data_5WN1
# 
_entry.id   5WN1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5WN1         
WWPDB D_1000229010 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5WN1 
_pdbx_database_status.recvd_initial_deposition_date   2017-07-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Freudenthal, B.D.' 1 ? 
'Whitaker, A.M.'    2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            9 
_citation.language                  ? 
_citation.page_first                399 
_citation.page_last                 399 
_citation.title                     'Molecular snapshots of APE1 proofreading mismatches and removing DNA damage.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-017-02175-y 
_citation.pdbx_database_id_PubMed   29374164 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Whitaker, A.M.'    1 ? 
primary 'Flynn, T.S.'       2 ? 
primary 'Freudenthal, B.D.' 3 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   109.430 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5WN1 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     71.869 
_cell.length_a_esd                 ? 
_cell.length_b                     63.528 
_cell.length_b_esd                 ? 
_cell.length_c                     90.548 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5WN1 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA-(apurinic or apyrimidinic site) lyase'                                     31156.477 2   
'3.1.-.-, 4.2.99.18' ? ? ? 
2 polymer     syn 
;DNA (5'-D(P*TP*CP*GP*AP*CP*GP*GP*AP*TP*CP*C)-3')
;
3334.186  1   ?                    ? ? ? 
3 polymer     syn 
;DNA (5'-D(*GP*CP*TP*GP*AP*TP*GP*CP*G)-3')
;
2771.822  1   ?                    ? ? ? 
4 polymer     syn 
;DNA (5'-D(*GP*GP*AP*TP*CP*CP*GP*TP*CP*GP*AP*TP*CP*GP*CP*AP*TP*CP*AP*GP*C)-3')
;
6424.148  1   ?                    ? ? ? 
5 non-polymer syn 'CHLORIDE ION'                                                                  35.453    1   ? ? ? ? 
6 non-polymer syn 'SODIUM ION'                                                                    22.990    2   ? ? ? ? 
7 non-polymer syn 'CALCIUM ION'                                                                   40.078    1   ? ? ? ? 
8 water       nat water                                                                           18.015    165 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'APEX1, APEX nuclease,APEN,Apurinic-apyrimidinic endonuclease 1, APE-1, REF-1, Redox factor-1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAP
SDKEGYSGVGLLSRQAPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASR
KPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRL
DYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
;
;ALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAP
SDKEGYSGVGLLSRQAPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASR
KPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRL
DYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
;
A,B ? 
2 polydeoxyribonucleotide no no '(DT)(DC)(DG)(DA)(DC)(DG)(DG)(DA)(DT)(DC)(DC)' TCGACGGATCC C   ? 
3 polydeoxyribonucleotide no no '(DG)(DC)(DT)(DG)(DA)(DT)(DG)(DC)(DG)' GCTGATGCG D   ? 
4 polydeoxyribonucleotide no no 
;(DG)(DG)(DA)(DT)(DC)(DC)(DG)(DT)(DC)(DG)(DA)(DT)(DC)(DG)(DC)(DA)(DT)(DC)(DA)(DG)
(DC)
;
GGATCCGTCGATCGCATCAGC E   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   LEU n 
1 3   TYR n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   PRO n 
1 8   ASP n 
1 9   GLN n 
1 10  LYS n 
1 11  THR n 
1 12  SER n 
1 13  PRO n 
1 14  SER n 
1 15  GLY n 
1 16  LYS n 
1 17  PRO n 
1 18  ALA n 
1 19  THR n 
1 20  LEU n 
1 21  LYS n 
1 22  ILE n 
1 23  CYS n 
1 24  SER n 
1 25  TRP n 
1 26  ASN n 
1 27  VAL n 
1 28  ASP n 
1 29  GLY n 
1 30  LEU n 
1 31  ARG n 
1 32  ALA n 
1 33  TRP n 
1 34  ILE n 
1 35  LYS n 
1 36  LYS n 
1 37  LYS n 
1 38  GLY n 
1 39  LEU n 
1 40  ASP n 
1 41  TRP n 
1 42  VAL n 
1 43  LYS n 
1 44  GLU n 
1 45  GLU n 
1 46  ALA n 
1 47  PRO n 
1 48  ASP n 
1 49  ILE n 
1 50  LEU n 
1 51  CYS n 
1 52  LEU n 
1 53  GLN n 
1 54  GLU n 
1 55  THR n 
1 56  LYS n 
1 57  CYS n 
1 58  SER n 
1 59  GLU n 
1 60  ASN n 
1 61  LYS n 
1 62  LEU n 
1 63  PRO n 
1 64  ALA n 
1 65  GLU n 
1 66  LEU n 
1 67  GLN n 
1 68  GLU n 
1 69  LEU n 
1 70  PRO n 
1 71  GLY n 
1 72  LEU n 
1 73  SER n 
1 74  HIS n 
1 75  GLN n 
1 76  TYR n 
1 77  TRP n 
1 78  SER n 
1 79  ALA n 
1 80  PRO n 
1 81  SER n 
1 82  ASP n 
1 83  LYS n 
1 84  GLU n 
1 85  GLY n 
1 86  TYR n 
1 87  SER n 
1 88  GLY n 
1 89  VAL n 
1 90  GLY n 
1 91  LEU n 
1 92  LEU n 
1 93  SER n 
1 94  ARG n 
1 95  GLN n 
1 96  ALA n 
1 97  PRO n 
1 98  LEU n 
1 99  LYS n 
1 100 VAL n 
1 101 SER n 
1 102 TYR n 
1 103 GLY n 
1 104 ILE n 
1 105 GLY n 
1 106 ASP n 
1 107 GLU n 
1 108 GLU n 
1 109 HIS n 
1 110 ASP n 
1 111 GLN n 
1 112 GLU n 
1 113 GLY n 
1 114 ARG n 
1 115 VAL n 
1 116 ILE n 
1 117 VAL n 
1 118 ALA n 
1 119 GLU n 
1 120 PHE n 
1 121 ASP n 
1 122 SER n 
1 123 PHE n 
1 124 VAL n 
1 125 LEU n 
1 126 VAL n 
1 127 THR n 
1 128 ALA n 
1 129 TYR n 
1 130 VAL n 
1 131 PRO n 
1 132 ASN n 
1 133 ALA n 
1 134 GLY n 
1 135 ARG n 
1 136 GLY n 
1 137 LEU n 
1 138 VAL n 
1 139 ARG n 
1 140 LEU n 
1 141 GLU n 
1 142 TYR n 
1 143 ARG n 
1 144 GLN n 
1 145 ARG n 
1 146 TRP n 
1 147 ASP n 
1 148 GLU n 
1 149 ALA n 
1 150 PHE n 
1 151 ARG n 
1 152 LYS n 
1 153 PHE n 
1 154 LEU n 
1 155 LYS n 
1 156 GLY n 
1 157 LEU n 
1 158 ALA n 
1 159 SER n 
1 160 ARG n 
1 161 LYS n 
1 162 PRO n 
1 163 LEU n 
1 164 VAL n 
1 165 LEU n 
1 166 CYS n 
1 167 GLY n 
1 168 ASP n 
1 169 LEU n 
1 170 ASN n 
1 171 VAL n 
1 172 ALA n 
1 173 HIS n 
1 174 GLU n 
1 175 GLU n 
1 176 ILE n 
1 177 ASP n 
1 178 LEU n 
1 179 ARG n 
1 180 ASN n 
1 181 PRO n 
1 182 LYS n 
1 183 GLY n 
1 184 ASN n 
1 185 LYS n 
1 186 LYS n 
1 187 ASN n 
1 188 ALA n 
1 189 GLY n 
1 190 PHE n 
1 191 THR n 
1 192 PRO n 
1 193 GLN n 
1 194 GLU n 
1 195 ARG n 
1 196 GLN n 
1 197 GLY n 
1 198 PHE n 
1 199 GLY n 
1 200 GLU n 
1 201 LEU n 
1 202 LEU n 
1 203 GLN n 
1 204 ALA n 
1 205 VAL n 
1 206 PRO n 
1 207 LEU n 
1 208 ALA n 
1 209 ASP n 
1 210 SER n 
1 211 PHE n 
1 212 ARG n 
1 213 HIS n 
1 214 LEU n 
1 215 TYR n 
1 216 PRO n 
1 217 ASN n 
1 218 THR n 
1 219 PRO n 
1 220 TYR n 
1 221 ALA n 
1 222 TYR n 
1 223 THR n 
1 224 PHE n 
1 225 TRP n 
1 226 THR n 
1 227 TYR n 
1 228 MET n 
1 229 MET n 
1 230 ASN n 
1 231 ALA n 
1 232 ARG n 
1 233 SER n 
1 234 LYS n 
1 235 ASN n 
1 236 VAL n 
1 237 GLY n 
1 238 TRP n 
1 239 ARG n 
1 240 LEU n 
1 241 ASP n 
1 242 TYR n 
1 243 PHE n 
1 244 LEU n 
1 245 LEU n 
1 246 SER n 
1 247 HIS n 
1 248 SER n 
1 249 LEU n 
1 250 LEU n 
1 251 PRO n 
1 252 ALA n 
1 253 LEU n 
1 254 CYS n 
1 255 ASP n 
1 256 SER n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LYS n 
1 262 ALA n 
1 263 LEU n 
1 264 GLY n 
1 265 SER n 
1 266 ASP n 
1 267 HIS n 
1 268 CYS n 
1 269 PRO n 
1 270 ILE n 
1 271 THR n 
1 272 LEU n 
1 273 TYR n 
1 274 LEU n 
1 275 ALA n 
1 276 LEU n 
2 1   DT  n 
2 2   DC  n 
2 3   DG  n 
2 4   DA  n 
2 5   DC  n 
2 6   DG  n 
2 7   DG  n 
2 8   DA  n 
2 9   DT  n 
2 10  DC  n 
2 11  DC  n 
3 1   DG  n 
3 2   DC  n 
3 3   DT  n 
3 4   DG  n 
3 5   DA  n 
3 6   DT  n 
3 7   DG  n 
3 8   DC  n 
3 9   DG  n 
4 1   DG  n 
4 2   DG  n 
4 3   DA  n 
4 4   DT  n 
4 5   DC  n 
4 6   DC  n 
4 7   DG  n 
4 8   DT  n 
4 9   DC  n 
4 10  DG  n 
4 11  DA  n 
4 12  DT  n 
4 13  DC  n 
4 14  DG  n 
4 15  DC  n 
4 16  DA  n 
4 17  DT  n 
4 18  DC  n 
4 19  DA  n 
4 20  DG  n 
4 21  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   276 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'APEX1, APE, APE1, APEX, APX, HAP1, REF1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 11 'synthetic construct' ? 32630 ? 
3 1 sample 1 9  'synthetic construct' ? 32630 ? 
4 1 sample 1 21 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP APEX1_HUMAN P27695 ? 1 
;ALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAP
SDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASR
KPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRL
DYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
;
43 
2 PDB 5WN1        5WN1   ? 2 ? 1  
3 PDB 5WN1        5WN1   ? 3 ? 1  
4 PDB 5WN1        5WN1   ? 4 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5WN1 A 1 ? 276 ? P27695 43 ? 318 ? 43 318 
2 1 5WN1 B 1 ? 276 ? P27695 43 ? 318 ? 43 318 
3 2 5WN1 C 1 ? 11  ? 5WN1   1  ? 11  ? 1  11  
4 3 5WN1 D 1 ? 9   ? 5WN1   1  ? 9   ? 1  9   
5 4 5WN1 E 1 ? 21  ? 5WN1   1  ? 21  ? 1  21  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5WN1 ALA A 96 ? UNP P27695 CYS 138 'engineered mutation' 138 1 
2 5WN1 ALA B 96 ? UNP P27695 CYS 138 'engineered mutation' 138 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'            40.078  
CL  non-polymer         . 'CHLORIDE ION'                       ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
NA  non-polymer         . 'SODIUM ION'                         ? 'Na 1'            22.990  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5WN1 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.60 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.78 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '7% PEG20000, 100 mM sodium citrate, 15% glycerol, 5 mM calcium chloride' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 200K' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-12-22 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.54 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            43.260 
_reflns.entry_id                         5WN1 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.300 
_reflns.d_resolution_low                 25.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       58422 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.400 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.200 
_reflns.pdbx_Rmerge_I_obs                0.110 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 2.096 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.124 
_reflns.pdbx_Rpim_I_all                  0.057 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.300 2.340  ? ? ? ? ? ? 1728 99.400 ? ? ? ? 0.746 ? ? ? ? ? ? ? ? 2.500 ? 1.087 ? ? 0.939 0.562 ? 1  1 0.757 ? 
2.340 2.380  ? ? ? ? ? ? 1695 99.500 ? ? ? ? 0.677 ? ? ? ? ? ? ? ? 2.600 ? 1.176 ? ? 0.848 0.503 ? 2  1 0.814 ? 
2.380 2.430  ? ? ? ? ? ? 1672 99.600 ? ? ? ? 0.686 ? ? ? ? ? ? ? ? 2.700 ? 1.204 ? ? 0.850 0.493 ? 3  1 0.827 ? 
2.430 2.480  ? ? ? ? ? ? 1706 99.800 ? ? ? ? 0.621 ? ? ? ? ? ? ? ? 2.900 ? 1.481 ? ? 0.759 0.428 ? 4  1 0.863 ? 
2.480 2.530  ? ? ? ? ? ? 1690 99.600 ? ? ? ? 0.630 ? ? ? ? ? ? ? ? 3.000 ? 1.723 ? ? 0.773 0.438 ? 5  1 0.561 ? 
2.530 2.590  ? ? ? ? ? ? 1715 99.700 ? ? ? ? 0.526 ? ? ? ? ? ? ? ? 3.200 ? 1.415 ? ? 0.632 0.343 ? 6  1 0.905 ? 
2.590 2.650  ? ? ? ? ? ? 1707 99.600 ? ? ? ? 0.471 ? ? ? ? ? ? ? ? 3.400 ? 1.458 ? ? 0.560 0.294 ? 7  1 0.908 ? 
2.650 2.730  ? ? ? ? ? ? 1697 99.500 ? ? ? ? 0.411 ? ? ? ? ? ? ? ? 3.600 ? 1.689 ? ? 0.482 0.245 ? 8  1 0.938 ? 
2.730 2.810  ? ? ? ? ? ? 1680 99.800 ? ? ? ? 0.380 ? ? ? ? ? ? ? ? 3.800 ? 1.849 ? ? 0.441 0.218 ? 9  1 0.946 ? 
2.810 2.900  ? ? ? ? ? ? 1719 99.700 ? ? ? ? 0.359 ? ? ? ? ? ? ? ? 4.100 ? 2.039 ? ? 0.413 0.199 ? 10 1 0.952 ? 
2.900 3.000  ? ? ? ? ? ? 1727 99.700 ? ? ? ? 0.312 ? ? ? ? ? ? ? ? 4.300 ? 2.056 ? ? 0.355 0.166 ? 11 1 0.965 ? 
3.000 3.120  ? ? ? ? ? ? 1683 99.500 ? ? ? ? 0.259 ? ? ? ? ? ? ? ? 4.800 ? 2.503 ? ? 0.293 0.132 ? 12 1 0.971 ? 
3.120 3.260  ? ? ? ? ? ? 1693 99.300 ? ? ? ? 0.191 ? ? ? ? ? ? ? ? 5.300 ? 2.597 ? ? 0.213 0.092 ? 13 1 0.978 ? 
3.260 3.430  ? ? ? ? ? ? 1711 99.500 ? ? ? ? 0.136 ? ? ? ? ? ? ? ? 5.500 ? 2.650 ? ? 0.152 0.065 ? 14 1 0.988 ? 
3.430 3.650  ? ? ? ? ? ? 1695 98.900 ? ? ? ? 0.112 ? ? ? ? ? ? ? ? 5.500 ? 2.661 ? ? 0.125 0.054 ? 15 1 0.991 ? 
3.650 3.930  ? ? ? ? ? ? 1710 98.900 ? ? ? ? 0.100 ? ? ? ? ? ? ? ? 5.400 ? 2.508 ? ? 0.111 0.048 ? 16 1 0.990 ? 
3.930 4.320  ? ? ? ? ? ? 1692 97.900 ? ? ? ? 0.087 ? ? ? ? ? ? ? ? 5.200 ? 2.396 ? ? 0.097 0.042 ? 17 1 0.992 ? 
4.320 4.940  ? ? ? ? ? ? 1701 98.800 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 5.200 ? 2.252 ? ? 0.088 0.038 ? 18 1 0.993 ? 
4.940 6.210  ? ? ? ? ? ? 1735 99.400 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 5.400 ? 2.097 ? ? 0.086 0.037 ? 19 1 0.994 ? 
