 N NE    . ARG A 1 139 ? -12.814 -30.412 8.201   1.00 56.21  ? 181 ARG A NE    1 
ATOM   1055 C CZ    . ARG A 1 139 ? -11.708 -29.946 8.786   1.00 51.39  ? 181 ARG A CZ    1 
ATOM   1056 N NH1   . ARG A 1 139 ? -10.533 -30.351 8.354   1.00 45.85  ? 181 ARG A NH1   1 
ATOM   1057 N NH2   . ARG A 1 139 ? -11.804 -29.109 9.799   1.00 62.46  ? 181 ARG A NH2   1 
ATOM   1058 N N     . LEU A 1 140 ? -15.272 -31.536 1.737   1.00 38.12  ? 182 LEU A N     1 
ATOM   1059 C CA    . LEU A 1 140 ? -14.867 -30.876 0.495   1.00 41.54  ? 182 LEU A CA    1 
ATOM   1060 C C     . LEU A 1 140 ? -15.254 -29.411 0.503   1.00 41.84  ? 182 LEU A C     1 
ATOM   1061 O O     . LEU A 1 140 ? -14.459 -28.547 0.122   1.00 42.72  ? 182 LEU A O     1 
ATOM   1062 C CB    . LEU A 1 140 ? -15.499 -31.546 -0.721  1.00 40.12  ? 182 LEU A CB    1 
ATOM   1063 C CG    . LEU A 1 140 ? -15.330 -30.698 -1.976  1.00 46.25  ? 182 LEU A CG    1 
ATOM   1064 C CD1   . LEU A 1 140 ? -13.858 -30.748 -2.484  1.00 37.33  ? 182 LEU A CD1   1 
ATOM   1065 C CD2   . LEU A 1 140 ? -16.299 -31.219 -3.036  1.00 45.40  ? 182 LEU A CD2   1 
ATOM   1066 N N     . GLU A 1 141 ? -16.479 -29.106 0.933   1.00 42.02  ? 183 GLU A N     1 
ATOM   1067 C CA    . GLU A 1 141 ? -16.927 -27.721 0.958   1.00 45.82  ? 183 GLU A CA    1 
ATOM   1068 C C     . GLU A 1 141 ? -16.093 -26.894 1.921   1.00 37.98  ? 183 GLU A C     1 
ATOM   1069 O O     . GLU A 1 141 ? -15.824 -25.718 1.647   1.00 36.17  ? 183 GLU A O     1 
ATOM   1070 C CB    . GLU A 1 141 ? -18.423 -27.648 1.307   1.00 44.61  ? 183 GLU A CB    1 
ATOM   1071 C CG    . GLU A 1 141 ? -19.258 -27.200 0.119   1.00 49.42  ? 183 GLU A CG    1 
ATOM   1072 C CD    . GLU A 1 141 ? -20.744 -27.144 0.405   1.00 47.74  ? 183 GLU A CD    1 
ATOM   1073 O OE1   . GLU A 1 141 ? -21.135 -26.380 1.286   1.00 45.63  ? 183 GLU A OE1   1 
ATOM   1074 O OE2   . GLU A 1 141 ? -21.525 -27.842 -0.258  1.00 51.72  ? 183 GLU A OE2   1 
ATOM   1075 N N     . TYR A 1 142 ? -15.661 -27.480 3.046   1.00 38.58  ? 184 TYR A N     1 
ATOM   1076 C CA    . TYR A 1 142 ? -14.688 -26.783 3.881   1.00 38.51  ? 184 TYR A CA    1 
ATOM   1077 C C     . TYR A 1 142 ? -13.371 -26.599 3.140   1.00 35.31  ? 184 TYR A C     1 
ATOM   1078 O O     . TYR A 1 142 ? -12.749 -25.529 3.207   1.00 32.78  ? 184 TYR A O     1 
ATOM   1079 C CB    . TYR A 1 142 ? -14.444 -27.544 5.177   1.00 41.48  ? 184 TYR A CB    1 
ATOM   1080 C CG    . TYR A 1 142 ? -13.329 -26.914 5.966   1.00 48.73  ? 184 TYR A CG    1 
ATOM   1081 C CD1   . TYR A 1 142 ? -13.565 -25.786 6.767   1.00 44.35  ? 184 TYR A CD1   1 
ATOM   1082 C CD2   . TYR A 1 142 ? -12.027 -27.408 5.880   1.00 45.03  ? 184 TYR A CD2   1 
ATOM   1083 C CE1   . TYR A 1 142 ? -12.549 -25.190 7.469   1.00 49.22  ? 184 TYR A CE1   1 
ATOM   1084 C CE2   . TYR A 1 142 ? -11.004 -26.814 6.582   1.00 46.00  ? 184 TYR A CE2   1 
ATOM   1085 C CZ    . TYR A 1 142 ? -11.270 -25.706 7.370   1.00 48.21  ? 184 TYR A CZ    1 
ATOM   1086 O OH    . TYR A 1 142 ? -10.253 -25.121 8.064   1.00 44.58  ? 184 TYR A OH    1 
ATOM   1087 N N     . ARG A 1 143 ? -12.933 -27.643 2.430   1.00 35.97  ? 185 ARG A N     1 
ATOM   1088 C CA    . ARG A 1 143 ? -11.667 -27.576 1.712   1.00 40.24  ? 185 ARG A CA    1 
ATOM   1089 C C     . ARG A 1 143 ? -11.663 -26.416 0.734   1.00 36.57  ? 185 ARG A C     1 
ATOM   1090 O O     . ARG A 1 143 ? -10.663 -25.693 0.620   1.00 29.24  ? 185 ARG A O     1 
ATOM   1091 C CB    . ARG A 1 143 ? -11.391 -28.895 0.993   1.00 30.65  ? 185 ARG A CB    1 
ATOM   1092 C CG    . ARG A 1 143 ? -10.334 -28.778 -0.102  1.00 34.50  ? 185 ARG A CG    1 
ATOM   1093 C CD    . ARG A 1 143 ? -8.934  -28.344 0.392   1.00 33.95  ? 185 ARG A CD    1 
ATOM   1094 N NE    . ARG A 1 143 ? -7.954  -28.499 -0.685  1.00 26.84  ? 185 ARG A NE    1 
ATOM   1095 C CZ    . ARG A 1 143 ? -7.459  -29.681 -1.054  1.00 30.08  ? 185 ARG A CZ    1 
ATOM   1096 N NH1   . ARG A 1 143 ? -7.835  -30.789 -0.424  1.00 28.68  ? 185 ARG A NH1   1 
ATOM   1097 N NH2   . ARG A 1 143 ? -6.593  -29.758 -2.051  1.00 34.77  ? 185 ARG A NH2   1 
ATOM   1098 N N     . GLN A 1 144 ? -12.797 -26.186 0.064   1.00 35.99  ? 186 GLN A N     1 
ATOM   1099 C CA    . GLN A 1 144 ? -12.847 -25.116 -0.924  1.00 39.15  ? 186 GLN A CA    1 
ATOM   1100 C C     . GLN A 1 144 ? -12.796 -23.752 -0.269  1.00 34.92  ? 186 GLN A C     1 
ATOM   1101 O O     . GLN A 1 144 ? -12.168 -22.830 -0.808  1.00 32.86  ? 186 GLN A O     1 
ATOM   1102 C CB    . GLN A 1 144 ? -14.079 -25.280 -1.816  1.00 38.01  ? 186 GLN A CB    1 
ATOM   1103 C CG    . GLN A 1 144 ? -14.273 -26.734 -2.256  1.00 43.65  ? 186 GLN A CG    1 
ATOM   1104 C CD    . GLN A 1 144 ? -15.540 -26.981 -3.091  1.00 48.95  ? 186 GLN A CD    1 
ATOM   1105 O OE1   . GLN A 1 144 ? -16.493 -27.523 -2.590  1.00 55.36  ? 186 GLN A OE1   1 
ATOM   1106 N NE2   . GLN A 1 144 ? -15.513 -26.584 -4.344  1.00 43.95  ? 186 GLN A NE2   1 
ATOM   1107 N N     . ARG A 1 145 ? -13.404 -23.615 0.910   1.00 36.18  ? 187 ARG A N     1 
ATOM   1108 C CA    . ARG A 1 145 ? -13.287 -22.366 1.647   1.00 30.86  ? 187 ARG A CA    1 
ATOM   1109 C C     . ARG A 1 145 ? -11.854 -22.146 2.088   1.00 30.23  ? 187 ARG A C     1 
ATOM   1110 O O     . ARG A 1 145 ? -11.348 -21.016 2.043   1.00 34.03  ? 187 ARG A O     1 
ATOM   1111 C CB    . ARG A 1 145 ? -14.246 -22.375 2.850   1.00 42.72  ? 187 ARG A CB    1 
ATOM   1112 C CG    . ARG A 1 145 ? -15.716 -22.149 2.469   1.00 32.79  ? 187 ARG A CG    1 
ATOM   1113 C CD    . ARG A 1 145 ? -16.588 -21.924 3.664   1.00 30.57  ? 187 ARG A CD    1 
ATOM   1114 N NE    . ARG A 1 145 ? -17.096 -23.186 4.225   1.00 44.03  ? 187 ARG A NE    1 
ATOM   1115 C CZ    . ARG A 1 145 ? -16.752 -23.708 5.409   1.00 48.17  ? 187 ARG A CZ    1 
ATOM   1116 N NH1   . ARG A 1 145 ? -15.882 -23.087 6.217   1.00 48.30  ? 187 ARG A NH1   1 
ATOM   1117 N NH2   . ARG A 1 145 ? -17.285 -24.869 5.790   1.00 43.25  ? 187 ARG A NH2   1 
ATOM   1118 N N     . TRP A 1 146 ? -11.180 -23.229 2.504   1.00 35.77  ? 188 TRP A N     1 
ATOM   1119 C CA    . TRP A 1 146 ? -9.769  -23.153 2.879   1.00 37.55  ? 188 TRP A CA    1 
ATOM   1120 C C     . TRP A 1 146 ? -8.943  -22.609 1.719   1.00 35.97  ? 188 TRP A C     1 
ATOM   1121 O O     . TRP A 1 146 ? -8.277  -21.571 1.828   1.00 34.67  ? 188 TRP A O     1 
ATOM   1122 C CB    . TRP A 1 146 ? -9.242  -24.538 3.296   1.00 36.34  ? 188 TRP A CB    1 
ATOM   1123 C CG    . TRP A 1 146 ? -7.733  -24.589 3.195   1.00 34.96  ? 188 TRP A CG    1 
ATOM   1124 C CD1   . TRP A 1 146 ? -6.975  -24.827 2.069   1.00 29.87  ? 188 TRP A CD1   1 
ATOM   1125 C CD2   . TRP A 1 146 ? -6.804  -24.334 4.246   1.00 41.29  ? 188 TRP A CD2   1 
ATOM   1126 N NE1   . TRP A 1 146 ? -5.644  -24.743 2.360   1.00 27.67  ? 188 TRP A NE1   1 
ATOM   1127 C CE2   . TRP A 1 146 ? -5.504  -24.446 3.689   1.00 35.74  ? 188 TRP A CE2   1 
ATOM   1128 C CE3   . TRP A 1 146 ? -6.941  -24.039 5.612   1.00 34.26  ? 188 TRP A CE3   1 
ATOM   1129 C CZ2   . TRP A 1 146 ? -4.358  -24.257 4.441   1.00 30.95  ? 188 TRP A CZ2   1 
ATOM   1130 C CZ3   . TRP A 1 146 ? -5.814  -23.856 6.352   1.00 35.69  ? 188 TRP A CZ3   1 
ATOM   1131 C CH2   . TRP A 1 146 ? -4.531  -23.964 5.767   1.00 42.28  ? 188 TRP A CH2   1 
ATOM   1132 N N     . ASP A 1 147 ? -8.979  -23.334 0.601   1.00 34.25  ? 189 ASP A N     1 
ATOM   1133 C CA    . ASP A 1 147 ? -8.286  -22.965 -0.619  1.00 32.08  ? 189 ASP A CA    1 
ATOM   1134 C C     . ASP A 1 147 ? -8.346  -21.472 -0.887  1.00 33.67  ? 189 ASP A C     1 
ATOM   1135 O O     . ASP A 1 147 ? -7.313  -20.830 -1.088  1.00 38.69  ? 189 ASP A O     1 
ATOM   1136 C CB    . ASP A 1 147 ? -8.894  -23.749 -1.784  1.00 32.34  ? 189 ASP A CB    1 
ATOM   1137 C CG    . ASP A 1 147 ? -8.329  -25.155 -1.910  1.00 37.47  ? 189 ASP A CG    1 
ATOM   1138 O OD1   . ASP A 1 147 ? -7.716  -25.682 -0.936  1.00 32.98  ? 189 ASP A OD1   1 
ATOM   1139 O OD2   . ASP A 1 147 ? -8.487  -25.725 -3.015  1.00 38.44  ? 189 ASP A OD2   1 
ATOM   1140 N N     . GLU A 1 148 ? -9.547  -20.895 -0.876  1.00 37.89  ? 190 GLU A N     1 
ATOM   1141 C CA    . GLU A 1 148 ? -9.658  -19.489 -1.231  1.00 41.72  ? 190 GLU A CA    1 
ATOM   1142 C C     . GLU A 1 148 ? -8.950  -18.618 -0.213  1.00 38.68  ? 190 GLU A C     1 
ATOM   1143 O O     . GLU A 1 148 ? -8.342  -17.596 -0.566  1.00 39.27  ? 190 GLU A O     1 
ATOM   1144 C CB    . GLU A 1 148 ? -11.117 -19.075 -1.349  1.00 45.46  ? 190 GLU A CB    1 
ATOM   1145 C CG    . GLU A 1 148 ? -11.225 -17.674 -1.909  1.00 59.09  ? 190 GLU A CG    1 
ATOM   1146 C CD    . GLU A 1 148 ? -12.571 -17.051 -1.687  1.00 72.09  ? 190 GLU A CD    1 
ATOM   1147 O OE1   . GLU A 1 148 ? -12.600 -15.847 -1.320  1.00 71.21  ? 190 GLU A OE1   1 
ATOM   1148 O OE2   . GLU A 1 148 ? -13.584 -17.766 -1.892  1.00 72.05  ? 190 GLU A OE2   1 
ATOM   1149 N N     . ALA A 1 149 ? -9.008  -19.011 1.056   1.00 32.85  ? 191 ALA A N     1 
ATOM   1150 C CA    . ALA A 1 149 ? -8.344  -18.220 2.079   1.00 35.10  ? 191 ALA A CA    1 
ATOM   1151 C C     . ALA A 1 149 ? -6.830  -18.345 1.955   1.00 35.14  ? 191 ALA A C     1 
ATOM   1152 O O     . ALA A 1 149 ? -6.105  -17.339 1.990   1.00 32.18  ? 191 ALA A O     1 
ATOM   1153 C CB    . ALA A 1 149 ? -8.837  -18.659 3.459   1.00 33.15  ? 191 ALA A CB    1 
ATOM   1154 N N     . PHE A 1 150 ? -6.346  -19.581 1.796   1.00 27.14  ? 192 PHE A N     1 
ATOM   1155 C CA    . PHE A 1 150 ? -4.925  -19.836 1.624   1.00 30.45  ? 192 PHE A CA    1 
ATOM   1156 C C     . PHE A 1 150 ? -4.387  -19.058 0.425   1.00 34.65  ? 192 PHE A C     1 
ATOM   1157 O O     . PHE A 1 150 ? -3.365  -18.358 0.513   1.00 26.56  ? 192 PHE A O     1 
ATOM   1158 C CB    . PHE A 1 150 ? -4.732  -21.351 1.465   1.00 28.53  ? 192 PHE A CB    1 
ATOM   1159 C CG    . PHE A 1 150 ? -3.316  -21.820 1.635   1.00 30.47  ? 192 PHE A CG    1 
ATOM   1160 C CD1   . PHE A 1 150 ? -2.547  -21.383 2.698   1.00 28.54  ? 192 PHE A CD1   1 
ATOM   1161 C CD2   . PHE A 1 150 ? -2.764  -22.738 0.750   1.00 34.74  ? 192 PHE A CD2   1 
ATOM   1162 C CE1   . PHE A 1 150 ? -1.245  -21.831 2.874   1.00 27.75  ? 192 PHE A CE1   1 
ATOM   1163 C CE2   . PHE A 1 150 ? -1.443  -23.191 0.915   1.00 30.46  ? 192 PHE A CE2   1 
ATOM   1164 C CZ    . PHE A 1 150 ? -0.694  -22.733 1.992   1.00 28.62  ? 192 PHE A CZ    1 
ATOM   1165 N N     . ARG A 1 151 ? -5.124  -19.126 -0.690  1.00 38.03  ? 193 ARG A N     1 
ATOM   1166 C CA    . ARG A 1 151 ? -4.770  -18.434 -1.926  1.00 34.46  ? 193 ARG A CA    1 
ATOM   1167 C C     . ARG A 1 151 ? -4.569  -16.949 -1.696  1.00 38.42  ? 193 ARG A C     1 
ATOM   1168 O O     . ARG A 1 151 ? -3.549  -16.383 -2.108  1.00 41.31  ? 193 ARG A O     1 
ATOM   1169 C CB    . ARG A 1 151 ? -5.867  -18.659 -2.959  1.00 38.95  ? 193 ARG A CB    1 
ATOM   1170 C CG    . ARG A 1 151 ? -5.576  -18.056 -4.291  1.00 42.53  ? 193 ARG A CG    1 
ATOM   1171 C CD    . ARG A 1 151 ? -6.773  -18.182 -5.197  1.00 45.19  ? 193 ARG A CD    1 
ATOM   1172 N NE    . ARG A 1 151 ? -7.430  -19.475 -5.045  1.00 52.80  ? 193 ARG A NE    1 
ATOM   1173 C CZ    . ARG A 1 151 ? -8.745  -19.637 -4.909  1.00 51.66  ? 193 ARG A CZ    1 
ATOM   1174 N NH1   . ARG A 1 151 ? -9.559  -18.583 -4.935  1.00 40.60  ? 193 ARG A NH1   1 
ATOM   1175 N NH2   . ARG A 1 151 ? -9.243  -20.862 -4.777  1.00 45.65  ? 193 ARG A NH2   1 
ATOM   1176 N N     . LYS A 1 152 ? -5.536  -16.295 -1.029  1.00 36.95  ? 194 LYS A N     1 
ATOM   1177 C CA    . LYS A 1 152 ? -5.396  -14.868 -0.752  1.00 34.47  ? 194 LYS A CA    1 
ATOM   1178 C C     . LYS A 1 152 ? -4.259  -14.602 0.223   1.00 36.49  ? 194 LYS A C     1 
ATOM   1179 O O     . LYS A 1 152 ? -3.571  -13.579 0.113   1.00 43.26  ? 194 LYS A O     1 
ATOM   1180 C CB    . LYS A 1 152 ? -6.715  -14.290 -0.230  1.00 26.78  ? 194 LYS A CB    1 
ATOM   1181 N N     . PHE A 1 153 ? -4.029  -15.513 1.166   1.00 35.27  ? 195 PHE A N     1 
ATOM   1182 C CA    . PHE A 1 153 ? -2.937  -15.317 2.106   1.00 37.78  ? 195 PHE A CA    1 
ATOM   1183 C C     . PHE A 1 153 ? -1.602  -15.298 1.381   1.00 37.71  ? 195 PHE A C     1 
ATOM   1184 O O     . PHE A 1 153 ? -0.761  -14.424 1.625   1.00 36.49  ? 195 PHE A O     1 
ATOM   1185 C CB    . PHE A 1 153 ? -2.967  -16.411 3.172   1.00 36.95  ? 195 PHE A CB    1 
ATOM   1186 C CG    . PHE A 1 153 ? -1.820  -16.358 4.145   1.00 37.34  ? 195 PHE A CG    1 
ATOM   1187 C CD1   . PHE A 1 153 ? -1.742  -15.347 5.100   1.00 44.83  ? 195 PHE A CD1   1 
ATOM   1188 C CD2   . PHE A 1 153 ? -0.843  -17.339 4.135   1.00 33.13  ? 195 PHE A CD2   1 
ATOM   1189 C CE1   . PHE A 1 153 ? -0.685  -15.300 6.021   1.00 38.00  ? 195 PHE A CE1   1 
ATOM   1190 C CE2   . PHE A 1 153 ? 0.204   -17.300 5.036   1.00 34.24  ? 195 PHE A CE2   1 
ATOM   1191 C CZ    . PHE A 1 153 ? 0.284   -16.276 5.986   1.00 37.31  ? 195 PHE A CZ    1 
ATOM   1192 N N     . LEU A 1 154 ? -1.409  -16.235 0.453   1.00 37.79  ? 196 LEU A N     1 
ATOM   1193 C CA    . LEU A 1 154 ? -0.117  -16.346 -0.215  1.00 41.11  ? 196 LEU A CA    1 
ATOM   1194 C C     . LEU A 1 154 ? 0.156   -15.144 -1.128  1.00 52.35  ? 196 LEU A C     1 
ATOM   1195 O O     . LEU A 1 154 ? 1.273   -14.598 -1.129  1.00 49.81  ? 196 LEU A O     1 
ATOM   1196 C CB    . LEU A 1 154 ? -0.065  -17.669 -0.970  1.00 36.09  ? 196 LEU A CB    1 
ATOM   1197 C CG    . LEU A 1 154 ? -0.152  -18.842 0.015   1.00 34.51  ? 196 LEU A CG    1 
ATOM   1198 C CD1   . LEU A 1 154 ? -0.328  -20.168 -0.686  1.00 25.62  ? 196 LEU A CD1   1 
ATOM   1199 C CD2   . LEU A 1 154 ? 1.073   -18.879 0.891   1.00 28.66  ? 196 LEU A CD2   1 
ATOM   1200 N N     . LYS A 1 155 ? -0.846  -14.707 -1.861  1.00 51.89  ? 197 LYS A N     1 
ATOM   1201 C CA    . LYS A 1 155 ? -0.703  -13.566 -2.722  1.00 45.31  ? 197 LYS A CA    1 
ATOM   1202 C C     . LYS A 1 155 ? -0.341  -12.356 -1.891  1.00 51.36  ? 197 LYS A C     1 
ATOM   1203 O O     . LYS A 1 155 ? 0.605   -11.687 -2.188  1.00 53.45  ? 197 LYS A O     1 
ATOM   1204 C CB    . LYS A 1 155 ? -1.982  -13.375 -3.477  1.00 43.47  ? 197 LYS A CB    1 
ATOM   1205 C CG    . LYS A 1 155 ? -1.972  -12.324 -4.541  1.00 53.14  ? 197 LYS A CG    1 
ATOM   1206 C CD    . LYS A 1 155 ? -3.359  -12.236 -5.163  1.00 54.21  ? 197 LYS A CD    1 
ATOM   1207 C CE    . LYS A 1 155 ? -3.467  -11.160 -6.227  1.00 47.75  ? 197 LYS A CE    1 
ATOM   1208 N NZ    . LYS A 1 155 ? -3.536  -11.734 -7.585  1.00 44.10  ? 197 LYS A NZ    1 
ATOM   1209 N N     . GLY A 1 156 ? -1.119  -12.095 -0.846  1.00 46.34  ? 198 GLY A N     1 
ATOM   1210 C CA    . GLY A 1 156 ? -0.862  -10.962 0.022   1.00 45.86  ? 198 GLY A CA    1 
ATOM   1211 C C     . GLY A 1 156 ? 0.446   -11.128 0.769   1.00 64.21  ? 198 GLY A C     1 
ATOM   1212 O O     . GLY A 1 156 ? 0.630   -10.572 1.852   1.00 84.08  ? 198 GLY A O     1 
ATOM   1213 N N     . LEU A 1 157 ? 1.358   -11.901 0.187   1.00 58.40  ? 199 LEU A N     1 
ATOM   1214 C CA    . LEU A 1 157 ? 2.656   -12.146 0.802   1.00 58.74  ? 199 LEU A CA    1 
ATOM   1215 C C     . LEU A 1 157 ? 3.768   -12.286 -0.234  1.00 65.89  ? 199 LEU A C     1 
ATOM   1216 O O     . LEU A 1 157 ? 4.887   -11.822 -0.018  1.00 57.74  ? 199 LEU A O     1 
ATOM   1217 C CB    . LEU A 1 157 ? 2.602   -13.396 1.683   1.00 52.80  ? 199 LEU A CB    1 
ATOM   1218 C CG    . LEU A 1 157 ? 3.836   -13.673 2.544   1.00 45.90  ? 199 LEU A CG    1 
ATOM   1219 C CD1   . LEU A 1 157 ? 3.440   -14.332 3.856   1.00 42.76  ? 199 LEU A CD1   1 
ATOM   1220 C CD2   . LEU A 1 157 ? 4.836   -14.534 1.787   1.00 40.33  ? 199 LEU A CD2   1 
ATOM   1221 N N     . ALA A 1 158 ? 3.459   -12.927 -1.358  1.00 60.82  ? 200 ALA A N     1 
ATOM   1222 C CA    . ALA A 1 158 ? 4.426   -13.116 -2.385  1.00 55.87  ? 200 ALA A CA    1 
ATOM   1223 C C     . ALA A 1 158 ? 4.700   -11.817 -3.091  1.00 64.40  ? 200 ALA A C     1 
ATOM   1224 O O     . ALA A 1 158 ? 5.299   -11.823 -4.130  1.00 72.36  ? 200 ALA A O     1 
ATOM   1225 C CB    . ALA A 1 158 ? 3.912   -14.120 -3.366  1.00 52.24  ? 200 ALA A CB    1 
ATOM   1226 N N     . SER A 1 159 ? 4.277   -10.697 -2.533  1.00 67.73  ? 201 SER A N     1 
ATOM   1227 C CA    . SER A 1 159 ? 4.496   -9.419  -3.195  1.00 62.09  ? 201 SER A CA    1 
ATOM   1228 C C     . SER A 1 159 ? 5.456   -8.527  -2.401  1.00 64.55  ? 201 SER A C     1 
ATOM   1229 O O     . SER A 1 159 ? 5.596   -7.339  -2.721  1.00 65.99  ? 201 SER A O     1 
ATOM   1230 C CB    . SER A 1 159 ? 3.157   -8.728  -3.418  1.00 65.35  ? 201 SER A CB    1 
ATOM   1231 O OG    . SER A 1 159 ? 2.206   -9.683  -3.863  1.00 66.09  ? 201 SER A OG    1 
ATOM   1232 N N     . ARG A 1 160 ? 6.107   -9.064  -1.362  1.00 58.85  ? 202 ARG A N     1 
ATOM   1233 C CA    . ARG A 1 160 ? 7.321   -8.484  -0.789  1.00 61.51  ? 202 ARG A CA    1 
ATOM   1234 C C     . ARG A 1 160 ? 8.567   -9.280  -1.149  1.00 63.81  ? 202 ARG A C     1 
ATOM   1235 O O     . ARG A 1 160 ? 9.588   -8.718  -1.558  1.00 61.43  ? 202 ARG A O     1 
ATOM   1236 C CB    . ARG A 1 160 ? 7.203   -8.424  0.729   1.00 57.22  ? 202 ARG A CB    1 
ATOM   1237 C CG    . ARG A 1 160 ? 5.781   -8.325  1.105   1.00 68.38  ? 202 ARG A CG    1 
ATOM   1238 C CD    . ARG A 1 160 ? 5.437   -7.670  2.439   1.00 70.09  ? 202 ARG A CD    1 
ATOM   1239 N NE    . ARG A 1 160 ? 4.085   -8.042  2.828   1.00 76.67  ? 202 ARG A NE    1 
ATOM   1240 C CZ    . ARG A 1 160 ? 3.766   -9.202  3.436   1.00 76.36  ? 202 ARG A CZ    1 
ATOM   1241 N NH1   . ARG A 1 160 ? 4.698   -10.145 3.680   1.00 74.87  ? 202 ARG A NH1   1 
ATOM   1242 N NH2   . ARG A 1 160 ? 2.497   -9.433  3.771   1.00 79.17  ? 202 ARG A NH2   1 
ATOM   1243 N N     . LYS A 1 161 ? 8.489   -10.589 -0.974  1.00 58.02  ? 203 LYS A N     1 
ATOM   1244 C CA    . LYS A 1 161 ? 9.596   -11.501 -1.163  1.00 49.64  ? 203 LYS A CA    1 
ATOM   1245 C C     . LYS A 1 161 ? 9.063   -12.668 -1.966  1.00 42.83  ? 203 LYS A C     1 
ATOM   1246 O O     . LYS A 1 161 ? 7.855   -12.930 -1.962  1.00 45.47  ? 203 LYS A O     1 
ATOM   1247 C CB    . LYS A 1 161 ? 10.175  -11.982 0.176   1.00 48.58  ? 203 LYS A CB    1 
ATOM   1248 C CG    . LYS A 1 161 ? 11.237  -11.064 0.749   1.00 52.46  ? 203 LYS A CG    1 
ATOM   1249 C CD    . LYS A 1 161 ? 11.806  -11.641 2.018   1.00 44.14  ? 203 LYS A CD    1 
ATOM   1250 C CE    . LYS A 1 161 ? 12.923  -10.768 2.553   1.00 43.82  ? 203 LYS A CE    1 
ATOM   1251 N NZ    . LYS A 1 161 ? 13.409  -11.222 3.888   1.00 45.60  ? 203 LYS A NZ    1 
ATOM   1252 N N     . PRO A 1 162 ? 9.929   -13.361 -2.695  1.00 36.40  ? 204 PRO A N     1 
ATOM   1253 C CA    . PRO A 1 162 ? 9.487   -14.529 -3.460  1.00 35.04  ? 204 PRO A CA    1 
ATOM   1254 C C     . PRO A 1 162 ? 9.111   -15.673 -2.536  1.00 31.87  ? 204 PRO A C     1 
ATOM   1255 O O     . PRO A 1 162 ? 9.604   -15.787 -1.413  1.00 28.73  ? 204 PRO A O     1 
ATOM   1256 C CB    . PRO A 1 162 ? 10.709  -14.875 -4.321  1.00 24.53  ? 204 PRO A CB    1 
ATOM   1257 C CG    . PRO A 1 162 ? 11.841  -14.274 -3.624  1.00 26.49  ? 204 PRO A CG    1 
ATOM   1258 C CD    . PRO A 1 162 ? 11.359  -13.078 -2.869  1.00 31.58  ? 204 PRO A CD    1 
ATOM   1259 N N     . LEU A 1 163 ? 8.235   -16.537 -3.037  1.00 31.56  ? 205 LEU A N     1 
ATOM   1260 C CA    . LEU A 1 163 ? 7.533   -17.501 -2.210  1.00 36.79  ? 205 LEU A CA    1 
ATOM   1261 C C     . LEU A 1 163 ? 7.977   -18.919 -2.529  1.00 36.42  ? 205 LEU A C     1 
ATOM   1262 O O     . LEU A 1 163 ? 7.950   -19.348 -3.689  1.00 30.37  ? 205 LEU A O     1 
ATOM   1263 C CB    . LEU A 1 163 ? 6.014   -17.382 -2.393  1.00 34.86  ? 205 LEU A CB    1 
ATOM   1264 C CG    . LEU A 1 163 ? 5.244   -17.869 -1.166  1.00 37.33  ? 205 LEU A CG    1 
ATOM   1265 C CD1   . LEU A 1 163 ? 5.833   -17.208 0.065   1.00 41.22  ? 205 LEU A CD1   1 
ATOM   1266 C CD2   . LEU A 1 163 ? 3.759   -17.516 -1.261  1.00 43.97  ? 205 LEU A CD2   1 
ATOM   1267 N N     . VAL A 1 164 ? 8.375   -19.643 -1.494  1.00 31.89  ? 206 VAL A N     1 
ATOM   1268 C CA    . VAL A 1 164 ? 8.480   -21.089 -1.555  1.00 32.29  ? 206 VAL A CA    1 
ATOM   1269 C C     . VAL A 1 164 ? 7.359   -21.631 -0.681  1.00 33.37  ? 206 VAL A C     1 
ATOM   1270 O O     . VAL A 1 164 ? 7.352   -21.415 0.540   1.00 33.44  ? 206 VAL A O     1 
ATOM   1271 C CB    . VAL A 1 164 ? 9.853   -21.598 -1.083  1.00 33.09  ? 206 VAL A CB    1 
ATOM   1272 C CG1   . VAL A 1 164 ? 10.006  -23.070 -1.415  1.00 25.44  ? 206 VAL A CG1   1 
ATOM   1273 C CG2   . VAL A 1 164 ? 10.996  -20.775 -1.687  1.00 27.24  ? 206 VAL A CG2   1 
ATOM   1274 N N     . LEU A 1 165 ? 6.391   -22.284 -1.313  1.00 29.56  ? 207 LEU A N     1 
ATOM   1275 C CA    . LEU A 1 165 ? 5.424   -23.128 -0.634  1.00 24.13  ? 207 LEU A CA    1 
ATOM   1276 C C     . LEU A 1 165 ? 5.766   -24.592 -0.888  1.00 27.59  ? 207 LEU A C     1 
ATOM   1277 O O     . LEU A 1 165 ? 6.033   -24.987 -2.033  1.00 29.13  ? 207 LEU A O     1 
ATOM   1278 C CB    . LEU A 1 165 ? 4.008   -22.827 -1.119  1.00 31.19  ? 207 LEU A CB    1 
ATOM   1279 C CG    . LEU A 1 165 ? 2.949   -23.879 -0.783  1.00 31.46  ? 207 LEU A CG    1 
ATOM   1280 C CD1   . LEU A 1 165 ? 2.713   -23.909 0.718   1.00 25.26  ? 207 LEU A CD1   1 
ATOM   1281 C CD2   . LEU A 1 165 ? 1.653   -23.634 -1.561  1.00 24.92  ? 207 LEU A CD2   1 
ATOM   1282 N N     . CYS A 1 166 ? 5.771   -25.387 0.182   1.00 21.71  ? 208 CYS A N     1 
ATOM   1283 C CA    . CYS A 1 166 ? 6.013   -26.819 0.118   1.00 20.01  ? 208 CYS A CA    1 
ATOM   1284 C C     . CYS A 1 166 ? 5.097   -27.529 1.108   1.00 27.59  ? 208 CYS A C     1 
ATOM   1285 O O     . CYS A 1 166 ? 4.567   -26.925 2.044   1.00 24.25  ? 208 CYS A O     1 
ATOM   1286 C CB    . CYS A 1 166 ? 7.460   -27.165 0.463   1.00 27.54  ? 208 CYS A CB    1 
ATOM   1287 S SG    . CYS A 1 166 ? 7.894   -26.780 2.202   1.00 33.35  ? 208 CYS A SG    1 
ATOM   1288 N N     . GLY A 1 167 ? 4.949   -28.835 0.918   1.00 27.71  ? 209 GLY A N     1 
ATOM   1289 C CA    . GLY A 1 167 ? 4.149   -29.637 1.808   1.00 28.04  ? 209 GLY A CA    1 
ATOM   1290 C C     . GLY A 1 167 ? 3.089   -30.424 1.069   1.00 28.71  ? 209 GLY A C     1 
ATOM   1291 O O     . GLY A 1 167 ? 3.113   -30.570 -0.164  1.00 29.79  ? 209 GLY A O     1 
ATOM   1292 N N     . ASP A 1 168 ? 2.142   -30.939 1.847   1.00 21.74  ? 210 ASP A N     1 
ATOM   1293 C CA    . ASP A 1 168 ? 1.079   -31.799 1.341   1.00 27.44  ? 210 ASP A CA    1 
ATOM   1294 C C     . ASP A 1 168 ? -0.125  -30.923 0.989   1.00 30.03  ? 210 ASP A C     1 
ATOM   1295 O O     . ASP A 1 168 ? -0.895  -30.520 1.864   1.00 26.27  ? 210 ASP A O     1 
ATOM   1296 C CB    . ASP A 1 168 ? 0.722   -32.857 2.384   1.00 28.50  ? 210 ASP A CB    1 
ATOM   1297 C CG    . ASP A 1 168 ? -0.375  -33.795 1.919   1.00 28.26  ? 210 ASP A CG    1 
ATOM   1298 O OD1   . ASP A 1 168 ? -0.596  -34.846 2.558   1.00 28.92  ? 210 ASP A OD1   1 
ATOM   1299 O OD2   . ASP A 1 168 ? -1.007  -33.500 0.888   1.00 27.22  ? 210 ASP A OD2   1 
ATOM   1300 N N     . LEU A 1 169 ? -0.323  -30.696 -0.308  1.00 31.74  ? 211 LEU A N     1 
ATOM   1301 C CA    . LEU A 1 169 ? -1.444  -29.919 -0.816  1.00 28.85  ? 211 LEU A CA    1 
ATOM   1302 C C     . LEU A 1 169 ? -2.675  -30.753 -1.158  1.00 25.59  ? 211 LEU A C     1 
ATOM   1303 O O     . LEU A 1 169 ? -3.682  -30.182 -1.586  1.00 25.15  ? 211 LEU A O     1 
ATOM   1304 C CB    . LEU A 1 169 ? -1.012  -29.091 -2.028  1.00 24.87  ? 211 LEU A CB    1 
ATOM   1305 C CG    . LEU A 1 169 ? 0.307   -28.348 -1.842  1.00 26.99  ? 211 LEU A CG    1 
ATOM   1306 C CD1   . LEU A 1 169 ? 0.529   -27.435 -3.043  1.00 36.36  ? 211 LEU A CD1   1 
ATOM   1307 C CD2   . LEU A 1 169 ? 0.395   -27.657 -0.478  1.00 31.42  ? 211 LEU A CD2   1 
ATOM   1308 N N     . ASN A 1 170 ? -2.623  -32.062 -0.925  1.00 29.40  ? 212 ASN A N     1 
ATOM   1309 C CA    . ASN A 1 170 ? -3.781  -32.966 -0.948  1.00 37.16  ? 212 ASN A CA    1 
ATOM   1310 C C     . ASN A 1 170 ? -4.619  -32.830 -2.220  1.00 36.31  ? 212 ASN A C     1 
ATOM   1311 O O     . ASN A 1 170 ? -5.850  -32.871 -2.192  1.00 32.90  ? 212 ASN A O     1 
ATOM   1312 C CB    . ASN A 1 170 ? -4.641  -32.782 0.304   1.00 29.71  ? 212 ASN A CB    1 
ATOM   1313 C CG    . ASN A 1 170 ? -4.161  -33.640 1.464   1.00 31.13  ? 212 ASN A CG    1 
ATOM   1314 O OD1   . ASN A 1 170 ? -3.902  -34.837 1.313   1.00 35.82  ? 212 ASN A OD1   1 
ATOM   1315 N ND2   . ASN A 1 170 ? -4.032  -33.028 2.629   1.00 35.51  ? 212 ASN A ND2   1 
ATOM   1316 N N     . VAL A 1 171 ? -3.936  -32.682 -3.348  1.00 35.94  ? 213 VAL A N     1 
ATOM   1317 C CA    . VAL A 1 171 ? -4.566  -32.648 -4.662  1.00 38.11  ? 213 VAL A CA    1 
ATOM   1318 C C     . VAL A 1 171 ? -3.556  -33.181 -5.658  1.00 33.60  ? 213 VAL A C     1 
ATOM   1319 O O     . VAL A 1 171 ? -2.358  -32.923 -5.539  1.00 34.20  ? 213 VAL A O     1 
ATOM   1320 C CB    . VAL A 1 171 ? -5.045  -31.233 -5.057  1.00 36.15  ? 213 VAL A CB    1 
ATOM   1321 C CG1   . VAL A 1 171 ? -3.940  -30.215 -4.885  1.00 34.07  ? 213 VAL A CG1   1 
ATOM   1322 C CG2   . VAL A 1 171 ? -5.504  -31.224 -6.518  1.00 46.59  ? 213 VAL A CG2   1 
ATOM   1323 N N     . ALA A 1 172 ? -4.035  -33.977 -6.601  1.00 37.83  ? 214 ALA A N     1 
ATOM   1324 C CA    . ALA A 1 172 ? -3.262  -34.368 -7.771  1.00 41.08  ? 214 ALA A CA    1 
ATOM   1325 C C     . ALA A 1 172 ? -3.712  -33.455 -8.904  1.00 41.50  ? 214 ALA A C     1 
ATOM   1326 O O     . ALA A 1 172 ? -4.814  -33.625 -9.431  1.00 41.10  ? 214 ALA A O     1 
ATOM   1327 C CB    . ALA A 1 172 ? -3.483  -35.840 -8.106  1.00 34.22  ? 214 ALA A CB    1 
ATOM   1328 N N     . HIS A 1 173 ? -2.878  -32.465 -9.243  1.00 33.08  ? 215 HIS A N     1 
ATOM   1329 C CA    . HIS A 1 173 ? -3.296  -31.399 -10.151 1.00 36.48  ? 215 HIS A CA    1 
ATOM   1330 C C     . HIS A 1 173 ? -3.924  -31.946 -11.431 1.00 42.22  ? 215 HIS A C     1 
ATOM   1331 O O     . HIS A 1 173 ? -4.965  -31.454 -11.886 1.00 41.23  ? 215 HIS A O     1 
ATOM   1332 C CB    . HIS A 1 173 ? -2.103  -30.503 -10.481 1.00 34.45  ? 215 HIS A CB    1 
ATOM   1333 C CG    . HIS A 1 173 ? -2.431  -29.365 -11.402 1.00 47.59  ? 215 HIS A CG    1 
ATOM   1334 N ND1   . HIS A 1 173 ? -3.725  -28.968 -11.670 1.00 51.80  ? 215 HIS A ND1   1 
ATOM   1335 C CD2   . HIS A 1 173 ? -1.629  -28.508 -12.082 1.00 46.39  ? 215 HIS A CD2   1 
ATOM   1336 C CE1   . HIS A 1 173 ? -3.708  -27.934 -12.492 1.00 46.46  ? 215 HIS A CE1   1 
ATOM   1337 N NE2   . HIS A 1 173 ? -2.449  -27.633 -12.754 1.00 47.95  ? 215 HIS A NE2   1 
ATOM   1338 N N     . GLU A 1 174 ? -3.305  -32.966 -12.024 1.00 38.41  ? 216 GLU A N     1 
ATOM   1339 C CA    . GLU A 1 174 ? -3.719  -33.488 -13.314 1.00 37.10  ? 216 GLU A CA    1 
ATOM   1340 C C     . GLU A 1 174 ? -3.618  -35.010 -13.290 1.00 42.68  ? 216 GLU A C     1 
ATOM   1341 O O     . GLU A 1 174 ? -3.035  -35.604 -12.372 1.00 36.64  ? 216 GLU A O     1 
ATOM   1342 C CB    . GLU A 1 174 ? -2.870  -32.895 -14.447 1.00 37.51  ? 216 GLU A CB    1 
ATOM   1343 C CG    . GLU A 1 174 ? -2.896  -31.374 -14.550 1.00 34.57  ? 216 GLU A CG    1 
ATOM   1344 C CD    . GLU A 1 174 ? -4.165  -30.862 -15.198 1.00 38.97  ? 216 GLU A CD    1 
ATOM   1345 O OE1   . GLU A 1 174 ? -4.943  -31.671 -15.764 1.00 38.84  ? 216 GLU A OE1   1 
ATOM   1346 O OE2   . GLU A 1 174 ? -4.393  -29.640 -15.128 1.00 44.20  ? 216 GLU A OE2   1 
ATOM   1347 N N     . GLU A 1 175 ? -4.210  -35.633 -14.325 1.00 41.66  ? 217 GLU A N     1 
ATOM   1348 C CA    . GLU A 1 175 ? -4.268  -37.089 -14.432 1.00 33.17  ? 217 GLU A CA    1 
ATOM   1349 C C     . GLU A 1 175 ? -2.874  -37.697 -14.473 1.00 43.37  ? 217 GLU A C     1 
ATOM   1350 O O     . GLU A 1 175 ? -2.655  -38.800 -13.953 1.00 43.72  ? 217 GLU A O     1 
ATOM   1351 C CB    . GLU A 1 175 ? -5.072  -37.470 -15.673 1.00 41.15  ? 217 GLU A CB    1 
ATOM   1352 C CG    . GLU A 1 175 ? -6.204  -36.469 -16.000 1.00 57.95  ? 217 GLU A CG    1 
ATOM   1353 C CD    . GLU A 1 175 ? -7.249  -37.013 -16.991 1.00 70.64  ? 217 GLU A CD    1 
ATOM   1354 O OE1   . GLU A 1 175 ? -8.215  -36.274 -17.347 1.00 67.85  ? 217 GLU A OE1   1 
ATOM   1355 O OE2   . GLU A 1 175 ? -7.086  -38.177 -17.425 1.00 67.42  ? 217 GLU A OE2   1 
ATOM   1356 N N     . ILE A 1 176 ? -1.919  -36.981 -15.076 1.00 40.32  ? 218 ILE A N     1 
ATOM   1357 C CA    . ILE A 1 176 ? -0.502  -37.314 -14.973 1.00 41.31  ? 218 ILE A CA    1 
ATOM   1358 C C     . ILE A 1 176 ? -0.093  -37.622 -13.529 1.00 44.79  ? 218 ILE A C     1 
ATOM   1359 O O     . ILE A 1 176 ? 0.764   -38.486 -13.293 1.00 41.01  ? 218 ILE A O     1 
ATOM   1360 C CB    . ILE A 1 176 ? 0.333   -36.152 -15.558 1.00 46.43  ? 218 ILE A CB    1 
ATOM   1361 C CG1   . ILE A 1 176 ? 1.825   -36.494 -15.577 1.00 45.97  ? 218 ILE A CG1   1 
ATOM   1362 C CG2   . ILE A 1 176 ? 0.101   -34.854 -14.764 1.00 42.65  ? 218 ILE A CG2   1 
ATOM   1363 C CD1   . ILE A 1 176 ? 2.285   -37.297 -16.777 1.00 44.88  ? 218 ILE A CD1   1 
ATOM   1364 N N     . ASP A 1 177 ? -0.712  -36.951 -12.547 1.00 36.36  ? 219 ASP A N     1 
ATOM   1365 C CA    . ASP A 1 177 ? -0.225  -36.950 -11.172 1.00 42.01  ? 219 ASP A CA    1 
ATOM   1366 C C     . ASP A 1 177 ? -0.805  -38.056 -10.305 1.00 40.61  ? 219 ASP A C     1 
ATOM   1367 O O     . ASP A 1 177 ? -0.628  -38.013 -9.078  1.00 31.63  ? 219 ASP A O     1 
ATOM   1368 C CB    . ASP A 1 177 ? -0.503  -35.608 -10.504 1.00 33.36  ? 219 ASP A CB    1 
ATOM   1369 C CG    . ASP A 1 177 ? 0.242   -34.493 -11.153 1.00 39.74  ? 219 ASP A CG    1 
ATOM   1370 O OD1   . ASP A 1 177 ? 1.493   -34.468 -10.995 1.00 35.97  ? 219 ASP A OD1   1 
ATOM   1371 O OD2   . ASP A 1 177 ? -0.414  -33.649 -11.811 1.00 40.78  ? 219 ASP A OD2   1 
ATOM   1372 N N     . LEU A 1 178 ? -1.486  -39.030 -10.904 1.00 42.22  ? 220 LEU A N     1 
ATOM   1373 C CA    . LEU A 1 178 ? -2.009  -40.182 -10.179 1.00 43.00  ? 220 LEU A CA    1 
ATOM   1374 C C     . LEU A 1 178 ? -2.144  -41.333 -11.162 1.00 38.89  ? 220 LEU A C     1 
ATOM   1375 O O     . LEU A 1 178 ? -2.160  -41.136 -12.383 1.00 36.97  ? 220 LEU A O     1 
ATOM   1376 C CB    . LEU A 1 178 ? -3.360  -39.889 -9.492  1.00 41.41  ? 220 LEU A CB    1 
ATOM   1377 C CG    . LEU A 1 178 ? -4.634  -39.513 -10.279 1.00 40.93  ? 220 LEU A CG    1 
ATOM   1378 C CD1   . LEU A 1 178 ? -5.846  -39.502 -9.362  1.00 42.70  ? 220 LEU A CD1   1 
ATOM   1379 C CD2   . LEU A 1 178 ? -4.508  -38.167 -10.945 1.00 40.99  ? 220 LEU A CD2   1 
ATOM   1380 N N     . ARG A 1 179 ? -2.265  -42.535 -10.594 1.00 33.07  ? 221 ARG A N     1 
ATOM   1381 C CA    . ARG A 1 179 ? -2.221  -43.786 -11.332 1.00 38.58  ? 221 ARG A CA    1 
ATOM   1382 C C     . ARG A 1 179 ? -3.598  -44.225 -11.830 1.00 42.77  ? 221 ARG A C     1 
ATOM   1383 O O     . ARG A 1 179 ? -3.709  -44.759 -12.944 1.00 50.40  ? 221 ARG A O     1 
ATOM   1384 C CB    . ARG A 1 179 ? -1.582  -44.882 -10.469 1.00 41.17  ? 221 ARG A CB    1 
ATOM   1385 C CG    . ARG A 1 179 ? -1.531  -46.240 -11.209 1.00 45.99  ? 221 ARG A CG    1 
ATOM   1386 C CD    . ARG A 1 179 ? -0.822  -46.236 -12.650 1.00 45.37  ? 221 ARG A CD    1 
ATOM   1387 N NE    . ARG A 1 179 ? -0.839  -47.538 -13.297 1.00 46.52  ? 221 ARG A NE    1 
ATOM   1388 C CZ    . ARG A 1 179 ? -1.833  -47.938 -14.122 1.00 57.66  ? 221 ARG A CZ    1 
ATOM   1389 N NH1   . ARG A 1 179 ? -2.885  -47.181 -14.358 1.00 56.21  ? 221 ARG A NH1   1 
ATOM   1390 N NH2   . ARG A 1 179 ? -1.823  -49.136 -14.677 1.00 48.67  ? 221 ARG A NH2   1 
ATOM   1391 N N     . ASN A 1 180 ? -4.659  -43.984 -11.056 1.00 44.52  ? 222 ASN A N     1 
ATOM   1392 C CA    . ASN A 1 180 ? -6.028  -44.336 -11.419 1.00 37.27  ? 222 ASN A CA    1 
ATOM   1393 C C     . ASN A 1 180 ? -6.895  -43.082 -11.464 1.00 41.93  ? 222 ASN A C     1 
ATOM   1394 O O     . ASN A 1 180 ? -7.840  -42.955 -10.675 1.00 47.14  ? 222 ASN A O     1 
ATOM   1395 C CB    . ASN A 1 180 ? -6.611  -45.344 -10.432 1.00 35.27  ? 222 ASN A CB    1 
ATOM   1396 C CG    . ASN A 1 180 ? -5.595  -46.400 -9.994  1.00 43.61  ? 222 ASN A CG    1 
ATOM   1397 O OD1   . ASN A 1 180 ? -4.723  -46.792 -10.770 1.00 50.46  ? 222 ASN A OD1   1 
ATOM   1398 N ND2   . ASN A 1 180 ? -5.727  -46.889 -8.753  1.00 42.55  ? 222 ASN A ND2   1 
ATOM   1399 N N     . PRO A 1 181 ? -6.619  -42.150 -12.386 1.00 40.02  ? 223 PRO A N     1 
ATOM   1400 C CA    . PRO A 1 181 ? -7.335  -40.865 -12.364 1.00 43.85  ? 223 PRO A CA    1 
ATOM   1401 C C     . PRO A 1 181 ? -8.846  -40.938 -12.539 1.00 53.12  ? 223 PRO A C     1 
ATOM   1402 O O     . PRO A 1 181 ? -9.520  -39.954 -12.191 1.00 56.49  ? 223 PRO A O     1 
ATOM   1403 C CB    . PRO A 1 181 ? -6.683  -40.071 -13.511 1.00 41.05  ? 223 PRO A CB    1 
ATOM   1404 C CG    . PRO A 1 181 ? -5.987  -41.068 -14.328 1.00 43.50  ? 223 PRO A CG    1 
ATOM   1405 C CD    . PRO A 1 181 ? -5.538  -42.137 -13.383 1.00 39.93  ? 223 PRO A CD    1 
ATOM   1406 N N     . LYS A 1 182 ? -9.426  -42.022 -13.065 1.00 50.12  ? 224 LYS A N     1 
ATOM   1407 C CA    . LYS A 1 182 ? -10.873 -41.931 -13.278 1.00 51.30  ? 224 LYS A CA    1 
ATOM   1408 C C     . LYS A 1 182 ? -11.699 -42.782 -12.332 1.00 53.50  ? 224 LYS A C     1 
ATOM   1409 O O     . LYS A 1 182 ? -12.882 -42.467 -12.114 1.00 58.29  ? 224 LYS A O     1 
ATOM   1410 C CB    . LYS A 1 182 ? -11.256 -42.247 -14.720 1.00 58.60  ? 224 LYS A CB    1 
ATOM   1411 N N     . GLY A 1 183 ? -11.108 -43.822 -11.731 1.00 44.91  ? 225 GLY A N     1 
ATOM   1412 C CA    . GLY A 1 183 ? -11.673 -44.415 -10.525 1.00 50.84  ? 225 GLY A CA    1 
ATOM   1413 C C     . GLY A 1 183 ? -11.652 -43.476 -9.322  1.00 57.69  ? 225 GLY A C     1 
ATOM   1414 O O     . GLY A 1 183 ? -12.168 -43.823 -8.253  1.00 55.68  ? 225 GLY A O     1 
ATOM   1415 N N     . ASN A 1 184 ? -11.086 -42.264 -9.496  1.00 46.55  ? 226 ASN A N     1 
ATOM   1416 C CA    . ASN A 1 184 ? -10.822 -41.352 -8.389  1.00 46.74  ? 226 ASN A CA    1 
ATOM   1417 C C     . ASN A 1 184 ? -11.408 -39.961 -8.595  1.00 47.98  ? 226 ASN A C     1 
ATOM   1418 O O     . ASN A 1 184 ? -10.988 -39.024 -7.908  1.00 52.68  ? 226 ASN A O     1 
ATOM   1419 C CB    . ASN A 1 184 ? -9.314  -41.206 -8.149  1.00 42.08  ? 226 ASN A CB    1 
ATOM   1420 C CG    . ASN A 1 184 ? -8.743  -42.304 -7.292  1.00 42.73  ? 226 ASN A CG    1 
ATOM   1421 O OD1   . ASN A 1 184 ? -9.317  -42.685 -6.259  1.00 48.00  ? 226 ASN A OD1   1 
ATOM   1422 N ND2   . ASN A 1 184 ? -7.595  -42.819 -7.703  1.00 39.51  ? 226 ASN A ND2   1 
ATOM   1423 N N     . LYS A 1 185 ? -12.338 -39.773 -9.526  1.00 46.18  ? 227 LYS A N     1 
ATOM   1424 C CA    . LYS A 1 185 ? -12.796 -38.399 -9.723  1.00 50.42  ? 227 LYS A CA    1 
ATOM   1425 C C     . LYS A 1 185 ? -13.841 -37.974 -8.702  1.00 38.09  ? 227 LYS A C     1 
ATOM   1426 O O     . LYS A 1 185 ? -14.138 -36.777 -8.604  1.00 38.49  ? 227 LYS A O     1 
ATOM   1427 C CB    . LYS A 1 185 ? -13.317 -38.194 -11.153 1.00 51.08  ? 227 LYS A CB    1 
ATOM   1428 C CG    . LYS A 1 185 ? -12.243 -37.630 -12.122 1.00 57.35  ? 227 LYS A CG    1 
ATOM   1429 C CD    . LYS A 1 185 ? -12.051 -36.104 -12.007 1.00 61.09  ? 227 LYS A CD    1 
ATOM   1430 C CE    . LYS A 1 185 ? -12.901 -35.358 -13.063 1.00 60.23  ? 227 LYS A CE    1 
ATOM   1431 N NZ    . LYS A 1 185 ? -12.772 -33.868 -13.030 1.00 68.02  ? 227 LYS A NZ    1 
ATOM   1432 N N     . LYS A 1 186 ? -14.387 -38.903 -7.927  1.00 34.34  ? 228 LYS A N     1 
ATOM   1433 C CA    . LYS A 1 186 ? -15.234 -38.518 -6.806  1.00 49.69  ? 228 LYS A CA    1 
ATOM   1434 C C     . LYS A 1 186 ? -14.558 -38.765 -5.454  1.00 50.13  ? 228 LYS A C     1 
ATOM   1435 O O     . LYS A 1 186 ? -15.184 -38.550 -4.408  1.00 40.11  ? 228 LYS A O     1 
ATOM   1436 C CB    . LYS A 1 186 ? -16.591 -39.225 -6.903  1.00 43.67  ? 228 LYS A CB    1 
ATOM   1437 C CG    . LYS A 1 186 ? -17.620 -38.513 -7.820  1.00 50.80  ? 228 LYS A CG    1 
ATOM   1438 C CD    . LYS A 1 186 ? -18.108 -37.138 -7.258  1.00 55.94  ? 228 LYS A CD    1 
ATOM   1439 C CE    . LYS A 1 186 ? -17.409 -35.913 -7.922  1.00 55.15  ? 228 LYS A CE    1 
ATOM   1440 N NZ    . LYS A 1 186 ? -17.572 -34.589 -7.196  1.00 47.78  ? 228 LYS A NZ    1 
ATOM   1441 N N     . ASN A 1 187 ? -13.279 -39.162 -5.458  1.00 44.84  ? 229 ASN A N     1 
ATOM   1442 C CA    . ASN A 1 187 ? -12.487 -39.346 -4.251  1.00 44.21  ? 229 ASN A CA    1 
ATOM   1443 C C     . ASN A 1 187 ? -11.655 -38.109 -3.918  1.00 45.63  ? 229 ASN A C     1 
ATOM   1444 O O     . ASN A 1 187 ? -11.249 -37.340 -4.799  1.00 40.37  ? 229 ASN A O     1 
ATOM   1445 C CB    . ASN A 1 187 ? -11.565 -40.548 -4.392  1.00 48.64  ? 229 ASN A CB    1 
ATOM   1446 C CG    . ASN A 1 187 ? -12.286 -41.754 -4.923  1.00 59.14  ? 229 ASN A CG    1 
ATOM   1447 O OD1   . ASN A 1 187 ? -13.040 -41.649 -5.897  1.00 70.32  ? 229 ASN A OD1   1 
ATOM   1448 N ND2   . ASN A 1 187 ? -12.080 -42.911 -4.285  1.00 56.65  ? 229 ASN A ND2   1 
ATOM   1449 N N     . ALA A 1 188 ? -11.406 -37.934 -2.618  1.00 43.36  ? 230 ALA A N     1 
ATOM   1450 C CA    . ALA A 1 188 ? -10.653 -36.786 -2.127  1.00 43.02  ? 230 ALA A CA    1 
ATOM   1451 C C     . ALA A 1 188 ? -9.274  -36.737 -2.764  1.00 45.35  ? 230 ALA A C     1 
ATOM   1452 O O     . ALA A 1 188 ? -8.513  -37.714 -2.716  1.00 40.98  ? 230 ALA A O     1 
ATOM   1453 C CB    . ALA A 1 188 ? -10.513 -36.847 -0.608  1.00 25.69  ? 230 ALA A CB    1 
ATOM   1454 N N     . GLY A 1 189 ? -8.945  -35.591 -3.341  1.00 31.22  ? 231 GLY A N     1 
ATOM   1455 C CA    . GLY A 1 189 ? -7.637  -35.364 -3.909  1.00 37.14  ? 231 GLY A CA    1 
ATOM   1456 C C     . GLY A 1 189 ? -7.639  -35.279 -5.411  1.00 39.23  ? 231 GLY A C     1 
ATOM   1457 O O     . GLY A 1 189 ? -6.706  -34.702 -5.980  1.00 38.30  ? 231 GLY A O     1 
ATOM   1458 N N     . PHE A 1 190 ? -8.663  -35.845 -6.071  1.00 40.89  ? 232 PHE A N     1 
ATOM   1459 C CA    . PHE A 1 190 ? -8.879  -35.650 -7.495  1.00 42.04  ? 232 PHE A CA    1 
ATOM   1460 C C     . PHE A 1 190 ? -10.293 -35.165 -7.798  1.00 43.36  ? 232 PHE A C     1 
ATOM   1461 O O     . PHE A 1 190 ? -10.868 -35.513 -8.837  1.00 41.40  ? 232 PHE A O     1 
ATOM   1462 C CB    . PHE A 1 190 ? -8.586  -36.922 -8.271  1.00 47.26  ? 232 PHE A CB    1 
ATOM   1463 C CG    . PHE A 1 190 ? -8.094  -36.663 -9.655  1.00 45.36  ? 232 PHE A CG    1 
ATOM   1464 C CD1   . PHE A 1 190 ? -7.115  -35.714 -9.880  1.00 40.36  ? 232 PHE A CD1   1 
ATOM   1465 C CD2   . PHE A 1 190 ? -8.599  -37.373 -10.729 1.00 44.89  ? 232 PHE A CD2   1 
ATOM   1466 C CE1   . PHE A 1 190 ? -6.639  -35.473 -11.162 1.00 42.04  ? 232 PHE A CE1   1 
ATOM   1467 C CE2   . PHE A 1 190 ? -8.130  -37.136 -12.010 1.00 47.63  ? 232 PHE A CE2   1 
ATOM   1468 C CZ    . PHE A 1 190 ? -7.145  -36.181 -12.224 1.00 44.05  ? 232 PHE A CZ    1 
ATOM   1469 N N     . THR A 1 191 ? -10.875 -34.346 -6.895  1.00 44.35  ? 233 THR A N     1 
ATOM   1470 C CA    . THR A 1 191 ? -12.135 -33.838 -7.401  1.00 46.22  ? 233 THR A CA    1 
ATOM   1471 C C     . THR A 1 191 ? -11.879 -32.617 -8.266  1.00 44.75  ? 233 THR A C     1 
ATOM   1472 O O     . THR A 1 191 ? -10.891 -31.906 -8.067  1.00 46.87  ? 233 THR A O     1 
ATOM   1473 C CB    . THR A 1 191 ? -13.091 -33.456 -6.259  1.00 45.68  ? 233 THR A CB    1 
ATOM   1474 O OG1   . THR A 1 191 ? -12.657 -32.231 -5.643  1.00 40.61  ? 233 THR A OG1   1 
ATOM   1475 C CG2   . THR A 1 191 ? -13.223 -34.597 -5.232  1.00 39.10  ? 233 THR A CG2   1 
ATOM   1476 N N     . PRO A 1 192 ? -12.768 -32.388 -9.229  1.00 48.34  ? 234 PRO A N     1 
ATOM   1477 C CA    . PRO A 1 192 ? -12.659 -31.183 -10.062 1.00 44.58  ? 234 PRO A CA    1 
ATOM   1478 C C     . PRO A 1 192 ? -12.523 -29.919 -9.246  1.00 42.46  ? 234 PRO A C     1 
ATOM   1479 O O     . PRO A 1 192 ? -11.723 -29.043 -9.599  1.00 40.01  ? 234 PRO A O     1 
ATOM   1480 C CB    . PRO A 1 192 ? -13.969 -31.190 -10.868 1.00 49.33  ? 234 PRO A CB    1 
ATOM   1481 C CG    . PRO A 1 192 ? -14.757 -32.378 -10.381 1.00 58.87  ? 234 PRO A CG    1 
ATOM   1482 C CD    . PRO A 1 192 ? -13.824 -33.300 -9.691  1.00 49.63  ? 234 PRO A CD    1 
ATOM   1483 N N     . GLN A 1 193 ? -13.284 -29.815 -8.150  1.00 47.62  ? 235 GLN A N     1 
ATOM   1484 C CA    . GLN A 1 193 ? -13.232 -28.635 -7.291  1.00 49.60  ? 235 GLN A CA    1 
ATOM   1485 C C     . GLN A 1 193 ? -11.851 -28.471 -6.665  1.00 43.67  ? 235 GLN A C     1 
ATOM   1486 O O     . GLN A 1 193 ? -11.294 -27.363 -6.639  1.00 36.72  ? 235 GLN A O     1 
ATOM   1487 C CB    . GLN A 1 193 ? -14.313 -28.733 -6.212  1.00 40.97  ? 235 GLN A CB    1 
ATOM   1488 C CG    . GLN A 1 193 ? -15.736 -28.855 -6.751  1.00 35.22  ? 235 GLN A CG    1 
ATOM   1489 C CD    . GLN A 1 193 ? -16.075 -30.239 -7.302  1.00 45.18  ? 235 GLN A CD    1 
ATOM   1490 O OE1   . GLN A 1 193 ? -15.494 -31.243 -6.899  1.00 45.81  ? 235 GLN A OE1   1 
ATOM   1491 N NE2   . GLN A 1 193 ? -17.015 -30.288 -8.249  1.00 48.46  ? 235 GLN A NE2   1 
ATOM   1492 N N     . GLU A 1 194 ? -11.276 -29.571 -6.171  1.00 42.74  ? 236 GLU A N     1 
ATOM   1493 C CA    . GLU A 1 194 ? -9.898  -29.529 -5.692  1.00 45.67  ? 236 GLU A CA    1 
ATOM   1494 C C     . GLU A 1 194 ? -8.934  -29.141 -6.814  1.00 42.90  ? 236 GLU A C     1 
ATOM   1495 O O     . GLU A 1 194 ? -8.166  -28.180 -6.682  1.00 41.14  ? 236 GLU A O     1 
ATOM   1496 C CB    . GLU A 1 194 ? -9.528  -30.877 -5.080  1.00 42.20  ? 236 GLU A CB    1 
ATOM   1497 C CG    . GLU A 1 194 ? -10.033 -31.064 -3.644  1.00 37.10  ? 236 GLU A CG    1 
ATOM   1498 C CD    . GLU A 1 194 ? -9.967  -32.521 -3.173  1.00 38.77  ? 236 GLU A CD    1 
ATOM   1499 O OE1   . GLU A 1 194 ? -10.268 -33.436 -3.977  1.00 38.15  ? 236 GLU A OE1   1 
ATOM   1500 O OE2   . GLU A 1 194 ? -9.613  -32.754 -1.996  1.00 41.20  ? 236 GLU A OE2   1 
ATOM   1501 N N     . ARG A 1 195 ? -8.993  -29.853 -7.943  1.00 37.50  ? 237 ARG A N     1 
ATOM   1502 C CA    . ARG A 1 195 ? -8.067  -29.604 -9.048  1.00 44.45  ? 237 ARG A CA    1 
ATOM   1503 C C     . ARG A 1 195 ? -8.073  -28.146 -9.491  1.00 40.05  ? 237 ARG A C     1 
ATOM   1504 O O     . ARG A 1 195 ? -7.017  -27.506 -9.565  1.00 42.62  ? 237 ARG A O     1 
ATOM   1505 C CB    . ARG A 1 195 ? -8.397  -30.513 -10.226 1.00 38.43  ? 237 ARG A CB    1 
ATOM   1506 C CG    . ARG A 1 195 ? -8.051  -31.946 -9.955  1.00 41.07  ? 237 ARG A CG    1 
ATOM   1507 C CD    . ARG A 1 195 ? -8.619  -32.805 -11.012 1.00 43.73  ? 237 ARG A CD    1 
ATOM   1508 N NE    . ARG A 1 195 ? -7.931  -32.614 -12.278 1.00 51.62  ? 237 ARG A NE    1 
ATOM   1509 C CZ    . ARG A 1 195 ? -8.236  -33.274 -13.388 1.00 53.11  ? 237 ARG A CZ    1 
ATOM   1510 N NH1   . ARG A 1 195 ? -9.231  -34.162 -13.380 1.00 42.04  ? 237 ARG A NH1   1 
ATOM   1511 N NH2   . ARG A 1 195 ? -7.550  -33.040 -14.500 1.00 48.87  ? 237 ARG A NH2   1 
ATOM   1512 N N     . GLN A 1 196 ? -9.247  -27.613 -9.815  1.00 34.46  ? 238 GLN A N     1 
ATOM   1513 C CA    . GLN A 1 196 ? -9.332  -26.227 -10.262 1.00 39.56  ? 238 GLN A CA    1 
ATOM   1514 C C     . GLN A 1 196 ? -8.837  -25.262 -9.180  1.00 41.39  ? 238 GLN A C     1 
ATOM   1515 O O     . GLN A 1 196 ? -8.296  -24.186 -9.493  1.00 36.65  ? 238 GLN A O     1 
ATOM   1516 C CB    . GLN A 1 196 ? -10.786 -25.945 -10.713 1.00 42.71  ? 238 GLN A CB    1 
ATOM   1517 C CG    . GLN A 1 196 ? -11.262 -24.501 -10.632 1.00 47.43  ? 238 GLN A CG    1 
ATOM   1518 C CD    . GLN A 1 196 ? -12.127 -24.239 -9.390  1.00 63.16  ? 238 GLN A CD    1 
ATOM   1519 O OE1   . GLN A 1 196 ? -13.073 -24.988 -9.103  1.00 61.23  ? 238 GLN A OE1   1 
ATOM   1520 N NE2   . GLN A 1 196 ? -11.773 -23.191 -8.626  1.00 57.27  ? 238 GLN A NE2   1 
ATOM   1521 N N     . GLY A 1 197 ? -8.977  -25.646 -7.907  1.00 36.97  ? 239 GLY A N     1 
ATOM   1522 C CA    . GLY A 1 197 ? -8.405  -24.842 -6.844  1.00 42.92  ? 239 GLY A CA    1 
ATOM   1523 C C     . GLY A 1 197 ? -6.892  -24.746 -6.935  1.00 41.89  ? 239 GLY A C     1 
ATOM   1524 O O     . GLY A 1 197 ? -6.318  -23.670 -6.758  1.00 40.73  ? 239 GLY A O     1 
ATOM   1525 N N     . PHE A 1 198 ? -6.227  -25.876 -7.199  1.00 38.15  ? 240 PHE A N     1 
ATOM   1526 C CA    . PHE A 1 198 ? -4.792  -25.861 -7.456  1.00 36.45  ? 240 PHE A CA    1 
ATOM   1527 C C     . PHE A 1 198 ? -4.437  -24.885 -8.577  1.00 47.02  ? 240 PHE A C     1 
ATOM   1528 O O     . PHE A 1 198 ? -3.570  -24.016 -8.405  1.00 45.13  ? 240 PHE A O     1 
ATOM   1529 C CB    . PHE A 1 198 ? -4.306  -27.266 -7.802  1.00 41.17  ? 240 PHE A CB    1 
ATOM   1530 C CG    . PHE A 1 198 ? -2.816  -27.404 -7.750  1.00 45.81  ? 240 PHE A CG    1 
ATOM   1531 C CD1   . PHE A 1 198 ? -2.046  -27.269 -8.897  1.00 45.78  ? 240 PHE A CD1   1 
ATOM   1532 C CD2   . PHE A 1 198 ? -2.178  -27.633 -6.537  1.00 39.68  ? 240 PHE A CD2   1 
ATOM   1533 C CE1   . PHE A 1 198 ? -0.660  -27.396 -8.838  1.00 42.11  ? 240 PHE A CE1   1 
ATOM   1534 C CE2   . PHE A 1 198 ? -0.805  -27.742 -6.466  1.00 37.33  ? 240 PHE A CE2   1 
ATOM   1535 C CZ    . PHE A 1 198 ? -0.044  -27.619 -7.620  1.00 42.70  ? 240 PHE A CZ    1 
ATOM   1536 N N     . GLY A 1 199 ? -5.088  -25.023 -9.740  1.00 42.05  ? 241 GLY A N     1 
ATOM   1537 C CA    . GLY A 1 199 ? -4.879  -24.059 -10.807 1.00 34.98  ? 241 GLY A CA    1 
ATOM   1538 C C     . GLY A 1 199 ? -5.148  -22.635 -10.362 1.00 36.29  ? 241 GLY A C     1 
ATOM   1539 O O     . GLY A 1 199 ? -4.433  -21.700 -10.739 1.00 40.42  ? 241 GLY A O     1 
ATOM   1540 N N     . GLU A 1 200 ? -6.195  -22.440 -9.576  1.00 39.32  ? 242 GLU A N     1 
ATOM   1541 C CA    . GLU A 1 200 ? -6.438  -21.105 -9.047  1.00 44.85  ? 242 GLU A CA    1 
ATOM   1542 C C     . GLU A 1 200 ? -5.233  -20.612 -8.260  1.00 38.33  ? 242 GLU A C     1 
ATOM   1543 O O     . GLU A 1 200 ? -4.830  -19.449 -8.374  1.00 37.76  ? 242 GLU A O     1 
ATOM   1544 C CB    . GLU A 1 200 ? -7.708  -21.124 -8.194  1.00 45.48  ? 242 GLU A CB    1 
ATOM   1545 C CG    . GLU A 1 200 ? -8.924  -20.610 -8.939  1.00 53.43  ? 242 GLU A CG    1 
ATOM   1546 C CD    . GLU A 1 200 ? -8.857  -19.103 -9.111  1.00 60.88  ? 242 GLU A CD    1 
ATOM   1547 O OE1   . GLU A 1 200 ? -9.261  -18.380 -8.174  1.00 62.80  ? 242 GLU A OE1   1 
ATOM   1548 O OE2   . GLU A 1 200 ? -8.360  -18.636 -10.162 1.00 72.02  ? 242 GLU A OE2   1 
ATOM   1549 N N     . LEU A 1 201 ? -4.625  -21.507 -7.486  1.00 34.42  ? 243 LEU A N     1 
ATOM   1550 C CA    . LEU A 1 201 ? -3.449  -21.165 -6.705  1.00 40.88  ? 243 LEU A CA    1 
ATOM   1551 C C     . LEU A 1 201 ? -2.292  -20.785 -7.625  1.00 40.26  ? 243 LEU A C     1 
ATOM   1552 O O     . LEU A 1 201 ? -1.616  -19.765 -7.412  1.00 38.58  ? 243 LEU A O     1 
ATOM   1553 C CB    . LEU A 1 201 ? -3.086  -22.356 -5.809  1.00 41.01  ? 243 LEU A CB    1 
ATOM   1554 C CG    . LEU A 1 201 ? -1.865  -22.277 -4.905  1.00 34.16  ? 243 LEU A CG    1 
ATOM   1555 C CD1   . LEU A 1 201 ? -2.018  -21.106 -3.980  1.00 29.54  ? 243 LEU A CD1   1 
ATOM   1556 C CD2   . LEU A 1 201 ? -1.820  -23.551 -4.117  1.00 27.28  ? 243 LEU A CD2   1 
ATOM   1557 N N     . LEU A 1 202 ? -2.076  -21.587 -8.680  1.00 31.87  ? 244 LEU A N     1 
ATOM   1558 C CA    . LEU A 1 202 ? -1.038  -21.327 -9.677  1.00 37.68  ? 244 LEU A CA    1 
ATOM   1559 C C     . LEU A 1 202 ? -1.263  -20.025 -10.451 1.00 39.08  ? 244 LEU A C     1 
ATOM   1560 O O     . LEU A 1 202 ? -0.295  -19.355 -10.824 1.00 40.82  ? 244 LEU A O     1 
ATOM   1561 C CB    . LEU A 1 202 ? -0.961  -22.506 -10.640 1.00 31.06  ? 244 LEU A CB    1 
ATOM   1562 C CG    . LEU A 1 202 ? -0.397  -23.812 -10.096 1.00 40.10  ? 244 LEU A CG    1 
ATOM   1563 C CD1   . LEU A 1 202 ? -0.299  -24.858 -11.234 1.00 31.83  ? 244 LEU A CD1   1 
ATOM   1564 C CD2   . LEU A 1 202 ? 0.957   -23.579 -9.372  1.00 29.98  ? 244 LEU A CD2   1 
ATOM   1565 N N     . GLN A 1 203 ? -2.509  -19.655 -10.728 1.00 39.91  ? 245 GLN A N     1 
ATOM   1566 C CA    . GLN A 1 203 ? -2.728  -18.409 -11.445 1.00 43.31  ? 245 GLN A CA    1 
ATOM   1567 C C     . GLN A 1 203 ? -2.732  -17.195 -10.523 1.00 44.72  ? 245 GLN A C     1 
ATOM   1568 O O     . GLN A 1 203 ? -2.154  -16.155 -10.858 1.00 48.49  ? 245 GLN A O     1 
ATOM   1569 C CB    . GLN A 1 203 ? -4.041  -18.486 -12.233 1.00 47.70  ? 245 GLN A CB    1 
ATOM   1570 C CG    . GLN A 1 203 ? -4.567  -17.141 -12.745 1.00 54.33  ? 245 GLN A CG    1 
ATOM   1571 C CD    . GLN A 1 203 ? -3.717  -16.536 -13.871 1.00 69.38  ? 245 GLN A CD    1 
ATOM   1572 O OE1   . GLN A 1 203 ? -2.494  -16.329 -13.732 1.00 68.25  ? 245 GLN A OE1   1 
ATOM   1573 N NE2   . GLN A 1 203 ? -4.368  -16.249 -14.997 1.00 59.54  ? 245 GLN A NE2   1 
ATOM   1574 N N     . ALA A 1 204 ? -3.353  -17.302 -9.354  1.00 36.95  ? 246 ALA A N     1 
ATOM   1575 C CA    . ALA A 1 204 ? -3.613  -16.101 -8.576  1.00 40.46  ? 246 ALA A CA    1 
ATOM   1576 C C     . ALA A 1 204 ? -2.351  -15.554 -7.920  1.00 35.98  ? 246 ALA A C     1 
ATOM   1577 O O     . ALA A 1 204 ? -2.160  -14.335 -7.875  1.00 43.98  ? 246 ALA A O     1 
ATOM   1578 C CB    . ALA A 1 204 ? -4.691  -16.382 -7.529  1.00 43.83  ? 246 ALA A CB    1 
ATOM   1579 N N     . VAL A 1 205 ? -1.487  -16.419 -7.394  1.00 42.52  ? 247 VAL A N     1 
ATOM   1580 C CA    . VAL A 1 205 ? -0.418  -15.928 -6.499  1.00 48.67  ? 247 VAL A CA    1 
ATOM   1581 C C     . VAL A 1 205 ? 0.595   -15.043 -7.238  1.00 43.75  ? 247 VAL A C     1 
ATOM   1582 O O     . VAL A 1 205 ? 0.891   -13.946 -6.770  1.00 44.31  ? 247 VAL A O     1 
ATOM   1583 C CB    . VAL A 1 205 ? 0.296   -17.090 -5.738  1.00 47.50  ? 247 VAL A CB    1 
ATOM   1584 C CG1   . VAL A 1 205 ? 1.542   -16.577 -4.998  1.00 44.00  ? 247 VAL A CG1   1 
ATOM   1585 C CG2   . VAL A 1 205 ? -0.670  -17.752 -4.752  1.00 41.62  ? 247 VAL A CG2   1 
ATOM   1586 N N     . PRO A 1 206 ? 1.131   -15.495 -8.386  1.00 41.81  ? 248 PRO A N     1 
ATOM   1587 C CA    . PRO A 1 206 ? 1.095   -16.813 -9.013  1.00 38.43  ? 248 PRO A CA    1 
ATOM   1588 C C     . PRO A 1 206 ? 2.226   -17.676 -8.481  1.00 38.19  ? 248 PRO A C     1 
ATOM   1589 O O     . PRO A 1 206 ? 3.094   -17.136 -7.797  1.00 29.91  ? 248 PRO A O     1 
ATOM   1590 C CB    . PRO A 1 206 ? 1.289   -16.493 -10.491 1.00 38.99  ? 248 PRO A CB    1 
ATOM   1591 C CG    . PRO A 1 206 ? 2.149   -15.301 -10.483 1.00 36.64  ? 248 PRO A CG    1 
ATOM   1592 C CD    . PRO A 1 206 ? 1.729   -14.493 -9.286  1.00 42.35  ? 248 PRO A CD    1 
ATOM   1593 N N     . LEU A 1 207 ? 2.211   -18.977 -8.797  1.00 40.23  ? 249 LEU A N     1 
ATOM   1594 C CA    . LEU A 1 207 ? 3.297   -19.896 -8.480  1.00 37.74  ? 249 LEU A CA    1 
ATOM   1595 C C     . LEU A 1 207 ? 3.539   -20.839 -9.660  1.00 37.34  ? 249 LEU A C     1 
ATOM   1596 O O     . LEU A 1 207 ? 2.766   -20.897 -10.620 1.00 38.83  ? 249 LEU A O     1 
ATOM   1597 C CB    . LEU A 1 207 ? 2.994   -20.711 -7.205  1.00 35.51  ? 249 LEU A CB    1 
ATOM   1598 C CG    . LEU A 1 207 ? 2.617   -19.860 -5.985  1.00 36.44  ? 249 LEU A CG    1 
ATOM   1599 C CD1   . LEU A 1 207 ? 1.769   -20.629 -4.953  1.00 30.50  ? 249 LEU A CD1   1 
ATOM   1600 C CD2   . LEU A 1 207 ? 3.862   -19.247 -5.350  1.00 34.45  ? 249 LEU A CD2   1 
ATOM   1601 N N     . ALA A 1 208 ? 4.608   -21.623 -9.545  1.00 38.60  ? 250 ALA A N     1 
ATOM   1602 C CA    . ALA A 1 208 ? 5.001   -22.635 -10.516 1.00 33.39  ? 250 ALA A CA    1 
ATOM   1603 C C     . ALA A 1 208 ? 5.313   -23.951 -9.805  1.00 34.61  ? 250 ALA A C     1 
ATOM   1604 O O     . ALA A 1 208 ? 6.005   -23.960 -8.781  1.00 35.73  ? 250 ALA A O     1 
ATOM   1605 C CB    . ALA A 1 208 ? 6.229   -22.166 -11.300 1.00 30.08  ? 250 ALA A CB    1 
ATOM   1606 N N     . ASP A 1 209 ? 4.808   -25.059 -10.354 1.00 34.59  ? 251 ASP A N     1 
ATOM   1607 C CA    . ASP A 1 209 ? 5.051   -26.407 -9.835  1.00 26.72  ? 251 ASP A CA    1 
ATOM   1608 C C     . ASP A 1 209 ? 6.467   -26.840 -10.238 1.00 28.42  ? 251 ASP A C     1 
ATOM   1609 O O     . ASP A 1 209 ? 6.711   -27.204 -11.390 1.00 29.56  ? 251 ASP A O     1 
ATOM   1610 C CB    . ASP A 1 209 ? 3.957   -27.333 -10.379 1.00 21.45  ? 251 ASP A CB    1 
ATOM   1611 C CG    . ASP A 1 209 ? 4.066   -28.793 -9.893  1.00 27.81  ? 251 ASP A CG    1 
ATOM   1612 O OD1   . ASP A 1 209 ? 5.147   -29.254 -9.482  1.00 30.44  ? 251 ASP A OD1   1 
ATOM   1613 O OD2   . ASP A 1 209 ? 3.052   -29.521 -9.971  1.00 32.79  ? 251 ASP A OD2   1 
ATOM   1614 N N     . SER A 1 210 ? 7.403   -26.807 -9.285  1.00 32.42  ? 252 SER A N     1 
ATOM   1615 C CA    . SER A 1 210 ? 8.810   -27.090 -9.582  1.00 32.24  ? 252 SER A CA    1 
ATOM   1616 C C     . SER A 1 210 ? 8.982   -28.415 -10.318 1.00 34.32  ? 252 SER A C     1 
ATOM   1617 O O     . SER A 1 210 ? 9.707   -28.498 -11.322 1.00 35.99  ? 252 SER A O     1 
ATOM   1618 C CB    . SER A 1 210 ? 9.630   -27.113 -8.290  1.00 24.76  ? 252 SER A CB    1 
ATOM   1619 O OG    . SER A 1 210 ? 9.222   -28.205 -7.485  1.00 30.88  ? 252 SER A OG    1 
ATOM   1620 N N     . PHE A 1 211 ? 8.335   -29.472 -9.826  1.00 29.88  ? 253 PHE A N     1 
ATOM   1621 C CA    . PHE A 1 211 ? 8.535   -30.762 -10.466 1.00 33.45  ? 253 PHE A CA    1 
ATOM   1622 C C     . PHE A 1 211 ? 7.957   -30.772 -11.873 1.00 38.60  ? 253 PHE A C     1 
ATOM   1623 O O     . PHE A 1 211 ? 8.535   -31.373 -12.782 1.00 34.95  ? 253 PHE A O     1 
ATOM   1624 C CB    . PHE A 1 211 ? 7.925   -31.887 -9.641  1.00 24.44  ? 253 PHE A CB    1 
ATOM   1625 C CG    . PHE A 1 211 ? 8.119   -33.237 -10.262 1.00 30.64  ? 253 PHE A CG    1 
ATOM   1626 C CD1   . PHE A 1 211 ? 7.190   -33.745 -11.167 1.00 34.62  ? 253 PHE A CD1   1 
ATOM   1627 C CD2   . PHE A 1 211 ? 9.245   -33.991 -9.975  1.00 33.09  ? 253 PHE A CD2   1 
ATOM   1628 C CE1   . PHE A 1 211 ? 7.371   -34.983 -11.751 1.00 30.37  ? 253 PHE A CE1   1 
ATOM   1629 C CE2   . PHE A 1 211 ? 9.438   -35.230 -10.562 1.00 32.65  ? 253 PHE A CE2   1 
ATOM   1630 C CZ    . PHE A 1 211 ? 8.492   -35.727 -11.444 1.00 34.04  ? 253 PHE A CZ    1 
ATOM   1631 N N     . ARG A 1 212 ? 6.810   -30.134 -12.078 1.00 35.95  ? 254 ARG A N     1 
ATOM   1632 C CA    . ARG A 1 212 ? 6.214   -30.226 -13.394 1.00 35.21  ? 254 ARG A CA    1 
ATOM   1633 C C     . ARG A 1 212 ? 6.802   -29.201 -14.350 1.00 39.46  ? 254 ARG A C     1 
ATOM   1634 O O     . ARG A 1 212 ? 6.674   -29.357 -15.566 1.00 47.59  ? 254 ARG A O     1 
ATOM   1635 C CB    . ARG A 1 212 ? 4.698   -30.080 -13.297 1.00 32.71  ? 254 ARG A CB    1 
ATOM   1636 C CG    . ARG A 1 212 ? 3.960   -30.657 -14.483 1.00 29.76  ? 254 ARG A CG    1 
ATOM   1637 C CD    . ARG A 1 212 ? 4.302   -32.122 -14.671 1.00 32.34  ? 254 ARG A CD    1 
ATOM   1638 N NE    . ARG A 1 212 ? 3.775   -33.003 -13.630 1.00 34.88  ? 254 ARG A NE    1 
ATOM   1639 C CZ    . ARG A 1 212 ? 3.992   -34.320 -13.616 1.00 38.27  ? 254 ARG A CZ    1 
ATOM   1640 N NH1   . ARG A 1 212 ? 4.725   -34.876 -14.571 1.00 38.35  ? 254 ARG A NH1   1 
ATOM   1641 N NH2   . ARG A 1 212 ? 3.493   -35.090 -12.659 1.00 39.85  ? 254 ARG A NH2   1 
ATOM   1642 N N     . HIS A 1 213 ? 7.448   -28.170 -13.830 1.00 34.37  ? 255 HIS A N     1 
ATOM   1643 C CA    . HIS A 1 213 ? 8.232   -27.274 -14.660 1.00 38.24  ? 255 HIS A CA    1 
ATOM   1644 C C     . HIS A 1 213 ? 9.561   -27.882 -15.092 1.00 44.55  ? 255 HIS A C     1 
ATOM   1645 O O     . HIS A 1 213 ? 10.170  -27.395 -16.053 1.00 44.93  ? 255 HIS A O     1 
ATOM   1646 C CB    . HIS A 1 213 ? 8.501   -25.973 -13.908 1.00 39.53  ? 255 HIS A CB    1 
ATOM   1647 C CG    . HIS A 1 213 ? 9.329   -24.994 -14.676 1.00 42.34  ? 255 HIS A CG    1 
ATOM   1648 N ND1   . HIS A 1 213 ? 10.704  -24.970 -14.606 1.00 42.55  ? 255 HIS A ND1   1 
ATOM   1649 C CD2   . HIS A 1 213 ? 8.976   -23.998 -15.522 1.00 45.01  ? 255 HIS A CD2   1 
ATOM   1650 C CE1   . HIS A 1 213 ? 11.165  -24.002 -15.378 1.00 50.00  ? 255 HIS A CE1   1 
ATOM   1651 N NE2   . HIS A 1 213 ? 10.137  -23.398 -15.945 1.00 49.62  ? 255 HIS A NE2   1 
ATOM   1652 N N     . LEU A 1 214 ? 10.052  -28.903 -14.394 1.00 41.03  ? 256 LEU A N     1 
ATOM   1653 C CA    . LEU A 1 214 ? 11.250  -29.583 -14.857 1.00 44.05  ? 256 LEU A CA    1 
ATOM   1654 C C     . LEU A 1 214 ? 10.952  -30.890 -15.570 1.00 43.09  ? 256 LEU A C     1 
ATOM   1655 O O     . LEU A 1 214 ? 11.843  -31.434 -16.229 1.00 48.18  ? 256 LEU A O     1 
ATOM   1656 C CB    . LEU A 1 214 ? 12.220  -29.853 -13.697 1.00 34.60  ? 256 LEU A CB    1 
ATOM   1657 C CG    . LEU A 1 214 ? 12.912  -28.616 -13.129 1.00 40.89  ? 256 LEU A CG    1 
ATOM   1658 C CD1   . LEU A 1 214 ? 13.738  -28.985 -11.919 1.00 40.67  ? 256 LEU A CD1   1 
ATOM   1659 C CD2   . LEU A 1 214 ? 13.783  -27.925 -14.168 1.00 48.21  ? 256 LEU A CD2   1 
ATOM   1660 N N     . TYR A 1 215 ? 9.743   -31.420 -15.446 1.00 36.00  ? 257 TYR A N     1 
ATOM   1661 C CA    . TYR A 1 215 ? 9.400   -32.719 -16.022 1.00 37.32  ? 257 TYR A CA    1 
ATOM   1662 C C     . TYR A 1 215 ? 7.963   -32.693 -16.505 1.00 40.52  ? 257 TYR A C     1 
ATOM   1663 O O     . TYR A 1 215 ? 7.113   -33.456 -16.026 1.00 38.71  ? 257 TYR A O     1 
ATOM   1664 C CB    . TYR A 1 215 ? 9.617   -33.844 -15.013 1.00 39.74  ? 257 TYR A CB    1 
ATOM   1665 C CG    . TYR A 1 215 ? 10.912  -33.778 -14.263 1.00 38.63  ? 257 TYR A CG    1 
ATOM   1666 C CD1   . TYR A 1 215 ? 11.051  -33.008 -13.120 1.00 36.99  ? 257 TYR A CD1   1 
ATOM   1667 C CD2   . TYR A 1 215 ? 12.007  -34.482 -14.714 1.00 46.67  ? 257 TYR A CD2   1 
ATOM   1668 C CE1   . TYR A 1 215 ? 12.253  -32.950 -12.447 1.00 39.05  ? 257 TYR A CE1   1 
ATOM   1669 C CE2   . TYR A 1 215 ? 13.211  -34.438 -14.049 1.00 50.82  ? 257 TYR A CE2   1 
ATOM   1670 C CZ    . TYR A 1 215 ? 13.334  -33.675 -12.921 1.00 45.81  ? 257 TYR A CZ    1 
ATOM   1671 O OH    . TYR A 1 215 ? 14.556  -33.662 -12.295 1.00 33.93  ? 257 TYR A OH    1 
ATOM   1672 N N     . PRO A 1 216 ? 7.665   -31.854 -17.505 1.00 41.06  ? 258 PRO A N     1 
ATOM   1673 C CA    . PRO A 1 216 ? 6.267   -31.598 -17.849 1.00 42.34  ? 258 PRO A CA    1 
ATOM   1674 C C     . PRO A 1 216 ? 5.546   -32.795 -18.425 1.00 37.16  ? 258 PRO A C     1 
ATOM   1675 O O     . PRO A 1 216 ? 4.322   -32.734 -18.555 1.00 42.84  ? 258 PRO A O     1 
ATOM   1676 C CB    . PRO A 1 216 ? 6.366   -30.450 -18.862 1.00 38.68  ? 258 PRO A CB    1 
ATOM   1677 C CG    . PRO A 1 216 ? 7.666   -30.597 -19.439 1.00 29.02  ? 258 PRO A CG    1 
ATOM   1678 C CD    . PRO A 1 216 ? 8.569   -31.092 -18.376 1.00 33.70  ? 258 PRO A CD    1 
ATOM   1679 N N     . ASN A 1 217 ? 6.232   -33.887 -18.745 1.00 35.24  ? 259 ASN A N     1 
ATOM   1680 C CA    . ASN A 1 217 ? 5.478   -35.044 -19.205 1.00 45.63  ? 259 ASN A CA    1 
ATOM   1681 C C     . ASN A 1 217 ? 6.032   -36.342 -18.667 1.00 43.99  ? 259 ASN A C     1 
ATOM   1682 O O     . ASN A 1 217 ? 5.865   -37.394 -19.302 1.00 42.60  ? 259 ASN A O     1 
ATOM   1683 C CB    . ASN A 1 217 ? 5.416   -35.116 -20.726 1.00 44.11  ? 259 ASN A CB    1 
ATOM   1684 C CG    . ASN A 1 217 ? 4.238   -34.355 -21.273 1.00 54.73  ? 259 ASN A CG    1 
ATOM   1685 O OD1   . ASN A 1 217 ? 3.091   -34.822 -21.208 1.00 57.27  ? 259 ASN A OD1   1 
ATOM   1686 N ND2   . ASN A 1 217 ? 4.503   -33.157 -21.793 1.00 54.81  ? 259 ASN A ND2   1 
ATOM   1687 N N     . THR A 1 218 ? 6.669   -36.296 -17.495 1.00 29.36  ? 260 THR A N     1 
ATOM   1688 C CA    . THR A 1 218 ? 7.161   -37.510 -16.859 1.00 41.32  ? 260 THR A CA    1 
ATOM   1689 C C     . THR A 1 218 ? 6.044   -38.179 -16.062 1.00 51.07  ? 260 THR A C     1 
ATOM   1690 O O     . THR A 1 218 ? 5.456   -37.537 -15.175 1.00 41.50  ? 260 THR A O     1 
ATOM   1691 C CB    . THR A 1 218 ? 8.323   -37.200 -15.951 1.00 40.36  ? 260 THR A CB    1 
ATOM   1692 O OG1   . THR A 1 218 ? 9.303   -36.479 -16.702 1.00 47.03  ? 260 THR A OG1   1 
ATOM   1693 C CG2   . THR A 1 218 ? 8.919   -38.499 -15.434 1.00 37.45  ? 260 THR A CG2   1 
ATOM   1694 N N     . PRO A 1 219 ? 5.714   -39.437 -16.341 1.00 45.93  ? 261 PRO A N     1 
ATOM   1695 C CA    . PRO A 1 219 ? 4.579   -40.065 -15.660 1.00 43.32  ? 261 PRO A CA    1 
ATOM   1696 C C     . PRO A 1 219 ? 5.031   -40.931 -14.515 1.00 39.61  ? 261 PRO A C     1 
ATOM   1697 O O     . PRO A 1 219 ? 6.231   -41.139 -14.330 1.00 35.15  ? 261 PRO A O     1 
ATOM   1698 C CB    . PRO A 1 219 ? 3.941   -40.910 -16.768 1.00 40.77  ? 261 PRO A CB    1 
ATOM   1699 C CG    . PRO A 1 219 ? 5.136   -41.369 -17.540 1.00 40.33  ? 261 PRO A CG    1 
ATOM   1700 C CD    . PRO A 1 219 ? 6.147   -40.223 -17.505 1.00 34.18  ? 261 PRO A CD    1 
ATOM   1701 N N     . TYR A 1 220 ? 4.061   -41.439 -13.752 1.00 49.40  ? 262 TYR A N     1 
ATOM   1702 C CA    . TYR A 1 220 ? 4.252   -42.444 -12.705 1.00 43.54  ? 262 TYR A CA    1 
ATOM   1703 C C     . TYR A 1 220 ? 5.026   -41.924 -11.492 1.00 35.41  ? 262 TYR A C     1 
ATOM   1704 O O     . TYR A 1 220 ? 5.477   -42.719 -10.653 1.00 32.91  ? 262 TYR A O     1 
ATOM   1705 C CB    . TYR A 1 220 ? 4.905   -43.696 -13.295 1.00 42.48  ? 262 TYR A CB    1 
ATOM   1706 C CG    . TYR A 1 220 ? 4.117   -44.224 -14.472 1.00 48.72  ? 262 TYR A CG    1 
ATOM   1707 C CD1   . TYR A 1 220 ? 2.724   -44.172 -14.463 1.00 47.13  ? 262 TYR A CD1   1 
ATOM   1708 C CD2   . TYR A 1 220 ? 4.748   -44.756 -15.591 1.00 49.42  ? 262 TYR A CD2   1 
ATOM   1709 C CE1   . TYR A 1 220 ? 1.977   -44.637 -15.527 1.00 51.85  ? 262 TYR A CE1   1 
ATOM   1710 C CE2   . TYR A 1 220 ? 4.002   -45.236 -16.673 1.00 54.05  ? 262 TYR A CE2   1 
ATOM   1711 C CZ    . TYR A 1 220 ? 2.616   -45.170 -16.630 1.00 58.81  ? 262 TYR A CZ    1 
ATOM   1712 O OH    . TYR A 1 220 ? 1.855   -45.633 -17.680 1.00 50.05  ? 262 TYR A OH    1 
ATOM   1713 N N     . ALA A 1 221 ? 5.135   -40.597 -11.354 1.00 32.82  ? 263 ALA A N     1 
ATOM   1714 C CA    . ALA A 1 221 ? 5.974   -39.968 -10.332 1.00 39.47  ? 263 ALA A CA    1 
ATOM   1715 C C     . ALA A 1 221 ? 5.073   -39.474 -9.195  1.00 34.99  ? 263 ALA A C     1 
ATOM   1716 O O     . ALA A 1 221 ? 4.537   -38.362 -9.232  1.00 29.34  ? 263 ALA A O     1 
ATOM   1717 C CB    . ALA A 1 221 ? 6.820   -38.846 -10.936 1.00 31.40  ? 263 ALA A CB    1 
ATOM   1718 N N     . TYR A 1 222 ? 4.929   -40.308 -8.175  1.00 30.23  ? 264 TYR A N     1 
ATOM   1719 C CA    . TYR A 1 222 ? 4.038   -40.070 -7.059  1.00 32.03  ? 264 TYR A CA    1 
ATOM   1720 C C     . TYR A 1 222 ? 4.825   -39.854 -5.771  1.00 28.76  ? 264 TYR A C     1 
ATOM   1721 O O     . TYR A 1 222 ? 5.983   -40.258 -5.644  1.00 31.33  ? 264 TYR A O     1 
ATOM   1722 C CB    . TYR A 1 222 ? 3.081   -41.254 -6.912  1.00 36.32  ? 264 TYR A CB    1 
ATOM   1723 C CG    . TYR A 1 222 ? 2.501   -41.692 -8.235  1.00 33.33  ? 264 TYR A CG    1 
ATOM   1724 C CD1   . TYR A 1 222 ? 2.025   -40.758 -9.156  1.00 37.04  ? 264 TYR A CD1   1 
ATOM   1725 C CD2   . TYR A 1 222 ? 2.449   -43.034 -8.575  1.00 33.61  ? 264 TYR A CD2   1 
ATOM   1726 C CE1   . TYR A 1 222 ? 1.505   -41.153 -10.390 1.00 38.83  ? 264 TYR A CE1   1 
ATOM   1727 C CE2   . TYR A 1 222 ? 1.927   -43.444 -9.797  1.00 38.86  ? 264 TYR A CE2   1 
ATOM   1728 C CZ    . TYR A 1 222 ? 1.456   -42.499 -10.709 1.00 41.11  ? 264 TYR A CZ    1 
ATOM   1729 O OH    . TYR A 1 222 ? 0.933   -42.910 -11.930 1.00 34.57  ? 264 TYR A OH    1 
ATOM   1730 N N     . THR A 1 223 ? 4.179   -39.202 -4.802  1.00 32.98  ? 265 THR A N     1 
ATOM   1731 C CA    . THR A 1 223 ? 4.739   -39.063 -3.461  1.00 28.76  ? 265 THR A CA    1 
ATOM   1732 C C     . THR A 1 223 ? 3.973   -39.841 -2.396  1.00 28.80  ? 265 THR A C     1 
ATOM   1733 O O     . THR A 1 223 ? 4.520   -40.063 -1.312  1.00 32.70  ? 265 THR A O     1 
ATOM   1734 C CB    . THR A 1 223 ? 4.805   -37.578 -3.062  1.00 28.54  ? 265 THR A CB    1 
ATOM   1735 O OG1   . THR A 1 223 ? 3.500   -36.984 -3.120  1.00 33.29  ? 265 THR A OG1   1 
ATOM   1736 C CG2   . THR A 1 223 ? 5.697   -36.819 -4.008  1.00 30.85  ? 265 THR A CG2   1 
ATOM   1737 N N     . PHE A 1 224 ? 2.744   -40.286 -2.686  1.00 26.42  ? 266 PHE A N     1 
ATOM   1738 C CA    . PHE A 1 224 ? 1.857   -40.904 -1.709  1.00 27.89  ? 266 PHE A CA    1 
ATOM   1739 C C     . PHE A 1 224 ? 1.309   -42.231 -2.218  1.00 30.76  ? 266 PHE A C     1 
ATOM   1740 O O     . PHE A 1 224 ? 0.836   -42.327 -3.350  1.00 33.79  ? 266 PHE A O     1 
ATOM   1741 C CB    . PHE A 1 224 ? 0.667   -39.996 -1.365  1.00 28.31  ? 266 PHE A CB    1 
ATOM   1742 C CG    . PHE A 1 224 ? -0.494  -40.749 -0.803  1.00 33.63  ? 266 PHE A CG    1 
ATOM   1743 C CD1   . PHE A 1 224 ? -0.460  -41.218 0.505   1.00 32.23  ? 266 PHE A CD1   1 
ATOM   1744 C CD2   . PHE A 1 224 ? -1.613  -41.039 -1.590  1.00 34.07  ? 266 PHE A CD2   1 
ATOM   1745 C CE1   . PHE A 1 224 ? -1.526  -41.963 1.026   1.00 30.51  ? 266 PHE A CE1   1 
ATOM   1746 C CE2   . PHE A 1 224 ? -2.682  -41.766 -1.069  1.00 31.38  ? 266 PHE A CE2   1 
ATOM   1747 C CZ    . PHE A 1 224 ? -2.636  -42.226 0.242   1.00 33.21  ? 266 PHE A CZ    1 
ATOM   1748 N N     . TRP A 1 225 ? 1.344   -43.253 -1.373  1.00 30.36  ? 267 TRP A N     1 
ATOM   1749 C CA    . TRP A 1 225 ? 0.707   -44.520 -1.714  1.00 36.76  ? 267 TRP A CA    1 
ATOM   1750 C C     . TRP A 1 225 ? -0.070  -44.977 -0.494  1.00 38.39  ? 267 TRP A C     1 
ATOM   1751 O O     . TRP A 1 225 ? 0.430   -44.865 0.632   1.00 34.78  ? 267 TRP A O     1 
ATOM   1752 C CB    . TRP A 1 225 ? 1.721   -45.595 -2.121  1.00 34.93  ? 267 TRP A CB    1 
ATOM   1753 C CG    . TRP A 1 225 ? 2.734   -45.133 -3.128  1.00 37.83  ? 267 TRP A CG    1 
ATOM   1754 C CD1   . TRP A 1 225 ? 2.670   -45.282 -4.476  1.00 39.53  ? 267 TRP A CD1   1 
ATOM   1755 C CD2   . TRP A 1 225 ? 3.958   -44.442 -2.858  1.00 35.50  ? 267 TRP A CD2   1 
ATOM   1756 N NE1   . TRP A 1 225 ? 3.772   -44.727 -5.066  1.00 40.39  ? 267 TRP A NE1   1 
ATOM   1757 C CE2   . TRP A 1 225 ? 4.579   -44.200 -4.096  1.00 32.79  ? 267 TRP A CE2   1 
ATOM   1758 C CE3   . TRP A 1 225 ? 4.582   -43.988 -1.684  1.00 37.52  ? 267 TRP A CE3   1 
ATOM   1759 C CZ2   . TRP A 1 225 ? 5.800   -43.524 -4.206  1.00 35.73  ? 267 TRP A CZ2   1 
ATOM   1760 C CZ3   . TRP A 1 225 ? 5.795   -43.320 -1.790  1.00 36.69  ? 267 TRP A CZ3   1 
ATOM   1761 C CH2   . TRP A 1 225 ? 6.397   -43.104 -3.047  1.00 39.48  ? 267 TRP A CH2   1 
ATOM   1762 N N     . THR A 1 226 ? -1.290  -45.460 -0.702  1.00 32.81  ? 268 THR A N     1 
ATOM   1763 C CA    . THR A 1 226 ? -2.041  -45.955 0.440   1.00 39.91  ? 268 THR A CA    1 
ATOM   1764 C C     . THR A 1 226 ? -1.393  -47.219 0.983   1.00 39.40  ? 268 THR A C     1 
ATOM   1765 O O     . THR A 1 226 ? -0.905  -48.066 0.230   1.00 36.84  ? 268 THR A O     1 
ATOM   1766 C CB    . THR A 1 226 ? -3.503  -46.234 0.095   1.00 42.29  ? 268 THR A CB    1 
ATOM   1767 O OG1   . THR A 1 226 ? -4.136  -46.840 1.232   1.00 45.43  ? 268 THR A OG1   1 
ATOM   1768 C CG2   . THR A 1 226 ? -3.622  -47.180 -1.103  1.00 42.94  ? 268 THR A CG2   1 
ATOM   1769 N N     . TYR A 1 227 ? -1.360  -47.315 2.312   1.00 40.19  ? 269 TYR A N     1 
ATOM   1770 C CA    . TYR A 1 227 ? -0.882  -48.526 2.956   1.00 40.11  ? 269 TYR A CA    1 
ATOM   1771 C C     . TYR A 1 227 ? -1.655  -49.736 2.475   1.00 37.54  ? 269 TYR A C     1 
ATOM   1772 O O     . TYR A 1 227 ? -1.139  -50.859 2.504   1.00 46.47  ? 269 TYR A O     1 
ATOM   1773 C CB    . TYR A 1 227 ? -1.006  -48.409 4.480   1.00 41.81  ? 269 TYR A CB    1 
ATOM   1774 C CG    . TYR A 1 227 ? -0.057  -47.443 5.163   1.00 39.67  ? 269 TYR A CG    1 
ATOM   1775 C CD1   . TYR A 1 227 ? 1.326   -47.620 5.095   1.00 39.74  ? 269 TYR A CD1   1 
ATOM   1776 C CD2   . TYR A 1 227 ? -0.547  -46.371 5.906   1.00 39.09  ? 269 TYR A CD2   1 
ATOM   1777 C CE1   . TYR A 1 227 ? 2.198   -46.738 5.742   1.00 42.88  ? 269 TYR A CE1   1 
ATOM   1778 C CE2   . TYR A 1 227 ? 0.314   -45.486 6.560   1.00 37.92  ? 269 TYR A CE2   1 
ATOM   1779 C CZ    . TYR A 1 227 ? 1.685   -45.671 6.480   1.00 39.01  ? 269 TYR A CZ    1 
ATOM   1780 O OH    . TYR A 1 227 ? 2.527   -44.783 7.130   1.00 37.05  ? 269 TYR A OH    1 
ATOM   1781 N N     . MET A 1 228 ? -2.888  -49.534 2.046   1.00 38.75  ? 270 MET A N     1 
ATOM   1782 C CA    . MET A 1 228 ? -3.743  -50.659 1.730   1.00 51.67  ? 270 MET A CA    1 
ATOM   1783 C C     . MET A 1 228 ? -3.360  -51.292 0.395   1.00 52.65  ? 270 MET A C     1 
ATOM   1784 O O     . MET A 1 228 ? -3.057  -50.597 -0.583  1.00 45.24  ? 270 MET A O     1 
ATOM   1785 C CB    . MET A 1 228 ? -5.201  -50.214 1.730   1.00 52.41  ? 270 MET A CB    1 
ATOM   1786 C CG    . MET A 1 228 ? -5.650  -49.726 3.087   1.00 57.13  ? 270 MET A CG    1 
ATOM   1787 S SD    . MET A 1 228 ? -7.407  -49.363 3.125   1.00 55.26  ? 270 MET A SD    1 
ATOM   1788 C CE    . MET A 1 228 ? -7.454  -47.864 2.132   1.00 56.39  ? 270 MET A CE    1 
ATOM   1789 N N     . MET A 1 229 ? -3.334  -52.628 0.387   1.00 58.62  ? 271 MET A N     1 
ATOM   1790 C CA    . MET A 1 229 ? -3.222  -53.433 -0.826  1.00 62.66  ? 271 MET A CA    1 
ATOM   1791 C C     . MET A 1 229 ? -1.895  -53.236 -1.538  1.00 52.92  ? 271 MET A C     1 
ATOM   1792 O O     . MET A 1 229 ? -1.849  -53.274 -2.766  1.00 52.32  ? 271 MET A O     1 
ATOM   1793 C CB    . MET A 1 229 ? -4.378  -53.149 -1.787  1.00 55.33  ? 271 MET A CB    1 
ATOM   1794 C CG    . MET A 1 229 ? -5.718  -53.592 -1.255  1.00 61.53  ? 271 MET A CG    1 
ATOM   1795 S SD    . MET A 1 229 ? -7.035  -52.988 -2.311  1.00 91.43  ? 271 MET A SD    1 
ATOM   1796 C CE    . MET A 1 229 ? -7.495  -51.516 -1.393  1.00 67.05  ? 271 MET A CE    1 
ATOM   1797 N N     . ASN A 1 230 ? -0.821  -53.015 -0.775  1.00 50.54  ? 272 ASN A N     1 
ATOM   1798 C CA    . ASN A 1 230 ? 0.538   -52.927 -1.321  1.00 54.30  ? 272 ASN A CA    1 
ATOM   1799 C C     . ASN A 1 230 ? 0.625   -51.908 -2.446  1.00 44.81  ? 272 ASN A C     1 
ATOM   1800 O O     . ASN A 1 230 ? 1.401   -52.070 -3.390  1.00 43.99  ? 272 ASN A O     1 
ATOM   1801 C CB    . ASN A 1 230 ? 1.036   -54.291 -1.815  1.00 46.60  ? 272 ASN A CB    1 
ATOM   1802 C CG    . ASN A 1 230 ? 1.283   -55.269 -0.683  1.00 61.20  ? 272 ASN A CG    1 
ATOM   1803 O OD1   . ASN A 1 230 ? 2.218   -55.109 0.107   1.00 64.08  ? 272 ASN A OD1   1 
ATOM   1804 N ND2   . ASN A 1 230 ? 0.442   -56.296 -0.600  1.00 67.93  ? 272 ASN A ND2   1 
ATOM   1805 N N     . ALA A 1 231 ? -0.186  -50.853 -2.350  1.00 36.50  ? 273 ALA A N     1 
ATOM   1806 C CA    . ALA A 1 231 ? -0.214  -49.845 -3.402  1.00 37.48  ? 273 ALA A CA    1 
ATOM   1807 C C     . ALA A 1 231 ? 1.178   -49.303 -3.708  1.00 46.07  ? 273 ALA A C     1 
ATOM   1808 O O     . ALA A 1 231 ? 1.455   -48.869 -4.837  1.00 38.82  ? 273 ALA A O     1 
ATOM   1809 C CB    . ALA A 1 231 ? -1.136  -48.706 -3.002  1.00 35.52  ? 273 ALA A CB    1 
ATOM   1810 N N     . ARG A 1 232 ? 2.072   -49.327 -2.721  1.00 47.15  ? 274 ARG A N     1 
ATOM   1811 C CA    . ARG A 1 232 ? 3.379   -48.742 -2.949  1.00 46.20  ? 274 ARG A CA    1 
ATOM   1812 C C     . ARG A 1 232 ? 4.251   -49.630 -3.819  1.00 38.15  ? 274 ARG A C     1 
ATOM   1813 O O     . ARG A 1 232 ? 4.977   -49.128 -4.681  1.00 37.80  ? 274 ARG A O     1 
ATOM   1814 C CB    . ARG A 1 232 ? 4.066   -48.447 -1.627  1.00 41.92  ? 274 ARG A CB    1 
ATOM   1815 C CG    . ARG A 1 232 ? 5.107   -47.370 -1.830  1.00 35.68  ? 274 ARG A CG    1 
ATOM   1816 C CD    . ARG A 1 232 ? 5.932   -47.110 -0.566  1.00 30.43  ? 274 ARG A CD    1 
ATOM   1817 N NE    . ARG A 1 232 ? 6.903   -46.069 -0.768  1.00 38.35  ? 274 ARG A NE    1 
ATOM   1818 C CZ    . ARG A 1 232 ? 7.516   -45.424 0.266   1.00 42.51  ? 274 ARG A CZ    1 
ATOM   1819 N NH1   . ARG A 1 232 ? 7.203   -45.709 1.512   1.00 34.40  ? 274 ARG A NH1   1 
ATOM   1820 N NH2   . ARG A 1 232 ? 8.409   -44.488 0.013   1.00 38.53  ? 274 ARG A NH2   1 
ATOM   1821 N N     . SER A 1 233 ? 4.209   -50.943 -3.602  1.00 36.75  ? 275 SER A N     1 
ATOM   1822 C CA    . SER A 1 233 ? 4.975   -51.846 -4.454  1.00 39.85  ? 275 SER A CA    1 
ATOM   1823 C C     . SER A 1 233 ? 4.496   -51.771 -5.899  1.00 47.36  ? 275 SER A C     1 
ATOM   1824 O O     . SER A 1 233 ? 5.307   -51.712 -6.833  1.00 55.60  ? 275 SER A O     1 
ATOM   1825 C CB    . SER A 1 233 ? 4.879   -53.280 -3.935  1.00 32.97  ? 275 SER A CB    1 
ATOM   1826 O OG    . SER A 1 233 ? 3.523   -53.653 -3.725  1.00 43.29  ? 275 SER A OG    1 
ATOM   1827 N N     . LYS A 1 234 ? 3.197   -51.752 -6.103  1.00 42.58  ? 276 LYS A N     1 
ATOM   1828 C CA    . LYS A 1 234 ? 2.670   -51.664 -7.449  1.00 39.14  ? 276 LYS A CA    1 
ATOM   1829 C C     . LYS A 1 234 ? 2.805   -50.237 -8.063  1.00 47.30  ? 276 LYS A C     1 
ATOM   1830 O O     . LYS A 1 234 ? 2.257   -49.976 -9.168  1.00 41.37  ? 276 LYS A O     1 
ATOM   1831 C CB    . LYS A 1 234 ? 1.212   -52.120 -7.431  1.00 40.76  ? 276 LYS A CB    1 
ATOM   1832 C CG    . LYS A 1 234 ? 1.036   -53.491 -6.796  1.00 42.46  ? 276 LYS A CG    1 
ATOM   1833 C CD    . LYS A 1 234 ? -0.362  -54.050 -7.044  1.00 56.52  ? 276 LYS A CD    1 
ATOM   1834 C CE    . LYS A 1 234 ? -1.292  -53.823 -5.859  1.00 52.58  ? 276 LYS A CE    1 
ATOM   1835 N NZ    . LYS A 1 234 ? -2.375  -54.856 -5.745  1.00 55.09  ? 276 LYS A NZ    1 
ATOM   1836 N N     . ASN A 1 235 ? 3.540   -49.366 -7.359  1.00 45.06  ? 277 ASN A N     1 
ATOM   1837 C CA    . ASN A 1 235 ? 3.639   -47.937 -7.661  1.00 43.07  ? 277 ASN A CA    1 
ATOM   1838 C C     . ASN A 1 235 ? 2.298   -47.313 -8.041  1.00 36.27  ? 277 ASN A C     1 
ATOM   1839 O O     . ASN A 1 235 ? 2.265   -46.378 -8.844  1.00 39.55  ? 277 ASN A O     1 
ATOM   1840 C CB    . ASN A 1 235 ? 4.651   -47.662 -8.784  1.00 41.39  ? 277 ASN A CB    1 
ATOM   1841 C CG    . ASN A 1 235 ? 5.008   -46.178 -8.894  1.00 45.06  ? 277 ASN A CG    1 
ATOM   1842 O OD1   . ASN A 1 235 ? 5.141   -45.491 -7.872  1.00 42.66  ? 277 ASN A OD1   1 
ATOM   1843 N ND2   . ASN A 1 235 ? 5.119   -45.669 -10.125 1.00 35.66  ? 277 ASN A ND2   1 
ATOM   1844 N N     . VAL A 1 236 ? 1.190   -47.797 -7.483  1.00 37.00  ? 278 VAL A N     1 
ATOM   1845 C CA    . VAL A 1 236 ? -0.113  -47.175 -7.716  1.00 41.73  ? 278 VAL A CA    1 
ATOM   1846 C C     . VAL A 1 236 ? -0.245  -46.086 -6.654  1.00 38.75  ? 278 VAL A C     1 
ATOM   1847 O O     . VAL A 1 236 ? -0.483  -46.369 -5.482  1.00 38.85  ? 278 VAL A O     1 
ATOM   1848 C CB    . VAL A 1 236 ? -1.257  -48.198 -7.674  1.00 44.39  ? 278 VAL A CB    1 
ATOM   1849 C CG1   . VAL A 1 236 ? -2.626  -47.531 -7.520  1.00 39.48  ? 278 VAL A CG1   1 
ATOM   1850 C CG2   . VAL A 1 236 ? -1.248  -49.068 -8.923  1.00 38.10  ? 278 VAL A CG2   1 
ATOM   1851 N N     . GLY A 1 237 ? -0.056  -44.835 -7.074  1.00 34.11  ? 279 GLY A N     1 
ATOM   1852 C CA    . GLY A 1 237 ? 0.114   -43.767 -6.117  1.00 34.25  ? 279 GLY A CA    1 
ATOM   1853 C C     . GLY A 1 237 ? -0.264  -42.425 -6.699  1.00 36.73  ? 279 GLY A C     1 
ATOM   1854 O O     . GLY A 1 237 ? -0.656  -42.311 -7.866  1.00 30.36  ? 279 GLY A O     1 
ATOM   1855 N N     . TRP A 1 238 ? -0.128  -41.398 -5.842  1.00 31.00  ? 280 TRP A N     1 
ATOM   1856 C CA    . TRP A 1 238 ? -0.551  -40.032 -6.125  1.00 34.35  ? 280 TRP A CA    1 
ATOM   1857 C C     . TRP A 1 238 ? 0.603   -39.082 -5.866  1.00 31.57  ? 280 TRP A C     1 
ATOM   1858 O O     . TRP A 1 238 ? 1.504   -39.387 -5.084  1.00 31.35  ? 280 TRP A O     1 
ATOM   1859 C CB    . TRP A 1 238 ? -1.724  -39.574 -5.236  1.00 33.27  ? 280 TRP A CB    1 
ATOM   1860 C CG    . TRP A 1 238 ? -2.966  -40.430 -5.202  1.00 29.65  ? 280 TRP A CG    1 
ATOM   1861 C CD1   . TRP A 1 238 ? -3.058  -41.787 -4.956  1.00 26.53  ? 280 TRP A CD1   1 
ATOM   1862 C CD2   . TRP A 1 238 ? -4.305  -39.960 -5.354  1.00 26.29  ? 280 TRP A CD2   1 
ATOM   1863 N NE1   . TRP A 1 238 ? -4.380  -42.177 -4.966  1.00 26.69  ? 280 TRP A NE1   1 
ATOM   1864 C CE2   . TRP A 1 238 ? -5.163  -41.072 -5.207  1.00 33.58  ? 280 TRP A CE2   1 
ATOM   1865 C CE3   . TRP A 1 238 ? -4.864  -38.701 -5.597  1.00 25.92  ? 280 TRP A CE3   1 
ATOM   1866 C CZ2   . TRP A 1 238 ? -6.549  -40.953 -5.296  1.00 33.47  ? 280 TRP A CZ2   1 
ATOM   1867 C CZ3   . TRP A 1 238 ? -6.233  -38.588 -5.692  1.00 34.31  ? 280 TRP A CZ3   1 
ATOM   1868 C CH2   . TRP A 1 238 ? -7.063  -39.706 -5.544  1.00 31.76  ? 280 TRP A CH2   1 
ATOM   1869 N N     . ARG A 1 239 ? 0.556   -37.914 -6.496  1.00 33.36  ? 281 ARG A N     1 
ATOM   1870 C CA    . ARG A 1 239 ? 1.523   -36.858 -6.225  1.00 32.59  ? 281 ARG A CA    1 
ATOM   1871 C C     . ARG A 1 239 ? 0.771   -35.777 -5.461  1.00 33.78  ? 281 ARG A C     1 
ATOM   1872 O O     . ARG A 1 239 ? 0.032   -34.985 -6.052  1.00 30.80  ? 281 ARG A O     1 
ATOM   1873 C CB    . ARG A 1 239 ? 2.163   -36.322 -7.506  1.00 28.48  ? 281 ARG A CB    1 
ATOM   1874 C CG    . ARG A 1 239 ? 3.285   -35.300 -7.254  1.00 34.32  ? 281 ARG A CG    1 
ATOM   1875 C CD    . ARG A 1 239 ? 4.183   -35.045 -8.485  1.00 37.25  ? 281 ARG A CD    1 
ATOM   1876 N NE    . ARG A 1 239 ? 3.571   -34.171 -9.485  1.00 37.87  ? 281 ARG A NE    1 
ATOM   1877 C CZ    . ARG A 1 239 ? 3.735   -32.849 -9.519  1.00 39.98  ? 281 ARG A CZ    1 
ATOM   1878 N NH1   . ARG A 1 239 ? 4.494   -32.246 -8.605  1.00 34.68  ? 281 ARG A NH1   1 
ATOM   1879 N NH2   . ARG A 1 239 ? 3.144   -32.130 -10.470 1.00 38.50  ? 281 ARG A NH2   1 
ATOM   1880 N N     . LEU A 1 240 ? 0.961   -35.751 -4.138  1.00 34.71  ? 282 LEU A N     1 
ATOM   1881 C CA    . LEU A 1 240 ? 0.286   -34.795 -3.269  1.00 28.70  ? 282 LEU A CA    1 
ATOM   1882 C C     . LEU A 1 240 ? 1.215   -33.722 -2.729  1.00 25.57  ? 282 LEU A C     1 
ATOM   1883 O O     . LEU A 1 240 ? 0.738   -32.695 -2.244  1.00 27.39  ? 282 LEU A O     1 
ATOM   1884 C CB    . LEU A 1 240 ? -0.391  -35.536 -2.103  1.00 25.51  ? 282 LEU A CB    1 
ATOM   1885 C CG    . LEU A 1 240 ? -1.347  -36.646 -2.564  1.00 33.78  ? 282 LEU A CG    1 
ATOM   1886 C CD1   . LEU A 1 240 ? -2.121  -37.291 -1.406  1.00 27.78  ? 282 LEU A CD1   1 
ATOM   1887 C CD2   . LEU A 1 240 ? -2.304  -36.138 -3.646  1.00 26.31  ? 282 LEU A CD2   1 
ATOM   1888 N N     . ASP A 1 241 ? 2.522   -33.902 -2.850  1.00 30.77  ? 283 ASP A N     1 
ATOM   1889 C CA    . ASP A 1 241 ? 3.504   -33.049 -2.192  1.00 27.28  ? 283 ASP A CA    1 
ATOM   1890 C C     . ASP A 1 241 ? 4.254   -32.205 -3.218  1.00 22.93  ? 283 ASP A C     1 
ATOM   1891 O O     . ASP A 1 241 ? 4.808   -32.733 -4.184  1.00 26.67  ? 283 ASP A O     1 
ATOM   1892 C CB    . ASP A 1 241 ? 4.441   -33.925 -1.363  1.00 24.41  ? 283 ASP A CB    1 
ATOM   1893 C CG    . ASP A 1 241 ? 3.660   -34.783 -0.372  1.00 31.60  ? 283 ASP A CG    1 
ATOM   1894 O OD1   . ASP A 1 241 ? 3.302   -34.241 0.695   1.00 29.20  ? 283 ASP A OD1   1 
ATOM   1895 O OD2   . ASP A 1 241 ? 3.356   -35.964 -0.673  1.00 26.77  ? 283 ASP A OD2   1 
ATOM   1896 N N     . TYR A 1 242 ? 4.256   -30.898 -3.014  1.00 23.13  ? 284 TYR A N     1 
ATOM   1897 C CA    . TYR A 1 242 ? 4.765   -29.972 -4.005  1.00 25.80  ? 284 TYR A CA    1 
ATOM   1898 C C     . TYR A 1 242 ? 5.827   -29.062 -3.407  1.00 27.61  ? 284 TYR A C     1 
ATOM   1899 O O     . TYR A 1 242 ? 5.896   -28.853 -2.192  1.00 25.28  ? 284 TYR A O     1 
ATOM   1900 C CB    . TYR A 1 242 ? 3.644   -29.110 -4.585  1.00 26.95  ? 284 TYR A CB    1 
ATOM   1901 C CG    . TYR A 1 242 ? 2.610   -29.915 -5.320  1.00 34.23  ? 284 TYR A CG    1 
ATOM   1902 C CD1   . TYR A 1 242 ? 1.533   -30.481 -4.651  1.00 22.57  ? 284 TYR A CD1   1 
ATOM   1903 C CD2   . TYR A 1 242 ? 2.732   -30.137 -6.694  1.00 31.69  ? 284 TYR A CD2   1 
ATOM   1904 C CE1   . TYR A 1 242 ? 0.609   -31.232 -5.325  1.00 28.56  ? 284 TYR A CE1   1 
ATOM   1905 C CE2   . TYR A 1 242 ? 1.809   -30.881 -7.382  1.00 31.29  ? 284 TYR A CE2   1 
ATOM   1906 C CZ    . TYR A 1 242 ? 0.742   -31.429 -6.699  1.00 35.84  ? 284 TYR A CZ    1 
ATOM   1907 O OH    . TYR A 1 242 ? -0.186  -32.176 -7.412  1.00 40.32  ? 284 TYR A OH    1 
ATOM   1908 N N     . PHE A 1 243 ? 6.671   -28.547 -4.295  1.00 25.07  ? 285 PHE A N     1 
ATOM   1909 C CA    . PHE A 1 243 ? 7.331   -27.260 -4.133  1.00 23.11  ? 285 PHE A CA    1 
ATOM   1910 C C     . PHE A 1 243 ? 6.720   -26.336 -5.163  1.00 25.87  ? 285 PHE A C     1 
ATOM   1911 O O     . PHE A 1 243 ? 6.709   -26.673 -6.351  1.00 35.38  ? 285 PHE A O     1 
ATOM   1912 C CB    . PHE A 1 243 ? 8.838   -27.366 -4.343  1.00 19.49  ? 285 PHE A CB    1 
ATOM   1913 C CG    . PHE A 1 243 ? 9.524   -28.139 -3.275  1.00 20.52  ? 285 PHE A CG    1 
ATOM   1914 C CD1   . PHE A 1 243 ? 9.810   -27.540 -2.059  1.00 19.40  ? 285 PHE A CD1   1 
ATOM   1915 C CD2   . PHE A 1 243 ? 9.870   -29.476 -3.475  1.00 24.89  ? 285 PHE A CD2   1 
ATOM   1916 C CE1   . PHE A 1 243 ? 10.437  -28.254 -1.049  1.00 23.46  ? 285 PHE A CE1   1 
ATOM   1917 C CE2   . PHE A 1 243 ? 10.507  -30.213 -2.480  1.00 23.90  ? 285 PHE A CE2   1 
ATOM   1918 C CZ    . PHE A 1 243 ? 10.794  -29.609 -1.262  1.00 26.73  ? 285 PHE A CZ    1 
ATOM   1919 N N     . LEU A 1 244 ? 6.163   -25.210 -4.713  1.00 26.66  ? 286 LEU A N     1 
ATOM   1920 C CA    . LEU A 1 244 ? 5.606   -24.196 -5.604  1.00 29.21  ? 286 LEU A CA    1 
ATOM   1921 C C     . LEU A 1 244 ? 6.422   -22.919 -5.464  1.00 34.00  ? 286 LEU A C     1 
ATOM   1922 O O     . LEU A 1 244 ? 6.716   -22.490 -4.340  1.00 31.07  ? 286 LEU A O     1 
ATOM   1923 C CB    . LEU A 1 244 ? 4.129   -23.929 -5.302  1.00 29.83  ? 286 LEU A CB    1 
ATOM   1924 C CG    . LEU A 1 244 ? 3.201   -25.147 -5.402  1.00 35.91  ? 286 LEU A CG    1 
ATOM   1925 C CD1   . LEU A 1 244 ? 1.755   -24.740 -5.125  1.00 33.75  ? 286 LEU A CD1   1 
ATOM   1926 C CD2   . LEU A 1 244 ? 3.321   -25.885 -6.751  1.00 29.98  ? 286 LEU A CD2   1 
ATOM   1927 N N     . LEU A 1 245 ? 6.812   -22.327 -6.599  1.00 34.29  ? 287 LEU A N     1 
ATOM   1928 C CA    . LEU A 1 245 ? 7.753   -21.217 -6.596  1.00 32.72  ? 287 LEU A CA    1 
ATOM   1929 C C     . LEU A 1 245 ? 7.126   -19.977 -7.195  1.00 32.29  ? 287 LEU A C     1 
ATOM   1930 O O     . LEU A 1 245 ? 6.393   -20.058 -8.174  1.00 30.97  ? 287 LEU A O     1 
ATOM   1931 C CB    . LEU A 1 245 ? 9.034   -21.506 -7.377  1.00 35.43  ? 287 LEU A CB    1 
ATOM   1932 C CG    . LEU A 1 245 ? 9.928   -22.643 -6.940  1.00 35.30  ? 287 LEU A CG    1 
ATOM   1933 C CD1   . LEU A 1 245 ? 10.112  -22.542 -5.444  1.00 41.58  ? 287 LEU A CD1   1 
ATOM   1934 C CD2   . LEU A 1 245 ? 9.320   -23.926 -7.304  1.00 35.57  ? 287 LEU A CD2   1 
ATOM   1935 N N     . SER A 1 246 ? 7.435   -18.833 -6.591  1.00 41.74  ? 288 SER A N     1 
ATOM   1936 C CA    . SER A 1 246 ? 7.340   -17.566 -7.289  1.00 36.33  ? 288 SER A CA    1 
ATOM   1937 C C     . SER A 1 246 ? 8.095   -17.658 -8.606  1.00 38.63  ? 288 SER A C     1 
ATOM   1938 O O     . SER A 1 246 ? 9.073   -18.403 -8.730  1.00 32.57  ? 288 SER A O     1 
ATOM   1939 C CB    . SER A 1 246 ? 7.922   -16.438 -6.434  1.00 36.56  ? 288 SER A CB    1 
ATOM   1940 O OG    . SER A 1 246 ? 6.981   -15.994 -5.475  1.00 36.76  ? 288 SER A OG    1 
ATOM   1941 N N     A HIS A 1 247 ? 7.609   -16.881 -9.592  0.54 41.74  ? 289 HIS A N     1 
ATOM   1942 N N     B HIS A 1 247 ? 7.651   -16.903 -9.598  0.46 41.24  ? 289 HIS A N     1 
ATOM   1943 C CA    A HIS A 1 247 ? 8.169   -16.885 -10.946 0.54 39.40  ? 289 HIS A CA    1 
ATOM   1944 C CA    B HIS A 1 247 ? 8.273   -17.059 -10.901 0.46 39.37  ? 289 HIS A CA    1 
ATOM   1945 C C     A HIS A 1 247 ? 9.632   -16.473 -10.928 0.54 36.49  ? 289 HIS A C     1 
ATOM   1946 C C     B HIS A 1 247 ? 9.671   -16.468 -10.953 0.46 37.33  ? 289 HIS A C     1 
ATOM   1947 O O     A HIS A 1 247 ? 10.466  -17.085 -11.608 0.54 38.38  ? 289 HIS A O     1 
ATOM   1948 O O     B HIS A 1 247 ? 10.506  -16.980 -11.709 0.46 38.57  ? 289 HIS A O     1 
ATOM   1949 C CB    A HIS A 1 247 ? 7.354   -15.949 -11.853 0.54 38.34  ? 289 HIS A CB    1 
ATOM   1950 C CB    B HIS A 1 247 ? 7.361   -16.475 -11.966 0.46 38.70  ? 289 HIS A CB    1 
ATOM   1951 C CG    A HIS A 1 247 ? 7.431   -16.270 -13.323 0.54 40.64  ? 289 HIS A CG    1 
ATOM   1952 C CG    B HIS A 1 247 ? 6.112   -17.274 -12.144 0.46 38.50  ? 289 HIS A CG    1 
ATOM   1953 N ND1   A HIS A 1 247 ? 7.169   -17.526 -13.829 0.54 39.72  ? 289 HIS A ND1   1 
ATOM   1954 N ND1   B HIS A 1 247 ? 5.066   -17.224 -11.247 0.46 38.62  ? 289 HIS A ND1   1 
ATOM   1955 C CD2   A HIS A 1 247 ? 7.707   -15.485 -14.396 0.54 37.52  ? 289 HIS A CD2   1 
ATOM   1956 C CD2   B HIS A 1 247 ? 5.772   -18.202 -13.066 0.46 37.25  ? 289 HIS A CD2   1 
ATOM   1957 C CE1   A HIS A 1 247 ? 7.301   -17.509 -15.145 0.54 37.66  ? 289 HIS A CE1   1 
ATOM   1958 C CE1   B HIS A 1 247 ? 4.117   -18.057 -11.634 0.46 37.80  ? 289 HIS A CE1   1 
ATOM   1959 N NE2   A HIS A 1 247 ? 7.624   -16.282 -15.514 0.54 36.64  ? 289 HIS A NE2   1 
ATOM   1960 N NE2   B HIS A 1 247 ? 4.521   -18.664 -12.735 0.46 38.72  ? 289 HIS A NE2   1 
ATOM   1961 N N     . SER A 1 248 ? 9.965   -15.454 -10.132 1.00 33.02  ? 290 SER A N     1 
ATOM   1962 C CA    . SER A 1 248 ? 11.333  -14.953 -9.986  1.00 31.34  ? 290 SER A CA    1 
ATOM   1963 C C     . SER A 1 248 ? 12.281  -15.962 -9.370  1.00 31.00  ? 290 SER A C     1 
ATOM   1964 O O     . SER A 1 248 ? 13.438  -15.617 -9.140  1.00 28.64  ? 290 SER A O     1 
ATOM   1965 C CB    . SER A 1 248 ? 11.364  -13.704 -9.113  1.00 34.60  ? 290 SER A CB    1 
ATOM   1966 O OG    . SER A 1 248 ? 11.296  -14.081 -7.750  1.00 42.43  ? 290 SER A OG    1 
ATOM   1967 N N     . LEU A 1 249 ? 11.827  -17.167 -9.043  1.00 33.45  ? 291 LEU A N     1 
ATOM   1968 C CA    . LEU A 1 249 ? 12.678  -18.187 -8.458  1.00 32.13  ? 291 LEU A CA    1 
ATOM   1969 C C     . LEU A 1 249 ? 12.961  -19.331 -9.405  1.00 34.99  ? 291 LEU A C     1 
ATOM   1970 O O     . LEU A 1 249 ? 13.741  -20.227 -9.053  1.00 38.95  ? 291 LEU A O     1 
ATOM   1971 C CB    . LEU A 1 249 ? 12.044  -18.756 -7.187  1.00 38.81  ? 291 LEU A CB    1 
ATOM   1972 C CG    . LEU A 1 249 ? 12.029  -17.812 -5.997  1.00 35.22  ? 291 LEU A CG    1 
ATOM   1973 C CD1   . LEU A 1 249 ? 11.143  -18.419 -4.906  1.00 36.34  ? 291 LEU A CD1   1 
ATOM   1974 C CD2   . LEU A 1 249 ? 13.439  -17.516 -5.502  1.00 27.37  ? 291 LEU A CD2   1 
ATOM   1975 N N     . LEU A 1 250 ? 12.340  -19.346 -10.571 1.00 36.97  ? 292 LEU A N     1 
ATOM   1976 C CA    . LEU A 1 250 ? 12.647  -20.389 -11.537 1.00 38.15  ? 292 LEU A CA    1 
ATOM   1977 C C     . LEU A 1 250 ? 14.070  -20.227 -12.061 1.00 34.46  ? 292 LEU A C     1 
ATOM   1978 O O     . LEU A 1 250 ? 14.786  -21.230 -12.189 1.00 31.93  ? 292 LEU A O     1 
ATOM   1979 C CB    . LEU A 1 250 ? 11.632  -20.389 -12.668 1.00 40.09  ? 292 LEU A CB    1 
ATOM   1980 C CG    . LEU A 1 250 ? 10.212  -20.622 -12.175 1.00 45.21  ? 292 LEU A CG    1 
ATOM   1981 C CD1   . LEU A 1 250 ? 9.284   -20.408 -13.345 1.00 48.65  ? 292 LEU A CD1   1 
ATOM   1982 C CD2   . LEU A 1 250 ? 10.082  -22.038 -11.599 1.00 38.06  ? 292 LEU A CD2   1 
ATOM   1983 N N     . PRO A 1 251 ? 14.535  -19.005 -12.342 1.00 37.34  ? 293 PRO A N     1 
ATOM   1984 C CA    . PRO A 1 251 ? 15.966  -18.860 -12.654 1.00 42.73  ? 293 PRO A CA    1 
ATOM   1985 C C     . PRO A 1 251 ? 16.863  -19.561 -11.636 1.00 39.80  ? 293 PRO A C     1 
ATOM   1986 O O     . PRO A 1 251 ? 17.863  -20.176 -12.022 1.00 37.13  ? 293 PRO A O     1 
ATOM   1987 C CB    . PRO A 1 251 ? 16.170  -17.336 -12.669 1.00 42.14  ? 293 PRO A CB    1 
ATOM   1988 C CG    . PRO A 1 251 ? 14.860  -16.788 -13.039 1.00 35.21  ? 293 PRO A CG    1 
ATOM   1989 C CD    . PRO A 1 251 ? 13.818  -17.716 -12.484 1.00 33.95  ? 293 PRO A CD    1 
ATOM   1990 N N     . ALA A 1 252 ? 16.485  -19.550 -10.356 1.00 38.02  ? 294 ALA A N     1 
ATOM   1991 C CA    . ALA A 1 252 ? 17.263  -20.188 -9.302  1.00 34.68  ? 294 ALA A CA    1 
ATOM   1992 C C     . ALA A 1 252 ? 17.003  -21.698 -9.146  1.00 36.75  ? 294 ALA A C     1 
ATOM   1993 O O     . ALA A 1 252 ? 17.722  -22.362 -8.374  1.00 29.29  ? 294 ALA A O     1 
ATOM   1994 C CB    . ALA A 1 252 ? 16.975  -19.467 -7.994  1.00 38.13  ? 294 ALA A CB    1 
ATOM   1995 N N     . LEU A 1 253 ? 16.030  -22.275 -9.860  1.00 32.30  ? 295 LEU A N     1 
ATOM   1996 C CA    . LEU A 1 253 ? 15.630  -23.659 -9.606  1.00 30.54  ? 295 LEU A CA    1 
ATOM   1997 C C     . LEU A 1 253 ? 16.607  -24.635 -10.253 1.00 36.46  ? 295 LEU A C     1 
ATOM   1998 O O     . LEU A 1 253 ? 16.808  -24.612 -11.474 1.00 40.12  ? 295 LEU A O     1 
ATOM   1999 C CB    . LEU A 1 253 ? 14.211  -23.911 -10.111 1.00 31.46  ? 295 LEU A CB    1 
ATOM   2000 C CG    . LEU A 1 253 ? 13.755  -25.367 -10.263 1.00 28.79  ? 295 LEU A CG    1 
ATOM   2001 C CD1   . LEU A 1 253 ? 13.740  -26.083 -8.949  1.00 23.14  ? 295 LEU A CD1   1 
ATOM   2002 C CD2   . LEU A 1 253 ? 12.390  -25.442 -10.913 1.00 27.69  ? 295 LEU A CD2   1 
ATOM   2003 N N     . CYS A 1 254 ? 17.207  -25.504 -9.440  1.00 40.67  ? 296 CYS A N     1 
ATOM   2004 C CA    . CYS A 1 254 ? 18.119  -26.521 -9.951  1.00 38.14  ? 296 CYS A CA    1 
ATOM   2005 C C     . CYS A 1 254 ? 17.440  -27.873 -10.086 1.00 36.79  ? 296 CYS A C     1 
ATOM   2006 O O     . CYS A 1 254 ? 17.548  -28.507 -11.144 1.00 41.64  ? 296 CYS A O     1 
ATOM   2007 C CB    . CYS A 1 254 ? 19.354  -26.659 -9.056  1.00 30.22  ? 296 CYS A CB    1 
ATOM   2008 S SG    . CYS A 1 254 ? 20.211  -25.131 -8.739  1.00 26.91  ? 296 CYS A SG    1 
ATOM   2009 N N     . ASP A 1 255 ? 16.744  -28.336 -9.044  1.00 34.73  ? 297 ASP A N     1 
ATOM   2010 C CA    . ASP A 1 255 ? 16.041  -29.607 -9.189  1.00 37.58  ? 297 ASP A CA    1 
ATOM   2011 C C     . ASP A 1 255 ? 14.960  -29.776 -8.125  1.00 33.39  ? 297 ASP A C     1 
ATOM   2012 O O     . ASP A 1 255 ? 15.043  -29.223 -7.020  1.00 31.22  ? 297 ASP A O     1 
ATOM   2013 C CB    . ASP A 1 255 ? 17.013  -30.806 -9.153  1.00 34.24  ? 297 ASP A CB    1 
ATOM   2014 C CG    . ASP A 1 255 ? 16.544  -31.960 -10.047 1.00 36.37  ? 297 ASP A CG    1 
ATOM   2015 O OD1   . ASP A 1 255 ? 15.408  -31.879 -10.562 1.00 30.09  ? 297 ASP A OD1   1 
ATOM   2016 O OD2   . ASP A 1 255 ? 17.286  -32.957 -10.199 1.00 33.06  ? 297 ASP A OD2   1 
ATOM   2017 N N     . SER A 1 256 ? 13.956  -30.575 -8.474  1.00 29.66  ? 298 SER A N     1 
ATOM   2018 C CA    . SER A 1 256 ? 12.861  -30.916 -7.576  1.00 26.23  ? 298 SER A CA    1 
ATOM   2019 C C     . SER A 1 256 ? 12.729  -32.434 -7.605  1.00 25.69  ? 298 SER A C     1 
ATOM   2020 O O     . SER A 1 256 ? 12.299  -33.004 -8.608  1.00 26.12  ? 298 SER A O     1 
ATOM   2021 C CB    . SER A 1 256 ? 11.580  -30.200 -8.004  1.00 29.02  ? 298 SER A CB    1 
ATOM   2022 O OG    . SER A 1 256 ? 10.462  -30.495 -7.180  1.00 29.79  ? 298 SER A OG    1 
ATOM   2023 N N     . LYS A 1 257 ? 13.135  -33.088 -6.522  1.00 28.86  ? 299 LYS A N     1 
ATOM   2024 C CA    . LYS A 1 257 ? 13.247  -34.538 -6.460  1.00 29.41  ? 299 LYS A CA    1 
ATOM   2025 C C     . LYS A 1 257 ? 12.022  -35.173 -5.798  1.00 31.30  ? 299 LYS A C     1 
ATOM   2026 O O     . LYS A 1 257 ? 11.373  -34.580 -4.928  1.00 30.34  ? 299 LYS A O     1 
ATOM   2027 C CB    . LYS A 1 257 ? 14.501  -34.959 -5.679  1.00 26.47  ? 299 LYS A CB    1 
ATOM   2028 C CG    . LYS A 1 257 ? 15.778  -34.154 -5.984  1.00 32.29  ? 299 LYS A CG    1 
ATOM   2029 C CD    . LYS A 1 257 ? 16.088  -34.048 -7.436  1.00 25.72  ? 299 LYS A CD    1 
ATOM   2030 C CE    . LYS A 1 257 ? 16.357  -35.398 -8.027  1.00 28.04  ? 299 LYS A CE    1 
ATOM   2031 N NZ    . LYS A 1 257 ? 16.230  -35.348 -9.516  1.00 35.21  ? 299 LYS A NZ    1 
ATOM   2032 N N     . ILE A 1 258 ? 11.738  -36.408 -6.187  1.00 22.13  ? 300 ILE A N     1 
ATOM   2033 C CA    . ILE A 1 258 ? 10.801  -37.254 -5.466  1.00 25.56  ? 300 ILE A CA    1 
ATOM   2034 C C     . ILE A 1 258 ? 11.591  -38.449 -4.932  1.00 29.75  ? 300 ILE A C     1 
ATOM   2035 O O     . ILE A 1 258 ? 12.019  -39.318 -5.704  1.00 22.45  ? 300 ILE A O     1 
ATOM   2036 C CB    . ILE A 1 258 ? 9.631   -37.678 -6.360  1.00 31.77  ? 300 ILE A CB    1 
ATOM   2037 C CG1   . ILE A 1 258 ? 8.888   -36.424 -6.803  1.00 28.32  ? 300 ILE A CG1   1 
ATOM   2038 C CG2   . ILE A 1 258 ? 8.685   -38.612 -5.627  1.00 29.82  ? 300 ILE A CG2   1 
ATOM   2039 C CD1   . ILE A 1 258 ? 7.825   -36.675 -7.806  1.00 30.28  ? 300 ILE A CD1   1 
ATOM   2040 N N     . ARG A 1 259 ? 11.811  -38.481 -3.609  1.00 30.03  ? 301 ARG A N     1 
ATOM   2041 C CA    . ARG A 1 259 ? 12.682  -39.492 -2.999  1.00 32.31  ? 301 ARG A CA    1 
ATOM   2042 C C     . ARG A 1 259 ? 11.890  -40.768 -2.744  1.00 29.23  ? 301 ARG A C     1 
ATOM   2043 O O     . ARG A 1 259 ? 11.562  -41.136 -1.610  1.00 26.09  ? 301 ARG A O     1 
ATOM   2044 C CB    . ARG A 1 259 ? 13.324  -38.961 -1.735  1.00 29.06  ? 301 ARG A CB    1 
ATOM   2045 C CG    . ARG A 1 259 ? 14.013  -37.652 -1.982  1.00 30.37  ? 301 ARG A CG    1 
ATOM   2046 C CD    . ARG A 1 259 ? 15.107  -37.748 -3.001  1.00 23.97  ? 301 ARG A CD    1 
ATOM   2047 N NE    . ARG A 1 259 ? 16.186  -36.808 -2.685  1.00 30.60  ? 301 ARG A NE    1 
ATOM   2048 C CZ    . ARG A 1 259 ? 17.204  -36.507 -3.492  1.00 31.80  ? 301 ARG A CZ    1 
ATOM   2049 N NH1   . ARG A 1 259 ? 17.294  -37.061 -4.698  1.00 25.06  ? 301 ARG A NH1   1 
ATOM   2050 N NH2   . ARG A 1 259 ? 18.134  -35.635 -3.093  1.00 32.18  ? 301 ARG A NH2   1 
ATOM   2051 N N     . SER A 1 260 ? 11.651  -41.472 -3.851  1.00 25.89  ? 302 SER A N     1 
ATOM   2052 C CA    . SER A 1 260 ? 10.742  -42.612 -3.889  1.00 33.49  ? 302 SER A CA    1 
ATOM   2053 C C     . SER A 1 260 ? 11.062  -43.667 -2.836  1.00 34.04  ? 302 SER A C     1 
ATOM   2054 O O     . SER A 1 260 ? 10.142  -44.323 -2.337  1.00 34.96  ? 302 SER A O     1 
ATOM   2055 C CB    . SER A 1 260 ? 10.778  -43.247 -5.284  1.00 36.87  ? 302 SER A CB    1 
ATOM   2056 O OG    . SER A 1 260 ? 10.697  -42.262 -6.305  1.00 37.76  ? 302 SER A OG    1 
ATOM   2057 N N     . LYS A 1 261 ? 12.343  -43.847 -2.479  1.00 33.59  ? 303 LYS A N     1 
ATOM   2058 C CA    . LYS A 1 261 ? 12.755  -45.029 -1.722  1.00 32.78  ? 303 LYS A CA    1 
ATOM   2059 C C     . LYS A 1 261 ? 12.817  -44.822 -0.212  1.00 33.22  ? 303 LYS A C     1 
ATOM   2060 O O     . LYS A 1 261 ? 12.790  -45.812 0.533   1.00 32.85  ? 303 LYS A O     1 
ATOM   2061 C CB    . LYS A 1 261 ? 14.126  -45.514 -2.211  1.00 27.43  ? 303 LYS A CB    1 
ATOM   2062 C CG    . LYS A 1 261 ? 14.169  -45.727 -3.705  1.00 36.98  ? 303 LYS A CG    1 
ATOM   2063 C CD    . LYS A 1 261 ? 15.394  -46.520 -4.157  1.00 50.23  ? 303 LYS A CD    1 
ATOM   2064 C CE    . LYS A 1 261 ? 16.469  -45.607 -4.691  1.00 42.27  ? 303 LYS A CE    1 
ATOM   2065 N NZ    . LYS A 1 261 ? 16.779  -45.939 -6.088  1.00 44.94  ? 303 LYS A NZ    1 
ATOM   2066 N N     . ALA A 1 262 ? 12.913  -43.586 0.265   1.00 28.15  ? 304 ALA A N     1 
ATOM   2067 C CA    . ALA A 1 262 ? 12.895  -43.361 1.709   1.00 35.42  ? 304 ALA A CA    1 
ATOM   2068 C C     . ALA A 1 262 ? 11.591  -43.867 2.295   1.00 32.01  ? 304 ALA A C     1 
ATOM   2069 O O     . ALA A 1 262 ? 10.516  -43.601 1.754   1.00 31.69  ? 304 ALA A O     1 
ATOM   2070 C CB    . ALA A 1 262 ? 13.059  -41.879 2.033   1.00 32.47  ? 304 ALA A CB    1 
ATOM   2071 N N     . LEU A 1 263 ? 11.684  -44.589 3.401   1.00 32.64  ? 305 LEU A N     1 
ATOM   2072 C CA    . LEU A 1 263 ? 10.504  -45.164 4.028   1.00 33.57  ? 305 LEU A CA    1 
ATOM   2073 C C     . LEU A 1 263 ? 10.213  -44.457 5.347   1.00 35.53  ? 305 LEU A C     1 
ATOM   2074 O O     . LEU A 1 263 ? 10.988  -43.613 5.817   1.00 31.62  ? 305 LEU A O     1 
ATOM   2075 C CB    . LEU A 1 263 ? 10.687  -46.673 4.249   1.00 36.40  ? 305 LEU A CB    1 
ATOM   2076 C CG    . LEU A 1 263 ? 11.167  -47.509 3.055   1.00 28.75  ? 305 LEU A CG    1 
ATOM   2077 C CD1   . LEU A 1 263 ? 11.194  -48.979 3.412   1.00 21.05  ? 305 LEU A CD1   1 
ATOM   2078 C CD2   . LEU A 1 263 ? 10.308  -47.276 1.843   1.00 28.60  ? 305 LEU A CD2   1 
ATOM   2079 N N     . GLY A 1 264 ? 9.062   -44.806 5.938   1.00 38.45  ? 306 GLY A N     1 
ATOM   2080 C CA    . GLY A 1 264 ? 8.685   -44.319 7.256   1.00 33.07  ? 306 GLY A CA    1 
ATOM   2081 C C     . GLY A 1 264 ? 7.286   -43.735 7.356   1.00 32.08  ? 306 GLY A C     1 
ATOM   2082 O O     . GLY A 1 264 ? 6.827   -43.358 8.438   1.00 30.76  ? 306 GLY A O     1 
ATOM   2083 N N     . SER A 1 265 ? 6.594   -43.661 6.229   1.00 34.02  ? 307 SER A N     1 
ATOM   2084 C CA    . SER A 1 265 ? 5.307   -42.993 6.172   1.00 32.58  ? 307 SER A CA    1 
ATOM   2085 C C     . SER A 1 265 ? 4.603   -43.471 4.917   1.00 35.57  ? 307 SER A C     1 
ATOM   2086 O O     . SER A 1 265 ? 5.190   -44.151 4.079   1.00 35.21  ? 307 SER A O     1 
ATOM   2087 C CB    . SER A 1 265 ? 5.472   -41.472 6.158   1.00 29.42  ? 307 SER A CB    1 
ATOM   2088 O OG    . SER A 1 265 ? 4.394   -40.880 5.466   1.00 31.67  ? 307 SER A OG    1 
ATOM   2089 N N     . ASP A 1 266 ? 3.332   -43.126 4.788   1.00 36.08  ? 308 ASP A N     1 
ATOM   2090 C CA    . ASP A 1 266 ? 2.739   -43.437 3.498   1.00 31.85  ? 308 ASP A CA    1 
ATOM   2091 C C     . ASP A 1 266 ? 3.059   -42.363 2.457   1.00 34.69  ? 308 ASP A C     1 
ATOM   2092 O O     . ASP A 1 266 ? 2.612   -42.480 1.302   1.00 37.04  ? 308 ASP A O     1 
ATOM   2093 C CB    . ASP A 1 266 ? 1.223   -43.679 3.636   1.00 30.63  ? 308 ASP A CB    1 
ATOM   2094 C CG    . ASP A 1 266 ? 0.495   -42.568 4.401   1.00 32.98  ? 308 ASP A CG    1 
ATOM   2095 O OD1   . ASP A 1 266 ? 1.152   -41.670 4.950   1.00 31.63  ? 308 ASP A OD1   1 
ATOM   2096 O OD2   . ASP A 1 266 ? -0.743  -42.611 4.469   1.00 28.66  ? 308 ASP A OD2   1 
ATOM   2097 N N     . HIS A 1 267 ? 3.830   -41.338 2.824   1.00 24.91  ? 309 HIS A N     1 
ATOM   2098 C CA    . HIS A 1 267 ? 4.413   -40.434 1.841   1.00 31.60  ? 309 HIS A CA    1 
ATOM   2099 C C     . HIS A 1 267 ? 5.916   -40.601 1.829   1.00 32.09  ? 309 HIS A C     1 
ATOM   2100 O O     . HIS A 1 267 ? 6.516   -41.095 2.787   1.00 30.48  ? 309 HIS A O     1 
ATOM   2101 C CB    . HIS A 1 267 ? 4.134   -38.958 2.117   1.00 25.46  ? 309 HIS A CB    1 
ATOM   2102 C CG    . HIS A 1 267 ? 2.695   -38.609 2.143   1.00 27.64  ? 309 HIS A CG    1 
ATOM   2103 N ND1   . HIS A 1 267 ? 2.191   -37.516 1.481   1.00 26.52  ? 309 HIS A ND1   1 
ATOM   2104 C CD2   . HIS A 1 267 ? 1.647   -39.191 2.770   1.00 32.84  ? 309 HIS A CD2   1 
ATOM   2105 C CE1   . HIS A 1 267 ? 0.894   -37.431 1.707   1.00 28.51  ? 309 HIS A CE1   1 
ATOM   2106 N NE2   . HIS A 1 267 ? 0.539   -38.435 2.485   1.00 35.17  ? 309 HIS A NE2   1 
ATOM   2107 N N     . CYS A 1 268 ? 6.507   -40.149 0.739   1.00 27.28  ? 310 CYS A N     1 
ATOM   2108 C CA    . CYS A 1 268 ? 7.938   -40.118 0.587   1.00 29.88  ? 310 CYS A CA    1 
ATOM   2109 C C     . CYS A 1 268 ? 8.408   -38.672 0.582   1.00 30.54  ? 310 CYS A C     1 
ATOM   2110 O O     . CYS A 1 268 ? 7.639   -37.760 0.265   1.00 27.46  ? 310 CYS A O     1 
ATOM   2111 C CB    . CYS A 1 268 ? 8.362   -40.821 -0.718  1.00 30.40  ? 310 CYS A CB    1 
ATOM   2112 S SG    . CYS A 1 268 ? 8.210   -39.822 -2.220  1.00 32.88  ? 310 CYS A SG    1 
ATOM   2113 N N     . PRO A 1 269 ? 9.665   -38.425 0.926   1.00 28.82  ? 311 PRO A N     1 
ATOM   2114 C CA    . PRO A 1 269 ? 10.176  -37.053 0.914   1.00 20.95  ? 311 PRO A CA    1 
ATOM   2115 C C     . PRO A 1 269 ? 10.254  -36.484 -0.493  1.00 27.23  ? 311 PRO A C     1 
ATOM   2116 O O     . PRO A 1 269 ? 10.384  -37.202 -1.496  1.00 28.27  ? 311 PRO A O     1 
ATOM   2117 C CB    . PRO A 1 269 ? 11.584  -37.189 1.509   1.00 28.13  ? 311 PRO A CB    1 
ATOM   2118 C CG    . PRO A 1 269 ? 11.646  -38.560 2.115   1.00 26.49  ? 311 PRO A CG    1 
ATOM   2119 C CD    . PRO A 1 269 ? 10.670  -39.403 1.384   1.00 27.41  ? 311 PRO A CD    1 
ATOM   2120 N N     . ILE A 1 270 ? 10.219  -35.165 -0.543  1.00 20.91  ? 312 ILE A N     1 
ATOM   2121 C CA    . ILE A 1 270 ? 10.561  -34.406 -1.736  1.00 26.62  ? 312 ILE A CA    1 
ATOM   2122 C C     . ILE A 1 270 ? 11.675  -33.443 -1.355  1.00 22.90  ? 312 ILE A C     1 
ATOM   2123 O O     . ILE A 1 270 ? 11.764  -32.985 -0.218  1.00 21.03  ? 312 ILE A O     1 
ATOM   2124 C CB    . ILE A 1 270 ? 9.355   -33.637 -2.359  1.00 25.81  ? 312 ILE A CB    1 
ATOM   2125 C CG1   . ILE A 1 270 ? 8.612   -32.770 -1.337  1.00 21.56  ? 312 ILE A CG1   1 
ATOM   2126 C CG2   . ILE A 1 270 ? 8.383   -34.593 -2.961  1.00 22.72  ? 312 ILE A CG2   1 
ATOM   2127 C CD1   . ILE A 1 270 ? 7.653   -31.842 -1.976  1.00 19.11  ? 312 ILE A CD1   1 
ATOM   2128 N N     . THR A 1 271 ? 12.533  -33.134 -2.315  1.00 27.54  ? 313 THR A N     1 
ATOM   2129 C CA    . THR A 1 271 ? 13.692  -32.299 -2.035  1.00 26.52  ? 313 THR A CA    1 
ATOM   2130 C C     . THR A 1 271 ? 13.852  -31.294 -3.159  1.00 26.81  ? 313 THR A C     1 
ATOM   2131 O O     . THR A 1 271 ? 13.708  -31.643 -4.336  1.00 29.38  ? 313 THR A O     1 
ATOM   2132 C CB    . THR A 1 271 ? 14.955  -33.149 -1.861  1.00 26.82  ? 313 THR A CB    1 
ATOM   2133 O OG1   . THR A 1 271 ? 14.881  -33.878 -0.615  1.00 22.62  ? 313 THR A OG1   1 
ATOM   2134 C CG2   . THR A 1 271 ? 16.175  -32.261 -1.893  1.00 25.88  ? 313 THR A CG2   1 
ATOM   2135 N N     . LEU A 1 272 ? 14.100  -30.049 -2.781  1.00 21.48  ? 314 LEU A N     1 
ATOM   2136 C CA    . LEU A 1 272 ? 14.266  -28.928 -3.687  1.00 26.97  ? 314 LEU A CA    1 
ATOM   2137 C C     . LEU A 1 272 ? 15.694  -28.408 -3.578  1.00 31.94  ? 314 LEU A C     1 
ATOM   2138 O O     . LEU A 1 272 ? 16.271  -28.349 -2.481  1.00 28.14  ? 314 LEU A O     1 
ATOM   2139 C CB    . LEU A 1 272 ? 13.265  -27.804 -3.359  1.00 26.06  ? 314 LEU A CB    1 
ATOM   2140 C CG    . LEU A 1 272 ? 13.346  -26.478 -4.135  1.00 26.27  ? 314 LEU A CG    1 
ATOM   2141 C CD1   . LEU A 1 272 ? 12.730  -26.619 -5.511  1.00 16.64  ? 314 LEU A CD1   1 
ATOM   2142 C CD2   . LEU A 1 272 ? 12.697  -25.331 -3.390  1.00 21.50  ? 314 LEU A CD2   1 
ATOM   2143 N N     . TYR A 1 273 ? 16.267  -28.061 -4.727  1.00 30.58  ? 315 TYR A N     1 
ATOM   2144 C CA    . TYR A 1 273 ? 17.608  -27.497 -4.828  1.00 26.85  ? 315 TYR A CA    1 
ATOM   2145 C C     . TYR A 1 273 ? 17.484  -26.131 -5.486  1.00 30.81  ? 315 TYR A C     1 
ATOM   2146 O O     . TYR A 1 273 ? 17.149  -26.035 -6.676  1.00 31.59  ? 315 TYR A O     1 
ATOM   2147 C CB    . TYR A 1 273 ? 18.527  -28.390 -5.662  1.00 26.27  ? 315 TYR A CB    1 
ATOM   2148 C CG    . TYR A 1 273 ? 19.046  -29.667 -5.029  1.00 30.98  ? 315 TYR A CG    1 
ATOM   2149 C CD1   . TYR A 1 273 ? 20.069  -29.641 -4.083  1.00 33.09  ? 315 TYR A CD1   1 
ATOM   2150 C CD2   . TYR A 1 273 ? 18.572  -30.904 -5.437  1.00 27.13  ? 315 TYR A CD2   1 
ATOM   2151 C CE1   . TYR A 1 273 ? 20.572  -30.819 -3.537  1.00 32.58  ? 315 TYR A CE1   1 
ATOM   2152 C CE2   . TYR A 1 273 ? 19.055  -32.073 -4.895  1.00 26.11  ? 315 TYR A CE2   1 
ATOM   2153 C CZ    . TYR A 1 273 ? 20.055  -32.031 -3.952  1.00 32.38  ? 315 TYR A CZ    1 
ATOM   2154 O OH    . TYR A 1 273 ? 20.525  -33.213 -3.423  1.00 34.22  ? 315 TYR A OH    1 
ATOM   2155 N N     . LEU A 1 274 ? 17.764  -25.080 -4.735  1.00 25.98  ? 316 LEU A N     1 
ATOM   2156 C CA    . LEU A 1 274 ? 17.803  -23.747 -5.313  1.00 32.02  ? 316 LEU A CA    1 
ATOM   2157 C C     . LEU A 1 274 ? 19.240  -23.246 -5.345  1.00 37.52  ? 316 LEU A C     1 
ATOM   2158 O O     . LEU A 1 274 ? 20.111  -23.734 -4.620  1.00 35.70  ? 316 LEU A O     1 
ATOM   2159 C CB    . LEU A 1 274 ? 16.909  -22.761 -4.540  1.00 29.48  ? 316 LEU A CB    1 
ATOM   2160 C CG    . LEU A 1 274 ? 15.407  -23.114 -4.611  1.00 33.25  ? 316 LEU A CG    1 
ATOM   2161 C CD1   . LEU A 1 274 ? 14.497  -22.105 -3.923  1.00 27.57  ? 316 LEU A CD1   1 
ATOM   2162 C CD2   . LEU A 1 274 ? 14.966  -23.297 -6.058  1.00 32.06  ? 316 LEU A CD2   1 
ATOM   2163 N N     . ALA A 1 275 ? 19.474  -22.275 -6.224  1.00 41.55  ? 317 ALA A N     1 
ATOM   2164 C CA    . ALA A 1 275 ? 20.729  -21.540 -6.309  1.00 37.02  ? 317 ALA A CA    1 
ATOM   2165 C C     . ALA A 1 275 ? 20.460  -20.090 -5.920  1.00 34.84  ? 317 ALA A C     1 
ATOM   2166 O O     . ALA A 1 275 ? 19.687  -19.397 -6.586  1.00 40.82  ? 317 ALA A O     1 
ATOM   2167 C CB    . ALA A 1 275 ? 21.314  -21.637 -7.721  1.00 40.78  ? 317 ALA A CB    1 
ATOM   2168 N N     . LEU A 1 276 ? 21.094  -19.635 -4.850  1.00 42.03  ? 318 LEU A N     1 
ATOM   2169 C CA    . LEU A 1 276 ? 20.832  -18.297 -4.316  1.00 48.65  ? 318 LEU A CA    1 
ATOM   2170 C C     . LEU A 1 276 ? 22.124  -17.547 -3.896  1.00 63.26  ? 318 LEU A C     1 
ATOM   2171 O O     . LEU A 1 276 ? 23.241  -18.086 -3.837  1.00 54.74  ? 318 LEU A O     1 
ATOM   2172 C CB    . LEU A 1 276 ? 19.853  -18.404 -3.137  1.00 40.43  ? 318 LEU A CB    1 
ATOM   2173 C CG    . LEU A 1 276 ? 18.389  -18.203 -3.536  1.00 45.18  ? 318 LEU A CG    1 
ATOM   2174 C CD1   . LEU A 1 276 ? 17.421  -18.748 -2.505  1.00 27.48  ? 318 LEU A CD1   1 
ATOM   2175 C CD2   . LEU A 1 276 ? 18.139  -16.718 -3.770  1.00 52.41  ? 318 LEU A CD2   1 
ATOM   2176 O OXT   . LEU A 1 276 ? 22.099  -16.347 -3.616  1.00 63.23  ? 318 LEU A OXT   1 
ATOM   2177 N N     . LEU B 1 2   ? 20.041  3.222   46.790  1.00 70.84  ? 44  LEU B N     1 
ATOM   2178 C CA    . LEU B 1 2   ? 20.588  2.699   45.538  1.00 67.88  ? 44  LEU B CA    1 
ATOM   2179 C C     . LEU B 1 2   ? 20.949  1.227   45.697  1.00 76.24  ? 44  LEU B C     1 
ATOM   2180 O O     . LEU B 1 2   ? 21.324  0.775   46.791  1.00 68.25  ? 44  LEU B O     1 
ATOM   2181 C CB    . LEU B 1 2   ? 21.804  3.507   45.079  1.00 61.90  ? 44  LEU B CB    1 
ATOM   2182 C CG    . LEU B 1 2   ? 21.479  4.780   44.287  1.00 68.49  ? 44  LEU B CG    1 
ATOM   2183 C CD1   . LEU B 1 2   ? 20.888  5.879   45.181  1.00 70.95  ? 44  LEU B CD1   1 
ATOM   2184 C CD2   . LEU B 1 2   ? 22.714  5.280   43.543  1.00 70.14  ? 44  LEU B CD2   1 
ATOM   2185 N N     . TYR B 1 3   ? 20.849  0.478   44.597  1.00 72.82  ? 45  TYR B N     1 
ATOM   2186 C CA    . TYR B 1 3   ? 20.607  -0.950  44.722  1.00 68.62  ? 45  TYR B CA    1 
ATOM   2187 C C     . TYR B 1 3   ? 21.164  -1.737  43.554  1.00 65.46  ? 45  TYR B C     1 
ATOM   2188 O O     . TYR B 1 3   ? 21.192  -1.263  42.418  1.00 68.50  ? 45  TYR B O     1 
ATOM   2189 C CB    . TYR B 1 3   ? 19.113  -1.204  44.816  1.00 73.70  ? 45  TYR B CB    1 
ATOM   2190 C CG    . TYR B 1 3   ? 18.701  -2.635  44.683  1.00 71.65  ? 45  TYR B CG    1 
ATOM   2191 C CD1   . TYR B 1 3   ? 17.869  -3.030  43.651  1.00 70.61  ? 45  TYR B CD1   1 
ATOM   2192 C CD2   . TYR B 1 3   ? 19.100  -3.580  45.616  1.00 68.30  ? 45  TYR B CD2   1 
ATOM   2193 C CE1   . TYR B 1 3   ? 17.455  -4.319  43.537  1.00 61.71  ? 45  TYR B CE1   1 
ATOM   2194 C CE2   . TYR B 1 3   ? 18.688  -4.873  45.516  1.00 66.47  ? 45  TYR B CE2   1 
ATOM   2195 C CZ    . TYR B 1 3   ? 17.866  -5.232  44.471  1.00 63.34  ? 45  TYR B CZ    1 
ATOM   2196 O OH    . TYR B 1 3   ? 17.441  -6.519  44.357  1.00 59.12  ? 45  TYR B OH    1 
ATOM   2197 N N     . GLU B 1 4   ? 21.544  -2.977  43.833  1.00 65.49  ? 46  GLU B N     1 