6.210 25.000 ? ? ? ? ? ? 1781 99.000 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 4.900 ? 1.891 ? ? 0.076 0.035 ? 20 1 0.995 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                109.100 
_refine.B_iso_mean                               47.8056 
_refine.B_iso_min                                26.160 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5WN1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.3 
_refine.ls_d_res_low                             24.5210 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     58422 
_refine.ls_number_reflns_R_free                  3443 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    86.8800 
_refine.ls_percent_reflns_R_free                 5.8900 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2161 
_refine.ls_R_factor_R_free                       0.2700 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2127 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.330 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 5DFF' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 35.0500 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3700 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        24.5210 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             167 
_refine_hist.number_atoms_total               5351 
_refine_hist.pdbx_number_residues_total       591 
_refine_hist.pdbx_B_iso_mean_ligand           64.90 
_refine_hist.pdbx_B_iso_mean_solvent          45.07 
_refine_hist.pdbx_number_atoms_protein        4345 
_refine_hist.pdbx_number_atoms_nucleic_acid   835 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010  ? 5419 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.161  ? 7524 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.056  ? 808  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 830  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 19.780 ? 3090 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.2979 2.3294  1794 . 93  1701 67.0000 . . . 0.4653 0.0000 0.3479 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 2.3294 2.3626  2030 . 129 1901 76.0000 . . . 0.3973 0.0000 0.3037 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 2.3626 2.3979  2090 . 110 1980 76.0000 . . . 0.3704 0.0000 0.2994 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 2.3979 2.4353  2074 . 120 1954 78.0000 . . . 0.3051 0.0000 0.2920 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 2.4353 2.4752  2093 . 121 1972 78.0000 . . . 0.3353 0.0000 0.2881 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 2.4752 2.5178  2146 . 134 2012 78.0000 . . . 0.3579 0.0000 0.2876 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 2.5178 2.5636  2127 . 139 1988 80.0000 . . . 0.3038 0.0000 0.2959 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 2.5636 2.6128  2215 . 113 2102 83.0000 . . . 0.4093 0.0000 0.2948 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 2.6128 2.6661  2310 . 151 2159 84.0000 . . . 0.4129 0.0000 0.3056 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 2.6661 2.7240  2261 . 146 2115 86.0000 . . . 0.4184 0.0000 0.2853 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 2.7240 2.7873  2365 . 112 2253 87.0000 . . . 0.3729 0.0000 0.2969 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 2.7873 2.8569  2391 . 147 2244 89.0000 . . . 0.3707 0.0000 0.2877 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 2.8569 2.9340  2398 . 153 2245 90.0000 . . . 0.3626 0.0000 0.2771 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 2.9340 3.0202  2476 . 124 2352 91.0000 . . . 0.4031 0.0000 0.3071 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 3.0202 3.1175  2442 . 156 2286 91.0000 . . . 0.3598 0.0000 0.2684 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 3.1175 3.2287  2525 . 146 2379 93.0000 . . . 0.3199 0.0000 0.2484 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 3.2287 3.3576  2536 . 136 2400 95.0000 . . . 0.3038 0.0000 0.2469 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 3.3576 3.5100  2535 . 156 2379 94.0000 . . . 0.2496 0.0000 0.2153 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 3.5100 3.6945  2514 . 134 2380 93.0000 . . . 0.2511 0.0000 0.2146 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 3.6945 3.9251  2515 . 158 2357 94.0000 . . . 0.2216 0.0000 0.1965 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 3.9251 4.2267  2482 . 160 2322 92.0000 . . . 0.2433 0.0000 0.1724 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 4.2267 4.6495  2439 . 145 2294 92.0000 . . . 0.1904 0.0000 0.1511 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 4.6495 5.3163  2547 . 154 2393 94.0000 . . . 0.2211 0.0000 0.1632 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 5.3163 6.6755  2540 . 145 2395 95.0000 . . . 0.2261 0.0000 0.1649 . . . . . . 25 . . . 
'X-RAY DIFFRACTION' 6.6755 24.5225 2577 . 161 2416 95.0000 . . . 0.2023 0.0000 0.1554 . . . . . . 25 . . . 
# 
_struct.entry_id                     5WN1 
_struct.title                        'APE1 exonuclease product complex' 
_struct.pdbx_descriptor              'DNA-(apurinic or apyrimidinic site) lyase/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5WN1 
_struct_keywords.text            'HYDROLASE, LYASE-DNA complex' 
_struct_keywords.pdbx_keywords   'HYDROLASE, LYASE/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 6 ? 
J N N 8 ? 
K N N 8 ? 
L N N 8 ? 
M N N 8 ? 
N N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 29  ? LYS A 36  ? GLY A 71  LYS A 78  1 ? 8  
HELX_P HELX_P2  AA2 LYS A 37  ? ALA A 46  ? LYS A 79  ALA A 88  1 ? 10 
HELX_P HELX_P3  AA3 SER A 58  ? LEU A 62  ? SER A 100 LEU A 104 5 ? 5  
HELX_P HELX_P4  AA4 PRO A 63  ? GLU A 68  ? PRO A 105 GLU A 110 5 ? 6  
HELX_P HELX_P5  AA5 LEU A 69  ? SER A 73  ? LEU A 111 SER A 115 5 ? 5  
HELX_P HELX_P6  AA6 ASP A 106 ? ASP A 110 ? ASP A 148 ASP A 152 5 ? 5  
HELX_P HELX_P7  AA7 GLY A 134 ? VAL A 138 ? GLY A 176 VAL A 180 5 ? 5  
HELX_P HELX_P8  AA8 ARG A 139 ? SER A 159 ? ARG A 181 SER A 201 1 ? 21 
HELX_P HELX_P9  AA9 GLU A 174 ? LEU A 178 ? GLU A 216 LEU A 220 5 ? 5  
HELX_P HELX_P10 AB1 ASN A 180 ? LYS A 185 ? ASN A 222 LYS A 227 1 ? 6  
HELX_P HELX_P11 AB2 THR A 191 ? VAL A 205 ? THR A 233 VAL A 247 1 ? 15 
HELX_P HELX_P12 AB3 SER A 210 ? TYR A 215 ? SER A 252 TYR A 257 1 ? 6  
HELX_P HELX_P13 AB4 TYR A 227 ? ASN A 235 ? TYR A 269 ASN A 277 5 ? 9  
HELX_P HELX_P14 AB5 HIS A 247 ? PRO A 251 ? HIS A 289 PRO A 293 5 ? 5  
HELX_P HELX_P15 AB6 GLY B 29  ? LYS B 36  ? GLY B 71  LYS B 78  1 ? 8  
HELX_P HELX_P16 AB7 LYS B 37  ? ALA B 46  ? LYS B 79  ALA B 88  1 ? 10 
HELX_P HELX_P17 AB8 SER B 58  ? LEU B 62  ? SER B 100 LEU B 104 5 ? 5  
HELX_P HELX_P18 AB9 PRO B 63  ? GLN B 67  ? PRO B 105 GLN B 109 5 ? 5  
HELX_P HELX_P19 AC1 LEU B 69  ? SER B 73  ? LEU B 111 SER B 115 5 ? 5  
HELX_P HELX_P20 AC2 ASP B 106 ? ASP B 110 ? ASP B 148 ASP B 152 5 ? 5  
HELX_P HELX_P21 AC3 GLY B 134 ? VAL B 138 ? GLY B 176 VAL B 180 5 ? 5  
HELX_P HELX_P22 AC4 ARG B 139 ? SER B 159 ? ARG B 181 SER B 201 1 ? 21 
HELX_P HELX_P23 AC5 GLU B 174 ? LEU B 178 ? GLU B 216 LEU B 220 5 ? 5  
HELX_P HELX_P24 AC6 PRO B 181 ? LYS B 185 ? PRO B 223 LYS B 227 5 ? 5  
HELX_P HELX_P25 AC7 THR B 191 ? VAL B 205 ? THR B 233 VAL B 247 1 ? 15 
HELX_P HELX_P26 AC8 SER B 210 ? TYR B 215 ? SER B 252 TYR B 257 1 ? 6  
HELX_P HELX_P27 AC9 TYR B 227 ? ALA B 231 ? TYR B 269 ALA B 273 5 ? 5  
HELX_P HELX_P28 AD1 HIS B 247 ? PRO B 251 ? HIS B 289 PRO B 293 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E DC  21  "O3'" ? ? ? 1_555 H CA  .  CA ? ? E DC  21  E CA  101 1_555 ? ? ? ? ? ? ?            2.766 ? 
metalc2  metalc ? ? B TYR 129 OH    ? ? ? 1_555 H CA  .  CA ? ? B TYR 171 E CA  101 1_656 ? ? ? ? ? ? ?            2.876 ? 
metalc3  metalc ? ? H CA  .   CA    ? ? ? 1_555 K HOH .  O  ? ? E CA  101 B HOH 501 1_454 ? ? ? ? ? ? ?            3.157 ? 
hydrog1  hydrog ? ? C DT  1   N3    ? ? ? 1_555 E DA  11 N1 ? ? C DT  1   E DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DT  1   O4    ? ? ? 1_555 E DA  11 N6 ? ? C DT  1   E DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DC  2   N3    ? ? ? 1_555 E DG  10 N1 ? ? C DC  2   E DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DC  2   N4    ? ? ? 1_555 E DG  10 O6 ? ? C DC  2   E DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DC  2   O2    ? ? ? 1_555 E DG  10 N2 ? ? C DC  2   E DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DG  3   N1    ? ? ? 1_555 E DC  9  N3 ? ? C DG  3   E DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DG  3   N2    ? ? ? 1_555 E DC  9  O2 ? ? C DG  3   E DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DG  3   O6    ? ? ? 1_555 E DC  9  N4 ? ? C DG  3   E DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DA  4   N1    ? ? ? 1_555 E DT  8  N3 ? ? C DA  4   E DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DA  4   N6    ? ? ? 1_555 E DT  8  O4 ? ? C DA  4   E DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DC  5   N3    ? ? ? 1_555 E DG  7  N2 ? ? C DC  5   E DG  7   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog12 hydrog ? ? C DG  6   N1    ? ? ? 1_555 E DC  6  N3 ? ? C DG  6   E DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DG  6   N2    ? ? ? 1_555 E DC  6  O2 ? ? C DG  6   E DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DG  6   O6    ? ? ? 1_555 E DC  6  N4 ? ? C DG  6   E DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DG  7   N1    ? ? ? 1_555 E DC  5  N3 ? ? C DG  7   E DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DG  7   N2    ? ? ? 1_555 E DC  5  O2 ? ? C DG  7   E DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DG  7   O6    ? ? ? 1_555 E DC  5  N4 ? ? C DG  7   E DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DA  8   N1    ? ? ? 1_555 E DT  4  N3 ? ? C DA  8   E DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DA  8   N6    ? ? ? 1_555 E DT  4  O4 ? ? C DA  8   E DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DT  9   N3    ? ? ? 1_555 E DA  3  N1 ? ? C DT  9   E DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DT  9   O4    ? ? ? 1_555 E DA  3  N6 ? ? C DT  9   E DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DC  10  N3    ? ? ? 1_555 E DG  2  N1 ? ? C DC  10  E DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DC  10  N4    ? ? ? 1_555 E DG  2  O6 ? ? C DC  10  E DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DC  10  O2    ? ? ? 1_555 E DG  2  N2 ? ? C DC  10  E DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DC  11  N3    ? ? ? 1_555 E DG  1  N1 ? ? C DC  11  E DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DC  11  N4    ? ? ? 1_555 E DG  1  O6 ? ? C DC  11  E DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DC  11  O2    ? ? ? 1_555 E DG  1  N2 ? ? C DC  11  E DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? D DG  1   N1    ? ? ? 1_555 E DC  21 N3 ? ? D DG  1   E DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? D DG  1   N2    ? ? ? 1_555 E DC  21 O2 ? ? D DG  1   E DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? D DG  1   O6    ? ? ? 1_555 E DC  21 N4 ? ? D DG  1   E DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? D DC  2   N3    ? ? ? 1_555 E DG  20 N1 ? ? D DC  2   E DG  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? D DC  2   N4    ? ? ? 1_555 E DG  20 O6 ? ? D DC  2   E DG  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? D DC  2   O2    ? ? ? 1_555 E DG  20 N2 ? ? D DC  2   E DG  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? D DT  3   N3    ? ? ? 1_555 E DA  19 N1 ? ? D DT  3   E DA  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? D DT  3   O4    ? ? ? 1_555 E DA  19 N6 ? ? D DT  3   E DA  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? D DG  4   N1    ? ? ? 1_555 E DC  18 N3 ? ? D DG  4   E DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? D DG  4   N2    ? ? ? 1_555 E DC  18 O2 ? ? D DG  4   E DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? D DG  4   O6    ? ? ? 1_555 E DC  18 N4 ? ? D DG  4   E DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? D DA  5   N1    ? ? ? 1_555 E DT  17 N3 ? ? D DA  5   E DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? D DA  5   N6    ? ? ? 1_555 E DT  17 O4 ? ? D DA  5   E DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? D DT  6   N3    ? ? ? 1_555 E DA  16 N1 ? ? D DT  6   E DA  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? D DT  6   O4    ? ? ? 1_555 E DA  16 N6 ? ? D DT  6   E DA  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? D DG  7   N1    ? ? ? 1_555 E DC  15 N3 ? ? D DG  7   E DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? D DG  7   N2    ? ? ? 1_555 E DC  15 O2 ? ? D DG  7   E DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? D DG  7   O6    ? ? ? 1_555 E DC  15 N4 ? ? D DG  7   E DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? D DC  8   N3    ? ? ? 1_555 E DG  14 N1 ? ? D DC  8   E DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? D DC  8   N4    ? ? ? 1_555 E DG  14 O6 ? ? D DC  8   E DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? D DC  8   O2    ? ? ? 1_555 E DG  14 N2 ? ? D DC  8   E DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? D DG  9   N1    ? ? ? 1_555 E DC  13 N3 ? ? D DG  9   E DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? D DG  9   N2    ? ? ? 1_555 E DC  13 O2 ? ? D DG  9   E DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? D DG  9   O6    ? ? ? 1_555 E DC  13 N4 ? ? D DG  9   E DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 205 A . ? VAL 247 A PRO 206 A ? PRO 248 A 1 -17.41 
2 VAL 205 B . ? VAL 247 B PRO 206 B ? PRO 248 B 1 -10.44 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 6 ? 
AA3 ? 6 ? 
AA4 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? parallel      
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 HIS A 74  ? SER A 78  ? HIS A 116 SER A 120 
AA1 2 VAL A 89  ? SER A 93  ? VAL A 131 SER A 135 
AA1 3 ILE A 49  ? GLN A 53  ? ILE A 91  GLN A 95  
AA1 4 LEU A 20  ? ASN A 26  ? LEU A 62  ASN A 68  
AA1 5 ILE A 270 ? LEU A 274 ? ILE A 312 LEU A 316 
AA1 6 LEU A 253 ? ILE A 258 ? LEU A 295 ILE A 300 
AA2 1 LYS A 99  ? TYR A 102 ? LYS A 141 TYR A 144 
AA2 2 VAL A 115 ? GLU A 119 ? VAL A 157 GLU A 161 
AA2 3 VAL A 124 ? TYR A 129 ? VAL A 166 TYR A 171 
AA2 4 LEU A 163 ? ASP A 168 ? LEU A 205 ASP A 210 
AA2 5 ASP A 241 ? LEU A 245 ? ASP A 283 LEU A 287 
AA2 6 ALA A 208 ? ASP A 209 ? ALA A 250 ASP A 251 
AA3 1 HIS B 74  ? SER B 78  ? HIS B 116 SER B 120 
AA3 2 VAL B 89  ? SER B 93  ? VAL B 131 SER B 135 
AA3 3 ILE B 49  ? GLN B 53  ? ILE B 91  GLN B 95  
AA3 4 LEU B 20  ? ASN B 26  ? LEU B 62  ASN B 68  
AA3 5 ILE B 270 ? LEU B 274 ? ILE B 312 LEU B 316 
AA3 6 LEU B 253 ? ILE B 258 ? LEU B 295 ILE B 300 
AA4 1 LYS B 99  ? TYR B 102 ? LYS B 141 TYR B 144 
AA4 2 VAL B 115 ? GLU B 119 ? VAL B 157 GLU B 161 
AA4 3 VAL B 124 ? TYR B 129 ? VAL B 166 TYR B 171 
AA4 4 LEU B 163 ? ASP B 168 ? LEU B 205 ASP B 210 
AA4 5 ASP B 241 ? LEU B 245 ? ASP B 283 LEU B 287 
AA4 6 ALA B 208 ? ASP B 209 ? ALA B 250 ASP B 251 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N HIS A 74  ? N HIS A 116 O SER A 93  ? O SER A 135 
AA1 2 3 O LEU A 92  ? O LEU A 134 N LEU A 50  ? N LEU A 92  
AA1 3 4 O CYS A 51  ? O CYS A 93  N CYS A 23  ? N CYS A 65  
AA1 4 5 N ILE A 22  ? N ILE A 64  O LEU A 272 ? O LEU A 314 
AA1 5 6 O THR A 271 ? O THR A 313 N LYS A 257 ? N LYS A 299 
AA2 1 2 N LYS A 99  ? N LYS A 141 O GLU A 119 ? O GLU A 161 
AA2 2 3 N ALA A 118 ? N ALA A 160 O LEU A 125 ? O LEU A 167 
AA2 3 4 N VAL A 126 ? N VAL A 168 O CYS A 166 ? O CYS A 208 
AA2 4 5 N LEU A 165 ? N LEU A 207 O LEU A 244 ? O LEU A 286 
AA2 5 6 O LEU A 245 ? O LEU A 287 N ALA A 208 ? N ALA A 250 
AA3 1 2 N TYR B 76  ? N TYR B 118 O LEU B 91  ? O LEU B 133 
AA3 2 3 O LEU B 92  ? O LEU B 134 N LEU B 50  ? N LEU B 92  
AA3 3 4 O ILE B 49  ? O ILE B 91  N CYS B 23  ? N CYS B 65  
AA3 4 5 N ILE B 22  ? N ILE B 64  O LEU B 272 ? O LEU B 314 
AA3 5 6 O THR B 271 ? O THR B 313 N LYS B 257 ? N LYS B 299 
AA4 1 2 N SER B 101 ? N SER B 143 O VAL B 117 ? O VAL B 159 
AA4 2 3 N ALA B 118 ? N ALA B 160 O LEU B 125 ? O LEU B 167 
AA4 3 4 N VAL B 126 ? N VAL B 168 O CYS B 166 ? O CYS B 208 
AA4 4 5 N LEU B 165 ? N LEU B 207 O LEU B 244 ? O LEU B 286 
AA4 5 6 O LEU B 245 ? O LEU B 287 N ALA B 208 ? N ALA B 250 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B NA 402 ? 1 'binding site for residue NA B 402' 
AC2 Software E CA 101 ? 4 'binding site for residue CA E 101' 
AC3 Software E NA 102 ? 3 'binding site for residue NA E 102' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 1 GLN B 193 ? GLN B 235 . ? 1_555 ? 
2 AC2 4 TYR B 129 ? TYR B 171 . ? 1_454 ? 
3 AC2 4 ASN B 132 ? ASN B 174 . ? 1_454 ? 
4 AC2 4 ASN B 170 ? ASN B 212 . ? 1_454 ? 
5 AC2 4 DC  E 21  ? DC  E 21  . ? 1_555 ? 
6 AC3 3 DT  D 6   ? DT  D 6   . ? 1_555 ? 
7 AC3 3 DT  E 17  ? DT  E 17  . ? 1_555 ? 
8 AC3 3 DC  E 18  ? DC  E 18  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5WN1 
_atom_sites.fract_transf_matrix[1][1]   0.013914 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004908 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015741 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011711 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ALA A 1 1   ? 11.140  -0.131  16.727  1.00 42.88  ? 43  ALA A N     1 
ATOM   2    C  CA    . ALA A 1 1   ? 11.015  -1.457  17.314  1.00 38.03  ? 43  ALA A CA    1 
ATOM   3    C  C     . ALA A 1 1   ? 9.608   -1.630  17.878  1.00 39.34  ? 43  ALA A C     1 
ATOM   4    O  O     . ALA A 1 1   ? 8.892   -0.652  18.086  1.00 45.28  ? 43  ALA A O     1 
ATOM   5    C  CB    . ALA A 1 1   ? 12.065  -1.656  18.401  1.00 42.58  ? 43  ALA A CB    1 
ATOM   6    N  N     . LEU A 1 2   ? 9.194   -2.863  18.113  1.00 39.49  ? 44  LEU A N     1 
ATOM   7    C  CA    . LEU A 1 2   ? 7.905   -3.083  18.745  1.00 41.09  ? 44  LEU A CA    1 
ATOM   8    C  C     . LEU A 1 2   ? 8.078   -3.149  20.260  1.00 43.88  ? 44  LEU A C     1 
ATOM   9    O  O     . LEU A 1 2   ? 9.190   -3.158  20.788  1.00 36.70  ? 44  LEU A O     1 
ATOM   10   C  CB    . LEU A 1 2   ? 7.250   -4.351  18.214  1.00 38.92  ? 44  LEU A CB    1 
ATOM   11   C  CG    . LEU A 1 2   ? 7.000   -4.293  16.698  1.00 44.16  ? 44  LEU A CG    1 
ATOM   12   C  CD1   . LEU A 1 2   ? 7.819   -5.347  16.004  1.00 41.83  ? 44  LEU A CD1   1 
ATOM   13   C  CD2   . LEU A 1 2   ? 5.530   -4.463  16.374  1.00 35.37  ? 44  LEU A CD2   1 
ATOM   14   N  N     . TYR A 1 3   ? 6.951   -3.192  20.961  1.00 36.39  ? 45  TYR A N     1 
ATOM   15   C  CA    . TYR A 1 3   ? 6.924   -3.032  22.404  1.00 41.47  ? 45  TYR A CA    1 
ATOM   16   C  C     . TYR A 1 3   ? 5.877   -3.962  22.985  1.00 43.61  ? 45  TYR A C     1 
ATOM   17   O  O     . TYR A 1 3   ? 4.723   -3.959  22.531  1.00 46.26  ? 45  TYR A O     1 
ATOM   18   C  CB    . TYR A 1 3   ? 6.601   -1.583  22.775  1.00 39.52  ? 45  TYR A CB    1 
ATOM   19   C  CG    . TYR A 1 3   ? 6.132   -1.414  24.199  1.00 41.55  ? 45  TYR A CG    1 
ATOM   20   C  CD1   . TYR A 1 3   ? 7.057   -1.267  25.240  1.00 39.92  ? 45  TYR A CD1   1 
ATOM   21   C  CD2   . TYR A 1 3   ? 4.777   -1.400  24.520  1.00 35.60  ? 45  TYR A CD2   1 
ATOM   22   C  CE1   . TYR A 1 3   ? 6.648   -1.116  26.526  1.00 37.60  ? 45  TYR A CE1   1 
ATOM   23   C  CE2   . TYR A 1 3   ? 4.369   -1.260  25.848  1.00 40.71  ? 45  TYR A CE2   1 
ATOM   24   C  CZ    . TYR A 1 3   ? 5.324   -1.105  26.832  1.00 33.94  ? 45  TYR A CZ    1 
ATOM   25   O  OH    . TYR A 1 3   ? 4.994   -0.956  28.142  1.00 32.45  ? 45  TYR A OH    1 
ATOM   26   N  N     . GLU A 1 4   ? 6.272   -4.725  24.008  1.00 46.32  ? 46  GLU A N     1 
ATOM   27   C  CA    . GLU A 1 4   ? 5.373   -5.626  24.731  1.00 48.46  ? 46  GLU A CA    1 
ATOM   28   C  C     . GLU A 1 4   ? 5.256   -5.131  26.166  1.00 46.85  ? 46  GLU A C     1 
ATOM   29   O  O     . GLU A 1 4   ? 6.229   -5.178  26.933  1.00 41.07  ? 46  GLU A O     1 
ATOM   30   C  CB    . GLU A 1 4   ? 5.853   -7.081  24.671  1.00 55.15  ? 46  GLU A CB    1 
ATOM   31   C  CG    . GLU A 1 4   ? 6.005   -7.558  23.211  1.00 58.79  ? 46  GLU A CG    1 
ATOM   32   C  CD    . GLU A 1 4   ? 6.107   -9.073  23.033  1.00 69.20  ? 46  GLU A CD    1 
ATOM   33   O  OE1   . GLU A 1 4   ? 6.602   -9.775  23.960  1.00 57.75  ? 46  GLU A OE1   1 
ATOM   34   O  OE2   . GLU A 1 4   ? 5.689   -9.547  21.940  1.00 71.07  ? 46  GLU A OE2   1 
ATOM   35   N  N     . ASP A 1 5   ? 4.081   -4.589  26.475  1.00 41.51  ? 47  ASP A N     1 
ATOM   36   C  CA    . ASP A 1 5   ? 3.709   -4.228  27.823  1.00 37.77  ? 47  ASP A CA    1 
ATOM   37   C  C     . ASP A 1 5   ? 3.838   -5.445  28.738  1.00 41.79  ? 47  ASP A C     1 
ATOM   38   O  O     . ASP A 1 5   ? 3.330   -6.524  28.395  1.00 41.90  ? 47  ASP A O     1 
ATOM   39   C  CB    . ASP A 1 5   ? 2.271   -3.706  27.836  1.00 35.02  ? 47  ASP A CB    1 
ATOM   40   C  CG    . ASP A 1 5   ? 2.039   -2.636  28.892  1.00 42.44  ? 47  ASP A CG    1 
ATOM   41   O  OD1   . ASP A 1 5   ? 2.862   -1.698  28.995  1.00 41.04  ? 47  ASP A OD1   1 
ATOM   42   O  OD2   . ASP A 1 5   ? 1.032   -2.730  29.629  1.00 42.37  ? 47  ASP A OD2   1 
ATOM   43   N  N     . PRO A 1 6   ? 4.492   -5.313  29.895  1.00 42.25  ? 48  PRO A N     1 
ATOM   44   C  CA    . PRO A 1 6   ? 4.698   -6.470  30.812  1.00 39.92  ? 48  PRO A CA    1 
ATOM   45   C  C     . PRO A 1 6   ? 3.430   -6.835  31.565  1.00 41.57  ? 48  PRO A C     1 
ATOM   46   O  O     . PRO A 1 6   ? 2.472   -6.047  31.619  1.00 36.09  ? 48  PRO A O     1 
ATOM   47   C  CB    . PRO A 1 6   ? 5.779   -5.960  31.772  1.00 36.57  ? 48  PRO A CB    1 
ATOM   48   C  CG    . PRO A 1 6   ? 5.648   -4.467  31.728  1.00 37.66  ? 48  PRO A CG    1 
ATOM   49   C  CD    . PRO A 1 6   ? 5.257   -4.127  30.319  1.00 36.76  ? 48  PRO A CD    1 
ATOM   50   N  N     . PRO A 1 7   ? 3.396   -8.013  32.190  1.00 39.69  ? 49  PRO A N     1 
ATOM   51   C  CA    . PRO A 1 7   ? 2.138   -8.497  32.763  1.00 38.30  ? 49  PRO A CA    1 
ATOM   52   C  C     . PRO A 1 7   ? 1.632   -7.591  33.879  1.00 40.06  ? 49  PRO A C     1 
ATOM   53   O  O     . PRO A 1 7   ? 2.394   -6.869  34.519  1.00 39.36  ? 49  PRO A O     1 
ATOM   54   C  CB    . PRO A 1 7   ? 2.504   -9.891  33.283  1.00 43.85  ? 49  PRO A CB    1 
ATOM   55   C  CG    . PRO A 1 7   ? 3.709   -10.298 32.497  1.00 35.34  ? 49  PRO A CG    1 
ATOM   56   C  CD    . PRO A 1 7   ? 4.464   -9.028  32.263  1.00 36.61  ? 49  PRO A CD    1 
ATOM   57   N  N     . ASP A 1 8   ? 0.317   -7.612  34.085  1.00 39.37  ? 50  ASP A N     1 
ATOM   58   C  CA    . ASP A 1 8   ? -0.287  -6.735  35.081  1.00 45.83  ? 50  ASP A CA    1 
ATOM   59   C  C     . ASP A 1 8   ? 0.296   -7.018  36.455  1.00 39.96  ? 50  ASP A C     1 
ATOM   60   O  O     . ASP A 1 8   ? 0.271   -8.164  36.915  1.00 41.91  ? 50  ASP A O     1 
ATOM   61   C  CB    . ASP A 1 8   ? -1.805  -6.929  35.130  1.00 48.31  ? 50  ASP A CB    1 
ATOM   62   C  CG    . ASP A 1 8   ? -2.519  -6.416  33.887  1.00 49.26  ? 50  ASP A CG    1 
ATOM   63   O  OD1   . ASP A 1 8   ? -1.830  -5.923  32.966  1.00 41.71  ? 50  ASP A OD1   1 
ATOM   64   O  OD2   . ASP A 1 8   ? -3.782  -6.513  33.845  1.00 49.75  ? 50  ASP A OD2   1 
ATOM   65   N  N     . GLN A 1 9   ? 0.820   -5.968  37.107  1.00 42.62  ? 51  GLN A N     1 
ATOM   66   C  CA    . GLN A 1 9   ? 1.278   -6.034  38.499  1.00 44.15  ? 51  GLN A CA    1 
ATOM   67   C  C     . GLN A 1 9   ? 0.164   -5.522  39.401  1.00 41.58  ? 51  GLN A C     1 
ATOM   68   O  O     . GLN A 1 9   ? -0.072  -4.314  39.470  1.00 39.26  ? 51  GLN A O     1 
ATOM   69   C  CB    . GLN A 1 9   ? 2.549   -5.214  38.716  1.00 41.60  ? 51  GLN A CB    1 
ATOM   70   C  CG    . GLN A 1 9   ? 2.941   -5.017  40.186  1.00 46.25  ? 51  GLN A CG    1 
ATOM   71   C  CD    . GLN A 1 9   ? 3.159   -6.335  40.927  1.00 51.05  ? 51  GLN A CD    1 
ATOM   72   O  OE1   . GLN A 1 9   ? 2.407   -6.674  41.842  1.00 51.00  ? 51  GLN A OE1   1 
ATOM   73   N  NE2   . GLN A 1 9   ? 4.190   -7.085  40.528  1.00 47.62  ? 51  GLN A NE2   1 
ATOM   74   N  N     . LYS A 1 10  ? -0.483  -6.434  40.129  1.00 44.68  ? 52  LYS A N     1 
ATOM   75   C  CA    . LYS A 1 10  ? -1.676  -6.106  40.903  1.00 46.80  ? 52  LYS A CA    1 
ATOM   76   C  C     . LYS A 1 10  ? -1.426  -6.033  42.414  1.00 52.09  ? 52  LYS A C     1 
ATOM   77   O  O     . LYS A 1 10  ? -2.390  -6.041  43.190  1.00 48.29  ? 52  LYS A O     1 
ATOM   78   C  CB    . LYS A 1 10  ? -2.780  -7.123  40.612  1.00 43.76  ? 52  LYS A CB    1 
ATOM   79   C  CG    . LYS A 1 10  ? -3.278  -7.154  39.183  1.00 47.30  ? 52  LYS A CG    1 
ATOM   80   C  CD    . LYS A 1 10  ? -3.948  -8.475  38.906  1.00 51.45  ? 52  LYS A CD    1 
ATOM   81   C  CE    . LYS A 1 10  ? -4.965  -8.386  37.798  1.00 50.21  ? 52  LYS A CE    1 
ATOM   82   N  NZ    . LYS A 1 10  ? -5.638  -9.710  37.640  1.00 60.39  ? 52  LYS A NZ    1 
ATOM   83   N  N     . THR A 1 11  ? -0.171  -5.960  42.855  1.00 44.32  ? 53  THR A N     1 
ATOM   84   C  CA    . THR A 1 11  ? 0.148   -5.833  44.273  1.00 49.07  ? 53  THR A CA    1 
ATOM   85   C  C     . THR A 1 11  ? 0.967   -4.570  44.504  1.00 46.74  ? 53  THR A C     1 
ATOM   86   O  O     . THR A 1 11  ? 1.963   -4.347  43.810  1.00 47.81  ? 53  THR A O     1 
ATOM   87   C  CB    . THR A 1 11  ? 0.940   -7.045  44.779  1.00 51.68  ? 53  THR A CB    1 
ATOM   88   O  OG1   . THR A 1 11  ? 0.184   -8.253  44.604  1.00 52.68  ? 53  THR A OG1   1 
ATOM   89   C  CG2   . THR A 1 11  ? 1.275   -6.858  46.245  1.00 54.57  ? 53  THR A CG2   1 
ATOM   90   N  N     . SER A 1 12  ? 0.573   -3.758  45.487  1.00 44.97  ? 54  SER A N     1 
ATOM   91   C  CA    . SER A 1 12  ? 1.352   -2.566  45.790  1.00 51.19  ? 54  SER A CA    1 
ATOM   92   C  C     . SER A 1 12  ? 2.751   -2.949  46.289  1.00 54.54  ? 54  SER A C     1 
ATOM   93   O  O     . SER A 1 12  ? 2.987   -4.090  46.697  1.00 54.17  ? 54  SER A O     1 
ATOM   94   C  CB    . SER A 1 12  ? 0.634   -1.706  46.827  1.00 54.34  ? 54  SER A CB    1 
ATOM   95   O  OG    . SER A 1 12  ? 0.600   -2.331  48.096  1.00 59.49  ? 54  SER A OG    1 
ATOM   96   N  N     . PRO A 1 13  ? 3.712   -2.019  46.243  1.00 54.71  ? 55  PRO A N     1 
ATOM   97   C  CA    . PRO A 1 13  ? 5.065   -2.337  46.732  1.00 58.03  ? 55  PRO A CA    1 
ATOM   98   C  C     . PRO A 1 13  ? 5.110   -2.632  48.226  1.00 62.52  ? 55  PRO A C     1 
ATOM   99   O  O     . PRO A 1 13  ? 6.166   -3.008  48.740  1.00 63.26  ? 55  PRO A O     1 
ATOM   100  C  CB    . PRO A 1 13  ? 5.873   -1.074  46.388  1.00 56.32  ? 55  PRO A CB    1 
ATOM   101  C  CG    . PRO A 1 13  ? 4.853   0.021   46.344  1.00 65.70  ? 55  PRO A CG    1 
ATOM   102  C  CD    . PRO A 1 13  ? 3.604   -0.618  45.793  1.00 54.07  ? 55  PRO A CD    1 
ATOM   103  N  N     . SER A 1 14  ? 3.992   -2.487  48.933  1.00 63.40  ? 56  SER A N     1 
ATOM   104  C  CA    . SER A 1 14  ? 3.891   -2.864  50.332  1.00 58.22  ? 56  SER A CA    1 
ATOM   105  C  C     . SER A 1 14  ? 2.994   -4.078  50.531  1.00 53.16  ? 56  SER A C     1 
ATOM   106  O  O     . SER A 1 14  ? 2.459   -4.273  51.623  1.00 56.69  ? 56  SER A O     1 
ATOM   107  C  CB    . SER A 1 14  ? 3.363   -1.696  51.156  1.00 60.72  ? 56  SER A CB    1 
ATOM   108  O  OG    . SER A 1 14  ? 1.951   -1.727  51.155  1.00 64.47  ? 56  SER A OG    1 
ATOM   109  N  N     . GLY A 1 15  ? 2.807   -4.889  49.496  1.00 52.83  ? 57  GLY A N     1 
ATOM   110  C  CA    . GLY A 1 15  ? 2.040   -6.107  49.634  1.00 54.52  ? 57  GLY A CA    1 
ATOM   111  C  C     . GLY A 1 15  ? 0.532   -5.943  49.668  1.00 58.40  ? 57  GLY A C     1 
ATOM   112  O  O     . GLY A 1 15  ? -0.173  -6.945  49.835  1.00 60.89  ? 57  GLY A O     1 