ATOM   2198 C CA    . GLU B 1 4   ? 22.152  -3.798  42.801  1.00 66.07  ? 46  GLU B CA    1 
ATOM   2199 C C     . GLU B 1 4   ? 21.822  -5.262  43.038  1.00 63.66  ? 46  GLU B C     1 
ATOM   2200 O O     . GLU B 1 4   ? 21.977  -5.769  44.154  1.00 65.29  ? 46  GLU B O     1 
ATOM   2201 C CB    . GLU B 1 4   ? 23.655  -3.580  42.755  1.00 60.60  ? 46  GLU B CB    1 
ATOM   2202 C CG    . GLU B 1 4   ? 24.407  -4.416  41.697  1.00 80.01  ? 46  GLU B CG    1 
ATOM   2203 C CD    . GLU B 1 4   ? 23.732  -4.534  40.311  1.00 89.25  ? 46  GLU B CD    1 
ATOM   2204 O OE1   . GLU B 1 4   ? 24.176  -5.394  39.526  1.00 80.30  ? 46  GLU B OE1   1 
ATOM   2205 O OE2   . GLU B 1 4   ? 22.808  -3.756  39.982  1.00 88.83  ? 46  GLU B OE2   1 
ATOM   2206 N N     . ASP B 1 5   ? 21.375  -5.955  41.991  1.00 56.05  ? 47  ASP B N     1 
ATOM   2207 C CA    . ASP B 1 5   ? 20.922  -7.297  42.307  1.00 57.09  ? 47  ASP B CA    1 
ATOM   2208 C C     . ASP B 1 5   ? 22.050  -8.318  42.165  1.00 53.70  ? 47  ASP B C     1 
ATOM   2209 O O     . ASP B 1 5   ? 22.911  -8.167  41.303  1.00 47.72  ? 47  ASP B O     1 
ATOM   2210 C CB    . ASP B 1 5   ? 19.733  -7.704  41.446  1.00 59.88  ? 47  ASP B CB    1 
ATOM   2211 C CG    . ASP B 1 5   ? 18.463  -7.752  42.253  1.00 63.45  ? 47  ASP B CG    1 
ATOM   2212 O OD1   . ASP B 1 5   ? 17.410  -8.093  41.711  1.00 62.20  ? 47  ASP B OD1   1 
ATOM   2213 O OD2   . ASP B 1 5   ? 18.525  -7.416  43.449  1.00 65.93  ? 47  ASP B OD2   1 
ATOM   2214 N N     . PRO B 1 6   ? 22.065  -9.329  43.032  1.00 46.63  ? 48  PRO B N     1 
ATOM   2215 C CA    . PRO B 1 6   ? 23.107  -10.366 42.989  1.00 48.50  ? 48  PRO B CA    1 
ATOM   2216 C C     . PRO B 1 6   ? 23.210  -11.023 41.622  1.00 47.44  ? 48  PRO B C     1 
ATOM   2217 O O     . PRO B 1 6   ? 22.266  -10.968 40.819  1.00 47.03  ? 48  PRO B O     1 
ATOM   2218 C CB    . PRO B 1 6   ? 22.630  -11.385 44.037  1.00 49.49  ? 48  PRO B CB    1 
ATOM   2219 C CG    . PRO B 1 6   ? 21.819  -10.588 44.988  1.00 50.69  ? 48  PRO B CG    1 
ATOM   2220 C CD    . PRO B 1 6   ? 21.253  -9.410  44.255  1.00 41.43  ? 48  PRO B CD    1 
ATOM   2221 N N     . PRO B 1 7   ? 24.348  -11.687 41.327  1.00 53.02  ? 49  PRO B N     1 
ATOM   2222 C CA    . PRO B 1 7   ? 24.425  -12.535 40.139  1.00 48.75  ? 49  PRO B CA    1 
ATOM   2223 C C     . PRO B 1 7   ? 23.293  -13.539 40.067  1.00 45.35  ? 49  PRO B C     1 
ATOM   2224 O O     . PRO B 1 7   ? 22.507  -13.714 41.005  1.00 47.37  ? 49  PRO B O     1 
ATOM   2225 C CB    . PRO B 1 7   ? 25.783  -13.226 40.279  1.00 51.46  ? 49  PRO B CB    1 
ATOM   2226 C CG    . PRO B 1 7   ? 26.269  -12.902 41.669  1.00 51.97  ? 49  PRO B CG    1 
ATOM   2227 C CD    . PRO B 1 7   ? 25.646  -11.598 42.017  1.00 49.46  ? 49  PRO B CD    1 
ATOM   2228 N N     . ASP B 1 8   ? 23.194  -14.215 38.924  1.00 52.24  ? 50  ASP B N     1 
ATOM   2229 C CA    . ASP B 1 8   ? 22.093  -15.139 38.671  1.00 46.80  ? 50  ASP B CA    1 
ATOM   2230 C C     . ASP B 1 8   ? 22.444  -16.498 39.267  1.00 50.38  ? 50  ASP B C     1 
ATOM   2231 O O     . ASP B 1 8   ? 23.469  -17.093 38.906  1.00 47.35  ? 50  ASP B O     1 
ATOM   2232 C CB    . ASP B 1 8   ? 21.836  -15.245 37.171  1.00 47.85  ? 50  ASP B CB    1 
ATOM   2233 C CG    . ASP B 1 8   ? 21.125  -14.022 36.610  1.00 47.85  ? 50  ASP B CG    1 
ATOM   2234 O OD1   . ASP B 1 8   ? 21.183  -12.958 37.256  1.00 49.35  ? 50  ASP B OD1   1 
ATOM   2235 O OD2   . ASP B 1 8   ? 20.514  -14.132 35.517  1.00 48.32  ? 50  ASP B OD2   1 
ATOM   2236 N N     . GLN B 1 9   ? 21.604  -16.977 40.176  1.00 50.24  ? 51  GLN B N     1 
ATOM   2237 C CA    . GLN B 1 9   ? 21.697  -18.341 40.674  1.00 51.90  ? 51  GLN B CA    1 
ATOM   2238 C C     . GLN B 1 9   ? 20.903  -19.244 39.739  1.00 47.22  ? 51  GLN B C     1 
ATOM   2239 O O     . GLN B 1 9   ? 19.688  -19.077 39.594  1.00 46.82  ? 51  GLN B O     1 
ATOM   2240 C CB    . GLN B 1 9   ? 21.179  -18.451 42.115  1.00 51.25  ? 51  GLN B CB    1 
ATOM   2241 C CG    . GLN B 1 9   ? 21.266  -19.868 42.695  1.00 46.60  ? 51  GLN B CG    1 
ATOM   2242 N N     . LYS B 1 10  ? 21.586  -20.194 39.095  1.00 52.78  ? 52  LYS B N     1 
ATOM   2243 C CA    . LYS B 1 10  ? 20.933  -21.074 38.130  1.00 50.83  ? 52  LYS B CA    1 
ATOM   2244 C C     . LYS B 1 10  ? 20.912  -22.532 38.575  1.00 48.96  ? 52  LYS B C     1 
ATOM   2245 O O     . LYS B 1 10  ? 20.697  -23.413 37.737  1.00 45.87  ? 52  LYS B O     1 
ATOM   2246 C CB    . LYS B 1 10  ? 21.591  -20.953 36.752  1.00 48.16  ? 52  LYS B CB    1 
ATOM   2247 C CG    . LYS B 1 10  ? 21.493  -19.560 36.132  1.00 47.26  ? 52  LYS B CG    1 
ATOM   2248 C CD    . LYS B 1 10  ? 22.337  -19.459 34.863  1.00 53.24  ? 52  LYS B CD    1 
ATOM   2249 C CE    . LYS B 1 10  ? 22.508  -18.008 34.405  1.00 49.46  ? 52  LYS B CE    1 
ATOM   2250 N NZ    . LYS B 1 10  ? 23.465  -17.906 33.264  1.00 54.02  ? 52  LYS B NZ    1 
ATOM   2251 N N     . THR B 1 11  ? 21.117  -22.811 39.870  1.00 50.66  ? 53  THR B N     1 
ATOM   2252 C CA    . THR B 1 11  ? 20.925  -24.153 40.421  1.00 50.57  ? 53  THR B CA    1 
ATOM   2253 C C     . THR B 1 11  ? 20.105  -24.076 41.705  1.00 51.84  ? 53  THR B C     1 
ATOM   2254 O O     . THR B 1 11  ? 20.374  -23.242 42.578  1.00 55.94  ? 53  THR B O     1 
ATOM   2255 C CB    . THR B 1 11  ? 22.261  -24.894 40.688  1.00 60.45  ? 53  THR B CB    1 
ATOM   2256 O OG1   . THR B 1 11  ? 23.143  -24.096 41.492  1.00 61.70  ? 53  THR B OG1   1 
ATOM   2257 C CG2   . THR B 1 11  ? 22.965  -25.296 39.371  1.00 52.11  ? 53  THR B CG2   1 
ATOM   2258 N N     . SER B 1 12  ? 19.109  -24.968 41.812  1.00 54.07  ? 54  SER B N     1 
ATOM   2259 C CA    . SER B 1 12  ? 18.137  -25.081 42.892  1.00 53.19  ? 54  SER B CA    1 
ATOM   2260 C C     . SER B 1 12  ? 18.838  -25.352 44.221  1.00 53.15  ? 54  SER B C     1 
ATOM   2261 O O     . SER B 1 12  ? 20.030  -25.686 44.228  1.00 49.88  ? 54  SER B O     1 
ATOM   2262 C CB    . SER B 1 12  ? 17.133  -26.196 42.571  1.00 54.66  ? 54  SER B CB    1 
ATOM   2263 O OG    . SER B 1 12  ? 17.568  -27.457 43.046  1.00 50.04  ? 54  SER B OG    1 
ATOM   2264 N N     . PRO B 1 13  ? 18.155  -25.194 45.363  1.00 59.59  ? 55  PRO B N     1 
ATOM   2265 C CA    . PRO B 1 13  ? 18.755  -25.672 46.623  1.00 61.10  ? 55  PRO B CA    1 
ATOM   2266 C C     . PRO B 1 13  ? 19.084  -27.150 46.567  1.00 53.68  ? 55  PRO B C     1 
ATOM   2267 O O     . PRO B 1 13  ? 20.107  -27.584 47.107  1.00 46.63  ? 55  PRO B O     1 
ATOM   2268 C CB    . PRO B 1 13  ? 17.671  -25.358 47.676  1.00 54.52  ? 55  PRO B CB    1 
ATOM   2269 C CG    . PRO B 1 13  ? 16.884  -24.232 47.084  1.00 49.44  ? 55  PRO B CG    1 
ATOM   2270 C CD    . PRO B 1 13  ? 16.878  -24.491 45.592  1.00 58.23  ? 55  PRO B CD    1 
ATOM   2271 N N     . SER B 1 14  ? 18.237  -27.930 45.889  1.00 60.31  ? 56  SER B N     1 
ATOM   2272 C CA    . SER B 1 14  ? 18.541  -29.337 45.635  1.00 61.98  ? 56  SER B CA    1 
ATOM   2273 C C     . SER B 1 14  ? 19.825  -29.517 44.818  1.00 56.07  ? 56  SER B C     1 
ATOM   2274 O O     . SER B 1 14  ? 20.503  -30.541 44.948  1.00 53.56  ? 56  SER B O     1 
ATOM   2275 C CB    . SER B 1 14  ? 17.350  -29.995 44.930  1.00 49.37  ? 56  SER B CB    1 
ATOM   2276 O OG    . SER B 1 14  ? 17.728  -31.209 44.321  1.00 45.98  ? 56  SER B OG    1 
ATOM   2277 N N     . GLY B 1 15  ? 20.181  -28.544 43.985  1.00 58.57  ? 57  GLY B N     1 
ATOM   2278 C CA    . GLY B 1 15  ? 21.333  -28.663 43.115  1.00 52.40  ? 57  GLY B CA    1 
ATOM   2279 C C     . GLY B 1 15  ? 21.027  -29.017 41.670  1.00 53.37  ? 57  GLY B C     1 
ATOM   2280 O O     . GLY B 1 15  ? 21.920  -29.511 40.972  1.00 56.17  ? 57  GLY B O     1 
ATOM   2281 N N     . LYS B 1 16  ? 19.792  -28.799 41.203  1.00 51.58  ? 58  LYS B N     1 
ATOM   2282 C CA    . LYS B 1 16  ? 19.385  -29.013 39.818  1.00 52.86  ? 58  LYS B CA    1 
ATOM   2283 C C     . LYS B 1 16  ? 19.540  -27.715 39.028  1.00 56.78  ? 58  LYS B C     1 
ATOM   2284 O O     . LYS B 1 16  ? 19.144  -26.649 39.514  1.00 57.94  ? 58  LYS B O     1 
ATOM   2285 C CB    . LYS B 1 16  ? 17.938  -29.498 39.743  1.00 46.30  ? 58  LYS B CB    1 
ATOM   2286 C CG    . LYS B 1 16  ? 17.659  -30.479 38.593  1.00 66.12  ? 58  LYS B CG    1 
ATOM   2287 C CD    . LYS B 1 16  ? 16.283  -30.299 37.925  1.00 61.94  ? 58  LYS B CD    1 
ATOM   2288 C CE    . LYS B 1 16  ? 16.303  -29.195 36.849  1.00 71.47  ? 58  LYS B CE    1 
ATOM   2289 N NZ    . LYS B 1 16  ? 17.361  -29.364 35.801  1.00 61.75  ? 58  LYS B NZ    1 
ATOM   2290 N N     . PRO B 1 17  ? 20.106  -27.750 37.821  1.00 64.33  ? 59  PRO B N     1 
ATOM   2291 C CA    . PRO B 1 17  ? 20.213  -26.520 37.023  1.00 55.00  ? 59  PRO B CA    1 
ATOM   2292 C C     . PRO B 1 17  ? 18.910  -26.182 36.306  1.00 52.56  ? 59  PRO B C     1 
ATOM   2293 O O     . PRO B 1 17  ? 18.198  -27.057 35.802  1.00 44.14  ? 59  PRO B O     1 
ATOM   2294 C CB    . PRO B 1 17  ? 21.319  -26.855 36.024  1.00 46.93  ? 59  PRO B CB    1 
ATOM   2295 C CG    . PRO B 1 17  ? 21.170  -28.346 35.858  1.00 51.56  ? 59  PRO B CG    1 
ATOM   2296 C CD    . PRO B 1 17  ? 20.793  -28.892 37.184  1.00 49.90  ? 59  PRO B CD    1 
ATOM   2297 N N     . ALA B 1 18  ? 18.627  -24.882 36.237  1.00 49.34  ? 60  ALA B N     1 
ATOM   2298 C CA    . ALA B 1 18  ? 17.330  -24.403 35.788  1.00 45.10  ? 60  ALA B CA    1 
ATOM   2299 C C     . ALA B 1 18  ? 17.094  -24.680 34.307  1.00 43.57  ? 60  ALA B C     1 
ATOM   2300 O O     . ALA B 1 18  ? 18.006  -24.610 33.478  1.00 39.93  ? 60  ALA B O     1 
ATOM   2301 C CB    . ALA B 1 18  ? 17.206  -22.908 36.060  1.00 39.43  ? 60  ALA B CB    1 
ATOM   2302 N N     . THR B 1 19  ? 15.838  -24.968 33.983  1.00 41.89  ? 61  THR B N     1 
ATOM   2303 C CA    . THR B 1 19  ? 15.402  -25.269 32.630  1.00 50.27  ? 61  THR B CA    1 
ATOM   2304 C C     . THR B 1 19  ? 14.421  -24.247 32.084  1.00 45.66  ? 61  THR B C     1 
ATOM   2305 O O     . THR B 1 19  ? 14.055  -24.313 30.902  1.00 46.69  ? 61  THR B O     1 
ATOM   2306 C CB    . THR B 1 19  ? 14.751  -26.657 32.592  1.00 51.87  ? 61  THR B CB    1 
ATOM   2307 O OG1   . THR B 1 19  ? 13.736  -26.741 33.611  1.00 52.74  ? 61  THR B OG1   1 
ATOM   2308 C CG2   . THR B 1 19  ? 15.805  -27.707 32.825  1.00 47.25  ? 61  THR B CG2   1 
ATOM   2309 N N     . LEU B 1 20  ? 13.985  -23.316 32.912  1.00 39.14  ? 62  LEU B N     1 
ATOM   2310 C CA    . LEU B 1 20  ? 12.947  -22.378 32.547  1.00 37.59  ? 62  LEU B CA    1 
ATOM   2311 C C     . LEU B 1 20  ? 13.385  -21.001 33.006  1.00 43.69  ? 62  LEU B C     1 
ATOM   2312 O O     . LEU B 1 20  ? 13.662  -20.790 34.200  1.00 32.45  ? 62  LEU B O     1 
ATOM   2313 C CB    . LEU B 1 20  ? 11.613  -22.767 33.176  1.00 35.94  ? 62  LEU B CB    1 
ATOM   2314 C CG    . LEU B 1 20  ? 10.412  -22.096 32.547  1.00 35.21  ? 62  LEU B CG    1 
ATOM   2315 C CD1   . LEU B 1 20  ? 10.220  -22.640 31.159  1.00 37.68  ? 62  LEU B CD1   1 
ATOM   2316 C CD2   . LEU B 1 20  ? 9.215   -22.375 33.413  1.00 38.14  ? 62  LEU B CD2   1 
ATOM   2317 N N     . LYS B 1 21  ? 13.477  -20.083 32.049  1.00 36.98  ? 63  LYS B N     1 
ATOM   2318 C CA    . LYS B 1 21  ? 13.725  -18.676 32.315  1.00 32.21  ? 63  LYS B CA    1 
ATOM   2319 C C     . LYS B 1 21  ? 12.479  -17.921 31.870  1.00 37.36  ? 63  LYS B C     1 
ATOM   2320 O O     . LYS B 1 21  ? 12.149  -17.916 30.678  1.00 34.86  ? 63  LYS B O     1 
ATOM   2321 C CB    . LYS B 1 21  ? 14.973  -18.219 31.577  1.00 29.81  ? 63  LYS B CB    1 
ATOM   2322 C CG    . LYS B 1 21  ? 15.540  -16.908 32.002  1.00 31.15  ? 63  LYS B CG    1 
ATOM   2323 C CD    . LYS B 1 21  ? 16.709  -16.600 31.126  1.00 36.57  ? 63  LYS B CD    1 
ATOM   2324 C CE    . LYS B 1 21  ? 17.346  -15.301 31.485  1.00 35.31  ? 63  LYS B CE    1 
ATOM   2325 N NZ    . LYS B 1 21  ? 18.745  -15.365 31.006  1.00 34.32  ? 63  LYS B NZ    1 
ATOM   2326 N N     . ILE B 1 22  ? 11.761  -17.325 32.827  1.00 33.79  ? 64  ILE B N     1 
ATOM   2327 C CA    . ILE B 1 22  ? 10.599  -16.485 32.531  1.00 34.48  ? 64  ILE B CA    1 
ATOM   2328 C C     . ILE B 1 22  ? 10.940  -15.039 32.840  1.00 31.72  ? 64  ILE B C     1 
ATOM   2329 O O     . ILE B 1 22  ? 11.539  -14.731 33.879  1.00 32.73  ? 64  ILE B O     1 
ATOM   2330 C CB    . ILE B 1 22  ? 9.339   -16.904 33.300  1.00 25.64  ? 64  ILE B CB    1 
ATOM   2331 C CG1   . ILE B 1 22  ? 9.040   -18.369 33.059  1.00 29.43  ? 64  ILE B CG1   1 
ATOM   2332 C CG2   . ILE B 1 22  ? 8.146   -16.056 32.835  1.00 26.61  ? 64  ILE B CG2   1 
ATOM   2333 C CD1   . ILE B 1 22  ? 7.853   -18.826 33.838  1.00 29.93  ? 64  ILE B CD1   1 
ATOM   2334 N N     . CYS B 1 23  ? 10.567  -14.158 31.932  1.00 32.10  ? 65  CYS B N     1 
ATOM   2335 C CA    . CYS B 1 23  ? 10.805  -12.742 32.089  1.00 33.88  ? 65  CYS B CA    1 
ATOM   2336 C C     . CYS B 1 23  ? 9.455   -12.067 32.002  1.00 32.82  ? 65  CYS B C     1 
ATOM   2337 O O     . CYS B 1 23  ? 8.622   -12.451 31.179  1.00 32.39  ? 65  CYS B O     1 
ATOM   2338 C CB    . CYS B 1 23  ? 11.756  -12.214 31.031  1.00 30.38  ? 65  CYS B CB    1 
ATOM   2339 S SG    . CYS B 1 23  ? 12.066  -10.472 31.205  1.00 39.74  ? 65  CYS B SG    1 
ATOM   2340 N N     . SER B 1 24  ? 9.217   -11.118 32.904  1.00 29.99  ? 66  SER B N     1 
ATOM   2341 C CA    . SER B 1 24  ? 7.971   -10.380 32.932  1.00 29.01  ? 66  SER B CA    1 
ATOM   2342 C C     . SER B 1 24  ? 8.282   -8.893  32.976  1.00 28.80  ? 66  SER B C     1 
ATOM   2343 O O     . SER B 1 24  ? 9.269   -8.471  33.585  1.00 35.26  ? 66  SER B O     1 
ATOM   2344 C CB    . SER B 1 24  ? 7.116   -10.792 34.112  1.00 27.11  ? 66  SER B CB    1 
ATOM   2345 O OG    . SER B 1 24  ? 5.836   -10.201 34.002  1.00 30.54  ? 66  SER B OG    1 
ATOM   2346 N N     . TRP B 1 25  ? 7.445   -8.096  32.314  1.00 26.65  ? 67  TRP B N     1 
ATOM   2347 C CA    . TRP B 1 25  ? 7.795   -6.692  32.112  1.00 27.77  ? 67  TRP B CA    1 
ATOM   2348 C C     . TRP B 1 25  ? 6.552   -5.889  31.794  1.00 26.43  ? 67  TRP B C     1 
ATOM   2349 O O     . TRP B 1 25  ? 5.864   -6.172  30.809  1.00 32.98  ? 67  TRP B O     1 
ATOM   2350 C CB    . TRP B 1 25  ? 8.817   -6.559  30.989  1.00 29.70  ? 67  TRP B CB    1 
ATOM   2351 C CG    . TRP B 1 25  ? 9.615   -5.277  30.989  1.00 34.74  ? 67  TRP B CG    1 
ATOM   2352 C CD1   . TRP B 1 25  ? 9.408   -4.169  31.765  1.00 37.04  ? 67  TRP B CD1   1 
ATOM   2353 C CD2   . TRP B 1 25  ? 10.750  -4.975  30.153  1.00 38.65  ? 67  TRP B CD2   1 
ATOM   2354 N NE1   . TRP B 1 25  ? 10.343  -3.197  31.467  1.00 37.21  ? 67  TRP B NE1   1 
ATOM   2355 C CE2   . TRP B 1 25  ? 11.181  -3.668  30.488  1.00 36.74  ? 67  TRP B CE2   1 
ATOM   2356 C CE3   . TRP B 1 25  ? 11.445  -5.685  29.160  1.00 28.54  ? 67  TRP B CE3   1 
ATOM   2357 C CZ2   . TRP B 1 25  ? 12.274  -3.060  29.864  1.00 36.94  ? 67  TRP B CZ2   1 
ATOM   2358 C CZ3   . TRP B 1 25  ? 12.538  -5.082  28.553  1.00 29.29  ? 67  TRP B CZ3   1 
ATOM   2359 C CH2   . TRP B 1 25  ? 12.939  -3.787  28.898  1.00 33.59  ? 67  TRP B CH2   1 
ATOM   2360 N N     . ASN B 1 26  ? 6.271   -4.884  32.610  1.00 30.82  ? 68  ASN B N     1 
ATOM   2361 C CA    . ASN B 1 26  ? 5.232   -3.899  32.307  1.00 30.70  ? 68  ASN B CA    1 
ATOM   2362 C C     . ASN B 1 26  ? 5.861   -2.853  31.388  1.00 32.30  ? 68  ASN B C     1 
ATOM   2363 O O     . ASN B 1 26  ? 6.615   -1.980  31.841  1.00 29.69  ? 68  ASN B O     1 
ATOM   2364 C CB    . ASN B 1 26  ? 4.675   -3.299  33.598  1.00 24.23  ? 68  ASN B CB    1 
ATOM   2365 C CG    . ASN B 1 26  ? 3.661   -2.183  33.351  1.00 30.87  ? 68  ASN B CG    1 
ATOM   2366 O OD1   . ASN B 1 26  ? 3.876   -1.296  32.520  1.00 31.11  ? 68  ASN B OD1   1 
ATOM   2367 N ND2   . ASN B 1 26  ? 2.548   -2.221  34.082  1.00 30.63  ? 68  ASN B ND2   1 
ATOM   2368 N N     . VAL B 1 27  ? 5.560   -2.943  30.082  1.00 28.65  ? 69  VAL B N     1 
ATOM   2369 C CA    . VAL B 1 27  ? 6.229   -2.102  29.090  1.00 27.26  ? 69  VAL B CA    1 
ATOM   2370 C C     . VAL B 1 27  ? 5.582   -0.732  28.926  1.00 31.11  ? 69  VAL B C     1 
ATOM   2371 O O     . VAL B 1 27  ? 6.143   0.117   28.212  1.00 32.85  ? 69  VAL B O     1 
ATOM   2372 C CB    . VAL B 1 27  ? 6.314   -2.788  27.704  1.00 31.31  ? 69  VAL B CB    1 
ATOM   2373 C CG1   . VAL B 1 27  ? 7.091   -4.078  27.804  1.00 30.49  ? 69  VAL B CG1   1 
ATOM   2374 C CG2   . VAL B 1 27  ? 4.920   -3.001  27.068  1.00 28.00  ? 69  VAL B CG2   1 
ATOM   2375 N N     . ASP B 1 28  ? 4.423   -0.495  29.546  1.00 26.63  ? 70  ASP B N     1 
ATOM   2376 C CA    . ASP B 1 28  ? 3.748   0.804   29.534  1.00 34.07  ? 70  ASP B CA    1 
ATOM   2377 C C     . ASP B 1 28  ? 3.726   1.432   28.133  1.00 32.13  ? 70  ASP B C     1 
ATOM   2378 O O     . ASP B 1 28  ? 4.208   2.539   27.906  1.00 32.23  ? 70  ASP B O     1 
ATOM   2379 C CB    . ASP B 1 28  ? 4.407   1.747   30.547  1.00 37.22  ? 70  ASP B CB    1 
ATOM   2380 C CG    . ASP B 1 28  ? 3.406   2.690   31.239  1.00 37.82  ? 70  ASP B CG    1 
ATOM   2381 O OD1   . ASP B 1 28  ? 2.329   3.017   30.681  1.00 41.43  ? 70  ASP B OD1   1 
ATOM   2382 O OD2   . ASP B 1 28  ? 3.724   3.133   32.355  1.00 37.56  ? 70  ASP B OD2   1 
ATOM   2383 N N     . GLY B 1 29  ? 3.150   0.703   27.183  1.00 42.27  ? 71  GLY B N     1 
ATOM   2384 C CA    . GLY B 1 29  ? 3.143   1.154   25.799  1.00 37.19  ? 71  GLY B CA    1 
ATOM   2385 C C     . GLY B 1 29  ? 4.083   0.352   24.926  1.00 33.96  ? 71  GLY B C     1 
ATOM   2386 O O     . GLY B 1 29  ? 5.264   0.672   24.774  1.00 41.53  ? 71  GLY B O     1 
ATOM   2387 N N     . LEU B 1 30  ? 3.539   -0.712  24.345  1.00 39.42  ? 72  LEU B N     1 
ATOM   2388 C CA    . LEU B 1 30  ? 4.344   -1.671  23.604  1.00 40.93  ? 72  LEU B CA    1 
ATOM   2389 C C     . LEU B 1 30  ? 5.064   -0.983  22.448  1.00 38.53  ? 72  LEU B C     1 
ATOM   2390 O O     . LEU B 1 30  ? 6.228   -1.273  22.145  1.00 38.60  ? 72  LEU B O     1 
ATOM   2391 C CB    . LEU B 1 30  ? 3.433   -2.798  23.111  1.00 31.71  ? 72  LEU B CB    1 
ATOM   2392 C CG    . LEU B 1 30  ? 4.240   -3.775  22.270  1.00 39.35  ? 72  LEU B CG    1 
ATOM   2393 C CD1   . LEU B 1 30  ? 5.388   -4.509  23.054  1.00 45.86  ? 72  LEU B CD1   1 
ATOM   2394 C CD2   . LEU B 1 30  ? 3.265   -4.750  21.676  1.00 50.66  ? 72  LEU B CD2   1 
ATOM   2395 N N     . ARG B 1 31  ? 4.397   -0.031  21.807  1.00 36.63  ? 73  ARG B N     1 
ATOM   2396 C CA    . ARG B 1 31  ? 4.987   0.693   20.694  1.00 39.28  ? 73  ARG B CA    1 
ATOM   2397 C C     . ARG B 1 31  ? 6.169   1.541   21.152  1.00 40.03  ? 73  ARG B C     1 
ATOM   2398 O O     . ARG B 1 31  ? 7.266   1.437   20.583  1.00 33.44  ? 73  ARG B O     1 
ATOM   2399 C CB    . ARG B 1 31  ? 3.887   1.511   20.015  1.00 38.43  ? 73  ARG B CB    1 
ATOM   2400 C CG    . ARG B 1 31  ? 2.989   0.595   19.177  1.00 34.06  ? 73  ARG B CG    1 
ATOM   2401 C CD    . ARG B 1 31  ? 1.749   1.264   18.737  1.00 31.70  ? 73  ARG B CD    1 
ATOM   2402 N NE    . ARG B 1 31  ? 0.896   1.616   19.861  1.00 51.83  ? 73  ARG B NE    1 
ATOM   2403 C CZ    . ARG B 1 31  ? -0.364  2.005   19.720  1.00 41.41  ? 73  ARG B CZ    1 
ATOM   2404 N NH1   . ARG B 1 31  ? -0.877  2.093   18.505  1.00 45.74  ? 73  ARG B NH1   1 
ATOM   2405 N NH2   . ARG B 1 31  ? -1.097  2.321   20.775  1.00 38.56  ? 73  ARG B NH2   1 
ATOM   2406 N N     . ALA B 1 32  ? 5.986   2.344   22.216  1.00 44.02  ? 74  ALA B N     1 
ATOM   2407 C CA    . ALA B 1 32  ? 7.069   3.207   22.695  1.00 31.75  ? 74  ALA B CA    1 
ATOM   2408 C C     . ALA B 1 32  ? 8.198   2.394   23.296  1.00 37.47  ? 74  ALA B C     1 
ATOM   2409 O O     . ALA B 1 32  ? 9.375   2.735   23.127  1.00 41.24  ? 74  ALA B O     1 
ATOM   2410 C CB    . ALA B 1 32  ? 6.551   4.216   23.707  1.00 28.33  ? 74  ALA B CB    1 
ATOM   2411 N N     . TRP B 1 33  ? 7.862   1.311   23.992  1.00 37.16  ? 75  TRP B N     1 
ATOM   2412 C CA    . TRP B 1 33  ? 8.884   0.398   24.490  1.00 36.70  ? 75  TRP B CA    1 
ATOM   2413 C C     . TRP B 1 33  ? 9.742   -0.165  23.363  1.00 38.55  ? 75  TRP B C     1 
ATOM   2414 O O     . TRP B 1 33  ? 10.948  -0.377  23.544  1.00 37.48  ? 75  TRP B O     1 
ATOM   2415 C CB    . TRP B 1 33  ? 8.205   -0.724  25.246  1.00 37.18  ? 75  TRP B CB    1 
ATOM   2416 C CG    . TRP B 1 33  ? 9.070   -1.834  25.715  1.00 33.96  ? 75  TRP B CG    1 
ATOM   2417 C CD1   . TRP B 1 33  ? 9.969   -1.801  26.735  1.00 32.03  ? 75  TRP B CD1   1 
ATOM   2418 C CD2   . TRP B 1 33  ? 9.043   -3.178  25.244  1.00 33.36  ? 75  TRP B CD2   1 
ATOM   2419 N NE1   . TRP B 1 33  ? 10.522  -3.045  26.918  1.00 29.59  ? 75  TRP B NE1   1 
ATOM   2420 C CE2   . TRP B 1 33  ? 9.972   -3.908  26.011  1.00 31.15  ? 75  TRP B CE2   1 
ATOM   2421 C CE3   . TRP B 1 33  ? 8.311   -3.842  24.250  1.00 38.18  ? 75  TRP B CE3   1 
ATOM   2422 C CZ2   . TRP B 1 33  ? 10.207  -5.263  25.807  1.00 32.77  ? 75  TRP B CZ2   1 
ATOM   2423 C CZ3   . TRP B 1 33  ? 8.537   -5.189  24.054  1.00 37.07  ? 75  TRP B CZ3   1 
ATOM   2424 C CH2   . TRP B 1 33  ? 9.478   -5.888  24.832  1.00 36.78  ? 75  TRP B CH2   1 
ATOM   2425 N N     . ILE B 1 34  ? 9.133   -0.437  22.201  1.00 34.69  ? 76  ILE B N     1 
ATOM   2426 C CA    . ILE B 1 34  ? 9.871   -1.041  21.097  1.00 38.98  ? 76  ILE B CA    1 
ATOM   2427 C C     . ILE B 1 34  ? 10.754  -0.007  20.404  1.00 37.52  ? 76  ILE B C     1 
ATOM   2428 O O     . ILE B 1 34  ? 11.906  -0.289  20.053  1.00 34.39  ? 76  ILE B O     1 
ATOM   2429 C CB    . ILE B 1 34  ? 8.905   -1.717  20.107  1.00 41.63  ? 76  ILE B CB    1 
ATOM   2430 C CG1   . ILE B 1 34  ? 8.446   -3.062  20.647  1.00 38.62  ? 76  ILE B CG1   1 
ATOM   2431 C CG2   . ILE B 1 34  ? 9.571   -1.914  18.716  1.00 32.87  ? 76  ILE B CG2   1 
ATOM   2432 C CD1   . ILE B 1 34  ? 7.766   -3.918  19.576  1.00 38.26  ? 76  ILE B CD1   1 
ATOM   2433 N N     . LYS B 1 35  ? 10.241  1.203   20.199  1.00 34.37  ? 77  LYS B N     1 
ATOM   2434 C CA    . LYS B 1 35  ? 11.110  2.252   19.693  1.00 37.97  ? 77  LYS B CA    1 
ATOM   2435 C C     . LYS B 1 35  ? 12.300  2.489   20.620  1.00 45.98  ? 77  LYS B C     1 
ATOM   2436 O O     . LYS B 1 35  ? 13.341  2.964   20.147  1.00 44.72  ? 77  LYS B O     1 
ATOM   2437 C CB    . LYS B 1 35  ? 10.316  3.548   19.481  1.00 42.82  ? 77  LYS B CB    1 
ATOM   2438 C CG    . LYS B 1 35  ? 9.154   3.414   18.497  1.00 44.04  ? 77  LYS B CG    1 
ATOM   2439 C CD    . LYS B 1 35  ? 8.596   4.772   18.046  1.00 50.05  ? 77  LYS B CD    1 
ATOM   2440 C CE    . LYS B 1 35  ? 7.854   4.645   16.682  1.00 64.23  ? 77  LYS B CE    1 
ATOM   2441 N NZ    . LYS B 1 35  ? 8.753   4.641   15.452  1.00 61.56  ? 77  LYS B NZ    1 
ATOM   2442 N N     . LYS B 1 36  ? 12.173  2.140   21.919  1.00 40.13  ? 78  LYS B N     1 
ATOM   2443 C CA    . LYS B 1 36  ? 13.236  2.266   22.919  1.00 37.95  ? 78  LYS B CA    1 
ATOM   2444 C C     . LYS B 1 36  ? 14.036  0.977   23.111  1.00 43.26  ? 78  LYS B C     1 
ATOM   2445 O O     . LYS B 1 36  ? 14.697  0.817   24.149  1.00 40.26  ? 78  LYS B O     1 
ATOM   2446 C CB    . LYS B 1 36  ? 12.663  2.722   24.263  1.00 40.11  ? 78  LYS B CB    1 
ATOM   2447 C CG    . LYS B 1 36  ? 12.252  4.199   24.300  1.00 45.93  ? 78  LYS B CG    1 
ATOM   2448 C CD    . LYS B 1 36  ? 11.605  4.628   25.642  1.00 39.89  ? 78  LYS B CD    1 
ATOM   2449 C CE    . LYS B 1 36  ? 10.175  4.100   25.767  1.00 42.35  ? 78  LYS B CE    1 
ATOM   2450 N NZ    . LYS B 1 36  ? 9.321   4.781   26.794  1.00 37.88  ? 78  LYS B NZ    1 
ATOM   2451 N N     . LYS B 1 37  ? 13.967  0.053   22.149  1.00 43.28  ? 79  LYS B N     1 
ATOM   2452 C CA    . LYS B 1 37  ? 14.893  -1.068  22.002  1.00 49.19  ? 79  LYS B CA    1 
ATOM   2453 C C     . LYS B 1 37  ? 14.636  -2.196  22.989  1.00 44.76  ? 79  LYS B C     1 
ATOM   2454 O O     . LYS B 1 37  ? 15.501  -3.078  23.147  1.00 39.83  ? 79  LYS B O     1 
ATOM   2455 C CB    . LYS B 1 37  ? 16.356  -0.604  22.105  1.00 49.89  ? 79  LYS B CB    1 
ATOM   2456 C CG    . LYS B 1 37  ? 16.712  0.478   21.086  1.00 46.57  ? 79  LYS B CG    1 
ATOM   2457 C CD    . LYS B 1 37  ? 16.238  0.036   19.705  1.00 55.95  ? 79  LYS B CD    1 
ATOM   2458 C CE    . LYS B 1 37  ? 15.986  1.216   18.763  1.00 63.10  ? 79  LYS B CE    1 
ATOM   2459 N NZ    . LYS B 1 37  ? 15.081  0.832   17.614  1.00 58.07  ? 79  LYS B NZ    1 
ATOM   2460 N N     . GLY B 1 38  ? 13.462  -2.194  23.634  1.00 42.60  ? 80  GLY B N     1 
ATOM   2461 C CA    . GLY B 1 38  ? 13.107  -3.270  24.555  1.00 39.62  ? 80  GLY B CA    1 
ATOM   2462 C C     . GLY B 1 38  ? 13.275  -4.660  23.965  1.00 39.72  ? 80  GLY B C     1 
ATOM   2463 O O     . GLY B 1 38  ? 13.817  -5.560  24.614  1.00 39.10  ? 80  GLY B O     1 
ATOM   2464 N N     . LEU B 1 39  ? 12.835  -4.855  22.719  1.00 40.92  ? 81  LEU B N     1 
ATOM   2465 C CA    . LEU B 1 39  ? 13.003  -6.164  22.090  1.00 43.91  ? 81  LEU B CA    1 
ATOM   2466 C C     . LEU B 1 39  ? 14.474  -6.570  21.971  1.00 43.56  ? 81  LEU B C     1 
ATOM   2467 O O     . LEU B 1 39  ? 14.786  -7.767  22.009  1.00 45.95  ? 81  LEU B O     1 
ATOM   2468 C CB    . LEU B 1 39  ? 12.336  -6.188  20.714  1.00 45.90  ? 81  LEU B CB    1 
ATOM   2469 C CG    . LEU B 1 39  ? 10.828  -6.395  20.821  1.00 49.32  ? 81  LEU B CG    1 
ATOM   2470 C CD1   . LEU B 1 39  ? 10.268  -6.797  19.496  1.00 34.17  ? 81  LEU B CD1   1 
ATOM   2471 C CD2   . LEU B 1 39  ? 10.515  -7.459  21.853  1.00 43.15  ? 81  LEU B CD2   1 
ATOM   2472 N N     . ASP B 1 40  ? 15.395  -5.613  21.838  1.00 44.25  ? 82  ASP B N     1 
ATOM   2473 C CA    . ASP B 1 40  ? 16.808  -5.994  21.866  1.00 46.90  ? 82  ASP B CA    1 
ATOM   2474 C C     . ASP B 1 40  ? 17.193  -6.532  23.236  1.00 42.12  ? 82  ASP B C     1 
ATOM   2475 O O     . ASP B 1 40  ? 17.936  -7.521  23.336  1.00 37.99  ? 82  ASP B O     1 
ATOM   2476 C CB    . ASP B 1 40  ? 17.708  -4.817  21.478  1.00 43.66  ? 82  ASP B CB    1 
ATOM   2477 C CG    . ASP B 1 40  ? 17.361  -4.243  20.111  1.00 51.58  ? 82  ASP B CG    1 
ATOM   2478 O OD1   . ASP B 1 40  ? 16.888  -5.018  19.241  1.00 49.13  ? 82  ASP B OD1   1 
ATOM   2479 O OD2   . ASP B 1 40  ? 17.538  -3.013  19.916  1.00 53.23  ? 82  ASP B OD2   1 
ATOM   2480 N N     . TRP B 1 41  ? 16.676  -5.910  24.307  1.00 41.35  ? 83  TRP B N     1 
ATOM   2481 C CA    . TRP B 1 41  ? 16.987  -6.397  25.648  1.00 42.11  ? 83  TRP B CA    1 
ATOM   2482 C C     . TRP B 1 41  ? 16.406  -7.785  25.871  1.00 40.97  ? 83  TRP B C     1 
ATOM   2483 O O     . TRP B 1 41  ? 17.039  -8.638  26.501  1.00 37.13  ? 83  TRP B O     1 
ATOM   2484 C CB    . TRP B 1 41  ? 16.484  -5.429  26.722  1.00 37.87  ? 83  TRP B CB    1 
ATOM   2485 C CG    . TRP B 1 41  ? 16.968  -5.857  28.063  1.00 32.37  ? 83  TRP B CG    1 
ATOM   2486 C CD1   . TRP B 1 41  ? 18.107  -5.460  28.681  1.00 38.98  ? 83  TRP B CD1   1 
ATOM   2487 C CD2   . TRP B 1 41  ? 16.355  -6.808  28.930  1.00 38.13  ? 83  TRP B CD2   1 
ATOM   2488 N NE1   . TRP B 1 41  ? 18.253  -6.098  29.883  1.00 39.59  ? 83  TRP B NE1   1 
ATOM   2489 C CE2   . TRP B 1 41  ? 17.182  -6.931  30.065  1.00 42.17  ? 83  TRP B CE2   1 
ATOM   2490 C CE3   . TRP B 1 41  ? 15.184  -7.571  28.860  1.00 38.03  ? 83  TRP B CE3   1 
ATOM   2491 C CZ2   . TRP B 1 41  ? 16.876  -7.789  31.125  1.00 40.28  ? 83  TRP B CZ2   1 
ATOM   2492 C CZ3   . TRP B 1 41  ? 14.877  -8.416  29.908  1.00 35.61  ? 83  TRP B CZ3   1 
ATOM   2493 C CH2   . TRP B 1 41  ? 15.719  -8.521  31.025  1.00 43.92  ? 83  TRP B CH2   1 
ATOM   2494 N N     . VAL B 1 42  ? 15.218  -8.038  25.330  1.00 38.69  ? 84  VAL B N     1 
ATOM   2495 C CA    . VAL B 1 42  ? 14.617  -9.361  25.443  1.00 39.00  ? 84  VAL B CA    1 
ATOM   2496 C C     . VAL B 1 42  ? 15.465  -10.411 24.725  1.00 39.50  ? 84  VAL B C     1 
ATOM   2497 O O     . VAL B 1 42  ? 15.662  -11.531 25.231  1.00 32.95  ? 84  VAL B O     1 
ATOM   2498 C CB    . VAL B 1 42  ? 13.177  -9.309  24.910  1.00 41.12  ? 84  VAL B CB    1 
ATOM   2499 C CG1   . VAL B 1 42  ? 12.638  -10.699 24.699  1.00 33.09  ? 84  VAL B CG1   1 
ATOM   2500 C CG2   . VAL B 1 42  ? 12.306  -8.482  25.874  1.00 32.11  ? 84  VAL B CG2   1 
ATOM   2501 N N     . LYS B 1 43  ? 15.995  -10.064 23.544  1.00 40.44  ? 85  LYS B N     1 
ATOM   2502 C CA    . LYS B 1 43  ? 16.811  -11.014 22.785  1.00 40.13  ? 85  LYS B CA    1 
ATOM   2503 C C     . LYS B 1 43  ? 18.111  -11.351 23.508  1.00 39.88  ? 85  LYS B C     1 
ATOM   2504 O O     . LYS B 1 43  ? 18.654  -12.449 23.330  1.00 41.20  ? 85  LYS B O     1 
ATOM   2505 C CB    . LYS B 1 43  ? 17.110  -10.467 21.388  1.00 44.17  ? 85  LYS B CB    1 
ATOM   2506 C CG    . LYS B 1 43  ? 15.896  -10.378 20.460  1.00 46.19  ? 85  LYS B CG    1 
ATOM   2507 C CD    . LYS B 1 43  ? 16.178  -9.504  19.243  1.00 50.79  ? 85  LYS B CD    1 
ATOM   2508 C CE    . LYS B 1 43  ? 15.032  -9.578  18.226  1.00 61.57  ? 85  LYS B CE    1 
ATOM   2509 N NZ    . LYS B 1 43  ? 15.364  -8.983  16.869  1.00 61.33  ? 85  LYS B NZ    1 
ATOM   2510 N N     . GLU B 1 44  ? 18.627  -10.426 24.321  1.00 39.92  ? 86  GLU B N     1 
ATOM   2511 C CA    . GLU B 1 44  ? 19.826  -10.700 25.106  1.00 42.26  ? 86  GLU B CA    1 
ATOM   2512 C C     . GLU B 1 44  ? 19.510  -11.445 26.400  1.00 41.70  ? 86  GLU B C     1 
ATOM   2513 O O     . GLU B 1 44  ? 20.330  -12.245 26.868  1.00 41.10  ? 86  GLU B O     1 
ATOM   2514 C CB    . GLU B 1 44  ? 20.555  -9.391  25.421  1.00 43.90  ? 86  GLU B CB    1 
ATOM   2515 C CG    . GLU B 1 44  ? 21.399  -8.842  24.280  1.00 37.70  ? 86  GLU B CG    1 
ATOM   2516 C CD    . GLU B 1 44  ? 21.758  -7.386  24.490  1.00 38.44  ? 86  GLU B CD    1 
ATOM   2517 O OE1   . GLU B 1 44  ? 21.347  -6.801  25.521  1.00 36.10  ? 86  GLU B OE1   1 
ATOM   2518 O OE2   . GLU B 1 44  ? 22.456  -6.827  23.620  1.00 41.02  ? 86  GLU B OE2   1 
ATOM   2519 N N     . GLU B 1 45  ? 18.349  -11.179 27.006  1.00 43.95  ? 87  GLU B N     1 
ATOM   2520 C CA    . GLU B 1 45  ? 17.930  -11.974 28.150  1.00 38.34  ? 87  GLU B CA    1 
ATOM   2521 C C     . GLU B 1 45  ? 17.582  -13.379 27.695  1.00 41.91  ? 87  GLU B C     1 
ATOM   2522 O O     . GLU B 1 45  ? 17.874  -14.353 28.404  1.00 35.61  ? 87  GLU B O     1 
ATOM   2523 C CB    . GLU B 1 45  ? 16.744  -11.305 28.849  1.00 35.45  ? 87  GLU B CB    1 
ATOM   2524 C CG    . GLU B 1 45  ? 16.376  -11.920 30.202  1.00 40.40  ? 87  GLU B CG    1 
ATOM   2525 C CD    . GLU B 1 45  ? 17.372  -11.591 31.314  1.00 43.65  ? 87  GLU B CD    1 
ATOM   2526 O OE1   . GLU B 1 45  ? 18.191  -10.654 31.141  1.00 41.00  ? 87  GLU B OE1   1 
ATOM   2527 O OE2   . GLU B 1 45  ? 17.332  -12.284 32.360  1.00 44.85  ? 87  GLU B OE2   1 
ATOM   2528 N N     . ALA B 1 46  ? 17.011  -13.488 26.493  1.00 40.13  ? 88  ALA B N     1 
ATOM   2529 C CA    . ALA B 1 46  ? 16.680  -14.758 25.862  1.00 33.08  ? 88  ALA B CA    1 
ATOM   2530 C C     . ALA B 1 46  ? 15.832  -15.635 26.804  1.00 39.62  ? 88  ALA B C     1 
ATOM   2531 O O     . ALA B 1 46  ? 16.231  -16.750 27.137  1.00 39.55  ? 88  ALA B O     1 
ATOM   2532 C CB    . ALA B 1 46  ? 17.932  -15.496 25.415  1.00 30.04  ? 88  ALA B CB    1 
ATOM   2533 N N     . PRO B 1 47  ? 14.670  -15.146 27.201  1.00 36.86  ? 89  PRO B N     1 
ATOM   2534 C CA    . PRO B 1 47  ? 13.802  -15.955 28.060  1.00 36.25  ? 89  PRO B CA    1 
ATOM   2535 C C     . PRO B 1 47  ? 13.148  -17.077 27.267  1.00 33.64  ? 89  PRO B C     1 
ATOM   2536 O O     . PRO B 1 47  ? 13.020  -17.022 26.043  1.00 38.07  ? 89  PRO B O     1 
ATOM   2537 C CB    . PRO B 1 47  ? 12.754  -14.949 28.545  1.00 38.23  ? 89  PRO B CB    1 
ATOM   2538 C CG    . PRO B 1 47  ? 12.833  -13.765 27.558  1.00 33.29  ? 89  PRO B CG    1 
ATOM   2539 C CD    . PRO B 1 47  ? 13.971  -13.989 26.627  1.00 33.92  ? 89  PRO B CD    1 
ATOM   2540 N N     . ASP B 1 48  ? 12.723  -18.113 27.990  1.00 31.57  ? 90  ASP B N     1 
ATOM   2541 C CA    . ASP B 1 48  ? 11.870  -19.123 27.371  1.00 34.52  ? 90  ASP B CA    1 
ATOM   2542 C C     . ASP B 1 48  ? 10.421  -18.649 27.255  1.00 35.34  ? 90  ASP B C     1 
ATOM   2543 O O     . ASP B 1 48  ? 9.706   -19.046 26.324  1.00 35.02  ? 90  ASP B O     1 
ATOM   2544 C CB    . ASP B 1 48  ? 11.932  -20.428 28.168  1.00 40.12  ? 90  ASP B CB    1 
ATOM   2545 C CG    . ASP B 1 48  ? 13.229  -21.174 27.983  1.00 37.31  ? 90  ASP B CG    1 
ATOM   2546 O OD1   . ASP B 1 48  ? 13.628  -21.406 26.817  1.00 41.65  ? 90  ASP B OD1   1 
ATOM   2547 O OD2   . ASP B 1 48  ? 13.843  -21.535 29.010  1.00 37.19  ? 90  ASP B OD2   1 
ATOM   2548 N N     . ILE B 1 49  ? 9.967   -17.821 28.192  1.00 32.80  ? 91  ILE B N     1 
ATOM   2549 C CA    . ILE B 1 49  ? 8.642   -17.218 28.145  1.00 31.23  ? 91  ILE B CA    1 
ATOM   2550 C C     . ILE B 1 49  ? 8.799   -15.763 28.549  1.00 31.77  ? 91  ILE B C     1 
ATOM   2551 O O     . ILE B 1 49  ? 9.646   -15.418 29.377  1.00 28.36  ? 91  ILE B O     1 
ATOM   2552 C CB    . ILE B 1 49  ? 7.628   -17.921 29.074  1.00 31.69  ? 91  ILE B CB    1 
ATOM   2553 C CG1   . ILE B 1 49  ? 7.596   -19.428 28.810  1.00 32.50  ? 91  ILE B CG1   1 
ATOM   2554 C CG2   . ILE B 1 49  ? 6.240   -17.301 28.932  1.00 32.23  ? 91  ILE B CG2   1 
ATOM   2555 C CD1   . ILE B 1 49  ? 6.828   -20.219 29.865  1.00 33.71  ? 91  ILE B CD1   1 
ATOM   2556 N N     . LEU B 1 50  ? 7.991   -14.901 27.942  1.00 34.05  ? 92  LEU B N     1 
ATOM   2557 C CA    . LEU B 1 50  ? 8.019   -13.483 28.252  1.00 30.29  ? 92  LEU B CA    1 
ATOM   2558 C C     . LEU B 1 50  ? 6.596   -12.969 28.374  1.00 31.33  ? 92  LEU B C     1 
ATOM   2559 O O     . LEU B 1 50  ? 5.716   -13.349 27.595  1.00 31.19  ? 92  LEU B O     1 
ATOM   2560 C CB    . LEU B 1 50  ? 8.806   -12.707 27.193  1.00 38.35  ? 92  LEU B CB    1 
ATOM   2561 C CG    . LEU B 1 50  ? 8.764   -11.189 27.348  1.00 39.90  ? 92  LEU B CG    1 
ATOM   2562 C CD1   . LEU B 1 50  ? 10.117  -10.647 27.135  1.00 44.23  ? 92  LEU B CD1   1 
ATOM   2563 C CD2   . LEU B 1 50  ? 7.899   -10.645 26.295  1.00 39.99  ? 92  LEU B CD2   1 
ATOM   2564 N N     . CYS B 1 51  ? 6.367   -12.140 29.390  1.00 32.76  ? 93  CYS B N     1 
ATOM   2565 C CA    . CYS B 1 51  ? 5.037   -11.634 29.710  1.00 31.64  ? 93  CYS B CA    1 
ATOM   2566 C C     . CYS B 1 51  ? 5.091   -10.121 29.773  1.00 33.32  ? 93  CYS B C     1 
ATOM   2567 O O     . CYS B 1 51  ? 5.957   -9.557  30.451  1.00 34.67  ? 93  CYS B O     1 
ATOM   2568 C CB    . CYS B 1 51  ? 4.533   -12.166 31.050  1.00 36.64  ? 93  CYS B CB    1 
ATOM   2569 S SG    . CYS B 1 51  ? 4.592   -13.947 31.267  1.00 40.01  ? 93  CYS B SG    1 
ATOM   2570 N N     . LEU B 1 52  ? 4.144   -9.470  29.113  1.00 32.27  ? 94  LEU B N     1 
ATOM   2571 C CA    . LEU B 1 52  ? 4.090   -8.020  29.079  1.00 30.79  ? 94  LEU B CA    1 
ATOM   2572 C C     . LEU B 1 52  ? 2.757   -7.557  29.632  1.00 34.39  ? 94  LEU B C     1 
ATOM   2573 O O     . LEU B 1 52  ? 1.726   -8.204  29.416  1.00 30.25  ? 94  LEU B O     1 
ATOM   2574 C CB    . LEU B 1 52  ? 4.269   -7.502  27.667  1.00 30.94  ? 94  LEU B CB    1 
ATOM   2575 C CG    . LEU B 1 52  ? 5.427   -8.208  26.964  1.00 32.59  ? 94  LEU B CG    1 
ATOM   2576 C CD1   . LEU B 1 52  ? 5.313   -8.005  25.464  1.00 31.57  ? 94  LEU B CD1   1 
ATOM   2577 C CD2   . LEU B 1 52  ? 6.739   -7.684  27.509  1.00 26.75  ? 94  LEU B CD2   1 
ATOM   2578 N N     . GLN B 1 53  ? 2.794   -6.439  30.355  1.00 32.24  ? 95  GLN B N     1 
ATOM   2579 C CA    . GLN B 1 53  ? 1.592   -5.808  30.856  1.00 31.61  ? 95  GLN B CA    1 
ATOM   2580 C C     . GLN B 1 53  ? 1.594   -4.335  30.470  1.00 33.50  ? 95  GLN B C     1 
ATOM   2581 O O     . GLN B 1 53  ? 2.648   -3.727  30.211  1.00 25.00  ? 95  GLN B O     1 
ATOM   2582 C CB    . GLN B 1 53  ? 1.450   -5.955  32.380  1.00 32.01  ? 95  GLN B CB    1 
ATOM   2583 C CG    . GLN B 1 53  ? 1.262   -7.381  32.890  1.00 26.07  ? 95  GLN B CG    1 
ATOM   2584 C CD    . GLN B 1 53  ? 2.574   -8.102  33.083  1.00 30.54  ? 95  GLN B CD    1 
ATOM   2585 O OE1   . GLN B 1 53  ? 2.608   -9.257  33.487  1.00 40.90  ? 95  GLN B OE1   1 
ATOM   2586 N NE2   . GLN B 1 53  ? 3.672   -7.411  32.833  1.00 33.56  ? 95  GLN B NE2   1 
ATOM   2587 N N     . GLU B 1 54  ? 0.378   -3.788  30.434  1.00 32.84  ? 96  GLU B N     1 
ATOM   2588 C CA    . GLU B 1 54  ? 0.101   -2.413  30.032  1.00 35.43  ? 96  GLU B CA    1 
ATOM   2589 C C     . GLU B 1 54  ? 0.658   -2.140  28.634  1.00 34.27  ? 96  GLU B C     1 
ATOM   2590 O O     . GLU B 1 54  ? 1.470   -1.240  28.388  1.00 30.58  ? 96  GLU B O     1 
ATOM   2591 C CB    . GLU B 1 54  ? 0.638   -1.436  31.074  1.00 41.67  ? 96  GLU B CB    1 
ATOM   2592 C CG    . GLU B 1 54  ? -0.196  -0.186  31.215  1.00 38.61  ? 96  GLU B CG    1 
ATOM   2593 C CD    . GLU B 1 54  ? 0.338   0.717   32.293  1.00 33.17  ? 96  GLU B CD    1 
ATOM   2594 O OE1   . GLU B 1 54  ? 1.293   0.308   32.980  1.00 32.65  ? 96  GLU B OE1   1 
ATOM   2595 O OE2   . GLU B 1 54  ? -0.188  1.833   32.449  1.00 43.44  ? 96  GLU B OE2   1 
ATOM   2596 N N     . THR B 1 55  ? 0.193   -2.959  27.701  1.00 35.84  ? 97  THR B N     1 
ATOM   2597 C CA    . THR B 1 55  ? 0.673   -2.840  26.332  1.00 42.56  ? 97  THR B CA    1 
ATOM   2598 C C     . THR B 1 55  ? 0.081   -1.626  25.608  1.00 42.37  ? 97  THR B C     1 
ATOM   2599 O O     . THR B 1 55  ? 0.776   -0.988  24.814  1.00 41.06  ? 97  THR B O     1 
ATOM   2600 C CB    . THR B 1 55  ? 0.360   -4.127  25.603  1.00 38.97  ? 97  THR B CB    1 
ATOM   2601 O OG1   . THR B 1 55  ? -1.060  -4.209  25.404  1.00 36.89  ? 97  THR B OG1   1 
ATOM   2602 C CG2   . THR B 1 55  ? 0.846   -5.298  26.476  1.00 33.92  ? 97  THR B CG2   1 
ATOM   2603 N N     . LYS B 1 56  ? -1.188  -1.293  25.863  1.00 41.49  ? 98  LYS B N     1 
ATOM   2604 C CA    . LYS B 1 56  ? -1.817  -0.095  25.305  1.00 47.07  ? 98  LYS B CA    1 
ATOM   2605 C C     . LYS B 1 56  ? -1.804  -0.133  23.777  1.00 43.98  ? 98  LYS B C     1 
ATOM   2606 O O     . LYS B 1 56  ? -1.248  0.741   23.108  1.00 45.29  ? 98  LYS B O     1 
ATOM   2607 C CB    . LYS B 1 56  ? -1.130  1.174   25.824  1.00 49.18  ? 98  LYS B CB    1 
ATOM   2608 C CG    . LYS B 1 56  ? -1.183  1.366   27.342  1.00 50.01  ? 98  LYS B CG    1 
ATOM   2609 C CD    . LYS B 1 56  ? -0.251  2.497   27.748  1.00 46.44  ? 98  LYS B CD    1 
ATOM   2610 C CE    . LYS B 1 56  ? -0.746  3.294   28.957  1.00 46.85  ? 98  LYS B CE    1 
ATOM   2611 N NZ    . LYS B 1 56  ? 0.068   4.553   29.103  1.00 48.90  ? 98  LYS B NZ    1 
ATOM   2612 N N     . CYS B 1 57  ? -2.442  -1.166  23.236  1.00 48.13  ? 99  CYS B N     1 
ATOM   2613 C CA    . CYS B 1 57  ? -2.253  -1.497  21.828  1.00 50.15  ? 99  CYS B CA    1 
ATOM   2614 C C     . CYS B 1 57  ? -3.270  -2.585  21.475  1.00 45.17  ? 99  CYS B C     1 
ATOM   2615 O O     . CYS B 1 57  ? -3.273  -3.650  22.105  1.00 36.47  ? 99  CYS B O     1 
ATOM   2616 C CB    . CYS B 1 57  ? -0.779  -1.848  21.606  1.00 39.88  ? 99  CYS B CB    1 
ATOM   2617 S SG    . CYS B 1 57  ? -0.320  -2.087  19.921  1.00 41.22  ? 99  CYS B SG    1 
ATOM   2618 N N     . SER B 1 58  ? -4.134  -2.322  20.484  1.00 51.11  ? 100 SER B N     1 
ATOM   2619 C CA    . SER B 1 58  ? -5.014  -3.346  19.905  1.00 54.62  ? 100 SER B CA    1 
ATOM   2620 C C     . SER B 1 58  ? -4.138  -4.262  19.053  1.00 49.18  ? 100 SER B C     1 
ATOM   2621 O O     . SER B 1 58  ? -2.995  -3.939  18.730  1.00 44.94  ? 100 SER B O     1 
ATOM   2622 C CB    . SER B 1 58  ? -6.038  -2.708  18.972  1.00 50.18  ? 100 SER B CB    1 
ATOM   2623 O OG    . SER B 1 58  ? -6.790  -1.716  19.608  1.00 55.34  ? 100 SER B OG    1 
ATOM   2624 N N     . GLU B 1 59  ? -4.714  -5.395  18.627  1.00 48.06  ? 101 GLU B N     1 
ATOM   2625 C CA    . GLU B 1 59  ? -3.904  -6.350  17.873  1.00 53.14  ? 101 GLU B CA    1 
ATOM   2626 C C     . GLU B 1 59  ? -3.600  -5.894  16.446  1.00 51.77  ? 101 GLU B C     1 
ATOM   2627 O O     . GLU B 1 59  ? -2.572  -6.312  15.898  1.00 55.12  ? 101 GLU B O     1 
ATOM   2628 C CB    . GLU B 1 59  ? -4.545  -7.748  17.878  1.00 55.21  ? 101 GLU B CB    1 
ATOM   2629 C CG    . GLU B 1 59  ? -3.676  -8.722  18.715  1.00 58.71  ? 101 GLU B CG    1 
ATOM   2630 C CD    . GLU B 1 59  ? -4.306  -10.083 19.077  1.00 64.07  ? 101 GLU B CD    1 
ATOM   2631 O OE1   . GLU B 1 59  ? -5.464  -10.121 19.558  1.00 54.07  ? 101 GLU B OE1   1 
ATOM   2632 O OE2   . GLU B 1 59  ? -3.599  -11.117 18.957  1.00 69.87  ? 101 GLU B OE2   1 
ATOM   2633 N N     . ASN B 1 60  ? -4.429  -5.039  15.830  1.00 54.35  ? 102 ASN B N     1 
ATOM   2634 C CA    . ASN B 1 60  ? -4.058  -4.524  14.512  1.00 52.81  ? 102 ASN B CA    1 
ATOM   2635 C C     . ASN B 1 60  ? -2.686  -3.880  14.564  1.00 52.03  ? 102 ASN B C     1 
ATOM   2636 O O     . ASN B 1 60  ? -1.851  -4.095  13.676  1.00 57.29  ? 102 ASN B O     1 
ATOM   2637 C CB    . ASN B 1 60  ? -5.059  -3.484  13.985  1.00 56.69  ? 102 ASN B CB    1 
ATOM   2638 C CG    . ASN B 1 60  ? -6.399  -4.075  13.582  1.00 65.89  ? 102 ASN B CG    1 
ATOM   2639 O OD1   . ASN B 1 60  ? -6.502  -5.242  13.287  1.00 67.65  ? 102 ASN B OD1   1 
ATOM   2640 N ND2   . ASN B 1 60  ? -7.425  -3.266  13.647  1.00 74.19  ? 102 ASN B ND2   1 
ATOM   2641 N N     . LYS B 1 61  ? -2.436  -3.089  15.604  1.00 44.22  ? 103 LYS B N     1 
ATOM   2642 C CA    . LYS B 1 61  ? -1.332  -2.148  15.596  1.00 46.92  ? 103 LYS B CA    1 
ATOM   2643 C C     . LYS B 1 61  ? -0.067  -2.713  16.209  1.00 44.68  ? 103 LYS B C     1 
ATOM   2644 O O     . LYS B 1 61  ? 0.911   -1.974  16.366  1.00 47.19  ? 103 LYS B O     1 
ATOM   2645 C CB    . LYS B 1 61  ? -1.766  -0.859  16.284  1.00 46.88  ? 103 LYS B CB    1 
ATOM   2646 C CG    . LYS B 1 61  ? -2.764  -0.074  15.420  1.00 50.02  ? 103 LYS B CG    1 
ATOM   2647 C CD    . LYS B 1 61  ? -3.718  0.749   16.249  1.00 59.26  ? 103 LYS B CD    1 
ATOM   2648 C CE    . LYS B 1 61  ? -4.583  -0.143  17.149  1.00 69.65  ? 103 LYS B CE    1 
ATOM   2649 N NZ    . LYS B 1 61  ? -5.751  -0.798  16.464  1.00 65.26  ? 103 LYS B NZ    1 
ATOM   2650 N N     . LEU B 1 62  ? -0.048  -4.009  16.500  1.00 44.43  ? 104 LEU B N     1 
ATOM   2651 C CA    . LEU B 1 62  ? 1.149   -4.669  16.994  1.00 42.48  ? 104 LEU B CA    1 
ATOM   2652 C C     . LEU B 1 62  ? 2.264   -4.525  15.972  1.00 45.24  ? 104 LEU B C     1 
ATOM   2653 O O     . LEU B 1 62  ? 2.114   -5.005  14.838  1.00 50.25  ? 104 LEU B O     1 
ATOM   2654 C CB    . LEU B 1 62  ? 0.883   -6.145  17.282  1.00 36.54  ? 104 LEU B CB    1 
ATOM   2655 C CG    . LEU B 1 62  ? -0.208  -6.423  18.315  1.00 37.34  ? 104 LEU B CG    1 
ATOM   2656 C CD1   . LEU B 1 62  ? -0.102  -7.811  18.830  1.00 41.06  ? 104 LEU B CD1   1 
ATOM   2657 C CD2   . LEU B 1 62  ? -0.064  -5.469  19.464  1.00 40.86  ? 104 LEU B CD2   1 
ATOM   2658 N N     . PRO B 1 63  ? 3.377   -3.871  16.319  1.00 44.68  ? 105 PRO B N     1 
ATOM   2659 C CA    . PRO B 1 63  ? 4.481   -3.703  15.365  1.00 37.77  ? 105 PRO B CA    1 
ATOM   2660 C C     . PRO B 1 63  ? 5.018   -5.041  14.906  1.00 40.88  ? 105 PRO B C     1 
ATOM   2661 O O     . PRO B 1 63  ? 5.227   -5.949  15.710  1.00 41.32  ? 105 PRO B O     1 
ATOM   2662 C CB    . PRO B 1 63  ? 5.529   -2.938  16.171  1.00 45.94  ? 105 PRO B CB    1 
ATOM   2663 C CG    . PRO B 1 63  ? 4.761   -2.314  17.307  1.00 45.48  ? 105 PRO B CG    1 
ATOM   2664 C CD    . PRO B 1 63  ? 3.670   -3.268  17.625  1.00 40.68  ? 105 PRO B CD    1 
ATOM   2665 N N     . ALA B 1 64  ? 5.238   -5.160  13.591  1.00 49.48  ? 106 ALA B N     1 
ATOM   2666 C CA    . ALA B 1 64  ? 5.636   -6.450  13.042  1.00 45.93  ? 106 ALA B CA    1 
ATOM   2667 C C     . ALA B 1 64  ? 6.980   -6.894  13.593  1.00 53.20  ? 106 ALA B C     1 
ATOM   2668 O O     . ALA B 1 64  ? 7.272   -8.101  13.582  1.00 47.22  ? 106 ALA B O     1 
ATOM   2669 C CB    . ALA B 1 64  ? 5.682   -6.410  11.511  1.00 50.06  ? 106 ALA B CB    1 
ATOM   2670 N N     . GLU B 1 65  ? 7.766   -5.957  14.148  1.00 47.27  ? 107 GLU B N     1 
ATOM   2671 C CA    . GLU B 1 65  ? 9.052   -6.298  14.742  1.00 50.43  ? 107 GLU B CA    1 
ATOM   2672 C C     . GLU B 1 65  ? 8.917   -7.377  15.821  1.00 46.26  ? 107 GLU B C     1 
ATOM   2673 O O     . GLU B 1 65  ? 9.931   -7.892  16.308  1.00 43.41  ? 107 GLU B O     1 
ATOM   2674 C CB    . GLU B 1 65  ? 9.748   -5.050  15.298  1.00 48.67  ? 107 GLU B CB    1 
ATOM   2675 C CG    . GLU B 1 65  ? 11.295  -5.167  15.182  1.00 66.59  ? 107 GLU B CG    1 
ATOM   2676 C CD    . GLU B 1 65  ? 12.015  -3.834  14.975  1.00 75.25  ? 107 GLU B CD    1 
ATOM   2677 O OE1   . GLU B 1 65  ? 11.491  -2.805  15.459  1.00 69.47  ? 107 GLU B OE1   1 
ATOM   2678 O OE2   . GLU B 1 65  ? 13.101  -3.820  14.328  1.00 70.04  ? 107 GLU B OE2   1 
ATOM   2679 N N     . LEU B 1 66  ? 7.681   -7.775  16.150  1.00 34.60  ? 108 LEU B N     1 
ATOM   2680 C CA    . LEU B 1 66  ? 7.465   -8.823  17.127  1.00 42.40  ? 108 LEU B CA    1 
ATOM   2681 C C     . LEU B 1 66  ? 7.618   -10.229 16.561  1.00 48.45  ? 108 LEU B C     1 
ATOM   2682 O O     . LEU B 1 66  ? 7.915   -11.154 17.330  1.00 54.93  ? 108 LEU B O     1 
ATOM   2683 C CB    . LEU B 1 66  ? 6.099   -8.649  17.783  1.00 42.93  ? 108 LEU B CB    1 
ATOM   2684 C CG    . LEU B 1 66  ? 6.240   -7.565  18.864  1.00 49.76  ? 108 LEU B CG    1 
ATOM   2685 C CD1   . LEU B 1 66  ? 4.955   -6.754  19.063  1.00 44.08  ? 108 LEU B CD1   1 
ATOM   2686 C CD2   . LEU B 1 66  ? 6.756   -8.133  20.213  1.00 46.38  ? 108 LEU B CD2   1 
ATOM   2687 N N     . GLN B 1 67  ? 7.466   -10.426 15.252  1.00 47.77  ? 109 GLN B N     1 
ATOM   2688 C CA    . GLN B 1 67  ? 7.822   -11.720 14.675  1.00 50.99  ? 109 GLN B CA    1 
ATOM   2689 C C     . GLN B 1 67  ? 9.301   -11.847 14.342  1.00 47.69  ? 109 GLN B C     1 
ATOM   2690 O O     . GLN B 1 67  ? 9.740   -12.925 13.933  1.00 44.29  ? 109 GLN B O     1 
ATOM   2691 C CB    . GLN B 1 67  ? 7.006   -12.012 13.424  1.00 64.51  ? 109 GLN B CB    1 
ATOM   2692 C CG    . GLN B 1 67  ? 5.533   -11.719 13.544  1.00 59.63  ? 109 GLN B CG    1 
ATOM   2693 C CD    . GLN B 1 67  ? 4.958   -11.440 12.178  1.00 72.78  ? 109 GLN B CD    1 
ATOM   2694 O OE1   . GLN B 1 67  ? 4.773   -12.354 11.375  1.00 66.68  ? 109 GLN B OE1   1 
ATOM   2695 N NE2   . GLN B 1 67  ? 4.742   -10.166 11.885  1.00 62.52  ? 109 GLN B NE2   1 
ATOM   2696 N N     . GLU B 1 68  ? 10.078  -10.789 14.543  1.00 54.35  ? 110 GLU B N     1 
ATOM   2697 C CA    . GLU B 1 68  ? 11.530  -10.886 14.602  1.00 54.00  ? 110 GLU B CA    1 
ATOM   2698 C C     . GLU B 1 68  ? 11.991  -11.562 15.897  1.00 53.12  ? 110 GLU B C     1 
ATOM   2699 O O     . GLU B 1 68  ? 13.158  -11.416 16.302  1.00 54.77  ? 110 GLU B O     1 
ATOM   2700 C CB    . GLU B 1 68  ? 12.135  -9.483  14.458  1.00 53.50  ? 110 GLU B CB    1 
ATOM   2701 C CG    . GLU B 1 68  ? 11.967  -8.860  13.068  1.00 51.78  ? 110 GLU B CG    1 
ATOM   2702 C CD    . GLU B 1 68  ? 12.769  -7.570  12.897  1.00 60.91  ? 110 GLU B CD    1 
ATOM   2703 O OE1   . GLU B 1 68  ? 12.258  -6.647  12.229  1.00 64.07  ? 110 GLU B OE1   1 
ATOM   2704 O OE2   . GLU B 1 68  ? 13.896  -7.464  13.444  1.00 61.65  ? 110 GLU B OE2   1 
ATOM   2705 N N     . LEU B 1 69  ? 11.090  -12.301 16.559  1.00 50.05  ? 111 LEU B N     1 
ATOM   2706 C CA    . LEU B 1 69  ? 11.391  -13.067 17.774  1.00 54.04  ? 111 LEU B CA    1 
ATOM   2707 C C     . LEU B 1 69  ? 11.122  -14.540 17.507  1.00 54.54  ? 111 LEU B C     1 
ATOM   2708 O O     . LEU B 1 69  ? 10.060  -15.068 17.899  1.00 51.99  ? 111 LEU B O     1 
ATOM   2709 C CB    . LEU B 1 69  ? 10.516  -12.590 18.932  1.00 55.15  ? 111 LEU B CB    1 
ATOM   2710 C CG    . LEU B 1 69  ? 10.635  -11.199 19.602  1.00 62.38  ? 111 LEU B CG    1 
ATOM   2711 C CD1   . LEU B 1 69  ? 9.598   -11.052 20.711  1.00 61.43  ? 111 LEU B CD1   1 
ATOM   2712 C CD2   . LEU B 1 69  ? 12.066  -10.913 20.081  1.00 57.37  ? 111 LEU B CD2   1 
ATOM   2713 N N     . PRO B 1 70  ? 12.035  -15.241 16.825  1.00 57.16  ? 112 PRO B N     1 
ATOM   2714 C CA    . PRO B 1 70  ? 11.818  -16.690 16.660  1.00 52.89  ? 112 PRO B CA    1 
ATOM   2715 C C     . PRO B 1 70  ? 11.968  -17.515 17.933  1.00 42.10  ? 112 PRO B C     1 
ATOM   2716 O O     . PRO B 1 70  ? 11.397  -18.617 18.008  1.00 41.89  ? 112 PRO B O     1 
ATOM   2717 C CB    . PRO B 1 70  ? 12.883  -17.103 15.593  1.00 52.88  ? 112 PRO B CB    1 
ATOM   2718 C CG    . PRO B 1 70  ? 13.130  -15.801 14.832  1.00 45.91  ? 112 PRO B CG    1 
ATOM   2719 C CD    . PRO B 1 70  ? 13.141  -14.800 15.961  1.00 54.87  ? 112 PRO B CD    1 
ATOM   2720 N N     . GLY B 1 71  ? 12.735  -17.046 18.929  1.00 48.56  ? 113 GLY B N     1 
ATOM   2721 C CA    . GLY B 1 71  ? 12.834  -17.726 20.219  1.00 36.81  ? 113 GLY B CA    1 
ATOM   2722 C C     . GLY B 1 71  ? 11.598  -17.586 21.089  1.00 36.61  ? 113 GLY B C     1 
ATOM   2723 O O     . GLY B 1 71  ? 11.496  -18.272 22.113  1.00 42.50  ? 113 GLY B O     1 
ATOM   2724 N N     . LEU B 1 72  ? 10.660  -16.727 20.689  1.00 36.18  ? 114 LEU B N     1 
ATOM   2725 C CA    . LEU B 1 72  ? 9.407   -16.473 21.386  1.00 33.83  ? 114 LEU B CA    1 
ATOM   2726 C C     . LEU B 1 72  ? 8.250   -16.345 20.387  1.00 37.40  ? 114 LEU B C     1 
ATOM   2727 O O     . LEU B 1 72  ? 7.514   -15.354 20.376  1.00 39.13  ? 114 LEU B O     1 
ATOM   2728 C CB    . LEU B 1 72  ? 9.534   -15.205 22.233  1.00 39.30  ? 114 LEU B CB    1 
ATOM   2729 C CG    . LEU B 1 72  ? 10.451  -15.248 23.462  1.00 35.13  ? 114 LEU B CG    1 
ATOM   2730 C CD1   . LEU B 1 72  ? 11.071  -13.900 23.661  1.00 26.58  ? 114 LEU B CD1   1 
ATOM   2731 C CD2   . LEU B 1 72  ? 9.717   -15.693 24.730  1.00 30.37  ? 114 LEU B CD2   1 
ATOM   2732 N N     . SER B 1 73  ? 8.051   -17.369 19.545  1.00 37.10  ? 115 SER B N     1 
ATOM   2733 C CA    . SER B 1 73  ? 7.188   -17.217 18.371  1.00 36.51  ? 115 SER B CA    1 
ATOM   2734 C C     . SER B 1 73  ? 5.707   -17.458 18.651  1.00 32.64  ? 115 SER B C     1 
ATOM   2735 O O     . SER B 1 73  ? 4.859   -17.022 17.872  1.00 31.92  ? 115 SER B O     1 
ATOM   2736 C CB    . SER B 1 73  ? 7.643   -18.159 17.257  1.00 41.00  ? 115 SER B CB    1 
ATOM   2737 O OG    . SER B 1 73  ? 7.388   -19.509 17.605  1.00 43.43  ? 115 SER B OG    1 
ATOM   2738 N N     . HIS B 1 74  ? 5.360   -18.140 19.722  1.00 34.41  ? 116 HIS B N     1 
ATOM   2739 C CA    . HIS B 1 74  ? 3.955   -18.334 20.048  1.00 37.21  ? 116 HIS B CA    1 
ATOM   2740 C C     . HIS B 1 74  ? 3.484   -17.167 20.914  1.00 38.32  ? 116 HIS B C     1 
ATOM   2741 O O     . HIS B 1 74  ? 3.928   -17.001 22.061  1.00 28.12  ? 116 HIS B O     1 
ATOM   2742 C CB    . HIS B 1 74  ? 3.758   -19.689 20.712  1.00 33.42  ? 116 HIS B CB    1 
ATOM   2743 C CG    . HIS B 1 74  ? 4.052   -20.824 19.791  1.00 36.22  ? 116 HIS B CG    1 
ATOM   2744 N ND1   . HIS B 1 74  ? 5.293   -21.426 19.725  1.00 31.45  ? 116 HIS B ND1   1 
ATOM   2745 C CD2   . HIS B 1 74  ? 3.281   -21.432 18.854  1.00 33.71  ? 116 HIS B CD2   1 
ATOM   2746 C CE1   . HIS B 1 74  ? 5.261   -22.387 18.815  1.00 34.02  ? 116 HIS B CE1   1 
ATOM   2747 N NE2   . HIS B 1 74  ? 4.054   -22.408 18.269  1.00 35.53  ? 116 HIS B NE2   1 
ATOM   2748 N N     . GLN B 1 75  ? 2.592   -16.349 20.354  1.00 36.61  ? 117 GLN B N     1 
ATOM   2749 C CA    . GLN B 1 75  ? 2.286   -15.034 20.899  1.00 36.03  ? 117 GLN B CA    1 
ATOM   2750 C C     . GLN B 1 75  ? 0.784   -14.889 21.073  1.00 39.19  ? 117 GLN B C     1 
ATOM   2751 O O     . GLN B 1 75  ? 0.014   -15.253 20.176  1.00 39.52  ? 117 GLN B O     1 
ATOM   2752 C CB    . GLN B 1 75  ? 2.832   -13.944 19.984  1.00 29.71  ? 117 GLN B CB    1 
ATOM   2753 C CG    . GLN B 1 75  ? 4.262   -14.217 19.545  1.00 30.50  ? 117 GLN B CG    1 
ATOM   2754 C CD    . GLN B 1 75  ? 4.891   -13.000 18.959  1.00 33.93  ? 117 GLN B CD    1 
ATOM   2755 O OE1   . GLN B 1 75  ? 4.207   -12.006 18.707  1.00 38.51  ? 117 GLN B OE1   1 
ATOM   2756 N NE2   . GLN B 1 75  ? 6.195   -13.053 18.737  1.00 33.86  ? 117 GLN B NE2   1 
ATOM   2757 N N     . TYR B 1 76  ? 0.378   -14.364 22.230  1.00 30.37  ? 118 TYR B N     1 
ATOM   2758 C CA    . TYR B 1 76  ? -1.024  -14.287 22.619  1.00 32.45  ? 118 TYR B CA    1 
ATOM   2759 C C     . TYR B 1 76  ? -1.256  -12.917 23.226  1.00 34.09  ? 118 TYR B C     1 
ATOM   2760 O O     . TYR B 1 76  ? -0.639  -12.576 24.237  1.00 40.20  ? 118 TYR B O     1 
ATOM   2761 C CB    . TYR B 1 76  ? -1.369  -15.405 23.618  1.00 37.49  ? 118 TYR B CB    1 
ATOM   2762 C CG    . TYR B 1 76  ? -0.898  -16.767 23.138  1.00 37.01  ? 118 TYR B CG    1 
ATOM   2763 C CD1   . TYR B 1 76  ? -1.683  -17.526 22.280  1.00 38.16  ? 118 TYR B CD1   1 
ATOM   2764 C CD2   . TYR B 1 76  ? 0.348   -17.274 23.502  1.00 34.92  ? 118 TYR B CD2   1 
ATOM   2765 C CE1   . TYR B 1 76  ? -1.254  -18.753 21.805  1.00 40.17  ? 118 TYR B CE1   1 
ATOM   2766 C CE2   . TYR B 1 76  ? 0.789   -18.517 23.035  1.00 33.41  ? 118 TYR B CE2   1 
ATOM   2767 C CZ    . TYR B 1 76  ? -0.019  -19.247 22.183  1.00 41.85  ? 118 TYR B CZ    1 
ATOM   2768 O OH    . TYR B 1 76  ? 0.378   -20.479 21.695  1.00 40.36  ? 118 TYR B OH    1 