ATOM   113  N  N     . LYS A 1 16  ? -0.006  -4.694  49.492  1.00 55.73  ? 58  LYS A N     1 
ATOM   114  C  CA    . LYS A 1 16  ? -1.467  -4.592  49.525  1.00 54.74  ? 58  LYS A CA    1 
ATOM   115  C  C     . LYS A 1 16  ? -2.060  -4.820  48.126  1.00 50.52  ? 58  LYS A C     1 
ATOM   116  O  O     . LYS A 1 16  ? -1.491  -4.372  47.131  1.00 47.69  ? 58  LYS A O     1 
ATOM   117  C  CB    . LYS A 1 16  ? -1.895  -3.228  50.070  1.00 52.17  ? 58  LYS A CB    1 
ATOM   118  C  CG    . LYS A 1 16  ? -1.054  -2.731  51.279  1.00 55.08  ? 58  LYS A CG    1 
ATOM   119  C  CD    . LYS A 1 16  ? -0.870  -3.815  52.397  1.00 65.01  ? 58  LYS A CD    1 
ATOM   120  C  CE    . LYS A 1 16  ? -0.028  -3.326  53.622  1.00 61.07  ? 58  LYS A CE    1 
ATOM   121  N  NZ    . LYS A 1 16  ? 0.429   -4.441  54.519  1.00 50.19  ? 58  LYS A NZ    1 
ATOM   122  N  N     . PRO A 1 17  ? -3.183  -5.536  48.016  1.00 54.17  ? 59  PRO A N     1 
ATOM   123  C  CA    . PRO A 1 17  ? -3.764  -5.816  46.698  1.00 46.81  ? 59  PRO A CA    1 
ATOM   124  C  C     . PRO A 1 17  ? -4.455  -4.603  46.086  1.00 50.52  ? 59  PRO A C     1 
ATOM   125  O  O     . PRO A 1 17  ? -5.040  -3.772  46.780  1.00 56.67  ? 59  PRO A O     1 
ATOM   126  C  CB    . PRO A 1 17  ? -4.785  -6.914  46.999  1.00 48.07  ? 59  PRO A CB    1 
ATOM   127  C  CG    . PRO A 1 17  ? -5.221  -6.614  48.382  1.00 47.82  ? 59  PRO A CG    1 
ATOM   128  C  CD    . PRO A 1 17  ? -3.997  -6.114  49.099  1.00 50.28  ? 59  PRO A CD    1 
ATOM   129  N  N     . ALA A 1 18  ? -4.419  -4.522  44.760  1.00 46.18  ? 60  ALA A N     1 
ATOM   130  C  CA    . ALA A 1 18  ? -5.112  -3.436  44.083  1.00 53.12  ? 60  ALA A CA    1 
ATOM   131  C  C     . ALA A 1 18  ? -6.627  -3.540  44.286  1.00 50.35  ? 60  ALA A C     1 
ATOM   132  O  O     . ALA A 1 18  ? -7.225  -4.618  44.170  1.00 40.74  ? 60  ALA A O     1 
ATOM   133  C  CB    . ALA A 1 18  ? -4.773  -3.435  42.593  1.00 50.44  ? 60  ALA A CB    1 
ATOM   134  N  N     . THR A 1 19  ? -7.244  -2.399  44.596  1.00 49.19  ? 61  THR A N     1 
ATOM   135  C  CA    . THR A 1 19  ? -8.684  -2.308  44.781  1.00 50.00  ? 61  THR A CA    1 
ATOM   136  C  C     . THR A 1 19  ? -9.370  -1.390  43.773  1.00 49.07  ? 61  THR A C     1 
ATOM   137  O  O     . THR A 1 19  ? -10.581 -1.200  43.863  1.00 50.24  ? 61  THR A O     1 
ATOM   138  C  CB    . THR A 1 19  ? -9.001  -1.819  46.200  1.00 53.03  ? 61  THR A CB    1 
ATOM   139  O  OG1   . THR A 1 19  ? -8.613  -0.447  46.318  1.00 56.00  ? 61  THR A OG1   1 
ATOM   140  C  CG2   . THR A 1 19  ? -8.232  -2.648  47.243  1.00 51.37  ? 61  THR A CG2   1 
ATOM   141  N  N     . LEU A 1 20  ? -8.642  -0.795  42.837  1.00 48.33  ? 62  LEU A N     1 
ATOM   142  C  CA    . LEU A 1 20  ? -9.287  0.078   41.865  1.00 46.40  ? 62  LEU A CA    1 
ATOM   143  C  C     . LEU A 1 20  ? -8.550  -0.031  40.536  1.00 49.03  ? 62  LEU A C     1 
ATOM   144  O  O     . LEU A 1 20  ? -7.310  -0.048  40.481  1.00 42.47  ? 62  LEU A O     1 
ATOM   145  C  CB    . LEU A 1 20  ? -9.337  1.531   42.364  1.00 46.36  ? 62  LEU A CB    1 
ATOM   146  C  CG    . LEU A 1 20  ? -9.857  2.668   41.480  1.00 50.05  ? 62  LEU A CG    1 
ATOM   147  C  CD1   . LEU A 1 20  ? -11.350 2.575   41.329  1.00 55.27  ? 62  LEU A CD1   1 
ATOM   148  C  CD2   . LEU A 1 20  ? -9.493  4.045   42.033  1.00 50.40  ? 62  LEU A CD2   1 
ATOM   149  N  N     . LYS A 1 21  ? -9.341  -0.146  39.475  1.00 45.75  ? 63  LYS A N     1 
ATOM   150  C  CA    . LYS A 1 21  ? -8.872  -0.271  38.106  1.00 42.50  ? 63  LYS A CA    1 
ATOM   151  C  C     . LYS A 1 21  ? -9.530  0.864   37.338  1.00 50.08  ? 63  LYS A C     1 
ATOM   152  O  O     . LYS A 1 21  ? -10.765 0.894   37.197  1.00 41.83  ? 63  LYS A O     1 
ATOM   153  C  CB    . LYS A 1 21  ? -9.248  -1.643  37.545  1.00 47.58  ? 63  LYS A CB    1 
ATOM   154  C  CG    . LYS A 1 21  ? -8.629  -2.026  36.215  1.00 42.50  ? 63  LYS A CG    1 
ATOM   155  C  CD    . LYS A 1 21  ? -8.913  -3.506  35.945  1.00 47.03  ? 63  LYS A CD    1 
ATOM   156  C  CE    . LYS A 1 21  ? -8.222  -4.004  34.697  1.00 45.64  ? 63  LYS A CE    1 
ATOM   157  N  NZ    . LYS A 1 21  ? -8.461  -5.456  34.461  1.00 51.97  ? 63  LYS A NZ    1 
ATOM   158  N  N     . ILE A 1 22  ? -8.730  1.831   36.898  1.00 36.92  ? 64  ILE A N     1 
ATOM   159  C  CA    . ILE A 1 22  ? -9.220  2.918   36.065  1.00 37.89  ? 64  ILE A CA    1 
ATOM   160  C  C     . ILE A 1 22  ? -8.673  2.705   34.658  1.00 43.56  ? 64  ILE A C     1 
ATOM   161  O  O     . ILE A 1 22  ? -7.468  2.461   34.482  1.00 36.79  ? 64  ILE A O     1 
ATOM   162  C  CB    . ILE A 1 22  ? -8.824  4.294   36.619  1.00 34.70  ? 64  ILE A CB    1 
ATOM   163  C  CG1   . ILE A 1 22  ? -9.312  4.428   38.043  1.00 37.90  ? 64  ILE A CG1   1 
ATOM   164  C  CG2   . ILE A 1 22  ? -9.411  5.431   35.760  1.00 29.27  ? 64  ILE A CG2   1 
ATOM   165  C  CD1   . ILE A 1 22  ? -8.980  5.768   38.643  1.00 38.05  ? 64  ILE A CD1   1 
ATOM   166  N  N     . CYS A 1 23  ? -9.563  2.786   33.663  1.00 37.84  ? 65  CYS A N     1 
ATOM   167  C  CA    . CYS A 1 23  ? -9.212  2.645   32.254  1.00 36.29  ? 65  CYS A CA    1 
ATOM   168  C  C     . CYS A 1 23  ? -9.573  3.921   31.507  1.00 34.67  ? 65  CYS A C     1 
ATOM   169  O  O     . CYS A 1 23  ? -10.725 4.372   31.570  1.00 38.06  ? 65  CYS A O     1 
ATOM   170  C  CB    . CYS A 1 23  ? -9.944  1.454   31.627  1.00 38.36  ? 65  CYS A CB    1 
ATOM   171  S  SG    . CYS A 1 23  ? -9.586  1.295   29.871  1.00 46.16  ? 65  CYS A SG    1 
ATOM   172  N  N     . SER A 1 24  ? -8.601  4.489   30.793  1.00 34.69  ? 66  SER A N     1 
ATOM   173  C  CA    . SER A 1 24  ? -8.798  5.692   29.989  1.00 33.40  ? 66  SER A CA    1 
ATOM   174  C  C     . SER A 1 24  ? -8.606  5.369   28.516  1.00 38.58  ? 66  SER A C     1 
ATOM   175  O  O     . SER A 1 24  ? -7.791  4.502   28.177  1.00 41.11  ? 66  SER A O     1 
ATOM   176  C  CB    . SER A 1 24  ? -7.819  6.782   30.384  1.00 39.41  ? 66  SER A CB    1 
ATOM   177  O  OG    . SER A 1 24  ? -8.109  8.003   29.744  1.00 37.71  ? 66  SER A OG    1 
ATOM   178  N  N     . TRP A 1 25  ? -9.337  6.075   27.631  1.00 32.82  ? 67  TRP A N     1 
ATOM   179  C  CA    . TRP A 1 25  ? -9.310  5.723   26.207  1.00 31.64  ? 67  TRP A CA    1 
ATOM   180  C  C     . TRP A 1 25  ? -9.881  6.847   25.342  1.00 35.53  ? 67  TRP A C     1 
ATOM   181  O  O     . TRP A 1 25  ? -11.091 7.102   25.370  1.00 36.66  ? 67  TRP A O     1 
ATOM   182  C  CB    . TRP A 1 25  ? -10.091 4.426   25.976  1.00 34.16  ? 67  TRP A CB    1 
ATOM   183  C  CG    . TRP A 1 25  ? -9.773  3.756   24.643  1.00 39.30  ? 67  TRP A CG    1 
ATOM   184  C  CD1   . TRP A 1 25  ? -9.000  4.266   23.626  1.00 36.37  ? 67  TRP A CD1   1 
ATOM   185  C  CD2   . TRP A 1 25  ? -10.202 2.457   24.202  1.00 37.65  ? 67  TRP A CD2   1 
ATOM   186  N  NE1   . TRP A 1 25  ? -8.921  3.360   22.589  1.00 35.93  ? 67  TRP A NE1   1 
ATOM   187  C  CE2   . TRP A 1 25  ? -9.646  2.244   22.920  1.00 35.76  ? 67  TRP A CE2   1 
ATOM   188  C  CE3   . TRP A 1 25  ? -10.999 1.457   24.766  1.00 41.44  ? 67  TRP A CE3   1 
ATOM   189  C  CZ2   . TRP A 1 25  ? -9.857  1.070   22.199  1.00 35.52  ? 67  TRP A CZ2   1 
ATOM   190  C  CZ3   . TRP A 1 25  ? -11.210 0.296   24.051  1.00 38.09  ? 67  TRP A CZ3   1 
ATOM   191  C  CH2   . TRP A 1 25  ? -10.637 0.109   22.780  1.00 39.28  ? 67  TRP A CH2   1 
ATOM   192  N  N     . ASN A 1 26  ? -9.035  7.472   24.523  1.00 35.41  ? 68  ASN A N     1 
ATOM   193  C  CA    . ASN A 1 26  ? -9.534  8.365   23.468  1.00 36.16  ? 68  ASN A CA    1 
ATOM   194  C  C     . ASN A 1 26  ? -10.140 7.506   22.364  1.00 35.97  ? 68  ASN A C     1 
ATOM   195  O  O     . ASN A 1 26  ? -9.415  6.799   21.661  1.00 35.26  ? 68  ASN A O     1 
ATOM   196  C  CB    . ASN A 1 26  ? -8.411  9.248   22.920  1.00 35.67  ? 68  ASN A CB    1 
ATOM   197  C  CG    . ASN A 1 26  ? -8.874  10.188  21.787  1.00 39.17  ? 68  ASN A CG    1 
ATOM   198  O  OD1   . ASN A 1 26  ? -9.585  9.784   20.861  1.00 42.69  ? 68  ASN A OD1   1 
ATOM   199  N  ND2   . ASN A 1 26  ? -8.441  11.445  21.855  1.00 37.30  ? 68  ASN A ND2   1 
ATOM   200  N  N     . VAL A 1 27  ? -11.466 7.534   22.236  1.00 30.44  ? 69  VAL A N     1 
ATOM   201  C  CA    . VAL A 1 27  ? -12.142 6.640   21.298  1.00 37.55  ? 69  VAL A CA    1 
ATOM   202  C  C     . VAL A 1 27  ? -12.291 7.234   19.901  1.00 39.28  ? 69  VAL A C     1 
ATOM   203  O  O     . VAL A 1 27  ? -12.506 6.472   18.939  1.00 34.10  ? 69  VAL A O     1 
ATOM   204  C  CB    . VAL A 1 27  ? -13.536 6.226   21.806  1.00 38.12  ? 69  VAL A CB    1 
ATOM   205  C  CG1   . VAL A 1 27  ? -13.447 5.550   23.161  1.00 38.57  ? 69  VAL A CG1   1 
ATOM   206  C  CG2   . VAL A 1 27  ? -14.467 7.425   21.863  1.00 40.74  ? 69  VAL A CG2   1 
ATOM   207  N  N     . ASP A 1 28  ? -12.157 8.557   19.760  1.00 37.79  ? 70  ASP A N     1 
ATOM   208  C  CA    . ASP A 1 28  ? -12.141 9.235   18.471  1.00 40.69  ? 70  ASP A CA    1 
ATOM   209  C  C     . ASP A 1 28  ? -13.418 8.900   17.700  1.00 41.62  ? 70  ASP A C     1 
ATOM   210  O  O     . ASP A 1 28  ? -13.388 8.264   16.639  1.00 34.62  ? 70  ASP A O     1 
ATOM   211  C  CB    . ASP A 1 28  ? -10.902 8.850   17.662  1.00 38.32  ? 70  ASP A CB    1 
ATOM   212  C  CG    . ASP A 1 28  ? -10.286 10.042  16.904  1.00 56.69  ? 70  ASP A CG    1 
ATOM   213  O  OD1   . ASP A 1 28  ? -11.006 10.833  16.262  1.00 50.88  ? 70  ASP A OD1   1 
ATOM   214  O  OD2   . ASP A 1 28  ? -9.032  10.193  16.930  1.00 56.74  ? 70  ASP A OD2   1 
ATOM   215  N  N     . GLY A 1 29  ? -14.536 9.338   18.286  1.00 42.88  ? 71  GLY A N     1 
ATOM   216  C  CA    . GLY A 1 29  ? -15.856 9.013   17.769  1.00 41.47  ? 71  GLY A CA    1 
ATOM   217  C  C     . GLY A 1 29  ? -16.472 7.820   18.466  1.00 37.61  ? 71  GLY A C     1 
ATOM   218  O  O     . GLY A 1 29  ? -16.309 6.681   18.014  1.00 37.80  ? 71  GLY A O     1 
ATOM   219  N  N     . LEU A 1 30  ? -17.190 8.094   19.561  1.00 39.23  ? 72  LEU A N     1 
ATOM   220  C  CA    . LEU A 1 30  ? -17.854 7.056   20.346  1.00 40.40  ? 72  LEU A CA    1 
ATOM   221  C  C     . LEU A 1 30  ? -18.673 6.095   19.466  1.00 42.39  ? 72  LEU A C     1 
ATOM   222  O  O     . LEU A 1 30  ? -18.548 4.871   19.593  1.00 38.18  ? 72  LEU A O     1 
ATOM   223  C  CB    . LEU A 1 30  ? -18.727 7.733   21.399  1.00 36.45  ? 72  LEU A CB    1 
ATOM   224  C  CG    . LEU A 1 30  ? -19.651 6.951   22.342  1.00 48.14  ? 72  LEU A CG    1 
ATOM   225  C  CD1   . LEU A 1 30  ? -18.953 5.840   23.058  1.00 41.14  ? 72  LEU A CD1   1 
ATOM   226  C  CD2   . LEU A 1 30  ? -20.257 7.901   23.368  1.00 52.40  ? 72  LEU A CD2   1 
ATOM   227  N  N     . ARG A 1 31  ? -19.484 6.635   18.539  1.00 33.88  ? 73  ARG A N     1 
ATOM   228  C  CA    . ARG A 1 31  ? -20.391 5.794   17.744  1.00 39.81  ? 73  ARG A CA    1 
ATOM   229  C  C     . ARG A 1 31  ? -19.632 4.818   16.844  1.00 35.12  ? 73  ARG A C     1 
ATOM   230  O  O     . ARG A 1 31  ? -19.899 3.609   16.866  1.00 37.21  ? 73  ARG A O     1 
ATOM   231  C  CB    . ARG A 1 31  ? -21.350 6.676   16.938  1.00 37.32  ? 73  ARG A CB    1 