ATOM   2769 N N     . TRP B 1 77  ? -2.131  -12.132 22.618  1.00 42.63  ? 119 TRP B N     1 
ATOM   2770 C CA    . TRP B 1 77  ? -2.395  -10.773 23.061  1.00 31.48  ? 119 TRP B CA    1 
ATOM   2771 C C     . TRP B 1 77  ? -3.859  -10.623 23.425  1.00 41.65  ? 119 TRP B C     1 
ATOM   2772 O O     . TRP B 1 77  ? -4.738  -11.275 22.846  1.00 39.44  ? 119 TRP B O     1 
ATOM   2773 C CB    . TRP B 1 77  ? -2.063  -9.767  22.006  1.00 31.41  ? 119 TRP B CB    1 
ATOM   2774 C CG    . TRP B 1 77  ? -0.752  -9.981  21.441  1.00 37.38  ? 119 TRP B CG    1 
ATOM   2775 C CD1   . TRP B 1 77  ? -0.430  -10.807 20.410  1.00 37.34  ? 119 TRP B CD1   1 
ATOM   2776 C CD2   . TRP B 1 77  ? 0.460   -9.374  21.869  1.00 38.46  ? 119 TRP B CD2   1 
ATOM   2777 N NE1   . TRP B 1 77  ? 0.918   -10.744 20.162  1.00 39.43  ? 119 TRP B NE1   1 
ATOM   2778 C CE2   . TRP B 1 77  ? 1.487   -9.867  21.045  1.00 39.16  ? 119 TRP B CE2   1 
ATOM   2779 C CE3   . TRP B 1 77  ? 0.778   -8.464  22.876  1.00 33.79  ? 119 TRP B CE3   1 
ATOM   2780 C CZ2   . TRP B 1 77  ? 2.806   -9.471  21.187  1.00 39.39  ? 119 TRP B CZ2   1 
ATOM   2781 C CZ3   . TRP B 1 77  ? 2.078   -8.070  23.014  1.00 35.61  ? 119 TRP B CZ3   1 
ATOM   2782 C CH2   . TRP B 1 77  ? 3.082   -8.570  22.175  1.00 40.15  ? 119 TRP B CH2   1 
ATOM   2783 N N     . SER B 1 78  ? -4.095  -9.733  24.384  1.00 43.36  ? 120 SER B N     1 
ATOM   2784 C CA    . SER B 1 78  ? -5.406  -9.519  24.971  1.00 35.73  ? 120 SER B CA    1 
ATOM   2785 C C     . SER B 1 78  ? -5.544  -8.025  25.177  1.00 37.42  ? 120 SER B C     1 
ATOM   2786 O O     . SER B 1 78  ? -4.826  -7.405  25.963  1.00 39.10  ? 120 SER B O     1 
ATOM   2787 C CB    . SER B 1 78  ? -5.543  -10.299 26.277  1.00 36.96  ? 120 SER B CB    1 
ATOM   2788 O OG    . SER B 1 78  ? -6.840  -10.172 26.821  1.00 38.89  ? 120 SER B OG    1 
ATOM   2789 N N     . ALA B 1 79  ? -6.424  -7.419  24.467  1.00 41.08  ? 121 ALA B N     1 
ATOM   2790 C CA    . ALA B 1 79  ? -6.667  -6.063  24.640  1.00 45.54  ? 121 ALA B CA    1 
ATOM   2791 C C     . ALA B 1 79  ? -7.999  -5.883  25.339  1.00 48.45  ? 121 ALA B C     1 
ATOM   2792 O O     . ALA B 1 79  ? -8.878  -6.747  25.247  1.00 47.02  ? 121 ALA B O     1 
ATOM   2793 C CB    . ALA B 1 79  ? -6.730  -5.367  23.276  1.00 41.79  ? 121 ALA B CB    1 
ATOM   2794 N N     . PRO B 1 80  ? -8.194  -4.776  26.042  1.00 46.80  ? 122 PRO B N     1 
ATOM   2795 C CA    . PRO B 1 80  ? -9.547  -4.411  26.448  1.00 52.39  ? 122 PRO B CA    1 
ATOM   2796 C C     . PRO B 1 80  ? -10.306 -3.947  25.223  1.00 59.01  ? 122 PRO B C     1 
ATOM   2797 O O     . PRO B 1 80  ? -9.738  -3.661  24.166  1.00 64.91  ? 122 PRO B O     1 
ATOM   2798 C CB    . PRO B 1 80  ? -9.339  -3.283  27.461  1.00 53.44  ? 122 PRO B CB    1 
ATOM   2799 C CG    . PRO B 1 80  ? -8.065  -2.630  27.021  1.00 55.48  ? 122 PRO B CG    1 
ATOM   2800 C CD    . PRO B 1 80  ? -7.216  -3.716  26.364  1.00 51.36  ? 122 PRO B CD    1 
ATOM   2801 N N     . SER B 1 81  ? -11.619 -3.892  25.358  1.00 55.64  ? 123 SER B N     1 
ATOM   2802 C CA    . SER B 1 81  ? -12.390 -3.596  24.167  1.00 68.31  ? 123 SER B CA    1 
ATOM   2803 C C     . SER B 1 81  ? -12.768 -2.127  24.142  1.00 71.70  ? 123 SER B C     1 
ATOM   2804 O O     . SER B 1 81  ? -12.077 -1.318  23.506  1.00 67.25  ? 123 SER B O     1 
ATOM   2805 C CB    . SER B 1 81  ? -13.620 -4.497  24.104  1.00 68.34  ? 123 SER B CB    1 
ATOM   2806 O OG    . SER B 1 81  ? -13.236 -5.852  23.953  1.00 59.41  ? 123 SER B OG    1 
ATOM   2807 N N     . ASP B 1 82  ? -13.858 -1.784  24.835  1.00 60.24  ? 124 ASP B N     1 
ATOM   2808 C CA    . ASP B 1 82  ? -14.250 -0.386  24.962  1.00 62.78  ? 124 ASP B CA    1 
ATOM   2809 C C     . ASP B 1 82  ? -13.094 0.496   25.438  1.00 69.65  ? 124 ASP B C     1 
ATOM   2810 O O     . ASP B 1 82  ? -12.949 1.641   24.990  1.00 63.46  ? 124 ASP B O     1 
ATOM   2811 C CB    . ASP B 1 82  ? -15.419 -0.271  25.942  1.00 62.70  ? 124 ASP B CB    1 
ATOM   2812 N N     . LYS B 1 83  ? -12.234 -0.042  26.313  1.00 70.09  ? 125 LYS B N     1 
ATOM   2813 C CA    . LYS B 1 83  ? -11.062 0.671   26.813  1.00 66.25  ? 125 LYS B CA    1 
ATOM   2814 C C     . LYS B 1 83  ? -10.122 0.835   25.619  1.00 66.04  ? 125 LYS B C     1 
ATOM   2815 O O     . LYS B 1 83  ? -9.325  -0.059  25.302  1.00 66.95  ? 125 LYS B O     1 
ATOM   2816 C CB    . LYS B 1 83  ? -10.423 -0.124  27.952  1.00 64.56  ? 125 LYS B CB    1 
ATOM   2817 N N     . GLU B 1 84  ? -10.195 1.988   24.964  1.00 59.91  ? 126 GLU B N     1 
ATOM   2818 C CA    . GLU B 1 84  ? -9.527  2.177   23.684  1.00 68.94  ? 126 GLU B CA    1 
ATOM   2819 C C     . GLU B 1 84  ? -8.082  2.573   23.985  1.00 75.26  ? 126 GLU B C     1 
ATOM   2820 O O     . GLU B 1 84  ? -7.837  3.535   24.723  1.00 83.32  ? 126 GLU B O     1 
ATOM   2821 C CB    . GLU B 1 84  ? -10.226 3.243   22.839  1.00 69.24  ? 126 GLU B CB    1 
ATOM   2822 N N     . GLY B 1 85  ? -7.130  1.822   23.426  1.00 66.75  ? 127 GLY B N     1 
ATOM   2823 C CA    . GLY B 1 85  ? -5.703  2.132   23.551  1.00 56.56  ? 127 GLY B CA    1 
ATOM   2824 C C     . GLY B 1 85  ? -5.173  2.281   24.964  1.00 66.46  ? 127 GLY B C     1 
ATOM   2825 O O     . GLY B 1 85  ? -4.321  3.142   25.215  1.00 58.84  ? 127 GLY B O     1 
ATOM   2826 N N     . TYR B 1 86  ? -5.642  1.425   25.864  1.00 74.26  ? 128 TYR B N     1 
ATOM   2827 C CA    . TYR B 1 86  ? -5.266  1.387   27.271  1.00 55.70  ? 128 TYR B CA    1 
ATOM   2828 C C     . TYR B 1 86  ? -5.122  -0.093  27.752  1.00 53.65  ? 128 TYR B C     1 
ATOM   2829 O O     . TYR B 1 86  ? -5.457  -0.995  27.033  1.00 56.12  ? 128 TYR B O     1 
ATOM   2830 C CB    . TYR B 1 86  ? -6.313  2.217   27.988  1.00 52.10  ? 128 TYR B CB    1 
ATOM   2831 C CG    . TYR B 1 86  ? -6.825  1.730   29.271  1.00 52.24  ? 128 TYR B CG    1 
ATOM   2832 C CD1   . TYR B 1 86  ? -6.239  2.110   30.439  1.00 59.59  ? 128 TYR B CD1   1 
ATOM   2833 C CD2   . TYR B 1 86  ? -7.940  0.951   29.322  1.00 55.41  ? 128 TYR B CD2   1 
ATOM   2834 C CE1   . TYR B 1 86  ? -6.730  1.683   31.638  1.00 63.77  ? 128 TYR B CE1   1 
ATOM   2835 C CE2   . TYR B 1 86  ? -8.438  0.505   30.517  1.00 74.04  ? 128 TYR B CE2   1 
ATOM   2836 C CZ    . TYR B 1 86  ? -7.827  0.876   31.668  1.00 67.78  ? 128 TYR B CZ    1 
ATOM   2837 O OH    . TYR B 1 86  ? -8.312  0.437   32.849  1.00 64.93  ? 128 TYR B OH    1 
ATOM   2838 N N     . SER B 1 87  ? -4.597  -0.335  28.935  1.00 45.19  ? 129 SER B N     1 
ATOM   2839 C CA    . SER B 1 87  ? -4.361  -1.676  29.497  1.00 47.29  ? 129 SER B CA    1 
ATOM   2840 C C     . SER B 1 87  ? -3.643  -2.597  28.494  1.00 46.95  ? 129 SER B C     1 
ATOM   2841 O O     . SER B 1 87  ? -2.794  -2.134  27.723  1.00 44.68  ? 129 SER B O     1 
ATOM   2842 C CB    . SER B 1 87  ? -5.687  -2.220  30.008  1.00 42.36  ? 129 SER B CB    1 
ATOM   2843 O OG    . SER B 1 87  ? -5.506  -3.460  30.670  1.00 40.58  ? 129 SER B OG    1 
ATOM   2844 N N     . GLY B 1 88  ? -3.958  -3.901  28.511  1.00 40.10  ? 130 GLY B N     1 
ATOM   2845 C CA    . GLY B 1 88  ? -3.424  -4.878  27.575  1.00 31.12  ? 130 GLY B CA    1 
ATOM   2846 C C     . GLY B 1 88  ? -2.273  -5.709  28.103  1.00 28.65  ? 130 GLY B C     1 
ATOM   2847 O O     . GLY B 1 88  ? -1.353  -5.163  28.715  1.00 31.29  ? 130 GLY B O     1 
ATOM   2848 N N     . VAL B 1 89  ? -2.307  -7.029  27.879  1.00 28.42  ? 131 VAL B N     1 
ATOM   2849 C CA    . VAL B 1 89  ? -1.223  -7.933  28.251  1.00 25.94  ? 131 VAL B CA    1 
ATOM   2850 C C     . VAL B 1 89  ? -0.883  -8.818  27.056  1.00 31.77  ? 131 VAL B C     1 
ATOM   2851 O O     . VAL B 1 89  ? -1.655  -8.952  26.101  1.00 38.20  ? 131 VAL B O     1 
ATOM   2852 C CB    . VAL B 1 89  ? -1.571  -8.819  29.485  1.00 29.38  ? 131 VAL B CB    1 
ATOM   2853 C CG1   . VAL B 1 89  ? -1.618  -7.979  30.759  1.00 29.21  ? 131 VAL B CG1   1 
ATOM   2854 C CG2   . VAL B 1 89  ? -2.906  -9.532  29.286  1.00 31.62  ? 131 VAL B CG2   1 
ATOM   2855 N N     . GLY B 1 90  ? 0.280   -9.441  27.127  1.00 28.63  ? 132 GLY B N     1 
ATOM   2856 C CA    . GLY B 1 90  ? 0.701   -10.360 26.088  1.00 27.98  ? 132 GLY B CA    1 
ATOM   2857 C C     . GLY B 1 90  ? 1.605   -11.426 26.657  1.00 35.86  ? 132 GLY B C     1 
ATOM   2858 O O     . GLY B 1 90  ? 2.357   -11.183 27.606  1.00 30.73  ? 132 GLY B O     1 
ATOM   2859 N N     . LEU B 1 91  ? 1.532   -12.622 26.065  1.00 36.26  ? 133 LEU B N     1 
ATOM   2860 C CA    . LEU B 1 91  ? 2.398   -13.731 26.443  1.00 34.98  ? 133 LEU B CA    1 
ATOM   2861 C C     . LEU B 1 91  ? 3.073   -14.312 25.203  1.00 33.95  ? 133 LEU B C     1 
ATOM   2862 O O     . LEU B 1 91  ? 2.402   -14.837 24.306  1.00 37.32  ? 133 LEU B O     1 
ATOM   2863 C CB    . LEU B 1 91  ? 1.612   -14.806 27.200  1.00 36.83  ? 133 LEU B CB    1 
ATOM   2864 C CG    . LEU B 1 91  ? 2.400   -15.943 27.870  1.00 40.14  ? 133 LEU B CG    1 
ATOM   2865 C CD1   . LEU B 1 91  ? 1.701   -16.393 29.149  1.00 45.51  ? 133 LEU B CD1   1 
ATOM   2866 C CD2   . LEU B 1 91  ? 2.565   -17.132 26.926  1.00 30.56  ? 133 LEU B CD2   1 
ATOM   2867 N N     . LEU B 1 92  ? 4.402   -14.240 25.180  1.00 34.90  ? 134 LEU B N     1 
ATOM   2868 C CA    . LEU B 1 92  ? 5.247   -14.771 24.122  1.00 33.48  ? 134 LEU B CA    1 
ATOM   2869 C C     . LEU B 1 92  ? 6.051   -15.940 24.681  1.00 34.75  ? 134 LEU B C     1 
ATOM   2870 O O     . LEU B 1 92  ? 6.648   -15.826 25.755  1.00 36.20  ? 134 LEU B O     1 
ATOM   2871 C CB    . LEU B 1 92  ? 6.188   -13.687 23.574  1.00 27.61  ? 134 LEU B CB    1 
ATOM   2872 C CG    . LEU B 1 92  ? 5.567   -12.408 23.004  1.00 27.72  ? 134 LEU B CG    1 
ATOM   2873 C CD1   . LEU B 1 92  ? 5.464   -11.347 24.052  1.00 32.08  ? 134 LEU B CD1   1 
ATOM   2874 C CD2   . LEU B 1 92  ? 6.336   -11.860 21.811  1.00 34.90  ? 134 LEU B CD2   1 
ATOM   2875 N N     . SER B 1 93  ? 6.077   -17.053 23.946  1.00 34.00  ? 135 SER B N     1 
ATOM   2876 C CA    . SER B 1 93  ? 6.683   -18.285 24.425  1.00 33.82  ? 135 SER B CA    1 
ATOM   2877 C C     . SER B 1 93  ? 7.332   -19.050 23.276  1.00 37.09  ? 135 SER B C     1 
ATOM   2878 O O     . SER B 1 93  ? 6.768   -19.166 22.181  1.00 32.62  ? 135 SER B O     1 
ATOM   2879 C CB    . SER B 1 93  ? 5.649   -19.192 25.105  1.00 32.08  ? 135 SER B CB    1 
ATOM   2880 O OG    . SER B 1 93  ? 6.280   -20.346 25.659  1.00 35.04  ? 135 SER B OG    1 
ATOM   2881 N N     . ARG B 1 94  ? 8.518   -19.585 23.558  1.00 35.13  ? 136 ARG B N     1 
ATOM   2882 C CA    . ARG B 1 94  ? 9.186   -20.502 22.647  1.00 37.11  ? 136 ARG B CA    1 
ATOM   2883 C C     . ARG B 1 94  ? 8.280   -21.668 22.276  1.00 41.16  ? 136 ARG B C     1 
ATOM   2884 O O     . ARG B 1 94  ? 7.974   -21.890 21.095  1.00 36.46  ? 136 ARG B O     1 
ATOM   2885 C CB    . ARG B 1 94  ? 10.466  -21.006 23.300  1.00 34.12  ? 136 ARG B CB    1 
ATOM   2886 C CG    . ARG B 1 94  ? 11.203  -21.942 22.457  1.00 37.53  ? 136 ARG B CG    1 
ATOM   2887 C CD    . ARG B 1 94  ? 12.652  -21.619 22.539  1.00 45.46  ? 136 ARG B CD    1 
ATOM   2888 N NE    . ARG B 1 94  ? 13.189  -21.975 23.841  1.00 55.14  ? 136 ARG B NE    1 
ATOM   2889 C CZ    . ARG B 1 94  ? 13.787  -23.131 24.086  1.00 67.09  ? 136 ARG B CZ    1 
ATOM   2890 N NH1   . ARG B 1 94  ? 13.900  -24.027 23.105  1.00 66.20  ? 136 ARG B NH1   1 
ATOM   2891 N NH2   . ARG B 1 94  ? 14.265  -23.388 25.301  1.00 64.46  ? 136 ARG B NH2   1 
ATOM   2892 N N     . GLN B 1 95  ? 7.849   -22.425 23.282  1.00 32.98  ? 137 GLN B N     1 
ATOM   2893 C CA    . GLN B 1 95  ? 6.923   -23.527 23.090  1.00 32.11  ? 137 GLN B CA    1 
ATOM   2894 C C     . GLN B 1 95  ? 5.477   -23.048 23.146  1.00 36.19  ? 137 GLN B C     1 
ATOM   2895 O O     . GLN B 1 95  ? 5.144   -22.094 23.849  1.00 40.57  ? 137 GLN B O     1 
ATOM   2896 C CB    . GLN B 1 95  ? 7.144   -24.584 24.157  1.00 34.21  ? 137 GLN B CB    1 
ATOM   2897 C CG    . GLN B 1 95  ? 8.470   -25.252 24.056  1.00 33.42  ? 137 GLN B CG    1 
ATOM   2898 C CD    . GLN B 1 95  ? 8.429   -26.574 24.744  1.00 42.31  ? 137 GLN B CD    1 
ATOM   2899 O OE1   . GLN B 1 95  ? 7.548   -26.811 25.579  1.00 46.90  ? 137 GLN B OE1   1 
ATOM   2900 N NE2   . GLN B 1 95  ? 9.355   -27.469 24.387  1.00 44.45  ? 137 GLN B NE2   1 
ATOM   2901 N N     . ALA B 1 96  ? 4.615   -23.712 22.397  1.00 33.92  ? 138 ALA B N     1 
ATOM   2902 C CA    . ALA B 1 96  ? 3.206   -23.398 22.514  1.00 34.81  ? 138 ALA B CA    1 
ATOM   2903 C C     . ALA B 1 96  ? 2.679   -23.909 23.848  1.00 34.27  ? 138 ALA B C     1 
ATOM   2904 O O     . ALA B 1 96  ? 3.014   -25.014 24.267  1.00 34.48  ? 138 ALA B O     1 
ATOM   2905 C CB    . ALA B 1 96  ? 2.397   -24.020 21.382  1.00 30.97  ? 138 ALA B CB    1 
ATOM   2906 N N     . PRO B 1 97  ? 1.847   -23.142 24.528  1.00 43.27  ? 139 PRO B N     1 
ATOM   2907 C CA    . PRO B 1 97  ? 1.115   -23.705 25.668  1.00 44.69  ? 139 PRO B CA    1 
ATOM   2908 C C     . PRO B 1 97  ? 0.109   -24.734 25.177  1.00 43.14  ? 139 PRO B C     1 
ATOM   2909 O O     . PRO B 1 97  ? -0.315  -24.729 24.016  1.00 39.04  ? 139 PRO B O     1 
ATOM   2910 C CB    . PRO B 1 97  ? 0.412   -22.492 26.297  1.00 43.03  ? 139 PRO B CB    1 
ATOM   2911 C CG    . PRO B 1 97  ? 1.019   -21.253 25.604  1.00 43.89  ? 139 PRO B CG    1 
ATOM   2912 C CD    . PRO B 1 97  ? 1.526   -21.726 24.275  1.00 35.43  ? 139 PRO B CD    1 
ATOM   2913 N N     . LEU B 1 98  ? -0.267  -25.644 26.079  1.00 38.44  ? 140 LEU B N     1 
ATOM   2914 C CA    . LEU B 1 98  ? -1.355  -26.560 25.747  1.00 41.36  ? 140 LEU B CA    1 
ATOM   2915 C C     . LEU B 1 98  ? -2.669  -25.808 25.630  1.00 37.05  ? 140 LEU B C     1 
ATOM   2916 O O     . LEU B 1 98  ? -3.434  -26.029 24.693  1.00 39.92  ? 140 LEU B O     1 
ATOM   2917 C CB    . LEU B 1 98  ? -1.471  -27.678 26.781  1.00 45.34  ? 140 LEU B CB    1 
ATOM   2918 C CG    . LEU B 1 98  ? -0.229  -28.350 27.369  1.00 45.94  ? 140 LEU B CG    1 
ATOM   2919 C CD1   . LEU B 1 98  ? -0.628  -29.241 28.534  1.00 58.04  ? 140 LEU B CD1   1 
ATOM   2920 C CD2   . LEU B 1 98  ? 0.600   -29.061 26.282  1.00 54.05  ? 140 LEU B CD2   1 
ATOM   2921 N N     . LYS B 1 99  ? -2.931  -24.893 26.553  1.00 45.35  ? 141 LYS B N     1 
ATOM   2922 C CA    . LYS B 1 99  ? -4.180  -24.150 26.610  1.00 41.79  ? 141 LYS B CA    1 
ATOM   2923 C C     . LYS B 1 99  ? -3.866  -22.669 26.752  1.00 40.50  ? 141 LYS B C     1 
ATOM   2924 O O     . LYS B 1 99  ? -2.901  -22.297 27.421  1.00 41.09  ? 141 LYS B O     1 
ATOM   2925 C CB    . LYS B 1 99  ? -5.023  -24.601 27.808  1.00 44.59  ? 141 LYS B CB    1 
ATOM   2926 C CG    . LYS B 1 99  ? -5.504  -26.038 27.760  1.00 59.26  ? 141 LYS B CG    1 
ATOM   2927 C CD    . LYS B 1 99  ? -6.823  -26.212 28.516  1.00 63.31  ? 141 LYS B CD    1 
ATOM   2928 C CE    . LYS B 1 99  ? -7.205  -27.684 28.651  1.00 57.63  ? 141 LYS B CE    1 
ATOM   2929 N NZ    . LYS B 1 99  ? -7.280  -28.112 30.081  1.00 58.56  ? 141 LYS B NZ    1 
ATOM   2930 N N     . VAL B 1 100 ? -4.691  -21.822 26.151  1.00 39.00  ? 142 VAL B N     1 
ATOM   2931 C CA    . VAL B 1 100 ? -4.595  -20.380 26.365  1.00 36.42  ? 142 VAL B CA    1 
ATOM   2932 C C     . VAL B 1 100 ? -6.004  -19.842 26.553  1.00 29.98  ? 142 VAL B C     1 
ATOM   2933 O O     . VAL B 1 100 ? -6.905  -20.193 25.791  1.00 26.06  ? 142 VAL B O     1 
ATOM   2934 C CB    . VAL B 1 100 ? -3.893  -19.654 25.194  1.00 37.07  ? 142 VAL B CB    1 
ATOM   2935 C CG1   . VAL B 1 100 ? -4.071  -18.155 25.333  1.00 34.45  ? 142 VAL B CG1   1 
ATOM   2936 C CG2   . VAL B 1 100 ? -2.406  -20.025 25.115  1.00 29.91  ? 142 VAL B CG2   1 
ATOM   2937 N N     . SER B 1 101 ? -6.205  -19.004 27.568  1.00 38.58  ? 143 SER B N     1 
ATOM   2938 C CA    . SER B 1 101 ? -7.495  -18.349 27.753  1.00 39.07  ? 143 SER B CA    1 
ATOM   2939 C C     . SER B 1 101 ? -7.265  -16.953 28.321  1.00 34.81  ? 143 SER B C     1 
ATOM   2940 O O     . SER B 1 101 ? -6.156  -16.600 28.728  1.00 36.52  ? 143 SER B O     1 
ATOM   2941 C CB    . SER B 1 101 ? -8.427  -19.174 28.649  1.00 27.56  ? 143 SER B CB    1 
ATOM   2942 O OG    . SER B 1 101 ? -7.783  -19.540 29.849  1.00 32.80  ? 143 SER B OG    1 
ATOM   2943 N N     . TYR B 1 102 ? -8.336  -16.158 28.348  1.00 39.86  ? 144 TYR B N     1 
ATOM   2944 C CA    . TYR B 1 102 ? -8.253  -14.725 28.628  1.00 38.90  ? 144 TYR B CA    1 
ATOM   2945 C C     . TYR B 1 102 ? -9.279  -14.324 29.678  1.00 32.90  ? 144 TYR B C     1 
ATOM   2946 O O     . TYR B 1 102 ? -10.475 -14.542 29.490  1.00 39.66  ? 144 TYR B O     1 
ATOM   2947 C CB    . TYR B 1 102 ? -8.465  -13.918 27.344  1.00 36.30  ? 144 TYR B CB    1 
ATOM   2948 C CG    . TYR B 1 102 ? -7.546  -14.357 26.242  1.00 33.91  ? 144 TYR B CG    1 
ATOM   2949 C CD1   . TYR B 1 102 ? -7.958  -15.282 25.289  1.00 32.73  ? 144 TYR B CD1   1 
ATOM   2950 C CD2   . TYR B 1 102 ? -6.250  -13.872 26.170  1.00 42.22  ? 144 TYR B CD2   1 
ATOM   2951 C CE1   . TYR B 1 102 ? -7.100  -15.698 24.282  1.00 42.10  ? 144 TYR B CE1   1 
ATOM   2952 C CE2   . TYR B 1 102 ? -5.384  -14.283 25.153  1.00 44.03  ? 144 TYR B CE2   1 
ATOM   2953 C CZ    . TYR B 1 102 ? -5.813  -15.192 24.227  1.00 38.90  ? 144 TYR B CZ    1 
ATOM   2954 O OH    . TYR B 1 102 ? -4.946  -15.582 23.249  1.00 46.22  ? 144 TYR B OH    1 
ATOM   2955 N N     . GLY B 1 103 ? -8.819  -13.719 30.764  1.00 34.70  ? 145 GLY B N     1 
ATOM   2956 C CA    . GLY B 1 103 ? -9.720  -13.111 31.718  1.00 40.10  ? 145 GLY B CA    1 
ATOM   2957 C C     . GLY B 1 103 ? -10.122 -14.047 32.841  1.00 49.01  ? 145 GLY B C     1 
ATOM   2958 O O     . GLY B 1 103 ? -9.403  -14.977 33.212  1.00 45.05  ? 145 GLY B O     1 
ATOM   2959 N N     . ILE B 1 104 ? -11.308 -13.777 33.398  1.00 63.04  ? 146 ILE B N     1 
ATOM   2960 C CA    . ILE B 1 104 ? -11.881 -14.574 34.487  1.00 60.86  ? 146 ILE B CA    1 
ATOM   2961 C C     . ILE B 1 104 ? -13.289 -15.017 34.084  1.00 63.55  ? 146 ILE B C     1 
ATOM   2962 O O     . ILE B 1 104 ? -14.213 -15.072 34.913  1.00 53.73  ? 146 ILE B O     1 
ATOM   2963 C CB    . ILE B 1 104 ? -11.900 -13.796 35.812  1.00 51.96  ? 146 ILE B CB    1 
ATOM   2964 C CG1   . ILE B 1 104 ? -10.571 -13.049 36.060  1.00 50.28  ? 146 ILE B CG1   1 
ATOM   2965 C CG2   . ILE B 1 104 ? -12.182 -14.726 36.962  1.00 53.81  ? 146 ILE B CG2   1 
ATOM   2966 C CD1   . ILE B 1 104 ? -9.315  -13.917 36.061  1.00 48.03  ? 146 ILE B CD1   1 
ATOM   2967 N N     . GLY B 1 105 ? -13.460 -15.323 32.792  1.00 73.57  ? 147 GLY B N     1 
ATOM   2968 C CA    . GLY B 1 105 ? -14.696 -15.897 32.277  1.00 83.07  ? 147 GLY B CA    1 
ATOM   2969 C C     . GLY B 1 105 ? -15.832 -14.917 32.026  1.00 84.34  ? 147 GLY B C     1 
ATOM   2970 O O     . GLY B 1 105 ? -16.462 -14.953 30.957  1.00 71.09  ? 147 GLY B O     1 
ATOM   2971 N N     . ASP B 1 106 ? -16.053 -14.006 32.987  1.00 71.99  ? 148 ASP B N     1 
ATOM   2972 C CA    . ASP B 1 106 ? -17.264 -13.179 33.093  1.00 69.12  ? 148 ASP B CA    1 
ATOM   2973 C C     . ASP B 1 106 ? -17.190 -11.900 32.251  1.00 64.39  ? 148 ASP B C     1 
ATOM   2974 O O     . ASP B 1 106 ? -17.349 -10.784 32.742  1.00 59.44  ? 148 ASP B O     1 
ATOM   2975 C CB    . ASP B 1 106 ? -17.481 -12.825 34.556  1.00 72.88  ? 148 ASP B CB    1 
ATOM   2976 C CG    . ASP B 1 106 ? -16.173 -12.434 35.243  1.00 72.90  ? 148 ASP B CG    1 
ATOM   2977 O OD1   . ASP B 1 106 ? -15.121 -12.723 34.647  1.00 61.55  ? 148 ASP B OD1   1 
ATOM   2978 O OD2   . ASP B 1 106 ? -16.181 -11.839 36.348  1.00 71.21  ? 148 ASP B OD2   1 
ATOM   2979 N N     . GLU B 1 107 ? -16.826 -12.068 31.004  1.00 65.73  ? 149 GLU B N     1 
ATOM   2980 C CA    . GLU B 1 107 ? -16.626 -10.951 30.139  1.00 61.97  ? 149 GLU B CA    1 
ATOM   2981 C C     . GLU B 1 107 ? -17.490 -11.112 28.939  1.00 59.22  ? 149 GLU B C     1 
ATOM   2982 O O     . GLU B 1 107 ? -17.022 -11.239 27.825  1.00 68.47  ? 149 GLU B O     1 
ATOM   2983 C CB    . GLU B 1 107 ? -15.157 -10.903 29.748  1.00 63.88  ? 149 GLU B CB    1 
ATOM   2984 N N     . GLU B 1 108 ? -18.782 -11.109 29.181  1.00 56.38  ? 150 GLU B N     1 
ATOM   2985 C CA    . GLU B 1 108 ? -19.737 -11.289 28.118  1.00 51.83  ? 150 GLU B CA    1 
ATOM   2986 C C     . GLU B 1 108 ? -20.115 -9.981  27.511  1.00 47.97  ? 150 GLU B C     1 
ATOM   2987 O O     . GLU B 1 108 ? -20.461 -9.926  26.362  1.00 39.74  ? 150 GLU B O     1 
ATOM   2988 C CB    . GLU B 1 108 ? -20.970 -12.049 28.613  1.00 46.42  ? 150 GLU B CB    1 
ATOM   2989 N N     . HIS B 1 109 ? -20.040 -8.924  28.285  1.00 30.00  ? 151 HIS B N     1 
ATOM   2990 C CA    . HIS B 1 109 ? -20.367 -7.628  27.779  1.00 30.00  ? 151 HIS B CA    1 
ATOM   2991 C C     . HIS B 1 109 ? -19.167 -6.736  27.884  1.00 30.00  ? 151 HIS B C     1 
ATOM   2992 O O     . HIS B 1 109 ? -19.284 -5.536  27.745  1.00 30.00  ? 151 HIS B O     1 
ATOM   2993 C CB    . HIS B 1 109 ? -21.452 -7.017  28.625  1.00 30.00  ? 151 HIS B CB    1 
ATOM   2994 C CG    . HIS B 1 109 ? -22.623 -7.919  28.859  1.00 30.00  ? 151 HIS B CG    1 
ATOM   2995 N ND1   . HIS B 1 109 ? -23.594 -8.145  27.906  1.00 30.00  ? 151 HIS B ND1   1 
ATOM   2996 C CD2   . HIS B 1 109 ? -22.979 -8.642  29.941  1.00 30.00  ? 151 HIS B CD2   1 
ATOM   2997 C CE1   . HIS B 1 109 ? -24.486 -8.976  28.394  1.00 30.00  ? 151 HIS B CE1   1 
ATOM   2998 N NE2   . HIS B 1 109 ? -24.138 -9.290  29.623  1.00 30.00  ? 151 HIS B NE2   1 
ATOM   2999 N N     . ASP B 1 110 ? -18.004 -7.308  28.151  1.00 30.00  ? 152 ASP B N     1 
ATOM   3000 C CA    . ASP B 1 110 ? -16.821 -6.507  28.313  1.00 30.00  ? 152 ASP B CA    1 
ATOM   3001 C C     . ASP B 1 110 ? -15.603 -7.330  28.586  1.00 30.00  ? 152 ASP B C     1 
ATOM   3002 O O     . ASP B 1 110 ? -15.678 -8.299  29.277  1.00 30.00  ? 152 ASP B O     1 
ATOM   3003 C CB    . ASP B 1 110 ? -17.035 -5.582  29.490  1.00 30.00  ? 152 ASP B CB    1 
ATOM   3004 N N     . GLN B 1 111 ? -14.472 -6.922  28.047  1.00 68.81  ? 153 GLN B N     1 
ATOM   3005 C CA    . GLN B 1 111 ? -13.216 -7.617  28.274  1.00 66.90  ? 153 GLN B CA    1 
ATOM   3006 C C     . GLN B 1 111 ? -12.174 -6.595  28.694  1.00 63.24  ? 153 GLN B C     1 
ATOM   3007 O O     . GLN B 1 111 ? -11.924 -5.644  27.994  1.00 62.52  ? 153 GLN B O     1 
ATOM   3008 C CB    . GLN B 1 111 ? -12.762 -8.350  27.019  1.00 30.00  ? 153 GLN B CB    1 
ATOM   3009 N N     . GLU B 1 112 ? -11.586 -6.805  29.854  1.00 57.14  ? 154 GLU B N     1 
ATOM   3010 C CA    . GLU B 1 112 ? -10.576 -5.920  30.429  1.00 48.87  ? 154 GLU B CA    1 
ATOM   3011 C C     . GLU B 1 112 ? -9.143  -5.976  29.887  1.00 46.94  ? 154 GLU B C     1 
ATOM   3012 O O     . GLU B 1 112 ? -8.398  -5.048  30.041  1.00 40.94  ? 154 GLU B O     1 
ATOM   3013 C CB    . GLU B 1 112 ? -10.514 -6.177  31.921  1.00 39.44  ? 154 GLU B CB    1 
ATOM   3014 N N     . GLY B 1 113 ? -8.761  -7.075  29.278  1.00 41.94  ? 155 GLY B N     1 
ATOM   3015 C CA    . GLY B 1 113 ? -7.415  -7.251  28.750  1.00 38.55  ? 155 GLY B CA    1 
ATOM   3016 C C     . GLY B 1 113 ? -6.300  -7.260  29.781  1.00 34.45  ? 155 GLY B C     1 
ATOM   3017 O O     . GLY B 1 113 ? -5.220  -6.716  29.526  1.00 37.39  ? 155 GLY B O     1 
ATOM   3018 N N     . ARG B 1 114 ? -6.514  -7.904  30.926  1.00 35.38  ? 156 ARG B N     1 
ATOM   3019 C CA    . ARG B 1 114 ? -5.552  -7.843  32.018  1.00 35.29  ? 156 ARG B CA    1 
ATOM   3020 C C     . ARG B 1 114 ? -4.898  -9.166  32.344  1.00 33.03  ? 156 ARG B C     1 
ATOM   3021 O O     . ARG B 1 114 ? -3.892  -9.176  33.065  1.00 29.59  ? 156 ARG B O     1 
ATOM   3022 C CB    . ARG B 1 114 ? -6.211  -7.322  33.298  1.00 31.63  ? 156 ARG B CB    1 
ATOM   3023 C CG    . ARG B 1 114 ? -6.770  -5.931  33.176  1.00 34.90  ? 156 ARG B CG    1 
ATOM   3024 C CD    . ARG B 1 114 ? -7.096  -5.316  34.537  1.00 39.15  ? 156 ARG B CD    1 
ATOM   3025 N NE    . ARG B 1 114 ? -7.372  -3.895  34.367  1.00 38.53  ? 156 ARG B NE    1 
ATOM   3026 C CZ    . ARG B 1 114 ? -6.436  -2.959  34.413  1.00 37.69  ? 156 ARG B CZ    1 
ATOM   3027 N NH1   . ARG B 1 114 ? -5.180  -3.303  34.664  1.00 37.96  ? 156 ARG B NH1   1 
ATOM   3028 N NH2   . ARG B 1 114 ? -6.754  -1.688  34.219  1.00 44.24  ? 156 ARG B NH2   1 
ATOM   3029 N N     . VAL B 1 115 ? -5.429  -10.277 31.848  1.00 33.35  ? 157 VAL B N     1 
ATOM   3030 C CA    . VAL B 1 115 ? -5.011  -11.585 32.329  1.00 35.85  ? 157 VAL B CA    1 
ATOM   3031 C C     . VAL B 1 115 ? -4.906  -12.554 31.163  1.00 33.93  ? 157 VAL B C     1 
ATOM   3032 O O     . VAL B 1 115 ? -5.826  -12.662 30.346  1.00 37.00  ? 157 VAL B O     1 
ATOM   3033 C CB    . VAL B 1 115 ? -5.973  -12.127 33.407  1.00 35.45  ? 157 VAL B CB    1 
ATOM   3034 C CG1   . VAL B 1 115 ? -5.709  -13.594 33.648  1.00 33.64  ? 157 VAL B CG1   1 
ATOM   3035 C CG2   . VAL B 1 115 ? -5.793  -11.357 34.715  1.00 33.95  ? 157 VAL B CG2   1 
ATOM   3036 N N     . ILE B 1 116 ? -3.783  -13.260 31.087  1.00 31.61  ? 158 ILE B N     1 
ATOM   3037 C CA    . ILE B 1 116 ? -3.657  -14.426 30.230  1.00 35.53  ? 158 ILE B CA    1 
ATOM   3038 C C     . ILE B 1 116 ? -3.330  -15.634 31.098  1.00 37.68  ? 158 ILE B C     1 
ATOM   3039 O O     . ILE B 1 116 ? -2.428  -15.575 31.949  1.00 32.14  ? 158 ILE B O     1 
ATOM   3040 C CB    . ILE B 1 116 ? -2.582  -14.233 29.151  1.00 33.82  ? 158 ILE B CB    1 
ATOM   3041 C CG1   . ILE B 1 116 ? -2.923  -13.026 28.286  1.00 33.61  ? 158 ILE B CG1   1 
ATOM   3042 C CG2   . ILE B 1 116 ? -2.470  -15.512 28.316  1.00 37.07  ? 158 ILE B CG2   1 
ATOM   3043 C CD1   . ILE B 1 116 ? -1.984  -12.829 27.080  1.00 33.66  ? 158 ILE B CD1   1 
ATOM   3044 N N     . VAL B 1 117 ? -4.055  -16.728 30.871  1.00 42.56  ? 159 VAL B N     1 
ATOM   3045 C CA    . VAL B 1 117 ? -3.789  -18.018 31.502  1.00 40.93  ? 159 VAL B CA    1 
ATOM   3046 C C     . VAL B 1 117 ? -3.217  -18.976 30.457  1.00 37.20  ? 159 VAL B C     1 
ATOM   3047 O O     . VAL B 1 117 ? -3.833  -19.222 29.413  1.00 33.79  ? 159 VAL B O     1 
ATOM   3048 C CB    . VAL B 1 117 ? -5.057  -18.584 32.157  1.00 39.77  ? 159 VAL B CB    1 
ATOM   3049 C CG1   . VAL B 1 117 ? -4.704  -19.743 33.053  1.00 43.17  ? 159 VAL B CG1   1 
ATOM   3050 C CG2   . VAL B 1 117 ? -5.710  -17.505 32.968  1.00 43.65  ? 159 VAL B CG2   1 
ATOM   3051 N N     . ALA B 1 118 ? -2.036  -19.512 30.749  1.00 40.73  ? 160 ALA B N     1 
ATOM   3052 C CA    . ALA B 1 118 ? -1.282  -20.372 29.844  1.00 42.12  ? 160 ALA B CA    1 
ATOM   3053 C C     . ALA B 1 118 ? -0.948  -21.657 30.594  1.00 42.25  ? 160 ALA B C     1 
ATOM   3054 O O     . ALA B 1 118 ? -0.007  -21.672 31.394  1.00 38.27  ? 160 ALA B O     1 
ATOM   3055 C CB    . ALA B 1 118 ? -0.008  -19.673 29.366  1.00 43.58  ? 160 ALA B CB    1 
ATOM   3056 N N     . GLU B 1 119 ? -1.718  -22.722 30.339  1.00 44.35  ? 161 GLU B N     1 
ATOM   3057 C CA    . GLU B 1 119 ? -1.421  -24.047 30.884  1.00 46.73  ? 161 GLU B CA    1 
ATOM   3058 C C     . GLU B 1 119 ? -0.297  -24.647 30.050  1.00 40.36  ? 161 GLU B C     1 
ATOM   3059 O O     . GLU B 1 119 ? -0.485  -24.948 28.866  1.00 43.09  ? 161 GLU B O     1 
ATOM   3060 C CB    . GLU B 1 119 ? -2.659  -24.958 30.887  1.00 51.44  ? 161 GLU B CB    1 
ATOM   3061 C CG    . GLU B 1 119 ? -2.346  -26.507 30.847  1.00 58.71  ? 161 GLU B CG    1 
ATOM   3062 C CD    . GLU B 1 119 ? -3.425  -27.415 31.457  1.00 59.88  ? 161 GLU B CD    1 
ATOM   3063 O OE1   . GLU B 1 119 ? -4.524  -26.941 31.777  1.00 57.94  ? 161 GLU B OE1   1 
ATOM   3064 O OE2   . GLU B 1 119 ? -3.169  -28.617 31.604  1.00 61.11  ? 161 GLU B OE2   1 
ATOM   3065 N N     . PHE B 1 120 ? 0.875   -24.802 30.662  1.00 43.68  ? 162 PHE B N     1 
ATOM   3066 C CA    . PHE B 1 120 ? 1.994   -25.543 30.099  1.00 41.89  ? 162 PHE B CA    1 
ATOM   3067 C C     . PHE B 1 120 ? 1.995   -26.968 30.641  1.00 52.83  ? 162 PHE B C     1 
ATOM   3068 O O     . PHE B 1 120 ? 1.070   -27.389 31.349  1.00 53.92  ? 162 PHE B O     1 
ATOM   3069 C CB    . PHE B 1 120 ? 3.315   -24.835 30.399  1.00 41.93  ? 162 PHE B CB    1 
ATOM   3070 C CG    . PHE B 1 120 ? 3.525   -23.604 29.581  1.00 45.65  ? 162 PHE B CG    1 
ATOM   3071 C CD1   . PHE B 1 120 ? 4.029   -23.691 28.287  1.00 44.73  ? 162 PHE B CD1   1 
ATOM   3072 C CD2   . PHE B 1 120 ? 3.190   -22.362 30.090  1.00 40.67  ? 162 PHE B CD2   1 
ATOM   3073 C CE1   . PHE B 1 120 ? 4.221   -22.558 27.518  1.00 38.23  ? 162 PHE B CE1   1 
ATOM   3074 C CE2   . PHE B 1 120 ? 3.367   -21.228 29.335  1.00 44.66  ? 162 PHE B CE2   1 
ATOM   3075 C CZ    . PHE B 1 120 ? 3.886   -21.324 28.036  1.00 41.99  ? 162 PHE B CZ    1 
ATOM   3076 N N     . ASP B 1 121 ? 3.059   -27.718 30.326  1.00 53.11  ? 163 ASP B N     1 
ATOM   3077 C CA    . ASP B 1 121 ? 3.051   -29.162 30.548  1.00 57.73  ? 163 ASP B CA    1 
ATOM   3078 C C     . ASP B 1 121 ? 2.997   -29.496 32.033  1.00 62.73  ? 163 ASP B C     1 
ATOM   3079 O O     . ASP B 1 121 ? 2.067   -30.168 32.495  1.00 59.85  ? 163 ASP B O     1 
ATOM   3080 C CB    . ASP B 1 121 ? 4.278   -29.797 29.888  1.00 57.07  ? 163 ASP B CB    1 
ATOM   3081 C CG    . ASP B 1 121 ? 4.544   -31.213 30.359  1.00 70.36  ? 163 ASP B CG    1 
ATOM   3082 O OD1   . ASP B 1 121 ? 5.154   -31.402 31.431  1.00 73.73  ? 163 ASP B OD1   1 
ATOM   3083 O OD2   . ASP B 1 121 ? 4.142   -32.155 29.641  1.00 70.22  ? 163 ASP B OD2   1 
ATOM   3084 N N     . SER B 1 122 ? 3.982   -29.027 32.804  1.00 59.58  ? 164 SER B N     1 
ATOM   3085 C CA    . SER B 1 122 ? 4.046   -29.360 34.222  1.00 51.07  ? 164 SER B CA    1 
ATOM   3086 C C     . SER B 1 122 ? 3.520   -28.256 35.122  1.00 50.27  ? 164 SER B C     1 
ATOM   3087 O O     . SER B 1 122 ? 3.457   -28.452 36.338  1.00 51.48  ? 164 SER B O     1 
ATOM   3088 C CB    . SER B 1 122 ? 5.489   -29.719 34.635  1.00 57.76  ? 164 SER B CB    1 
ATOM   3089 O OG    . SER B 1 122 ? 6.451   -28.761 34.222  1.00 57.60  ? 164 SER B OG    1 
ATOM   3090 N N     . PHE B 1 123 ? 3.142   -27.108 34.576  1.00 48.57  ? 165 PHE B N     1 
ATOM   3091 C CA    . PHE B 1 123 ? 2.586   -26.055 35.412  1.00 46.62  ? 165 PHE B CA    1 
ATOM   3092 C C     . PHE B 1 123 ? 1.641   -25.197 34.577  1.00 48.46  ? 165 PHE B C     1 
ATOM   3093 O O     . PHE B 1 123 ? 1.469   -25.415 33.372  1.00 48.20  ? 165 PHE B O     1 
ATOM   3094 C CB    . PHE B 1 123 ? 3.700   -25.223 36.046  1.00 39.09  ? 165 PHE B CB    1 
ATOM   3095 C CG    . PHE B 1 123 ? 4.413   -24.354 35.078  1.00 40.52  ? 165 PHE B CG    1 
ATOM   3096 C CD1   . PHE B 1 123 ? 5.450   -24.852 34.312  1.00 51.04  ? 165 PHE B CD1   1 
ATOM   3097 C CD2   . PHE B 1 123 ? 4.049   -23.035 34.919  1.00 39.98  ? 165 PHE B CD2   1 
ATOM   3098 C CE1   . PHE B 1 123 ? 6.119   -24.045 33.399  1.00 44.09  ? 165 PHE B CE1   1 
ATOM   3099 C CE2   . PHE B 1 123 ? 4.717   -22.224 34.020  1.00 41.83  ? 165 PHE B CE2   1 
ATOM   3100 C CZ    . PHE B 1 123 ? 5.757   -22.736 33.260  1.00 37.22  ? 165 PHE B CZ    1 
ATOM   3101 N N     . VAL B 1 124 ? 1.005   -24.228 35.238  1.00 41.99  ? 166 VAL B N     1 
ATOM   3102 C CA    . VAL B 1 124 ? 0.144   -23.252 34.581  1.00 40.84  ? 166 VAL B CA    1 
ATOM   3103 C C     . VAL B 1 124 ? 0.614   -21.859 34.976  1.00 39.73  ? 166 VAL B C     1 
ATOM   3104 O O     . VAL B 1 124 ? 0.911   -21.596 36.146  1.00 35.80  ? 166 VAL B O     1 
ATOM   3105 C CB    . VAL B 1 124 ? -1.347  -23.461 34.934  1.00 43.39  ? 166 VAL B CB    1 
ATOM   3106 C CG1   . VAL B 1 124 ? -1.541  -23.494 36.427  1.00 44.70  ? 166 VAL B CG1   1 
ATOM   3107 C CG2   . VAL B 1 124 ? -2.207  -22.366 34.328  1.00 41.46  ? 166 VAL B CG2   1 
ATOM   3108 N N     . LEU B 1 125 ? 0.695   -20.969 33.996  1.00 42.01  ? 167 LEU B N     1 
ATOM   3109 C CA    . LEU B 1 125 ? 1.236   -19.632 34.204  1.00 42.10  ? 167 LEU B CA    1 
ATOM   3110 C C     . LEU B 1 125 ? 0.146   -18.592 33.959  1.00 33.97  ? 167 LEU B C     1 
ATOM   3111 O O     . LEU B 1 125 ? -0.561  -18.643 32.949  1.00 33.07  ? 167 LEU B O     1 
ATOM   3112 C CB    . LEU B 1 125 ? 2.465   -19.403 33.298  1.00 40.54  ? 167 LEU B CB    1 
ATOM   3113 C CG    . LEU B 1 125 ? 3.068   -17.999 33.163  1.00 35.96  ? 167 LEU B CG    1 
ATOM   3114 C CD1   . LEU B 1 125 ? 3.609   -17.546 34.470  1.00 30.67  ? 167 LEU B CD1   1 
ATOM   3115 C CD2   . LEU B 1 125 ? 4.161   -17.991 32.114  1.00 43.37  ? 167 LEU B CD2   1 
ATOM   3116 N N     . VAL B 1 126 ? -0.014  -17.680 34.907  1.00 35.88  ? 168 VAL B N     1 
ATOM   3117 C CA    . VAL B 1 126 ? -0.919  -16.545 34.775  1.00 38.64  ? 168 VAL B CA    1 
ATOM   3118 C C     . VAL B 1 126 ? -0.077  -15.286 34.732  1.00 37.68  ? 168 VAL B C     1 
ATOM   3119 O O     . VAL B 1 126 ? 0.873   -15.138 35.511  1.00 40.81  ? 168 VAL B O     1 
ATOM   3120 C CB    . VAL B 1 126 ? -1.933  -16.455 35.932  1.00 35.61  ? 168 VAL B CB    1 
ATOM   3121 C CG1   . VAL B 1 126 ? -2.732  -15.160 35.834  1.00 28.44  ? 168 VAL B CG1   1 
ATOM   3122 C CG2   . VAL B 1 126 ? -2.862  -17.663 35.923  1.00 37.27  ? 168 VAL B CG2   1 
ATOM   3123 N N     . THR B 1 127 ? -0.414  -14.382 33.823  1.00 33.26  ? 169 THR B N     1 
ATOM   3124 C CA    . THR B 1 127 ? 0.138   -13.042 33.873  1.00 34.07  ? 169 THR B CA    1 
ATOM   3125 C C     . THR B 1 127 ? -0.998  -12.049 34.036  1.00 38.00  ? 169 THR B C     1 
ATOM   3126 O O     . THR B 1 127 ? -2.067  -12.198 33.432  1.00 31.54  ? 169 THR B O     1 
ATOM   3127 C CB    . THR B 1 127 ? 0.971   -12.702 32.653  1.00 33.92  ? 169 THR B CB    1 
ATOM   3128 O OG1   . THR B 1 127 ? 2.127   -13.543 32.625  1.00 46.52  ? 169 THR B OG1   1 
ATOM   3129 C CG2   . THR B 1 127 ? 1.454   -11.317 32.778  1.00 29.42  ? 169 THR B CG2   1 
ATOM   3130 N N     . ALA B 1 128 ? -0.763  -11.052 34.884  1.00 34.34  ? 170 ALA B N     1 
ATOM   3131 C CA    . ALA B 1 128 ? -1.799  -10.115 35.251  1.00 28.37  ? 170 ALA B CA    1 
ATOM   3132 C C     . ALA B 1 128 ? -1.242  -8.708  35.202  1.00 28.51  ? 170 ALA B C     1 
ATOM   3133 O O     . ALA B 1 128 ? -0.041  -8.487  35.318  1.00 33.77  ? 170 ALA B O     1 
ATOM   3134 C CB    . ALA B 1 128 ? -2.359  -10.406 36.655  1.00 33.07  ? 170 ALA B CB    1 
ATOM   3135 N N     . TYR B 1 129 ? -2.143  -7.765  35.009  1.00 33.06  ? 171 TYR B N     1 
ATOM   3136 C CA    . TYR B 1 129 ? -1.870  -6.351  35.145  1.00 32.54  ? 171 TYR B CA    1 
ATOM   3137 C C     . TYR B 1 129 ? -3.052  -5.853  35.969  1.00 39.45  ? 171 TYR B C     1 
ATOM   3138 O O     . TYR B 1 129 ? -4.061  -5.391  35.417  1.00 39.24  ? 171 TYR B O     1 
ATOM   3139 C CB    . TYR B 1 129 ? -1.741  -5.662  33.794  1.00 33.38  ? 171 TYR B CB    1 
ATOM   3140 C CG    . TYR B 1 129 ? -1.760  -4.170  33.909  1.00 31.72  ? 171 TYR B CG    1 
ATOM   3141 C CD1   . TYR B 1 129 ? -0.894  -3.529  34.755  1.00 38.37  ? 171 TYR B CD1   1 
ATOM   3142 C CD2   . TYR B 1 129 ? -2.572  -3.402  33.128  1.00 39.47  ? 171 TYR B CD2   1 
ATOM   3143 C CE1   . TYR B 1 129 ? -0.896  -2.130  34.867  1.00 52.80  ? 171 TYR B CE1   1 
ATOM   3144 C CE2   . TYR B 1 129 ? -2.580  -2.019  33.226  1.00 51.65  ? 171 TYR B CE2   1 
ATOM   3145 C CZ    . TYR B 1 129 ? -1.748  -1.374  34.088  1.00 45.54  ? 171 TYR B CZ    1 
ATOM   3146 O OH    . TYR B 1 129 ? -1.793  0.004   34.156  1.00 36.32  ? 171 TYR B OH    1 
ATOM   3147 N N     . VAL B 1 130 ? -2.905  -5.982  37.287  1.00 36.61  ? 172 VAL B N     1 
ATOM   3148 C CA    . VAL B 1 130 ? -3.985  -5.767  38.267  1.00 39.30  ? 172 VAL B CA    1 
ATOM   3149 C C     . VAL B 1 130 ? -4.441  -4.311  38.215  1.00 35.24  ? 172 VAL B C     1 
ATOM   3150 O O     . VAL B 1 130 ? -3.588  -3.405  38.188  1.00 38.00  ? 172 VAL B O     1 
ATOM   3151 C CB    . VAL B 1 130 ? -3.485  -6.145  39.679  1.00 38.77  ? 172 VAL B CB    1 
ATOM   3152 C CG1   . VAL B 1 130 ? -4.475  -5.748  40.769  1.00 31.24  ? 172 VAL B CG1   1 
ATOM   3153 C CG2   . VAL B 1 130 ? -3.141  -7.631  39.739  1.00 34.27  ? 172 VAL B CG2   1 
ATOM   3154 N N     . PRO B 1 131 ? -5.745  -4.017  38.205  1.00 35.81  ? 173 PRO B N     1 
ATOM   3155 C CA    . PRO B 1 131 ? -6.182  -2.626  38.000  1.00 37.99  ? 173 PRO B CA    1 
ATOM   3156 C C     . PRO B 1 131 ? -5.741  -1.725  39.137  1.00 45.67  ? 173 PRO B C     1 
ATOM   3157 O O     . PRO B 1 131 ? -5.869  -2.070  40.317  1.00 45.24  ? 173 PRO B O     1 
ATOM   3158 C CB    . PRO B 1 131 ? -7.709  -2.731  37.924  1.00 37.73  ? 173 PRO B CB    1 
ATOM   3159 C CG    . PRO B 1 131 ? -8.035  -4.038  38.482  1.00 36.04  ? 173 PRO B CG    1 
ATOM   3160 C CD    . PRO B 1 131 ? -6.885  -4.943  38.216  1.00 33.86  ? 173 PRO B CD    1 
ATOM   3161 N N     . ASN B 1 132 ? -5.212  -0.562  38.759  1.00 47.39  ? 174 ASN B N     1 
ATOM   3162 C CA    . ASN B 1 132 ? -4.675  0.407   39.706  1.00 41.01  ? 174 ASN B CA    1 
ATOM   3163 C C     . ASN B 1 132 ? -5.795  1.032   40.528  1.00 39.79  ? 174 ASN B C     1 
ATOM   3164 O O     . ASN B 1 132 ? -6.898  1.262   40.030  1.00 40.74  ? 174 ASN B O     1 
ATOM   3165 C CB    . ASN B 1 132 ? -3.920  1.501   38.948  1.00 48.11  ? 174 ASN B CB    1 
ATOM   3166 C CG    . ASN B 1 132 ? -2.943  2.250   39.813  1.00 46.59  ? 174 ASN B CG    1 
ATOM   3167 O OD1   . ASN B 1 132 ? -3.325  3.114   40.612  1.00 52.81  ? 174 ASN B OD1   1 
ATOM   3168 N ND2   . ASN B 1 132 ? -1.664  1.934   39.649  1.00 38.06  ? 174 ASN B ND2   1 
ATOM   3169 N N     . ALA B 1 133 ? -5.496  1.333   41.798  1.00 45.33  ? 175 ALA B N     1 
ATOM   3170 C CA    . ALA B 1 133 ? -6.528  1.889   42.671  1.00 45.84  ? 175 ALA B CA    1 
ATOM   3171 C C     . ALA B 1 133 ? -6.953  3.285   42.232  1.00 44.85  ? 175 ALA B C     1 
ATOM   3172 O O     . ALA B 1 133 ? -8.111  3.672   42.428  1.00 35.72  ? 175 ALA B O     1 
ATOM   3173 C CB    . ALA B 1 133 ? -6.040  1.904   44.114  1.00 48.59  ? 175 ALA B CB    1 
ATOM   3174 N N     . GLY B 1 134 ? -6.042  4.038   41.633  1.00 58.74  ? 176 GLY B N     1 
ATOM   3175 C CA    . GLY B 1 134 ? -6.307  5.338   41.046  1.00 54.33  ? 176 GLY B CA    1 
ATOM   3176 C C     . GLY B 1 134 ? -5.883  6.482   41.950  1.00 55.91  ? 176 GLY B C     1 
ATOM   3177 O O     . GLY B 1 134 ? -5.918  6.390   43.187  1.00 58.23  ? 176 GLY B O     1 
ATOM   3178 N N     . ARG B 1 135 ? -5.462  7.580   41.329  1.00 39.10  ? 177 ARG B N     1 
ATOM   3179 C CA    . ARG B 1 135 ? -5.247  8.797   42.086  1.00 43.33  ? 177 ARG B CA    1 
ATOM   3180 C C     . ARG B 1 135 ? -6.529  9.181   42.805  1.00 51.00  ? 177 ARG B C     1 
ATOM   3181 O O     . ARG B 1 135 ? -7.596  9.258   42.190  1.00 46.73  ? 177 ARG B O     1 
ATOM   3182 C CB    . ARG B 1 135 ? -4.786  9.917   41.171  1.00 46.23  ? 177 ARG B CB    1 
ATOM   3183 C CG    . ARG B 1 135 ? -3.306  10.157  41.279  1.00 54.33  ? 177 ARG B CG    1 
ATOM   3184 C CD    . ARG B 1 135 ? -2.771  10.694  39.995  1.00 50.89  ? 177 ARG B CD    1 
ATOM   3185 N NE    . ARG B 1 135 ? -1.318  10.657  39.986  1.00 64.73  ? 177 ARG B NE    1 
ATOM   3186 C CZ    . ARG B 1 135 ? -0.551  11.727  39.838  1.00 65.49  ? 177 ARG B CZ    1 
ATOM   3187 N NH1   . ARG B 1 135 ? 0.773   11.596  39.845  1.00 70.25  ? 177 ARG B NH1   1 
ATOM   3188 N NH2   . ARG B 1 135 ? -1.110  12.921  39.674  1.00 59.75  ? 177 ARG B NH2   1 
ATOM   3189 N N     . GLY B 1 136 ? -6.418  9.384   44.123  1.00 51.61  ? 178 GLY B N     1 
ATOM   3190 C CA    . GLY B 1 136 ? -7.564  9.584   44.985  1.00 47.34  ? 178 GLY B CA    1 
ATOM   3191 C C     . GLY B 1 136 ? -8.409  8.353   45.229  1.00 56.04  ? 178 GLY B C     1 
ATOM   3192 O O     . GLY B 1 136 ? -9.501  8.475   45.795  1.00 57.29  ? 178 GLY B O     1 
ATOM   3193 N N     . LEU B 1 137 ? -7.950  7.175   44.806  1.00 48.23  ? 179 LEU B N     1 
ATOM   3194 C CA    . LEU B 1 137 ? -8.640  5.915   45.076  1.00 52.43  ? 179 LEU B CA    1 
ATOM   3195 C C     . LEU B 1 137 ? -10.080 5.916   44.572  1.00 58.01  ? 179 LEU B C     1 
ATOM   3196 O O     . LEU B 1 137 ? -10.963 5.323   45.204  1.00 57.98  ? 179 LEU B O     1 
ATOM   3197 C CB    . LEU B 1 137 ? -8.625  5.588   46.568  1.00 49.69  ? 179 LEU B CB    1 
ATOM   3198 C CG    . LEU B 1 137 ? -7.349  5.947   47.332  1.00 51.11  ? 179 LEU B CG    1 
ATOM   3199 C CD1   . LEU B 1 137 ? -7.546  5.674   48.819  1.00 53.18  ? 179 LEU B CD1   1 
ATOM   3200 C CD2   . LEU B 1 137 ? -6.123  5.216   46.793  1.00 49.01  ? 179 LEU B CD2   1 
ATOM   3201 N N     . VAL B 1 138 ? -10.352 6.593   43.453  1.00 58.64  ? 180 VAL B N     1 
ATOM   3202 C CA    . VAL B 1 138 ? -11.707 6.536   42.909  1.00 64.27  ? 180 VAL B CA    1 
ATOM   3203 C C     . VAL B 1 138 ? -12.027 5.120   42.450  1.00 60.89  ? 180 VAL B C     1 
ATOM   3204 O O     . VAL B 1 138 ? -13.151 4.630   42.634  1.00 66.88  ? 180 VAL B O     1 
ATOM   3205 C CB    . VAL B 1 138 ? -11.895 7.570   41.781  1.00 63.07  ? 180 VAL B CB    1 
ATOM   3206 C CG1   . VAL B 1 138 ? -10.912 7.326   40.625  1.00 54.45  ? 180 VAL B CG1   1 
ATOM   3207 C CG2   . VAL B 1 138 ? -13.347 7.561   41.298  1.00 62.26  ? 180 VAL B CG2   1 
ATOM   3208 N N     . ARG B 1 139 ? -11.030 4.424   41.899  1.00 58.26  ? 181 ARG B N     1 
ATOM   3209 C CA    . ARG B 1 139 ? -11.166 3.054   41.423  1.00 59.84  ? 181 ARG B CA    1 
ATOM   3210 C C     . ARG B 1 139 ? -10.721 2.026   42.464  1.00 60.37  ? 181 ARG B C     1 
ATOM   3211 O O     . ARG B 1 139 ? -10.194 0.970   42.103  1.00 61.60  ? 181 ARG B O     1 
ATOM   3212 C CB    . ARG B 1 139 ? -10.381 2.874   40.125  1.00 55.86  ? 181 ARG B CB    1 
ATOM   3213 N N     . LEU B 1 140 ? -10.942 2.301   43.751  1.00 62.26  ? 182 LEU B N     1 
ATOM   3214 C CA    . LEU B 1 140 ? -10.463 1.421   44.816  1.00 59.14  ? 182 LEU B CA    1 
ATOM   3215 C C     . LEU B 1 140 ? -11.446 0.321   45.190  1.00 61.46  ? 182 LEU B C     1 
ATOM   3216 O O     . LEU B 1 140 ? -11.019 -0.763  45.607  1.00 56.71  ? 182 LEU B O     1 
ATOM   3217 C CB    . LEU B 1 140 ? -10.150 2.230   46.074  1.00 61.23  ? 182 LEU B CB    1 
ATOM   3218 C CG    . LEU B 1 140 ? -9.724  1.441   47.315  1.00 59.22  ? 182 LEU B CG    1 
ATOM   3219 C CD1   . LEU B 1 140 ? -8.337  0.857   47.164  1.00 51.03  ? 182 LEU B CD1   1 
ATOM   3220 C CD2   . LEU B 1 140 ? -9.800  2.297   48.546  1.00 60.61  ? 182 LEU B CD2   1 
ATOM   3221 N N     . GLU B 1 141 ? -12.747 0.569   45.089  1.00 62.41  ? 183 GLU B N     1 
ATOM   3222 C CA    . GLU B 1 141 ? -13.695 -0.484  45.411  1.00 63.50  ? 183 GLU B CA    1 
ATOM   3223 C C     . GLU B 1 141 ? -13.968 -1.400  44.234  1.00 58.28  ? 183 GLU B C     1 
ATOM   3224 O O     . GLU B 1 141 ? -14.493 -2.500  44.434  1.00 70.14  ? 183 GLU B O     1 
ATOM   3225 C CB    . GLU B 1 141 ? -14.993 0.122   45.946  1.00 62.80  ? 183 GLU B CB    1 
ATOM   3226 C CG    . GLU B 1 141 ? -14.714 0.924   47.212  1.00 75.52  ? 183 GLU B CG    1 
ATOM   3227 C CD    . GLU B 1 141 ? -15.925 1.120   48.130  1.00 85.72  ? 183 GLU B CD    1 
ATOM   3228 O OE1   . GLU B 1 141 ? -16.161 2.274   48.555  1.00 68.89  ? 183 GLU B OE1   1 
ATOM   3229 O OE2   . GLU B 1 141 ? -16.624 0.129   48.449  1.00 85.07  ? 183 GLU B OE2   1 
ATOM   3230 N N     . TYR B 1 142 ? -13.632 -0.981  43.016  1.00 52.82  ? 184 TYR B N     1 
ATOM   3231 C CA    . TYR B 1 142 ? -13.584 -1.950  41.934  1.00 58.75  ? 184 TYR B CA    1 
ATOM   3232 C C     . TYR B 1 142 ? -12.330 -2.789  42.078  1.00 53.59  ? 184 TYR B C     1 
ATOM   3233 O O     . TYR B 1 142 ? -12.336 -3.975  41.742  1.00 54.35  ? 184 TYR B O     1 
ATOM   3234 C CB    . TYR B 1 142 ? -13.665 -1.242  40.564  1.00 52.35  ? 184 TYR B CB    1 
ATOM   3235 C CG    . TYR B 1 142 ? -13.251 -2.076  39.351  1.00 52.74  ? 184 TYR B CG    1 
ATOM   3236 C CD1   . TYR B 1 142 ? -11.923 -2.233  39.023  1.00 52.16  ? 184 TYR B CD1   1 
ATOM   3237 C CD2   . TYR B 1 142 ? -14.185 -2.666  38.512  1.00 55.78  ? 184 TYR B CD2   1 
ATOM   3238 C CE1   . TYR B 1 142 ? -11.526 -2.989  37.916  1.00 56.57  ? 184 TYR B CE1   1 
ATOM   3239 C CE2   . TYR B 1 142 ? -13.783 -3.427  37.388  1.00 47.21  ? 184 TYR B CE2   1 
ATOM   3240 C CZ    . TYR B 1 142 ? -12.453 -3.585  37.100  1.00 50.64  ? 184 TYR B CZ    1 
ATOM   3241 O OH    . TYR B 1 142 ? -12.029 -4.326  36.005  1.00 70.69  ? 184 TYR B OH    1 
ATOM   3242 N N     . ARG B 1 143 ? -11.265 -2.184  42.613  1.00 47.03  ? 185 ARG B N     1 
ATOM   3243 C CA    . ARG B 1 143 ? -10.031 -2.919  42.861  1.00 48.99  ? 185 ARG B CA    1 
ATOM   3244 C C     . ARG B 1 143 ? -10.239 -3.959  43.951  1.00 47.24  ? 185 ARG B C     1 
ATOM   3245 O O     . ARG B 1 143 ? -9.747  -5.091  43.847  1.00 39.93  ? 185 ARG B O     1 
ATOM   3246 C CB    . ARG B 1 143 ? -8.915  -1.939  43.234  1.00 41.95  ? 185 ARG B CB    1 
ATOM   3247 C CG    . ARG B 1 143 ? -7.714  -2.543  43.913  1.00 35.55  ? 185 ARG B CG    1 
ATOM   3248 C CD    . ARG B 1 143 ? -6.869  -3.402  42.974  1.00 38.76  ? 185 ARG B CD    1 
ATOM   3249 N NE    . ARG B 1 143 ? -5.769  -4.054  43.684  1.00 38.23  ? 185 ARG B NE    1 
ATOM   3250 C CZ    . ARG B 1 143 ? -4.500  -3.644  43.667  1.00 34.20  ? 185 ARG B CZ    1 
ATOM   3251 N NH1   . ARG B 1 143 ? -4.146  -2.567  42.981  1.00 37.79  ? 185 ARG B NH1   1 
ATOM   3252 N NH2   . ARG B 1 143 ? -3.587  -4.306  44.344  1.00 29.19  ? 185 ARG B NH2   1 
ATOM   3253 N N     . GLN B 1 144 ? -10.986 -3.595  44.992  1.00 48.35  ? 186 GLN B N     1 
ATOM   3254 C CA    . GLN B 1 144 ? -11.320 -4.557  46.031  1.00 47.36  ? 186 GLN B CA    1 
ATOM   3255 C C     . GLN B 1 144 ? -12.070 -5.748  45.444  1.00 42.48  ? 186 GLN B C     1 
ATOM   3256 O O     . GLN B 1 144 ? -11.665 -6.899  45.627  1.00 41.73  ? 186 GLN B O     1 
ATOM   3257 C CB    . GLN B 1 144 ? -12.118 -3.862  47.135  1.00 57.53  ? 186 GLN B CB    1 
ATOM   3258 C CG    . GLN B 1 144 ? -11.239 -3.101  48.158  1.00 54.78  ? 186 GLN B CG    1 
ATOM   3259 C CD    . GLN B 1 144 ? -12.042 -2.102  49.006  1.00 70.59  ? 186 GLN B CD    1 
ATOM   3260 O OE1   . GLN B 1 144 ? -12.405 -1.022  48.530  1.00 72.83  ? 186 GLN B OE1   1 
ATOM   3261 N NE2   . GLN B 1 144 ? -12.330 -2.468  50.261  1.00 64.33  ? 186 GLN B NE2   1 
ATOM   3262 N N     . ARG B 1 145 ? -13.134 -5.489  44.680  1.00 57.36  ? 187 ARG B N     1 
ATOM   3263 C CA    . ARG B 1 145 ? -13.871 -6.581  44.043  1.00 55.33  ? 187 ARG B CA    1 
ATOM   3264 C C     . ARG B 1 145 ? -12.934 -7.427  43.196  1.00 47.18  ? 187 ARG B C     1 
ATOM   3265 O O     . ARG B 1 145 ? -12.865 -8.652  43.358  1.00 42.64  ? 187 ARG B O     1 
ATOM   3266 C CB    . ARG B 1 145 ? -15.018 -6.037  43.178  1.00 49.56  ? 187 ARG B CB    1 
ATOM   3267 N N     . TRP B 1 146 ? -12.179 -6.760  42.308  1.00 45.13  ? 188 TRP B N     1 
ATOM   3268 C CA    . TRP B 1 146 ? -11.233 -7.425  41.418  1.00 42.63  ? 188 TRP B CA    1 
ATOM   3269 C C     . TRP B 1 146 ? -10.289 -8.329  42.192  1.00 44.41  ? 188 TRP B C     1 
ATOM   3270 O O     . TRP B 1 146 ? -10.039 -9.468  41.781  1.00 36.00  ? 188 TRP B O     1 
ATOM   3271 C CB    . TRP B 1 146 ? -10.435 -6.385  40.619  1.00 35.93  ? 188 TRP B CB    1 
ATOM   3272 C CG    . TRP B 1 146 ? -9.770  -7.008  39.412  1.00 51.09  ? 188 TRP B CG    1 
ATOM   3273 C CD1   . TRP B 1 146 ? -10.270 -7.060  38.132  1.00 41.09  ? 188 TRP B CD1   1 
ATOM   3274 C CD2   . TRP B 1 146 ? -8.497  -7.680  39.368  1.00 31.99  ? 188 TRP B CD2   1 
ATOM   3275 N NE1   . TRP B 1 146 ? -9.390  -7.717  37.313  1.00 35.91  ? 188 TRP B NE1   1 
ATOM   3276 C CE2   . TRP B 1 146 ? -8.301  -8.115  38.041  1.00 27.87  ? 188 TRP B CE2   1 
ATOM   3277 C CE3   . TRP B 1 146 ? -7.511  -7.946  40.316  1.00 31.73  ? 188 TRP B CE3   1 
ATOM   3278 C CZ2   . TRP B 1 146 ? -7.166  -8.802  37.640  1.00 33.23  ? 188 TRP B CZ2   1 
ATOM   3279 C CZ3   . TRP B 1 146 ? -6.380  -8.638  39.918  1.00 39.48  ? 188 TRP B CZ3   1 
ATOM   3280 C CH2   . TRP B 1 146 ? -6.217  -9.055  38.593  1.00 44.19  ? 188 TRP B CH2   1 
ATOM   3281 N N     . ASP B 1 147 ? -9.769  -7.834  43.326  1.00 45.05  ? 189 ASP B N     1 
ATOM   3282 C CA    . ASP B 1 147 ? -8.870  -8.627  44.157  1.00 41.63  ? 189 ASP B CA    1 
ATOM   3283 C C     . ASP B 1 147 ? -9.514  -9.937  44.563  1.00 44.35  ? 189 ASP B C     1 
ATOM   3284 O O     . ASP B 1 147 ? -8.893  -11.005 44.478  1.00 39.03  ? 189 ASP B O     1 
ATOM   3285 C CB    . ASP B 1 147 ? -8.469  -7.840  45.398  1.00 42.30  ? 189 ASP B CB    1 
ATOM   3286 C CG    . ASP B 1 147 ? -7.183  -7.057  45.202  1.00 48.99  ? 189 ASP B CG    1 
ATOM   3287 O OD1   . ASP B 1 147 ? -6.778  -6.874  44.028  1.00 49.94  ? 189 ASP B OD1   1 
ATOM   3288 O OD2   . ASP B 1 147 ? -6.574  -6.636  46.220  1.00 44.38  ? 189 ASP B OD2   1 
ATOM   3289 N N     . GLU B 1 148 ? -10.771 -9.873  45.006  1.00 46.50  ? 190 GLU B N     1 
ATOM   3290 C CA    . GLU B 1 148 ? -11.426 -11.065 45.525  1.00 45.94  ? 190 GLU B CA    1 
ATOM   3291 C C     . GLU B 1 148 ? -11.729 -12.050 44.407  1.00 42.73  ? 190 GLU B C     1 
ATOM   3292 O O     . GLU B 1 148 ? -11.550 -13.263 44.581  1.00 41.00  ? 190 GLU B O     1 
ATOM   3293 C CB    . GLU B 1 148 ? -12.702 -10.690 46.298  1.00 50.30  ? 190 GLU B CB    1 
ATOM   3294 C CG    . GLU B 1 148 ? -13.757 -11.819 46.372  1.00 56.56  ? 190 GLU B CG    1 
ATOM   3295 C CD    . GLU B 1 148 ? -14.942 -11.468 47.236  1.00 57.72  ? 190 GLU B CD    1 
ATOM   3296 O OE1   . GLU B 1 148 ? -15.028 -10.316 47.681  1.00 56.72  ? 190 GLU B OE1   1 
ATOM   3297 O OE2   . GLU B 1 148 ? -15.797 -12.333 47.461  1.00 64.60  ? 190 GLU B OE2   1 
ATOM   3298 N N     . ALA B 1 149 ? -12.190 -11.547 43.252  1.00 37.19  ? 191 ALA B N     1 
ATOM   3299 C CA    . ALA B 1 149 ? -12.381 -12.407 42.090  1.00 31.59  ? 191 ALA B CA    1 
ATOM   3300 C C     . ALA B 1 149 ? -11.082 -13.067 41.683  1.00 40.66  ? 191 ALA B C     1 
ATOM   3301 O O     . ALA B 1 149 ? -11.086 -14.212 41.211  1.00 47.10  ? 191 ALA B O     1 
ATOM   3302 C CB    . ALA B 1 149 ? -12.942 -11.602 40.916  1.00 30.11  ? 191 ALA B CB    1 
ATOM   3303 N N     . PHE B 1 150 ? -9.963  -12.363 41.858  1.00 33.59  ? 192 PHE B N     1 
ATOM   3304 C CA    . PHE B 1 150 ? -8.703  -12.890 41.372  1.00 36.69  ? 192 PHE B CA    1 
ATOM   3305 C C     . PHE B 1 150 ? -8.266  -14.085 42.209  1.00 36.51  ? 192 PHE B C     1 
ATOM   3306 O O     . PHE B 1 150 ? -7.948  -15.146 41.662  1.00 43.56  ? 192 PHE B O     1 
ATOM   3307 C CB    . PHE B 1 150 ? -7.635  -11.788 41.336  1.00 35.82  ? 192 PHE B CB    1 
ATOM   3308 C CG    . PHE B 1 150 ? -6.509  -12.093 40.407  1.00 32.84  ? 192 PHE B CG    1 
ATOM   3309 C CD1   . PHE B 1 150 ? -6.757  -12.723 39.182  1.00 43.51  ? 192 PHE B CD1   1 
ATOM   3310 C CD2   . PHE B 1 150 ? -5.210  -11.810 40.748  1.00 35.71  ? 192 PHE B CD2   1 
ATOM   3311 C CE1   . PHE B 1 150 ? -5.721  -13.048 38.300  1.00 36.61  ? 192 PHE B CE1   1 
ATOM   3312 C CE2   . PHE B 1 150 ? -4.156  -12.124 39.869  1.00 41.18  ? 192 PHE B CE2   1 
ATOM   3313 C CZ    . PHE B 1 150 ? -4.419  -12.742 38.640  1.00 38.60  ? 192 PHE B CZ    1 
ATOM   3314 N N     . ARG B 1 151 ? -8.298  -13.950 43.539  1.00 46.81  ? 193 ARG B N     1 
ATOM   3315 C CA    . ARG B 1 151 ? -8.043  -15.080 44.437  1.00 46.46  ? 193 ARG B CA    1 
ATOM   3316 C C     . ARG B 1 151 ? -8.838  -16.303 44.037  1.00 43.92  ? 193 ARG B C     1 
ATOM   3317 O O     . ARG B 1 151 ? -8.276  -17.383 43.830  1.00 49.57  ? 193 ARG B O     1 
ATOM   3318 C CB    . ARG B 1 151 ? -8.419  -14.761 45.886  1.00 51.28  ? 193 ARG B CB    1 
ATOM   3319 C CG    . ARG B 1 151 ? -7.767  -13.603 46.518  1.00 45.59  ? 193 ARG B CG    1 
ATOM   3320 C CD    . ARG B 1 151 ? -8.428  -13.287 47.879  1.00 50.25  ? 193 ARG B CD    1 
ATOM   3321 N NE    . ARG B 1 151 ? -8.162  -11.904 48.163  1.00 65.15  ? 193 ARG B NE    1 
ATOM   3322 C CZ    . ARG B 1 151 ? -9.123  -10.985 48.400  1.00 62.21  ? 193 ARG B CZ    1 
ATOM   3323 N NH1   . ARG B 1 151 ? -10.406 -11.312 48.459  1.00 58.77  ? 193 ARG B NH1   1 
ATOM   3324 N NH2   . ARG B 1 151 ? -8.763  -9.733  48.597  1.00 57.06  ? 193 ARG B NH2   1 
ATOM   3325 N N     . LYS B 1 152 ? -10.164 -16.156 43.996  1.00 38.44  ? 194 LYS B N     1 
ATOM   3326 C CA    . LYS B 1 152 ? -11.014 -17.321 43.792  1.00 45.77  ? 194 LYS B CA    1 
ATOM   3327 C C     . LYS B 1 152 ? -10.744 -17.960 42.453  1.00 51.32  ? 194 LYS B C     1 
ATOM   3328 O O     . LYS B 1 152 ? -10.680 -19.192 42.350  1.00 65.44  ? 194 LYS B O     1 
ATOM   3329 C CB    . LYS B 1 152 ? -12.484 -16.962 43.930  1.00 35.76  ? 194 LYS B CB    1 
ATOM   3330 C CG    . LYS B 1 152 ? -12.775 -16.283 45.264  1.00 61.07  ? 194 LYS B CG    1 
ATOM   3331 C CD    . LYS B 1 152 ? -14.298 -16.211 45.548  1.00 64.46  ? 194 LYS B CD    1 
ATOM   3332 C CE    . LYS B 1 152 ? -14.671 -15.173 46.582  1.00 48.93  ? 194 LYS B CE    1 
ATOM   3333 N NZ    . LYS B 1 152 ? -15.901 -14.430 46.181  1.00 45.80  ? 194 LYS B NZ    1 
ATOM   3334 N N     . PHE B 1 153 ? -10.554 -17.142 41.420  1.00 45.47  ? 195 PHE B N     1 
ATOM   3335 C CA    . PHE B 1 153 ? -10.156 -17.682 40.132  1.00 44.94  ? 195 PHE B CA    1 
ATOM   3336 C C     . PHE B 1 153 ? -8.857  -18.462 40.250  1.00 47.04  ? 195 PHE B C     1 
ATOM   3337 O O     . PHE B 1 153 ? -8.714  -19.543 39.666  1.00 53.49  ? 195 PHE B O     1 
ATOM   3338 C CB    . PHE B 1 153 ? -10.009 -16.555 39.124  1.00 47.98  ? 195 PHE B CB    1 
ATOM   3339 C CG    . PHE B 1 153 ? -9.564  -17.017 37.777  1.00 51.38  ? 195 PHE B CG    1 
ATOM   3340 C CD1   . PHE B 1 153 ? -10.487 -17.488 36.857  1.00 45.06  ? 195 PHE B CD1   1 