ATOM   232  C  CG    . ARG A 1 31  ? -22.527 7.130   17.830  1.00 47.90  ? 73  ARG A CG    1 
ATOM   233  C  CD    . ARG A 1 31  ? -23.383 8.261   17.240  1.00 45.01  ? 73  ARG A CD    1 
ATOM   234  N  NE    . ARG A 1 31  ? -22.633 9.514   17.105  1.00 41.93  ? 73  ARG A NE    1 
ATOM   235  C  CZ    . ARG A 1 31  ? -23.122 10.614  16.548  1.00 42.91  ? 73  ARG A CZ    1 
ATOM   236  N  NH1   . ARG A 1 31  ? -24.351 10.624  16.066  1.00 44.49  ? 73  ARG A NH1   1 
ATOM   237  N  NH2   . ARG A 1 31  ? -22.377 11.698  16.454  1.00 44.18  ? 73  ARG A NH2   1 
ATOM   238  N  N     . ALA A 1 32  ? -18.630 5.313   16.105  1.00 33.41  ? 74  ALA A N     1 
ATOM   239  C  CA    . ALA A 1 32  ? -17.727 4.427   15.355  1.00 35.84  ? 74  ALA A CA    1 
ATOM   240  C  C     . ALA A 1 32  ? -16.977 3.430   16.242  1.00 33.75  ? 74  ALA A C     1 
ATOM   241  O  O     . ALA A 1 32  ? -16.765 2.282   15.842  1.00 35.72  ? 74  ALA A O     1 
ATOM   242  C  CB    . ALA A 1 32  ? -16.722 5.246   14.556  1.00 32.09  ? 74  ALA A CB    1 
ATOM   243  N  N     . TRP A 1 33  ? -16.484 3.862   17.411  1.00 40.07  ? 75  TRP A N     1 
ATOM   244  C  CA    . TRP A 1 33  ? -15.728 2.951   18.278  1.00 37.14  ? 75  TRP A CA    1 
ATOM   245  C  C     . TRP A 1 33  ? -16.609 1.791   18.766  1.00 39.55  ? 75  TRP A C     1 
ATOM   246  O  O     . TRP A 1 33  ? -16.186 0.628   18.752  1.00 43.34  ? 75  TRP A O     1 
ATOM   247  C  CB    . TRP A 1 33  ? -15.146 3.763   19.438  1.00 41.66  ? 75  TRP A CB    1 
ATOM   248  C  CG    . TRP A 1 33  ? -14.625 3.044   20.629  1.00 33.36  ? 75  TRP A CG    1 
ATOM   249  C  CD1   . TRP A 1 33  ? -13.443 2.390   20.741  1.00 38.58  ? 75  TRP A CD1   1 
ATOM   250  C  CD2   . TRP A 1 33  ? -15.241 2.987   21.905  1.00 36.59  ? 75  TRP A CD2   1 
ATOM   251  N  NE1   . TRP A 1 33  ? -13.290 1.892   22.016  1.00 39.66  ? 75  TRP A NE1   1 
ATOM   252  C  CE2   . TRP A 1 33  ? -14.386 2.252   22.753  1.00 40.47  ? 75  TRP A CE2   1 
ATOM   253  C  CE3   . TRP A 1 33  ? -16.439 3.488   22.422  1.00 38.56  ? 75  TRP A CE3   1 
ATOM   254  C  CZ2   . TRP A 1 33  ? -14.693 1.993   24.092  1.00 37.09  ? 75  TRP A CZ2   1 
ATOM   255  C  CZ3   . TRP A 1 33  ? -16.745 3.233   23.750  1.00 38.85  ? 75  TRP A CZ3   1 
ATOM   256  C  CH2   . TRP A 1 33  ? -15.865 2.491   24.575  1.00 39.60  ? 75  TRP A CH2   1 
ATOM   257  N  N     . ILE A 1 34  ? -17.851 2.091   19.174  1.00 41.50  ? 76  ILE A N     1 
ATOM   258  C  CA    . ILE A 1 34  ? -18.860 1.064   19.467  1.00 38.87  ? 76  ILE A CA    1 
ATOM   259  C  C     . ILE A 1 34  ? -18.974 0.040   18.343  1.00 44.07  ? 76  ILE A C     1 
ATOM   260  O  O     . ILE A 1 34  ? -19.067 -1.167  18.601  1.00 43.04  ? 76  ILE A O     1 
ATOM   261  C  CB    . ILE A 1 34  ? -20.229 1.711   19.715  1.00 41.80  ? 76  ILE A CB    1 
ATOM   262  C  CG1   . ILE A 1 34  ? -20.146 2.731   20.845  1.00 39.93  ? 76  ILE A CG1   1 
ATOM   263  C  CG2   . ILE A 1 34  ? -21.271 0.609   19.959  1.00 41.42  ? 76  ILE A CG2   1 
ATOM   264  C  CD1   . ILE A 1 34  ? -20.446 2.194   22.116  1.00 37.84  ? 76  ILE A CD1   1 
ATOM   265  N  N     . LYS A 1 35  ? -19.077 0.508   17.082  1.00 35.80  ? 77  LYS A N     1 
ATOM   266  C  CA    . LYS A 1 35  ? -19.219 -0.440  15.971  1.00 43.10  ? 77  LYS A CA    1 
ATOM   267  C  C     . LYS A 1 35  ? -17.949 -1.271  15.759  1.00 44.49  ? 77  LYS A C     1 
ATOM   268  O  O     . LYS A 1 35  ? -18.020 -2.404  15.267  1.00 41.36  ? 77  LYS A O     1 
ATOM   269  C  CB    . LYS A 1 35  ? -19.587 0.285   14.667  1.00 40.76  ? 77  LYS A CB    1 
ATOM   270  C  CG    . LYS A 1 35  ? -20.924 1.042   14.691  1.00 45.89  ? 77  LYS A CG    1 
ATOM   271  C  CD    . LYS A 1 35  ? -21.219 1.718   13.348  1.00 52.23  ? 77  LYS A CD    1 
ATOM   272  C  CE    . LYS A 1 35  ? -22.310 2.772   13.466  1.00 54.73  ? 77  LYS A CE    1 
ATOM   273  N  NZ    . LYS A 1 35  ? -22.106 3.803   12.403  1.00 54.24  ? 77  LYS A NZ    1 
ATOM   274  N  N     . LYS A 1 36  ? -16.784 -0.737  16.116  1.00 42.10  ? 78  LYS A N     1 
ATOM   275  C  CA    . LYS A 1 36  ? -15.539 -1.496  16.023  1.00 43.47  ? 78  LYS A CA    1 
ATOM   276  C  C     . LYS A 1 36  ? -15.288 -2.353  17.258  1.00 44.13  ? 78  LYS A C     1 
ATOM   277  O  O     . LYS A 1 36  ? -14.165 -2.846  17.432  1.00 45.81  ? 78  LYS A O     1 
ATOM   278  C  CB    . LYS A 1 36  ? -14.369 -0.545  15.749  1.00 36.40  ? 78  LYS A CB    1 
ATOM   279  C  CG    . LYS A 1 36  ? -14.590 0.218   14.423  1.00 44.18  ? 78  LYS A CG    1 
ATOM   280  C  CD    . LYS A 1 36  ? -13.411 1.075   13.985  1.00 41.23  ? 78  LYS A CD    1 
ATOM   281  C  CE    . LYS A 1 36  ? -13.579 2.476   14.498  1.00 38.36  ? 78  LYS A CE    1 
ATOM   282  N  NZ    . LYS A 1 36  ? -12.552 3.356   13.903  1.00 42.99  ? 78  LYS A NZ    1 
ATOM   283  N  N     . LYS A 1 37  ? -16.316 -2.540  18.104  1.00 39.99  ? 79  LYS A N     1 
ATOM   284  C  CA    . LYS A 1 37  ? -16.332 -3.508  19.203  1.00 45.45  ? 79  LYS A CA    1 
ATOM   285  C  C     . LYS A 1 37  ? -15.538 -3.049  20.419  1.00 43.75  ? 79  LYS A C     1 
ATOM   286  O  O     . LYS A 1 37  ? -15.063 -3.874  21.201  1.00 42.96  ? 79  LYS A O     1 
ATOM   287  C  CB    . LYS A 1 37  ? -15.811 -4.867  18.738  1.00 44.31  ? 79  LYS A CB    1 
ATOM   288  C  CG    . LYS A 1 37  ? -16.901 -5.852  18.360  1.00 54.16  ? 79  LYS A CG    1 
ATOM   289  C  CD    . LYS A 1 37  ? -17.330 -5.728  16.908  1.00 54.43  ? 79  LYS A CD    1 
ATOM   290  C  CE    . LYS A 1 37  ? -18.617 -6.506  16.663  1.00 60.84  ? 79  LYS A CE    1 
ATOM   291  N  NZ    . LYS A 1 37  ? -19.411 -5.915  15.542  1.00 64.59  ? 79  LYS A NZ    1 
ATOM   292  N  N     . GLY A 1 38  ? -15.425 -1.734  20.614  1.00 49.87  ? 80  GLY A N     1 
ATOM   293  C  CA    . GLY A 1 38  ? -14.641 -1.220  21.730  1.00 45.12  ? 80  GLY A CA    1 
ATOM   294  C  C     . GLY A 1 38  ? -15.280 -1.476  23.082  1.00 46.45  ? 80  GLY A C     1 
ATOM   295  O  O     . GLY A 1 38  ? -14.574 -1.608  24.086  1.00 42.23  ? 80  GLY A O     1 
ATOM   296  N  N     . LEU A 1 39  ? -16.618 -1.548  23.134  1.00 43.11  ? 81  LEU A N     1 
ATOM   297  C  CA    . LEU A 1 39  ? -17.284 -1.896  24.383  1.00 39.28  ? 81  LEU A CA    1 
ATOM   298  C  C     . LEU A 1 39  ? -17.092 -3.361  24.721  1.00 43.24  ? 81  LEU A C     1 
ATOM   299  O  O     . LEU A 1 39  ? -17.036 -3.712  25.905  1.00 43.91  ? 81  LEU A O     1 
ATOM   300  C  CB    . LEU A 1 39  ? -18.779 -1.580  24.322  1.00 41.15  ? 81  LEU A CB    1 
ATOM   301  C  CG    . LEU A 1 39  ? -19.208 -0.135  24.521  1.00 41.83  ? 81  LEU A CG    1 
ATOM   302  C  CD1   . LEU A 1 39  ? -20.698 -0.089  24.508  1.00 48.26  ? 81  LEU A CD1   1 
ATOM   303  C  CD2   . LEU A 1 39  ? -18.722 0.413   25.831  1.00 44.16  ? 81  LEU A CD2   1 
ATOM   304  N  N     . ASP A 1 40  ? -17.022 -4.230  23.706  1.00 44.43  ? 82  ASP A N     1 
ATOM   305  C  CA    . ASP A 1 40  ? -16.652 -5.624  23.959  1.00 49.11  ? 82  ASP A CA    1 
ATOM   306  C  C     . ASP A 1 40  ? -15.333 -5.705  24.725  1.00 48.35  ? 82  ASP A C     1 
ATOM   307  O  O     . ASP A 1 40  ? -15.201 -6.492  25.665  1.00 52.40  ? 82  ASP A O     1 
ATOM   308  C  CB    . ASP A 1 40  ? -16.527 -6.411  22.647  1.00 52.17  ? 82  ASP A CB    1 
ATOM   309  C  CG    . ASP A 1 40  ? -17.874 -6.695  21.963  1.00 54.71  ? 82  ASP A CG    1 
ATOM   310  O  OD1   . ASP A 1 40  ? -18.949 -6.233  22.424  1.00 52.09  ? 82  ASP A OD1   1 
ATOM   311  O  OD2   . ASP A 1 40  ? -17.831 -7.389  20.920  1.00 57.79  ? 82  ASP A OD2   1 
ATOM   312  N  N     . TRP A 1 41  ? -14.340 -4.901  24.329  1.00 47.34  ? 83  TRP A N     1 
ATOM   313  C  CA    . TRP A 1 41  ? -13.068 -4.907  25.045  1.00 45.34  ? 83  TRP A CA    1 
ATOM   314  C  C     . TRP A 1 41  ? -13.228 -4.363  26.468  1.00 48.01  ? 83  TRP A C     1 
ATOM   315  O  O     . TRP A 1 41  ? -12.622 -4.894  27.404  1.00 49.03  ? 83  TRP A O     1 
ATOM   316  C  CB    . TRP A 1 41  ? -12.007 -4.117  24.262  1.00 41.21  ? 83  TRP A CB    1 
ATOM   317  C  CG    . TRP A 1 41  ? -10.649 -4.220  24.895  1.00 48.53  ? 83  TRP A CG    1 
ATOM   318  C  CD1   . TRP A 1 41  ? -9.668  -5.117  24.590  1.00 47.75  ? 83  TRP A CD1   1 
ATOM   319  C  CD2   . TRP A 1 41  ? -10.140 -3.420  25.973  1.00 44.94  ? 83  TRP A CD2   1 
ATOM   320  N  NE1   . TRP A 1 41  ? -8.583  -4.927  25.410  1.00 51.70  ? 83  TRP A NE1   1 
ATOM   321  C  CE2   . TRP A 1 41  ? -8.845  -3.894  26.266  1.00 45.12  ? 83  TRP A CE2   1 
ATOM   322  C  CE3   . TRP A 1 41  ? -10.655 -2.353  26.717  1.00 43.98  ? 83  TRP A CE3   1 
ATOM   323  C  CZ2   . TRP A 1 41  ? -8.049  -3.332  27.263  1.00 45.98  ? 83  TRP A CZ2   1 
ATOM   324  C  CZ3   . TRP A 1 41  ? -9.874  -1.799  27.711  1.00 46.02  ? 83  TRP A CZ3   1 
ATOM   325  C  CH2   . TRP A 1 41  ? -8.575  -2.286  27.975  1.00 47.18  ? 83  TRP A CH2   1 
ATOM   326  N  N     . VAL A 1 42  ? -14.045 -3.312  26.650  1.00 46.12  ? 84  VAL A N     1 
ATOM   327  C  CA    . VAL A 1 42  ? -14.258 -2.726  27.977  1.00 40.25  ? 84  VAL A CA    1 
ATOM   328  C  C     . VAL A 1 42  ? -14.903 -3.739  28.906  1.00 43.76  ? 84  VAL A C     1 
ATOM   329  O  O     . VAL A 1 42  ? -14.555 -3.829  30.090  1.00 50.37  ? 84  VAL A O     1 
ATOM   330  C  CB    . VAL A 1 42  ? -15.115 -1.446  27.874  1.00 39.35  ? 84  VAL A CB    1 
ATOM   331  C  CG1   . VAL A 1 42  ? -15.614 -1.018  29.244  1.00 33.07  ? 84  VAL A CG1   1 
ATOM   332  C  CG2   . VAL A 1 42  ? -14.355 -0.324  27.195  1.00 37.92  ? 84  VAL A CG2   1 
ATOM   333  N  N     . LYS A 1 43  ? -15.847 -4.524  28.380  1.00 45.37  ? 85  LYS A N     1 
ATOM   334  C  CA    . LYS A 1 43  ? -16.516 -5.564  29.156  1.00 47.70  ? 85  LYS A CA    1 
ATOM   335  C  C     . LYS A 1 43  ? -15.514 -6.584  29.688  1.00 48.04  ? 85  LYS A C     1 
ATOM   336  O  O     . LYS A 1 43  ? -15.575 -6.973  30.860  1.00 48.32  ? 85  LYS A O     1 
ATOM   337  C  CB    . LYS A 1 43  ? -17.586 -6.255  28.291  1.00 45.62  ? 85  LYS A CB    1 
ATOM   338  C  CG    . LYS A 1 43  ? -18.951 -5.510  28.137  1.00 52.92  ? 85  LYS A CG    1 
ATOM   339  C  CD    . LYS A 1 43  ? -19.897 -6.283  27.185  1.00 57.75  ? 85  LYS A CD    1 
ATOM   340  C  CE    . LYS A 1 43  ? -21.378 -5.931  27.338  1.00 65.05  ? 85  LYS A CE    1 
ATOM   341  N  NZ    . LYS A 1 43  ? -22.257 -6.949  26.657  1.00 64.25  ? 85  LYS A NZ    1 
ATOM   342  N  N     . GLU A 1 44  ? -14.580 -7.030  28.835  1.00 48.24  ? 86  GLU A N     1 
ATOM   343  C  CA    . GLU A 1 44  ? -13.547 -7.972  29.272  1.00 47.42  ? 86  GLU A CA    1 
ATOM   344  C  C     . GLU A 1 44  ? -12.581 -7.325  30.265  1.00 46.81  ? 86  GLU A C     1 
ATOM   345  O  O     . GLU A 1 44  ? -12.249 -7.923  31.297  1.00 47.23  ? 86  GLU A O     1 
ATOM   346  C  CB    . GLU A 1 44  ? -12.801 -8.529  28.058  1.00 49.43  ? 86  GLU A CB    1 
ATOM   347  C  CG    . GLU A 1 44  ? -13.771 -8.972  26.936  1.00 57.31  ? 86  GLU A CG    1 
ATOM   348  C  CD    . GLU A 1 44  ? -13.129 -9.747  25.772  1.00 71.82  ? 86  GLU A CD    1 
ATOM   349  O  OE1   . GLU A 1 44  ? -13.637 -10.854 25.459  1.00 77.03  ? 86  GLU A OE1   1 
ATOM   350  O  OE2   . GLU A 1 44  ? -12.144 -9.256  25.152  1.00 65.51  ? 86  GLU A OE2   1 