ATOM   3341 C CD2   . PHE B 1 153 ? -8.225  -16.981 37.426  1.00 54.21  ? 195 PHE B CD2   1 
ATOM   3342 C CE1   . PHE B 1 153 ? -10.093 -17.896 35.632  1.00 46.29  ? 195 PHE B CE1   1 
ATOM   3343 C CE2   . PHE B 1 153 ? -7.822  -17.398 36.176  1.00 55.32  ? 195 PHE B CE2   1 
ATOM   3344 C CZ    . PHE B 1 153 ? -8.752  -17.854 35.282  1.00 49.40  ? 195 PHE B CZ    1 
ATOM   3345 N N     . LEU B 1 154 ? -7.907  -17.945 41.021  1.00 41.67  ? 196 LEU B N     1 
ATOM   3346 C CA    . LEU B 1 154 ? -6.625  -18.618 41.093  1.00 53.65  ? 196 LEU B CA    1 
ATOM   3347 C C     . LEU B 1 154 ? -6.705  -19.944 41.846  1.00 59.01  ? 196 LEU B C     1 
ATOM   3348 O O     . LEU B 1 154 ? -5.711  -20.684 41.904  1.00 60.10  ? 196 LEU B O     1 
ATOM   3349 C CB    . LEU B 1 154 ? -5.584  -17.670 41.703  1.00 42.02  ? 196 LEU B CB    1 
ATOM   3350 C CG    . LEU B 1 154 ? -5.122  -16.572 40.728  1.00 38.94  ? 196 LEU B CG    1 
ATOM   3351 C CD1   . LEU B 1 154 ? -4.266  -15.539 41.413  1.00 43.29  ? 196 LEU B CD1   1 
ATOM   3352 C CD2   . LEU B 1 154 ? -4.355  -17.172 39.569  1.00 37.29  ? 196 LEU B CD2   1 
ATOM   3353 N N     . LYS B 1 155 ? -7.875  -20.292 42.368  1.00 58.03  ? 197 LYS B N     1 
ATOM   3354 C CA    . LYS B 1 155 ? -8.067  -21.581 43.011  1.00 62.11  ? 197 LYS B CA    1 
ATOM   3355 C C     . LYS B 1 155 ? -8.618  -22.636 42.075  1.00 59.71  ? 197 LYS B C     1 
ATOM   3356 O O     . LYS B 1 155 ? -8.254  -23.808 42.207  1.00 72.25  ? 197 LYS B O     1 
ATOM   3357 C CB    . LYS B 1 155 ? -8.983  -21.418 44.221  1.00 64.47  ? 197 LYS B CB    1 
ATOM   3358 C CG    . LYS B 1 155 ? -8.433  -20.362 45.160  1.00 57.56  ? 197 LYS B CG    1 
ATOM   3359 C CD    . LYS B 1 155 ? -9.061  -20.423 46.523  1.00 58.27  ? 197 LYS B CD    1 
ATOM   3360 C CE    . LYS B 1 155 ? -8.454  -21.498 47.393  1.00 54.37  ? 197 LYS B CE    1 
ATOM   3361 N NZ    . LYS B 1 155 ? -9.190  -21.487 48.702  1.00 44.00  ? 197 LYS B NZ    1 
ATOM   3362 N N     . GLY B 1 156 ? -9.457  -22.252 41.115  1.00 61.23  ? 198 GLY B N     1 
ATOM   3363 C CA    . GLY B 1 156 ? -9.812  -23.169 40.040  1.00 69.67  ? 198 GLY B CA    1 
ATOM   3364 C C     . GLY B 1 156 ? -8.628  -23.632 39.216  1.00 69.06  ? 198 GLY B C     1 
ATOM   3365 O O     . GLY B 1 156 ? -8.778  -24.561 38.409  1.00 73.34  ? 198 GLY B O     1 
ATOM   3366 N N     . LEU B 1 157 ? -7.459  -23.014 39.416  1.00 61.85  ? 199 LEU B N     1 
ATOM   3367 C CA    . LEU B 1 157 ? -6.218  -23.289 38.697  1.00 65.46  ? 199 LEU B CA    1 
ATOM   3368 C C     . LEU B 1 157 ? -5.203  -24.050 39.540  1.00 61.62  ? 199 LEU B C     1 
ATOM   3369 O O     . LEU B 1 157 ? -4.635  -25.054 39.088  1.00 56.65  ? 199 LEU B O     1 
ATOM   3370 C CB    . LEU B 1 157 ? -5.588  -21.972 38.217  1.00 56.53  ? 199 LEU B CB    1 
ATOM   3371 C CG    . LEU B 1 157 ? -6.204  -21.120 37.101  1.00 59.04  ? 199 LEU B CG    1 
ATOM   3372 C CD1   . LEU B 1 157 ? -5.375  -19.876 36.877  1.00 59.69  ? 199 LEU B CD1   1 
ATOM   3373 C CD2   . LEU B 1 157 ? -6.438  -21.891 35.788  1.00 61.08  ? 199 LEU B CD2   1 
ATOM   3374 N N     . ALA B 1 158 ? -4.946  -23.573 40.761  1.00 67.03  ? 200 ALA B N     1 
ATOM   3375 C CA    . ALA B 1 158 ? -3.934  -24.201 41.603  1.00 70.26  ? 200 ALA B CA    1 
ATOM   3376 C C     . ALA B 1 158 ? -4.378  -25.559 42.121  1.00 70.46  ? 200 ALA B C     1 
ATOM   3377 O O     . ALA B 1 158 ? -3.532  -26.337 42.576  1.00 81.69  ? 200 ALA B O     1 
ATOM   3378 C CB    . ALA B 1 158 ? -3.574  -23.291 42.773  1.00 64.17  ? 200 ALA B CB    1 
ATOM   3379 N N     . SER B 1 159 ? -5.678  -25.859 42.061  1.00 59.38  ? 201 SER B N     1 
ATOM   3380 C CA    . SER B 1 159 ? -6.190  -27.161 42.453  1.00 59.46  ? 201 SER B CA    1 
ATOM   3381 C C     . SER B 1 159 ? -5.880  -28.245 41.436  1.00 67.62  ? 201 SER B C     1 
ATOM   3382 O O     . SER B 1 159 ? -6.026  -29.428 41.763  1.00 72.13  ? 201 SER B O     1 
ATOM   3383 C CB    . SER B 1 159 ? -7.704  -27.096 42.654  1.00 66.16  ? 201 SER B CB    1 
ATOM   3384 O OG    . SER B 1 159 ? -8.366  -26.825 41.423  1.00 71.32  ? 201 SER B OG    1 
ATOM   3385 N N     . ARG B 1 160 ? -5.464  -27.872 40.214  1.00 70.47  ? 202 ARG B N     1 
ATOM   3386 C CA    . ARG B 1 160 ? -5.226  -28.827 39.135  1.00 68.29  ? 202 ARG B CA    1 
ATOM   3387 C C     . ARG B 1 160 ? -3.777  -28.879 38.656  1.00 73.57  ? 202 ARG B C     1 
ATOM   3388 O O     . ARG B 1 160 ? -3.410  -29.842 37.972  1.00 82.47  ? 202 ARG B O     1 
ATOM   3389 C CB    . ARG B 1 160 ? -6.149  -28.518 37.938  1.00 61.18  ? 202 ARG B CB    1 
ATOM   3390 C CG    . ARG B 1 160 ? -7.649  -28.370 38.316  1.00 67.45  ? 202 ARG B CG    1 
ATOM   3391 C CD    . ARG B 1 160 ? -8.462  -27.693 37.220  1.00 59.39  ? 202 ARG B CD    1 
ATOM   3392 N NE    . ARG B 1 160 ? -7.781  -26.470 36.803  1.00 78.29  ? 202 ARG B NE    1 
ATOM   3393 C CZ    . ARG B 1 160 ? -7.831  -25.928 35.587  1.00 71.41  ? 202 ARG B CZ    1 
ATOM   3394 N NH1   . ARG B 1 160 ? -8.555  -26.478 34.611  1.00 72.18  ? 202 ARG B NH1   1 
ATOM   3395 N NH2   . ARG B 1 160 ? -7.146  -24.824 35.349  1.00 58.64  ? 202 ARG B NH2   1 
ATOM   3396 N N     . LYS B 1 161 ? -2.941  -27.889 39.002  1.00 71.29  ? 203 LYS B N     1 
ATOM   3397 C CA    . LYS B 1 161 ? -1.549  -27.789 38.562  1.00 59.16  ? 203 LYS B CA    1 
ATOM   3398 C C     . LYS B 1 161 ? -0.821  -26.741 39.395  1.00 57.13  ? 203 LYS B C     1 
ATOM   3399 O O     . LYS B 1 161 ? -1.455  -25.820 39.939  1.00 47.11  ? 203 LYS B O     1 
ATOM   3400 C CB    . LYS B 1 161 ? -1.462  -27.417 37.078  1.00 54.05  ? 203 LYS B CB    1 
ATOM   3401 C CG    . LYS B 1 161 ? -0.973  -28.534 36.144  1.00 59.17  ? 203 LYS B CG    1 
ATOM   3402 C CD    . LYS B 1 161 ? -1.499  -28.304 34.716  1.00 50.98  ? 203 LYS B CD    1 
ATOM   3403 C CE    . LYS B 1 161 ? -0.513  -28.685 33.642  1.00 48.53  ? 203 LYS B CE    1 
ATOM   3404 N NZ    . LYS B 1 161 ? -0.200  -30.138 33.579  1.00 50.38  ? 203 LYS B NZ    1 
ATOM   3405 N N     . PRO B 1 162 ? 0.503   -26.839 39.515  1.00 49.83  ? 204 PRO B N     1 
ATOM   3406 C CA    . PRO B 1 162 ? 1.257   -25.759 40.161  1.00 46.77  ? 204 PRO B CA    1 
ATOM   3407 C C     . PRO B 1 162 ? 1.105   -24.463 39.380  1.00 43.70  ? 204 PRO B C     1 
ATOM   3408 O O     . PRO B 1 162 ? 1.111   -24.450 38.148  1.00 42.70  ? 204 PRO B O     1 
ATOM   3409 C CB    . PRO B 1 162 ? 2.705   -26.264 40.145  1.00 42.66  ? 204 PRO B CB    1 
ATOM   3410 C CG    . PRO B 1 162 ? 2.586   -27.748 39.961  1.00 51.01  ? 204 PRO B CG    1 
ATOM   3411 C CD    . PRO B 1 162 ? 1.373   -27.954 39.108  1.00 48.83  ? 204 PRO B CD    1 
ATOM   3412 N N     . LEU B 1 163 ? 0.972   -23.371 40.119  1.00 46.01  ? 205 LEU B N     1 
ATOM   3413 C CA    . LEU B 1 163 ? 0.694   -22.055 39.572  1.00 41.51  ? 205 LEU B CA    1 
ATOM   3414 C C     . LEU B 1 163 ? 1.957   -21.191 39.604  1.00 41.22  ? 205 LEU B C     1 
ATOM   3415 O O     . LEU B 1 163 ? 2.719   -21.219 40.576  1.00 42.68  ? 205 LEU B O     1 
ATOM   3416 C CB    . LEU B 1 163 ? -0.440  -21.409 40.378  1.00 40.25  ? 205 LEU B CB    1 
ATOM   3417 C CG    . LEU B 1 163 ? -1.129  -20.154 39.846  1.00 45.27  ? 205 LEU B CG    1 
ATOM   3418 C CD1   . LEU B 1 163 ? -0.278  -18.922 40.088  1.00 47.60  ? 205 LEU B CD1   1 
ATOM   3419 C CD2   . LEU B 1 163 ? -1.381  -20.317 38.370  1.00 51.39  ? 205 LEU B CD2   1 
ATOM   3420 N N     . VAL B 1 164 ? 2.190   -20.446 38.525  1.00 37.66  ? 206 VAL B N     1 
ATOM   3421 C CA    . VAL B 1 164 ? 3.146   -19.340 38.505  1.00 33.14  ? 206 VAL B CA    1 
ATOM   3422 C C     . VAL B 1 164 ? 2.361   -18.114 38.065  1.00 36.42  ? 206 VAL B C     1 
ATOM   3423 O O     . VAL B 1 164 ? 1.737   -18.118 36.995  1.00 34.30  ? 206 VAL B O     1 
ATOM   3424 C CB    . VAL B 1 164 ? 4.351   -19.613 37.576  1.00 39.51  ? 206 VAL B CB    1 
ATOM   3425 C CG1   . VAL B 1 164 ? 5.344   -18.441 37.550  1.00 27.66  ? 206 VAL B CG1   1 
ATOM   3426 C CG2   . VAL B 1 164 ? 5.102   -20.845 38.025  1.00 38.77  ? 206 VAL B CG2   1 
ATOM   3427 N N     . LEU B 1 165 ? 2.338   -17.094 38.915  1.00 38.16  ? 207 LEU B N     1 
ATOM   3428 C CA    . LEU B 1 165 ? 1.657   -15.832 38.648  1.00 34.60  ? 207 LEU B CA    1 
ATOM   3429 C C     . LEU B 1 165 ? 2.702   -14.729 38.618  1.00 40.91  ? 207 LEU B C     1 
ATOM   3430 O O     . LEU B 1 165 ? 3.383   -14.483 39.623  1.00 34.17  ? 207 LEU B O     1 
ATOM   3431 C CB    . LEU B 1 165 ? 0.599   -15.522 39.707  1.00 35.38  ? 207 LEU B CB    1 
ATOM   3432 C CG    . LEU B 1 165 ? 0.111   -14.061 39.814  1.00 46.16  ? 207 LEU B CG    1 
ATOM   3433 C CD1   . LEU B 1 165 ? -0.478  -13.540 38.481  1.00 35.17  ? 207 LEU B CD1   1 
ATOM   3434 C CD2   . LEU B 1 165 ? -0.881  -13.854 40.995  1.00 29.53  ? 207 LEU B CD2   1 
ATOM   3435 N N     . CYS B 1 166 ? 2.827   -14.072 37.467  1.00 41.72  ? 208 CYS B N     1 
ATOM   3436 C CA    . CYS B 1 166 ? 3.716   -12.934 37.318  1.00 34.01  ? 208 CYS B CA    1 
ATOM   3437 C C     . CYS B 1 166 ? 2.946   -11.735 36.780  1.00 31.66  ? 208 CYS B C     1 
ATOM   3438 O O     . CYS B 1 166 ? 1.787   -11.832 36.361  1.00 30.92  ? 208 CYS B O     1 
ATOM   3439 C CB    . CYS B 1 166 ? 4.896   -13.273 36.408  1.00 39.05  ? 208 CYS B CB    1 
ATOM   3440 S SG    . CYS B 1 166 ? 4.498   -13.253 34.653  1.00 37.85  ? 208 CYS B SG    1 
ATOM   3441 N N     . GLY B 1 167 ? 3.599   -10.587 36.819  1.00 31.96  ? 209 GLY B N     1 
ATOM   3442 C CA    . GLY B 1 167 ? 3.039   -9.382  36.265  1.00 30.16  ? 209 GLY B CA    1 
ATOM   3443 C C     . GLY B 1 167 ? 3.056   -8.244  37.260  1.00 38.45  ? 209 GLY B C     1 
ATOM   3444 O O     . GLY B 1 167 ? 3.628   -8.337  38.357  1.00 38.43  ? 209 GLY B O     1 
ATOM   3445 N N     . ASP B 1 168 ? 2.410   -7.152  36.851  1.00 32.87  ? 210 ASP B N     1 
ATOM   3446 C CA    . ASP B 1 168 ? 2.215   -5.967  37.671  1.00 36.50  ? 210 ASP B CA    1 
ATOM   3447 C C     . ASP B 1 168 ? 1.009   -6.209  38.580  1.00 40.89  ? 210 ASP B C     1 
ATOM   3448 O O     . ASP B 1 168 ? -0.148  -6.059  38.171  1.00 37.76  ? 210 ASP B O     1 
ATOM   3449 C CB    . ASP B 1 168 ? 2.038   -4.739  36.781  1.00 35.45  ? 210 ASP B CB    1 
ATOM   3450 C CG    . ASP B 1 168 ? 1.977   -3.433  37.568  1.00 39.78  ? 210 ASP B CG    1 
ATOM   3451 O OD1   . ASP B 1 168 ? 2.011   -3.490  38.812  1.00 44.14  ? 210 ASP B OD1   1 
ATOM   3452 O OD2   . ASP B 1 168 ? 1.889   -2.345  36.952  1.00 41.19  ? 210 ASP B OD2   1 
ATOM   3453 N N     . LEU B 1 169 ? 1.283   -6.570  39.832  1.00 39.13  ? 211 LEU B N     1 
ATOM   3454 C CA    . LEU B 1 169 ? 0.226   -6.772  40.808  1.00 38.58  ? 211 LEU B CA    1 
ATOM   3455 C C     . LEU B 1 169 ? -0.173  -5.490  41.539  1.00 31.81  ? 211 LEU B C     1 
ATOM   3456 O O     . LEU B 1 169 ? -1.162  -5.499  42.275  1.00 28.75  ? 211 LEU B O     1 
ATOM   3457 C CB    . LEU B 1 169 ? 0.643   -7.875  41.789  1.00 37.88  ? 211 LEU B CB    1 
ATOM   3458 C CG    . LEU B 1 169 ? 0.665   -9.228  41.044  1.00 46.14  ? 211 LEU B CG    1 
ATOM   3459 C CD1   . LEU B 1 169 ? 1.850   -10.096 41.418  1.00 44.06  ? 211 LEU B CD1   1 
ATOM   3460 C CD2   . LEU B 1 169 ? -0.642  -10.017 41.208  1.00 42.33  ? 211 LEU B CD2   1 
ATOM   3461 N N     . ASN B 1 170 ? 0.556   -4.395  41.343  1.00 35.86  ? 212 ASN B N     1 
ATOM   3462 C CA    . ASN B 1 170 ? 0.090   -3.046  41.693  1.00 35.79  ? 212 ASN B CA    1 
ATOM   3463 C C     . ASN B 1 170 ? -0.103  -2.851  43.198  1.00 35.71  ? 212 ASN B C     1 
ATOM   3464 O O     . ASN B 1 170 ? -1.097  -2.283  43.664  1.00 38.01  ? 212 ASN B O     1 
ATOM   3465 C CB    . ASN B 1 170 ? -1.186  -2.700  40.931  1.00 35.83  ? 212 ASN B CB    1 
ATOM   3466 C CG    . ASN B 1 170 ? -0.936  -1.692  39.832  1.00 38.53  ? 212 ASN B CG    1 
ATOM   3467 O OD1   . ASN B 1 170 ? -0.178  -0.735  40.018  1.00 38.09  ? 212 ASN B OD1   1 
ATOM   3468 N ND2   . ASN B 1 170 ? -1.552  -1.908  38.671  1.00 39.58  ? 212 ASN B ND2   1 
ATOM   3469 N N     . VAL B 1 171 ? 0.893   -3.284  43.955  1.00 31.61  ? 213 VAL B N     1 
ATOM   3470 C CA    . VAL B 1 171 ? 0.880   -3.193  45.404  1.00 38.73  ? 213 VAL B CA    1 
ATOM   3471 C C     . VAL B 1 171 ? 2.283   -3.490  45.920  1.00 39.31  ? 213 VAL B C     1 
ATOM   3472 O O     . VAL B 1 171 ? 2.977   -4.373  45.404  1.00 37.07  ? 213 VAL B O     1 
ATOM   3473 C CB    . VAL B 1 171 ? -0.158  -4.148  46.011  1.00 34.28  ? 213 VAL B CB    1 
ATOM   3474 C CG1   . VAL B 1 171 ? 0.203   -5.588  45.670  1.00 37.84  ? 213 VAL B CG1   1 
ATOM   3475 C CG2   . VAL B 1 171 ? -0.238  -3.929  47.499  1.00 39.39  ? 213 VAL B CG2   1 
ATOM   3476 N N     . ALA B 1 172 ? 2.735   -2.714  46.902  1.00 45.81  ? 214 ALA B N     1 
ATOM   3477 C CA    . ALA B 1 172 ? 3.946   -3.045  47.644  1.00 44.09  ? 214 ALA B CA    1 
ATOM   3478 C C     . ALA B 1 172 ? 3.477   -3.776  48.889  1.00 48.60  ? 214 ALA B C     1 
ATOM   3479 O O     . ALA B 1 172 ? 2.720   -3.218  49.692  1.00 51.73  ? 214 ALA B O     1 
ATOM   3480 C CB    . ALA B 1 172 ? 4.761   -1.799  47.975  1.00 45.98  ? 214 ALA B CB    1 
ATOM   3481 N N     . HIS B 1 173 ? 3.848   -5.048  49.001  1.00 47.48  ? 215 HIS B N     1 
ATOM   3482 C CA    . HIS B 1 173 ? 3.306   -5.888  50.059  1.00 48.48  ? 215 HIS B CA    1 
ATOM   3483 C C     . HIS B 1 173 ? 3.582   -5.256  51.415  1.00 50.91  ? 215 HIS B C     1 
ATOM   3484 O O     . HIS B 1 173 ? 2.662   -4.820  52.116  1.00 51.35  ? 215 HIS B O     1 
ATOM   3485 C CB    . HIS B 1 173 ? 3.916   -7.282  49.995  1.00 46.58  ? 215 HIS B CB    1 
ATOM   3486 C CG    . HIS B 1 173 ? 3.382   -8.224  51.026  1.00 53.55  ? 215 HIS B CG    1 
ATOM   3487 N ND1   . HIS B 1 173 ? 2.116   -8.101  51.565  1.00 53.82  ? 215 HIS B ND1   1 
ATOM   3488 C CD2   . HIS B 1 173 ? 3.939   -9.311  51.611  1.00 47.97  ? 215 HIS B CD2   1 
ATOM   3489 C CE1   . HIS B 1 173 ? 1.918   -9.073  52.437  1.00 54.01  ? 215 HIS B CE1   1 
ATOM   3490 N NE2   . HIS B 1 173 ? 3.008   -9.819  52.484  1.00 55.13  ? 215 HIS B NE2   1 
ATOM   3491 N N     . GLU B 1 174 ? 4.855   -5.177  51.768  1.00 51.88  ? 216 GLU B N     1 
ATOM   3492 C CA    . GLU B 1 174 ? 5.287   -4.627  53.036  1.00 49.30  ? 216 GLU B CA    1 
ATOM   3493 C C     . GLU B 1 174 ? 6.065   -3.346  52.801  1.00 52.99  ? 216 GLU B C     1 
ATOM   3494 O O     . GLU B 1 174 ? 6.408   -2.986  51.662  1.00 50.16  ? 216 GLU B O     1 
ATOM   3495 C CB    . GLU B 1 174 ? 6.134   -5.641  53.810  1.00 48.83  ? 216 GLU B CB    1 
ATOM   3496 C CG    . GLU B 1 174 ? 5.375   -6.911  54.173  1.00 48.77  ? 216 GLU B CG    1 
ATOM   3497 C CD    . GLU B 1 174 ? 4.329   -6.690  55.254  1.00 53.15  ? 216 GLU B CD    1 
ATOM   3498 O OE1   . GLU B 1 174 ? 3.676   -7.681  55.638  1.00 62.05  ? 216 GLU B OE1   1 
ATOM   3499 O OE2   . GLU B 1 174 ? 4.160   -5.538  55.725  1.00 54.45  ? 216 GLU B OE2   1 
ATOM   3500 N N     . GLU B 1 175 ? 6.336   -2.664  53.918  1.00 57.25  ? 217 GLU B N     1 
ATOM   3501 C CA    . GLU B 1 175 ? 7.069   -1.404  53.886  1.00 56.06  ? 217 GLU B CA    1 
ATOM   3502 C C     . GLU B 1 175 ? 8.437   -1.566  53.219  1.00 46.69  ? 217 GLU B C     1 
ATOM   3503 O O     . GLU B 1 175 ? 8.923   -0.634  52.565  1.00 39.93  ? 217 GLU B O     1 
ATOM   3504 C CB    . GLU B 1 175 ? 7.171   -0.847  55.320  1.00 55.07  ? 217 GLU B CB    1 
ATOM   3505 C CG    . GLU B 1 175 ? 5.868   -0.104  55.768  1.00 65.33  ? 217 GLU B CG    1 
ATOM   3506 C CD    . GLU B 1 175 ? 5.741   0.217   57.281  1.00 70.62  ? 217 GLU B CD    1 
ATOM   3507 O OE1   . GLU B 1 175 ? 5.074   -0.574  58.003  1.00 66.99  ? 217 GLU B OE1   1 
ATOM   3508 O OE2   . GLU B 1 175 ? 6.266   1.273   57.734  1.00 57.64  ? 217 GLU B OE2   1 
ATOM   3509 N N     . ILE B 1 176 ? 9.023   -2.763  53.309  1.00 46.04  ? 218 ILE B N     1 
ATOM   3510 C CA    . ILE B 1 176 ? 10.345  -3.030  52.747  1.00 48.04  ? 218 ILE B CA    1 
ATOM   3511 C C     . ILE B 1 176 ? 10.380  -2.816  51.232  1.00 55.26  ? 218 ILE B C     1 
ATOM   3512 O O     . ILE B 1 176 ? 11.441  -2.487  50.670  1.00 57.95  ? 218 ILE B O     1 
ATOM   3513 C CB    . ILE B 1 176 ? 10.788  -4.459  53.122  1.00 47.73  ? 218 ILE B CB    1 
ATOM   3514 C CG1   . ILE B 1 176 ? 12.250  -4.660  52.753  1.00 52.84  ? 218 ILE B CG1   1 
ATOM   3515 C CG2   . ILE B 1 176 ? 9.915   -5.506  52.450  1.00 48.76  ? 218 ILE B CG2   1 
ATOM   3516 C CD1   . ILE B 1 176 ? 13.169  -3.830  53.581  1.00 58.25  ? 218 ILE B CD1   1 
ATOM   3517 N N     . ASP B 1 177 ? 9.228   -2.963  50.556  1.00 51.50  ? 219 ASP B N     1 
ATOM   3518 C CA    . ASP B 1 177 ? 9.138   -2.966  49.104  1.00 50.83  ? 219 ASP B CA    1 
ATOM   3519 C C     . ASP B 1 177 ? 8.841   -1.605  48.492  1.00 54.38  ? 219 ASP B C     1 
ATOM   3520 O O     . ASP B 1 177 ? 8.762   -1.500  47.262  1.00 55.86  ? 219 ASP B O     1 
ATOM   3521 C CB    . ASP B 1 177 ? 8.063   -3.950  48.628  1.00 50.82  ? 219 ASP B CB    1 
ATOM   3522 C CG    . ASP B 1 177 ? 8.051   -5.222  49.402  1.00 51.52  ? 219 ASP B CG    1 
ATOM   3523 O OD1   . ASP B 1 177 ? 7.036   -5.509  50.054  1.00 58.93  ? 219 ASP B OD1   1 
ATOM   3524 O OD2   . ASP B 1 177 ? 9.071   -5.946  49.359  1.00 63.75  ? 219 ASP B OD2   1 
ATOM   3525 N N     . LEU B 1 178 ? 8.645   -0.565  49.284  1.00 58.61  ? 220 LEU B N     1 
ATOM   3526 C CA    . LEU B 1 178 ? 8.577   0.766   48.708  1.00 58.66  ? 220 LEU B CA    1 
ATOM   3527 C C     . LEU B 1 178 ? 9.448   1.691   49.533  1.00 57.16  ? 220 LEU B C     1 
ATOM   3528 O O     . LEU B 1 178 ? 9.733   1.430   50.706  1.00 59.69  ? 220 LEU B O     1 
ATOM   3529 C CB    . LEU B 1 178 ? 7.142   1.318   48.603  1.00 57.88  ? 220 LEU B CB    1 
ATOM   3530 C CG    . LEU B 1 178 ? 6.517   2.029   49.797  1.00 52.77  ? 220 LEU B CG    1 
ATOM   3531 C CD1   . LEU B 1 178 ? 5.295   2.832   49.355  1.00 44.62  ? 220 LEU B CD1   1 
ATOM   3532 C CD2   . LEU B 1 178 ? 6.155   1.007   50.867  1.00 51.99  ? 220 LEU B CD2   1 
ATOM   3533 N N     . ARG B 1 179 ? 9.883   2.768   48.876  1.00 47.50  ? 221 ARG B N     1 
ATOM   3534 C CA    . ARG B 1 179 ? 10.847  3.677   49.469  1.00 52.02  ? 221 ARG B CA    1 
ATOM   3535 C C     . ARG B 1 179 ? 10.212  4.538   50.561  1.00 60.19  ? 221 ARG B C     1 
ATOM   3536 O O     . ARG B 1 179 ? 10.841  4.794   51.597  1.00 56.56  ? 221 ARG B O     1 
ATOM   3537 C CB    . ARG B 1 179 ? 11.458  4.539   48.368  1.00 58.44  ? 221 ARG B CB    1 
ATOM   3538 C CG    . ARG B 1 179 ? 12.966  4.726   48.473  1.00 62.44  ? 221 ARG B CG    1 
ATOM   3539 C CD    . ARG B 1 179 ? 13.288  5.761   49.520  1.00 64.07  ? 221 ARG B CD    1 
ATOM   3540 N NE    . ARG B 1 179 ? 14.600  6.367   49.329  1.00 64.52  ? 221 ARG B NE    1 
ATOM   3541 C CZ    . ARG B 1 179 ? 15.002  7.472   49.957  1.00 78.56  ? 221 ARG B CZ    1 
ATOM   3542 N NH1   . ARG B 1 179 ? 14.186  8.099   50.814  1.00 60.95  ? 221 ARG B NH1   1 
ATOM   3543 N NH2   . ARG B 1 179 ? 16.217  7.960   49.720  1.00 74.13  ? 221 ARG B NH2   1 
ATOM   3544 N N     . ASN B 1 180 ? 8.967   4.986   50.362  1.00 57.35  ? 222 ASN B N     1 
ATOM   3545 C CA    . ASN B 1 180 ? 8.308   5.938   51.262  1.00 45.70  ? 222 ASN B CA    1 
ATOM   3546 C C     . ASN B 1 180 ? 6.971   5.395   51.766  1.00 51.47  ? 222 ASN B C     1 
ATOM   3547 O O     . ASN B 1 180 ? 5.900   5.902   51.396  1.00 53.62  ? 222 ASN B O     1 
ATOM   3548 C CB    . ASN B 1 180 ? 8.081   7.282   50.570  1.00 53.47  ? 222 ASN B CB    1 
ATOM   3549 C CG    . ASN B 1 180 ? 9.322   7.826   49.891  1.00 67.39  ? 222 ASN B CG    1 
ATOM   3550 O OD1   . ASN B 1 180 ? 9.265   8.235   48.739  1.00 71.49  ? 222 ASN B OD1   1 
ATOM   3551 N ND2   . ASN B 1 180 ? 10.442  7.868   50.608  1.00 69.81  ? 222 ASN B ND2   1 
ATOM   3552 N N     . PRO B 1 181 ? 6.990   4.392   52.644  1.00 47.63  ? 223 PRO B N     1 
ATOM   3553 C CA    . PRO B 1 181 ? 5.719   3.941   53.247  1.00 51.68  ? 223 PRO B CA    1 
ATOM   3554 C C     . PRO B 1 181 ? 4.862   5.077   53.807  1.00 65.14  ? 223 PRO B C     1 
ATOM   3555 O O     . PRO B 1 181 ? 3.620   4.981   53.808  1.00 65.62  ? 223 PRO B O     1 
ATOM   3556 C CB    . PRO B 1 181 ? 6.172   2.987   54.360  1.00 52.65  ? 223 PRO B CB    1 
ATOM   3557 C CG    . PRO B 1 181 ? 7.684   2.908   54.284  1.00 48.81  ? 223 PRO B CG    1 
ATOM   3558 C CD    . PRO B 1 181 ? 8.129   3.532   53.009  1.00 45.82  ? 223 PRO B CD    1 
ATOM   3559 N N     . LYS B 1 182 ? 5.507   6.168   54.246  1.00 64.45  ? 224 LYS B N     1 
ATOM   3560 C CA    . LYS B 1 182 ? 4.902   7.284   54.968  1.00 62.16  ? 224 LYS B CA    1 
ATOM   3561 C C     . LYS B 1 182 ? 3.664   7.889   54.311  1.00 73.00  ? 224 LYS B C     1 
ATOM   3562 O O     . LYS B 1 182 ? 2.539   7.740   54.814  1.00 64.37  ? 224 LYS B O     1 
ATOM   3563 C CB    . LYS B 1 182 ? 5.948   8.385   55.144  1.00 69.42  ? 224 LYS B CB    1 
ATOM   3564 N N     . GLY B 1 183 ? 3.877   8.589   53.196  1.00 66.04  ? 225 GLY B N     1 
ATOM   3565 C CA    . GLY B 1 183 ? 2.847   9.408   52.591  1.00 58.75  ? 225 GLY B CA    1 
ATOM   3566 C C     . GLY B 1 183 ? 2.124   8.682   51.487  1.00 67.05  ? 225 GLY B C     1 
ATOM   3567 O O     . GLY B 1 183 ? 1.474   9.310   50.649  1.00 75.62  ? 225 GLY B O     1 
ATOM   3568 N N     . ASN B 1 184 ? 2.234   7.353   51.479  1.00 67.00  ? 226 ASN B N     1 
ATOM   3569 C CA    . ASN B 1 184 ? 1.530   6.513   50.520  1.00 64.50  ? 226 ASN B CA    1 
ATOM   3570 C C     . ASN B 1 184 ? 0.532   5.574   51.185  1.00 65.60  ? 226 ASN B C     1 
ATOM   3571 O O     . ASN B 1 184 ? -0.100  4.765   50.491  1.00 71.15  ? 226 ASN B O     1 
ATOM   3572 C CB    . ASN B 1 184 ? 2.541   5.732   49.679  1.00 51.29  ? 226 ASN B CB    1 
ATOM   3573 C CG    . ASN B 1 184 ? 3.263   6.620   48.715  1.00 49.99  ? 226 ASN B CG    1 
ATOM   3574 O OD1   . ASN B 1 184 ? 2.642   7.477   48.096  1.00 53.69  ? 226 ASN B OD1   1 
ATOM   3575 N ND2   . ASN B 1 184 ? 4.580   6.445   48.587  1.00 49.08  ? 226 ASN B ND2   1 
ATOM   3576 N N     . LYS B 1 185 ? 0.359   5.669   52.507  1.00 62.16  ? 227 LYS B N     1 
ATOM   3577 C CA    . LYS B 1 185 ? -0.640  4.851   53.180  1.00 55.51  ? 227 LYS B CA    1 
ATOM   3578 C C     . LYS B 1 185 ? -2.041  5.154   52.671  1.00 56.75  ? 227 LYS B C     1 
ATOM   3579 O O     . LYS B 1 185 ? -2.944  4.327   52.849  1.00 64.05  ? 227 LYS B O     1 
ATOM   3580 C CB    . LYS B 1 185 ? -0.533  5.046   54.701  1.00 63.95  ? 227 LYS B CB    1 
ATOM   3581 C CG    . LYS B 1 185 ? -1.821  4.794   55.525  1.00 63.84  ? 227 LYS B CG    1 
ATOM   3582 C CD    . LYS B 1 185 ? -1.509  4.195   56.904  1.00 58.60  ? 227 LYS B CD    1 
ATOM   3583 C CE    . LYS B 1 185 ? -2.682  4.291   57.861  1.00 64.23  ? 227 LYS B CE    1 
ATOM   3584 N NZ    . LYS B 1 185 ? -2.769  5.664   58.447  1.00 59.24  ? 227 LYS B NZ    1 
ATOM   3585 N N     . LYS B 1 186 ? -2.251  6.298   52.013  1.00 47.31  ? 228 LYS B N     1 
ATOM   3586 C CA    . LYS B 1 186 ? -3.514  6.463   51.306  1.00 59.77  ? 228 LYS B CA    1 
ATOM   3587 C C     . LYS B 1 186 ? -3.285  6.859   49.851  1.00 60.76  ? 228 LYS B C     1 
ATOM   3588 O O     . LYS B 1 186 ? -4.102  7.567   49.251  1.00 59.97  ? 228 LYS B O     1 
ATOM   3589 C CB    . LYS B 1 186 ? -4.442  7.441   52.029  1.00 60.43  ? 228 LYS B CB    1 
ATOM   3590 N N     . ASN B 1 187 ? -2.200  6.362   49.260  1.00 59.09  ? 229 ASN B N     1 
ATOM   3591 C CA    . ASN B 1 187 ? -1.940  6.483   47.833  1.00 61.32  ? 229 ASN B CA    1 
ATOM   3592 C C     . ASN B 1 187 ? -1.959  5.112   47.169  1.00 57.32  ? 229 ASN B C     1 
ATOM   3593 O O     . ASN B 1 187 ? -1.457  4.135   47.738  1.00 53.18  ? 229 ASN B O     1 
ATOM   3594 C CB    . ASN B 1 187 ? -0.598  7.162   47.573  1.00 57.32  ? 229 ASN B CB    1 
ATOM   3595 C CG    . ASN B 1 187 ? -0.709  8.672   47.577  1.00 62.81  ? 229 ASN B CG    1 
ATOM   3596 O OD1   . ASN B 1 187 ? -1.808  9.230   47.499  1.00 63.43  ? 229 ASN B OD1   1 
ATOM   3597 N ND2   . ASN B 1 187 ? 0.433   9.347   47.664  1.00 63.18  ? 229 ASN B ND2   1 
ATOM   3598 N N     . ALA B 1 188 ? -2.534  5.059   45.956  1.00 58.31  ? 230 ALA B N     1 
ATOM   3599 C CA    . ALA B 1 188 ? -2.719  3.810   45.212  1.00 49.38  ? 230 ALA B CA    1 
ATOM   3600 C C     . ALA B 1 188 ? -1.437  3.006   45.183  1.00 40.73  ? 230 ALA B C     1 
ATOM   3601 O O     . ALA B 1 188 ? -0.391  3.497   44.754  1.00 46.35  ? 230 ALA B O     1 
ATOM   3602 C CB    . ALA B 1 188 ? -3.186  4.096   43.783  1.00 48.64  ? 230 ALA B CB    1 
ATOM   3603 N N     . GLY B 1 189 ? -1.521  1.775   45.665  1.00 41.65  ? 231 GLY B N     1 
ATOM   3604 C CA    . GLY B 1 189 ? -0.376  0.888   45.744  1.00 44.81  ? 231 GLY B CA    1 
ATOM   3605 C C     . GLY B 1 189 ? -0.195  0.395   47.160  1.00 50.14  ? 231 GLY B C     1 
ATOM   3606 O O     . GLY B 1 189 ? 0.273   -0.741  47.344  1.00 37.48  ? 231 GLY B O     1 
ATOM   3607 N N     . PHE B 1 190 ? -0.561  1.206   48.164  1.00 52.44  ? 232 PHE B N     1 
ATOM   3608 C CA    . PHE B 1 190 ? -0.235  0.902   49.550  1.00 52.71  ? 232 PHE B CA    1 
ATOM   3609 C C     . PHE B 1 190 ? -1.306  1.237   50.578  1.00 55.43  ? 232 PHE B C     1 
ATOM   3610 O O     . PHE B 1 190 ? -1.001  1.386   51.769  1.00 51.04  ? 232 PHE B O     1 
ATOM   3611 C CB    . PHE B 1 190 ? 1.002   1.765   49.814  1.00 52.94  ? 232 PHE B CB    1 
ATOM   3612 C CG    . PHE B 1 190 ? 1.928   1.192   50.857  1.00 57.05  ? 232 PHE B CG    1 
ATOM   3613 C CD1   . PHE B 1 190 ? 2.399   -0.109  50.749  1.00 52.31  ? 232 PHE B CD1   1 
ATOM   3614 C CD2   . PHE B 1 190 ? 2.325   1.957   51.950  1.00 55.38  ? 232 PHE B CD2   1 
ATOM   3615 C CE1   . PHE B 1 190 ? 3.256   -0.635  51.697  1.00 54.80  ? 232 PHE B CE1   1 
ATOM   3616 C CE2   . PHE B 1 190 ? 3.180   1.437   52.910  1.00 48.74  ? 232 PHE B CE2   1 
ATOM   3617 C CZ    . PHE B 1 190 ? 3.640   0.139   52.790  1.00 58.85  ? 232 PHE B CZ    1 
ATOM   3618 N N     . THR B 1 191 ? -2.559  1.368   50.143  1.00 53.40  ? 233 THR B N     1 
ATOM   3619 C CA    . THR B 1 191 ? -3.630  1.424   51.126  1.00 51.11  ? 233 THR B CA    1 
ATOM   3620 C C     . THR B 1 191 ? -3.696  0.089   51.854  1.00 55.33  ? 233 THR B C     1 
ATOM   3621 O O     . THR B 1 191 ? -3.144  -0.908  51.378  1.00 46.60  ? 233 THR B O     1 
ATOM   3622 C CB    . THR B 1 191 ? -4.951  1.720   50.444  1.00 56.52  ? 233 THR B CB    1 
ATOM   3623 O OG1   . THR B 1 191 ? -5.371  0.560   49.710  1.00 54.08  ? 233 THR B OG1   1 
ATOM   3624 C CG2   . THR B 1 191 ? -4.802  2.918   49.508  1.00 53.60  ? 233 THR B CG2   1 
ATOM   3625 N N     . PRO B 1 192 ? -4.328  0.060   53.024  1.00 66.62  ? 234 PRO B N     1 
ATOM   3626 C CA    . PRO B 1 192 ? -4.414  -1.208  53.752  1.00 56.52  ? 234 PRO B CA    1 
ATOM   3627 C C     . PRO B 1 192 ? -5.235  -2.252  53.052  1.00 51.17  ? 234 PRO B C     1 
ATOM   3628 O O     . PRO B 1 192 ? -5.038  -3.445  53.324  1.00 53.62  ? 234 PRO B O     1 
ATOM   3629 C CB    . PRO B 1 192 ? -5.034  -0.801  55.095  1.00 65.11  ? 234 PRO B CB    1 
ATOM   3630 C CG    . PRO B 1 192 ? -4.610  0.608   55.265  1.00 56.93  ? 234 PRO B CG    1 
ATOM   3631 C CD    . PRO B 1 192 ? -4.627  1.212   53.898  1.00 59.66  ? 234 PRO B CD    1 
ATOM   3632 N N     . GLN B 1 193 ? -6.132  -1.862  52.141  1.00 58.06  ? 235 GLN B N     1 
ATOM   3633 C CA    . GLN B 1 193 ? -6.909  -2.866  51.412  1.00 61.28  ? 235 GLN B CA    1 
ATOM   3634 C C     . GLN B 1 193 ? -6.035  -3.606  50.411  1.00 53.78  ? 235 GLN B C     1 
ATOM   3635 O O     . GLN B 1 193 ? -6.077  -4.839  50.317  1.00 52.97  ? 235 GLN B O     1 
ATOM   3636 C CB    . GLN B 1 193 ? -8.093  -2.201  50.697  1.00 56.36  ? 235 GLN B CB    1 
ATOM   3637 C CG    . GLN B 1 193 ? -9.092  -1.542  51.629  1.00 63.52  ? 235 GLN B CG    1 
ATOM   3638 C CD    . GLN B 1 193 ? -8.581  -0.227  52.248  1.00 69.93  ? 235 GLN B CD    1 
ATOM   3639 O OE1   . GLN B 1 193 ? -7.676  0.418   51.722  1.00 69.14  ? 235 GLN B OE1   1 
ATOM   3640 N NE2   . GLN B 1 193 ? -9.151  0.152   53.384  1.00 64.53  ? 235 GLN B NE2   1 
ATOM   3641 N N     . GLU B 1 194 ? -5.232  -2.862  49.656  1.00 45.91  ? 236 GLU B N     1 
ATOM   3642 C CA    . GLU B 1 194 ? -4.307  -3.505  48.738  1.00 48.43  ? 236 GLU B CA    1 
ATOM   3643 C C     . GLU B 1 194 ? -3.329  -4.399  49.490  1.00 51.31  ? 236 GLU B C     1 
ATOM   3644 O O     . GLU B 1 194 ? -3.066  -5.536  49.074  1.00 51.87  ? 236 GLU B O     1 
ATOM   3645 C CB    . GLU B 1 194 ? -3.555  -2.444  47.933  1.00 48.36  ? 236 GLU B CB    1 
ATOM   3646 C CG    . GLU B 1 194 ? -4.368  -1.709  46.863  1.00 45.93  ? 236 GLU B CG    1 
ATOM   3647 C CD    . GLU B 1 194 ? -4.085  -0.215  46.865  1.00 53.44  ? 236 GLU B CD    1 
ATOM   3648 O OE1   . GLU B 1 194 ? -4.254  0.404   47.919  1.00 60.66  ? 236 GLU B OE1   1 
ATOM   3649 O OE2   . GLU B 1 194 ? -3.675  0.344   45.834  1.00 56.46  ? 236 GLU B OE2   1 
ATOM   3650 N N     . ARG B 1 195 ? -2.778  -3.900  50.600  1.00 43.94  ? 237 ARG B N     1 
ATOM   3651 C CA    . ARG B 1 195 ? -1.800  -4.672  51.354  1.00 41.92  ? 237 ARG B CA    1 
ATOM   3652 C C     . ARG B 1 195 ? -2.421  -5.930  51.954  1.00 44.53  ? 237 ARG B C     1 
ATOM   3653 O O     . ARG B 1 195 ? -1.787  -6.990  51.970  1.00 46.50  ? 237 ARG B O     1 
ATOM   3654 C CB    . ARG B 1 195 ? -1.157  -3.792  52.420  1.00 42.16  ? 237 ARG B CB    1 
ATOM   3655 C CG    . ARG B 1 195 ? -0.353  -2.647  51.831  1.00 49.58  ? 237 ARG B CG    1 
ATOM   3656 C CD    . ARG B 1 195 ? 0.383   -1.853  52.880  1.00 44.24  ? 237 ARG B CD    1 
ATOM   3657 N NE    . ARG B 1 195 ? 1.333   -2.669  53.636  1.00 55.95  ? 237 ARG B NE    1 
ATOM   3658 C CZ    . ARG B 1 195 ? 1.934   -2.275  54.768  1.00 62.22  ? 237 ARG B CZ    1 
ATOM   3659 N NH1   . ARG B 1 195 ? 1.686   -1.075  55.286  1.00 48.89  ? 237 ARG B NH1   1 
ATOM   3660 N NH2   . ARG B 1 195 ? 2.775   -3.087  55.400  1.00 49.84  ? 237 ARG B NH2   1 
ATOM   3661 N N     . GLN B 1 196 ? -3.665  -5.852  52.415  1.00 43.96  ? 238 GLN B N     1 
ATOM   3662 C CA    . GLN B 1 196 ? -4.352  -7.069  52.837  1.00 52.36  ? 238 GLN B CA    1 
ATOM   3663 C C     . GLN B 1 196 ? -4.731  -7.945  51.652  1.00 50.80  ? 238 GLN B C     1 
ATOM   3664 O O     . GLN B 1 196 ? -4.666  -9.178  51.752  1.00 48.02  ? 238 GLN B O     1 
ATOM   3665 C CB    . GLN B 1 196 ? -5.595  -6.731  53.657  1.00 58.09  ? 238 GLN B CB    1 
ATOM   3666 C CG    . GLN B 1 196 ? -5.290  -5.972  54.931  1.00 73.68  ? 238 GLN B CG    1 
ATOM   3667 C CD    . GLN B 1 196 ? -6.142  -6.448  56.088  1.00 78.00  ? 238 GLN B CD    1 
ATOM   3668 O OE1   . GLN B 1 196 ? -7.361  -6.578  55.960  1.00 78.93  ? 238 GLN B OE1   1 
ATOM   3669 N NE2   . GLN B 1 196 ? -5.504  -6.716  57.219  1.00 69.77  ? 238 GLN B NE2   1 
ATOM   3670 N N     . GLY B 1 197 ? -5.159  -7.331  50.540  1.00 44.13  ? 239 GLY B N     1 
ATOM   3671 C CA    . GLY B 1 197 ? -5.459  -8.110  49.347  1.00 47.58  ? 239 GLY B CA    1 
ATOM   3672 C C     . GLY B 1 197 ? -4.342  -9.073  48.991  1.00 47.76  ? 239 GLY B C     1 
ATOM   3673 O O     . GLY B 1 197 ? -4.565  -10.273 48.805  1.00 47.35  ? 239 GLY B O     1 
ATOM   3674 N N     . PHE B 1 198 ? -3.115  -8.559  48.933  1.00 43.22  ? 240 PHE B N     1 
ATOM   3675 C CA    . PHE B 1 198 ? -1.953  -9.387  48.645  1.00 43.60  ? 240 PHE B CA    1 
ATOM   3676 C C     . PHE B 1 198 ? -1.833  -10.531 49.645  1.00 50.35  ? 240 PHE B C     1 
ATOM   3677 O O     . PHE B 1 198 ? -1.590  -11.688 49.265  1.00 50.94  ? 240 PHE B O     1 
ATOM   3678 C CB    . PHE B 1 198 ? -0.704  -8.510  48.685  1.00 45.34  ? 240 PHE B CB    1 
ATOM   3679 C CG    . PHE B 1 198 ? 0.441   -9.048  47.903  1.00 47.78  ? 240 PHE B CG    1 
ATOM   3680 C CD1   . PHE B 1 198 ? 0.327   -9.241  46.531  1.00 45.09  ? 240 PHE B CD1   1 
ATOM   3681 C CD2   . PHE B 1 198 ? 1.646   -9.333  48.525  1.00 42.06  ? 240 PHE B CD2   1 
ATOM   3682 C CE1   . PHE B 1 198 ? 1.395   -9.728  45.793  1.00 49.54  ? 240 PHE B CE1   1 
ATOM   3683 C CE2   . PHE B 1 198 ? 2.731   -9.818  47.795  1.00 46.56  ? 240 PHE B CE2   1 
ATOM   3684 C CZ    . PHE B 1 198 ? 2.606   -10.015 46.420  1.00 47.67  ? 240 PHE B CZ    1 
ATOM   3685 N N     . GLY B 1 199 ? -1.995  -10.216 50.936  1.00 47.79  ? 241 GLY B N     1 
ATOM   3686 C CA    . GLY B 1 199 ? -1.915  -11.238 51.966  1.00 40.90  ? 241 GLY B CA    1 
ATOM   3687 C C     . GLY B 1 199 ? -2.970  -12.322 51.826  1.00 41.64  ? 241 GLY B C     1 
ATOM   3688 O O     . GLY B 1 199 ? -2.684  -13.501 52.060  1.00 42.20  ? 241 GLY B O     1 
ATOM   3689 N N     . GLU B 1 200 ? -4.213  -11.941 51.464  1.00 35.24  ? 242 GLU B N     1 
ATOM   3690 C CA    . GLU B 1 200 ? -5.232  -12.952 51.193  1.00 43.49  ? 242 GLU B CA    1 
ATOM   3691 C C     . GLU B 1 200 ? -4.866  -13.766 49.969  1.00 49.30  ? 242 GLU B C     1 
ATOM   3692 O O     . GLU B 1 200 ? -5.121  -14.976 49.910  1.00 46.03  ? 242 GLU B O     1 
ATOM   3693 C CB    . GLU B 1 200 ? -6.615  -12.345 51.009  1.00 52.56  ? 242 GLU B CB    1 
ATOM   3694 C CG    . GLU B 1 200 ? -6.945  -11.245 51.979  1.00 56.73  ? 242 GLU B CG    1 
ATOM   3695 C CD    . GLU B 1 200 ? -8.281  -10.571 51.695  1.00 63.22  ? 242 GLU B CD    1 
ATOM   3696 O OE1   . GLU B 1 200 ? -8.288  -9.571  50.942  1.00 66.84  ? 242 GLU B OE1   1 
ATOM   3697 O OE2   . GLU B 1 200 ? -9.308  -11.025 52.253  1.00 63.83  ? 242 GLU B OE2   1 
ATOM   3698 N N     . LEU B 1 201 ? -4.285  -13.113 48.963  1.00 49.08  ? 243 LEU B N     1 
ATOM   3699 C CA    . LEU B 1 201 ? -3.827  -13.810 47.772  1.00 46.10  ? 243 LEU B CA    1 
ATOM   3700 C C     . LEU B 1 201 ? -2.764  -14.838 48.139  1.00 43.93  ? 243 LEU B C     1 
ATOM   3701 O O     . LEU B 1 201 ? -2.928  -16.028 47.856  1.00 39.42  ? 243 LEU B O     1 
ATOM   3702 C CB    . LEU B 1 201 ? -3.325  -12.780 46.745  1.00 46.48  ? 243 LEU B CB    1 
ATOM   3703 C CG    . LEU B 1 201 ? -2.944  -13.261 45.330  1.00 50.63  ? 243 LEU B CG    1 
ATOM   3704 C CD1   . LEU B 1 201 ? -4.012  -14.103 44.628  1.00 41.83  ? 243 LEU B CD1   1 
ATOM   3705 C CD2   . LEU B 1 201 ? -2.604  -12.063 44.472  1.00 45.10  ? 243 LEU B CD2   1 
ATOM   3706 N N     . LEU B 1 202 ? -1.696  -14.414 48.828  1.00 41.97  ? 244 LEU B N     1 
ATOM   3707 C CA    . LEU B 1 202 ? -0.660  -15.376 49.207  1.00 43.10  ? 244 LEU B CA    1 
ATOM   3708 C C     . LEU B 1 202 ? -1.219  -16.532 50.030  1.00 46.08  ? 244 LEU B C     1 
ATOM   3709 O O     . LEU B 1 202 ? -0.673  -17.647 49.997  1.00 42.30  ? 244 LEU B O     1 
ATOM   3710 C CB    . LEU B 1 202 ? 0.450   -14.685 49.987  1.00 39.32  ? 244 LEU B CB    1 
ATOM   3711 C CG    . LEU B 1 202 ? 1.386   -13.806 49.174  1.00 41.03  ? 244 LEU B CG    1 
ATOM   3712 C CD1   . LEU B 1 202 ? 2.350   -13.139 50.087  1.00 39.84  ? 244 LEU B CD1   1 
ATOM   3713 C CD2   . LEU B 1 202 ? 2.151   -14.661 48.206  1.00 41.93  ? 244 LEU B CD2   1 
ATOM   3714 N N     . GLN B 1 203 ? -2.313  -16.282 50.762  1.00 48.93  ? 245 GLN B N     1 
ATOM   3715 C CA    . GLN B 1 203 ? -2.907  -17.227 51.701  1.00 45.48  ? 245 GLN B CA    1 
ATOM   3716 C C     . GLN B 1 203 ? -4.053  -18.030 51.095  1.00 36.01  ? 245 GLN B C     1 
ATOM   3717 O O     . GLN B 1 203 ? -4.248  -19.198 51.442  1.00 32.40  ? 245 GLN B O     1 
ATOM   3718 C CB    . GLN B 1 203 ? -3.399  -16.476 52.948  1.00 48.11  ? 245 GLN B CB    1 
ATOM   3719 C CG    . GLN B 1 203 ? -2.575  -16.799 54.179  1.00 44.18  ? 245 GLN B CG    1 
ATOM   3720 C CD    . GLN B 1 203 ? -2.724  -18.254 54.581  1.00 44.08  ? 245 GLN B CD    1 
ATOM   3721 O OE1   . GLN B 1 203 ? -3.797  -18.675 55.000  1.00 53.57  ? 245 GLN B OE1   1 
ATOM   3722 N NE2   . GLN B 1 203 ? -1.646  -19.031 54.448  1.00 52.76  ? 245 GLN B NE2   1 
ATOM   3723 N N     . ALA B 1 204 ? -4.726  -17.450 50.162  1.00 38.97  ? 246 ALA B N     1 
ATOM   3724 C CA    . ALA B 1 204 ? -5.783  -18.131 49.504  1.00 49.58  ? 246 ALA B CA    1 
ATOM   3725 C C     . ALA B 1 204 ? -5.365  -19.227 48.516  1.00 49.42  ? 246 ALA B C     1 
ATOM   3726 O O     . ALA B 1 204 ? -5.943  -20.281 48.525  1.00 54.11  ? 246 ALA B O     1 
ATOM   3727 C CB    . ALA B 1 204 ? -6.656  -17.103 48.818  1.00 50.49  ? 246 ALA B CB    1 
ATOM   3728 N N     . VAL B 1 205 ? -4.391  -18.986 47.659  1.00 46.53  ? 247 VAL B N     1 
ATOM   3729 C CA    . VAL B 1 205 ? -4.003  -19.998 46.678  1.00 54.20  ? 247 VAL B CA    1 
ATOM   3730 C C     . VAL B 1 205 ? -3.569  -21.312 47.292  1.00 45.86  ? 247 VAL B C     1 
ATOM   3731 O O     . VAL B 1 205 ? -4.251  -22.273 47.110  1.00 57.46  ? 247 VAL B O     1 
ATOM   3732 C CB    . VAL B 1 205 ? -3.034  -19.493 45.587  1.00 48.40  ? 247 VAL B CB    1 
ATOM   3733 N N     . PRO B 1 206 ? -2.418  -21.421 48.051  1.00 38.22  ? 248 PRO B N     1 
ATOM   3734 C CA    . PRO B 1 206 ? -1.628  -20.208 48.227  1.00 42.84  ? 248 PRO B CA    1 
ATOM   3735 C C     . PRO B 1 206 ? -0.353  -20.120 47.422  1.00 42.16  ? 248 PRO B C     1 
ATOM   3736 O O     . PRO B 1 206 ? -0.047  -20.993 46.668  1.00 45.85  ? 248 PRO B O     1 
ATOM   3737 C CB    . PRO B 1 206 ? -1.216  -20.321 49.660  1.00 45.50  ? 248 PRO B CB    1 
ATOM   3738 C CG    . PRO B 1 206 ? -0.917  -21.772 49.828  1.00 31.49  ? 248 PRO B CG    1 
ATOM   3739 C CD    . PRO B 1 206 ? -1.754  -22.497 48.861  1.00 30.66  ? 248 PRO B CD    1 
ATOM   3740 N N     . LEU B 1 207 ? 0.394   -19.051 47.621  1.00 42.81  ? 249 LEU B N     1 
ATOM   3741 C CA    . LEU B 1 207 ? 1.642   -18.815 46.915  1.00 45.77  ? 249 LEU B CA    1 
ATOM   3742 C C     . LEU B 1 207 ? 2.661   -18.134 47.757  1.00 41.73  ? 249 LEU B C     1 
ATOM   3743 O O     . LEU B 1 207 ? 2.382   -17.661 48.808  1.00 45.27  ? 249 LEU B O     1 
ATOM   3744 C CB    . LEU B 1 207 ? 1.433   -17.918 45.691  1.00 47.89  ? 249 LEU B CB    1 
ATOM   3745 C CG    . LEU B 1 207 ? 0.364   -18.297 44.700  1.00 41.91  ? 249 LEU B CG    1 
ATOM   3746 C CD1   . LEU B 1 207 ? -0.439  -17.099 44.327  1.00 47.86  ? 249 LEU B CD1   1 
ATOM   3747 C CD2   . LEU B 1 207 ? 0.898   -18.997 43.494  1.00 42.55  ? 249 LEU B CD2   1 
ATOM   3748 N N     . ALA B 1 208 ? 3.860   -18.079 47.238  1.00 42.40  ? 250 ALA B N     1 
ATOM   3749 C CA    . ALA B 1 208 ? 4.992   -17.433 47.884  1.00 45.90  ? 250 ALA B CA    1 
ATOM   3750 C C     . ALA B 1 208 ? 5.610   -16.424 46.924  1.00 46.58  ? 250 ALA B C     1 
ATOM   3751 O O     . ALA B 1 208 ? 5.923   -16.766 45.775  1.00 51.97  ? 250 ALA B O     1 
ATOM   3752 C CB    . ALA B 1 208 ? 6.035   -18.468 48.330  1.00 36.05  ? 250 ALA B CB    1 
ATOM   3753 N N     . ASP B 1 209 ? 5.751   -15.181 47.396  1.00 36.09  ? 251 ASP B N     1 
ATOM   3754 C CA    . ASP B 1 209 ? 6.550   -14.127 46.778  1.00 39.06  ? 251 ASP B CA    1 
ATOM   3755 C C     . ASP B 1 209 ? 7.940   -14.704 46.519  1.00 37.66  ? 251 ASP B C     1 
ATOM   3756 O O     . ASP B 1 209 ? 8.710   -14.926 47.462  1.00 37.22  ? 251 ASP B O     1 
ATOM   3757 C CB    . ASP B 1 209 ? 6.556   -12.900 47.699  1.00 40.61  ? 251 ASP B CB    1 
ATOM   3758 C CG    . ASP B 1 209 ? 7.318   -11.716 47.112  1.00 43.88  ? 251 ASP B CG    1 
ATOM   3759 O OD1   . ASP B 1 209 ? 8.287   -11.930 46.346  1.00 39.65  ? 251 ASP B OD1   1 
ATOM   3760 O OD2   . ASP B 1 209 ? 6.940   -10.561 47.421  1.00 41.76  ? 251 ASP B OD2   1 
ATOM   3761 N N     . SER B 1 210 ? 8.291   -14.894 45.240  1.00 39.88  ? 252 SER B N     1 
ATOM   3762 C CA    . SER B 1 210 ? 9.520   -15.622 44.903  1.00 41.75  ? 252 SER B CA    1 
ATOM   3763 C C     . SER B 1 210 ? 10.698  -14.754 45.327  1.00 40.93  ? 252 SER B C     1 
ATOM   3764 O O     . SER B 1 210 ? 11.650  -15.248 45.939  1.00 39.60  ? 252 SER B O     1 
ATOM   3765 C CB    . SER B 1 210 ? 9.601   -15.962 43.403  1.00 48.27  ? 252 SER B CB    1 
ATOM   3766 O OG    . SER B 1 210 ? 9.870   -14.835 42.563  1.00 41.74  ? 252 SER B OG    1 
ATOM   3767 N N     . PHE B 1 211 ? 10.638  -13.452 45.053  1.00 41.38  ? 253 PHE B N     1 
ATOM   3768 C CA    . PHE B 1 211 ? 11.789  -12.621 45.372  1.00 42.49  ? 253 PHE B CA    1 
ATOM   3769 C C     . PHE B 1 211 ? 11.992  -12.512 46.882  1.00 46.01  ? 253 PHE B C     1 
ATOM   3770 O O     . PHE B 1 211 ? 13.127  -12.582 47.370  1.00 38.72  ? 253 PHE B O     1 
ATOM   3771 C CB    . PHE B 1 211 ? 11.641  -11.234 44.751  1.00 34.18  ? 253 PHE B CB    1 
ATOM   3772 C CG    . PHE B 1 211 ? 12.826  -10.345 45.003  1.00 42.52  ? 253 PHE B CG    1 
ATOM   3773 C CD1   . PHE B 1 211 ? 13.943  -10.412 44.185  1.00 41.43  ? 253 PHE B CD1   1 
ATOM   3774 C CD2   . PHE B 1 211 ? 12.846  -9.476  46.090  1.00 42.44  ? 253 PHE B CD2   1 
ATOM   3775 C CE1   . PHE B 1 211 ? 15.040  -9.605  44.427  1.00 48.44  ? 253 PHE B CE1   1 
ATOM   3776 C CE2   . PHE B 1 211 ? 13.942  -8.669  46.341  1.00 43.73  ? 253 PHE B CE2   1 
ATOM   3777 C CZ    . PHE B 1 211 ? 15.041  -8.724  45.514  1.00 42.17  ? 253 PHE B CZ    1 
ATOM   3778 N N     . ARG B 1 212 ? 10.913  -12.340 47.640  1.00 43.58  ? 254 ARG B N     1 
ATOM   3779 C CA    . ARG B 1 212 ? 11.094  -12.176 49.074  1.00 47.52  ? 254 ARG B CA    1 
ATOM   3780 C C     . ARG B 1 212 ? 11.381  -13.509 49.756  1.00 51.93  ? 254 ARG B C     1 
ATOM   3781 O O     . ARG B 1 212 ? 12.063  -13.536 50.792  1.00 55.87  ? 254 ARG B O     1 
ATOM   3782 C CB    . ARG B 1 212 ? 9.882   -11.477 49.698  1.00 45.48  ? 254 ARG B CB    1 
ATOM   3783 C CG    . ARG B 1 212 ? 10.210  -10.899 51.058  1.00 46.04  ? 254 ARG B CG    1 
ATOM   3784 C CD    . ARG B 1 212 ? 9.812   -9.426  51.288  1.00 51.72  ? 254 ARG B CD    1 
ATOM   3785 N NE    . ARG B 1 212 ? 10.117  -8.440  50.237  1.00 50.27  ? 254 ARG B NE    1 
ATOM   3786 C CZ    . ARG B 1 212 ? 11.339  -8.000  49.910  1.00 46.81  ? 254 ARG B CZ    1 
ATOM   3787 N NH1   . ARG B 1 212 ? 12.422  -8.511  50.468  1.00 43.97  ? 254 ARG B NH1   1 
ATOM   3788 N NH2   . ARG B 1 212 ? 11.486  -7.073  48.975  1.00 45.70  ? 254 ARG B NH2   1 
ATOM   3789 N N     . HIS B 1 213 ? 10.930  -14.623 49.175  1.00 40.83  ? 255 HIS B N     1 
ATOM   3790 C CA    . HIS B 1 213 ? 11.356  -15.902 49.723  1.00 49.51  ? 255 HIS B CA    1 
ATOM   3791 C C     . HIS B 1 213 ? 12.866  -16.110 49.618  1.00 56.76  ? 255 HIS B C     1 
ATOM   3792 O O     . HIS B 1 213 ? 13.414  -16.926 50.364  1.00 65.23  ? 255 HIS B O     1 
ATOM   3793 C CB    . HIS B 1 213 ? 10.652  -17.078 49.043  1.00 46.69  ? 255 HIS B CB    1 
ATOM   3794 C CG    . HIS B 1 213 ? 10.990  -18.398 49.669  1.00 59.24  ? 255 HIS B CG    1 
ATOM   3795 N ND1   . HIS B 1 213 ? 12.213  -19.014 49.494  1.00 61.85  ? 255 HIS B ND1   1 
ATOM   3796 C CD2   . HIS B 1 213 ? 10.285  -19.198 50.504  1.00 63.83  ? 255 HIS B CD2   1 
ATOM   3797 C CE1   . HIS B 1 213 ? 12.239  -20.143 50.178  1.00 66.14  ? 255 HIS B CE1   1 
ATOM   3798 N NE2   . HIS B 1 213 ? 11.080  -20.280 50.798  1.00 72.78  ? 255 HIS B NE2   1 
ATOM   3799 N N     . LEU B 1 214 ? 13.553  -15.424 48.703  1.00 51.74  ? 256 LEU B N     1 
ATOM   3800 C CA    . LEU B 1 214 ? 15.003  -15.543 48.595  1.00 48.77  ? 256 LEU B CA    1 
ATOM   3801 C C     . LEU B 1 214 ? 15.754  -14.448 49.339  1.00 49.29  ? 256 LEU B C     1 
ATOM   3802 O O     . LEU B 1 214 ? 16.817  -14.698 49.916  1.00 46.36  ? 256 LEU B O     1 
ATOM   3803 C CB    . LEU B 1 214 ? 15.432  -15.530 47.129  1.00 49.63  ? 256 LEU B CB    1 
ATOM   3804 C CG    . LEU B 1 214 ? 14.897  -16.646 46.245  1.00 50.63  ? 256 LEU B CG    1 
ATOM   3805 C CD1   . LEU B 1 214 ? 15.575  -16.584 44.904  1.00 52.29  ? 256 LEU B CD1   1 
ATOM   3806 C CD2   . LEU B 1 214 ? 15.041  -18.006 46.917  1.00 49.67  ? 256 LEU B CD2   1 
ATOM   3807 N N     . TYR B 1 215 ? 15.227  -13.241 49.345  1.00 47.58  ? 257 TYR B N     1 
ATOM   3808 C CA    . TYR B 1 215 ? 15.876  -12.109 49.993  1.00 54.21  ? 257 TYR B CA    1 
ATOM   3809 C C     . TYR B 1 215 ? 14.865  -11.498 50.942  1.00 53.96  ? 257 TYR B C     1 
ATOM   3810 O O     . TYR B 1 215 ? 14.275  -10.451 50.642  1.00 52.02  ? 257 TYR B O     1 
ATOM   3811 C CB    . TYR B 1 215 ? 16.385  -11.107 48.961  1.00 47.87  ? 257 TYR B CB    1 
ATOM   3812 C CG    . TYR B 1 215 ? 16.991  -11.781 47.759  1.00 56.12  ? 257 TYR B CG    1 
ATOM   3813 C CD1   . TYR B 1 215 ? 16.227  -12.080 46.633  1.00 50.02  ? 257 TYR B CD1   1 
ATOM   3814 C CD2   . TYR B 1 215 ? 18.322  -12.159 47.766  1.00 56.18  ? 257 TYR B CD2   1 
ATOM   3815 C CE1   . TYR B 1 215 ? 16.787  -12.714 45.549  1.00 44.94  ? 257 TYR B CE1   1 
ATOM   3816 C CE2   . TYR B 1 215 ? 18.885  -12.786 46.687  1.00 51.13  ? 257 TYR B CE2   1 
ATOM   3817 C CZ    . TYR B 1 215 ? 18.123  -13.062 45.586  1.00 50.13  ? 257 TYR B CZ    1 
ATOM   3818 O OH    . TYR B 1 215 ? 18.743  -13.692 44.537  1.00 39.25  ? 257 TYR B OH    1 
ATOM   3819 N N     . PRO B 1 216 ? 14.631  -12.135 52.096  1.00 60.04  ? 258 PRO B N     1 
ATOM   3820 C CA    . PRO B 1 216 ? 13.595  -11.622 53.004  1.00 56.78  ? 258 PRO B CA    1 
ATOM   3821 C C     . PRO B 1 216 ? 13.972  -10.299 53.614  1.00 48.21  ? 258 PRO B C     1 
ATOM   3822 O O     . PRO B 1 216 ? 13.087  -9.464  53.834  1.00 46.21  ? 258 PRO B O     1 
ATOM   3823 C CB    . PRO B 1 216 ? 13.477  -12.722 54.064  1.00 61.79  ? 258 PRO B CB    1 
ATOM   3824 C CG    . PRO B 1 216 ? 14.829  -13.355 54.084  1.00 57.33  ? 258 PRO B CG    1 
ATOM   3825 C CD    . PRO B 1 216 ? 15.394  -13.247 52.692  1.00 54.72  ? 258 PRO B CD    1 
ATOM   3826 N N     . ASN B 1 217 ? 15.265  -10.062 53.845  1.00 59.78  ? 259 ASN B N     1 
ATOM   3827 C CA    . ASN B 1 217 ? 15.736  -8.850  54.504  1.00 64.85  ? 259 ASN B CA    1 
ATOM   3828 C C     . ASN B 1 217 ? 16.297  -7.810  53.538  1.00 58.39  ? 259 ASN B C     1 
ATOM   3829 O O     . ASN B 1 217 ? 16.723  -6.741  53.986  1.00 62.67  ? 259 ASN B O     1 
ATOM   3830 C CB    . ASN B 1 217 ? 16.807  -9.193  55.556  1.00 64.45  ? 259 ASN B CB    1 
ATOM   3831 C CG    . ASN B 1 217 ? 16.499  -10.469 56.315  1.00 65.98  ? 259 ASN B CG    1 
ATOM   3832 O OD1   . ASN B 1 217 ? 15.580  -10.519 57.130  1.00 63.74  ? 259 ASN B OD1   1 
ATOM   3833 N ND2   . ASN B 1 217 ? 17.276  -11.513 56.050  1.00 71.12  ? 259 ASN B ND2   1 
ATOM   3834 N N     . THR B 1 218 ? 16.344  -8.092  52.249  1.00 60.17  ? 260 THR B N     1 
ATOM   3835 C CA    . THR B 1 218 ? 16.924  -7.133  51.313  1.00 59.82  ? 260 THR B CA    1 
ATOM   3836 C C     . THR B 1 218 ? 16.073  -5.952  50.991  1.00 59.94  ? 260 THR B C     1 
ATOM   3837 O O     . THR B 1 218 ? 14.934  -6.107  50.651  1.00 64.14  ? 260 THR B O     1 
ATOM   3838 C CB    . THR B 1 218 ? 17.315  -7.770  49.992  1.00 58.12  ? 260 THR B CB    1 
ATOM   3839 O OG1   . THR B 1 218 ? 18.042  -8.965  50.239  1.00 66.33  ? 260 THR B OG1   1 
ATOM   3840 C CG2   . THR B 1 218 ? 18.190  -6.854  49.249  1.00 54.65  ? 260 THR B CG2   1 
ATOM   3841 N N     . ALA B 1 221 ? 14.830  -2.689  46.714  1.00 55.13  ? 263 ALA B N     1 
ATOM   3842 C CA    . ALA B 1 221 ? 14.683  -3.461  45.480  1.00 58.64  ? 263 ALA B CA    1 
ATOM   3843 C C     . ALA B 1 221 ? 13.334  -3.138  44.849  1.00 49.81  ? 263 ALA B C     1 
ATOM   3844 O O     . ALA B 1 221 ? 12.289  -3.584  45.331  1.00 45.48  ? 263 ALA B O     1 
ATOM   3845 C CB    . ALA B 1 221 ? 14.799  -4.959  45.754  1.00 55.09  ? 263 ALA B CB    1 
ATOM   3846 N N     . TYR B 1 222 ? 13.343  -2.377  43.771  1.00 50.55  ? 264 TYR B N     1 
ATOM   3847 C CA    . TYR B 1 222 ? 12.082  -1.987  43.180  1.00 53.48  ? 264 TYR B CA    1 
ATOM   3848 C C     . TYR B 1 222 ? 12.033  -2.330  41.705  1.00 41.70  ? 264 TYR B C     1 
ATOM   3849 O O     . TYR B 1 222 ? 13.060  -2.484  41.041  1.00 41.11  ? 264 TYR B O     1 
ATOM   3850 C CB    . TYR B 1 222 ? 11.827  -0.500  43.361  1.00 53.47  ? 264 TYR B CB    1 
ATOM   3851 C CG    . TYR B 1 222 ? 12.238  0.033   44.706  1.00 53.17  ? 264 TYR B CG    1 
ATOM   3852 C CD1   . TYR B 1 222 ? 11.638  -0.409  45.878  1.00 52.73  ? 264 TYR B CD1   1 
ATOM   3853 C CD2   . TYR B 1 222 ? 13.203  1.000   44.809  1.00 54.70  ? 264 TYR B CD2   1 
ATOM   3854 C CE1   . TYR B 1 222 ? 12.016  0.100   47.122  1.00 46.15  ? 264 TYR B CE1   1 
ATOM   3855 C CE2   . TYR B 1 222 ? 13.580  1.512   46.054  1.00 57.10  ? 264 TYR B CE2   1 
ATOM   3856 C CZ    . TYR B 1 222 ? 12.990  1.062   47.206  1.00 49.92  ? 264 TYR B CZ    1 
ATOM   3857 O OH    . TYR B 1 222 ? 13.379  1.578   48.418  1.00 52.79  ? 264 TYR B OH    1 
ATOM   3858 N N     . THR B 1 223 ? 10.801  -2.415  41.212  1.00 45.29  ? 265 THR B N     1 
ATOM   3859 C CA    . THR B 1 223 ? 10.497  -2.638  39.801  1.00 49.04  ? 265 THR B CA    1 
ATOM   3860 C C     . THR B 1 223 ? 9.879   -1.420  39.128  1.00 44.30  ? 265 THR B C     1 
ATOM   3861 O O     . THR B 1 223 ? 9.574   -1.490  37.935  1.00 43.59  ? 265 THR B O     1 
ATOM   3862 C CB    . THR B 1 223 ? 9.542   -3.845  39.616  1.00 40.41  ? 265 THR B CB    1 
ATOM   3863 O OG1   . THR B 1 223 ? 8.310   -3.652  40.338  1.00 33.51  ? 265 THR B OG1   1 
ATOM   3864 C CG2   . THR B 1 223 ? 10.192  -5.133  40.076  1.00 40.38  ? 265 THR B CG2   1 
ATOM   3865 N N     . PHE B 1 224 ? 9.667   -0.318  39.852  1.00 44.13  ? 266 PHE B N     1 
ATOM   3866 C CA    . PHE B 1 224 ? 8.911   0.799   39.292  1.00 47.29  ? 266 PHE B CA    1 
ATOM   3867 C C     . PHE B 1 224 ? 9.329   2.131   39.905  1.00 46.41  ? 266 PHE B C     1 
ATOM   3868 O O     . PHE B 1 224 ? 9.480   2.246   41.125  1.00 44.81  ? 266 PHE B O     1 
ATOM   3869 C CB    . PHE B 1 224 ? 7.409   0.588   39.485  1.00 40.17  ? 266 PHE B CB    1 
ATOM   3870 C CG    . PHE B 1 224 ? 6.610   1.848   39.372  1.00 42.92  ? 266 PHE B CG    1 
ATOM   3871 C CD1   . PHE B 1 224 ? 6.073   2.443   40.504  1.00 44.42  ? 266 PHE B CD1   1 
ATOM   3872 C CD2   . PHE B 1 224 ? 6.404   2.446   38.136  1.00 39.53  ? 266 PHE B CD2   1 
ATOM   3873 C CE1   . PHE B 1 224 ? 5.334   3.594   40.407  1.00 43.80  ? 266 PHE B CE1   1 
ATOM   3874 C CE2   . PHE B 1 224 ? 5.669   3.607   38.030  1.00 39.75  ? 266 PHE B CE2   1 
ATOM   3875 C CZ    . PHE B 1 224 ? 5.124   4.179   39.164  1.00 46.72  ? 266 PHE B CZ    1 
ATOM   3876 N N     . TRP B 1 225 ? 9.512   3.130   39.048  1.00 41.66  ? 267 TRP B N     1 
ATOM   3877 C CA    . TRP B 1 225 ? 9.830   4.488   39.460  1.00 45.42  ? 267 TRP B CA    1 
ATOM   3878 C C     . TRP B 1 225 ? 9.021   5.443   38.598  1.00 48.04  ? 267 TRP B C     1 
ATOM   3879 O O     . TRP B 1 225 ? 9.057   5.340   37.367  1.00 48.49  ? 267 TRP B O     1 
ATOM   3880 C CB    . TRP B 1 225 ? 11.321  4.792   39.294  1.00 42.84  ? 267 TRP B CB    1 
ATOM   3881 C CG    . TRP B 1 225 ? 12.201  3.770   39.873  1.00 47.61  ? 267 TRP B CG    1 
ATOM   3882 C CD1   . TRP B 1 225 ? 12.796  3.812   41.091  1.00 51.22  ? 267 TRP B CD1   1 
ATOM   3883 C CD2   . TRP B 1 225 ? 12.606  2.535   39.265  1.00 47.80  ? 267 TRP B CD2   1 
ATOM   3884 N NE1   . TRP B 1 225 ? 13.544  2.677   41.290  1.00 54.90  ? 267 TRP B NE1   1 
ATOM   3885 C CE2   . TRP B 1 225 ? 13.442  1.874   40.185  1.00 50.18  ? 267 TRP B CE2   1 
ATOM   3886 C CE3   . TRP B 1 225 ? 12.342  1.924   38.035  1.00 45.36  ? 267 TRP B CE3   1 
ATOM   3887 C CZ2   . TRP B 1 225 ? 14.023  0.631   39.915  1.00 48.70  ? 267 TRP B CZ2   1 
ATOM   3888 C CZ3   . TRP B 1 225 ? 12.922  0.686   37.766  1.00 48.38  ? 267 TRP B CZ3   1 
ATOM   3889 C CH2   . TRP B 1 225 ? 13.752  0.056   38.701  1.00 47.61  ? 267 TRP B CH2   1 
ATOM   3890 N N     . THR B 1 226 ? 8.308   6.373   39.226  1.00 49.23  ? 268 THR B N     1 
ATOM   3891 C CA    . THR B 1 226 ? 7.569   7.346   38.437  1.00 52.00  ? 268 THR B CA    1 
ATOM   3892 C C     . THR B 1 226 ? 8.532   8.117   37.544  1.00 49.76  ? 268 THR B C     1 
ATOM   3893 O O     . THR B 1 226 ? 9.699   8.330   37.883  1.00 46.92  ? 268 THR B O     1 
ATOM   3894 C CB    . THR B 1 226 ? 6.792   8.313   39.331  1.00 49.48  ? 268 THR B CB    1 
ATOM   3895 O OG1   . THR B 1 226 ? 6.185   9.321   38.510  1.00 44.49  ? 268 THR B OG1   1 
ATOM   3896 C CG2   . THR B 1 226 ? 7.730   8.974   40.326  1.00 46.78  ? 268 THR B CG2   1 
ATOM   3897 N N     . TYR B 1 227 ? 8.044   8.494   36.363  1.00 50.58  ? 269 TYR B N     1 
ATOM   3898 C CA    . TYR B 1 227 ? 8.865   9.278   35.446  1.00 49.33  ? 269 TYR B CA    1 
ATOM   3899 C C     . TYR B 1 227 ? 9.182   10.648  36.030  1.00 54.07  ? 269 TYR B C     1 
ATOM   3900 O O     . TYR B 1 227 ? 10.210  11.246  35.686  1.00 55.71  ? 269 TYR B O     1 
ATOM   3901 C CB    . TYR B 1 227 ? 8.155   9.433   34.097  1.00 47.90  ? 269 TYR B CB    1 
ATOM   3902 C CG    . TYR B 1 227 ? 8.119   8.199   33.218  1.00 46.06  ? 269 TYR B CG    1 
ATOM   3903 C CD1   . TYR B 1 227 ? 9.256   7.401   33.050  1.00 45.84  ? 269 TYR B CD1   1 
ATOM   3904 C CD2   . TYR B 1 227 ? 6.955   7.844   32.541  1.00 36.89  ? 269 TYR B CD2   1 
ATOM   3905 C CE1   . TYR B 1 227 ? 9.231   6.283   32.245  1.00 44.38  ? 269 TYR B CE1   1 
ATOM   3906 C CE2   . TYR B 1 227 ? 6.918   6.721   31.724  1.00 40.72  ? 269 TYR B CE2   1 
ATOM   3907 C CZ    . TYR B 1 227 ? 8.057   5.945   31.581  1.00 50.28  ? 269 TYR B CZ    1 
ATOM   3908 O OH    . TYR B 1 227 ? 8.032   4.835   30.769  1.00 46.07  ? 269 TYR B OH    1 
ATOM   3909 N N     . MET B 1 228 ? 8.321   11.142  36.920  1.00 53.42  ? 270 MET B N     1 
ATOM   3910 C CA    . MET B 1 228 ? 8.433   12.473  37.491  1.00 56.20  ? 270 MET B CA    1 
ATOM   3911 C C     . MET B 1 228 ? 9.563   12.555  38.511  1.00 61.80  ? 270 MET B C     1 
ATOM   3912 O O     . MET B 1 228 ? 10.019  11.547  39.076  1.00 54.27  ? 270 MET B O     1 