ATOM   351  N  N     . GLU A 1 45  ? -12.147 -6.094  30.000  1.00 43.56  ? 87  GLU A N     1 
ATOM   352  C  CA    . GLU A 1 45  ? -11.197 -5.462  30.909  1.00 48.56  ? 87  GLU A CA    1 
ATOM   353  C  C     . GLU A 1 45  ? -11.827 -5.147  32.262  1.00 47.49  ? 87  GLU A C     1 
ATOM   354  O  O     . GLU A 1 45  ? -11.101 -5.052  33.263  1.00 50.65  ? 87  GLU A O     1 
ATOM   355  C  CB    . GLU A 1 45  ? -10.605 -4.203  30.253  1.00 43.55  ? 87  GLU A CB    1 
ATOM   356  C  CG    . GLU A 1 45  ? -9.674  -3.380  31.127  1.00 46.71  ? 87  GLU A CG    1 
ATOM   357  C  CD    . GLU A 1 45  ? -8.171  -3.692  30.962  1.00 47.50  ? 87  GLU A CD    1 
ATOM   358  O  OE1   . GLU A 1 45  ? -7.388  -3.146  31.757  1.00 47.98  ? 87  GLU A OE1   1 
ATOM   359  O  OE2   . GLU A 1 45  ? -7.764  -4.463  30.063  1.00 48.73  ? 87  GLU A OE2   1 
ATOM   360  N  N     . ALA A 1 46  ? -13.153 -5.028  32.311  1.00 44.10  ? 88  ALA A N     1 
ATOM   361  C  CA    . ALA A 1 46  ? -13.925 -4.839  33.539  1.00 42.04  ? 88  ALA A CA    1 
ATOM   362  C  C     . ALA A 1 46  ? -13.349 -3.824  34.533  1.00 42.56  ? 88  ALA A C     1 
ATOM   363  O  O     . ALA A 1 46  ? -12.976 -4.173  35.655  1.00 40.26  ? 88  ALA A O     1 
ATOM   364  C  CB    . ALA A 1 46  ? -14.152 -6.184  34.219  1.00 38.18  ? 88  ALA A CB    1 
ATOM   365  N  N     . PRO A 1 47  ? -13.263 -2.552  34.148  1.00 41.36  ? 89  PRO A N     1 
ATOM   366  C  CA    . PRO A 1 47  ? -12.770 -1.530  35.068  1.00 40.21  ? 89  PRO A CA    1 
ATOM   367  C  C     . PRO A 1 47  ? -13.857 -0.983  35.988  1.00 45.40  ? 89  PRO A C     1 
ATOM   368  O  O     . PRO A 1 47  ? -15.053 -1.092  35.717  1.00 51.50  ? 89  PRO A O     1 
ATOM   369  C  CB    . PRO A 1 47  ? -12.273 -0.437  34.118  1.00 37.44  ? 89  PRO A CB    1 
ATOM   370  C  CG    . PRO A 1 47  ? -13.128 -0.568  32.931  1.00 44.82  ? 89  PRO A CG    1 
ATOM   371  C  CD    . PRO A 1 47  ? -13.424 -2.026  32.779  1.00 43.41  ? 89  PRO A CD    1 
ATOM   372  N  N     . ASP A 1 48  ? -13.411 -0.326  37.075  1.00 40.62  ? 90  ASP A N     1 
ATOM   373  C  CA    . ASP A 1 48  ? -14.337 0.348   37.988  1.00 40.13  ? 90  ASP A CA    1 
ATOM   374  C  C     . ASP A 1 48  ? -14.713 1.734   37.502  1.00 41.11  ? 90  ASP A C     1 
ATOM   375  O  O     . ASP A 1 48  ? -15.806 2.221   37.804  1.00 47.08  ? 90  ASP A O     1 
ATOM   376  C  CB    . ASP A 1 48  ? -13.747 0.466   39.391  1.00 38.55  ? 90  ASP A CB    1 
ATOM   377  C  CG    . ASP A 1 48  ? -13.214 -0.853  39.906  1.00 55.65  ? 90  ASP A CG    1 
ATOM   378  O  OD1   . ASP A 1 48  ? -14.056 -1.730  40.200  1.00 58.00  ? 90  ASP A OD1   1 
ATOM   379  O  OD2   . ASP A 1 48  ? -11.962 -1.019  40.023  1.00 51.51  ? 90  ASP A OD2   1 
ATOM   380  N  N     . ILE A 1 49  ? -13.828 2.393   36.774  1.00 39.82  ? 91  ILE A N     1 
ATOM   381  C  CA    . ILE A 1 49  ? -14.121 3.687   36.167  1.00 44.20  ? 91  ILE A CA    1 
ATOM   382  C  C     . ILE A 1 49  ? -13.580 3.655   34.742  1.00 42.06  ? 91  ILE A C     1 
ATOM   383  O  O     . ILE A 1 49  ? -12.452 3.193   34.515  1.00 41.57  ? 91  ILE A O     1 
ATOM   384  C  CB    . ILE A 1 49  ? -13.519 4.864   36.969  1.00 43.53  ? 91  ILE A CB    1 
ATOM   385  C  CG1   . ILE A 1 49  ? -14.162 4.987   38.339  1.00 46.58  ? 91  ILE A CG1   1 
ATOM   386  C  CG2   . ILE A 1 49  ? -13.741 6.176   36.284  1.00 40.86  ? 91  ILE A CG2   1 
ATOM   387  C  CD1   . ILE A 1 49  ? -13.304 5.751   39.312  1.00 42.39  ? 91  ILE A CD1   1 
ATOM   388  N  N     . LEU A 1 50  ? -14.400 4.104   33.783  1.00 39.68  ? 92  LEU A N     1 
ATOM   389  C  CA    . LEU A 1 50  ? -14.009 4.258   32.391  1.00 37.84  ? 92  LEU A CA    1 
ATOM   390  C  C     . LEU A 1 50  ? -14.023 5.742   32.037  1.00 38.23  ? 92  LEU A C     1 
ATOM   391  O  O     . LEU A 1 50  ? -14.998 6.447   32.305  1.00 39.23  ? 92  LEU A O     1 
ATOM   392  C  CB    . LEU A 1 50  ? -14.941 3.468   31.459  1.00 41.21  ? 92  LEU A CB    1 
ATOM   393  C  CG    . LEU A 1 50  ? -14.671 3.484   29.935  1.00 36.39  ? 92  LEU A CG    1 
ATOM   394  C  CD1   . LEU A 1 50  ? -13.464 2.603   29.512  1.00 42.28  ? 92  LEU A CD1   1 
ATOM   395  C  CD2   . LEU A 1 50  ? -15.874 3.063   29.156  1.00 37.61  ? 92  LEU A CD2   1 
ATOM   396  N  N     . CYS A 1 51  ? -12.928 6.217   31.461  1.00 41.41  ? 93  CYS A N     1 
ATOM   397  C  CA    . CYS A 1 51  ? -12.813 7.590   30.986  1.00 38.11  ? 93  CYS A CA    1 
ATOM   398  C  C     . CYS A 1 51  ? -12.564 7.550   29.483  1.00 39.76  ? 93  CYS A C     1 
ATOM   399  O  O     . CYS A 1 51  ? -11.611 6.906   29.020  1.00 38.19  ? 93  CYS A O     1 
ATOM   400  C  CB    . CYS A 1 51  ? -11.699 8.338   31.718  1.00 37.63  ? 93  CYS A CB    1 
ATOM   401  S  SG    . CYS A 1 51  ? -12.002 8.452   33.522  1.00 51.17  ? 93  CYS A SG    1 
ATOM   402  N  N     . LEU A 1 52  ? -13.443 8.206   28.726  1.00 33.17  ? 94  LEU A N     1 
ATOM   403  C  CA    . LEU A 1 52  ? -13.368 8.222   27.284  1.00 31.69  ? 94  LEU A CA    1 
ATOM   404  C  C     . LEU A 1 52  ? -13.166 9.658   26.854  1.00 35.05  ? 94  LEU A C     1 
ATOM   405  O  O     . LEU A 1 52  ? -13.750 10.577  27.437  1.00 38.10  ? 94  LEU A O     1 
ATOM   406  C  CB    . LEU A 1 52  ? -14.646 7.647   26.662  1.00 35.68  ? 94  LEU A CB    1 
ATOM   407  C  CG    . LEU A 1 52  ? -15.094 6.349   27.325  1.00 35.99  ? 94  LEU A CG    1 
ATOM   408  C  CD1   . LEU A 1 52  ? -16.550 6.147   27.045  1.00 38.20  ? 94  LEU A CD1   1 
ATOM   409  C  CD2   . LEU A 1 52  ? -14.275 5.150   26.852  1.00 29.28  ? 94  LEU A CD2   1 
ATOM   410  N  N     . GLN A 1 53  ? -12.336 9.850   25.845  1.00 32.16  ? 95  GLN A N     1 
ATOM   411  C  CA    . GLN A 1 53  ? -12.101 11.174  25.302  1.00 38.29  ? 95  GLN A CA    1 
ATOM   412  C  C     . GLN A 1 53  ? -12.444 11.201  23.819  1.00 38.59  ? 95  GLN A C     1 
ATOM   413  O  O     . GLN A 1 53  ? -12.482 10.163  23.151  1.00 35.18  ? 95  GLN A O     1 
ATOM   414  C  CB    . GLN A 1 53  ? -10.640 11.619  25.508  1.00 40.90  ? 95  GLN A CB    1 
ATOM   415  C  CG    . GLN A 1 53  ? -10.218 11.707  26.959  1.00 35.42  ? 95  GLN A CG    1 
ATOM   416  C  CD    . GLN A 1 53  ? -9.843  10.369  27.524  1.00 36.31  ? 95  GLN A CD    1 
ATOM   417  O  OE1   . GLN A 1 53  ? -9.166  9.582   26.874  1.00 37.01  ? 95  GLN A OE1   1 
ATOM   418  N  NE2   . GLN A 1 53  ? -10.283 10.095  28.741  1.00 37.11  ? 95  GLN A NE2   1 
ATOM   419  N  N     . GLU A 1 54  ? -12.663 12.421  23.319  1.00 41.78  ? 96  GLU A N     1 
ATOM   420  C  CA    . GLU A 1 54  ? -12.973 12.702  21.916  1.00 43.11  ? 96  GLU A CA    1 
ATOM   421  C  C     . GLU A 1 54  ? -14.165 11.857  21.453  1.00 46.51  ? 96  GLU A C     1 
ATOM   422  O  O     . GLU A 1 54  ? -14.085 10.935  20.634  1.00 46.98  ? 96  GLU A O     1 
ATOM   423  C  CB    . GLU A 1 54  ? -11.747 12.504  21.020  1.00 41.69  ? 96  GLU A CB    1 
ATOM   424  C  CG    . GLU A 1 54  ? -11.895 13.231  19.670  1.00 44.29  ? 96  GLU A CG    1 
ATOM   425  C  CD    . GLU A 1 54  ? -10.633 13.215  18.827  1.00 48.49  ? 96  GLU A CD    1 
ATOM   426  O  OE1   . GLU A 1 54  ? -10.645 13.866  17.759  1.00 52.76  ? 96  GLU A OE1   1 
ATOM   427  O  OE2   . GLU A 1 54  ? -9.636  12.560  19.215  1.00 46.97  ? 96  GLU A OE2   1 
ATOM   428  N  N     . THR A 1 55  ? -15.296 12.224  22.008  1.00 41.84  ? 97  THR A N     1 
ATOM   429  C  CA    . THR A 1 55  ? -16.465 11.390  21.852  1.00 43.40  ? 97  THR A CA    1 
ATOM   430  C  C     . THR A 1 55  ? -17.280 11.744  20.592  1.00 47.13  ? 97  THR A C     1 
ATOM   431  O  O     . THR A 1 55  ? -17.859 10.848  19.954  1.00 39.42  ? 97  THR A O     1 
ATOM   432  C  CB    . THR A 1 55  ? -17.254 11.482  23.156  1.00 40.39  ? 97  THR A CB    1 
ATOM   433  O  OG1   . THR A 1 55  ? -18.300 10.521  23.134  1.00 53.81  ? 97  THR A OG1   1 
ATOM   434  C  CG2   . THR A 1 55  ? -17.776 12.867  23.408  1.00 38.46  ? 97  THR A CG2   1 
ATOM   435  N  N     . LYS A 1 56  ? -17.264 13.007  20.170  1.00 40.64  ? 98  LYS A N     1 
ATOM   436  C  CA    . LYS A 1 56  ? -17.881 13.407  18.910  1.00 48.23  ? 98  LYS A CA    1 
ATOM   437  C  C     . LYS A 1 56  ? -19.352 12.968  18.855  1.00 47.62  ? 98  LYS A C     1 
ATOM   438  O  O     . LYS A 1 56  ? -19.816 12.385  17.878  1.00 46.48  ? 98  LYS A O     1 
ATOM   439  C  CB    . LYS A 1 56  ? -17.066 12.855  17.727  1.00 44.77  ? 98  LYS A CB    1 
ATOM   440  C  CG    . LYS A 1 56  ? -15.674 13.485  17.590  1.00 44.04  ? 98  LYS A CG    1 
ATOM   441  C  CD    . LYS A 1 56  ? -14.921 12.908  16.390  1.00 47.50  ? 98  LYS A CD    1 
ATOM   442  C  CE    . LYS A 1 56  ? -13.883 13.848  15.794  1.00 44.54  ? 98  LYS A CE    1 
ATOM   443  N  NZ    . LYS A 1 56  ? -13.676 13.491  14.350  1.00 41.24  ? 98  LYS A NZ    1 
ATOM   444  N  N     . CYS A 1 57  ? -20.086 13.242  19.932  1.00 50.24  ? 99  CYS A N     1 
ATOM   445  C  CA    . CYS A 1 57  ? -21.460 12.758  20.072  1.00 50.11  ? 99  CYS A CA    1 
ATOM   446  C  C     . CYS A 1 57  ? -22.182 13.602  21.104  1.00 48.90  ? 99  CYS A C     1 
ATOM   447  O  O     . CYS A 1 57  ? -21.752 13.659  22.255  1.00 50.71  ? 99  CYS A O     1 
ATOM   448  C  CB    . CYS A 1 57  ? -21.482 11.293  20.497  1.00 49.14  ? 99  CYS A CB    1 
ATOM   449  S  SG    . CYS A 1 57  ? -23.142 10.539  20.409  1.00 50.90  ? 99  CYS A SG    1 
ATOM   450  N  N     . SER A 1 58  ? -23.274 14.244  20.710  1.00 54.24  ? 100 SER A N     1 
ATOM   451  C  CA    . SER A 1 58  ? -24.098 14.930  21.696  1.00 57.01  ? 100 SER A CA    1 
ATOM   452  C  C     . SER A 1 58  ? -24.866 13.903  22.527  1.00 57.54  ? 100 SER A C     1 
ATOM   453  O  O     . SER A 1 58  ? -25.066 12.759  22.107  1.00 51.90  ? 100 SER A O     1 
ATOM   454  C  CB    . SER A 1 58  ? -25.055 15.898  21.009  1.00 61.78  ? 100 SER A CB    1 
ATOM   455  O  OG    . SER A 1 58  ? -25.709 15.275  19.907  1.00 64.70  ? 100 SER A OG    1 
ATOM   456  N  N     . GLU A 1 59  ? -25.273 14.306  23.741  1.00 58.87  ? 101 GLU A N     1 
ATOM   457  C  CA    . GLU A 1 59  ? -25.870 13.321  24.638  1.00 58.68  ? 101 GLU A CA    1 
ATOM   458  C  C     . GLU A 1 59  ? -27.222 12.830  24.117  1.00 55.67  ? 101 GLU A C     1 
ATOM   459  O  O     . GLU A 1 59  ? -27.568 11.657  24.312  1.00 60.89  ? 101 GLU A O     1 
ATOM   460  C  CB    . GLU A 1 59  ? -25.988 13.874  26.070  1.00 64.11  ? 101 GLU A CB    1 
ATOM   461  C  CG    . GLU A 1 59  ? -26.684 12.882  27.039  1.00 63.92  ? 101 GLU A CG    1 
ATOM   462  C  CD    . GLU A 1 59  ? -26.629 13.278  28.515  1.00 67.68  ? 101 GLU A CD    1 
ATOM   463  O  OE1   . GLU A 1 59  ? -27.504 12.836  29.304  1.00 62.89  ? 101 GLU A OE1   1 
ATOM   464  O  OE2   . GLU A 1 59  ? -25.696 14.019  28.893  1.00 68.51  ? 101 GLU A OE2   1 
ATOM   465  N  N     . ASN A 1 60  ? -27.981 13.683  23.426  1.00 58.56  ? 102 ASN A N     1 
ATOM   466  C  CA    . ASN A 1 60  ? -29.257 13.237  22.873  1.00 54.57  ? 102 ASN A CA    1 
ATOM   467  C  C     . ASN A 1 60  ? -29.092 12.196  21.770  1.00 56.96  ? 102 ASN A C     1 
ATOM   468  O  O     . ASN A 1 60  ? -30.093 11.609  21.356  1.00 64.33  ? 102 ASN A O     1 
ATOM   469  C  CB    . ASN A 1 60  ? -30.062 14.428  22.344  1.00 55.78  ? 102 ASN A CB    1 
ATOM   470  C  CG    . ASN A 1 60  ? -29.315 15.217  21.260  1.00 69.65  ? 102 ASN A CG    1 
ATOM   471  O  OD1   . ASN A 1 60  ? -29.027 14.695  20.177  1.00 67.09  ? 102 ASN A OD1   1 
ATOM   472  N  ND2   . ASN A 1 60  ? -29.013 16.489  21.547  1.00 68.66  ? 102 ASN A ND2   1 
ATOM   473  N  N     . LYS A 1 61  ? -27.868 11.947  21.290  1.00 59.61  ? 103 LYS A N     1 
ATOM   474  C  CA    . LYS A 1 61  ? -27.592 10.906  20.296  1.00 57.41  ? 103 LYS A CA    1 
ATOM   475  C  C     . LYS A 1 61  ? -26.771 9.744   20.859  1.00 54.18  ? 103 LYS A C     1 
ATOM   476  O  O     . LYS A 1 61  ? -26.233 8.949   20.080  1.00 52.14  ? 103 LYS A O     1 
ATOM   477  C  CB    . LYS A 1 61  ? -26.882 11.494  19.069  1.00 57.55  ? 103 LYS A CB    1 
ATOM   478  C  CG    . LYS A 1 61  ? -27.795 12.265  18.093  1.00 52.31  ? 103 LYS A CG    1 
ATOM   479  C  CD    . LYS A 1 61  ? -27.025 12.786  16.865  1.00 66.51  ? 103 LYS A CD    1 
ATOM   480  C  CE    . LYS A 1 61  ? -27.192 14.301  16.658  1.00 69.07  ? 103 LYS A CE    1 
ATOM   481  N  NZ    . LYS A 1 61  ? -26.009 15.105  17.117  1.00 66.06  ? 103 LYS A NZ    1 
ATOM   482  N  N     . LEU A 1 62  ? -26.687 9.614   22.196  1.00 54.88  ? 104 LEU A N     1 
ATOM   483  C  CA    . LEU A 1 62  ? -25.815 8.604   22.812  1.00 55.04  ? 104 LEU A CA    1 
ATOM   484  C  C     . LEU A 1 62  ? -26.296 7.201   22.475  1.00 47.57  ? 104 LEU A C     1 
ATOM   485  O  O     . LEU A 1 62  ? -27.462 6.884   22.707  1.00 45.25  ? 104 LEU A O     1 
ATOM   486  C  CB    . LEU A 1 62  ? -25.750 8.773   24.331  1.00 46.83  ? 104 LEU A CB    1 
ATOM   487  C  CG    . LEU A 1 62  ? -24.784 9.858   24.815  1.00 55.20  ? 104 LEU A CG    1 
ATOM   488  C  CD1   . LEU A 1 62  ? -24.720 9.942   26.357  1.00 52.48  ? 104 LEU A CD1   1 
ATOM   489  C  CD2   . LEU A 1 62  ? -23.392 9.626   24.200  1.00 51.00  ? 104 LEU A CD2   1 
ATOM   490  N  N     . PRO A 1 63  ? -25.420 6.325   21.989  1.00 53.05  ? 105 PRO A N     1 
ATOM   491  C  CA    . PRO A 1 63  ? -25.860 5.020   21.480  1.00 53.04  ? 105 PRO A CA    1 
ATOM   492  C  C     . PRO A 1 63  ? -26.507 4.172   22.566  1.00 55.49  ? 105 PRO A C     1 
ATOM   493  O  O     . PRO A 1 63  ? -26.248 4.338   23.764  1.00 53.90  ? 105 PRO A O     1 
ATOM   494  C  CB    . PRO A 1 63  ? -24.559 4.376   20.975  1.00 49.06  ? 105 PRO A CB    1 
ATOM   495  C  CG    . PRO A 1 63  ? -23.583 5.507   20.855  1.00 41.61  ? 105 PRO A CG    1 
ATOM   496  C  CD    . PRO A 1 63  ? -23.960 6.462   21.947  1.00 44.25  ? 105 PRO A CD    1 
ATOM   497  N  N     . ALA A 1 64  ? -27.363 3.245   22.124  1.00 48.89  ? 106 ALA A N     1 
ATOM   498  C  CA    . ALA A 1 64  ? -28.149 2.454   23.060  1.00 54.21  ? 106 ALA A CA    1 
ATOM   499  C  C     . ALA A 1 64  ? -27.297 1.438   23.800  1.00 50.75  ? 106 ALA A C     1 
ATOM   500  O  O     . ALA A 1 64  ? -27.663 1.043   24.913  1.00 47.49  ? 106 ALA A O     1 
ATOM   501  C  CB    . ALA A 1 64  ? -29.307 1.751   22.330  1.00 52.09  ? 106 ALA A CB    1 
ATOM   502  N  N     . GLU A 1 65  ? -26.170 1.009   23.218  1.00 48.75  ? 107 GLU A N     1 
ATOM   503  C  CA    . GLU A 1 65  ? -25.300 0.059   23.911  1.00 49.77  ? 107 GLU A CA    1 
ATOM   504  C  C     . GLU A 1 65  ? -24.790 0.591   25.252  1.00 49.15  ? 107 GLU A C     1 
ATOM   505  O  O     . GLU A 1 65  ? -24.437 -0.204  26.131  1.00 47.80  ? 107 GLU A O     1 
ATOM   506  C  CB    . GLU A 1 65  ? -24.117 -0.321  23.024  1.00 48.60  ? 107 GLU A CB    1 
ATOM   507  C  CG    . GLU A 1 65  ? -24.488 -1.122  21.798  1.00 50.29  ? 107 GLU A CG    1 
ATOM   508  C  CD    . GLU A 1 65  ? -24.909 -0.245  20.644  1.00 51.13  ? 107 GLU A CD    1 
ATOM   509  O  OE1   . GLU A 1 65  ? -25.403 0.879   20.892  1.00 52.96  ? 107 GLU A OE1   1 
ATOM   510  O  OE2   . GLU A 1 65  ? -24.731 -0.676  19.485  1.00 48.66  ? 107 GLU A OE2   1 
ATOM   511  N  N     . LEU A 1 66  ? -24.760 1.908   25.453  1.00 44.54  ? 108 LEU A N     1 
ATOM   512  C  CA    . LEU A 1 66  ? -24.279 2.395   26.743  1.00 48.20  ? 108 LEU A CA    1 
ATOM   513  C  C     . LEU A 1 66  ? -25.237 2.056   27.874  1.00 47.93  ? 108 LEU A C     1 
ATOM   514  O  O     . LEU A 1 66  ? -24.853 2.140   29.041  1.00 47.88  ? 108 LEU A O     1 
ATOM   515  C  CB    . LEU A 1 66  ? -23.999 3.900   26.664  1.00 36.61  ? 108 LEU A CB    1 
ATOM   516  C  CG    . LEU A 1 66  ? -22.871 4.119   25.648  1.00 41.51  ? 108 LEU A CG    1 
ATOM   517  C  CD1   . LEU A 1 66  ? -22.467 5.560   25.518  1.00 47.90  ? 108 LEU A CD1   1 
ATOM   518  C  CD2   . LEU A 1 66  ? -21.669 3.252   25.988  1.00 45.82  ? 108 LEU A CD2   1 
ATOM   519  N  N     . GLN A 1 67  ? -26.447 1.642   27.545  1.00 48.16  ? 109 GLN A N     1 
ATOM   520  C  CA    . GLN A 1 67  ? -27.429 1.135   28.488  1.00 48.42  ? 109 GLN A CA    1 
ATOM   521  C  C     . GLN A 1 67  ? -27.221 -0.339  28.827  1.00 44.89  ? 109 GLN A C     1 
ATOM   522  O  O     . GLN A 1 67  ? -27.980 -0.872  29.637  1.00 52.47  ? 109 GLN A O     1 
ATOM   523  C  CB    . GLN A 1 67  ? -28.849 1.341   27.914  1.00 50.86  ? 109 GLN A CB    1 
ATOM   524  C  CG    . GLN A 1 67  ? -29.298 2.799   27.755  1.00 48.96  ? 109 GLN A CG    1 
ATOM   525  C  CD    . GLN A 1 67  ? -30.696 2.932   27.144  1.00 64.59  ? 109 GLN A CD    1 
ATOM   526  O  OE1   . GLN A 1 67  ? -31.666 3.284   27.834  1.00 69.18  ? 109 GLN A OE1   1 
ATOM   527  N  NE2   . GLN A 1 67  ? -30.802 2.660   25.844  1.00 50.31  ? 109 GLN A NE2   1 
ATOM   528  N  N     . GLU A 1 68  ? -26.244 -1.017  28.222  1.00 47.33  ? 110 GLU A N     1 
ATOM   529  C  CA    . GLU A 1 68  ? -25.975 -2.431  28.489  1.00 49.88  ? 110 GLU A CA    1 
ATOM   530  C  C     . GLU A 1 68  ? -24.635 -2.620  29.216  1.00 55.74  ? 110 GLU A C     1 
ATOM   531  O  O     . GLU A 1 68  ? -23.884 -3.572  28.960  1.00 53.03  ? 110 GLU A O     1 
ATOM   532  C  CB    . GLU A 1 68  ? -26.031 -3.247  27.193  1.00 55.05  ? 110 GLU A CB    1 
ATOM   533  C  CG    . GLU A 1 68  ? -24.825 -3.061  26.265  1.00 60.76  ? 110 GLU A CG    1 
ATOM   534  C  CD    . GLU A 1 68  ? -24.848 -3.923  25.010  1.00 72.40  ? 110 GLU A CD    1 
ATOM   535  O  OE1   . GLU A 1 68  ? -25.961 -4.166  24.467  1.00 74.62  ? 110 GLU A OE1   1 
ATOM   536  O  OE2   . GLU A 1 68  ? -23.742 -4.337  24.563  1.00 67.15  ? 110 GLU A OE2   1 
ATOM   537  N  N     . LEU A 1 69  ? -24.328 -1.720  30.162  1.00 51.50  ? 111 LEU A N     1 
ATOM   538  C  CA    . LEU A 1 69  ? -23.092 -1.769  30.943  1.00 55.59  ? 111 LEU A CA    1 
ATOM   539  C  C     . LEU A 1 69  ? -23.472 -1.793  32.414  1.00 50.33  ? 111 LEU A C     1 
ATOM   540  O  O     . LEU A 1 69  ? -23.433 -0.754  33.089  1.00 49.25  ? 111 LEU A O     1 
ATOM   541  C  CB    . LEU A 1 69  ? -22.176 -0.586  30.634  1.00 51.78  ? 111 LEU A CB    1 
ATOM   542  C  CG    . LEU A 1 69  ? -21.597 -0.611  29.218  1.00 53.26  ? 111 LEU A CG    1 
ATOM   543  C  CD1   . LEU A 1 69  ? -20.895 0.686   28.914  1.00 49.57  ? 111 LEU A CD1   1 
ATOM   544  C  CD2   . LEU A 1 69  ? -20.636 -1.783  29.066  1.00 54.79  ? 111 LEU A CD2   1 
ATOM   545  N  N     . PRO A 1 70  ? -23.800 -2.965  32.954  1.00 51.93  ? 112 PRO A N     1 
ATOM   546  C  CA    . PRO A 1 70  ? -24.256 -3.015  34.356  1.00 55.16  ? 112 PRO A CA    1 
ATOM   547  C  C     . PRO A 1 70  ? -23.197 -2.563  35.359  1.00 55.88  ? 112 PRO A C     1 
ATOM   548  O  O     . PRO A 1 70  ? -23.517 -1.826  36.312  1.00 48.33  ? 112 PRO A O     1 
ATOM   549  C  CB    . PRO A 1 70  ? -24.632 -4.493  34.547  1.00 48.31  ? 112 PRO A CB    1 
ATOM   550  C  CG    . PRO A 1 70  ? -23.896 -5.251  33.445  1.00 55.38  ? 112 PRO A CG    1 
ATOM   551  C  CD    . PRO A 1 70  ? -23.336 -4.271  32.456  1.00 55.84  ? 112 PRO A CD    1 
ATOM   552  N  N     . GLY A 1 71  ? -21.935 -2.984  35.168  1.00 56.23  ? 113 GLY A N     1 
ATOM   553  C  CA    . GLY A 1 71  ? -20.850 -2.596  36.058  1.00 49.14  ? 113 GLY A CA    1 
ATOM   554  C  C     . GLY A 1 71  ? -20.378 -1.166  35.911  1.00 51.63  ? 113 GLY A C     1 
ATOM   555  O  O     . GLY A 1 71  ? -19.409 -0.788  36.575  1.00 47.57  ? 113 GLY A O     1 
ATOM   556  N  N     . LEU A 1 72  ? -21.033 -0.360  35.068  1.00 50.35  ? 114 LEU A N     1 
ATOM   557  C  CA    . LEU A 1 72  ? -20.641 1.027   34.825  1.00 47.27  ? 114 LEU A CA    1 
ATOM   558  C  C     . LEU A 1 72  ? -21.889 1.920   34.722  1.00 48.83  ? 114 LEU A C     1 
ATOM   559  O  O     . LEU A 1 72  ? -22.031 2.747   33.816  1.00 48.55  ? 114 LEU A O     1 
ATOM   560  C  CB    . LEU A 1 72  ? -19.750 1.088   33.576  1.00 42.20  ? 114 LEU A CB    1 
ATOM   561  C  CG    . LEU A 1 72  ? -18.352 0.420   33.642  1.00 40.81  ? 114 LEU A CG    1 
ATOM   562  C  CD1   . LEU A 1 72  ? -17.679 0.442   32.271  1.00 38.94  ? 114 LEU A CD1   1 
ATOM   563  C  CD2   . LEU A 1 72  ? -17.452 1.088   34.664  1.00 41.54  ? 114 LEU A CD2   1 
ATOM   564  N  N     . SER A 1 73  ? -22.799 1.784   35.690  1.00 45.12  ? 115 SER A N     1 
ATOM   565  C  CA    . SER A 1 73  ? -24.136 2.355   35.547  1.00 47.52  ? 115 SER A CA    1 
ATOM   566  C  C     . SER A 1 73  ? -24.203 3.863   35.770  1.00 53.61  ? 115 SER A C     1 
ATOM   567  O  O     . SER A 1 73  ? -25.211 4.485   35.401  1.00 49.80  ? 115 SER A O     1 
ATOM   568  C  CB    . SER A 1 73  ? -25.117 1.668   36.504  1.00 47.45  ? 115 SER A CB    1 
ATOM   569  O  OG    . SER A 1 73  ? -24.603 1.602   37.817  1.00 57.65  ? 115 SER A OG    1 
ATOM   570  N  N     . HIS A 1 74  ? -23.186 4.474   36.353  1.00 42.98  ? 116 HIS A N     1 
ATOM   571  C  CA    . HIS A 1 74  ? -23.217 5.906   36.610  1.00 45.03  ? 116 HIS A CA    1 
ATOM   572  C  C     . HIS A 1 74  ? -22.403 6.627   35.540  1.00 46.85  ? 116 HIS A C     1 
ATOM   573  O  O     . HIS A 1 74  ? -21.176 6.502   35.488  1.00 45.07  ? 116 HIS A O     1 
ATOM   574  C  CB    . HIS A 1 74  ? -22.703 6.198   38.013  1.00 50.51  ? 116 HIS A CB    1 
ATOM   575  C  CG    . HIS A 1 74  ? -23.568 5.621   39.086  1.00 53.22  ? 116 HIS A CG    1 
ATOM   576  N  ND1   . HIS A 1 74  ? -23.402 4.338   39.566  1.00 53.65  ? 116 HIS A ND1   1 
ATOM   577  C  CD2   . HIS A 1 74  ? -24.615 6.147   39.762  1.00 50.88  ? 116 HIS A CD2   1 
ATOM   578  C  CE1   . HIS A 1 74  ? -24.304 4.104   40.500  1.00 53.81  ? 116 HIS A CE1   1 
ATOM   579  N  NE2   . HIS A 1 74  ? -25.054 5.184   40.637  1.00 57.96  ? 116 HIS A NE2   1 
ATOM   580  N  N     . GLN A 1 75  ? -23.089 7.383   34.693  1.00 44.62  ? 117 GLN A N     1 
ATOM   581  C  CA    . GLN A 1 75  ? -22.493 7.948   33.491  1.00 46.50  ? 117 GLN A CA    1 
ATOM   582  C  C     . GLN A 1 75  ? -22.721 9.454   33.434  1.00 46.74  ? 117 GLN A C     1 
ATOM   583  O  O     . GLN A 1 75  ? -23.794 9.951   33.780  1.00 47.22  ? 117 GLN A O     1 
ATOM   584  C  CB    . GLN A 1 75  ? -23.050 7.267   32.230  1.00 39.46  ? 117 GLN A CB    1 
ATOM   585  C  CG    . GLN A 1 75  ? -22.900 5.740   32.239  1.00 42.40  ? 117 GLN A CG    1 
ATOM   586  C  CD    . GLN A 1 75  ? -23.569 5.080   31.042  1.00 42.75  ? 117 GLN A CD    1 
ATOM   587  O  OE1   . GLN A 1 75  ? -24.105 5.757   30.167  1.00 44.44  ? 117 GLN A OE1   1 