ATOM   3913 C CB    . MET B 1 228 ? 7.124   12.886  38.157  1.00 50.75  ? 270 MET B CB    1 
ATOM   3914 C CG    . MET B 1 228 ? 5.922   12.782  37.248  1.00 53.43  ? 270 MET B CG    1 
ATOM   3915 S SD    . MET B 1 228 ? 4.355   12.837  38.147  1.00 59.75  ? 270 MET B SD    1 
ATOM   3916 C CE    . MET B 1 228 ? 4.049   14.594  38.341  1.00 64.84  ? 270 MET B CE    1 
ATOM   3917 N N     . MET B 1 229 ? 10.006  13.797  38.740  1.00 60.10  ? 271 MET B N     1 
ATOM   3918 C CA    . MET B 1 229 ? 11.004  14.152  39.754  1.00 62.72  ? 271 MET B CA    1 
ATOM   3919 C C     . MET B 1 229 ? 12.300  13.362  39.598  1.00 65.71  ? 271 MET B C     1 
ATOM   3920 O O     . MET B 1 229 ? 13.077  13.250  40.558  1.00 65.42  ? 271 MET B O     1 
ATOM   3921 C CB    . MET B 1 229 ? 10.451  13.980  41.177  1.00 63.49  ? 271 MET B CB    1 
ATOM   3922 N N     . ASN B 1 230 ? 12.559  12.826  38.399  1.00 66.82  ? 272 ASN B N     1 
ATOM   3923 C CA    . ASN B 1 230 ? 13.726  11.977  38.171  1.00 70.08  ? 272 ASN B CA    1 
ATOM   3924 C C     . ASN B 1 230 ? 13.845  10.935  39.295  1.00 65.75  ? 272 ASN B C     1 
ATOM   3925 O O     . ASN B 1 230 ? 14.910  10.688  39.870  1.00 62.32  ? 272 ASN B O     1 
ATOM   3926 C CB    . ASN B 1 230 ? 14.983  12.841  38.025  1.00 65.49  ? 272 ASN B CB    1 
ATOM   3927 C CG    . ASN B 1 230 ? 16.238  12.024  37.879  1.00 73.53  ? 272 ASN B CG    1 
ATOM   3928 O OD1   . ASN B 1 230 ? 17.256  12.321  38.514  1.00 63.43  ? 272 ASN B OD1   1 
ATOM   3929 N ND2   . ASN B 1 230 ? 16.164  10.949  37.090  1.00 73.19  ? 272 ASN B ND2   1 
ATOM   3930 N N     . ALA B 1 231 ? 12.703  10.332  39.627  1.00 58.85  ? 273 ALA B N     1 
ATOM   3931 C CA    . ALA B 1 231 ? 12.643  9.416   40.756  1.00 58.59  ? 273 ALA B CA    1 
ATOM   3932 C C     . ALA B 1 231 ? 13.492  8.169   40.551  1.00 54.93  ? 273 ALA B C     1 
ATOM   3933 O O     . ALA B 1 231 ? 13.851  7.516   41.540  1.00 53.24  ? 273 ALA B O     1 
ATOM   3934 C CB    . ALA B 1 231 ? 11.190  9.017   41.020  1.00 55.69  ? 273 ALA B CB    1 
ATOM   3935 N N     . ARG B 1 232 ? 13.812  7.816   39.298  1.00 57.17  ? 274 ARG B N     1 
ATOM   3936 C CA    . ARG B 1 232 ? 14.483  6.545   39.040  1.00 52.94  ? 274 ARG B CA    1 
ATOM   3937 C C     . ARG B 1 232 ? 15.963  6.606   39.395  1.00 54.31  ? 274 ARG B C     1 
ATOM   3938 O O     . ARG B 1 232 ? 16.528  5.601   39.843  1.00 50.42  ? 274 ARG B O     1 
ATOM   3939 C CB    . ARG B 1 232 ? 14.286  6.116   37.575  1.00 48.29  ? 274 ARG B CB    1 
ATOM   3940 C CG    . ARG B 1 232 ? 14.932  4.740   37.219  1.00 48.11  ? 274 ARG B CG    1 
ATOM   3941 C CD    . ARG B 1 232 ? 14.227  4.008   36.075  1.00 43.51  ? 274 ARG B CD    1 
ATOM   3942 N NE    . ARG B 1 232 ? 14.870  2.740   35.718  1.00 47.61  ? 274 ARG B NE    1 
ATOM   3943 C CZ    . ARG B 1 232 ? 14.558  2.024   34.634  1.00 43.60  ? 274 ARG B CZ    1 
ATOM   3944 N NH1   . ARG B 1 232 ? 13.617  2.454   33.801  1.00 39.09  ? 274 ARG B NH1   1 
ATOM   3945 N NH2   . ARG B 1 232 ? 15.192  0.886   34.370  1.00 39.32  ? 274 ARG B NH2   1 
ATOM   3946 N N     . SER B 1 233 ? 16.596  7.772   39.239  1.00 59.38  ? 275 SER B N     1 
ATOM   3947 C CA    . SER B 1 233 ? 18.015  7.886   39.560  1.00 61.97  ? 275 SER B CA    1 
ATOM   3948 C C     . SER B 1 233 ? 18.252  7.876   41.068  1.00 59.66  ? 275 SER B C     1 
ATOM   3949 O O     . SER B 1 233 ? 19.213  7.263   41.551  1.00 70.16  ? 275 SER B O     1 
ATOM   3950 C CB    . SER B 1 233 ? 18.577  9.150   38.932  1.00 59.74  ? 275 SER B CB    1 
ATOM   3951 O OG    . SER B 1 233 ? 17.908  10.258  39.489  1.00 69.10  ? 275 SER B OG    1 
ATOM   3952 N N     . LYS B 1 234 ? 17.394  8.543   41.832  1.00 54.90  ? 276 LYS B N     1 
ATOM   3953 C CA    . LYS B 1 234 ? 17.448  8.393   43.285  1.00 57.11  ? 276 LYS B CA    1 
ATOM   3954 C C     . LYS B 1 234 ? 16.975  7.027   43.753  1.00 63.96  ? 276 LYS B C     1 
ATOM   3955 O O     . LYS B 1 234 ? 17.089  6.740   44.949  1.00 69.76  ? 276 LYS B O     1 
ATOM   3956 C CB    . LYS B 1 234 ? 16.596  9.462   43.971  1.00 59.36  ? 276 LYS B CB    1 
ATOM   3957 C CG    . LYS B 1 234 ? 16.524  10.779  43.221  1.00 61.09  ? 276 LYS B CG    1 
ATOM   3958 C CD    . LYS B 1 234 ? 17.909  11.375  43.002  1.00 60.62  ? 276 LYS B CD    1 
ATOM   3959 C CE    . LYS B 1 234 ? 17.846  12.863  42.723  1.00 69.06  ? 276 LYS B CE    1 
ATOM   3960 N NZ    . LYS B 1 234 ? 19.156  13.393  42.232  1.00 67.75  ? 276 LYS B NZ    1 
ATOM   3961 N N     . ASN B 1 235 ? 16.465  6.189   42.849  1.00 61.31  ? 277 ASN B N     1 
ATOM   3962 C CA    . ASN B 1 235 ? 15.825  4.923   43.190  1.00 56.62  ? 277 ASN B CA    1 
ATOM   3963 C C     . ASN B 1 235 ? 14.829  5.110   44.337  1.00 56.62  ? 277 ASN B C     1 
ATOM   3964 O O     . ASN B 1 235 ? 14.969  4.549   45.423  1.00 60.11  ? 277 ASN B O     1 
ATOM   3965 C CB    . ASN B 1 235 ? 16.866  3.846   43.521  1.00 59.14  ? 277 ASN B CB    1 
ATOM   3966 C CG    . ASN B 1 235 ? 16.490  2.478   42.957  1.00 74.56  ? 277 ASN B CG    1 
ATOM   3967 O OD1   . ASN B 1 235 ? 15.478  1.893   43.351  1.00 69.28  ? 277 ASN B OD1   1 
ATOM   3968 N ND2   . ASN B 1 235 ? 17.302  1.969   42.010  1.00 75.99  ? 277 ASN B ND2   1 
ATOM   3969 N N     . VAL B 1 236 ? 13.835  5.953   44.076  1.00 53.21  ? 278 VAL B N     1 
ATOM   3970 C CA    . VAL B 1 236 ? 12.648  6.058   44.920  1.00 59.37  ? 278 VAL B CA    1 
ATOM   3971 C C     . VAL B 1 236 ? 11.534  5.344   44.155  1.00 60.59  ? 278 VAL B C     1 
ATOM   3972 O O     . VAL B 1 236 ? 10.805  5.921   43.337  1.00 52.98  ? 278 VAL B O     1 
ATOM   3973 C CB    . VAL B 1 236 ? 12.303  7.509   45.249  1.00 58.35  ? 278 VAL B CB    1 
ATOM   3974 C CG1   . VAL B 1 236 ? 11.082  7.599   46.176  1.00 55.80  ? 278 VAL B CG1   1 
ATOM   3975 C CG2   . VAL B 1 236 ? 13.522  8.210   45.846  1.00 60.22  ? 278 VAL B CG2   1 
ATOM   3976 N N     . GLY B 1 237 ? 11.399  4.052   44.424  1.00 53.73  ? 279 GLY B N     1 
ATOM   3977 C CA    . GLY B 1 237 ? 10.406  3.315   43.699  1.00 50.91  ? 279 GLY B CA    1 
ATOM   3978 C C     . GLY B 1 237 ? 9.678   2.268   44.500  1.00 47.72  ? 279 GLY B C     1 
ATOM   3979 O O     . GLY B 1 237 ? 9.779   2.209   45.729  1.00 44.85  ? 279 GLY B O     1 
ATOM   3980 N N     . TRP B 1 238 ? 8.947   1.421   43.784  1.00 47.55  ? 280 TRP B N     1 
ATOM   3981 C CA    . TRP B 1 238 ? 8.089   0.411   44.369  1.00 44.63  ? 280 TRP B CA    1 
ATOM   3982 C C     . TRP B 1 238 ? 8.439   -0.966  43.813  1.00 44.76  ? 280 TRP B C     1 
ATOM   3983 O O     . TRP B 1 238 ? 8.903   -1.108  42.675  1.00 42.64  ? 280 TRP B O     1 
ATOM   3984 C CB    . TRP B 1 238 ? 6.610   0.724   44.085  1.00 43.11  ? 280 TRP B CB    1 
ATOM   3985 C CG    . TRP B 1 238 ? 6.123   2.111   44.495  1.00 46.60  ? 280 TRP B CG    1 
ATOM   3986 C CD1   . TRP B 1 238 ? 6.690   3.315   44.177  1.00 40.55  ? 280 TRP B CD1   1 
ATOM   3987 C CD2   . TRP B 1 238 ? 4.937   2.416   45.253  1.00 46.54  ? 280 TRP B CD2   1 
ATOM   3988 N NE1   . TRP B 1 238 ? 5.943   4.341   44.704  1.00 42.34  ? 280 TRP B NE1   1 
ATOM   3989 C CE2   . TRP B 1 238 ? 4.866   3.819   45.371  1.00 45.46  ? 280 TRP B CE2   1 
ATOM   3990 C CE3   . TRP B 1 238 ? 3.933   1.638   45.845  1.00 46.83  ? 280 TRP B CE3   1 
ATOM   3991 C CZ2   . TRP B 1 238 ? 3.829   4.462   46.054  1.00 44.75  ? 280 TRP B CZ2   1 
ATOM   3992 C CZ3   . TRP B 1 238 ? 2.901   2.280   46.529  1.00 47.31  ? 280 TRP B CZ3   1 
ATOM   3993 C CH2   . TRP B 1 238 ? 2.859   3.676   46.627  1.00 42.50  ? 280 TRP B CH2   1 
ATOM   3994 N N     . ARG B 1 239 ? 8.222   -1.987  44.625  1.00 45.94  ? 281 ARG B N     1 
ATOM   3995 C CA    . ARG B 1 239 ? 8.203   -3.362  44.141  1.00 48.82  ? 281 ARG B CA    1 
ATOM   3996 C C     . ARG B 1 239 ? 6.749   -3.715  43.838  1.00 45.12  ? 281 ARG B C     1 
ATOM   3997 O O     . ARG B 1 239 ? 5.971   -4.024  44.742  1.00 45.48  ? 281 ARG B O     1 
ATOM   3998 C CB    . ARG B 1 239 ? 8.830   -4.309  45.156  1.00 45.36  ? 281 ARG B CB    1 
ATOM   3999 C CG    . ARG B 1 239 ? 9.636   -5.404  44.510  1.00 43.61  ? 281 ARG B CG    1 
ATOM   4000 C CD    . ARG B 1 239 ? 10.115  -6.436  45.495  1.00 39.51  ? 281 ARG B CD    1 
ATOM   4001 N NE    . ARG B 1 239 ? 9.041   -6.942  46.314  1.00 44.01  ? 281 ARG B NE    1 
ATOM   4002 C CZ    . ARG B 1 239 ? 8.918   -8.224  46.632  1.00 47.30  ? 281 ARG B CZ    1 
ATOM   4003 N NH1   . ARG B 1 239 ? 9.781   -9.080  46.137  1.00 48.31  ? 281 ARG B NH1   1 
ATOM   4004 N NH2   . ARG B 1 239 ? 7.916   -8.635  47.397  1.00 50.98  ? 281 ARG B NH2   1 
ATOM   4005 N N     . LEU B 1 240 ? 6.384   -3.648  42.555  1.00 45.92  ? 282 LEU B N     1 
ATOM   4006 C CA    . LEU B 1 240 ? 5.020   -3.902  42.110  1.00 44.31  ? 282 LEU B CA    1 
ATOM   4007 C C     . LEU B 1 240 ? 4.876   -5.156  41.276  1.00 41.58  ? 282 LEU B C     1 
ATOM   4008 O O     . LEU B 1 240 ? 3.745   -5.621  41.086  1.00 40.31  ? 282 LEU B O     1 
ATOM   4009 C CB    . LEU B 1 240 ? 4.496   -2.720  41.281  1.00 41.45  ? 282 LEU B CB    1 
ATOM   4010 C CG    . LEU B 1 240 ? 4.479   -1.392  42.017  1.00 41.81  ? 282 LEU B CG    1 
ATOM   4011 C CD1   . LEU B 1 240 ? 4.099   -0.304  41.051  1.00 34.10  ? 282 LEU B CD1   1 
ATOM   4012 C CD2   . LEU B 1 240 ? 3.515   -1.463  43.205  1.00 35.84  ? 282 LEU B CD2   1 
ATOM   4013 N N     . ASP B 1 241 ? 5.984   -5.691  40.774  1.00 35.66  ? 283 ASP B N     1 
ATOM   4014 C CA    . ASP B 1 241 ? 6.000   -6.756  39.784  1.00 34.74  ? 283 ASP B CA    1 
ATOM   4015 C C     . ASP B 1 241 ? 6.600   -8.000  40.414  1.00 38.22  ? 283 ASP B C     1 
ATOM   4016 O O     . ASP B 1 241 ? 7.712   -7.955  40.946  1.00 38.95  ? 283 ASP B O     1 
ATOM   4017 C CB    . ASP B 1 241 ? 6.796   -6.323  38.560  1.00 38.62  ? 283 ASP B CB    1 
ATOM   4018 C CG    . ASP B 1 241 ? 6.195   -5.099  37.893  1.00 42.97  ? 283 ASP B CG    1 
ATOM   4019 O OD1   . ASP B 1 241 ? 6.441   -3.973  38.373  1.00 41.14  ? 283 ASP B OD1   1 
ATOM   4020 O OD2   . ASP B 1 241 ? 5.462   -5.275  36.890  1.00 47.08  ? 283 ASP B OD2   1 
ATOM   4021 N N     . TYR B 1 242 ? 5.855   -9.095  40.387  1.00 33.97  ? 284 TYR B N     1 
ATOM   4022 C CA    . TYR B 1 242 ? 6.266   -10.267 41.124  1.00 32.68  ? 284 TYR B CA    1 
ATOM   4023 C C     . TYR B 1 242 ? 6.226   -11.514 40.253  1.00 34.66  ? 284 TYR B C     1 
ATOM   4024 O O     . TYR B 1 242 ? 5.607   -11.549 39.188  1.00 35.44  ? 284 TYR B O     1 
ATOM   4025 C CB    . TYR B 1 242 ? 5.382   -10.508 42.340  1.00 36.98  ? 284 TYR B CB    1 
ATOM   4026 C CG    . TYR B 1 242 ? 5.191   -9.345  43.287  1.00 43.94  ? 284 TYR B CG    1 
ATOM   4027 C CD1   . TYR B 1 242 ? 4.162   -8.429  43.082  1.00 38.77  ? 284 TYR B CD1   1 
ATOM   4028 C CD2   . TYR B 1 242 ? 6.016   -9.179  44.417  1.00 41.50  ? 284 TYR B CD2   1 
ATOM   4029 C CE1   . TYR B 1 242 ? 3.952   -7.374  43.957  1.00 46.32  ? 284 TYR B CE1   1 
ATOM   4030 C CE2   . TYR B 1 242 ? 5.815   -8.117  45.304  1.00 43.97  ? 284 TYR B CE2   1 
ATOM   4031 C CZ    . TYR B 1 242 ? 4.776   -7.219  45.070  1.00 47.41  ? 284 TYR B CZ    1 
ATOM   4032 O OH    . TYR B 1 242 ? 4.548   -6.162  45.921  1.00 38.46  ? 284 TYR B OH    1 
ATOM   4033 N N     . PHE B 1 243 ? 6.938   -12.529 40.724  1.00 32.71  ? 285 PHE B N     1 
ATOM   4034 C CA    . PHE B 1 243 ? 6.666   -13.923 40.410  1.00 42.66  ? 285 PHE B CA    1 
ATOM   4035 C C     . PHE B 1 243 ? 6.180   -14.554 41.711  1.00 38.53  ? 285 PHE B C     1 
ATOM   4036 O O     . PHE B 1 243 ? 6.926   -14.597 42.692  1.00 30.07  ? 285 PHE B O     1 
ATOM   4037 C CB    . PHE B 1 243 ? 7.911   -14.649 39.882  1.00 36.02  ? 285 PHE B CB    1 
ATOM   4038 C CG    . PHE B 1 243 ? 8.324   -14.264 38.481  1.00 29.35  ? 285 PHE B CG    1 
ATOM   4039 C CD1   . PHE B 1 243 ? 7.726   -14.852 37.378  1.00 37.14  ? 285 PHE B CD1   1 
ATOM   4040 C CD2   . PHE B 1 243 ? 9.361   -13.372 38.266  1.00 33.30  ? 285 PHE B CD2   1 
ATOM   4041 C CE1   . PHE B 1 243 ? 8.127   -14.528 36.074  1.00 34.40  ? 285 PHE B CE1   1 
ATOM   4042 C CE2   . PHE B 1 243 ? 9.765   -13.033 36.959  1.00 34.45  ? 285 PHE B CE2   1 
ATOM   4043 C CZ    . PHE B 1 243 ? 9.143   -13.609 35.865  1.00 28.83  ? 285 PHE B CZ    1 
ATOM   4044 N N     . LEU B 1 244 ? 4.923   -14.991 41.738  1.00 40.50  ? 286 LEU B N     1 
ATOM   4045 C CA    . LEU B 1 244 ? 4.375   -15.711 42.878  1.00 40.54  ? 286 LEU B CA    1 
ATOM   4046 C C     . LEU B 1 244 ? 4.216   -17.176 42.492  1.00 41.04  ? 286 LEU B C     1 
ATOM   4047 O O     . LEU B 1 244 ? 3.793   -17.486 41.377  1.00 42.09  ? 286 LEU B O     1 
ATOM   4048 C CB    . LEU B 1 244 ? 3.036   -15.119 43.331  1.00 38.99  ? 286 LEU B CB    1 
ATOM   4049 C CG    . LEU B 1 244 ? 2.950   -13.617 43.594  1.00 33.10  ? 286 LEU B CG    1 
ATOM   4050 C CD1   . LEU B 1 244 ? 1.613   -13.311 44.211  1.00 36.75  ? 286 LEU B CD1   1 
ATOM   4051 C CD2   . LEU B 1 244 ? 4.041   -13.153 44.509  1.00 39.87  ? 286 LEU B CD2   1 
ATOM   4052 N N     . LEU B 1 245 ? 4.589   -18.074 43.398  1.00 42.20  ? 287 LEU B N     1 
ATOM   4053 C CA    . LEU B 1 245 ? 4.712   -19.487 43.070  1.00 43.58  ? 287 LEU B CA    1 
ATOM   4054 C C     . LEU B 1 245 ? 3.876   -20.346 43.997  1.00 46.77  ? 287 LEU B C     1 
ATOM   4055 O O     . LEU B 1 245 ? 3.800   -20.083 45.201  1.00 47.64  ? 287 LEU B O     1 
ATOM   4056 C CB    . LEU B 1 245 ? 6.168   -19.938 43.172  1.00 38.37  ? 287 LEU B CB    1 
ATOM   4057 C CG    . LEU B 1 245 ? 7.198   -19.126 42.414  1.00 47.47  ? 287 LEU B CG    1 
ATOM   4058 C CD1   . LEU B 1 245 ? 8.571   -19.807 42.519  1.00 41.82  ? 287 LEU B CD1   1 
ATOM   4059 C CD2   . LEU B 1 245 ? 6.717   -18.850 40.942  1.00 44.04  ? 287 LEU B CD2   1 
ATOM   4060 N N     . SER B 1 246 ? 3.256   -21.375 43.426  1.00 40.57  ? 288 SER B N     1 
ATOM   4061 C CA    . SER B 1 246 ? 2.803   -22.490 44.240  1.00 45.04  ? 288 SER B CA    1 
ATOM   4062 C C     . SER B 1 246 ? 3.932   -22.995 45.128  1.00 50.66  ? 288 SER B C     1 
ATOM   4063 O O     . SER B 1 246 ? 5.099   -23.013 44.729  1.00 48.31  ? 288 SER B O     1 
ATOM   4064 C CB    . SER B 1 246 ? 2.301   -23.612 43.352  1.00 36.59  ? 288 SER B CB    1 
ATOM   4065 O OG    . SER B 1 246 ? 1.059   -23.223 42.842  1.00 43.44  ? 288 SER B OG    1 
ATOM   4066 N N     . HIS B 1 247 ? 3.579   -23.400 46.350  1.00 52.56  ? 289 HIS B N     1 
ATOM   4067 C CA    . HIS B 1 247 ? 4.610   -23.873 47.270  1.00 60.61  ? 289 HIS B CA    1 
ATOM   4068 C C     . HIS B 1 247 ? 5.315   -25.102 46.711  1.00 52.17  ? 289 HIS B C     1 
ATOM   4069 O O     . HIS B 1 247 ? 6.535   -25.252 46.861  1.00 52.55  ? 289 HIS B O     1 
ATOM   4070 C CB    . HIS B 1 247 ? 4.002   -24.142 48.650  1.00 60.63  ? 289 HIS B CB    1 
ATOM   4071 C CG    . HIS B 1 247 ? 3.541   -22.899 49.349  1.00 61.68  ? 289 HIS B CG    1 
ATOM   4072 N ND1   . HIS B 1 247 ? 3.069   -22.899 50.645  1.00 71.82  ? 289 HIS B ND1   1 
ATOM   4073 C CD2   . HIS B 1 247 ? 3.483   -21.612 48.929  1.00 58.86  ? 289 HIS B CD2   1 
ATOM   4074 C CE1   . HIS B 1 247 ? 2.747   -21.665 50.996  1.00 64.08  ? 289 HIS B CE1   1 
ATOM   4075 N NE2   . HIS B 1 247 ? 2.991   -20.866 49.973  1.00 62.52  ? 289 HIS B NE2   1 
ATOM   4076 N N     . SER B 1 248 ? 4.575   -25.955 46.008  1.00 43.26  ? 290 SER B N     1 
ATOM   4077 C CA    . SER B 1 248 ? 5.136   -27.172 45.453  1.00 43.26  ? 290 SER B CA    1 
ATOM   4078 C C     . SER B 1 248 ? 6.235   -26.893 44.440  1.00 49.54  ? 290 SER B C     1 
ATOM   4079 O O     . SER B 1 248 ? 6.840   -27.834 43.925  1.00 56.95  ? 290 SER B O     1 
ATOM   4080 C CB    . SER B 1 248 ? 4.038   -28.002 44.795  1.00 45.65  ? 290 SER B CB    1 
ATOM   4081 O OG    . SER B 1 248 ? 3.258   -27.213 43.912  1.00 50.14  ? 290 SER B OG    1 
ATOM   4082 N N     . LEU B 1 249 ? 6.490   -25.617 44.125  1.00 54.92  ? 291 LEU B N     1 
ATOM   4083 C CA    . LEU B 1 249 ? 7.523   -25.247 43.161  1.00 52.52  ? 291 LEU B CA    1 
ATOM   4084 C C     . LEU B 1 249 ? 8.763   -24.639 43.798  1.00 56.70  ? 291 LEU B C     1 
ATOM   4085 O O     . LEU B 1 249 ? 9.831   -24.664 43.176  1.00 57.00  ? 291 LEU B O     1 
ATOM   4086 C CB    . LEU B 1 249 ? 6.977   -24.254 42.121  1.00 43.11  ? 291 LEU B CB    1 
ATOM   4087 C CG    . LEU B 1 249 ? 5.835   -24.745 41.229  1.00 51.11  ? 291 LEU B CG    1 
ATOM   4088 C CD1   . LEU B 1 249 ? 5.424   -23.672 40.243  1.00 39.04  ? 291 LEU B CD1   1 
ATOM   4089 C CD2   . LEU B 1 249 ? 6.211   -26.028 40.514  1.00 51.48  ? 291 LEU B CD2   1 
ATOM   4090 N N     . LEU B 1 250 ? 8.651   -24.101 45.005  1.00 53.52  ? 292 LEU B N     1 
ATOM   4091 C CA    . LEU B 1 250 ? 9.803   -23.637 45.763  1.00 55.85  ? 292 LEU B CA    1 
ATOM   4092 C C     . LEU B 1 250 ? 10.991  -24.601 45.709  1.00 56.79  ? 292 LEU B C     1 
ATOM   4093 O O     . LEU B 1 250 ? 12.147  -24.151 45.683  1.00 55.41  ? 292 LEU B O     1 
ATOM   4094 C CB    . LEU B 1 250 ? 9.385   -23.383 47.212  1.00 60.48  ? 292 LEU B CB    1 
ATOM   4095 C CG    . LEU B 1 250 ? 8.467   -22.177 47.461  1.00 58.56  ? 292 LEU B CG    1 
ATOM   4096 C CD1   . LEU B 1 250 ? 8.069   -22.083 48.914  1.00 49.51  ? 292 LEU B CD1   1 
ATOM   4097 C CD2   . LEU B 1 250 ? 9.158   -20.887 47.034  1.00 52.47  ? 292 LEU B CD2   1 
ATOM   4098 N N     . PRO B 1 251 ? 10.767  -25.922 45.714  1.00 55.99  ? 293 PRO B N     1 
ATOM   4099 C CA    . PRO B 1 251 ? 11.871  -26.850 45.402  1.00 65.05  ? 293 PRO B CA    1 
ATOM   4100 C C     . PRO B 1 251 ? 12.628  -26.540 44.112  1.00 64.73  ? 293 PRO B C     1 
ATOM   4101 O O     . PRO B 1 251 ? 13.845  -26.782 44.046  1.00 57.35  ? 293 PRO B O     1 
ATOM   4102 C CB    . PRO B 1 251 ? 11.162  -28.215 45.308  1.00 67.35  ? 293 PRO B CB    1 
ATOM   4103 C CG    . PRO B 1 251 ? 9.679   -27.934 45.432  1.00 64.80  ? 293 PRO B CG    1 
ATOM   4104 C CD    . PRO B 1 251 ? 9.604   -26.667 46.224  1.00 63.45  ? 293 PRO B CD    1 
ATOM   4105 N N     . ALA B 1 252 ? 11.953  -26.031 43.080  1.00 60.57  ? 294 ALA B N     1 
ATOM   4106 C CA    . ALA B 1 252 ? 12.599  -25.763 41.799  1.00 55.82  ? 294 ALA B CA    1 
ATOM   4107 C C     . ALA B 1 252 ? 13.143  -24.342 41.676  1.00 49.74  ? 294 ALA B C     1 
ATOM   4108 O O     . ALA B 1 252 ? 13.771  -24.018 40.661  1.00 43.35  ? 294 ALA B O     1 
ATOM   4109 C CB    . ALA B 1 252 ? 11.617  -26.041 40.660  1.00 52.54  ? 294 ALA B CB    1 
ATOM   4110 N N     . LEU B 1 253 ? 12.929  -23.488 42.671  1.00 43.45  ? 295 LEU B N     1 
ATOM   4111 C CA    . LEU B 1 253 ? 13.263  -22.081 42.526  1.00 47.49  ? 295 LEU B CA    1 
ATOM   4112 C C     . LEU B 1 253 ? 14.763  -21.871 42.674  1.00 51.40  ? 295 LEU B C     1 
ATOM   4113 O O     . LEU B 1 253 ? 15.334  -22.123 43.740  1.00 55.28  ? 295 LEU B O     1 
ATOM   4114 C CB    . LEU B 1 253 ? 12.512  -21.232 43.541  1.00 49.21  ? 295 LEU B CB    1 
ATOM   4115 C CG    . LEU B 1 253 ? 13.043  -19.799 43.643  1.00 44.44  ? 295 LEU B CG    1 
ATOM   4116 C CD1   . LEU B 1 253 ? 12.987  -19.059 42.307  1.00 35.32  ? 295 LEU B CD1   1 
ATOM   4117 C CD2   . LEU B 1 253 ? 12.246  -19.059 44.703  1.00 44.02  ? 295 LEU B CD2   1 
ATOM   4118 N N     . CYS B 1 254 ? 15.388  -21.368 41.608  1.00 53.37  ? 296 CYS B N     1 
ATOM   4119 C CA    . CYS B 1 254 ? 16.811  -21.052 41.598  1.00 45.42  ? 296 CYS B CA    1 
ATOM   4120 C C     . CYS B 1 254 ? 17.055  -19.592 41.963  1.00 44.77  ? 296 CYS B C     1 
ATOM   4121 O O     . CYS B 1 254 ? 17.800  -19.296 42.903  1.00 51.57  ? 296 CYS B O     1 
ATOM   4122 C CB    . CYS B 1 254 ? 17.399  -21.385 40.225  1.00 44.86  ? 296 CYS B CB    1 
ATOM   4123 S SG    . CYS B 1 254 ? 16.954  -23.041 39.621  1.00 43.88  ? 296 CYS B SG    1 
ATOM   4124 N N     . ASP B 1 255 ? 16.433  -18.671 41.239  1.00 43.66  ? 297 ASP B N     1 
ATOM   4125 C CA    . ASP B 1 255 ? 16.599  -17.266 41.573  1.00 45.47  ? 297 ASP B CA    1 
ATOM   4126 C C     . ASP B 1 255 ? 15.463  -16.445 40.959  1.00 49.38  ? 297 ASP B C     1 
ATOM   4127 O O     . ASP B 1 255 ? 14.879  -16.821 39.934  1.00 44.47  ? 297 ASP B O     1 
ATOM   4128 C CB    . ASP B 1 255 ? 17.971  -16.752 41.110  1.00 46.27  ? 297 ASP B CB    1 
ATOM   4129 C CG    . ASP B 1 255 ? 18.389  -15.462 41.816  1.00 51.10  ? 297 ASP B CG    1 
ATOM   4130 O OD1   . ASP B 1 255 ? 17.536  -14.873 42.514  1.00 51.40  ? 297 ASP B OD1   1 
ATOM   4131 O OD2   . ASP B 1 255 ? 19.569  -15.033 41.678  1.00 48.61  ? 297 ASP B OD2   1 
ATOM   4132 N N     . SER B 1 256 ? 15.162  -15.320 41.618  1.00 43.13  ? 298 SER B N     1 
ATOM   4133 C CA    . SER B 1 256 ? 14.151  -14.355 41.197  1.00 36.53  ? 298 SER B CA    1 
ATOM   4134 C C     . SER B 1 256 ? 14.834  -13.000 41.106  1.00 39.47  ? 298 SER B C     1 
ATOM   4135 O O     . SER B 1 256 ? 15.273  -12.457 42.121  1.00 47.88  ? 298 SER B O     1 
ATOM   4136 C CB    . SER B 1 256 ? 12.988  -14.312 42.186  1.00 38.96  ? 298 SER B CB    1 
ATOM   4137 O OG    . SER B 1 256 ? 11.876  -13.613 41.665  1.00 36.74  ? 298 SER B OG    1 
ATOM   4138 N N     . LYS B 1 257 ? 14.940  -12.452 39.907  1.00 40.28  ? 299 LYS B N     1 
ATOM   4139 C CA    . LYS B 1 257 ? 15.785  -11.288 39.705  1.00 39.03  ? 299 LYS B CA    1 
ATOM   4140 C C     . LYS B 1 257 ? 14.962  -10.046 39.426  1.00 41.40  ? 299 LYS B C     1 
ATOM   4141 O O     . LYS B 1 257 ? 13.746  -10.088 39.204  1.00 37.55  ? 299 LYS B O     1 
ATOM   4142 C CB    . LYS B 1 257 ? 16.774  -11.499 38.549  1.00 39.37  ? 299 LYS B CB    1 
ATOM   4143 C CG    . LYS B 1 257 ? 17.626  -12.749 38.633  1.00 42.16  ? 299 LYS B CG    1 
ATOM   4144 C CD    . LYS B 1 257 ? 18.557  -12.837 39.856  1.00 41.58  ? 299 LYS B CD    1 
ATOM   4145 C CE    . LYS B 1 257 ? 19.086  -11.527 40.410  1.00 47.34  ? 299 LYS B CE    1 
ATOM   4146 N NZ    . LYS B 1 257 ? 18.661  -11.307 41.853  1.00 49.78  ? 299 LYS B NZ    1 
ATOM   4147 N N     . ILE B 1 258 ? 15.680  -8.928  39.420  1.00 42.49  ? 300 ILE B N     1 
ATOM   4148 C CA    . ILE B 1 258 ? 15.155  -7.608  39.105  1.00 40.17  ? 300 ILE B CA    1 
ATOM   4149 C C     . ILE B 1 258 ? 16.197  -6.973  38.202  1.00 36.58  ? 300 ILE B C     1 
ATOM   4150 O O     . ILE B 1 258 ? 17.358  -6.836  38.599  1.00 36.44  ? 300 ILE B O     1 
ATOM   4151 C CB    . ILE B 1 258 ? 14.919  -6.757  40.372  1.00 50.06  ? 300 ILE B CB    1 
ATOM   4152 C CG1   . ILE B 1 258 ? 14.026  -7.509  41.357  1.00 40.54  ? 300 ILE B CG1   1 
ATOM   4153 C CG2   . ILE B 1 258 ? 14.297  -5.408  40.050  1.00 45.50  ? 300 ILE B CG2   1 
ATOM   4154 C CD1   . ILE B 1 258 ? 13.601  -6.700  42.523  1.00 45.52  ? 300 ILE B CD1   1 
ATOM   4155 N N     . ARG B 1 259 ? 15.810  -6.657  36.968  1.00 41.43  ? 301 ARG B N     1 
ATOM   4156 C CA    . ARG B 1 259 ? 16.764  -6.189  35.959  1.00 34.96  ? 301 ARG B CA    1 
ATOM   4157 C C     . ARG B 1 259 ? 16.775  -4.667  35.985  1.00 39.53  ? 301 ARG B C     1 
ATOM   4158 O O     . ARG B 1 259 ? 16.347  -3.989  35.053  1.00 40.68  ? 301 ARG B O     1 
ATOM   4159 C CB    . ARG B 1 259 ? 16.403  -6.735  34.587  1.00 32.20  ? 301 ARG B CB    1 
ATOM   4160 C CG    . ARG B 1 259 ? 16.287  -8.239  34.547  1.00 36.04  ? 301 ARG B CG    1 
ATOM   4161 C CD    . ARG B 1 259 ? 17.564  -8.896  35.077  1.00 33.32  ? 301 ARG B CD    1 
ATOM   4162 N NE    . ARG B 1 259 ? 17.661  -10.299 34.684  1.00 35.12  ? 301 ARG B NE    1 
ATOM   4163 C CZ    . ARG B 1 259 ? 18.662  -11.108 35.024  1.00 36.78  ? 301 ARG B CZ    1 
ATOM   4164 N NH1   . ARG B 1 259 ? 19.648  -10.662 35.780  1.00 37.59  ? 301 ARG B NH1   1 
ATOM   4165 N NH2   . ARG B 1 259 ? 18.670  -12.368 34.619  1.00 40.39  ? 301 ARG B NH2   1 
ATOM   4166 N N     . SER B 1 260 ? 17.281  -4.152  37.110  1.00 42.10  ? 302 SER B N     1 
ATOM   4167 C CA    . SER B 1 260 ? 17.055  -2.764  37.500  1.00 43.02  ? 302 SER B CA    1 
ATOM   4168 C C     . SER B 1 260 ? 17.430  -1.770  36.413  1.00 51.04  ? 302 SER B C     1 
ATOM   4169 O O     . SER B 1 260 ? 16.789  -0.715  36.294  1.00 48.56  ? 302 SER B O     1 
ATOM   4170 C CB    . SER B 1 260 ? 17.830  -2.452  38.783  1.00 40.68  ? 302 SER B CB    1 
ATOM   4171 O OG    . SER B 1 260 ? 17.035  -2.749  39.923  1.00 43.97  ? 302 SER B OG    1 
ATOM   4172 N N     . LYS B 1 261 ? 18.445  -2.087  35.605  1.00 40.11  ? 303 LYS B N     1 
ATOM   4173 C CA    . LYS B 1 261 ? 19.034  -1.099  34.715  1.00 48.68  ? 303 LYS B CA    1 
ATOM   4174 C C     . LYS B 1 261 ? 18.573  -1.221  33.266  1.00 53.30  ? 303 LYS B C     1 
ATOM   4175 O O     . LYS B 1 261 ? 19.030  -0.439  32.426  1.00 48.93  ? 303 LYS B O     1 
ATOM   4176 C CB    . LYS B 1 261 ? 20.562  -1.180  34.787  1.00 47.35  ? 303 LYS B CB    1 
ATOM   4177 C CG    . LYS B 1 261 ? 21.164  -2.397  34.154  1.00 50.83  ? 303 LYS B CG    1 
ATOM   4178 C CD    . LYS B 1 261 ? 22.691  -2.306  34.158  1.00 53.71  ? 303 LYS B CD    1 
ATOM   4179 C CE    . LYS B 1 261 ? 23.227  -2.222  35.569  1.00 58.73  ? 303 LYS B CE    1 
ATOM   4180 N NZ    . LYS B 1 261 ? 22.625  -3.267  36.443  1.00 63.02  ? 303 LYS B NZ    1 
ATOM   4181 N N     . ALA B 1 262 ? 17.673  -2.160  32.955  1.00 50.64  ? 304 ALA B N     1 
ATOM   4182 C CA    . ALA B 1 262 ? 17.137  -2.320  31.602  1.00 38.73  ? 304 ALA B CA    1 
ATOM   4183 C C     . ALA B 1 262 ? 16.057  -1.264  31.357  1.00 37.62  ? 304 ALA B C     1 
ATOM   4184 O O     . ALA B 1 262 ? 14.999  -1.289  31.985  1.00 46.73  ? 304 ALA B O     1 
ATOM   4185 C CB    . ALA B 1 262 ? 16.591  -3.732  31.430  1.00 31.98  ? 304 ALA B CB    1 
ATOM   4186 N N     . LEU B 1 263 ? 16.308  -0.327  30.452  1.00 39.02  ? 305 LEU B N     1 
ATOM   4187 C CA    . LEU B 1 263 ? 15.413  0.814   30.329  1.00 44.91  ? 305 LEU B CA    1 
ATOM   4188 C C     . LEU B 1 263 ? 14.277  0.512   29.352  1.00 44.21  ? 305 LEU B C     1 
ATOM   4189 O O     . LEU B 1 263 ? 14.237  -0.540  28.717  1.00 44.38  ? 305 LEU B O     1 
ATOM   4190 C CB    . LEU B 1 263 ? 16.200  2.056   29.905  1.00 51.52  ? 305 LEU B CB    1 
ATOM   4191 C CG    . LEU B 1 263 ? 17.343  2.499   30.833  1.00 47.16  ? 305 LEU B CG    1 
ATOM   4192 C CD1   . LEU B 1 263 ? 18.147  3.625   30.195  1.00 42.60  ? 305 LEU B CD1   1 
ATOM   4193 C CD2   . LEU B 1 263 ? 16.864  2.886   32.250  1.00 31.89  ? 305 LEU B CD2   1 
ATOM   4194 N N     . GLY B 1 264 ? 13.332  1.446   29.233  1.00 43.35  ? 306 GLY B N     1 
ATOM   4195 C CA    . GLY B 1 264 ? 12.255  1.329   28.261  1.00 39.43  ? 306 GLY B CA    1 
ATOM   4196 C C     . GLY B 1 264 ? 10.857  1.602   28.792  1.00 40.98  ? 306 GLY B C     1 
ATOM   4197 O O     . GLY B 1 264 ? 9.889   1.702   28.031  1.00 42.75  ? 306 GLY B O     1 
ATOM   4198 N N     . SER B 1 265 ? 10.745  1.766   30.101  1.00 35.94  ? 307 SER B N     1 
ATOM   4199 C CA    . SER B 1 265 ? 9.446   1.828   30.744  1.00 37.44  ? 307 SER B CA    1 
ATOM   4200 C C     . SER B 1 265 ? 9.660   2.435   32.127  1.00 45.74  ? 307 SER B C     1 
ATOM   4201 O O     . SER B 1 265 ? 10.793  2.575   32.597  1.00 48.20  ? 307 SER B O     1 
ATOM   4202 C CB    . SER B 1 265 ? 8.826   0.420   30.798  1.00 35.83  ? 307 SER B CB    1 
ATOM   4203 O OG    . SER B 1 265 ? 7.572   0.390   31.455  1.00 36.36  ? 307 SER B OG    1 
ATOM   4204 N N     . ASP B 1 266 ? 8.569   2.816   32.776  1.00 38.40  ? 308 ASP B N     1 
ATOM   4205 C CA    . ASP B 1 266 ? 8.750   3.187   34.167  1.00 38.34  ? 308 ASP B CA    1 
ATOM   4206 C C     . ASP B 1 266 ? 8.852   1.960   35.062  1.00 40.34  ? 308 ASP B C     1 
ATOM   4207 O O     . ASP B 1 266 ? 9.063   2.109   36.272  1.00 41.09  ? 308 ASP B O     1 
ATOM   4208 C CB    . ASP B 1 266 ? 7.638   4.145   34.641  1.00 41.73  ? 308 ASP B CB    1 
ATOM   4209 C CG    . ASP B 1 266 ? 6.264   3.779   34.112  1.00 43.24  ? 308 ASP B CG    1 
ATOM   4210 O OD1   . ASP B 1 266 ? 6.185   2.823   33.316  1.00 39.82  ? 308 ASP B OD1   1 
ATOM   4211 O OD2   . ASP B 1 266 ? 5.270   4.465   34.478  1.00 38.34  ? 308 ASP B OD2   1 
ATOM   4212 N N     . HIS B 1 267 ? 8.733   0.761   34.493  1.00 33.94  ? 309 HIS B N     1 
ATOM   4213 C CA    . HIS B 1 267 ? 9.014   -0.483  35.193  1.00 36.67  ? 309 HIS B CA    1 
ATOM   4214 C C     . HIS B 1 267 ? 10.242  -1.129  34.577  1.00 40.00  ? 309 HIS B C     1 
ATOM   4215 O O     . HIS B 1 267 ? 10.543  -0.930  33.391  1.00 42.93  ? 309 HIS B O     1 
ATOM   4216 C CB    . HIS B 1 267 ? 7.870   -1.506  35.112  1.00 31.06  ? 309 HIS B CB    1 
ATOM   4217 C CG    . HIS B 1 267 ? 6.558   -1.025  35.638  1.00 28.09  ? 309 HIS B CG    1 
ATOM   4218 N ND1   . HIS B 1 267 ? 5.836   -1.728  36.579  1.00 28.91  ? 309 HIS B ND1   1 
ATOM   4219 C CD2   . HIS B 1 267 ? 5.815   0.065   35.331  1.00 30.53  ? 309 HIS B CD2   1 
ATOM   4220 C CE1   . HIS B 1 267 ? 4.707   -1.090  36.833  1.00 27.39  ? 309 HIS B CE1   1 
ATOM   4221 N NE2   . HIS B 1 267 ? 4.667   0.001   36.088  1.00 28.07  ? 309 HIS B NE2   1 
ATOM   4222 N N     . CYS B 1 268 ? 10.933  -1.926  35.384  1.00 38.98  ? 310 CYS B N     1 
ATOM   4223 C CA    . CYS B 1 268 ? 12.038  -2.739  34.897  1.00 43.65  ? 310 CYS B CA    1 
ATOM   4224 C C     . CYS B 1 268 ? 11.597  -4.195  34.802  1.00 38.08  ? 310 CYS B C     1 
ATOM   4225 O O     . CYS B 1 268 ? 10.582  -4.581  35.393  1.00 40.29  ? 310 CYS B O     1 
ATOM   4226 C CB    . CYS B 1 268 ? 13.271  -2.605  35.809  1.00 43.23  ? 310 CYS B CB    1 
ATOM   4227 S SG    . CYS B 1 268 ? 13.179  -3.477  37.391  1.00 42.86  ? 310 CYS B SG    1 
ATOM   4228 N N     . PRO B 1 269 ? 12.302  -5.026  34.045  1.00 31.64  ? 311 PRO B N     1 
ATOM   4229 C CA    . PRO B 1 269 ? 11.886  -6.421  33.924  1.00 36.23  ? 311 PRO B CA    1 
ATOM   4230 C C     . PRO B 1 269 ? 12.276  -7.216  35.161  1.00 36.70  ? 311 PRO B C     1 
ATOM   4231 O O     . PRO B 1 269 ? 13.194  -6.862  35.905  1.00 38.51  ? 311 PRO B O     1 
ATOM   4232 C CB    . PRO B 1 269 ? 12.640  -6.924  32.681  1.00 35.91  ? 311 PRO B CB    1 
ATOM   4233 C CG    . PRO B 1 269 ? 13.306  -5.732  32.086  1.00 35.64  ? 311 PRO B CG    1 
ATOM   4234 C CD    . PRO B 1 269 ? 13.441  -4.721  33.169  1.00 33.58  ? 311 PRO B CD    1 
ATOM   4235 N N     . ILE B 1 270 ? 11.537  -8.301  35.372  1.00 30.39  ? 312 ILE B N     1 
ATOM   4236 C CA    . ILE B 1 270 ? 11.860  -9.311  36.371  1.00 33.88  ? 312 ILE B CA    1 
ATOM   4237 C C     . ILE B 1 270 ? 12.016  -10.643 35.668  1.00 33.72  ? 312 ILE B C     1 
ATOM   4238 O O     . ILE B 1 270 ? 11.325  -10.919 34.679  1.00 38.89  ? 312 ILE B O     1 
ATOM   4239 C CB    . ILE B 1 270 ? 10.770  -9.416  37.441  1.00 32.56  ? 312 ILE B CB    1 
ATOM   4240 C CG1   . ILE B 1 270 ? 9.406   -9.578  36.745  1.00 30.15  ? 312 ILE B CG1   1 
ATOM   4241 C CG2   . ILE B 1 270 ? 10.865  -8.210  38.358  1.00 31.88  ? 312 ILE B CG2   1 
ATOM   4242 C CD1   . ILE B 1 270 ? 8.235   -9.941  37.656  1.00 30.69  ? 312 ILE B CD1   1 
ATOM   4243 N N     . THR B 1 271 ? 12.917  -11.482 36.178  1.00 29.07  ? 313 THR B N     1 
ATOM   4244 C CA    . THR B 1 271 ? 13.147  -12.772 35.547  1.00 33.69  ? 313 THR B CA    1 
ATOM   4245 C C     . THR B 1 271 ? 13.151  -13.878 36.593  1.00 33.54  ? 313 THR B C     1 
ATOM   4246 O O     . THR B 1 271 ? 13.620  -13.691 37.718  1.00 28.46  ? 313 THR B O     1 
ATOM   4247 C CB    . THR B 1 271 ? 14.454  -12.786 34.730  1.00 37.41  ? 313 THR B CB    1 
ATOM   4248 O OG1   . THR B 1 271 ? 15.482  -12.120 35.473  1.00 62.15  ? 313 THR B OG1   1 
ATOM   4249 C CG2   . THR B 1 271 ? 14.264  -12.060 33.417  1.00 29.34  ? 313 THR B CG2   1 
ATOM   4250 N N     . LEU B 1 272 ? 12.620  -15.036 36.203  1.00 31.03  ? 314 LEU B N     1 
ATOM   4251 C CA    . LEU B 1 272 ? 12.458  -16.183 37.080  1.00 29.37  ? 314 LEU B CA    1 
ATOM   4252 C C     . LEU B 1 272 ? 13.211  -17.372 36.504  1.00 33.40  ? 314 LEU B C     1 
ATOM   4253 O O     . LEU B 1 272 ? 13.156  -17.625 35.298  1.00 35.34  ? 314 LEU B O     1 
ATOM   4254 C CB    . LEU B 1 272 ? 10.953  -16.538 37.260  1.00 33.21  ? 314 LEU B CB    1 
ATOM   4255 C CG    . LEU B 1 272 ? 10.580  -17.712 38.192  1.00 30.15  ? 314 LEU B CG    1 
ATOM   4256 C CD1   . LEU B 1 272 ? 10.629  -17.271 39.624  1.00 31.57  ? 314 LEU B CD1   1 
ATOM   4257 C CD2   . LEU B 1 272 ? 9.222   -18.310 37.884  1.00 25.61  ? 314 LEU B CD2   1 
ATOM   4258 N N     . TYR B 1 273 ? 13.904  -18.111 37.369  1.00 39.33  ? 315 TYR B N     1 
ATOM   4259 C CA    . TYR B 1 273 ? 14.635  -19.318 36.985  1.00 41.11  ? 315 TYR B CA    1 
ATOM   4260 C C     . TYR B 1 273 ? 14.073  -20.518 37.743  1.00 41.60  ? 315 TYR B C     1 
ATOM   4261 O O     . TYR B 1 273 ? 14.267  -20.639 38.954  1.00 45.95  ? 315 TYR B O     1 
ATOM   4262 C CB    . TYR B 1 273 ? 16.121  -19.177 37.288  1.00 42.01  ? 315 TYR B CB    1 
ATOM   4263 C CG    . TYR B 1 273 ? 16.940  -18.312 36.367  1.00 47.19  ? 315 TYR B CG    1 
ATOM   4264 C CD1   . TYR B 1 273 ? 17.343  -18.775 35.114  1.00 44.96  ? 315 TYR B CD1   1 
ATOM   4265 C CD2   . TYR B 1 273 ? 17.389  -17.068 36.785  1.00 47.82  ? 315 TYR B CD2   1 
ATOM   4266 C CE1   . TYR B 1 273 ? 18.141  -18.001 34.289  1.00 41.76  ? 315 TYR B CE1   1 
ATOM   4267 C CE2   . TYR B 1 273 ? 18.183  -16.286 35.974  1.00 45.37  ? 315 TYR B CE2   1 
ATOM   4268 C CZ    . TYR B 1 273 ? 18.559  -16.755 34.729  1.00 51.52  ? 315 TYR B CZ    1 
ATOM   4269 O OH    . TYR B 1 273 ? 19.354  -15.958 33.929  1.00 55.07  ? 315 TYR B OH    1 
ATOM   4270 N N     . LEU B 1 274 ? 13.424  -21.433 37.042  1.00 46.23  ? 316 LEU B N     1 
ATOM   4271 C CA    . LEU B 1 274 ? 12.846  -22.600 37.688  1.00 46.42  ? 316 LEU B CA    1 
ATOM   4272 C C     . LEU B 1 274 ? 13.536  -23.855 37.192  1.00 50.35  ? 316 LEU B C     1 
ATOM   4273 O O     . LEU B 1 274 ? 13.733  -24.026 35.983  1.00 51.58  ? 316 LEU B O     1 
ATOM   4274 C CB    . LEU B 1 274 ? 11.350  -22.694 37.421  1.00 49.83  ? 316 LEU B CB    1 
ATOM   4275 C CG    . LEU B 1 274 ? 10.530  -21.709 38.247  1.00 46.71  ? 316 LEU B CG    1 
ATOM   4276 C CD1   . LEU B 1 274 ? 9.085   -22.033 38.050  1.00 41.35  ? 316 LEU B CD1   1 
ATOM   4277 C CD2   . LEU B 1 274 ? 10.919  -21.734 39.722  1.00 43.88  ? 316 LEU B CD2   1 
ATOM   4278 N N     . ALA B 1 275 ? 13.896  -24.727 38.135  1.00 55.11  ? 317 ALA B N     1 
ATOM   4279 C CA    . ALA B 1 275 ? 14.513  -26.018 37.838  1.00 53.05  ? 317 ALA B CA    1 
ATOM   4280 C C     . ALA B 1 275 ? 13.408  -27.069 37.752  1.00 57.82  ? 317 ALA B C     1 
ATOM   4281 O O     . ALA B 1 275 ? 13.179  -27.858 38.673  1.00 65.81  ? 317 ALA B O     1 
ATOM   4282 C CB    . ALA B 1 275 ? 15.554  -26.361 38.897  1.00 54.41  ? 317 ALA B CB    1 
ATOM   4283 N N     . LEU B 1 276 ? 12.699  -27.055 36.620  1.00 57.33  ? 318 LEU B N     1 
ATOM   4284 C CA    . LEU B 1 276 ? 11.617  -27.998 36.334  1.00 57.22  ? 318 LEU B CA    1 
ATOM   4285 C C     . LEU B 1 276 ? 12.144  -29.325 35.820  1.00 68.21  ? 318 LEU B C     1 
ATOM   4286 O O     . LEU B 1 276 ? 13.247  -29.393 35.271  1.00 67.36  ? 318 LEU B O     1 
ATOM   4287 C CB    . LEU B 1 276 ? 10.646  -27.430 35.295  1.00 56.16  ? 318 LEU B CB    1 
ATOM   4288 C CG    . LEU B 1 276 ? 9.837   -26.178 35.643  1.00 61.82  ? 318 LEU B CG    1 
ATOM   4289 C CD1   . LEU B 1 276 ? 9.005   -25.757 34.436  1.00 57.44  ? 318 LEU B CD1   1 
ATOM   4290 C CD2   . LEU B 1 276 ? 8.947   -26.368 36.867  1.00 49.89  ? 318 LEU B CD2   1 
ATOM   4291 O OXT   . LEU B 1 276 ? 11.461  -30.349 35.919  1.00 75.35  ? 318 LEU B OXT   1 
ATOM   4292 O OP3   . DT  C 2 1   ? -6.456  -40.726 0.914   1.00 65.12  ? 1   DT  C OP3   1 
ATOM   4293 P P     . DT  C 2 1   ? -7.168  -42.098 0.457   1.00 93.31  ? 1   DT  C P     1 
ATOM   4294 O OP1   . DT  C 2 1   ? -8.563  -41.760 0.123   1.00 74.17  ? 1   DT  C OP1   1 
ATOM   4295 O OP2   . DT  C 2 1   ? -6.878  -43.169 1.462   1.00 59.00  ? 1   DT  C OP2   1 
ATOM   4296 O "O5'" . DT  C 2 1   ? -6.503  -42.534 -0.915  1.00 66.63  ? 1   DT  C "O5'" 1 
ATOM   4297 C "C5'" . DT  C 2 1   ? -7.320  -42.747 -2.030  1.00 50.40  ? 1   DT  C "C5'" 1 
ATOM   4298 C "C4'" . DT  C 2 1   ? -7.132  -44.153 -2.539  1.00 54.85  ? 1   DT  C "C4'" 1 
ATOM   4299 O "O4'" . DT  C 2 1   ? -7.780  -45.070 -1.621  1.00 55.01  ? 1   DT  C "O4'" 1 
ATOM   4300 C "C3'" . DT  C 2 1   ? -7.783  -44.426 -3.896  1.00 52.72  ? 1   DT  C "C3'" 1 
ATOM   4301 O "O3'" . DT  C 2 1   ? -7.213  -45.603 -4.482  1.00 46.36  ? 1   DT  C "O3'" 1 
ATOM   4302 C "C2'" . DT  C 2 1   ? -9.195  -44.697 -3.449  1.00 54.93  ? 1   DT  C "C2'" 1 
ATOM   4303 C "C1'" . DT  C 2 1   ? -8.885  -45.649 -2.301  1.00 57.49  ? 1   DT  C "C1'" 1 
ATOM   4304 N N1    . DT  C 2 1   ? -10.008 -45.836 -1.374  1.00 51.90  ? 1   DT  C N1    1 
ATOM   4305 C C2    . DT  C 2 1   ? -10.155 -47.041 -0.732  1.00 51.06  ? 1   DT  C C2    1 
ATOM   4306 O O2    . DT  C 2 1   ? -9.383  -47.976 -0.853  1.00 53.46  ? 1   DT  C O2    1 
ATOM   4307 N N3    . DT  C 2 1   ? -11.229 -47.114 0.075   1.00 46.25  ? 1   DT  C N3    1 
ATOM   4308 C C4    . DT  C 2 1   ? -12.173 -46.155 0.310   1.00 51.31  ? 1   DT  C C4    1 
ATOM   4309 O O4    . DT  C 2 1   ? -13.117 -46.344 1.071   1.00 53.16  ? 1   DT  C O4    1 
ATOM   4310 C C5    . DT  C 2 1   ? -11.979 -44.913 -0.399  1.00 57.16  ? 1   DT  C C5    1 
ATOM   4311 C C7    . DT  C 2 1   ? -12.953 -43.785 -0.227  1.00 50.82  ? 1   DT  C C7    1 
ATOM   4312 C C6    . DT  C 2 1   ? -10.916 -44.815 -1.208  1.00 52.15  ? 1   DT  C C6    1 
ATOM   4313 P P     . DC  C 2 2   ? -5.865  -45.514 -5.355  1.00 42.47  ? 2   DC  C P     1 
ATOM   4314 O OP1   . DC  C 2 2   ? -4.816  -44.830 -4.575  1.00 45.42  ? 2   DC  C OP1   1 
ATOM   4315 O OP2   . DC  C 2 2   ? -6.227  -44.929 -6.652  1.00 39.77  ? 2   DC  C OP2   1 
ATOM   4316 O "O5'" . DC  C 2 2   ? -5.428  -47.035 -5.500  1.00 39.27  ? 2   DC  C "O5'" 1 
ATOM   4317 C "C5'" . DC  C 2 2   ? -5.161  -47.793 -4.326  1.00 48.63  ? 2   DC  C "C5'" 1 
ATOM   4318 C "C4'" . DC  C 2 2   ? -5.723  -49.198 -4.443  1.00 56.17  ? 2   DC  C "C4'" 1 
ATOM   4319 O "O4'" . DC  C 2 2   ? -7.022  -49.279 -3.791  1.00 47.41  ? 2   DC  C "O4'" 1 
ATOM   4320 C "C3'" . DC  C 2 2   ? -5.936  -49.683 -5.879  1.00 62.73  ? 2   DC  C "C3'" 1 
ATOM   4321 O "O3'" . DC  C 2 2   ? -5.564  -51.032 -5.971  1.00 68.06  ? 2   DC  C "O3'" 1 
ATOM   4322 C "C2'" . DC  C 2 2   ? -7.435  -49.507 -6.089  1.00 60.68  ? 2   DC  C "C2'" 1 
ATOM   4323 C "C1'" . DC  C 2 2   ? -7.970  -49.806 -4.697  1.00 55.52  ? 2   DC  C "C1'" 1 
ATOM   4324 N N1    . DC  C 2 2   ? -9.266  -49.169 -4.418  1.00 55.20  ? 2   DC  C N1    1 
ATOM   4325 C C2    . DC  C 2 2   ? -10.167 -49.819 -3.592  1.00 56.38  ? 2   DC  C C2    1 
ATOM   4326 O O2    . DC  C 2 2   ? -9.858  -50.920 -3.128  1.00 57.24  ? 2   DC  C O2    1 
ATOM   4327 N N3    . DC  C 2 2   ? -11.359 -49.241 -3.323  1.00 47.96  ? 2   DC  C N3    1 
ATOM   4328 C C4    . DC  C 2 2   ? -11.656 -48.065 -3.848  1.00 49.93  ? 2   DC  C C4    1 
ATOM   4329 N N4    . DC  C 2 2   ? -12.846 -47.531 -3.547  1.00 55.92  ? 2   DC  C N4    1 
ATOM   4330 C C5    . DC  C 2 2   ? -10.751 -47.379 -4.716  1.00 56.97  ? 2   DC  C C5    1 
ATOM   4331 C C6    . DC  C 2 2   ? -9.570  -47.959 -4.964  1.00 54.26  ? 2   DC  C C6    1 
ATOM   4332 P P     . DG  C 2 3   ? -4.936  -51.607 -7.326  1.00 60.67  ? 3   DG  C P     1 
ATOM   4333 O OP1   . DG  C 2 3   ? -3.526  -51.982 -7.043  1.00 51.42  ? 3   DG  C OP1   1 
ATOM   4334 O OP2   . DG  C 2 3   ? -5.269  -50.654 -8.422  1.00 54.57  ? 3   DG  C OP2   1 
ATOM   4335 O "O5'" . DG  C 2 3   ? -5.735  -52.968 -7.490  1.00 72.04  ? 3   DG  C "O5'" 1 
ATOM   4336 C "C5'" . DG  C 2 3   ? -6.056  -53.703 -6.326  1.00 68.60  ? 3   DG  C "C5'" 1 
ATOM   4337 C "C4'" . DG  C 2 3   ? -7.445  -54.280 -6.442  1.00 79.64  ? 3   DG  C "C4'" 1 
ATOM   4338 O "O4'" . DG  C 2 3   ? -8.443  -53.281 -6.081  1.00 76.28  ? 3   DG  C "O4'" 1 
ATOM   4339 C "C3'" . DG  C 2 3   ? -7.820  -54.757 -7.858  1.00 83.70  ? 3   DG  C "C3'" 1 
ATOM   4340 O "O3'" . DG  C 2 3   ? -8.412  -56.049 -7.773  1.00 97.46  ? 3   DG  C "O3'" 1 
ATOM   4341 C "C2'" . DG  C 2 3   ? -8.840  -53.709 -8.304  1.00 72.15  ? 3   DG  C "C2'" 1 
ATOM   4342 C "C1'" . DG  C 2 3   ? -9.511  -53.427 -6.980  1.00 75.30  ? 3   DG  C "C1'" 1 
ATOM   4343 N N9    . DG  C 2 3   ? -10.345 -52.237 -6.979  1.00 68.50  ? 3   DG  C N9    1 
ATOM   4344 C C8    . DG  C 2 3   ? -10.163 -51.093 -7.715  1.00 68.95  ? 3   DG  C C8    1 
ATOM   4345 N N7    . DG  C 2 3   ? -11.096 -50.198 -7.517  1.00 61.42  ? 3   DG  C N7    1 
ATOM   4346 C C5    . DG  C 2 3   ? -11.947 -50.797 -6.608  1.00 56.86  ? 3   DG  C C5    1 
ATOM   4347 C C6    . DG  C 2 3   ? -13.135 -50.310 -6.030  1.00 66.67  ? 3   DG  C C6    1 
ATOM   4348 O O6    . DG  C 2 3   ? -13.682 -49.205 -6.220  1.00 67.13  ? 3   DG  C O6    1 
ATOM   4349 N N1    . DG  C 2 3   ? -13.700 -51.248 -5.151  1.00 71.71  ? 3   DG  C N1    1 
ATOM   4350 C C2    . DG  C 2 3   ? -13.165 -52.499 -4.883  1.00 71.31  ? 3   DG  C C2    1 
ATOM   4351 N N2    . DG  C 2 3   ? -13.835 -53.270 -4.008  1.00 69.83  ? 3   DG  C N2    1 
ATOM   4352 N N3    . DG  C 2 3   ? -12.046 -52.956 -5.427  1.00 64.31  ? 3   DG  C N3    1 
ATOM   4353 C C4    . DG  C 2 3   ? -11.499 -52.057 -6.272  1.00 60.69  ? 3   DG  C C4    1 
ATOM   4354 P P     . DA  C 2 4   ? -8.075  -57.205 -8.842  1.00 95.38  ? 4   DA  C P     1 
ATOM   4355 O OP1   . DA  C 2 4   ? -6.615  -57.413 -8.891  1.00 86.58  ? 4   DA  C OP1   1 
ATOM   4356 O OP2   . DA  C 2 4   ? -8.773  -56.870 -10.109 1.00 84.27  ? 4   DA  C OP2   1 
ATOM   4357 O "O5'" . DA  C 2 4   ? -8.743  -58.497 -8.164  1.00 87.79  ? 4   DA  C "O5'" 1 
ATOM   4358 C "C5'" . DA  C 2 4   ? -9.961  -59.014 -8.668  1.00 91.52  ? 4   DA  C "C5'" 1 
ATOM   4359 C "C4'" . DA  C 2 4   ? -11.127 -58.690 -7.752  1.00 90.50  ? 4   DA  C "C4'" 1 
ATOM   4360 O "O4'" . DA  C 2 4   ? -11.230 -57.271 -7.563  1.00 81.95  ? 4   DA  C "O4'" 1 
ATOM   4361 C "C3'" . DA  C 2 4   ? -12.484 -59.088 -8.306  1.00 104.46 ? 4   DA  C "C3'" 1 
ATOM   4362 O "O3'" . DA  C 2 4   ? -12.751 -60.450 -7.986  1.00 115.65 ? 4   DA  C "O3'" 1 
ATOM   4363 C "C2'" . DA  C 2 4   ? -13.447 -58.140 -7.581  1.00 99.40  ? 4   DA  C "C2'" 1 
ATOM   4364 C "C1'" . DA  C 2 4   ? -12.562 -56.960 -7.183  1.00 86.29  ? 4   DA  C "C1'" 1 
ATOM   4365 N N9    . DA  C 2 4   ? -12.947 -55.673 -7.773  1.00 77.91  ? 4   DA  C N9    1 
ATOM   4366 C C8    . DA  C 2 4   ? -12.324 -55.021 -8.801  1.00 75.10  ? 4   DA  C C8    1 
ATOM   4367 N N7    . DA  C 2 4   ? -12.861 -53.860 -9.093  1.00 72.79  ? 4   DA  C N7    1 
ATOM   4368 C C5    . DA  C 2 4   ? -13.906 -53.732 -8.187  1.00 76.33  ? 4   DA  C C5    1 
ATOM   4369 C C6    . DA  C 2 4   ? -14.878 -52.711 -7.976  1.00 80.90  ? 4   DA  C C6    1 
ATOM   4370 N N6    . DA  C 2 4   ? -14.940 -51.579 -8.700  1.00 77.99  ? 4   DA  C N6    1 
ATOM   4371 N N1    . DA  C 2 4   ? -15.788 -52.907 -6.985  1.00 79.19  ? 4   DA  C N1    1 
ATOM   4372 C C2    . DA  C 2 4   ? -15.731 -54.043 -6.273  1.00 75.23  ? 4   DA  C C2    1 
ATOM   4373 N N3    . DA  C 2 4   ? -14.869 -55.064 -6.380  1.00 75.25  ? 4   DA  C N3    1 
ATOM   4374 C C4    . DA  C 2 4   ? -13.975 -54.844 -7.366  1.00 77.07  ? 4   DA  C C4    1 
ATOM   4375 P P     . DC  C 2 5   ? -13.379 -61.440 -9.084  1.00 104.23 ? 5   DC  C P     1 
ATOM   4376 O OP1   . DC  C 2 5   ? -12.937 -62.805 -8.716  1.00 90.70  ? 5   DC  C OP1   1 
ATOM   4377 O OP2   . DC  C 2 5   ? -13.107 -60.873 -10.428 1.00 83.80  ? 5   DC  C OP2   1 
ATOM   4378 O "O5'" . DC  C 2 5   ? -14.953 -61.312 -8.849  1.00 99.89  ? 5   DC  C "O5'" 1 
ATOM   4379 C "C5'" . DC  C 2 5   ? -15.714 -60.515 -9.720  1.00 98.48  ? 5   DC  C "C5'" 1 
ATOM   4380 C "C4'" . DC  C 2 5   ? -16.623 -59.598 -8.942  1.00 97.85  ? 5   DC  C "C4'" 1 
ATOM   4381 O "O4'" . DC  C 2 5   ? -16.059 -58.278 -8.917  1.00 94.32  ? 5   DC  C "O4'" 1 
ATOM   4382 C "C3'" . DC  C 2 5   ? -17.980 -59.387 -9.574  1.00 118.13 ? 5   DC  C "C3'" 1 
ATOM   4383 O "O3'" . DC  C 2 5   ? -18.864 -60.449 -9.218  1.00 125.62 ? 5   DC  C "O3'" 1 
ATOM   4384 C "C2'" . DC  C 2 5   ? -18.422 -58.043 -8.982  1.00 113.67 ? 5   DC  C "C2'" 1 
ATOM   4385 C "C1'" . DC  C 2 5   ? -17.089 -57.350 -8.645  1.00 99.67  ? 5   DC  C "C1'" 1 
ATOM   4386 N N1    . DC  C 2 5   ? -16.814 -56.067 -9.413  1.00 91.20  ? 5   DC  C N1    1 
ATOM   4387 C C2    . DC  C 2 5   ? -17.738 -54.993 -9.368  1.00 86.72  ? 5   DC  C C2    1 
ATOM   4388 O O2    . DC  C 2 5   ? -18.788 -55.107 -8.723  1.00 81.19  ? 5   DC  C O2    1 
ATOM   4389 N N3    . DC  C 2 5   ? -17.450 -53.856 -10.050 1.00 85.34  ? 5   DC  C N3    1 
ATOM   4390 C C4    . DC  C 2 5   ? -16.312 -53.756 -10.742 1.00 83.80  ? 5   DC  C C4    1 
ATOM   4391 N N4    . DC  C 2 5   ? -16.080 -52.618 -11.385 1.00 78.35  ? 5   DC  C N4    1 
ATOM   4392 C C5    . DC  C 2 5   ? -15.364 -54.825 -10.800 1.00 87.93  ? 5   DC  C C5    1 
ATOM   4393 C C6    . DC  C 2 5   ? -15.646 -55.947 -10.125 1.00 86.88  ? 5   DC  C C6    1 
ATOM   4394 P P     . DG  C 2 6   ? -19.811 -61.096 -10.344 1.00 151.12 ? 6   DG  C P     1 
ATOM   4395 O OP1   . DG  C 2 6   ? -19.431 -62.512 -10.527 1.00 112.44 ? 6   DG  C OP1   1 
ATOM   4396 O OP2   . DG  C 2 6   ? -19.777 -60.189 -11.508 1.00 124.93 ? 6   DG  C OP2   1 
ATOM   4397 O "O5'" . DG  C 2 6   ? -21.275 -60.985 -9.721  1.00 122.37 ? 6   DG  C "O5'" 1 
ATOM   4398 C "C5'" . DG  C 2 6   ? -22.381 -60.732 -10.569 1.00 120.62 ? 6   DG  C "C5'" 1 
ATOM   4399 C "C4'" . DG  C 2 6   ? -22.785 -59.272 -10.516 1.00 119.03 ? 6   DG  C "C4'" 1 
ATOM   4400 O "O4'" . DG  C 2 6   ? -21.615 -58.437 -10.492 1.00 113.66 ? 6   DG  C "O4'" 1 
ATOM   4401 C "C3'" . DG  C 2 6   ? -23.564 -58.799 -11.728 1.00 118.22 ? 6   DG  C "C3'" 1 
ATOM   4402 O "O3'" . DG  C 2 6   ? -24.960 -58.965 -11.503 1.00 124.91 ? 6   DG  C "O3'" 1 
ATOM   4403 C "C2'" . DG  C 2 6   ? -23.186 -57.319 -11.851 1.00 112.86 ? 6   DG  C "C2'" 1 
ATOM   4404 C "C1'" . DG  C 2 6   ? -21.977 -57.154 -10.943 1.00 112.36 ? 6   DG  C "C1'" 1 
ATOM   4405 N N9    . DG  C 2 6   ? -20.845 -56.554 -11.628 1.00 105.75 ? 6   DG  C N9    1 
ATOM   4406 C C8    . DG  C 2 6   ? -19.678 -57.171 -11.993 1.00 106.39 ? 6   DG  C C8    1 
ATOM   4407 N N7    . DG  C 2 6   ? -18.842 -56.380 -12.603 1.00 103.27 ? 6   DG  C N7    1 
ATOM   4408 C C5    . DG  C 2 6   ? -19.503 -55.159 -12.656 1.00 97.02  ? 6   DG  C C5    1 
ATOM   4409 C C6    . DG  C 2 6   ? -19.090 -53.918 -13.205 1.00 93.45  ? 6   DG  C C6    1 
ATOM   4410 O O6    . DG  C 2 6   ? -18.019 -53.642 -13.771 1.00 89.96  ? 6   DG  C O6    1 
ATOM   4411 N N1    . DG  C 2 6   ? -20.064 -52.935 -13.040 1.00 96.86  ? 6   DG  C N1    1 
ATOM   4412 C C2    . DG  C 2 6   ? -21.284 -53.125 -12.426 1.00 98.60  ? 6   DG  C C2    1 
ATOM   4413 N N2    . DG  C 2 6   ? -22.097 -52.057 -12.368 1.00 93.66  ? 6   DG  C N2    1 
ATOM   4414 N N3    . DG  C 2 6   ? -21.681 -54.282 -11.911 1.00 101.93 ? 6   DG  C N3    1 
ATOM   4415 C C4    . DG  C 2 6   ? -20.740 -55.251 -12.061 1.00 101.10 ? 6   DG  C C4    1 
ATOM   4416 P P     . DG  C 2 7   ? -26.011 -58.669 -12.688 1.00 131.89 ? 7   DG  C P     1 
ATOM   4417 O OP1   . DG  C 2 7   ? -26.906 -59.843 -12.795 1.00 129.08 ? 7   DG  C OP1   1 
ATOM   4418 O OP2   . DG  C 2 7   ? -25.251 -58.228 -13.878 1.00 129.71 ? 7   DG  C OP2   1 
ATOM   4419 O "O5'" . DG  C 2 7   ? -26.896 -57.427 -12.150 1.00 142.72 ? 7   DG  C "O5'" 1 
ATOM   4420 C "C5'" . DG  C 2 7   ? -26.287 -56.172 -11.766 1.00 132.96 ? 7   DG  C "C5'" 1 
ATOM   4421 C "C4'" . DG  C 2 7   ? -26.484 -55.108 -12.837 1.00 123.77 ? 7   DG  C "C4'" 1 
ATOM   4422 O "O4'" . DG  C 2 7   ? -25.210 -54.478 -13.147 1.00 116.87 ? 7   DG  C "O4'" 1 
ATOM   4423 C "C3'" . DG  C 2 7   ? -27.051 -55.618 -14.169 1.00 119.18 ? 7   DG  C "C3'" 1 
ATOM   4424 O "O3'" . DG  C 2 7   ? -28.208 -54.855 -14.522 1.00 115.74 ? 7   DG  C "O3'" 1 
ATOM   4425 C "C2'" . DG  C 2 7   ? -25.889 -55.442 -15.159 1.00 113.67 ? 7   DG  C "C2'" 1 
ATOM   4426 C "C1'" . DG  C 2 7   ? -25.111 -54.293 -14.538 1.00 114.77 ? 7   DG  C "C1'" 1 
ATOM   4427 N N9    . DG  C 2 7   ? -23.691 -54.264 -14.906 1.00 111.28 ? 7   DG  C N9    1 
ATOM   4428 C C8    . DG  C 2 7   ? -22.779 -55.298 -14.803 1.00 108.05 ? 7   DG  C C8    1 
ATOM   4429 N N7    . DG  C 2 7   ? -21.575 -54.975 -15.204 1.00 101.75 ? 7   DG  C N7    1 
ATOM   4430 C C5    . DG  C 2 7   ? -21.690 -53.640 -15.597 1.00 103.30 ? 7   DG  C C5    1 
ATOM   4431 C C6    . DG  C 2 7   ? -20.712 -52.749 -16.113 1.00 93.76  ? 7   DG  C C6    1 
ATOM   4432 O O6    . DG  C 2 7   ? -19.520 -52.977 -16.344 1.00 87.32  ? 7   DG  C O6    1 
ATOM   4433 N N1    . DG  C 2 7   ? -21.248 -51.484 -16.383 1.00 96.29  ? 7   DG  C N1    1 
ATOM   4434 C C2    . DG  C 2 7   ? -22.564 -51.119 -16.166 1.00 100.89 ? 7   DG  C C2    1 
ATOM   4435 N N2    . DG  C 2 7   ? -22.898 -49.854 -16.484 1.00 98.91  ? 7   DG  C N2    1 
ATOM   4436 N N3    . DG  C 2 7   ? -23.491 -51.946 -15.681 1.00 101.53 ? 7   DG  C N3    1 
ATOM   4437 C C4    . DG  C 2 7   ? -22.984 -53.184 -15.413 1.00 107.18 ? 7   DG  C C4    1 
ATOM   4438 P P     . DA  C 2 8   ? -28.640 -54.638 -16.053 1.00 114.68 ? 8   DA  C P     1 
ATOM   4439 O OP1   . DA  C 2 8   ? -29.992 -54.027 -16.013 1.00 116.19 ? 8   DA  C OP1   1 
ATOM   4440 O OP2   . DA  C 2 8   ? -28.400 -55.881 -16.829 1.00 110.10 ? 8   DA  C OP2   1 
ATOM   4441 O "O5'" . DA  C 2 8   ? -27.631 -53.516 -16.569 1.00 115.17 ? 8   DA  C "O5'" 1 
ATOM   4442 C "C5'" . DA  C 2 8   ? -27.632 -52.214 -15.978 1.00 115.78 ? 8   DA  C "C5'" 1 
ATOM   4443 C "C4'" . DA  C 2 8   ? -27.408 -51.171 -17.046 1.00 109.07 ? 8   DA  C "C4'" 1 
ATOM   4444 O "O4'" . DA  C 2 8   ? -25.986 -51.044 -17.312 1.00 107.29 ? 8   DA  C "O4'" 1 
ATOM   4445 C "C3'" . DA  C 2 8   ? -28.051 -51.523 -18.378 1.00 111.06 ? 8   DA  C "C3'" 1 
ATOM   4446 O "O3'" . DA  C 2 8   ? -28.494 -50.360 -19.022 1.00 113.22 ? 8   DA  C "O3'" 1 
ATOM   4447 C "C2'" . DA  C 2 8   ? -26.922 -52.199 -19.144 1.00 106.49 ? 8   DA  C "C2'" 1 
ATOM   4448 C "C1'" . DA  C 2 8   ? -25.685 -51.490 -18.622 1.00 101.80 ? 8   DA  C "C1'" 1 
ATOM   4449 N N9    . DA  C 2 8   ? -24.555 -52.391 -18.546 1.00 97.86  ? 8   DA  C N9    1 
ATOM   4450 C C8    . DA  C 2 8   ? -24.580 -53.679 -18.090 1.00 101.07 ? 8   DA  C C8    1 
ATOM   4451 N N7    . DA  C 2 8   ? -23.419 -54.284 -18.150 1.00 101.26 ? 8   DA  C N7    1 
ATOM   4452 C C5    . DA  C 2 8   ? -22.568 -53.326 -18.691 1.00 101.49 ? 8   DA  C C5    1 
ATOM   4453 C C6    . DA  C 2 8   ? -21.189 -53.345 -19.020 1.00 93.82  ? 8   DA  C C6    1 
ATOM   4454 N N6    . DA  C 2 8   ? -20.395 -54.408 -18.820 1.00 85.77  ? 8   DA  C N6    1 
ATOM   4455 N N1    . DA  C 2 8   ? -20.656 -52.215 -19.545 1.00 83.75  ? 8   DA  C N1    1 
ATOM   4456 C C2    . DA  C 2 8   ? -21.452 -51.157 -19.738 1.00 86.04  ? 8   DA  C C2    1 
ATOM   4457 N N3    . DA  C 2 8   ? -22.755 -51.022 -19.475 1.00 90.27  ? 8   DA  C N3    1 
ATOM   4458 C C4    . DA  C 2 8   ? -23.259 -52.153 -18.953 1.00 96.54  ? 8   DA  C C4    1 
ATOM   4459 P P     . DT  C 2 9   ? -28.928 -50.467 -20.516 1.00 126.51 ? 9   DT  C P     1 
ATOM   4460 O OP1   . DT  C 2 9   ? -30.013 -49.497 -20.721 1.00 114.71 ? 9   DT  C OP1   1 
ATOM   4461 O OP2   . DT  C 2 9   ? -29.161 -51.897 -20.795 1.00 111.42 ? 9   DT  C OP2   1 
ATOM   4462 O "O5'" . DT  C 2 9   ? -27.604 -50.112 -21.321 1.00 103.22 ? 9   DT  C "O5'" 1 
ATOM   4463 C "C5'" . DT  C 2 9   ? -27.066 -48.795 -21.320 1.00 101.64 ? 9   DT  C "C5'" 1 
ATOM   4464 C "C4'" . DT  C 2 9   ? -25.868 -48.714 -22.235 1.00 105.44 ? 9   DT  C "C4'" 1 
ATOM   4465 O "O4'" . DT  C 2 9   ? -24.909 -49.729 -21.909 1.00 93.92  ? 9   DT  C "O4'" 1 
ATOM   4466 C "C3'" . DT  C 2 9   ? -26.173 -48.909 -23.720 1.00 108.90 ? 9   DT  C "C3'" 1 
ATOM   4467 O "O3'" . DT  C 2 9   ? -26.076 -47.668 -24.374 1.00 98.81  ? 9   DT  C "O3'" 1 
ATOM   4468 C "C2'" . DT  C 2 9   ? -25.097 -49.868 -24.212 1.00 101.99 ? 9   DT  C "C2'" 1 
ATOM   4469 C "C1'" . DT  C 2 9   ? -24.123 -49.910 -23.062 1.00 100.32 ? 9   DT  C "C1'" 1 
ATOM   4470 N N1    . DT  C 2 9   ? -23.344 -51.144 -22.890 1.00 94.57  ? 9   DT  C N1    1 
ATOM   4471 C C2    . DT  C 2 9   ? -22.004 -51.100 -23.189 1.00 90.27  ? 9   DT  C C2    1 
ATOM   4472 O O2    . DT  C 2 9   ? -21.458 -50.115 -23.653 1.00 84.69  ? 9   DT  C O2    1 
ATOM   4473 N N3    . DT  C 2 9   ? -21.328 -52.265 -22.943 1.00 90.74  ? 9   DT  C N3    1 
ATOM   4474 C C4    . DT  C 2 9   ? -21.838 -53.429 -22.405 1.00 90.45  ? 9   DT  C C4    1 
ATOM   4475 O O4    . DT  C 2 9   ? -21.109 -54.399 -22.245 1.00 86.76  ? 9   DT  C O4    1 
ATOM   4476 C C5    . DT  C 2 9   ? -23.247 -53.401 -22.107 1.00 87.91  ? 9   DT  C C5    1 
ATOM   4477 C C7    . DT  C 2 9   ? -23.892 -54.626 -21.543 1.00 86.79  ? 9   DT  C C7    1 
ATOM   4478 C C6    . DT  C 2 9   ? -23.918 -52.268 -22.344 1.00 88.62  ? 9   DT  C C6    1 
ATOM   4479 P P     . DC  C 2 10  ? -25.996 -47.684 -25.965 1.00 104.15 ? 10  DC  C P     1 
ATOM   4480 O OP1   . DC  C 2 10  ? -26.490 -46.395 -26.446 1.00 96.65  ? 10  DC  C OP1   1 
ATOM   4481 O OP2   . DC  C 2 10  ? -26.625 -48.937 -26.386 1.00 114.78 ? 10  DC  C OP2   1 
ATOM   4482 O "O5'" . DC  C 2 10  ? -24.439 -47.851 -26.181 1.00 100.18 ? 10  DC  C "O5'" 1 
ATOM   4483 C "C5'" . DC  C 2 10  ? -23.547 -46.753 -26.025 1.00 97.73  ? 10  DC  C "C5'" 1 
ATOM   4484 C "C4'" . DC  C 2 10  ? -22.370 -46.921 -26.956 1.00 97.14  ? 10  DC  C "C4'" 1 
ATOM   4485 O "O4'" . DC  C 2 10  ? -21.664 -48.138 -26.627 1.00 98.45  ? 10  DC  C "O4'" 1 
ATOM   4486 C "C3'" . DC  C 2 10  ? -22.738 -47.032 -28.432 1.00 93.83  ? 10  DC  C "C3'" 1 
ATOM   4487 O "O3'" . DC  C 2 10  ? -21.763 -46.335 -29.208 1.00 89.99  ? 10  DC  C "O3'" 1 
ATOM   4488 C "C2'" . DC  C 2 10  ? -22.682 -48.524 -28.690 1.00 95.60  ? 10  DC  C "C2'" 1 
ATOM   4489 C "C1'" . DC  C 2 10  ? -21.561 -48.968 -27.770 1.00 98.20  ? 10  DC  C "C1'" 1 
ATOM   4490 N N1    . DC  C 2 10  ? -21.659 -50.368 -27.324 1.00 92.61  ? 10  DC  C N1    1 
ATOM   4491 C C2    . DC  C 2 10  ? -20.550 -51.206 -27.460 1.00 85.40  ? 10  DC  C C2    1 
ATOM   4492 O O2    . DC  C 2 10  ? -19.512 -50.751 -27.948 1.00 78.56  ? 10  DC  C O2    1 
ATOM   4493 N N3    . DC  C 2 10  ? -20.637 -52.488 -27.047 1.00 82.45  ? 10  DC  C N3    1 
ATOM   4494 C C4    . DC  C 2 10  ? -21.775 -52.943 -26.523 1.00 81.95  ? 10  DC  C C4    1 
ATOM   4495 N N4    . DC  C 2 10  ? -21.816 -54.219 -26.136 1.00 75.37  ? 10  DC  C N4    1 
ATOM   4496 C C5    . DC  C 2 10  ? -22.918 -52.111 -26.368 1.00 83.49  ? 10  DC  C C5    1 
ATOM   4497 C C6    . DC  C 2 10  ? -22.822 -50.846 -26.791 1.00 86.41  ? 10  DC  C C6    1 
ATOM   4498 P P     . DC  C 2 11  ? -21.883 -46.268 -30.790 1.00 98.24  ? 11  DC  C P     1 
ATOM   4499 O OP1   . DC  C 2 11  ? -20.530 -46.129 -31.334 1.00 101.83 ? 11  DC  C OP1   1 
ATOM   4500 O OP2   . DC  C 2 11  ? -22.906 -45.281 -31.142 1.00 94.85  ? 11  DC  C OP2   1 
ATOM   4501 O "O5'" . DC  C 2 11  ? -22.436 -47.699 -31.199 1.00 98.34  ? 11  DC  C "O5'" 1 
ATOM   4502 C "C5'" . DC  C 2 11  ? -22.163 -48.272 -32.484 1.00 99.63  ? 11  DC  C "C5'" 1 
ATOM   4503 C "C4'" . DC  C 2 11  ? -20.688 -48.544 -32.664 1.00 97.20  ? 11  DC  C "C4'" 1 
ATOM   4504 O "O4'" . DC  C 2 11  ? -20.134 -49.126 -31.465 1.00 102.35 ? 11  DC  C "O4'" 1 
ATOM   4505 C "C3'" . DC  C 2 11  ? -20.374 -49.523 -33.794 1.00 91.88  ? 11  DC  C "C3'" 1 
ATOM   4506 O "O3'" . DC  C 2 11  ? -19.741 -48.839 -34.873 1.00 86.31  ? 11  DC  C "O3'" 1 
ATOM   4507 C "C2'" . DC  C 2 11  ? -19.441 -50.541 -33.163 1.00 96.60  ? 11  DC  C "C2'" 1 
ATOM   4508 C "C1'" . DC  C 2 11  ? -19.801 -50.477 -31.699 1.00 95.53  ? 11  DC  C "C1'" 1 
ATOM   4509 N N1    . DC  C 2 11  ? -20.936 -51.319 -31.259 1.00 94.14  ? 11  DC  C N1    1 
ATOM   4510 C C2    . DC  C 2 11  ? -20.687 -52.641 -30.891 1.00 84.77  ? 11  DC  C C2    1 
ATOM   4511 O O2    . DC  C 2 11  ? -19.533 -53.076 -30.974 1.00 81.78  ? 11  DC  C O2    1 
ATOM   4512 N N3    . DC  C 2 11  ? -21.711 -53.416 -30.471 1.00 76.61  ? 11  DC  C N3    1 
ATOM   4513 C C4    . DC  C 2 11  ? -22.940 -52.909 -30.395 1.00 75.68  ? 11  DC  C C4    1 
ATOM   4514 N N4    . DC  C 2 11  ? -23.918 -53.707 -29.972 1.00 66.68  ? 11  DC  C N4    1 
ATOM   4515 C C5    . DC  C 2 11  ? -23.223 -51.564 -30.759 1.00 81.74  ? 11  DC  C C5    1 
ATOM   4516 C C6    . DC  C 2 11  ? -22.203 -50.811 -31.184 1.00 89.05  ? 11  DC  C C6    1 
ATOM   4517 O "O5'" . DG  D 3 1   ? 4.804   -45.860 35.478  1.00 61.76  ? 1   DG  D "O5'" 1 
ATOM   4518 C "C5'" . DG  D 3 1   ? 4.464   -46.088 34.100  1.00 46.87  ? 1   DG  D "C5'" 1 
ATOM   4519 C "C4'" . DG  D 3 1   ? 4.626   -47.561 33.712  1.00 54.39  ? 1   DG  D "C4'" 1 
ATOM   4520 O "O4'" . DG  D 3 1   ? 3.519   -48.340 34.237  1.00 56.51  ? 1   DG  D "O4'" 1 
ATOM   4521 C "C3'" . DG  D 3 1   ? 4.589   -47.825 32.218  1.00 54.12  ? 1   DG  D "C3'" 1 
ATOM   4522 O "O3'" . DG  D 3 1   ? 5.242   -49.032 31.901  1.00 52.69  ? 1   DG  D "O3'" 1 
ATOM   4523 C "C2'" . DG  D 3 1   ? 3.101   -47.927 31.937  1.00 55.20  ? 1   DG  D "C2'" 1 
ATOM   4524 C "C1'" . DG  D 3 1   ? 2.585   -48.614 33.198  1.00 50.08  ? 1   DG  D "C1'" 1 
ATOM   4525 N N9    . DG  D 3 1   ? 1.277   -48.120 33.615  1.00 49.02  ? 1   DG  D N9    1 
ATOM   4526 C C8    . DG  D 3 1   ? 0.902   -46.813 33.817  1.00 48.32  ? 1   DG  D C8    1 
ATOM   4527 N N7    . DG  D 3 1   ? -0.348  -46.682 34.180  1.00 44.95  ? 1   DG  D N7    1 
ATOM   4528 C C5    . DG  D 3 1   ? -0.828  -47.987 34.218  1.00 48.85  ? 1   DG  D C5    1 
ATOM   4529 C C6    . DG  D 3 1   ? -2.122  -48.497 34.554  1.00 51.88  ? 1   DG  D C6    1 
ATOM   4530 O O6    . DG  D 3 1   ? -3.145  -47.881 34.905  1.00 56.25  ? 1   DG  D O6    1 
ATOM   4531 N N1    . DG  D 3 1   ? -2.161  -49.875 34.459  1.00 44.87  ? 1   DG  D N1    1 
ATOM   4532 C C2    . DG  D 3 1   ? -1.102  -50.667 34.089  1.00 44.60  ? 1   DG  D C2    1 
ATOM   4533 N N2    . DG  D 3 1   ? -1.334  -51.975 34.049  1.00 41.51  ? 1   DG  D N2    1 
ATOM   4534 N N3    . DG  D 3 1   ? 0.097   -50.213 33.776  1.00 47.32  ? 1   DG  D N3    1 
ATOM   4535 C C4    . DG  D 3 1   ? 0.165   -48.874 33.867  1.00 48.92  ? 1   DG  D C4    1 
ATOM   4536 P P     . DC  D 3 2   ? 5.826   -49.215 30.410  1.00 66.23  ? 2   DC  D P     1 
ATOM   4537 O OP1   . DC  D 3 2   ? 7.158   -49.860 30.538  1.00 43.89  ? 2   DC  D OP1   1 
ATOM   4538 O OP2   . DC  D 3 2   ? 5.630   -47.923 29.706  1.00 44.02  ? 2   DC  D OP2   1 
ATOM   4539 O "O5'" . DC  D 3 2   ? 4.786   -50.194 29.673  1.00 56.54  ? 2   DC  D "O5'" 1 
ATOM   4540 C "C5'" . DC  D 3 2   ? 4.821   -51.590 29.912  1.00 44.82  ? 2   DC  D "C5'" 1 
ATOM   4541 C "C4'" . DC  D 3 2   ? 3.464   -52.218 29.654  1.00 44.18  ? 2   DC  D "C4'" 1 
ATOM   4542 O "O4'" . DC  D 3 2   ? 2.443   -51.490 30.344  1.00 44.25  ? 2   DC  D "O4'" 1 
ATOM   4543 C "C3'" . DC  D 3 2   ? 2.996   -52.236 28.198  1.00 37.18  ? 2   DC  D "C3'" 1 
ATOM   4544 O "O3'" . DC  D 3 2   ? 3.348   -53.463 27.626  1.00 44.07  ? 2   DC  D "O3'" 1 
ATOM   4545 C "C2'" . DC  D 3 2   ? 1.467   -52.087 28.295  1.00 38.09  ? 2   DC  D "C2'" 1 
ATOM   4546 C "C1'" . DC  D 3 2   ? 1.224   -51.912 29.803  1.00 42.55  ? 2   DC  D "C1'" 1 
ATOM   4547 N N1    . DC  D 3 2   ? 0.142   -50.925 30.163  1.00 42.93  ? 2   DC  D N1    1 
ATOM   4548 C C2    . DC  D 3 2   ? -1.119  -51.410 30.484  1.00 38.10  ? 2   DC  D C2    1 
ATOM   4549 O O2    . DC  D 3 2   ? -1.299  -52.627 30.463  1.00 41.91  ? 2   DC  D O2    1 
ATOM   4550 N N3    . DC  D 3 2   ? -2.103  -50.539 30.800  1.00 40.37  ? 2   DC  D N3    1 
ATOM   4551 C C4    . DC  D 3 2   ? -1.854  -49.225 30.808  1.00 43.39  ? 2   DC  D C4    1 
ATOM   4552 N N4    . DC  D 3 2   ? -2.857  -48.397 31.140  1.00 40.62  ? 2   DC  D N4    1 
ATOM   4553 C C5    . DC  D 3 2   ? -0.564  -48.703 30.477  1.00 40.51  ? 2   DC  D C5    1 
ATOM   4554 C C6    . DC  D 3 2   ? 0.396   -49.580 30.168  1.00 41.59  ? 2   DC  D C6    1 
ATOM   4555 P P     . DT  D 3 3   ? 3.243   -53.703 26.041  1.00 40.37  ? 3   DT  D P     1 
ATOM   4556 O OP1   . DT  D 3 3   ? 4.291   -54.680 25.670  1.00 32.13  ? 3   DT  D OP1   1 
ATOM   4557 O OP2   . DT  D 3 3   ? 3.160   -52.401 25.352  1.00 39.08  ? 3   DT  D OP2   1 
ATOM   4558 O "O5'" . DT  D 3 3   ? 1.802   -54.363 25.861  1.00 40.52  ? 3   DT  D "O5'" 1 
ATOM   4559 C "C5'" . DT  D 3 3   ? 1.390   -55.459 26.663  1.00 34.28  ? 3   DT  D "C5'" 1 
ATOM   4560 C "C4'" . DT  D 3 3   ? -0.121  -55.620 26.577  1.00 37.40  ? 3   DT  D "C4'" 1 
ATOM   4561 O "O4'" . DT  D 3 3   ? -0.758  -54.488 27.200  1.00 33.07  ? 3   DT  D "O4'" 1 
ATOM   4562 C "C3'" . DT  D 3 3   ? -0.672  -55.657 25.153  1.00 41.57  ? 3   DT  D "C3'" 1 
ATOM   4563 O "O3'" . DT  D 3 3   ? -1.166  -56.941 24.875  1.00 41.23  ? 3   DT  D "O3'" 1 
ATOM   4564 C "C2'" . DT  D 3 3   ? -1.790  -54.591 25.134  1.00 39.95  ? 3   DT  D "C2'" 1 
ATOM   4565 C "C1'" . DT  D 3 3   ? -2.008  -54.302 26.614  1.00 39.02  ? 3   DT  D "C1'" 1 
ATOM   4566 N N1    . DT  D 3 3   ? -2.431  -52.902 26.923  1.00 38.74  ? 3   DT  D N1    1 
ATOM   4567 C C2    . DT  D 3 3   ? -3.642  -52.659 27.566  1.00 39.83  ? 3   DT  D C2    1 
ATOM   4568 O O2    . DT  D 3 3   ? -4.431  -53.529 27.870  1.00 47.40  ? 3   DT  D O2    1 
ATOM   4569 N N3    . DT  D 3 3   ? -3.900  -51.349 27.821  1.00 41.57  ? 3   DT  D N3    1 
ATOM   4570 C C4    . DT  D 3 3   ? -3.092  -50.268 27.514  1.00 46.47  ? 3   DT  D C4    1 
ATOM   4571 O O4    . DT  D 3 3   ? -3.420  -49.108 27.780  1.00 43.40  ? 3   DT  D O4    1 
ATOM   4572 C C5    . DT  D 3 3   ? -1.839  -50.599 26.850  1.00 41.25  ? 3   DT  D C5    1 
ATOM   4573 C C7    . DT  D 3 3   ? -0.873  -49.523 26.458  1.00 36.79  ? 3   DT  D C7    1 
ATOM   4574 C C6    . DT  D 3 3   ? -1.577  -51.883 26.605  1.00 39.70  ? 3   DT  D C6    1 
ATOM   4575 P P     . DG  D 3 4   ? -1.494  -57.357 23.365  1.00 41.77  ? 4   DG  D P     1 
ATOM   4576 O OP1   . DG  D 3 4   ? -1.193  -58.803 23.187  1.00 38.88  ? 4   DG  D OP1   1 
ATOM   4577 O OP2   . DG  D 3 4   ? -0.752  -56.404 22.506  1.00 50.61  ? 4   DG  D OP2   1 
ATOM   4578 O "O5'" . DG  D 3 4   ? -3.059  -57.052 23.246  1.00 35.13  ? 4   DG  D "O5'" 1 
ATOM   4579 C "C5'" . DG  D 3 4   ? -3.960  -57.575 24.206  1.00 38.40  ? 4   DG  D "C5'" 1 
ATOM   4580 C "C4'" . DG  D 3 4   ? -5.333  -56.952 24.048  1.00 45.63  ? 4   DG  D "C4'" 1 
ATOM   4581 O "O4'" . DG  D 3 4   ? -5.333  -55.629 24.647  1.00 51.01  ? 4   DG  D "O4'" 1 
ATOM   4582 C "C3'" . DG  D 3 4   ? -5.813  -56.776 22.593  1.00 49.53  ? 4   DG  D "C3'" 1 
ATOM   4583 O "O3'" . DG  D 3 4   ? -7.167  -57.264 22.439  1.00 54.17  ? 4   DG  D "O3'" 1 
ATOM   4584 C "C2'" . DG  D 3 4   ? -5.729  -55.267 22.366  1.00 51.72  ? 4   DG  D "C2'" 1 
ATOM   4585 C "C1'" . DG  D 3 4   ? -5.960  -54.717 23.765  1.00 54.17  ? 4   DG  D "C1'" 1 
ATOM   4586 N N9    . DG  D 3 4   ? -5.360  -53.407 23.964  1.00 47.04  ? 4   DG  D N9    1 
ATOM   4587 C C8    . DG  D 3 4   ? -4.107  -53.009 23.563  1.00 39.34  ? 4   DG  D C8    1 
ATOM   4588 N N7    . DG  D 3 4   ? -3.821  -51.788 23.899  1.00 38.66  ? 4   DG  D N7    1 
ATOM   4589 C C5    . DG  D 3 4   ? -4.966  -51.337 24.545  1.00 40.58  ? 4   DG  D C5    1 
ATOM   4590 C C6    . DG  D 3 4   ? -5.242  -50.083 25.117  1.00 42.92  ? 4   DG  D C6    1 
ATOM   4591 O O6    . DG  D 3 4   ? -4.505  -49.090 25.155  1.00 48.35  ? 4   DG  D O6    1 
ATOM   4592 N N1    . DG  D 3 4   ? -6.517  -50.035 25.691  1.00 47.54  ? 4   DG  D N1    1 
ATOM   4593 C C2    . DG  D 3 4   ? -7.414  -51.078 25.701  1.00 48.41  ? 4   DG  D C2    1 
ATOM   4594 N N2    . DG  D 3 4   ? -8.602  -50.836 26.292  1.00 38.57  ? 4   DG  D N2    1 
ATOM   4595 N N3    . DG  D 3 4   ? -7.164  -52.273 25.155  1.00 48.83  ? 4   DG  D N3    1 
ATOM   4596 C C4    . DG  D 3 4   ? -5.923  -52.324 24.598  1.00 42.08  ? 4   DG  D C4    1 
ATOM   4597 P P     . DA  D 3 5   ? -7.916  -57.238 21.009  1.00 58.45  ? 5   DA  D P     1 
ATOM   4598 O OP1   . DA  D 3 5   ? -8.513  -58.574 20.828  1.00 57.95  ? 5   DA  D OP1   1 
ATOM   4599 O OP2   . DA  D 3 5   ? -6.999  -56.749 19.934  1.00 45.60  ? 5   DA  D OP2   1 
ATOM   4600 O "O5'" . DA  D 3 5   ? -9.130  -56.220 21.262  1.00 58.69  ? 5   DA  D "O5'" 1 
ATOM   4601 C "C5'" . DA  D 3 5   ? -9.766  -56.183 22.552  1.00 64.97  ? 5   DA  D "C5'" 1 
ATOM   4602 C "C4'" . DA  D 3 5   ? -11.003 -55.271 22.574  1.00 65.85  ? 5   DA  D "C4'" 1 
ATOM   4603 O "O4'" . DA  D 3 5   ? -10.673 -53.955 23.105  1.00 58.60  ? 5   DA  D "O4'" 1 
ATOM   4604 C "C3'" . DA  D 3 5   ? -11.693 -55.028 21.241  1.00 55.42  ? 5   DA  D "C3'" 1 
ATOM   4605 O "O3'" . DA  D 3 5   ? -13.099 -54.942 21.459  1.00 74.48  ? 5   DA  D "O3'" 1 
ATOM   4606 C "C2'" . DA  D 3 5   ? -11.113 -53.691 20.781  1.00 50.26  ? 5   DA  D "C2'" 1 
ATOM   4607 C "C1'" . DA  D 3 5   ? -10.773 -52.972 22.092  1.00 53.89  ? 5   DA  D "C1'" 1 
ATOM   4608 N N9    . DA  D 3 5   ? -9.496  -52.264 22.025  1.00 51.44  ? 5   DA  D N9    1 
ATOM   4609 C C8    . DA  D 3 5   ? -8.299  -52.772 21.584  1.00 50.10  ? 5   DA  D C8    1 
ATOM   4610 N N7    . DA  D 3 5   ? -7.310  -51.911 21.622  1.00 47.30  ? 5   DA  D N7    1 
ATOM   4611 C C5    . DA  D 3 5   ? -7.897  -50.757 22.128  1.00 44.36  ? 5   DA  D C5    1 
ATOM   4612 C C6    . DA  D 3 5   ? -7.384  -49.476 22.410  1.00 40.71  ? 5   DA  D C6    1 
ATOM   4613 N N6    . DA  D 3 5   ? -6.111  -49.139 22.218  1.00 42.35  ? 5   DA  D N6    1 
ATOM   4614 N N1    . DA  D 3 5   ? -8.237  -48.554 22.899  1.00 44.46  ? 5   DA  D N1    1 
ATOM   4615 C C2    . DA  D 3 5   ? -9.518  -48.896 23.090  1.00 41.85  ? 5   DA  D C2    1 
ATOM   4616 N N3    . DA  D 3 5   ? -10.115 -50.064 22.857  1.00 41.59  ? 5   DA  D N3    1 
ATOM   4617 C C4    . DA  D 3 5   ? -9.244  -50.960 22.379  1.00 40.95  ? 5   DA  D C4    1 
ATOM   4618 P P     . DT  D 3 6   ? -14.109 -54.622 20.245  1.00 75.22  ? 6   DT  D P     1 
ATOM   4619 O OP1   . DT  D 3 6   ? -15.471 -55.095 20.629  1.00 62.82  ? 6   DT  D OP1   1 
ATOM   4620 O OP2   . DT  D 3 6   ? -13.432 -55.072 19.004  1.00 51.34  ? 6   DT  D OP2   1 
ATOM   4621 O "O5'" . DT  D 3 6   ? -14.142 -53.023 20.183  1.00 61.72  ? 6   DT  D "O5'" 1 
ATOM   4622 C "C5'" . DT  D 3 6   ? -14.476 -52.264 21.336  1.00 46.04  ? 6   DT  D "C5'" 1 
ATOM   4623 C "C4'" . DT  D 3 6   ? -14.479 -50.786 21.009  1.00 48.53  ? 6   DT  D "C4'" 1 
ATOM   4624 O "O4'" . DT  D 3 6   ? -13.130 -50.271 21.076  1.00 53.30  ? 6   DT  D "O4'" 1 
ATOM   4625 C "C3'" . DT  D 3 6   ? -14.999 -50.422 19.605  1.00 58.63  ? 6   DT  D "C3'" 1 
ATOM   4626 O "O3'" . DT  D 3 6   ? -15.901 -49.336 19.711  1.00 49.08  ? 6   DT  D "O3'" 1 
ATOM   4627 C "C2'" . DT  D 3 6   ? -13.726 -50.033 18.831  1.00 43.99  ? 6   DT  D "C2'" 1 
ATOM   4628 C "C1'" . DT  D 3 6   ? -12.902 -49.444 19.960  1.00 49.39  ? 6   DT  D "C1'" 1 
ATOM   4629 N N1    . DT  D 3 6   ? -11.451 -49.389 19.695  1.00 45.92  ? 6   DT  D N1    1 
ATOM   4630 C C2    . DT  D 3 6   ? -10.771 -48.260 20.060  1.00 47.80  ? 6   DT  D C2    1 
ATOM   4631 O O2    . DT  D 3 6   ? -11.307 -47.304 20.604  1.00 57.91  ? 6   DT  D O2    1 
ATOM   4632 N N3    . DT  D 3 6   ? -9.440  -48.277 19.780  1.00 45.96  ? 6   DT  D N3    1 
ATOM   4633 C C4    . DT  D 3 6   ? -8.724  -49.290 19.192  1.00 43.77  ? 6   DT  D C4    1 
ATOM   4634 O O4    . DT  D 3 6   ? -7.518  -49.196 18.994  1.00 38.67  ? 6   DT  D O4    1 
ATOM   4635 C C5    . DT  D 3 6   ? -9.499  -50.463 18.826  1.00 43.02  ? 6   DT  D C5    1 
ATOM   4636 C C7    . DT  D 3 6   ? -8.835  -51.634 18.172  1.00 33.65  ? 6   DT  D C7    1 
ATOM   4637 C C6    . DT  D 3 6   ? -10.812 -50.456 19.099  1.00 45.13  ? 6   DT  D C6    1 
ATOM   4638 P P     . DG  D 3 7   ? -16.715 -48.830 18.434  1.00 50.55  ? 7   DG  D P     1 
ATOM   4639 O OP1   . DG  D 3 7   ? -18.061 -48.526 18.964  1.00 62.78  ? 7   DG  D OP1   1 
ATOM   4640 O OP2   . DG  D 3 7   ? -16.553 -49.745 17.276  1.00 43.55  ? 7   DG  D OP2   1 
ATOM   4641 O "O5'" . DG  D 3 7   ? -16.001 -47.459 18.073  1.00 50.38  ? 7   DG  D "O5'" 1 
ATOM   4642 C "C5'" . DG  D 3 7   ? -15.935 -46.455 19.037  1.00 47.61  ? 7   DG  D "C5'" 1 
ATOM   4643 C "C4'" . DG  D 3 7   ? -15.149 -45.272 18.514  1.00 62.92  ? 7   DG  D "C4'" 1 
ATOM   4644 O "O4'" . DG  D 3 7   ? -13.735 -45.575 18.527  1.00 55.67  ? 7   DG  D "O4'" 1 
ATOM   4645 C "C3'" . DG  D 3 7   ? -15.500 -44.843 17.085  1.00 55.02  ? 7   DG  D "C3'" 1 
ATOM   4646 O "O3'" . DG  D 3 7   ? -15.933 -43.491 17.099  1.00 63.91  ? 7   DG  D "O3'" 1 
ATOM   4647 C "C2'" . DG  D 3 7   ? -14.201 -45.027 16.290  1.00 48.69  ? 7   DG  D "C2'" 1 
ATOM   4648 C "C1'" . DG  D 3 7   ? -13.132 -45.023 17.381  1.00 59.46  ? 7   DG  D "C1'" 1 
ATOM   4649 N N9    . DG  D 3 7   ? -11.954 -45.841 17.071  1.00 56.09  ? 7   DG  D N9    1 
ATOM   4650 C C8    . DG  D 3 7   ? -11.940 -47.179 16.752  1.00 51.41  ? 7   DG  D C8    1 
ATOM   4651 N N7    . DG  D 3 7   ? -10.747 -47.653 16.547  1.00 48.76  ? 7   DG  D N7    1 
ATOM   4652 C C5    . DG  D 3 7   ? -9.911  -46.565 16.762  1.00 48.85  ? 7   DG  D C5    1 
ATOM   4653 C C6    . DG  D 3 7   ? -8.505  -46.477 16.686  1.00 47.88  ? 7   DG  D C6    1 
ATOM   4654 O O6    . DG  D 3 7   ? -7.701  -47.375 16.419  1.00 47.30  ? 7   DG  D O6    1 
ATOM   4655 N N1    . DG  D 3 7   ? -8.051  -45.193 16.961  1.00 48.90  ? 7   DG  D N1    1 
ATOM   4656 C C2    . DG  D 3 7   ? -8.856  -44.126 17.271  1.00 49.04  ? 7   DG  D C2    1 
ATOM   4657 N N2    . DG  D 3 7   ? -8.233  -42.970 17.500  1.00 48.75  ? 7   DG  D N2    1 
ATOM   4658 N N3    . DG  D 3 7   ? -10.179 -44.191 17.357  1.00 48.86  ? 7   DG  D N3    1 
ATOM   4659 C C4    . DG  D 3 7   ? -10.635 -45.442 17.088  1.00 49.39  ? 7   DG  D C4    1 
ATOM   4660 P P     . DC  D 3 8   ? -16.456 -42.774 15.761  1.00 68.80  ? 8   DC  D P     1 
ATOM   4661 O OP1   . DC  D 3 8   ? -17.364 -41.716 16.256  1.00 60.93  ? 8   DC  D OP1   1 
ATOM   4662 O OP2   . DC  D 3 8   ? -16.900 -43.779 14.763  1.00 58.81  ? 8   DC  D OP2   1 
ATOM   4663 O "O5'" . DC  D 3 8   ? -15.127 -42.090 15.175  1.00 72.91  ? 8   DC  D "O5'" 1 
ATOM   4664 C "C5'" . DC  D 3 8   ? -14.254 -41.360 16.056  1.00 58.42  ? 8   DC  D "C5'" 1 
ATOM   4665 C "C4'" . DC  D 3 8   ? -13.092 -40.778 15.283  1.00 63.23  ? 8   DC  D "C4'" 1 
ATOM   4666 O "O4'" . DC  D 3 8   ? -12.012 -41.742 15.233  1.00 60.05  ? 8   DC  D "O4'" 1 
ATOM   4667 C "C3'" . DC  D 3 8   ? -13.413 -40.415 13.830  1.00 67.27  ? 8   DC  D "C3'" 1 
ATOM   4668 O "O3'" . DC  D 3 8   ? -13.047 -39.064 13.580  1.00 69.05  ? 8   DC  D "O3'" 1 
ATOM   4669 C "C2'" . DC  D 3 8   ? -12.585 -41.410 12.992  1.00 54.16  ? 8   DC  D "C2'" 1 
ATOM   4670 C "C1'" . DC  D 3 8   ? -11.447 -41.759 13.941  1.00 50.52  ? 8   DC  D "C1'" 1 
ATOM   4671 N N1    . DC  D 3 8   ? -10.836 -43.129 13.720  1.00 46.03  ? 8   DC  D N1    1 
ATOM   4672 C C2    . DC  D 3 8   ? -9.434  -43.281 13.707  1.00 42.25  ? 8   DC  D C2    1 
ATOM   4673 O O2    . DC  D 3 8   ? -8.713  -42.287 13.846  1.00 43.17  ? 8   DC  D O2    1 
ATOM   4674 N N3    . DC  D 3 8   ? -8.910  -44.518 13.531  1.00 41.45  ? 8   DC  D N3    1 
ATOM   4675 C C4    . DC  D 3 8   ? -9.714  -45.573 13.372  1.00 43.29  ? 8   DC  D C4    1 
ATOM   4676 N N4    . DC  D 3 8   ? -9.145  -46.775 13.202  1.00 37.19  ? 8   DC  D N4    1 
ATOM   4677 C C5    . DC  D 3 8   ? -11.139 -45.442 13.382  1.00 42.75  ? 8   DC  D C5    1 
ATOM   4678 C C6    . DC  D 3 8   ? -11.648 -44.216 13.564  1.00 45.89  ? 8   DC  D C6    1 
ATOM   4679 P P     . DG  D 3 9   ? -13.485 -38.356 12.208  1.00 68.81  ? 9   DG  D P     1 
ATOM   4680 O OP1   . DG  D 3 9   ? -13.912 -36.998 12.625  1.00 56.65  ? 9   DG  D OP1   1 
ATOM   4681 O OP2   . DG  D 3 9   ? -14.327 -39.265 11.383  1.00 47.92  ? 9   DG  D OP2   1 
ATOM   4682 O "O5'" . DG  D 3 9   ? -12.114 -38.223 11.406  1.00 57.68  ? 9   DG  D "O5'" 1 
ATOM   4683 C "C5'" . DG  D 3 9   ? -10.975 -37.646 12.046  1.00 53.00  ? 9   DG  D "C5'" 1 
ATOM   4684 C "C4'" . DG  D 3 9   ? -9.762  -37.826 11.169  1.00 42.49  ? 9   DG  D "C4'" 1 
ATOM   4685 O "O4'" . DG  D 3 9   ? -9.302  -39.191 11.290  1.00 36.11  ? 9   DG  D "O4'" 1 
ATOM   4686 C "C3'" . DG  D 3 9   ? -10.035 -37.602 9.679   1.00 41.10  ? 9   DG  D "C3'" 1 
ATOM   4687 O "O3'" . DG  D 3 9   ? -8.975  -36.883 9.110   1.00 34.97  ? 9   DG  D "O3'" 1 
ATOM   4688 C "C2'" . DG  D 3 9   ? -10.129 -39.019 9.118   1.00 36.82  ? 9   DG  D "C2'" 1 
ATOM   4689 C "C1'" . DG  D 3 9   ? -9.148  -39.752 10.012  1.00 35.07  ? 9   DG  D "C1'" 1 
ATOM   4690 N N9    . DG  D 3 9   ? -9.380  -41.191 10.110  1.00 35.15  ? 9   DG  D N9    1 
ATOM   4691 C C8    . DG  D 3 9   ? -10.586 -41.835 10.265  1.00 35.85  ? 9   DG  D C8    1 
ATOM   4692 N N7    . DG  D 3 9   ? -10.478 -43.138 10.322  1.00 33.26  ? 9   DG  D N7    1 
ATOM   4693 C C5    . DG  D 3 9   ? -9.119  -43.372 10.203  1.00 37.04  ? 9   DG  D C5    1 
ATOM   4694 C C6    . DG  D 3 9   ? -8.395  -44.592 10.198  1.00 38.78  ? 9   DG  D C6    1 
ATOM   4695 O O6    . DG  D 3 9   ? -8.830  -45.747 10.299  1.00 36.44  ? 9   DG  D O6    1 
ATOM   4696 N N1    . DG  D 3 9   ? -7.025  -44.376 10.056  1.00 34.60  ? 9   DG  D N1    1 
ATOM   4697 C C2    . DG  D 3 9   ? -6.436  -43.149 9.922   1.00 31.07  ? 9   DG  D C2    1 
ATOM   4698 N N2    . DG  D 3 9   ? -5.118  -43.157 9.811   1.00 38.76  ? 9   DG  D N2    1 
ATOM   4699 N N3    . DG  D 3 9   ? -7.090  -41.994 9.915   1.00 29.28  ? 9   DG  D N3    1 
ATOM   4700 C C4    . DG  D 3 9   ? -8.426  -42.180 10.066  1.00 36.38  ? 9   DG  D C4    1 
ATOM   4701 P P     . DC  D 3 10  ? -9.215  -36.017 7.785   1.00 45.24  ? 10  DC  D P     1 
ATOM   4702 O OP1   . DC  D 3 10  ? -8.941  -34.586 8.087   1.00 52.56  ? 10  DC  D OP1   1 
ATOM   4703 O OP2   . DC  D 3 10  ? -10.490 -36.478 7.138   1.00 31.95  ? 10  DC  D OP2   1 
ATOM   4704 O "O5'" . DC  D 3 10  ? -8.087  -36.529 6.822   1.00 47.30  ? 10  DC  D "O5'" 1 
ATOM   4705 C "C5'" . DC  D 3 10  ? -8.153  -37.822 6.388   1.00 39.05  ? 10  DC  D "C5'" 1 
ATOM   4706 C "C4'" . DC  D 3 10  ? -6.784  -38.381 6.297   1.00 35.69  ? 10  DC  D "C4'" 1 
ATOM   4707 O "O4'" . DC  D 3 10  ? -6.766  -39.667 6.947   1.00 35.31  ? 10  DC  D "O4'" 1 
ATOM   4708 C "C3'" . DC  D 3 10  ? -6.334  -38.618 4.865   1.00 41.11  ? 10  DC  D "C3'" 1 
ATOM   4709 O "O3'" . DC  D 3 10  ? -4.909  -38.478 4.773   1.00 30.89  ? 10  DC  D "O3'" 1 
ATOM   4710 C "C2'" . DC  D 3 10  ? -6.824  -40.045 4.606   1.00 32.26  ? 10  DC  D "C2'" 1 
ATOM   4711 C "C1'" . DC  D 3 10  ? -6.606  -40.689 5.976   1.00 34.12  ? 10  DC  D "C1'" 1 
ATOM   4712 N N1    . DC  D 3 10  ? -7.552  -41.809 6.284   1.00 39.92  ? 10  DC  D N1    1 
ATOM   4713 C C2    . DC  D 3 10  ? -7.047  -43.108 6.416   1.00 37.57  ? 10  DC  D C2    1 
ATOM   4714 O O2    . DC  D 3 10  ? -5.823  -43.295 6.277   1.00 31.03  ? 10  DC  D O2    1 
ATOM   4715 N N3    . DC  D 3 10  ? -7.916  -44.125 6.690   1.00 39.16  ? 10  DC  D N3    1 
ATOM   4716 C C4    . DC  D 3 10  ? -9.229  -43.867 6.839   1.00 37.80  ? 10  DC  D C4    1 
ATOM   4717 N N4    . DC  D 3 10  ? -10.047 -44.897 7.109   1.00 30.73  ? 10  DC  D N4    1 
ATOM   4718 C C5    . DC  D 3 10  ? -9.756  -42.545 6.709   1.00 31.27  ? 10  DC  D C5    1 
ATOM   4719 C C6    . DC  D 3 10  ? -8.897  -41.559 6.437   1.00 35.17  ? 10  DC  D C6    1 
ATOM   4720 O "O5'" . DG  E 4 1   ? -18.360 -63.716 -28.266 1.00 59.61  ? 1   DG  E "O5'" 1 
ATOM   4721 C "C5'" . DG  E 4 1   ? -17.635 -62.768 -29.016 1.00 54.37  ? 1   DG  E "C5'" 1 
ATOM   4722 C "C4'" . DG  E 4 1   ? -17.055 -61.682 -28.120 1.00 60.19  ? 1   DG  E "C4'" 1 
ATOM   4723 O "O4'" . DG  E 4 1   ? -17.871 -60.488 -28.218 1.00 68.90  ? 1   DG  E "O4'" 1 
ATOM   4724 C "C3'" . DG  E 4 1   ? -16.974 -62.012 -26.621 1.00 62.59  ? 1   DG  E "C3'" 1 
ATOM   4725 O "O3'" . DG  E 4 1   ? -15.847 -61.349 -26.029 1.00 60.04  ? 1   DG  E "O3'" 1 
ATOM   4726 C "C2'" . DG  E 4 1   ? -18.275 -61.418 -26.099 1.00 59.24  ? 1   DG  E "C2'" 1 
ATOM   4727 C "C1'" . DG  E 4 1   ? -18.366 -60.152 -26.942 1.00 64.20  ? 1   DG  E "C1'" 1 
ATOM   4728 N N9    . DG  E 4 1   ? -19.717 -59.643 -27.103 1.00 65.30  ? 1   DG  E N9    1 
ATOM   4729 C C8    . DG  E 4 1   ? -20.881 -60.200 -26.626 1.00 63.02  ? 1   DG  E C8    1 
ATOM   4730 N N7    . DG  E 4 1   ? -21.945 -59.509 -26.921 1.00 59.33  ? 1   DG  E N7    1 
ATOM   4731 C C5    . DG  E 4 1   ? -21.459 -58.428 -27.648 1.00 60.48  ? 1   DG  E C5    1 
ATOM   4732 C C6    . DG  E 4 1   ? -22.148 -57.341 -28.235 1.00 60.69  ? 1   DG  E C6    1 
ATOM   4733 O O6    . DG  E 4 1   ? -23.366 -57.113 -28.229 1.00 61.16  ? 1   DG  E O6    1 
ATOM   4734 N N1    . DG  E 4 1   ? -21.274 -56.463 -28.884 1.00 64.82  ? 1   DG  E N1    1 
ATOM   4735 C C2    . DG  E 4 1   ? -19.899 -56.621 -28.952 1.00 69.99  ? 1   DG  E C2    1 
ATOM   4736 N N2    . DG  E 4 1   ? -19.219 -55.671 -29.621 1.00 68.73  ? 1   DG  E N2    1 
ATOM   4737 N N3    . DG  E 4 1   ? -19.239 -57.639 -28.404 1.00 64.87  ? 1   DG  E N3    1 
ATOM   4738 C C4    . DG  E 4 1   ? -20.085 -58.499 -27.770 1.00 65.90  ? 1   DG  E C4    1 
ATOM   4739 P P     . DG  E 4 2   ? -14.365 -61.977 -26.105 1.00 48.57  ? 2   DG  E P     1 
ATOM   4740 O OP1   . DG  E 4 2   ? -14.252 -62.782 -27.336 1.00 66.27  ? 2   DG  E OP1   1 
ATOM   4741 O OP2   . DG  E 4 2   ? -14.073 -62.628 -24.807 1.00 54.14  ? 2   DG  E OP2   1 
ATOM   4742 O "O5'" . DG  E 4 2   ? -13.470 -60.691 -26.356 1.00 53.35  ? 2   DG  E "O5'" 1 
ATOM   4743 C "C5'" . DG  E 4 2   ? -14.070 -59.607 -27.023 1.00 64.19  ? 2   DG  E "C5'" 1 
ATOM   4744 C "C4'" . DG  E 4 2   ? -13.106 -58.466 -27.263 1.00 73.52  ? 2   DG  E "C4'" 1 
ATOM   4745 O "O4'" . DG  E 4 2   ? -13.879 -57.265 -27.427 1.00 78.97  ? 2   DG  E "O4'" 1 
ATOM   4746 C "C3'" . DG  E 4 2   ? -12.203 -58.120 -26.105 1.00 72.24  ? 2   DG  E "C3'" 1 
ATOM   4747 O "O3'" . DG  E 4 2   ? -11.216 -57.202 -26.572 1.00 81.84  ? 2   DG  E "O3'" 1 
ATOM   4748 C "C2'" . DG  E 4 2   ? -13.195 -57.450 -25.162 1.00 70.01  ? 2   DG  E "C2'" 1 
ATOM   4749 C "C1'" . DG  E 4 2   ? -14.105 -56.704 -26.147 1.00 74.20  ? 2   DG  E "C1'" 1 
ATOM   4750 N N9    . DG  E 4 2   ? -15.520 -56.821 -25.827 1.00 65.31  ? 2   DG  E N9    1 
ATOM   4751 C C8    . DG  E 4 2   ? -16.134 -57.849 -25.150 1.00 64.47  ? 2   DG  E C8    1 
ATOM   4752 N N7    . DG  E 4 2   ? -17.418 -57.670 -24.990 1.00 66.22  ? 2   DG  E N7    1 
ATOM   4753 C C5    . DG  E 4 2   ? -17.667 -56.443 -25.601 1.00 65.15  ? 2   DG  E C5    1 
ATOM   4754 C C6    . DG  E 4 2   ? -18.878 -55.728 -25.749 1.00 66.84  ? 2   DG  E C6    1 
ATOM   4755 O O6    . DG  E 4 2   ? -20.011 -56.045 -25.362 1.00 67.81  ? 2   DG  E O6    1 
ATOM   4756 N N1    . DG  E 4 2   ? -18.689 -54.528 -26.429 1.00 70.99  ? 2   DG  E N1    1 
ATOM   4757 C C2    . DG  E 4 2   ? -17.484 -54.073 -26.910 1.00 75.31  ? 2   DG  E C2    1 
ATOM   4758 N N2    . DG  E 4 2   ? -17.508 -52.886 -27.545 1.00 73.22  ? 2   DG  E N2    1 
ATOM   4759 N N3    . DG  E 4 2   ? -16.337 -54.735 -26.781 1.00 71.71  ? 2   DG  E N3    1 
ATOM   4760 C C4    . DG  E 4 2   ? -16.506 -55.909 -26.117 1.00 66.59  ? 2   DG  E C4    1 
ATOM   4761 P P     . DA  E 4 3   ? -10.377 -56.268 -25.570 1.00 85.54  ? 3   DA  E P     1 
ATOM   4762 O OP1   . DA  E 4 3   ? -9.189  -55.820 -26.346 1.00 82.03  ? 3   DA  E OP1   1 
ATOM   4763 O OP2   . DA  E 4 3   ? -10.215 -56.985 -24.276 1.00 70.10  ? 3   DA  E OP2   1 
ATOM   4764 O "O5'" . DA  E 4 3   ? -11.299 -54.972 -25.374 1.00 76.53  ? 3   DA  E "O5'" 1 
ATOM   4765 C "C5'" . DA  E 4 3   ? -11.362 -53.960 -26.400 1.00 76.87  ? 3   DA  E "C5'" 1 
ATOM   4766 C "C4'" . DA  E 4 3   ? -12.135 -52.739 -25.908 1.00 86.02  ? 3   DA  E "C4'" 1 
ATOM   4767 O "O4'" . DA  E 4 3   ? -13.507 -53.125 -25.608 1.00 87.54  ? 3   DA  E "O4'" 1 
ATOM   4768 C "C3'" . DA  E 4 3   ? -11.599 -52.106 -24.607 1.00 95.86  ? 3   DA  E "C3'" 1 
ATOM   4769 O "O3'" . DA  E 4 3   ? -11.763 -50.670 -24.628 1.00 100.24 ? 3   DA  E "O3'" 1 
ATOM   4770 C "C2'" . DA  E 4 3   ? -12.495 -52.738 -23.555 1.00 85.10  ? 3   DA  E "C2'" 1 
ATOM   4771 C "C1'" . DA  E 4 3   ? -13.812 -52.707 -24.294 1.00 79.08  ? 3   DA  E "C1'" 1 
ATOM   4772 N N9    . DA  E 4 3   ? -14.806 -53.584 -23.709 1.00 70.53  ? 3   DA  E N9    1 
ATOM   4773 C C8    . DA  E 4 3   ? -14.571 -54.742 -23.023 1.00 72.92  ? 3   DA  E C8    1 
ATOM   4774 N N7    . DA  E 4 3   ? -15.661 -55.316 -22.565 1.00 73.00  ? 3   DA  E N7    1 
ATOM   4775 C C5    . DA  E 4 3   ? -16.681 -54.463 -22.969 1.00 77.04  ? 3   DA  E C5    1 
ATOM   4776 C C6    . DA  E 4 3   ? -18.082 -54.509 -22.797 1.00 76.19  ? 3   DA  E C6    1 
ATOM   4777 N N6    . DA  E 4 3   ? -18.706 -55.500 -22.144 1.00 70.66  ? 3   DA  E N6    1 
ATOM   4778 N N1    . DA  E 4 3   ? -18.815 -53.494 -23.334 1.00 75.81  ? 3   DA  E N1    1 
ATOM   4779 C C2    . DA  E 4 3   ? -18.180 -52.506 -23.985 1.00 73.62  ? 3   DA  E C2    1 
ATOM   4780 N N3    . DA  E 4 3   ? -16.871 -52.359 -24.211 1.00 73.88  ? 3   DA  E N3    1 
ATOM   4781 C C4    . DA  E 4 3   ? -16.170 -53.383 -23.671 1.00 74.48  ? 3   DA  E C4    1 
ATOM   4782 P P     . DT  E 4 4   ? -11.049 -49.747 -23.514 1.00 88.61  ? 4   DT  E P     1 
ATOM   4783 O OP1   . DT  E 4 4   ? -11.333 -48.344 -23.905 1.00 76.09  ? 4   DT  E OP1   1 
ATOM   4784 O OP2   . DT  E 4 4   ? -9.638  -50.221 -23.399 1.00 73.45  ? 4   DT  E OP2   1 
ATOM   4785 O "O5'" . DT  E 4 4   ? -11.818 -50.120 -22.142 1.00 90.16  ? 4   DT  E "O5'" 1 
ATOM   4786 C "C5'" . DT  E 4 4   ? -12.420 -49.096 -21.320 1.00 97.63  ? 4   DT  E "C5'" 1 
ATOM   4787 C "C4'" . DT  E 4 4   ? -13.694 -48.564 -21.959 1.00 89.15  ? 4   DT  E "C4'" 1 
ATOM   4788 O "O4'" . DT  E 4 4   ? -14.455 -49.671 -22.455 1.00 82.95  ? 4   DT  E "O4'" 1 
ATOM   4789 C "C3'" . DT  E 4 4   ? -14.605 -47.761 -21.032 1.00 93.35  ? 4   DT  E "C3'" 1 
ATOM   4790 O "O3'" . DT  E 4 4   ? -14.542 -46.389 -21.387 1.00 99.42  ? 4   DT  E "O3'" 1 
ATOM   4791 C "C2'" . DT  E 4 4   ? -16.011 -48.305 -21.282 1.00 88.04  ? 4   DT  E "C2'" 1 
ATOM   4792 C "C1'" . DT  E 4 4   ? -15.788 -49.614 -22.020 1.00 78.85  ? 4   DT  E "C1'" 1 
ATOM   4793 N N1    . DT  E 4 4   ? -16.070 -50.833 -21.220 1.00 76.14  ? 4   DT  E N1    1 
ATOM   4794 C C2    . DT  E 4 4   ? -17.376 -51.159 -20.935 1.00 77.95  ? 4   DT  E C2    1 
ATOM   4795 O O2    . DT  E 4 4   ? -18.322 -50.473 -21.277 1.00 81.68  ? 4   DT  E O2    1 
ATOM   4796 N N3    . DT  E 4 4   ? -17.538 -52.316 -20.219 1.00 76.71  ? 4   DT  E N3    1 
ATOM   4797 C C4    . DT  E 4 4   ? -16.545 -53.170 -19.773 1.00 83.52  ? 4   DT  E C4    1 
ATOM   4798 O O4    . DT  E 4 4   ? -16.797 -54.191 -19.131 1.00 82.04  ? 4   DT  E O4    1 
ATOM   4799 C C5    . DT  E 4 4   ? -15.187 -52.774 -20.114 1.00 81.31  ? 4   DT  E C5    1 
ATOM   4800 C C7    . DT  E 4 4   ? -14.019 -53.617 -19.686 1.00 75.74  ? 4   DT  E C7    1 
ATOM   4801 C C6    . DT  E 4 4   ? -15.021 -51.639 -20.819 1.00 81.24  ? 4   DT  E C6    1 
ATOM   4802 P P     . DC  E 4 5   ? -14.017 -45.294 -20.340 1.00 103.90 ? 5   DC  E P     1 
ATOM   4803 O OP1   . DC  E 4 5   ? -13.621 -44.125 -21.155 1.00 98.78  ? 5   DC  E OP1   1 
ATOM   4804 O OP2   . DC  E 4 5   ? -13.066 -45.953 -19.411 1.00 90.80  ? 5   DC  E OP2   1 
ATOM   4805 O "O5'" . DC  E 4 5   ? -15.316 -44.907 -19.496 1.00 100.83 ? 5   DC  E "O5'" 1 
ATOM   4806 C "C5'" . DC  E 4 5   ? -16.452 -44.330 -20.140 1.00 97.71  ? 5   DC  E "C5'" 1 
ATOM   4807 C "C4'" . DC  E 4 5   ? -17.630 -44.303 -19.184 1.00 98.27  ? 5   DC  E "C4'" 1 
ATOM   4808 O "O4'" . DC  E 4 5   ? -18.156 -45.655 -19.051 1.00 98.99  ? 5   DC  E "O4'" 1 
ATOM   4809 C "C3'" . DC  E 4 5   ? -17.281 -43.838 -17.761 1.00 100.05 ? 5   DC  E "C3'" 1 
ATOM   4810 O "O3'" . DC  E 4 5   ? -18.329 -43.005 -17.200 1.00 99.31  ? 5   DC  E "O3'" 1 
ATOM   4811 C "C2'" . DC  E 4 5   ? -17.126 -45.153 -17.006 1.00 97.65  ? 5   DC  E "C2'" 1 
ATOM   4812 C "C1'" . DC  E 4 5   ? -18.162 -46.026 -17.690 1.00 96.80  ? 5   DC  E "C1'" 1 
ATOM   4813 N N1    . DC  E 4 5   ? -17.856 -47.477 -17.563 1.00 95.60  ? 5   DC  E N1    1 
ATOM   4814 C C2    . DC  E 4 5   ? -18.809 -48.323 -17.002 1.00 94.57  ? 5   DC  E C2    1 
ATOM   4815 O O2    . DC  E 4 5   ? -19.903 -47.849 -16.658 1.00 86.95  ? 5   DC  E O2    1 
ATOM   4816 N N3    . DC  E 4 5   ? -18.512 -49.644 -16.865 1.00 92.28  ? 5   DC  E N3    1 
ATOM   4817 C C4    . DC  E 4 5   ? -17.317 -50.105 -17.243 1.00 84.62  ? 5   DC  E C4    1 
ATOM   4818 N N4    . DC  E 4 5   ? -17.072 -51.407 -17.079 1.00 81.07  ? 5   DC  E N4    1 
ATOM   4819 C C5    . DC  E 4 5   ? -16.324 -49.251 -17.803 1.00 79.92  ? 5   DC  E C5    1 
ATOM   4820 C C6    . DC  E 4 5   ? -16.630 -47.955 -17.935 1.00 89.86  ? 5   DC  E C6    1 
ATOM   4821 P P     . DC  E 4 6   ? -18.391 -42.692 -15.612 1.00 107.54 ? 6   DC  E P     1 
ATOM   4822 O OP1   . DC  E 4 6   ? -18.954 -41.335 -15.442 1.00 106.58 ? 6   DC  E OP1   1 
ATOM   4823 O OP2   . DC  E 4 6   ? -17.103 -42.997 -14.947 1.00 92.48  ? 6   DC  E OP2   1 
ATOM   4824 O "O5'" . DC  E 4 6   ? -19.461 -43.749 -15.082 1.00 99.05  ? 6   DC  E "O5'" 1 
ATOM   4825 C "C5'" . DC  E 4 6   ? -19.893 -43.752 -13.731 1.00 92.02  ? 6   DC  E "C5'" 1 
ATOM   4826 C "C4'" . DC  E 4 6   ? -20.833 -44.921 -13.524 1.00 90.81  ? 6   DC  E "C4'" 1 
ATOM   4827 O "O4'" . DC  E 4 6   ? -20.293 -46.061 -14.214 1.00 97.75  ? 6   DC  E "O4'" 1 
ATOM   4828 C "C3'" . DC  E 4 6   ? -21.003 -45.376 -12.091 1.00 90.43  ? 6   DC  E "C3'" 1 
ATOM   4829 O "O3'" . DC  E 4 6   ? -22.085 -44.687 -11.494 1.00 92.79  ? 6   DC  E "O3'" 1 
ATOM   4830 C "C2'" . DC  E 4 6   ? -21.331 -46.864 -12.239 1.00 94.50  ? 6   DC  E "C2'" 1 
ATOM   4831 C "C1'" . DC  E 4 6   ? -20.707 -47.243 -13.578 1.00 93.02  ? 6   DC  E "C1'" 1 
ATOM   4832 N N1    . DC  E 4 6   ? -19.541 -48.144 -13.470 1.00 93.26  ? 6   DC  E N1    1 
ATOM   4833 C C2    . DC  E 4 6   ? -19.755 -49.517 -13.481 1.00 93.11  ? 6   DC  E C2    1 
ATOM   4834 O O2    . DC  E 4 6   ? -20.920 -49.934 -13.558 1.00 89.50  ? 6   DC  E O2    1 
ATOM   4835 N N3    . DC  E 4 6   ? -18.681 -50.352 -13.404 1.00 95.99  ? 6   DC  E N3    1 
ATOM   4836 C C4    . DC  E 4 6   ? -17.443 -49.844 -13.323 1.00 93.89  ? 6   DC  E C4    1 
ATOM   4837 N N4    . DC  E 4 6   ? -16.421 -50.697 -13.257 1.00 93.11  ? 6   DC  E N4    1 
ATOM   4838 C C5    . DC  E 4 6   ? -17.205 -48.436 -13.313 1.00 91.94  ? 6   DC  E C5    1 
ATOM   4839 C C6    . DC  E 4 6   ? -18.272 -47.629 -13.391 1.00 94.62  ? 6   DC  E C6    1 
ATOM   4840 P P     . DG  E 4 7   ? -21.813 -43.443 -10.519 1.00 100.62 ? 7   DG  E P     1 
ATOM   4841 O OP1   . DG  E 4 7   ? -22.708 -42.365 -11.000 1.00 92.26  ? 7   DG  E OP1   1 
ATOM   4842 O OP2   . DG  E 4 7   ? -20.345 -43.223 -10.494 1.00 95.79  ? 7   DG  E OP2   1 
ATOM   4843 O "O5'" . DG  E 4 7   ? -22.251 -43.969 -9.055  1.00 96.35  ? 7   DG  E "O5'" 1 
ATOM   4844 C "C5'" . DG  E 4 7   ? -23.607 -44.375 -8.775  1.00 80.64  ? 7   DG  E "C5'" 1 
ATOM   4845 C "C4'" . DG  E 4 7   ? -23.683 -45.871 -8.485  1.00 79.98  ? 7   DG  E "C4'" 1 
ATOM   4846 O "O4'" . DG  E 4 7   ? -22.963 -46.596 -9.511  1.00 89.05  ? 7   DG  E "O4'" 1 
ATOM   4847 C "C3'" . DG  E 4 7   ? -23.019 -46.344 -7.204  1.00 80.38  ? 7   DG  E "C3'" 1 
ATOM   4848 O "O3'" . DG  E 4 7   ? -23.869 -46.189 -6.112  1.00 76.33  ? 7   DG  E "O3'" 1 
ATOM   4849 C "C2'" . DG  E 4 7   ? -22.806 -47.819 -7.506  1.00 78.93  ? 7   DG  E "C2'" 1 
ATOM   4850 C "C1'" . DG  E 4 7   ? -22.383 -47.772 -8.949  1.00 83.10  ? 7   DG  E "C1'" 1 
ATOM   4851 N N9    . DG  E 4 7   ? -20.933 -47.730 -9.114  1.00 90.26  ? 7   DG  E N9    1 
ATOM   4852 C C8    . DG  E 4 7   ? -20.125 -46.615 -9.183  1.00 91.48  ? 7   DG  E C8    1 
ATOM   4853 N N7    . DG  E 4 7   ? -18.862 -46.898 -9.349  1.00 90.94  ? 7   DG  E N7    1 
ATOM   4854 C C5    . DG  E 4 7   ? -18.829 -48.287 -9.374  1.00 92.89  ? 7   DG  E C5    1 
ATOM   4855 C C6    . DG  E 4 7   ? -17.734 -49.169 -9.517  1.00 93.65  ? 7   DG  E C6    1 
ATOM   4856 O O6    . DG  E 4 7   ? -16.538 -48.889 -9.655  1.00 92.46  ? 7   DG  E O6    1 
ATOM   4857 N N1    . DG  E 4 7   ? -18.140 -50.503 -9.492  1.00 97.81  ? 7   DG  E N1    1 
ATOM   4858 C C2    . DG  E 4 7   ? -19.445 -50.929 -9.343  1.00 94.19  ? 7   DG  E C2    1 
ATOM   4859 N N2    . DG  E 4 7   ? -19.645 -52.258 -9.338  1.00 83.21  ? 7   DG  E N2    1 
ATOM   4860 N N3    . DG  E 4 7   ? -20.480 -50.109 -9.205  1.00 93.60  ? 7   DG  E N3    1 
ATOM   4861 C C4    . DG  E 4 7   ? -20.098 -48.810 -9.229  1.00 92.23  ? 7   DG  E C4    1 
ATOM   4862 P P     . DT  E 4 8   ? -23.306 -46.523 -4.647  1.00 76.94  ? 8   DT  E P     1 
ATOM   4863 O OP1   . DT  E 4 8   ? -24.411 -46.300 -3.694  1.00 81.00  ? 8   DT  E OP1   1 
ATOM   4864 O OP2   . DT  E 4 8   ? -22.028 -45.789 -4.518  1.00 86.87  ? 8   DT  E OP2   1 
ATOM   4865 O "O5'" . DT  E 4 8   ? -22.934 -48.081 -4.693  1.00 74.39  ? 8   DT  E "O5'" 1 
ATOM   4866 C "C5'" . DT  E 4 8   ? -23.563 -49.003 -3.820  1.00 79.48  ? 8   DT  E "C5'" 1 
ATOM   4867 C "C4'" . DT  E 4 8   ? -22.852 -50.344 -3.872  1.00 80.37  ? 8   DT  E "C4'" 1 
ATOM   4868 O "O4'" . DT  E 4 8   ? -21.958 -50.365 -5.013  1.00 79.89  ? 8   DT  E "O4'" 1 
ATOM   4869 C "C3'" . DT  E 4 8   ? -22.008 -50.667 -2.638  1.00 87.41  ? 8   DT  E "C3'" 1 
ATOM   4870 O "O3'" . DT  E 4 8   ? -22.775 -51.514 -1.740  1.00 91.09  ? 8   DT  E "O3'" 1 
ATOM   4871 C "C2'" . DT  E 4 8   ? -20.785 -51.401 -3.209  1.00 82.78  ? 8   DT  E "C2'" 1 
ATOM   4872 C "C1'" . DT  E 4 8   ? -20.694 -50.911 -4.662  1.00 88.87  ? 8   DT  E "C1'" 1 
ATOM   4873 N N1    . DT  E 4 8   ? -19.630 -49.853 -4.902  1.00 94.36  ? 8   DT  E N1    1 
ATOM   4874 C C2    . DT  E 4 8   ? -18.588 -50.088 -5.809  1.00 88.26  ? 8   DT  E C2    1 
ATOM   4875 O O2    . DT  E 4 8   ? -18.447 -51.135 -6.433  1.00 73.21  ? 8   DT  E O2    1 
ATOM   4876 N N3    . DT  E 4 8   ? -17.699 -49.035 -5.936  1.00 89.80  ? 8   DT  E N3    1 
ATOM   4877 C C4    . DT  E 4 8   ? -17.746 -47.803 -5.267  1.00 87.12  ? 8   DT  E C4    1 
ATOM   4878 O O4    . DT  E 4 8   ? -16.905 -46.922 -5.441  1.00 75.07  ? 8   DT  E O4    1 
ATOM   4879 C C5    . DT  E 4 8   ? -18.858 -47.634 -4.346  1.00 88.70  ? 8   DT  E C5    1 
ATOM   4880 C C7    . DT  E 4 8   ? -19.019 -46.356 -3.570  1.00 71.33  ? 8   DT  E C7    1 
ATOM   4881 C C6    . DT  E 4 8   ? -19.729 -48.649 -4.214  1.00 90.59  ? 8   DT  E C6    1 
ATOM   4882 P P     . DC  E 4 9   ? -22.588 -51.456 -0.135  1.00 82.05  ? 9   DC  E P     1 
ATOM   4883 O OP1   . DC  E 4 9   ? -23.775 -52.142 0.418   1.00 77.45  ? 9   DC  E OP1   1 
ATOM   4884 O OP2   . DC  E 4 9   ? -22.226 -50.094 0.348   1.00 73.47  ? 9   DC  E OP2   1 
ATOM   4885 O "O5'" . DC  E 4 9   ? -21.351 -52.421 0.119   1.00 77.85  ? 9   DC  E "O5'" 1 
ATOM   4886 C "C5'" . DC  E 4 9   ? -21.446 -53.772 -0.262  1.00 71.17  ? 9   DC  E "C5'" 1 
ATOM   4887 C "C4'" . DC  E 4 9   ? -20.074 -54.368 -0.492  1.00 70.67  ? 9   DC  E "C4'" 1 
ATOM   4888 O "O4'" . DC  E 4 9   ? -19.338 -53.569 -1.443  1.00 72.88  ? 9   DC  E "O4'" 1 
ATOM   4889 C "C3'" . DC  E 4 9   ? -19.176 -54.459 0.747   1.00 72.00  ? 9   DC  E "C3'" 1 
ATOM   4890 O "O3'" . DC  E 4 9   ? -18.601 -55.747 0.798   1.00 73.94  ? 9   DC  E "O3'" 1 
ATOM   4891 C "C2'" . DC  E 4 9   ? -18.108 -53.386 0.497   1.00 68.00  ? 9   DC  E "C2'" 1 
ATOM   4892 C "C1'" . DC  E 4 9   ? -18.003 -53.487 -1.005  1.00 73.87  ? 9   DC  E "C1'" 1 
ATOM   4893 N N1    . DC  E 4 9   ? -17.371 -52.340 -1.665  1.00 70.05  ? 9   DC  E N1    1 
ATOM   4894 C C2    . DC  E 4 9   ? -16.338 -52.568 -2.583  1.00 68.77  ? 9   DC  E C2    1 
ATOM   4895 O O2    . DC  E 4 9   ? -15.957 -53.731 -2.789  1.00 67.11  ? 9   DC  E O2    1 
ATOM   4896 N N3    . DC  E 4 9   ? -15.777 -51.512 -3.217  1.00 63.79  ? 9   DC  E N3    1 
ATOM   4897 C C4    . DC  E 4 9   ? -16.215 -50.279 -2.965  1.00 70.55  ? 9   DC  E C4    1 
ATOM   4898 N N4    . DC  E 4 9   ? -15.626 -49.267 -3.609  1.00 67.85  ? 9   DC  E N4    1 
ATOM   4899 C C5    . DC  E 4 9   ? -17.278 -50.028 -2.040  1.00 73.56  ? 9   DC  E C5    1 
ATOM   4900 C C6    . DC  E 4 9   ? -17.823 -51.080 -1.421  1.00 70.18  ? 9   DC  E C6    1 
ATOM   4901 P P     . DG  E 4 10  ? -17.816 -56.214 2.114   1.00 79.37  ? 10  DG  E P     1 
ATOM   4902 O OP1   . DG  E 4 10  ? -18.066 -57.660 2.268   1.00 85.09  ? 10  DG  E OP1   1 
ATOM   4903 O OP2   . DG  E 4 10  ? -18.105 -55.257 3.216   1.00 66.81  ? 10  DG  E OP2   1 
ATOM   4904 O "O5'" . DG  E 4 10  ? -16.289 -56.001 1.731   1.00 83.28  ? 10  DG  E "O5'" 1 
ATOM   4905 C "C5'" . DG  E 4 10  ? -15.605 -56.930 0.904   1.00 76.46  ? 10  DG  E "C5'" 1 
ATOM   4906 C "C4'" . DG  E 4 10  ? -14.095 -56.734 1.027   1.00 81.25  ? 10  DG  E "C4'" 1 
ATOM   4907 O "O4'" . DG  E 4 10  ? -13.713 -55.418 0.524   1.00 79.98  ? 10  DG  E "O4'" 1 
ATOM   4908 C "C3'" . DG  E 4 10  ? -13.543 -56.783 2.453   1.00 87.09  ? 10  DG  E "C3'" 1 
ATOM   4909 O "O3'" . DG  E 4 10  ? -12.195 -57.222 2.406   1.00 83.16  ? 10  DG  E "O3'" 1 
ATOM   4910 C "C2'" . DG  E 4 10  ? -13.645 -55.322 2.901   1.00 81.84  ? 10  DG  E "C2'" 1 
ATOM   4911 C "C1'" . DG  E 4 10  ? -13.297 -54.585 1.612   1.00 81.00  ? 10  DG  E "C1'" 1 
ATOM   4912 N N9    . DG  E 4 10  ? -13.937 -53.271 1.483   1.00 75.11  ? 10  DG  E N9    1 
ATOM   4913 C C8    . DG  E 4 10  ? -14.893 -52.696 2.306   1.00 68.73  ? 10  DG  E C8    1 
ATOM   4914 N N7    . DG  E 4 10  ? -15.260 -51.499 1.911   1.00 64.96  ? 10  DG  E N7    1 
ATOM   4915 C C5    . DG  E 4 10  ? -14.497 -51.278 0.766   1.00 66.01  ? 10  DG  E C5    1 
ATOM   4916 C C6    . DG  E 4 10  ? -14.441 -50.158 -0.109  1.00 67.44  ? 10  DG  E C6    1 
ATOM   4917 O O6    . DG  E 4 10  ? -15.075 -49.092 -0.047  1.00 69.98  ? 10  DG  E O6    1 
ATOM   4918 N N1    . DG  E 4 10  ? -13.517 -50.365 -1.135  1.00 61.88  ? 10  DG  E N1    1 
ATOM   4919 C C2    . DG  E 4 10  ? -12.758 -51.508 -1.291  1.00 59.56  ? 10  DG  E C2    1 
ATOM   4920 N N2    . DG  E 4 10  ? -11.938 -51.541 -2.326  1.00 60.67  ? 10  DG  E N2    1 
ATOM   4921 N N3    . DG  E 4 10  ? -12.801 -52.542 -0.491  1.00 61.23  ? 10  DG  E N3    1 
ATOM   4922 C C4    . DG  E 4 10  ? -13.685 -52.365 0.504   1.00 67.71  ? 10  DG  E C4    1 
ATOM   4923 P P     . DA  E 4 11  ? -11.239 -57.122 3.698   1.00 86.35  ? 11  DA  E P     1 
ATOM   4924 O OP1   . DA  E 4 11  ? -10.538 -58.429 3.669   1.00 69.37  ? 11  DA  E OP1   1 
ATOM   4925 O OP2   . DA  E 4 11  ? -11.981 -56.677 4.911   1.00 80.49  ? 11  DA  E OP2   1 
ATOM   4926 O "O5'" . DA  E 4 11  ? -10.178 -55.985 3.298   1.00 79.73  ? 11  DA  E "O5'" 1 
ATOM   4927 C "C5'" . DA  E 4 11  ? -9.214  -56.244 2.267   1.00 73.43  ? 11  DA  E "C5'" 1 
ATOM   4928 C "C4'" . DA  E 4 11  ? -8.593  -54.954 1.751   1.00 73.66  ? 11  DA  E "C4'" 1 
ATOM   4929 O "O4'" . DA  E 4 11  ? -9.627  -53.972 1.574   1.00 76.84  ? 11  DA  E "O4'" 1 
ATOM   4930 C "C3'" . DA  E 4 11  ? -7.542  -54.334 2.671   1.00 70.64  ? 11  DA  E "C3'" 1 
ATOM   4931 O "O3'" . DA  E 4 11  ? -6.263  -54.504 2.110   1.00 64.93  ? 11  DA  E "O3'" 1 
ATOM   4932 C "C2'" . DA  E 4 11  ? -7.888  -52.850 2.764   1.00 67.92  ? 11  DA  E "C2'" 1 
ATOM   4933 C "C1'" . DA  E 4 11  ? -9.200  -52.700 2.006   1.00 70.99  ? 11  DA  E "C1'" 1 
ATOM   4934 N N9    . DA  E 4 11  ? -10.266 -52.142 2.811   1.00 66.66  ? 11  DA  E N9    1 
ATOM   4935 C C8    . DA  E 4 11  ? -10.744 -52.610 4.006   1.00 69.79  ? 11  DA  E C8    1 
ATOM   4936 N N7    . DA  E 4 11  ? -11.736 -51.902 4.484   1.00 63.69  ? 11  DA  E N7    1 
ATOM   4937 C C5    . DA  E 4 11  ? -11.916 -50.921 3.537   1.00 55.85  ? 11  DA  E C5    1 
ATOM   4938 C C6    . DA  E 4 11  ? -12.815 -49.855 3.449   1.00 59.73  ? 11  DA  E C6    1 
ATOM   4939 N N6    . DA  E 4 11  ? -13.743 -49.592 4.374   1.00 68.78  ? 11  DA  E N6    1 
ATOM   4940 N N1    . DA  E 4 11  ? -12.721 -49.064 2.372   1.00 61.62  ? 11  DA  E N1    1 
ATOM   4941 C C2    . DA  E 4 11  ? -11.788 -49.343 1.454   1.00 62.74  ? 11  DA  E C2    1 
ATOM   4942 N N3    . DA  E 4 11  ? -10.888 -50.306 1.427   1.00 58.29  ? 11  DA  E N3    1 
ATOM   4943 C C4    . DA  E 4 11  ? -11.013 -51.067 2.503   1.00 57.29  ? 11  DA  E C4    1 
ATOM   4944 P P     . DG  E 4 12  ? -5.006  -54.716 3.085   1.00 73.52  ? 12  DG  E P     1 
ATOM   4945 O OP1   . DG  E 4 12  ? -3.789  -54.505 2.264   1.00 71.08  ? 12  DG  E OP1   1 
ATOM   4946 O OP2   . DG  E 4 12  ? -5.230  -55.952 3.877   1.00 73.26  ? 12  DG  E OP2   1 
ATOM   4947 O "O5'" . DG  E 4 12  ? -5.130  -53.522 4.129   1.00 66.86  ? 12  DG  E "O5'" 1 
ATOM   4948 C "C5'" . DG  E 4 12  ? -4.415  -53.590 5.322   1.00 53.60  ? 12  DG  E "C5'" 1 
ATOM   4949 C "C4'" . DG  E 4 12  ? -3.135  -52.803 5.202   1.00 54.50  ? 12  DG  E "C4'" 1 
ATOM   4950 O "O4'" . DG  E 4 12  ? -3.440  -51.392 5.063   1.00 49.84  ? 12  DG  E "O4'" 1 
ATOM   4951 C "C3'" . DG  E 4 12  ? -2.239  -52.886 6.416   1.00 54.18  ? 12  DG  E "C3'" 1 
ATOM   4952 O "O3'" . DG  E 4 12  ? -0.881  -52.611 6.012   1.00 51.00  ? 12  DG  E "O3'" 1 
ATOM   4953 C "C2'" . DG  E 4 12  ? -2.848  -51.806 7.341   1.00 52.01  ? 12  DG  E "C2'" 1 
ATOM   4954 C "C1'" . DG  E 4 12  ? -3.380  -50.762 6.341   1.00 50.77  ? 12  DG  E "C1'" 1 
ATOM   4955 N N9    . DG  E 4 12  ? -4.720  -50.250 6.622   1.00 49.81  ? 12  DG  E N9    1 
ATOM   4956 C C8    . DG  E 4 12  ? -5.860  -50.981 6.863   1.00 51.26  ? 12  DG  E C8    1 
ATOM   4957 N N7    . DG  E 4 12  ? -6.932  -50.242 7.022   1.00 45.91  ? 12  DG  E N7    1 
ATOM   4958 C C5    . DG  E 4 12  ? -6.475  -48.944 6.849   1.00 43.01  ? 12  DG  E C5    1 
ATOM   4959 C C6    . DG  E 4 12  ? -7.175  -47.715 6.900   1.00 41.06  ? 12  DG  E C6    1 
ATOM   4960 O O6    . DG  E 4 12  ? -8.379  -47.523 7.111   1.00 39.30  ? 12  DG  E O6    1 
ATOM   4961 N N1    . DG  E 4 12  ? -6.332  -46.630 6.675   1.00 43.21  ? 12  DG  E N1    1 
ATOM   4962 C C2    . DG  E 4 12  ? -4.976  -46.721 6.424   1.00 50.70  ? 12  DG  E C2    1 
ATOM   4963 N N2    . DG  E 4 12  ? -4.319  -45.557 6.224   1.00 44.67  ? 12  DG  E N2    1 
ATOM   4964 N N3    . DG  E 4 12  ? -4.306  -47.872 6.375   1.00 48.41  ? 12  DG  E N3    1 
ATOM   4965 C C4    . DG  E 4 12  ? -5.117  -48.935 6.590   1.00 47.28  ? 12  DG  E C4    1 
ATOM   4966 P P     . DC  E 4 13  ? 0.290   -52.380 7.093   1.00 49.63  ? 13  DC  E P     1 
ATOM   4967 O OP1   . DC  E 4 13  ? 1.566   -52.703 6.423   1.00 52.20  ? 13  DC  E OP1   1 
ATOM   4968 O OP2   . DC  E 4 13  ? -0.032  -53.047 8.380   1.00 33.10  ? 13  DC  E OP2   1 
ATOM   4969 O "O5'" . DC  E 4 13  ? 0.248   -50.807 7.300   1.00 47.62  ? 13  DC  E "O5'" 1 
ATOM   4970 C "C5'" . DC  E 4 13  ? 0.622   -50.323 8.499   1.00 40.38  ? 13  DC  E "C5'" 1 
ATOM   4971 C "C4'" . DC  E 4 13  ? 0.237   -48.889 8.688   1.00 35.58  ? 13  DC  E "C4'" 1 
ATOM   4972 O "O4'" . DC  E 4 13  ? -1.166  -48.699 8.446   1.00 41.12  ? 13  DC  E "O4'" 1 
ATOM   4973 C "C3'" . DC  E 4 13  ? 0.445   -48.475 10.116  1.00 37.32  ? 13  DC  E "C3'" 1 
ATOM   4974 O "O3'" . DC  E 4 13  ? 1.749   -47.923 10.229  1.00 31.25  ? 13  DC  E "O3'" 1 
ATOM   4975 C "C2'" . DC  E 4 13  ? -0.676  -47.467 10.401  1.00 35.74  ? 13  DC  E "C2'" 1 
ATOM   4976 C "C1'" . DC  E 4 13  ? -1.593  -47.583 9.180   1.00 35.85  ? 13  DC  E "C1'" 1 
ATOM   4977 N N1    . DC  E 4 13  ? -3.043  -47.727 9.537   1.00 41.94  ? 13  DC  E N1    1 
ATOM   4978 C C2    . DC  E 4 13  ? -3.784  -46.584 9.801   1.00 41.81  ? 13  DC  E C2    1 
ATOM   4979 O O2    . DC  E 4 13  ? -3.228  -45.487 9.718   1.00 43.72  ? 13  DC  E O2    1 
ATOM   4980 N N3    . DC  E 4 13  ? -5.092  -46.704 10.137  1.00 44.39  ? 13  DC  E N3    1 
ATOM   4981 C C4    . DC  E 4 13  ? -5.652  -47.905 10.229  1.00 41.64  ? 13  DC  E C4    1 
ATOM   4982 N N4    . DC  E 4 13  ? -6.950  -47.968 10.567  1.00 42.96  ? 13  DC  E N4    1 
ATOM   4983 C C5    . DC  E 4 13  ? -4.907  -49.094 9.987   1.00 43.22  ? 13  DC  E C5    1 
ATOM   4984 C C6    . DC  E 4 13  ? -3.616  -48.960 9.645   1.00 47.65  ? 13  DC  E C6    1 
ATOM   4985 P P     . DG  E 4 14  ? 2.438   -47.810 11.658  1.00 30.99  ? 14  DG  E P     1 
ATOM   4986 O OP1   . DG  E 4 14  ? 3.892   -47.578 11.413  1.00 37.76  ? 14  DG  E OP1   1 
ATOM   4987 O OP2   . DG  E 4 14  ? 2.028   -48.933 12.528  1.00 31.55  ? 14  DG  E OP2   1 
ATOM   4988 O "O5'" . DG  E 4 14  ? 1.712   -46.556 12.294  1.00 35.06  ? 14  DG  E "O5'" 1 
ATOM   4989 C "C5'" . DG  E 4 14  ? 1.955   -45.262 11.793  1.00 36.64  ? 14  DG  E "C5'" 1 
ATOM   4990 C "C4'" . DG  E 4 14  ? 1.007   -44.299 12.437  1.00 35.12  ? 14  DG  E "C4'" 1 
ATOM   4991 O "O4'" . DG  E 4 14  ? -0.329  -44.788 12.207  1.00 31.57  ? 14  DG  E "O4'" 1 
ATOM   4992 C "C3'" . DG  E 4 14  ? 1.162   -44.180 13.965  1.00 36.76  ? 14  DG  E "C3'" 1 
ATOM   4993 O "O3'" . DG  E 4 14  ? 1.564   -42.829 14.322  1.00 31.95  ? 14  DG  E "O3'" 1 
ATOM   4994 C "C2'" . DG  E 4 14  ? -0.232  -44.552 14.520  1.00 30.78  ? 14  DG  E "C2'" 1 
ATOM   4995 C "C1'" . DG  E 4 14  ? -1.130  -44.439 13.291  1.00 35.64  ? 14  DG  E "C1'" 1 
ATOM   4996 N N9    . DG  E 4 14  ? -2.273  -45.344 13.306  1.00 41.70  ? 14  DG  E N9    1 
ATOM   4997 C C8    . DG  E 4 14  ? -2.234  -46.710 13.294  1.00 38.91  ? 14  DG  E C8    1 
ATOM   4998 N N7    . DG  E 4 14  ? -3.409  -47.265 13.302  1.00 35.75  ? 14  DG  E N7    1 
ATOM   4999 C C5    . DG  E 4 14  ? -4.290  -46.199 13.312  1.00 38.73  ? 14  DG  E C5    1 
ATOM   5000 C C6    . DG  E 4 14  ? -5.703  -46.191 13.331  1.00 42.17  ? 14  DG  E C6    1 
ATOM   5001 O O6    . DG  E 4 14  ? -6.472  -47.159 13.339  1.00 43.72  ? 14  DG  E O6    1 
ATOM   5002 N N1    . DG  E 4 14  ? -6.212  -44.900 13.340  1.00 42.95  ? 14  DG  E N1    1 
ATOM   5003 C C2    . DG  E 4 14  ? -5.455  -43.754 13.338  1.00 41.39  ? 14  DG  E C2    1 
ATOM   5004 N N2    . DG  E 4 14  ? -6.136  -42.597 13.342  1.00 34.84  ? 14  DG  E N2    1 
ATOM   5005 N N3    . DG  E 4 14  ? -4.122  -43.743 13.317  1.00 40.56  ? 14  DG  E N3    1 
ATOM   5006 C C4    . DG  E 4 14  ? -3.611  -45.004 13.306  1.00 39.52  ? 14  DG  E C4    1 
ATOM   5007 P P     . DC  E 4 15  ? 2.150   -42.480 15.788  1.00 36.87  ? 15  DC  E P     1 
ATOM   5008 O OP1   . DC  E 4 15  ? 3.059   -41.344 15.553  1.00 32.99  ? 15  DC  E OP1   1 
ATOM   5009 O OP2   . DC  E 4 15  ? 2.726   -43.644 16.503  1.00 27.03  ? 15  DC  E OP2   1 
ATOM   5010 O "O5'" . DC  E 4 15  ? 0.833   -41.984 16.576  1.00 36.69  ? 15  DC  E "O5'" 1 
ATOM   5011 C "C5'" . DC  E 4 15  ? -0.006  -41.018 15.955  1.00 33.80  ? 15  DC  E "C5'" 1 
ATOM   5012 C "C4'" . DC  E 4 15  ? -1.316  -40.827 16.695  1.00 37.40  ? 15  DC  E "C4'" 1 
ATOM   5013 O "O4'" . DC  E 4 15  ? -2.278  -41.827 16.286  1.00 38.18  ? 15  DC  E "O4'" 1 
ATOM   5014 C "C3'" . DC  E 4 15  ? -1.237  -40.894 18.229  1.00 39.60  ? 15  DC  E "C3'" 1 
ATOM   5015 O "O3'" . DC  E 4 15  ? -1.757  -39.684 18.763  1.00 36.41  ? 15  DC  E "O3'" 1 
ATOM   5016 C "C2'" . DC  E 4 15  ? -2.100  -42.116 18.596  1.00 37.93  ? 15  DC  E "C2'" 1 
ATOM   5017 C "C1'" . DC  E 4 15  ? -3.053  -42.185 17.405  1.00 43.71  ? 15  DC  E "C1'" 1 
ATOM   5018 N N1    . DC  E 4 15  ? -3.640  -43.533 17.152  1.00 36.86  ? 15  DC  E N1    1 
ATOM   5019 C C2    . DC  E 4 15  ? -5.030  -43.684 17.090  1.00 39.82  ? 15  DC  E C2    1 
ATOM   5020 O O2    . DC  E 4 15  ? -5.755  -42.697 17.259  1.00 39.34  ? 15  DC  E O2    1 
ATOM   5021 N N3    . DC  E 4 15  ? -5.542  -44.907 16.844  1.00 43.17  ? 15  DC  E N3    1 
ATOM   5022 C C4    . DC  E 4 15  ? -4.723  -45.942 16.647  1.00 42.09  ? 15  DC  E C4    1 
ATOM   5023 N N4    . DC  E 4 15  ? -5.269  -47.130 16.403  1.00 36.57  ? 15  DC  E N4    1 
ATOM   5024 C C5    . DC  E 4 15  ? -3.304  -45.804 16.697  1.00 39.25  ? 15  DC  E C5    1 
ATOM   5025 C C6    . DC  E 4 15  ? -2.815  -44.594 16.952  1.00 39.25  ? 15  DC  E C6    1 
ATOM   5026 P P     . DA  E 4 16  ? -1.777  -39.432 20.344  1.00 36.02  ? 16  DA  E P     1 
ATOM   5027 O OP1   . DA  E 4 16  ? -1.385  -38.021 20.558  1.00 49.63  ? 16  DA  E OP1   1 
ATOM   5028 O OP2   . DA  E 4 16  ? -0.983  -40.529 20.924  1.00 41.51  ? 16  DA  E OP2   1 
ATOM   5029 O "O5'" . DA  E 4 16  ? -3.317  -39.628 20.757  1.00 37.62  ? 16  DA  E "O5'" 1 
ATOM   5030 C "C5'" . DA  E 4 16  ? -4.344  -38.874 20.083  1.00 38.78  ? 16  DA  E "C5'" 1 
ATOM   5031 C "C4'" . DA  E 4 16  ? -5.714  -39.046 20.746  1.00 49.20  ? 16  DA  E "C4'" 1 
ATOM   5032 O "O4'" . DA  E 4 16  ? -6.354  -40.262 20.283  1.00 46.18  ? 16  DA  E "O4'" 1 
ATOM   5033 C "C3'" . DA  E 4 16  ? -5.706  -39.127 22.267  1.00 48.62  ? 16  DA  E "C3'" 1 
ATOM   5034 O "O3'" . DA  E 4 16  ? -6.777  -38.412 22.795  1.00 55.69  ? 16  DA  E "O3'" 1 
ATOM   5035 C "C2'" . DA  E 4 16  ? -5.848  -40.616 22.563  1.00 42.86  ? 16  DA  E "C2'" 1 
ATOM   5036 C "C1'" . DA  E 4 16  ? -6.626  -41.133 21.364  1.00 39.38  ? 16  DA  E "C1'" 1 
ATOM   5037 N N9    . DA  E 4 16  ? -6.194  -42.472 20.971  1.00 49.48  ? 16  DA  E N9    1 
ATOM   5038 C C8    . DA  E 4 16  ? -4.902  -42.884 20.729  1.00 46.76  ? 16  DA  E C8    1 
ATOM   5039 N N7    . DA  E 4 16  ? -4.799  -44.152 20.400  1.00 43.61  ? 16  DA  E N7    1 
ATOM   5040 C C5    . DA  E 4 16  ? -6.105  -44.602 20.421  1.00 46.12  ? 16  DA  E C5    1 
ATOM   5041 C C6    . DA  E 4 16  ? -6.668  -45.856 20.157  1.00 48.08  ? 16  DA  E C6    1 
ATOM   5042 N N6    . DA  E 4 16  ? -5.940  -46.917 19.808  1.00 41.24  ? 16  DA  E N6    1 
ATOM   5043 N N1    . DA  E 4 16  ? -8.015  -45.978 20.269  1.00 48.96  ? 16  DA  E N1    1 
ATOM   5044 C C2    . DA  E 4 16  ? -8.734  -44.906 20.621  1.00 44.49  ? 16  DA  E C2    1 
ATOM   5045 N N3    . DA  E 4 16  ? -8.315  -43.672 20.900  1.00 45.46  ? 16  DA  E N3    1 
ATOM   5046 C C4    . DA  E 4 16  ? -6.981  -43.583 20.775  1.00 48.34  ? 16  DA  E C4    1 
ATOM   5047 P P     . DT  E 4 17  ? -6.956  -38.364 24.386  1.00 49.12  ? 17  DT  E P     1 
ATOM   5048 O OP1   . DT  E 4 17  ? -7.609  -37.080 24.718  1.00 61.92  ? 17  DT  E OP1   1 
ATOM   5049 O OP2   . DT  E 4 17  ? -5.658  -38.735 24.973  1.00 51.37  ? 17  DT  E OP2   1 
ATOM   5050 O "O5'" . DT  E 4 17  ? -7.984  -39.544 24.688  1.00 56.13  ? 17  DT  E "O5'" 1 
ATOM   5051 C "C5'" . DT  E 4 17  ? -9.246  -39.523 24.062  1.00 50.36  ? 17  DT  E "C5'" 1 
ATOM   5052 C "C4'" . DT  E 4 17  ? -10.151 -40.613 24.606  1.00 60.22  ? 17  DT  E "C4'" 1 
ATOM   5053 O "O4'" . DT  E 4 17  ? -9.809  -41.892 24.013  1.00 60.25  ? 17  DT  E "O4'" 1 
ATOM   5054 C "C3'" . DT  E 4 17  ? -10.125 -40.838 26.120  1.00 54.56  ? 17  DT  E "C3'" 1 
ATOM   5055 O "O3'" . DT  E 4 17  ? -11.426 -41.214 26.499  1.00 67.24  ? 17  DT  E "O3'" 1 
ATOM   5056 C "C2'" . DT  E 4 17  ? -9.170  -42.018 26.257  1.00 44.20  ? 17  DT  E "C2'" 1 
ATOM   5057 C "C1'" . DT  E 4 17  ? -9.582  -42.831 25.043  1.00 50.05  ? 17  DT  E "C1'" 1 
ATOM   5058 N N1    . DT  E 4 17  ? -8.560  -43.761 24.557  1.00 51.42  ? 17  DT  E N1    1 
ATOM   5059 C C2    . DT  E 4 17  ? -8.958  -44.974 24.084  1.00 52.16  ? 17  DT  E C2    1 
ATOM   5060 O O2    . DT  E 4 17  ? -10.124 -45.330 24.066  1.00 59.86  ? 17  DT  E O2    1 
ATOM   5061 N N3    . DT  E 4 17  ? -7.947  -45.769 23.631  1.00 47.34  ? 17  DT  E N3    1 
ATOM   5062 C C4    . DT  E 4 17  ? -6.608  -45.474 23.594  1.00 41.46  ? 17  DT  E C4    1 
ATOM   5063 O O4    . DT  E 4 17  ? -5.784  -46.260 23.171  1.00 43.35  ? 17  DT  E O4    1 
ATOM   5064 C C5    . DT  E 4 17  ? -6.247  -44.177 24.094  1.00 48.06  ? 17  DT  E C5    1 
ATOM   5065 C C7    . DT  E 4 17  ? -4.807  -43.745 24.104  1.00 35.36  ? 17  DT  E C7    1 
ATOM   5066 C C6    . DT  E 4 17  ? -7.234  -43.384 24.547  1.00 53.57  ? 17  DT  E C6    1 
ATOM   5067 P P     . DC  E 4 18  ? -11.916 -41.186 28.028  1.00 55.92  ? 18  DC  E P     1 
ATOM   5068 O OP1   . DC  E 4 18  ? -13.177 -40.412 27.986  1.00 51.88  ? 18  DC  E OP1   1 
ATOM   5069 O OP2   . DC  E 4 18  ? -10.797 -40.793 28.930  1.00 32.01  ? 18  DC  E OP2   1 
ATOM   5070 O "O5'" . DC  E 4 18  ? -12.304 -42.716 28.289  1.00 51.68  ? 18  DC  E "O5'" 1 
ATOM   5071 C "C5'" . DC  E 4 18  ? -12.857 -43.501 27.243  1.00 46.18  ? 18  DC  E "C5'" 1 
ATOM   5072 C "C4'" . DC  E 4 18  ? -12.759 -44.982 27.579  1.00 55.15  ? 18  DC  E "C4'" 1 
ATOM   5073 O "O4'" . DC  E 4 18  ? -11.580 -45.562 26.948  1.00 49.93  ? 18  DC  E "O4'" 1 
ATOM   5074 C "C3'" . DC  E 4 18  ? -12.637 -45.304 29.078  1.00 54.00  ? 18  DC  E "C3'" 1 
ATOM   5075 O "O3'" . DC  E 4 18  ? -13.447 -46.438 29.411  1.00 65.24  ? 18  DC  E "O3'" 1 
ATOM   5076 C "C2'" . DC  E 4 18  ? -11.160 -45.631 29.234  1.00 51.50  ? 18  DC  E "C2'" 1 
ATOM   5077 C "C1'" . DC  E 4 18  ? -10.891 -46.332 27.908  1.00 55.85  ? 18  DC  E "C1'" 1 
ATOM   5078 N N1    . DC  E 4 18  ? -9.429  -46.398 27.551  1.00 52.07  ? 18  DC  E N1    1 
ATOM   5079 C C2    . DC  E 4 18  ? -8.933  -47.491 26.822  1.00 49.33  ? 18  DC  E C2    1 
ATOM   5080 O O2    . DC  E 4 18  ? -9.708  -48.383 26.458  1.00 49.27  ? 18  DC  E O2    1 
ATOM   5081 N N3    . DC  E 4 18  ? -7.616  -47.537 26.529  1.00 49.54  ? 18  DC  E N3    1 
ATOM   5082 C C4    . DC  E 4 18  ? -6.802  -46.559 26.945  1.00 55.37  ? 18  DC  E C4    1 
ATOM   5083 N N4    . DC  E 4 18  ? -5.499  -46.651 26.627  1.00 51.40  ? 18  DC  E N4    1 
ATOM   5084 C C5    . DC  E 4 18  ? -7.283  -45.445 27.706  1.00 52.81  ? 18  DC  E C5    1 
ATOM   5085 C C6    . DC  E 4 18  ? -8.587  -45.413 27.989  1.00 50.24  ? 18  DC  E C6    1 
ATOM   5086 P P     . DA  E 4 19  ? -14.047 -46.598 30.902  1.00 66.61  ? 19  DA  E P     1 
ATOM   5087 O OP1   . DA  E 4 19  ? -15.506 -46.320 30.808  1.00 55.30  ? 19  DA  E OP1   1 
ATOM   5088 O OP2   . DA  E 4 19  ? -13.167 -45.881 31.865  1.00 53.48  ? 19  DA  E OP2   1 
ATOM   5089 O "O5'" . DA  E 4 19  ? -13.866 -48.144 31.222  1.00 53.71  ? 19  DA  E "O5'" 1 
ATOM   5090 C "C5'" . DA  E 4 19  ? -14.131 -49.102 30.219  1.00 59.47  ? 19  DA  E "C5'" 1 
ATOM   5091 C "C4'" . DA  E 4 19  ? -13.234 -50.303 30.408  1.00 63.12  ? 19  DA  E "C4'" 1 
ATOM   5092 O "O4'" . DA  E 4 19  ? -11.910 -50.001 29.905  1.00 57.83  ? 19  DA  E "O4'" 1 
ATOM   5093 C "C3'" . DA  E 4 19  ? -13.047 -50.728 31.865  1.00 57.40  ? 19  DA  E "C3'" 1 
ATOM   5094 O "O3'" . DA  E 4 19  ? -13.297 -52.106 31.994  1.00 57.30  ? 19  DA  E "O3'" 1 
ATOM   5095 C "C2'" . DA  E 4 19  ? -11.582 -50.387 32.175  1.00 53.95  ? 19  DA  E "C2'" 1 
ATOM   5096 C "C1'" . DA  E 4 19  ? -10.947 -50.485 30.804  1.00 52.30  ? 19  DA  E "C1'" 1 
ATOM   5097 N N9    . DA  E 4 19  ? -9.773  -49.655 30.650  1.00 54.69  ? 19  DA  E N9    1 
ATOM   5098 C C8    . DA  E 4 19  ? -9.654  -48.335 30.978  1.00 55.34  ? 19  DA  E C8    1 
ATOM   5099 N N7    . DA  E 4 19  ? -8.472  -47.832 30.713  1.00 58.12  ? 19  DA  E N7    1 
ATOM   5100 C C5    . DA  E 4 19  ? -7.770  -48.898 30.150  1.00 53.00  ? 19  DA  E C5    1 
ATOM   5101 C C6    . DA  E 4 19  ? -6.446  -49.019 29.644  1.00 50.95  ? 19  DA  E C6    1 
ATOM   5102 N N6    . DA  E 4 19  ? -5.557  -48.011 29.619  1.00 47.25  ? 19  DA  E N6    1 
ATOM   5103 N N1    . DA  E 4 19  ? -6.073  -50.222 29.172  1.00 50.42  ? 19  DA  E N1    1 
ATOM   5104 C C2    . DA  E 4 19  ? -6.966  -51.230 29.191  1.00 53.16  ? 19  DA  E C2    1 
ATOM   5105 N N3    . DA  E 4 19  ? -8.224  -51.236 29.632  1.00 44.34  ? 19  DA  E N3    1 
ATOM   5106 C C4    . DA  E 4 19  ? -8.564  -50.028 30.105  1.00 50.66  ? 19  DA  E C4    1 
ATOM   5107 P P     . DG  E 4 20  ? -13.693 -52.711 33.428  1.00 58.39  ? 20  DG  E P     1 
ATOM   5108 O OP1   . DG  E 4 20  ? -15.030 -53.319 33.244  1.00 51.45  ? 20  DG  E OP1   1 
ATOM   5109 O OP2   . DG  E 4 20  ? -13.412 -51.699 34.480  1.00 53.82  ? 20  DG  E OP2   1 
ATOM   5110 O "O5'" . DG  E 4 20  ? -12.599 -53.841 33.684  1.00 58.10  ? 20  DG  E "O5'" 1 
ATOM   5111 C "C5'" . DG  E 4 20  ? -12.196 -54.663 32.625  1.00 57.85  ? 20  DG  E "C5'" 1 
ATOM   5112 C "C4'" . DG  E 4 20  ? -10.747 -55.023 32.785  1.00 47.69  ? 20  DG  E "C4'" 1 
ATOM   5113 O "O4'" . DG  E 4 20  ? -9.933  -53.896 32.435  1.00 58.01  ? 20  DG  E "O4'" 1 
ATOM   5114 C "C3'" . DG  E 4 20  ? -10.348 -55.390 34.201  1.00 49.66  ? 20  DG  E "C3'" 1 
ATOM   5115 O "O3'" . DG  E 4 20  ? -10.171 -56.788 34.264  1.00 59.07  ? 20  DG  E "O3'" 1 
ATOM   5116 C "C2'" . DG  E 4 20  ? -9.020  -54.619 34.452  1.00 53.38  ? 20  DG  E "C2'" 1 
ATOM   5117 C "C1'" . DG  E 4 20  ? -8.694  -54.033 33.081  1.00 56.64  ? 20  DG  E "C1'" 1 
ATOM   5118 N N9    . DG  E 4 20  ? -8.044  -52.713 33.086  1.00 48.83  ? 20  DG  E N9    1 
ATOM   5119 C C8    . DG  E 4 20  ? -8.599  -51.518 33.471  1.00 49.57  ? 20  DG  E C8    1 
ATOM   5120 N N7    . DG  E 4 20  ? -7.802  -50.498 33.325  1.00 49.45  ? 20  DG  E N7    1 
ATOM   5121 C C5    . DG  E 4 20  ? -6.648  -51.043 32.783  1.00 53.03  ? 20  DG  E C5    1 
ATOM   5122 C C6    . DG  E 4 20  ? -5.427  -50.415 32.400  1.00 48.05  ? 20  DG  E C6    1 
ATOM   5123 O O6    . DG  E 4 20  ? -5.122  -49.211 32.469  1.00 47.50  ? 20  DG  E O6    1 
ATOM   5124 N N1    . DG  E 4 20  ? -4.513  -51.340 31.898  1.00 43.72  ? 20  DG  E N1    1 
ATOM   5125 C C2    . DG  E 4 20  ? -4.754  -52.699 31.783  1.00 46.50  ? 20  DG  E C2    1 
ATOM   5126 N N2    . DG  E 4 20  ? -3.767  -53.434 31.278  1.00 42.91  ? 20  DG  E N2    1 
ATOM   5127 N N3    . DG  E 4 20  ? -5.888  -53.291 32.131  1.00 47.98  ? 20  DG  E N3    1 
ATOM   5128 C C4    . DG  E 4 20  ? -6.786  -52.409 32.624  1.00 49.98  ? 20  DG  E C4    1 
ATOM   5129 P P     . DC  E 4 21  ? -10.060 -57.527 35.678  1.00 55.47  ? 21  DC  E P     1 
ATOM   5130 O OP1   . DC  E 4 21  ? -10.441 -58.948 35.488  1.00 57.35  ? 21  DC  E OP1   1 
ATOM   5131 O OP2   . DC  E 4 21  ? -10.758 -56.650 36.647  1.00 50.95  ? 21  DC  E OP2   1 
ATOM   5132 O "O5'" . DC  E 4 21  ? -8.506  -57.421 36.042  1.00 54.15  ? 21  DC  E "O5'" 1 
ATOM   5133 C "C5'" . DC  E 4 21  ? -7.510  -57.890 35.138  1.00 51.11  ? 21  DC  E "C5'" 1 
ATOM   5134 C "C4'" . DC  E 4 21  ? -6.143  -57.328 35.504  1.00 55.16  ? 21  DC  E "C4'" 1 
ATOM   5135 O "O4'" . DC  E 4 21  ? -6.074  -55.936 35.136  1.00 60.82  ? 21  DC  E "O4'" 1 
ATOM   5136 C "C3'" . DC  E 4 21  ? -5.792  -57.375 37.001  1.00 46.64  ? 21  DC  E "C3'" 1 
ATOM   5137 O "O3'" . DC  E 4 21  ? -4.813  -58.365 37.224  1.00 46.79  ? 21  DC  E "O3'" 1 
ATOM   5138 C "C2'" . DC  E 4 21  ? -5.256  -55.969 37.329  1.00 45.27  ? 21  DC  E "C2'" 1 
ATOM   5139 C "C1'" . DC  E 4 21  ? -5.111  -55.325 35.952  1.00 55.11  ? 21  DC  E "C1'" 1 
ATOM   5140 N N1    . DC  E 4 21  ? -5.338  -53.855 35.955  1.00 59.14  ? 21  DC  E N1    1 
ATOM   5141 C C2    . DC  E 4 21  ? -4.422  -53.022 35.305  1.00 54.04  ? 21  DC  E C2    1 
ATOM   5142 O O2    . DC  E 4 21  ? -3.456  -53.534 34.731  1.00 49.20  ? 21  DC  E O2    1 
ATOM   5143 N N3    . DC  E 4 21  ? -4.624  -51.676 35.324  1.00 54.60  ? 21  DC  E N3    1 
ATOM   5144 C C4    . DC  E 4 21  ? -5.686  -51.165 35.960  1.00 57.29  ? 21  DC  E C4    1 
ATOM   5145 N N4    . DC  E 4 21  ? -5.840  -49.837 35.951  1.00 56.49  ? 21  DC  E N4    1 
ATOM   5146 C C5    . DC  E 4 21  ? -6.637  -52.000 36.628  1.00 55.97  ? 21  DC  E C5    1 
ATOM   5147 C C6    . DC  E 4 21  ? -6.425  -53.327 36.602  1.00 59.11  ? 21  DC  E C6    1 
HETATM 5148 O O     . HOH F 5 .   ? -1.667  -37.852 4.849   1.00 28.17  ? 401 HOH A O     1 
HETATM 5149 O O     . HOH F 5 .   ? -7.045  -27.200 -3.993  1.00 30.29  ? 402 HOH A O     1 
HETATM 5150 O O     . HOH F 5 .   ? 9.761   -27.807 21.432  1.00 32.91  ? 403 HOH A O     1 
HETATM 5151 O O     . HOH F 5 .   ? 15.536  -38.816 -6.475  1.00 33.86  ? 404 HOH A O     1 
HETATM 5152 O O     . HOH F 5 .   ? 9.817   -32.397 -5.708  1.00 30.18  ? 405 HOH A O     1 
HETATM 5153 O O     . HOH F 5 .   ? 5.535   -33.025 1.977   1.00 22.06  ? 406 HOH A O     1 
HETATM 5154 O O     . HOH F 5 .   ? -5.049  -33.872 -17.090 1.00 33.46  ? 407 HOH A O     1 
HETATM 5155 O O     . HOH F 5 .   ? 5.973   -42.776 -8.126  1.00 34.91  ? 408 HOH A O     1 
HETATM 5156 O O     . HOH F 5 .   ? -18.854 -24.890 3.421   1.00 37.42  ? 409 HOH A O     1 
HETATM 5157 O O     . HOH F 5 .   ? 21.812  -22.977 2.427   1.00 30.15  ? 410 HOH A O     1 
HETATM 5158 O O     . HOH F 5 .   ? 6.711   -10.496 5.257   1.00 59.69  ? 411 HOH A O     1 
HETATM 5159 O O     . HOH F 5 .   ? 4.997   -15.538 -9.253  1.00 36.82  ? 412 HOH A O     1 
HETATM 5160 O O     . HOH F 5 .   ? 4.778   -46.451 2.896   1.00 24.98  ? 413 HOH A O     1 
HETATM 5161 O O     . HOH F 5 .   ? -17.853 -30.062 3.907   1.00 36.97  ? 414 HOH A O     1 
HETATM 5162 O O     . HOH F 5 .   ? 11.289  -36.911 -13.102 1.00 36.83  ? 415 HOH A O     1 
HETATM 5163 O O     . HOH F 5 .   ? 21.206  -25.719 13.431  1.00 39.13  ? 416 HOH A O     1 
HETATM 5164 O O     . HOH F 5 .   ? 7.955   -43.342 3.050   1.00 28.94  ? 417 HOH A O     1 
HETATM 5165 O O     . HOH F 5 .   ? 3.972   -30.471 14.981  1.00 31.12  ? 418 HOH A O     1 
HETATM 5166 O O     . HOH F 5 .   ? -5.054  -25.245 -0.794  1.00 22.44  ? 419 HOH A O     1 
HETATM 5167 O O     . HOH F 5 .   ? 4.601   -42.769 9.931   1.00 28.43  ? 420 HOH A O     1 
HETATM 5168 O O     . HOH F 5 .   ? 5.109   -39.420 23.097  1.00 39.96  ? 421 HOH A O     1 
HETATM 5169 O O     . HOH F 5 .   ? 23.482  -34.757 8.289   1.00 35.08  ? 422 HOH A O     1 
HETATM 5170 O O     . HOH F 5 .   ? 10.137  -22.812 18.308  1.00 31.56  ? 423 HOH A O     1 
HETATM 5171 O O     . HOH F 5 .   ? 6.651   -29.859 -6.728  1.00 25.21  ? 424 HOH A O     1 
HETATM 5172 O O     . HOH F 5 .   ? 1.136   -25.572 18.369  1.00 30.65  ? 425 HOH A O     1 
HETATM 5173 O O     . HOH F 5 .   ? -6.033  -35.356 -0.904  1.00 36.54  ? 426 HOH A O     1 
HETATM 5174 O O     . HOH F 5 .   ? -14.639 -22.921 8.748   1.00 49.08  ? 427 HOH A O     1 
HETATM 5175 O O     . HOH F 5 .   ? 21.514  -31.884 11.097  1.00 52.36  ? 428 HOH A O     1 
HETATM 5176 O O     . HOH F 5 .   ? 3.113   -24.974 -12.687 1.00 30.50  ? 429 HOH A O     1 
HETATM 5177 O O     . HOH F 5 .   ? -2.416  -34.919 -17.035 1.00 40.08  ? 430 HOH A O     1 
HETATM 5178 O O     . HOH F 5 .   ? 7.594   -47.296 5.614   1.00 33.70  ? 431 HOH A O     1 
HETATM 5179 O O     . HOH F 5 .   ? 23.493  -35.315 1.325   1.00 33.46  ? 432 HOH A O     1 
HETATM 5180 O O     . HOH F 5 .   ? 5.308   -46.526 7.329   1.00 37.13  ? 433 HOH A O     1 
HETATM 5181 O O     . HOH F 5 .   ? -2.364  -16.187 11.584  1.00 41.66  ? 434 HOH A O     1 
HETATM 5182 O O     . HOH F 5 .   ? 5.994   -20.312 -14.945 1.00 31.16  ? 435 HOH A O     1 
HETATM 5183 O O     . HOH F 5 .   ? 17.617  -15.449 7.945   1.00 39.87  ? 436 HOH A O     1 
HETATM 5184 O O     . HOH F 5 .   ? 8.140   -9.180  -4.560  1.00 52.37  ? 437 HOH A O     1 
HETATM 5185 O O     . HOH F 5 .   ? -5.812  -26.672 -14.043 1.00 43.22  ? 438 HOH A O     1 
HETATM 5186 O O     . HOH F 5 .   ? -10.921 -37.936 -20.203 1.00 41.34  ? 439 HOH A O     1 
HETATM 5187 O O     . HOH F 5 .   ? 18.226  -19.161 4.021   1.00 35.48  ? 440 HOH A O     1 
HETATM 5188 O O     . HOH G 5 .   ? 19.167  13.048  39.157  1.00 62.47  ? 401 HOH B O     1 
HETATM 5189 O O     . HOH G 5 .   ? -4.281  -6.111  46.218  1.00 31.89  ? 402 HOH B O     1 
HETATM 5190 O O     . HOH G 5 .   ? -6.937  -5.329  17.197  1.00 64.33  ? 403 HOH B O     1 
HETATM 5191 O O     . HOH G 5 .   ? 5.445   -7.620  34.784  1.00 33.33  ? 404 HOH B O     1 
HETATM 5192 O O     . HOH G 5 .   ? -0.971  0.661   36.617  1.00 27.23  ? 405 HOH B O     1 
HETATM 5193 O O     . HOH G 5 .   ? 8.010   -5.257  34.928  1.00 35.18  ? 406 HOH B O     1 
HETATM 5194 O O     . HOH G 5 .   ? 8.420   -21.974 26.180  1.00 31.42  ? 407 HOH B O     1 
HETATM 5195 O O     . HOH G 5 .   ? -12.317 8.081   46.177  1.00 39.65  ? 408 HOH B O     1 
HETATM 5196 O O     . HOH G 5 .   ? 3.598   -5.797  58.554  1.00 46.95  ? 409 HOH B O     1 
HETATM 5197 O O     . HOH G 5 .   ? 5.016   2.333   60.290  1.00 58.40  ? 410 HOH B O     1 
HETATM 5198 O O     . HOH G 5 .   ? -9.471  -18.667 49.923  1.00 42.92  ? 411 HOH B O     1 
HETATM 5199 O O     . HOH G 5 .   ? 16.916  -21.905 29.298  1.00 39.05  ? 412 HOH B O     1 
HETATM 5200 O O     . HOH G 5 .   ? 17.889  -21.712 31.951  1.00 40.39  ? 413 HOH B O     1 
HETATM 5201 O O     . HOH G 5 .   ? 23.992  -24.811 44.748  1.00 32.18  ? 414 HOH B O     1 
HETATM 5202 O O     . HOH G 5 .   ? 16.532  -24.698 28.541  1.00 45.22  ? 415 HOH B O     1 
HETATM 5203 O O     . HOH G 5 .   ? 10.943  -27.260 31.389  1.00 30.39  ? 416 HOH B O     1 
HETATM 5204 O O     . HOH H 5 .   ? -12.740 -53.466 17.768  1.00 46.41  ? 101 HOH D O     1 
HETATM 5205 O O     . HOH H 5 .   ? -5.495  -52.114 20.273  1.00 34.47  ? 102 HOH D O     1 
HETATM 5206 O O     . HOH H 5 .   ? -8.711  -61.170 20.208  1.00 43.24  ? 103 HOH D O     1 
HETATM 5207 O O     . HOH H 5 .   ? -4.565  -35.817 4.585   1.00 14.55  ? 104 HOH D O     1 
HETATM 5208 O O     . HOH H 5 .   ? -17.183 -39.620 14.033  1.00 57.76  ? 105 HOH D O     1 
HETATM 5209 O O     . HOH I 5 .   ? -8.456  -48.522 34.447  1.00 52.64  ? 101 HOH E O     1 
HETATM 5210 O O     . HOH I 5 .   ? -17.197 -53.660 4.711   1.00 54.01  ? 102 HOH E O     1 
HETATM 5211 O O     . HOH I 5 .   ? 3.330   -38.997 16.049  1.00 28.04  ? 103 HOH E O     1 
HETATM 5212 O O     . HOH I 5 .   ? -1.672  -43.518 9.223   1.00 29.59  ? 104 HOH E O     1 
HETATM 5213 O O     . HOH I 5 .   ? -7.050  -56.410 -27.660 1.00 68.30  ? 105 HOH E O     1 
HETATM 5214 O O     . HOH I 5 .   ? -2.217  -41.813 22.997  1.00 30.56  ? 106 HOH E O     1 
HETATM 5215 O O     . HOH I 5 .   ? 1.058   -42.470 20.947  1.00 29.06  ? 107 HOH E O     1 
HETATM 5216 O O     . HOH I 5 .   ? 0.797   -45.239 17.867  1.00 31.27  ? 108 HOH E O     1 
HETATM 5217 O O     . HOH I 5 .   ? 3.181   -42.314 19.010  1.00 35.46  ? 109 HOH E O     1 
HETATM 5218 O O     . HOH I 5 .   ? -2.576  -44.995 3.951   1.00 35.70  ? 110 HOH E O     1 
HETATM 5219 O O     . HOH I 5 .   ? 4.764   -49.315 8.473   1.00 31.54  ? 111 HOH E O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   43  43  ALA ALA A . n 
A 1 2   LEU 2   44  44  LEU LEU A . n 
A 1 3   TYR 3   45  45  TYR TYR A . n 
A 1 4   GLU 4   46  46  GLU GLU A . n 
A 1 5   ASP 5   47  47  ASP ASP A . n 
A 1 6   PRO 6   48  48  PRO PRO A . n 
A 1 7   PRO 7   49  49  PRO PRO A . n 
A 1 8   ASP 8   50  50  ASP ASP A . n 
A 1 9   GLN 9   51  51  GLN GLN A . n 
A 1 10  LYS 10  52  52  LYS LYS A . n 
A 1 11  THR 11  53  53  THR THR A . n 
A 1 12  SER 12  54  54  SER SER A . n 
A 1 13  PRO 13  55  55  PRO PRO A . n 
A 1 14  SER 14  56  56  SER SER A . n 
A 1 15  GLY 15  57  57  GLY GLY A . n 
A 1 16  LYS 16  58  58  LYS LYS A . n 
A 1 17  PRO 17  59  59  PRO PRO A . n 
A 1 18  ALA 18  60  60  ALA ALA A . n 
A 1 19  THR 19  61  61  THR THR A . n 
A 1 20  LEU 20  62  62  LEU LEU A . n 
A 1 21  LYS 21  63  63  LYS LYS A . n 
A 1 22  ILE 22  64  64  ILE ILE A . n 
A 1 23  CYS 23  65  65  CYS CYS A . n 
A 1 24  SER 24  66  66  SER SER A . n 
A 1 25  TRP 25  67  67  TRP TRP A . n 
A 1 26  ASN 26  68  68  ASN ASN A . n 
A 1 27  VAL 27  69  69  VAL VAL A . n 
A 1 28  ASP 28  70  70  ASP ASP A . n 
A 1 29  GLY 29  71  71  GLY GLY A . n 
A 1 30  LEU 30  72  72  LEU LEU A . n 
A 1 31  ARG 31  73  73  ARG ARG A . n 
A 1 32  ALA 32  74  74  ALA ALA A . n 
A 1 33  TRP 33  75  75  TRP TRP A . n 
A 1 34  ILE 34  76  76  ILE ILE A . n 
A 1 35  LYS 35  77  77  LYS LYS A . n 
A 1 36  LYS 36  78  78  LYS LYS A . n 
A 1 37  LYS 37  79  79  LYS LYS A . n 
A 1 38  GLY 38  80  80  GLY GLY A . n 
A 1 39  LEU 39  81  81  LEU LEU A . n 
A 1 40  ASP 40  82  82  ASP ASP A . n 
A 1 41  TRP 41  83  83  TRP TRP A . n 
A 1 42  VAL 42  84  84  VAL VAL A . n 
A 1 43  LYS 43  85  85  LYS LYS A . n 
A 1 44  GLU 44  86  86  GLU GLU A . n 
A 1 45  GLU 45  87  87  GLU GLU A . n 
A 1 46  ALA 46  88  88  ALA ALA A . n 
A 1 47  PRO 47  89  89  PRO PRO A . n 
A 1 48  ASP 48  90  90  ASP ASP A . n 
A 1 49  ILE 49  91  91  ILE ILE A . n 
A 1 50  LEU 50  92  92  LEU LEU A . n 
A 1 51  CYS 51  93  93  CYS CYS A . n 
A 1 52  LEU 52  94  94  LEU LEU A . n 
A 1 53  GLN 53  95  95  GLN GLN A . n 
A 1 54  GLU 54  96  96  GLU GLU A . n 
A 1 55  THR 55  97  97  THR THR A . n 
A 1 56  LYS 56  98  98  LYS LYS A . n 
A 1 57  CYS 57  99  99  CYS CYS A . n 
A 1 58  SER 58  100 100 SER SER A . n 
A 1 59  GLU 59  101 101 GLU GLU A . n 
A 1 60  ASN 60  102 102 ASN ASN A . n 
A 1 61  LYS 61  103 103 LYS LYS A . n 
A 1 62  LEU 62  104 104 LEU LEU A . n 
A 1 63  PRO 63  105 105 PRO PRO A . n 
A 1 64  ALA 64  106 106 ALA ALA A . n 
A 1 65  GLU 65  107 107 GLU GLU A . n 
A 1 66  LEU 66  108 108 LEU LEU A . n 
A 1 67  GLN 67  109 109 GLN GLN A . n 
A 1 68  GLU 68  110 110 GLU GLU A . n 
A 1 69  LEU 69  111 111 LEU LEU A . n 
A 1 70  PRO 70  112 112 PRO PRO A . n 
A 1 71  GLY 71  113 113 GLY GLY A . n 
A 1 72  LEU 72  114 114 LEU LEU A . n 
A 1 73  SER 73  115 115 SER SER A . n 
A 1 74  HIS 74  116 116 HIS HIS A . n 
A 1 75  GLN 75  117 117 GLN GLN A . n 
A 1 76  TYR 76  118 118 TYR TYR A . n 
A 1 77  TRP 77  119 119 TRP TRP A . n 
A 1 78  SER 78  120 120 SER SER A . n 
A 1 79  ALA 79  121 121 ALA ALA A . n 
A 1 80  PRO 80  122 122 PRO PRO A . n 
A 1 81  SER 81  123 123 SER SER A . n 
A 1 82  ASP 82  124 124 ASP ASP A . n 
A 1 83  LYS 83  125 125 LYS LYS A . n 
A 1 84  GLU 84  126 126 GLU GLU A . n 
A 1 85  GLY 85  127 127 GLY GLY A . n 
A 1 86  TYR 86  128 128 TYR TYR A . n 
A 1 87  SER 87  129 129 SER SER A . n 
A 1 88  GLY 88  130 130 GLY GLY A . n 
A 1 89  VAL 89  131 131 VAL VAL A . n 
A 1 90  GLY 90  132 132 GLY GLY A . n 
A 1 91  LEU 91  133 133 LEU LEU A . n 
A 1 92  LEU 92  134 134 LEU LEU A . n 
A 1 93  SER 93  135 135 SER SER A . n 
A 1 94  ARG 94  136 136 ARG ARG A . n 
A 1 95  GLN 95  137 137 GLN GLN A . n 
A 1 96  ALA 96  138 138 ALA ALA A . n 
A 1 97  PRO 97  139 139 PRO PRO A . n 
A 1 98  LEU 98  140 140 LEU LEU A . n 
A 1 99  LYS 99  141 141 LYS LYS A . n 
A 1 100 VAL 100 142 142 VAL VAL A . n 
A 1 101 SER 101 143 143 SER SER A . n 
A 1 102 TYR 102 144 144 TYR TYR A . n 
A 1 103 GLY 103 145 145 GLY GLY A . n 
A 1 104 ILE 104 146 146 ILE ILE A . n 
A 1 105 GLY 105 147 147 GLY GLY A . n 
A 1 106 ASP 106 148 148 ASP ASP A . n 
A 1 107 GLU 107 149 149 GLU GLU A . n 
A 1 108 GLU 108 150 150 GLU ALA A . n 
A 1 109 HIS 109 151 151 HIS HIS A . n 
A 1 110 ASP 110 152 152 ASP ASP A . n 
A 1 111 GLN 111 153 153 GLN GLN A . n 
A 1 112 GLU 112 154 154 GLU GLU A . n 
A 1 113 GLY 113 155 155 GLY GLY A . n 
A 1 114 ARG 114 156 156 ARG ARG A . n 
A 1 115 VAL 115 157 157 VAL VAL A . n 
A 1 116 ILE 116 158 158 ILE ILE A . n 
A 1 117 VAL 117 159 159 VAL VAL A . n 
A 1 118 ALA 118 160 160 ALA ALA A . n 
A 1 119 GLU 119 161 161 GLU GLU A . n 
A 1 120 PHE 120 162 162 PHE PHE A . n 
A 1 121 ASP 121 163 163 ASP ASP A . n 
A 1 122 SER 122 164 164 SER SER A . n 
A 1 123 PHE 123 165 165 PHE PHE A . n 
A 1 124 VAL 124 166 166 VAL VAL A . n 
A 1 125 LEU 125 167 167 LEU LEU A . n 
A 1 126 VAL 126 168 168 VAL VAL A . n 
A 1 127 THR 127 169 169 THR THR A . n 
A 1 128 ALA 128 170 170 ALA ALA A . n 
A 1 129 TYR 129 171 171 TYR TYR A . n 
A 1 130 VAL 130 172 172 VAL VAL A . n 
A 1 131 PRO 131 173 173 PRO PRO A . n 
A 1 132 ASN 132 174 174 ASN ASN A . n 
A 1 133 ALA 133 175 175 ALA ALA A . n 
A 1 134 GLY 134 176 176 GLY GLY A . n 
A 1 135 ARG 135 177 177 ARG ARG A . n 
A 1 136 GLY 136 178 178 GLY GLY A . n 
A 1 137 LEU 137 179 179 LEU LEU A . n 
A 1 138 VAL 138 180 180 VAL VAL A . n 
A 1 139 ARG 139 181 181 ARG ARG A . n 
A 1 140 LEU 140 182 182 LEU LEU A . n 
A 1 141 GLU 141 183 183 GLU GLU A . n 
A 1 142 TYR 142 184 184 TYR TYR A . n 
A 1 143 ARG 143 185 185 ARG ARG A . n 
A 1 144 GLN 144 186 186 GLN GLN A . n 
A 1 145 ARG 145 187 187 ARG ARG A . n 
A 1 146 TRP 146 188 188 TRP TRP A . n 
A 1 147 ASP 147 189 189 ASP ASP A . n 
A 1 148 GLU 148 190 190 GLU GLU A . n 
A 1 149 ALA 149 191 191 ALA ALA A . n 
A 1 150 PHE 150 192 192 PHE PHE A . n 
A 1 151 ARG 151 193 193 ARG ARG A . n 
A 1 152 LYS 152 194 194 LYS LYS A . n 
A 1 153 PHE 153 195 195 PHE PHE A . n 
A 1 154 LEU 154 196 196 LEU LEU A . n 
A 1 155 LYS 155 197 197 LYS LYS A . n 
A 1 156 GLY 156 198 198 GLY GLY A . n 
A 1 157 LEU 157 199 199 LEU LEU A . n 
A 1 158 ALA 158 200 200 ALA ALA A . n 
A 1 159 SER 159 201 201 SER SER A . n 
A 1 160 ARG 160 202 202 ARG ARG A . n 
A 1 161 LYS 161 203 203 LYS LYS A . n 
A 1 162 PRO 162 204 204 PRO PRO A . n 
A 1 163 LEU 163 205 205 LEU LEU A . n 
A 1 164 VAL 164 206 206 VAL VAL A . n 
A 1 165 LEU 165 207 207 LEU LEU A . n 
A 1 166 CYS 166 208 208 CYS CYS A . n 
A 1 167 GLY 167 209 209 GLY GLY A . n 
A 1 168 ASP 168 210 210 ASP ASP A . n 
A 1 169 LEU 169 211 211 LEU LEU A . n 
A 1 170 ASN 170 212 212 ASN ASN A . n 
A 1 171 VAL 171 213 213 VAL VAL A . n 
A 1 172 ALA 172 214 214 ALA ALA A . n 
A 1 173 HIS 173 215 215 HIS HIS A . n 
A 1 174 GLU 174 216 216 GLU GLU A . n 
A 1 175 GLU 175 217 217 GLU GLU A . n 
A 1 176 ILE 176 218 218 ILE ILE A . n 
A 1 177 ASP 177 219 219 ASP ASP A . n 
A 1 178 LEU 178 220 220 LEU LEU A . n 
A 1 179 ARG 179 221 221 ARG ARG A . n 
A 1 180 ASN 180 222 222 ASN ASN A . n 
A 1 181 PRO 181 223 223 PRO PRO A . n 
A 1 182 LYS 182 224 224 LYS LYS A . n 
A 1 183 GLY 183 225 225 GLY GLY A . n 
A 1 184 ASN 184 226 226 ASN ASN A . n 
A 1 185 LYS 185 227 227 LYS LYS A . n 
A 1 186 LYS 186 228 228 LYS LYS A . n 
A 1 187 ASN 187 229 229 ASN ASN A . n 
A 1 188 ALA 188 230 230 ALA ALA A . n 
A 1 189 GLY 189 231 231 GLY GLY A . n 
A 1 190 PHE 190 232 232 PHE PHE A . n 
A 1 191 THR 191 233 233 THR THR A . n 
A 1 192 PRO 192 234 234 PRO PRO A . n 
A 1 193 GLN 193 235 235 GLN GLN A . n 
A 1 194 GLU 194 236 236 GLU GLU A . n 
A 1 195 ARG 195 237 237 ARG ARG A . n 
A 1 196 GLN 196 238 238 GLN GLN A . n 
A 1 197 GLY 197 239 239 GLY GLY A . n 
A 1 198 PHE 198 240 240 PHE PHE A . n 
A 1 199 GLY 199 241 241 GLY GLY A . n 
A 1 200 GLU 200 242 242 GLU GLU A . n 
A 1 201 LEU 201 243 243 LEU LEU A . n 
A 1 202 LEU 202 244 244 LEU LEU A . n 
A 1 203 GLN 203 245 245 GLN GLN A . n 
A 1 204 ALA 204 246 246 ALA ALA A . n 
A 1 205 VAL 205 247 247 VAL VAL A . n 
A 1 206 PRO 206 248 248 PRO PRO A . n 
A 1 207 LEU 207 249 249 LEU LEU A . n 
A 1 208 ALA 208 250 250 ALA ALA A . n 
A 1 209 ASP 209 251 251 ASP ASP A . n 
A 1 210 SER 210 252 252 SER SER A . n 
A 1 211 PHE 211 253 253 PHE PHE A . n 
A 1 212 ARG 212 254 254 ARG ARG A . n 
A 1 213 HIS 213 255 255 HIS HIS A . n 
A 1 214 LEU 214 256 256 LEU LEU A . n 
A 1 215 TYR 215 257 257 TYR TYR A . n 
A 1 216 PRO 216 258 258 PRO PRO A . n 
A 1 217 ASN 217 259 259 ASN ASN A . n 
A 1 218 THR 218 260 260 THR THR A . n 
A 1 219 PRO 219 261 261 PRO PRO A . n 
A 1 220 TYR 220 262 262 TYR TYR A . n 
A 1 221 ALA 221 263 263 ALA ALA A . n 
A 1 222 TYR 222 264 264 TYR TYR A . n 
A 1 223 THR 223 265 265 THR THR A . n 
A 1 224 PHE 224 266 266 PHE PHE A . n 
A 1 225 TRP 225 267 267 TRP TRP A . n 
A 1 226 THR 226 268 268 THR THR A . n 
A 1 227 TYR 227 269 269 TYR TYR A . n 
A 1 228 MET 228 270 270 MET MET A . n 
A 1 229 MET 229 271 271 MET MET A . n 
A 1 230 ASN 230 272 272 ASN ASN A . n 
A 1 231 ALA 231 273 273 ALA ALA A . n 
A 1 232 ARG 232 274 274 ARG ARG A . n 
A 1 233 SER 233 275 275 SER SER A . n 
A 1 234 LYS 234 276 276 LYS LYS A . n 
A 1 235 ASN 235 277 277 ASN ASN A . n 
A 1 236 VAL 236 278 278 VAL VAL A . n 
A 1 237 GLY 237 279 279 GLY GLY A . n 
A 1 238 TRP 238 280 280 TRP TRP A . n 
A 1 239 ARG 239 281 281 ARG ARG A . n 
A 1 240 LEU 240 282 282 LEU LEU A . n 
A 1 241 ASP 241 283 283 ASP ASP A . n 
A 1 242 TYR 242 284 284 TYR TYR A . n 
A 1 243 PHE 243 285 285 PHE PHE A . n 
A 1 244 LEU 244 286 286 LEU LEU A . n 
A 1 245 LEU 245 287 287 LEU LEU A . n 
A 1 246 SER 246 288 288 SER SER A . n 
A 1 247 HIS 247 289 289 HIS HIS A . n 
A 1 248 SER 248 290 290 SER SER A . n 
A 1 249 LEU 249 291 291 LEU LEU A . n 
A 1 250 LEU 250 292 292 LEU LEU A . n 
A 1 251 PRO 251 293 293 PRO PRO A . n 
A 1 252 ALA 252 294 294 ALA ALA A . n 
A 1 253 LEU 253 295 295 LEU LEU A . n 
A 1 254 CYS 254 296 296 CYS CYS A . n 
A 1 255 ASP 255 297 297 ASP ASP A . n 
A 1 256 SER 256 298 298 SER SER A . n 
A 1 257 LYS 257 299 299 LYS LYS A . n 
A 1 258 ILE 258 300 300 ILE ILE A . n 
A 1 259 ARG 259 301 301 ARG ARG A . n 
A 1 260 SER 260 302 302 SER SER A . n 
A 1 261 LYS 261 303 303 LYS LYS A . n 
A 1 262 ALA 262 304 304 ALA ALA A . n 
A 1 263 LEU 263 305 305 LEU LEU A . n 
A 1 264 GLY 264 306 306 GLY GLY A . n 
A 1 265 SER 265 307 307 SER SER A . n 
A 1 266 ASP 266 308 308 ASP ASP A . n 
A 1 267 HIS 267 309 309 HIS HIS A . n 
A 1 268 CYS 268 310 310 CYS CYS A . n 
A 1 269 PRO 269 311 311 PRO PRO A . n 
A 1 270 ILE 270 312 312 ILE ILE A . n 
A 1 271 THR 271 313 313 THR THR A . n 
A 1 272 LEU 272 314 314 LEU LEU A . n 
A 1 273 TYR 273 315 315 TYR TYR A . n 
A 1 274 LEU 274 316 316 LEU LEU A . n 
A 1 275 ALA 275 317 317 ALA ALA A . n 
A 1 276 LEU 276 318 318 LEU LEU A . n 
B 1 1   ALA 1   43  ?   ?   ?   B . n 
B 1 2   LEU 2   44  44  LEU LEU B . n 
B 1 3   TYR 3   45  45  TYR TYR B . n 
B 1 4   GLU 4   46  46  GLU GLU B . n 
B 1 5   ASP 5   47  47  ASP ASP B . n 
B 1 6   PRO 6   48  48  PRO PRO B . n 
B 1 7   PRO 7   49  49  PRO PRO B . n 
B 1 8   ASP 8   50  50  ASP ASP B . n 
B 1 9   GLN 9   51  51  GLN GLN B . n 
B 1 10  LYS 10  52  52  LYS LYS B . n 
B 1 11  THR 11  53  53  THR THR B . n 
B 1 12  SER 12  54  54  SER SER B . n 
B 1 13  PRO 13  55  55  PRO PRO B . n 
B 1 14  SER 14  56  56  SER SER B . n 
B 1 15  GLY 15  57  57  GLY GLY B . n 
B 1 16  LYS 16  58  58  LYS LYS B . n 
B 1 17  PRO 17  59  59  PRO PRO B . n 
B 1 18  ALA 18  60  60  ALA ALA B . n 
B 1 19  THR 19  61  61  THR THR B . n 
B 1 20  LEU 20  62  62  LEU LEU B . n 
B 1 21  LYS 21  63  63  LYS LYS B . n 
B 1 22  ILE 22  64  64  ILE ILE B . n 
B 1 23  CYS 23  65  65  CYS CYS B . n 
B 1 24  SER 24  66  66  SER SER B . n 
B 1 25  TRP 25  67  67  TRP TRP B . n 
B 1 26  ASN 26  68  68  ASN ASN B . n 
B 1 27  VAL 27  69  69  VAL VAL B . n 
B 1 28  ASP 28  70  70  ASP ASP B . n 
B 1 29  GLY 29  71  71  GLY GLY B . n 
B 1 30  LEU 30  72  72  LEU LEU B . n 
B 1 31  ARG 31  73  73  ARG ARG B . n 
B 1 32  ALA 32  74  74  ALA ALA B . n 
B 1 33  TRP 33  75  75  TRP TRP B . n 
B 1 34  ILE 34  76  76  ILE ILE B . n 
B 1 35  LYS 35  77  77  LYS LYS B . n 
B 1 36  LYS 36  78  78  LYS LYS B . n 
B 1 37  LYS 37  79  79  LYS LYS B . n 
B 1 38  GLY 38  80  80  GLY GLY B . n 
B 1 39  LEU 39  81  81  LEU LEU B . n 
B 1 40  ASP 40  82  82  ASP ASP B . n 
B 1 41  TRP 41  83  83  TRP TRP B . n 
B 1 42  VAL 42  84  84  VAL VAL B . n 
B 1 43  LYS 43  85  85  LYS LYS B . n 
B 1 44  GLU 44  86  86  GLU GLU B . n 
B 1 45  GLU 45  87  87  GLU GLU B . n 
B 1 46  ALA 46  88  88  ALA ALA B . n 
B 1 47  PRO 47  89  89  PRO PRO B . n 
B 1 48  ASP 48  90  90  ASP ASP B . n 
B 1 49  ILE 49  91  91  ILE ILE B . n 
B 1 50  LEU 50  92  92  LEU LEU B . n 
B 1 51  CYS 51  93  93  CYS CYS B . n 
B 1 52  LEU 52  94  94  LEU LEU B . n 
B 1 53  GLN 53  95  95  GLN GLN B . n 
B 1 54  GLU 54  96  96  GLU GLU B . n 
B 1 55  THR 55  97  97  THR THR B . n 
B 1 56  LYS 56  98  98  LYS LYS B . n 
B 1 57  CYS 57  99  99  CYS CYS B . n 
B 1 58  SER 58  100 100 SER SER B . n 
B 1 59  GLU 59  101 101 GLU GLU B . n 
B 1 60  ASN 60  102 102 ASN ASN B . n 
B 1 61  LYS 61  103 103 LYS LYS B . n 
B 1 62  LEU 62  104 104 LEU LEU B . n 
B 1 63  PRO 63  105 105 PRO PRO B . n 
B 1 64  ALA 64  106 106 ALA ALA B . n 
B 1 65  GLU 65  107 107 GLU GLU B . n 
B 1 66  LEU 66  108 108 LEU LEU B . n 
B 1 67  GLN 67  109 109 GLN GLN B . n 
B 1 68  GLU 68  110 110 GLU GLU B . n 
B 1 69  LEU 69  111 111 LEU LEU B . n 
B 1 70  PRO 70  112 112 PRO PRO B . n 
B 1 71  GLY 71  113 113 GLY GLY B . n 
B 1 72  LEU 72  114 114 LEU LEU B . n 
B 1 73  SER 73  115 115 SER SER B . n 
B 1 74  HIS 74  116 116 HIS HIS B . n 
B 1 75  GLN 75  117 117 GLN GLN B . n 
B 1 76  TYR 76  118 118 TYR TYR B . n 
B 1 77  TRP 77  119 119 TRP TRP B . n 
B 1 78  SER 78  120 120 SER SER B . n 
B 1 79  ALA 79  121 121 ALA ALA B . n 
B 1 80  PRO 80  122 122 PRO PRO B . n 
B 1 81  SER 81  123 123 SER SER B . n 
B 1 82  ASP 82  124 124 ASP ASP B . n 
B 1 83  LYS 83  125 125 LYS LYS B . n 
B 1 84  GLU 84  126 126 GLU GLU B . n 
B 1 85  GLY 85  127 127 GLY GLY B . n 
B 1 86  TYR 86  128 128 TYR TYR B . n 
B 1 87  SER 87  129 129 SER SER B . n 
B 1 88  GLY 88  130 130 GLY GLY B . n 
B 1 89  VAL 89  131 131 VAL VAL B . n 
B 1 90  GLY 90  132 132 GLY GLY B . n 
B 1 91  LEU 91  133 133 LEU LEU B . n 
B 1 92  LEU 92  134 134 LEU LEU B . n 
B 1 93  SER 93  135 135 SER SER B . n 
B 1 94  ARG 94  136 136 ARG ARG B . n 
B 1 95  GLN 95  137 137 GLN GLN B . n 
B 1 96  ALA 96  138 138 ALA ALA B . n 
B 1 97  PRO 97  139 139 PRO PRO B . n 
B 1 98  LEU 98  140 140 LEU LEU B . n 
B 1 99  LYS 99  141 141 LYS LYS B . n 
B 1 100 VAL 100 142 142 VAL VAL B . n 
B 1 101 SER 101 143 143 SER SER B . n 
B 1 102 TYR 102 144 144 TYR TYR B . n 
B 1 103 GLY 103 145 145 GLY GLY B . n 
B 1 104 ILE 104 146 146 ILE ILE B . n 
B 1 105 GLY 105 147 147 GLY GLY B . n 
B 1 106 ASP 106 148 148 ASP ASP B . n 
B 1 107 GLU 107 149 149 GLU GLU B . n 
B 1 108 GLU 108 150 150 GLU GLU B . n 
B 1 109 HIS 109 151 151 HIS HIS B . n 
B 1 110 ASP 110 152 152 ASP ASP B . n 
B 1 111 GLN 111 153 153 GLN GLN B . n 
B 1 112 GLU 112 154 154 GLU GLU B . n 
B 1 113 GLY 113 155 155 GLY GLY B . n 
B 1 114 ARG 114 156 156 ARG ARG B . n 
B 1 115 VAL 115 157 157 VAL VAL B . n 
B 1 116 ILE 116 158 158 ILE ILE B . n 
B 1 117 VAL 117 159 159 VAL VAL B . n 
B 1 118 ALA 118 160 160 ALA ALA B . n 
B 1 119 GLU 119 161 161 GLU GLU B . n 
B 1 120 PHE 120 162 162 PHE PHE B . n 
B 1 121 ASP 121 163 163 ASP ASP B . n 
B 1 122 SER 122 164 164 SER SER B . n 
B 1 123 PHE 123 165 165 PHE PHE B . n 
B 1 124 VAL 124 166 166 VAL VAL B . n 
B 1 125 LEU 125 167 167 LEU LEU B . n 
B 1 126 VAL 126 168 168 VAL VAL B . n 
B 1 127 THR 127 169 169 THR THR B . n 
B 1 128 ALA 128 170 170 ALA ALA B . n 
B 1 129 TYR 129 171 171 TYR TYR B . n 
B 1 130 VAL 130 172 172 VAL VAL B . n 
B 1 131 PRO 131 173 173 PRO PRO B . n 
B 1 132 ASN 132 174 174 ASN ASN B . n 
B 1 133 ALA 133 175 175 ALA ALA B . n 
B 1 134 GLY 134 176 176 GLY GLY B . n 
B 1 135 ARG 135 177 177 ARG ARG B . n 
B 1 136 GLY 136 178 178 GLY GLY B . n 
B 1 137 LEU 137 179 179 LEU LEU B . n 
B 1 138 VAL 138 180 180 VAL VAL B . n 
B 1 139 ARG 139 181 181 ARG ARG B . n 
B 1 140 LEU 140 182 182 LEU LEU B . n 
B 1 141 GLU 141 183 183 GLU GLU B . n 
B 1 142 TYR 142 184 184 TYR TYR B . n 
B 1 143 ARG 143 185 185 ARG ARG B . n 
B 1 144 GLN 144 186 186 GLN GLN B . n 
B 1 145 ARG 145 187 187 ARG ARG B . n 
B 1 146 TRP 146 188 188 TRP TRP B . n 
B 1 147 ASP 147 189 189 ASP ASP B . n 
B 1 148 GLU 148 190 190 GLU GLU B . n 
B 1 149 ALA 149 191 191 ALA ALA B . n 
B 1 150 PHE 150 192 192 PHE PHE B . n 
B 1 151 ARG 151 193 193 ARG ARG B . n 
B 1 152 LYS 152 194 194 LYS LYS B . n 
B 1 153 PHE 153 195 195 PHE PHE B . n 
B 1 154 LEU 154 196 196 LEU LEU B . n 
B 1 155 LYS 155 197 197 LYS LYS B . n 
B 1 156 GLY 156 198 198 GLY GLY B . n 
B 1 157 LEU 157 199 199 LEU LEU B . n 
B 1 158 ALA 158 200 200 ALA ALA B . n 
B 1 159 SER 159 201 201 SER SER B . n 
B 1 160 ARG 160 202 202 ARG ARG B . n 
B 1 161 LYS 161 203 203 LYS LYS B . n 
B 1 162 PRO 162 204 204 PRO PRO B . n 
B 1 163 LEU 163 205 205 LEU LEU B . n 
B 1 164 VAL 164 206 206 VAL VAL B . n 
B 1 165 LEU 165 207 207 LEU LEU B . n 
B 1 166 CYS 166 208 208 CYS CYS B . n 
B 1 167 GLY 167 209 209 GLY GLY B . n 
B 1 168 ASP 168 210 210 ASP ASP B . n 
B 1 169 LEU 169 211 211 LEU LEU B . n 
B 1 170 ASN 170 212 212 ASN ASN B . n 
B 1 171 VAL 171 213 213 VAL VAL B . n 
B 1 172 ALA 172 214 214 ALA ALA B . n 
B 1 173 HIS 173 215 215 HIS HIS B . n 
B 1 174 GLU 174 216 216 GLU GLU B . n 
B 1 175 GLU 175 217 217 GLU GLU B . n 
B 1 176 ILE 176 218 218 ILE ILE B . n 
B 1 177 ASP 177 219 219 ASP ASP B . n 
B 1 178 LEU 178 220 220 LEU LEU B . n 
B 1 179 ARG 179 221 221 ARG ARG B . n 
B 1 180 ASN 180 222 222 ASN ASN B . n 
B 1 181 PRO 181 223 223 PRO PRO B . n 
B 1 182 LYS 182 224 224 LYS LYS B . n 
B 1 183 GLY 183 225 225 GLY GLY B . n 
B 1 184 ASN 184 226 226 ASN ASN B . n 
B 1 185 LYS 185 227 227 LYS LYS B . n 
B 1 186 LYS 186 228 228 LYS LYS B . n 
B 1 187 ASN 187 229 229 ASN ASN B . n 
B 1 188 ALA 188 230 230 ALA ALA B . n 
B 1 189 GLY 189 231 231 GLY GLY B . n 
B 1 190 PHE 190 232 232 PHE PHE B . n 
B 1 191 THR 191 233 233 THR THR B . n 
B 1 192 PRO 192 234 234 PRO PRO B . n 
B 1 193 GLN 193 235 235 GLN GLN B . n 
B 1 194 GLU 194 236 236 GLU GLU B . n 
B 1 195 ARG 195 237 237 ARG ARG B . n 
B 1 196 GLN 196 238 238 GLN GLN B . n 
B 1 197 GLY 197 239 239 GLY GLY B . n 
B 1 198 PHE 198 240 240 PHE PHE B . n 
B 1 199 GLY 199 241 241 GLY GLY B . n 
B 1 200 GLU 200 242 242 GLU GLU B . n 
B 1 201 LEU 201 243 243 LEU LEU B . n 
B 1 202 LEU 202 244 244 LEU LEU B . n 
B 1 203 GLN 203 245 245 GLN GLN B . n 
B 1 204 ALA 204 246 246 ALA ALA B . n 
B 1 205 VAL 205 247 247 VAL VAL B . n 
B 1 206 PRO 206 248 248 PRO PRO B . n 
B 1 207 LEU 207 249 249 LEU LEU B . n 
B 1 208 ALA 208 250 250 ALA ALA B . n 
B 1 209 ASP 209 251 251 ASP ASP B . n 
B 1 210 SER 210 252 252 SER SER B . n 
B 1 211 PHE 211 253 253 PHE PHE B . n 
B 1 212 ARG 212 254 254 ARG ARG B . n 
B 1 213 HIS 213 255 255 HIS HIS B . n 
B 1 214 LEU 214 256 256 LEU LEU B . n 
B 1 215 TYR 215 257 257 TYR TYR B . n 
B 1 216 PRO 216 258 258 PRO PRO B . n 
B 1 217 ASN 217 259 259 ASN ASN B . n 
B 1 218 THR 218 260 260 THR THR B . n 
B 1 219 PRO 219 261 ?   ?   ?   B . n 
B 1 220 TYR 220 262 ?   ?   ?   B . n 
B 1 221 ALA 221 263 263 ALA ALA B . n 
B 1 222 TYR 222 264 264 TYR TYR B . n 
B 1 223 THR 223 265 265 THR THR B . n 
B 1 224 PHE 224 266 266 PHE PHE B . n 
B 1 225 TRP 225 267 267 TRP TRP B . n 
B 1 226 THR 226 268 268 THR THR B . n 
B 1 227 TYR 227 269 269 TYR TYR B . n 
B 1 228 MET 228 270 270 MET MET B . n 
B 1 229 MET 229 271 271 MET MET B . n 
B 1 230 ASN 230 272 272 ASN ASN B . n 
B 1 231 ALA 231 273 273 ALA ALA B . n 
B 1 232 ARG 232 274 274 ARG ARG B . n 
B 1 233 SER 233 275 275 SER SER B . n 
B 1 234 LYS 234 276 276 LYS LYS B . n 
B 1 235 ASN 235 277 277 ASN ASN B . n 
B 1 236 VAL 236 278 278 VAL VAL B . n 
B 1 237 GLY 237 279 279 GLY GLY B . n 
B 1 238 TRP 238 280 280 TRP TRP B . n 
B 1 239 ARG 239 281 281 ARG ARG B . n 
B 1 240 LEU 240 282 282 LEU LEU B . n 
B 1 241 ASP 241 283 283 ASP ASP B . n 
B 1 242 TYR 242 284 284 TYR TYR B . n 
B 1 243 PHE 243 285 285 PHE PHE B . n 
B 1 244 LEU 244 286 286 LEU LEU B . n 
B 1 245 LEU 245 287 287 LEU LEU B . n 
B 1 246 SER 246 288 288 SER SER B . n 
B 1 247 HIS 247 289 289 HIS HIS B . n 
B 1 248 SER 248 290 290 SER SER B . n 
B 1 249 LEU 249 291 291 LEU LEU B . n 
B 1 250 LEU 250 292 292 LEU LEU B . n 
B 1 251 PRO 251 293 293 PRO PRO B . n 
B 1 252 ALA 252 294 294 ALA ALA B . n 
B 1 253 LEU 253 295 295 LEU LEU B . n 
B 1 254 CYS 254 296 296 CYS CYS B . n 
B 1 255 ASP 255 297 297 ASP ASP B . n 
B 1 256 SER 256 298 298 SER SER B . n 
B 1 257 LYS 257 299 299 LYS LYS B . n 
B 1 258 ILE 258 300 300 ILE ILE B . n 
B 1 259 ARG 259 301 301 ARG ARG B . n 
B 1 260 SER 260 302 302 SER SER B . n 
B 1 261 LYS 261 303 303 LYS LYS B . n 
B 1 262 ALA 262 304 304 ALA ALA B . n 
B 1 263 LEU 263 305 305 LEU LEU B . n 
B 1 264 GLY 264 306 306 GLY GLY B . n 
B 1 265 SER 265 307 307 SER SER B . n 
B 1 266 ASP 266 308 308 ASP ASP B . n 
B 1 267 HIS 267 309 309 HIS HIS B . n 
B 1 268 CYS 268 310 310 CYS CYS B . n 
B 1 269 PRO 269 311 311 PRO PRO B . n 
B 1 270 ILE 270 312 312 ILE ILE B . n 
B 1 271 THR 271 313 313 THR THR B . n 
B 1 272 LEU 272 314 314 LEU LEU B . n 
B 1 273 TYR 273 315 315 TYR TYR B . n 
B 1 274 LEU 274 316 316 LEU LEU B . n 
B 1 275 ALA 275 317 317 ALA ALA B . n 
B 1 276 LEU 276 318 318 LEU LEU B . n 
C 2 1   DT  1   1   1   DT  DT  C . n 
C 2 2   DC  2   2   2   DC  DC  C . n 
C 2 3   DG  3   3   3   DG  DG  C . n 
C 2 4   DA  4   4   4   DA  DA  C . n 
C 2 5   DC  5   5   5   DC  DC  C . n 
C 2 6   DG  6   6   6   DG  DG  C . n 
C 2 7   DG  7   7   7   DG  DG  C . n 
C 2 8   DA  8   8   8   DA  DA  C . n 
C 2 9   DT  9   9   9   DT  DT  C . n 
C 2 10  DC  10  10  10  DC  DC  C . n 
C 2 11  DC  11  11  11  DC  DC  C . n 
D 3 1   DG  1   1   1   DG  DG  D . n 
D 3 2   DC  2   2   2   DC  DC  D . n 
D 3 3   DT  3   3   3   DT  DT  D . n 
D 3 4   DG  4   4   4   DG  DG  D . n 
D 3 5   DA  5   5   5   DA  DA  D . n 
D 3 6   DT  6   6   6   DT  DT  D . n 
D 3 7   DG  7   7   7   DG  DG  D . n 
D 3 8   DC  8   8   8   DC  DC  D . n 
D 3 9   DG  9   9   9   DG  DG  D . n 
D 3 10  DC  10  10  10  DC  DC  D . n 
E 4 1   DG  1   1   1   DG  DG  E . n 
E 4 2   DG  2   2   2   DG  DG  E . n 
E 4 3   DA  3   3   3   DA  DA  E . n 
E 4 4   DT  4   4   4   DT  DT  E . n 
E 4 5   DC  5   5   5   DC  DC  E . n 
E 4 6   DC  6   6   6   DC  DC  E . n 
E 4 7   DG  7   7   7   DG  DG  E . n 
E 4 8   DT  8   8   8   DT  DT  E . n 
E 4 9   DC  9   9   9   DC  DC  E . n 
E 4 10  DG  10  10  10  DG  DG  E . n 
E 4 11  DA  11  11  11  DA  DA  E . n 
E 4 12  DG  12  12  12  DG  DG  E . n 
E 4 13  DC  13  13  13  DC  DC  E . n 
E 4 14  DG  14  14  14  DG  DG  E . n 
E 4 15  DC  15  15  15  DC  DC  E . n 
E 4 16  DA  16  16  16  DA  DA  E . n 
E 4 17  DT  17  17  17  DT  DT  E . n 
E 4 18  DC  18  18  18  DC  DC  E . n 
E 4 19  DA  19  19  19  DA  DA  E . n 
E 4 20  DG  20  20  20  DG  DG  E . n 
E 4 21  DC  21  21  21  DC  DC  E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 5 HOH 1  401 86 HOH HOH A . 
F 5 HOH 2  402 39 HOH HOH A . 
F 5 HOH 3  403 70 HOH HOH A . 
F 5 HOH 4  404 28 HOH HOH A . 
F 5 HOH 5  405 43 HOH HOH A . 
F 5 HOH 6  406 8  HOH HOH A . 
F 5 HOH 7  407 23 HOH HOH A . 
F 5 HOH 8  408 4  HOH HOH A . 
F 5 HOH 9  409 25 HOH HOH A . 
F 5 HOH 10 410 7  HOH HOH A . 
F 5 HOH 11 411 17 HOH HOH A . 
F 5 HOH 12 412 48 HOH HOH A . 
F 5 HOH 13 413 6  HOH HOH A . 
F 5 HOH 14 414 21 HOH HOH A . 
F 5 HOH 15 415 36 HOH HOH A . 
F 5 HOH 16 416 67 HOH HOH A . 
F 5 HOH 17 417 59 HOH HOH A . 
F 5 HOH 18 418 69 HOH HOH A . 
F 5 HOH 19 419 92 HOH HOH A . 
F 5 HOH 20 420 30 HOH HOH A . 
F 5 HOH 21 421 64 HOH HOH A . 
F 5 HOH 22 422 29 HOH HOH A . 
F 5 HOH 23 423 79 HOH HOH A . 
F 5 HOH 24 424 37 HOH HOH A . 
F 5 HOH 25 425 11 HOH HOH A . 
F 5 HOH 26 426 85 HOH HOH A . 
F 5 HOH 27 427 71 HOH HOH A . 
F 5 HOH 28 428 20 HOH HOH A . 
F 5 HOH 29 429 44 HOH HOH A . 
F 5 HOH 30 430 73 HOH HOH A . 
F 5 HOH 31 431 74 HOH HOH A . 
F 5 HOH 32 432 88 HOH HOH A . 
F 5 HOH 33 433 51 HOH HOH A . 
F 5 HOH 34 434 22 HOH HOH A . 
F 5 HOH 35 435 93 HOH HOH A . 
F 5 HOH 36 436 89 HOH HOH A . 
F 5 HOH 37 437 49 HOH HOH A . 
F 5 HOH 38 438 77 HOH HOH A . 
F 5 HOH 39 439 45 HOH HOH A . 
F 5 HOH 40 440 90 HOH HOH A . 
G 5 HOH 1  401 35 HOH HOH B . 
G 5 HOH 2  402 2  HOH HOH B . 
G 5 HOH 3  403 75 HOH HOH B . 
G 5 HOH 4  404 12 HOH HOH B . 
G 5 HOH 5  405 94 HOH HOH B . 
G 5 HOH 6  406 32 HOH HOH B . 
G 5 HOH 7  407 26 HOH HOH B . 
G 5 HOH 8  408 82 HOH HOH B . 
G 5 HOH 9  409 56 HOH HOH B . 
G 5 HOH 10 410 57 HOH HOH B . 
G 5 HOH 11 411 40 HOH HOH B . 
G 5 HOH 12 412 46 HOH HOH B . 
G 5 HOH 13 413 53 HOH HOH B . 
G 5 HOH 14 414 76 HOH HOH B . 
G 5 HOH 15 415 81 HOH HOH B . 
G 5 HOH 16 416 58 HOH HOH B . 
H 5 HOH 1  101 54 HOH HOH D . 
H 5 HOH 2  102 84 HOH HOH D . 
H 5 HOH 3  103 34 HOH HOH D . 
H 5 HOH 4  104 1  HOH HOH D . 
H 5 HOH 5  105 50 HOH HOH D . 
I 5 HOH 1  101 55 HOH HOH E . 
I 5 HOH 2  102 83 HOH HOH E . 
I 5 HOH 3  103 62 HOH HOH E . 
I 5 HOH 4  104 19 HOH HOH E . 
I 5 HOH 5  105 72 HOH HOH E . 
I 5 HOH 6  106 33 HOH HOH E . 
I 5 HOH 7  107 31 HOH HOH E . 
I 5 HOH 8  108 42 HOH HOH E . 
I 5 HOH 9  109 80 HOH HOH E . 
I 5 HOH 10 110 87 HOH HOH E . 
I 5 HOH 11 111 68 HOH HOH E . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 author_and_software_defined_assembly PISA monomeric  1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,H,I 
2 1 B,G           
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4380  ? 
1 MORE         -25   ? 
1 'SSA (A^2)'  17640 ? 
2 'ABSA (A^2)' 0     ? 
2 MORE         0     ? 
2 'SSA (A^2)'  12290 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2018-02-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .         1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.10_2155 2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22      3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .         4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .         5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OH  B TYR 45  ? ? OD2 B ASP 47  ? ? 1.67 
2 1 N   A ILE 146 ? ? OD1 A ASP 152 ? ? 2.11 
3 1 OG1 B THR 233 ? ? OE1 B GLU 236 ? ? 2.12 
4 1 OP2 D DT  6   ? ? O   D HOH 101 ? ? 2.14 
5 1 OD1 B ASN 272 ? ? O   B HOH 401 ? ? 2.14 
6 1 OD2 B ASP 251 ? ? NH2 B ARG 281 ? ? 2.16 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C     B VAL 247 ? ? N     B PRO 248 ? ? CD B PRO 248 ? ? 136.10 120.60 15.50 2.20 Y 
2 1 "O4'" C DT  1   ? ? "C1'" C DT  1   ? ? N1 C DT  1   ? ? 110.16 108.30 1.86  0.30 N 
3 1 "O4'" C DG  3   ? ? "C1'" C DG  3   ? ? N9 C DG  3   ? ? 110.55 108.30 2.25  0.30 N 
4 1 "O4'" E DA  3   ? ? "C1'" E DA  3   ? ? N9 E DA  3   ? ? 110.16 108.30 1.86  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 70  ? ? 39.91   62.81   
2  1 GLU A 110 ? ? -77.83  27.34   
3  1 LEU A 114 ? ? -145.16 57.18   
4  1 SER A 129 ? ? 58.44   -145.16 
5  1 ASP A 152 ? ? -102.70 40.87   
6  1 LEU A 199 ? ? -145.79 -38.00  
7  1 ASN A 259 ? ? -140.64 27.89   
8  1 SER A 290 ? ? -64.44  0.85    
9  1 SER A 290 ? ? -65.25  0.85    
10 1 PRO B 49  ? ? -52.15  170.98  
11 1 CYS B 99  ? ? -171.71 121.94  
12 1 GLU B 107 ? ? -55.58  -5.25   
13 1 LEU B 111 ? ? -119.40 78.71   
14 1 SER B 123 ? ? -98.96  -83.71  
15 1 LYS B 125 ? ? -67.42  95.81   
16 1 SER B 129 ? ? 48.66   -145.75 
17 1 ASP B 148 ? ? -85.70  49.78   
18 1 ASP B 152 ? ? -179.01 143.14  
19 1 ARG B 181 ? ? -95.55  34.37   
20 1 LYS B 224 ? ? -51.47  -70.97  
21 1 PHE B 232 ? ? -141.69 20.65   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 86  ? CG  ? A GLU 44  CG  
2  1 Y 1 A GLU 86  ? CD  ? A GLU 44  CD  
3  1 Y 1 A GLU 86  ? OE1 ? A GLU 44  OE1 
4  1 Y 1 A GLU 86  ? OE2 ? A GLU 44  OE2 
5  1 Y 1 A ASP 124 ? CG  ? A ASP 82  CG  
6  1 Y 1 A ASP 124 ? OD1 ? A ASP 82  OD1 
7  1 Y 1 A ASP 124 ? OD2 ? A ASP 82  OD2 
8  1 Y 1 A LYS 125 ? CG  ? A LYS 83  CG  
9  1 Y 1 A LYS 125 ? CD  ? A LYS 83  CD  
10 1 Y 1 A LYS 125 ? CE  ? A LYS 83  CE  
11 1 Y 1 A LYS 125 ? NZ  ? A LYS 83  NZ  
12 1 Y 1 A ASP 148 ? CG  ? A ASP 106 CG  
13 1 Y 1 A ASP 148 ? OD1 ? A ASP 106 OD1 
14 1 Y 1 A ASP 148 ? OD2 ? A ASP 106 OD2 
15 1 Y 1 A GLU 149 ? CG  ? A GLU 107 CG  
16 1 Y 1 A GLU 149 ? CD  ? A GLU 107 CD  
17 1 Y 1 A GLU 149 ? OE1 ? A GLU 107 OE1 
18 1 Y 1 A GLU 149 ? OE2 ? A GLU 107 OE2 
19 1 Y 1 A GLU 150 ? CG  ? A GLU 108 CG  
20 1 Y 1 A GLU 150 ? CD  ? A GLU 108 CD  
21 1 Y 1 A GLU 150 ? OE1 ? A GLU 108 OE1 
22 1 Y 1 A GLU 150 ? OE2 ? A GLU 108 OE2 
23 1 Y 1 A GLN 153 ? CG  ? A GLN 111 CG  
24 1 Y 1 A GLN 153 ? CD  ? A GLN 111 CD  
25 1 Y 1 A GLN 153 ? OE1 ? A GLN 111 OE1 
26 1 Y 1 A GLN 153 ? NE2 ? A GLN 111 NE2 
27 1 Y 1 A LYS 194 ? CG  ? A LYS 152 CG  
28 1 Y 1 A LYS 194 ? CD  ? A LYS 152 CD  
29 1 Y 1 A LYS 194 ? CE  ? A LYS 152 CE  
30 1 Y 1 A LYS 194 ? NZ  ? A LYS 152 NZ  
31 1 Y 1 A LYS 224 ? CG  ? A LYS 182 CG  
32 1 Y 1 A LYS 224 ? CD  ? A LYS 182 CD  
33 1 Y 1 A LYS 224 ? CE  ? A LYS 182 CE  
34 1 Y 1 A LYS 224 ? NZ  ? A LYS 182 NZ  
35 1 Y 1 B GLN 51  ? CD  ? B GLN 9   CD  
36 1 Y 1 B GLN 51  ? OE1 ? B GLN 9   OE1 
37 1 Y 1 B GLN 51  ? NE2 ? B GLN 9   NE2 
38 1 Y 1 B ASP 124 ? CG  ? B ASP 82  CG  
39 1 Y 1 B ASP 124 ? OD1 ? B ASP 82  OD1 
40 1 Y 1 B ASP 124 ? OD2 ? B ASP 82  OD2 
41 1 Y 1 B LYS 125 ? CG  ? B LYS 83  CG  
42 1 Y 1 B LYS 125 ? CD  ? B LYS 83  CD  
43 1 Y 1 B LYS 125 ? CE  ? B LYS 83  CE  
44 1 Y 1 B LYS 125 ? NZ  ? B LYS 83  NZ  
45 1 Y 1 B GLU 126 ? CG  ? B GLU 84  CG  
46 1 Y 1 B GLU 126 ? CD  ? B GLU 84  CD  
47 1 Y 1 B GLU 126 ? OE1 ? B GLU 84  OE1 
48 1 Y 1 B GLU 126 ? OE2 ? B GLU 84  OE2 
49 1 Y 1 B GLU 149 ? CG  ? B GLU 107 CG  
50 1 Y 1 B GLU 149 ? CD  ? B GLU 107 CD  
51 1 Y 1 B GLU 149 ? OE1 ? B GLU 107 OE1 
52 1 Y 1 B GLU 149 ? OE2 ? B GLU 107 OE2 
53 1 Y 1 B GLU 150 ? CG  ? B GLU 108 CG  
54 1 Y 1 B GLU 150 ? CD  ? B GLU 108 CD  
55 1 Y 1 B GLU 150 ? OE1 ? B GLU 108 OE1 
56 1 Y 1 B GLU 150 ? OE2 ? B GLU 108 OE2 
57 1 Y 1 B ASP 152 ? CG  ? B ASP 110 CG  
58 1 Y 1 B ASP 152 ? OD1 ? B ASP 110 OD1 
59 1 Y 1 B ASP 152 ? OD2 ? B ASP 110 OD2 
60 1 Y 1 B GLN 153 ? CG  ? B GLN 111 CG  
61 1 Y 1 B GLN 153 ? CD  ? B GLN 111 CD  
62 1 Y 1 B GLN 153 ? OE1 ? B GLN 111 OE1 
63 1 Y 1 B GLN 153 ? NE2 ? B GLN 111 NE2 
64 1 Y 1 B GLU 154 ? CG  ? B GLU 112 CG  
65 1 Y 1 B GLU 154 ? CD  ? B GLU 112 CD  
66 1 Y 1 B GLU 154 ? OE1 ? B GLU 112 OE1 
67 1 Y 1 B GLU 154 ? OE2 ? B GLU 112 OE2 
68 1 Y 1 B ARG 181 ? CG  ? B ARG 139 CG  
69 1 Y 1 B ARG 181 ? CD  ? B ARG 139 CD  
70 1 Y 1 B ARG 181 ? NE  ? B ARG 139 NE  
71 1 Y 1 B ARG 181 ? CZ  ? B ARG 139 CZ  
72 1 Y 1 B ARG 181 ? NH1 ? B ARG 139 NH1 
73 1 Y 1 B ARG 181 ? NH2 ? B ARG 139 NH2 
74 1 Y 1 B ARG 187 ? CG  ? B ARG 145 CG  
75 1 Y 1 B ARG 187 ? CD  ? B ARG 145 CD  
76 1 Y 1 B ARG 187 ? NE  ? B ARG 145 NE  
77 1 Y 1 B ARG 187 ? CZ  ? B ARG 145 CZ  
78 1 Y 1 B ARG 187 ? NH1 ? B ARG 145 NH1 
79 1 Y 1 B ARG 187 ? NH2 ? B ARG 145 NH2 
80 1 Y 1 B LYS 224 ? CG  ? B LYS 182 CG  
81 1 Y 1 B LYS 224 ? CD  ? B LYS 182 CD  
82 1 Y 1 B LYS 224 ? CE  ? B LYS 182 CE  
83 1 Y 1 B LYS 224 ? NZ  ? B LYS 182 NZ  
84 1 Y 1 B LYS 228 ? CG  ? B LYS 186 CG  
85 1 Y 1 B LYS 228 ? CD  ? B LYS 186 CD  
86 1 Y 1 B LYS 228 ? CE  ? B LYS 186 CE  
87 1 Y 1 B LYS 228 ? NZ  ? B LYS 186 NZ  
88 1 Y 1 B VAL 247 ? CG1 ? B VAL 205 CG1 
89 1 Y 1 B VAL 247 ? CG2 ? B VAL 205 CG2 
90 1 Y 1 B MET 271 ? CG  ? B MET 229 CG  
91 1 Y 1 B MET 271 ? SD  ? B MET 229 SD  
92 1 Y 1 B MET 271 ? CE  ? B MET 229 CE  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B ALA 43  ? B ALA 1   
2 1 Y 1 B PRO 261 ? B PRO 219 
3 1 Y 1 B TYR 262 ? B TYR 220 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5WN0 'double helix'        
5WN0 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DT 1  1_555 E DA 11 1_555 -1.949 0.067  0.134  -17.893 -12.561 43.912 1  C_DT1:DA11_E  C 1  ? E 11 ? ?  1 
1 C DC 2  1_555 E DG 10 1_555 -0.641 0.627  0.287  -16.780 -15.775 31.971 2  C_DC2:DG10_E  C 2  ? E 10 ? ?  1 
1 C DG 3  1_555 E DC 9  1_555 0.707  -0.098 0.209  -8.280  -17.208 7.518  3  C_DG3:DC9_E   C 3  ? E 9  ? 19 1 
1 C DC 5  1_555 E DG 7  1_555 -1.345 0.231  1.344  -6.661  -30.941 4.789  4  C_DC5:DG7_E   C 5  ? E 7  ? ?  1 
1 C DG 6  1_555 E DC 6  1_555 -1.046 -0.199 0.274  -16.949 -26.805 5.940  5  C_DG6:DC6_E   C 6  ? E 6  ? 19 1 
1 C DG 7  1_555 E DC 5  1_555 -0.644 0.020  0.719  -0.317  9.754   -7.230 6  C_DG7:DC5_E   C 7  ? E 5  ? 19 1 
1 C DA 8  1_555 E DT 4  1_555 -0.714 0.189  -0.129 -4.441  -13.907 7.778  7  C_DA8:DT4_E   C 8  ? E 4  ? 20 1 
1 C DT 9  1_555 E DA 3  1_555 -1.251 -0.309 -0.296 -7.616  -10.805 -7.281 8  C_DT9:DA3_E   C 9  ? E 3  ? 20 1 
1 C DC 10 1_555 E DG 2  1_555 -0.666 -0.157 0.497  -13.789 -2.687  -6.211 9  C_DC10:DG2_E  C 10 ? E 2  ? 19 1 
1 C DC 11 1_555 E DG 1  1_555 -0.279 0.598  0.438  -14.832 1.880   9.820  10 C_DC11:DG1_E  C 11 ? E 1  ? ?  1 
1 D DG 1  1_555 E DC 21 1_555 -0.138 0.304  -0.427 -17.839 -4.307  9.333  11 D_DG1:DC21_E  D 1  ? E 21 ? 19 1 
1 D DC 2  1_555 E DG 20 1_555 -0.126 -0.252 0.484  -4.865  -6.342  -1.525 12 D_DC2:DG20_E  D 2  ? E 20 ? 19 1 
1 D DT 3  1_555 E DA 19 1_555 -0.705 -0.146 0.225  3.684   -12.011 1.535  13 D_DT3:DA19_E  D 3  ? E 19 ? 20 1 
1 D DG 4  1_555 E DC 18 1_555 -0.128 -0.162 -0.491 -3.329  -15.818 4.866  14 D_DG4:DC18_E  D 4  ? E 18 ? 19 1 
1 D DA 5  1_555 E DT 17 1_555 0.518  -0.057 -0.283 -6.279  -5.147  0.871  15 D_DA5:DT17_E  D 5  ? E 17 ? 20 1 
1 D DT 6  1_555 E DA 16 1_555 -0.129 -0.206 -0.082 4.766   -9.248  0.077  16 D_DT6:DA16_E  D 6  ? E 16 ? 20 1 
1 D DG 7  1_555 E DC 15 1_555 -0.109 -0.526 -0.146 -4.014  -3.540  -2.794 17 D_DG7:DC15_E  D 7  ? E 15 ? 19 1 
1 D DC 8  1_555 E DG 14 1_555 -0.025 -0.282 -0.064 -1.219  -8.057  -1.018 18 D_DC8:DG14_E  D 8  ? E 14 ? 19 1 
1 D DG 9  1_555 E DC 13 1_555 0.129  -0.013 0.597  10.481  -2.803  -2.851 19 D_DG9:DC13_E  D 9  ? E 13 ? 19 1 
1 D DC 10 1_555 E DG 12 1_555 0.683  -0.128 -0.103 5.387   -1.265  3.276  20 D_DC10:DG12_E D 10 ? E 12 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DT 1  1_555 E DA 11 1_555 C DC 2  1_555 E DG 10 1_555 -1.103 1.736  3.429 -3.901  -1.819 47.909 2.281  1.031  3.439 -2.235 
4.793   48.091 1  CC_DT1DC2:DG10DA11_EE  C 1  ? E 11 ? C 2  ? E 10 ? 
1 C DC 2  1_555 E DG 10 1_555 C DG 3  1_555 E DC 9  1_555 -0.543 1.488  3.162 -3.910  11.433 39.225 0.828  0.331  3.482 16.559 
5.663   40.973 2  CC_DC2DG3:DC9DG10_EE   C 2  ? E 10 ? C 3  ? E 9  ? 
1 C DG 3  1_555 E DC 9  1_555 C DC 5  1_555 E DG 7  1_555 0.455  -1.248 6.109 -15.738 13.460 56.443 -2.476 -1.889 5.426 13.731 
16.055  59.828 3  CC_DG3DC5:DG7DC9_EE    C 3  ? E 9  ? C 5  ? E 7  ? 
1 C DC 5  1_555 E DG 7  1_555 C DG 6  1_555 E DC 6  1_555 -0.339 0.750  3.746 0.757   7.985  39.448 0.034  0.593  3.813 11.683 
-1.107  40.223 4  CC_DC5DG6:DC6DG7_EE    C 5  ? E 7  ? C 6  ? E 6  ? 
1 C DG 6  1_555 E DC 6  1_555 C DG 7  1_555 E DC 5  1_555 -0.989 -1.395 2.834 -8.340  -4.656 33.042 -1.681 0.458  3.146 -7.980 
14.296  34.358 5  CC_DG6DG7:DC5DC6_EE    C 6  ? E 6  ? C 7  ? E 5  ? 
1 C DG 7  1_555 E DC 5  1_555 C DA 8  1_555 E DT 4  1_555 0.921  -0.512 3.359 0.425   14.074 36.698 -2.452 -1.321 2.983 21.411 
-0.646  39.219 6  CC_DG7DA8:DT4DC5_EE    C 7  ? E 5  ? C 8  ? E 4  ? 
1 C DA 8  1_555 E DT 4  1_555 C DT 9  1_555 E DA 3  1_555 -1.103 -1.256 3.315 -0.396  -0.250 24.990 -2.826 2.428  3.344 -0.578 
0.915   24.994 7  CC_DA8DT9:DA3DT4_EE    C 8  ? E 4  ? C 9  ? E 3  ? 
1 C DT 9  1_555 E DA 3  1_555 C DC 10 1_555 E DG 2  1_555 -0.609 -0.292 3.592 -6.148  -0.330 37.599 -0.402 0.065  3.645 -0.507 
9.461   38.082 8  CC_DT9DC10:DG2DA3_EE   C 9  ? E 3  ? C 10 ? E 2  ? 
1 C DC 10 1_555 E DG 2  1_555 C DC 11 1_555 E DG 1  1_555 1.844  0.774  3.545 4.610   -4.511 39.231 1.717  -2.122 3.623 -6.663 
-6.809  39.737 9  CC_DC10DC11:DG1DG2_EE  C 10 ? E 2  ? C 11 ? E 1  ? 
1 D DG 1  1_555 E DC 21 1_555 D DC 2  1_555 E DG 20 1_555 -1.033 -0.268 3.054 -7.562  2.328  27.707 -1.046 0.431  3.186 4.740  
15.398  28.793 10 DD_DG1DC2:DG20DC21_EE  D 1  ? E 21 ? D 2  ? E 20 ? 
1 D DC 2  1_555 E DG 20 1_555 D DT 3  1_555 E DA 19 1_555 0.127  -0.361 3.026 4.912   4.264  30.033 -1.453 0.648  2.931 8.108  
-9.342  30.713 11 DD_DC2DT3:DA19DG20_EE  D 2  ? E 20 ? D 3  ? E 19 ? 
1 D DT 3  1_555 E DA 19 1_555 D DG 4  1_555 E DC 18 1_555 0.303  0.548  3.477 4.092   14.801 36.086 -1.147 0.091  3.448 22.672 
-6.268  39.117 12 DD_DT3DG4:DC18DA19_EE  D 3  ? E 19 ? D 4  ? E 18 ? 
1 D DG 4  1_555 E DC 18 1_555 D DA 5  1_555 E DT 17 1_555 -0.912 0.018  3.291 -6.118  5.558  38.579 -0.649 0.609  3.362 8.297  
9.133   39.421 13 DD_DG4DA5:DT17DC18_EE  D 4  ? E 18 ? D 5  ? E 17 ? 
1 D DA 5  1_555 E DT 17 1_555 D DT 6  1_555 E DA 16 1_555 0.264  -0.568 2.939 -0.526  1.591  27.018 -1.572 -0.684 2.895 3.400  
1.124   27.069 14 DD_DA5DT6:DA16DT17_EE  D 5  ? E 17 ? D 6  ? E 16 ? 
1 D DT 6  1_555 E DA 16 1_555 D DG 7  1_555 E DC 15 1_555 0.374  -0.474 3.500 1.843   9.246  37.789 -1.898 -0.325 3.311 14.011 
-2.792  38.906 15 DD_DT6DG7:DC15DA16_EE  D 6  ? E 16 ? D 7  ? E 15 ? 
1 D DG 7  1_555 E DC 15 1_555 D DC 8  1_555 E DG 14 1_555 0.179  -0.642 3.333 1.180   8.287  30.655 -2.689 -0.112 3.064 15.319 
-2.181  31.750 16 DD_DG7DC8:DG14DC15_EE  D 7  ? E 15 ? D 8  ? E 14 ? 
1 D DC 8  1_555 E DG 14 1_555 D DG 9  1_555 E DC 13 1_555 -0.139 -0.123 2.980 -6.439  9.146  32.456 -1.521 -0.687 2.820 15.790 
11.117  34.281 17 DD_DC8DG9:DC13DG14_EE  D 8  ? E 14 ? D 9  ? E 13 ? 
1 D DG 9  1_555 E DC 13 1_555 D DC 10 1_555 E DG 12 1_555 0.314  -0.805 3.569 5.591   1.825  29.962 -1.925 0.619  3.514 3.488  
-10.685 30.521 18 DD_DG9DC10:DG12DC13_EE D 9  ? E 13 ? D 10 ? E 12 ? 
# 
_pdbx_audit_support.funding_organization   'National Institutes of Health' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   5 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#