ATOM   588  N  NE2   . GLN A 1 75  ? -23.550 3.752   31.006  1.00 38.31  ? 117 GLN A NE2   1 
ATOM   589  N  N     . TYR A 1 76  ? -21.684 10.173  33.021  1.00 45.09  ? 118 TYR A N     1 
ATOM   590  C  CA    . TYR A 1 76  ? -21.643 11.624  33.037  1.00 43.01  ? 118 TYR A CA    1 
ATOM   591  C  C     . TYR A 1 76  ? -20.998 12.087  31.735  1.00 42.62  ? 118 TYR A C     1 
ATOM   592  O  O     . TYR A 1 76  ? -19.999 11.514  31.295  1.00 43.37  ? 118 TYR A O     1 
ATOM   593  C  CB    . TYR A 1 76  ? -20.858 12.110  34.281  1.00 43.60  ? 118 TYR A CB    1 
ATOM   594  C  CG    . TYR A 1 76  ? -21.348 11.466  35.564  1.00 45.26  ? 118 TYR A CG    1 
ATOM   595  C  CD1   . TYR A 1 76  ? -20.868 10.219  35.976  1.00 45.13  ? 118 TYR A CD1   1 
ATOM   596  C  CD2   . TYR A 1 76  ? -22.311 12.088  36.349  1.00 47.00  ? 118 TYR A CD2   1 
ATOM   597  C  CE1   . TYR A 1 76  ? -21.337 9.608   37.132  1.00 41.59  ? 118 TYR A CE1   1 
ATOM   598  C  CE2   . TYR A 1 76  ? -22.784 11.490  37.512  1.00 46.20  ? 118 TYR A CE2   1 
ATOM   599  C  CZ    . TYR A 1 76  ? -22.300 10.257  37.895  1.00 48.03  ? 118 TYR A CZ    1 
ATOM   600  O  OH    . TYR A 1 76  ? -22.799 9.690   39.045  1.00 49.45  ? 118 TYR A OH    1 
ATOM   601  N  N     . TRP A 1 77  ? -21.580 13.095  31.087  1.00 48.47  ? 119 TRP A N     1 
ATOM   602  C  CA    . TRP A 1 77  ? -21.095 13.505  29.772  1.00 45.93  ? 119 TRP A CA    1 
ATOM   603  C  C     . TRP A 1 77  ? -20.962 15.018  29.691  1.00 43.83  ? 119 TRP A C     1 
ATOM   604  O  O     . TRP A 1 77  ? -21.727 15.772  30.300  1.00 47.27  ? 119 TRP A O     1 
ATOM   605  C  CB    . TRP A 1 77  ? -22.017 12.984  28.649  1.00 46.75  ? 119 TRP A CB    1 
ATOM   606  C  CG    . TRP A 1 77  ? -22.268 11.519  28.762  1.00 41.32  ? 119 TRP A CG    1 
ATOM   607  C  CD1   . TRP A 1 77  ? -23.268 10.919  29.460  1.00 42.31  ? 119 TRP A CD1   1 
ATOM   608  C  CD2   . TRP A 1 77  ? -21.484 10.461  28.194  1.00 41.01  ? 119 TRP A CD2   1 
ATOM   609  N  NE1   . TRP A 1 77  ? -23.176 9.550   29.348  1.00 41.61  ? 119 TRP A NE1   1 
ATOM   610  C  CE2   . TRP A 1 77  ? -22.084 9.241   28.584  1.00 40.52  ? 119 TRP A CE2   1 
ATOM   611  C  CE3   . TRP A 1 77  ? -20.343 10.425  27.384  1.00 42.99  ? 119 TRP A CE3   1 
ATOM   612  C  CZ2   . TRP A 1 77  ? -21.586 8.001   28.190  1.00 40.15  ? 119 TRP A CZ2   1 
ATOM   613  C  CZ3   . TRP A 1 77  ? -19.854 9.181   26.979  1.00 40.61  ? 119 TRP A CZ3   1 
ATOM   614  C  CH2   . TRP A 1 77  ? -20.472 7.991   27.390  1.00 39.11  ? 119 TRP A CH2   1 
ATOM   615  N  N     . SER A 1 78  ? -19.971 15.456  28.927  1.00 44.67  ? 120 SER A N     1 
ATOM   616  C  CA    . SER A 1 78  ? -19.744 16.873  28.666  1.00 47.84  ? 120 SER A CA    1 
ATOM   617  C  C     . SER A 1 78  ? -19.532 17.046  27.168  1.00 47.85  ? 120 SER A C     1 
ATOM   618  O  O     . SER A 1 78  ? -18.503 16.613  26.632  1.00 43.97  ? 120 SER A O     1 
ATOM   619  C  CB    . SER A 1 78  ? -18.539 17.390  29.446  1.00 38.92  ? 120 SER A CB    1 
ATOM   620  O  OG    . SER A 1 78  ? -18.506 18.799  29.439  1.00 53.32  ? 120 SER A OG    1 
ATOM   621  N  N     . ALA A 1 79  ? -20.515 17.661  26.489  1.00 50.61  ? 121 ALA A N     1 
ATOM   622  C  CA    . ALA A 1 79  ? -20.434 18.019  25.078  1.00 50.57  ? 121 ALA A CA    1 
ATOM   623  C  C     . ALA A 1 79  ? -20.060 19.484  24.939  1.00 54.31  ? 121 ALA A C     1 
ATOM   624  O  O     . ALA A 1 79  ? -20.232 20.273  25.877  1.00 53.81  ? 121 ALA A O     1 
ATOM   625  C  CB    . ALA A 1 79  ? -21.773 17.768  24.379  1.00 49.60  ? 121 ALA A CB    1 
ATOM   626  N  N     . PRO A 1 80  ? -19.512 19.892  23.796  1.00 54.62  ? 122 PRO A N     1 
ATOM   627  C  CA    . PRO A 1 80  ? -19.344 21.327  23.551  1.00 57.20  ? 122 PRO A CA    1 
ATOM   628  C  C     . PRO A 1 80  ? -20.698 21.992  23.333  1.00 57.81  ? 122 PRO A C     1 
ATOM   629  O  O     . PRO A 1 80  ? -21.721 21.334  23.127  1.00 55.85  ? 122 PRO A O     1 
ATOM   630  C  CB    . PRO A 1 80  ? -18.469 21.382  22.293  1.00 51.77  ? 122 PRO A CB    1 
ATOM   631  C  CG    . PRO A 1 80  ? -18.627 20.054  21.651  1.00 52.06  ? 122 PRO A CG    1 
ATOM   632  C  CD    . PRO A 1 80  ? -18.854 19.076  22.765  1.00 51.04  ? 122 PRO A CD    1 
ATOM   633  N  N     . SER A 1 81  ? -20.701 23.323  23.427  1.00 56.72  ? 123 SER A N     1 
ATOM   634  C  CA    . SER A 1 81  ? -21.925 24.091  23.239  1.00 61.23  ? 123 SER A CA    1 
ATOM   635  C  C     . SER A 1 81  ? -22.150 24.451  21.771  1.00 76.41  ? 123 SER A C     1 
ATOM   636  O  O     . SER A 1 81  ? -23.269 24.310  21.252  1.00 70.90  ? 123 SER A O     1 
ATOM   637  C  CB    . SER A 1 81  ? -21.880 25.368  24.083  1.00 63.31  ? 123 SER A CB    1 
ATOM   638  O  OG    . SER A 1 81  ? -21.343 25.131  25.375  1.00 56.92  ? 123 SER A OG    1 
ATOM   639  N  N     . ASP A 1 82  ? -21.106 24.895  21.079  1.00 71.56  ? 124 ASP A N     1 
ATOM   640  C  CA    . ASP A 1 82  ? -21.254 25.312  19.696  1.00 71.92  ? 124 ASP A CA    1 
ATOM   641  C  C     . ASP A 1 82  ? -21.026 24.154  18.731  1.00 77.67  ? 124 ASP A C     1 
ATOM   642  O  O     . ASP A 1 82  ? -21.921 23.807  17.955  1.00 84.95  ? 124 ASP A O     1 
ATOM   643  C  CB    . ASP A 1 82  ? -20.293 26.462  19.384  1.00 75.68  ? 124 ASP A CB    1 
ATOM   644  N  N     . LYS A 1 83  ? -19.854 23.524  18.773  1.00 66.58  ? 125 LYS A N     1 
ATOM   645  C  CA    . LYS A 1 83  ? -19.449 22.623  17.703  1.00 69.99  ? 125 LYS A CA    1 
ATOM   646  C  C     . LYS A 1 83  ? -20.104 21.229  17.809  1.00 68.17  ? 125 LYS A C     1 
ATOM   647  O  O     . LYS A 1 83  ? -20.417 20.741  18.906  1.00 68.33  ? 125 LYS A O     1 
ATOM   648  C  CB    . LYS A 1 83  ? -17.929 22.499  17.709  1.00 61.52  ? 125 LYS A CB    1 
ATOM   649  N  N     . GLU A 1 84  ? -20.327 20.597  16.652  1.00 74.24  ? 126 GLU A N     1 
ATOM   650  C  CA    . GLU A 1 84  ? -20.902 19.260  16.524  1.00 67.04  ? 126 GLU A CA    1 
ATOM   651  C  C     . GLU A 1 84  ? -19.837 18.238  16.159  1.00 69.54  ? 126 GLU A C     1 
ATOM   652  O  O     . GLU A 1 84  ? -18.836 18.587  15.509  1.00 83.73  ? 126 GLU A O     1 
ATOM   653  C  CB    . GLU A 1 84  ? -21.947 19.213  15.433  1.00 69.07  ? 126 GLU A CB    1 
ATOM   654  C  CG    . GLU A 1 84  ? -23.154 20.058  15.706  1.00 75.89  ? 126 GLU A CG    1 
ATOM   655  C  CD    . GLU A 1 84  ? -23.818 19.686  16.995  1.00 85.36  ? 126 GLU A CD    1 
ATOM   656  O  OE1   . GLU A 1 84  ? -23.944 18.474  17.278  1.00 83.44  ? 126 GLU A OE1   1 
ATOM   657  O  OE2   . GLU A 1 84  ? -24.182 20.611  17.748  1.00 89.70  ? 126 GLU A OE2   1 
ATOM   658  N  N     . GLY A 1 85  ? -20.079 16.965  16.518  1.00 57.94  ? 127 GLY A N     1 
ATOM   659  C  CA    . GLY A 1 85  ? -19.092 15.923  16.277  1.00 53.21  ? 127 GLY A CA    1 
ATOM   660  C  C     . GLY A 1 85  ? -17.661 16.381  16.522  1.00 58.62  ? 127 GLY A C     1 
ATOM   661  O  O     . GLY A 1 85  ? -16.799 16.185  15.648  1.00 51.80  ? 127 GLY A O     1 
ATOM   662  N  N     . TYR A 1 86  ? -17.424 16.973  17.707  1.00 51.31  ? 128 TYR A N     1 
ATOM   663  C  CA    . TYR A 1 86  ? -16.171 17.635  18.052  1.00 51.31  ? 128 TYR A CA    1 
ATOM   664  C  C     . TYR A 1 86  ? -15.951 17.481  19.554  1.00 51.65  ? 128 TYR A C     1 
ATOM   665  O  O     . TYR A 1 86  ? -16.882 17.706  20.333  1.00 43.43  ? 128 TYR A O     1 
ATOM   666  C  CB    . TYR A 1 86  ? -16.215 19.116  17.644  1.00 50.32  ? 128 TYR A CB    1 
ATOM   667  C  CG    . TYR A 1 86  ? -15.040 19.935  18.139  1.00 49.92  ? 128 TYR A CG    1 
ATOM   668  C  CD1   . TYR A 1 86  ? -13.790 19.813  17.547  1.00 56.04  ? 128 TYR A CD1   1 
ATOM   669  C  CD2   . TYR A 1 86  ? -15.174 20.842  19.200  1.00 51.93  ? 128 TYR A CD2   1 
ATOM   670  C  CE1   . TYR A 1 86  ? -12.688 20.574  18.001  1.00 58.57  ? 128 TYR A CE1   1 
ATOM   671  C  CE2   . TYR A 1 86  ? -14.085 21.607  19.660  1.00 50.21  ? 128 TYR A CE2   1 
ATOM   672  C  CZ    . TYR A 1 86  ? -12.845 21.463  19.052  1.00 54.26  ? 128 TYR A CZ    1 
ATOM   673  O  OH    . TYR A 1 86  ? -11.748 22.189  19.465  1.00 55.35  ? 128 TYR A OH    1 
ATOM   674  N  N     . SER A 1 87  ? -14.716 17.126  19.944  1.00 44.15  ? 129 SER A N     1 
ATOM   675  C  CA    A SER A 1 87  ? -14.365 16.860  21.333  0.50 41.62  ? 129 SER A CA    1 
ATOM   676  C  CA    B SER A 1 87  ? -14.342 16.829  21.324  0.50 41.97  ? 129 SER A CA    1 
ATOM   677  C  C     . SER A 1 87  ? -15.415 16.015  22.038  1.00 42.24  ? 129 SER A C     1 
ATOM   678  O  O     . SER A 1 87  ? -15.935 15.047  21.478  1.00 45.47  ? 129 SER A O     1 
ATOM   679  C  CB    A SER A 1 87  ? -14.157 18.161  22.107  0.50 43.75  ? 129 SER A CB    1 
ATOM   680  C  CB    B SER A 1 87  ? -14.030 18.112  22.104  0.50 45.44  ? 129 SER A CB    1 
ATOM   681  O  OG    A SER A 1 87  ? -12.849 18.648  21.921  0.50 45.65  ? 129 SER A OG    1 
ATOM   682  O  OG    B SER A 1 87  ? -15.186 18.901  22.303  0.50 47.57  ? 129 SER A OG    1 
ATOM   683  N  N     . GLY A 1 88  ? -15.737 16.381  23.266  1.00 39.62  ? 130 GLY A N     1 
ATOM   684  C  CA    . GLY A 1 88  ? -16.621 15.572  24.075  1.00 43.10  ? 130 GLY A CA    1 
ATOM   685  C  C     . GLY A 1 88  ? -15.909 14.486  24.873  1.00 41.87  ? 130 GLY A C     1 
ATOM   686  O  O     . GLY A 1 88  ? -15.060 13.758  24.342  1.00 36.56  ? 130 GLY A O     1 
ATOM   687  N  N     . VAL A 1 89  ? -16.273 14.337  26.149  1.00 40.36  ? 131 VAL A N     1 
ATOM   688  C  CA    . VAL A 1 89  ? -15.654 13.338  27.014  1.00 41.18  ? 131 VAL A CA    1 
ATOM   689  C  C     . VAL A 1 89  ? -16.721 12.680  27.872  1.00 40.07  ? 131 VAL A C     1 
ATOM   690  O  O     . VAL A 1 89  ? -17.815 13.211  28.066  1.00 40.73  ? 131 VAL A O     1 
ATOM   691  C  CB    . VAL A 1 89  ? -14.544 13.918  27.922  1.00 39.16  ? 131 VAL A CB    1 
ATOM   692  C  CG1   . VAL A 1 89  ? -13.438 14.541  27.090  1.00 32.50  ? 131 VAL A CG1   1 
ATOM   693  C  CG2   . VAL A 1 89  ? -15.130 14.936  28.887  1.00 40.04  ? 131 VAL A CG2   1 
ATOM   694  N  N     . GLY A 1 90  ? -16.378 11.513  28.389  1.00 36.70  ? 132 GLY A N     1 
ATOM   695  C  CA    . GLY A 1 90  ? -17.295 10.767  29.227  1.00 41.32  ? 132 GLY A CA    1 
ATOM   696  C  C     . GLY A 1 90  ? -16.577 10.122  30.392  1.00 38.78  ? 132 GLY A C     1 
ATOM   697  O  O     . GLY A 1 90  ? -15.409 9.720   30.293  1.00 40.33  ? 132 GLY A O     1 
ATOM   698  N  N     . LEU A 1 91  ? -17.301 10.022  31.510  1.00 42.83  ? 133 LEU A N     1 
ATOM   699  C  CA    . LEU A 1 91  ? -16.803 9.374   32.727  1.00 44.65  ? 133 LEU A CA    1 
ATOM   700  C  C     . LEU A 1 91  ? -17.882 8.437   33.253  1.00 42.33  ? 133 LEU A C     1 
ATOM   701  O  O     . LEU A 1 91  ? -18.971 8.887   33.626  1.00 45.17  ? 133 LEU A O     1 
ATOM   702  C  CB    . LEU A 1 91  ? -16.408 10.406  33.792  1.00 40.02  ? 133 LEU A CB    1 
ATOM   703  C  CG    . LEU A 1 91  ? -15.656 9.894   35.033  1.00 46.53  ? 133 LEU A CG    1 
ATOM   704  C  CD1   . LEU A 1 91  ? -14.787 11.014  35.608  1.00 38.69  ? 133 LEU A CD1   1 
ATOM   705  C  CD2   . LEU A 1 91  ? -16.615 9.362   36.101  1.00 39.37  ? 133 LEU A CD2   1 
ATOM   706  N  N     . LEU A 1 92  ? -17.573 7.143   33.281  1.00 39.33  ? 134 LEU A N     1 
ATOM   707  C  CA    . LEU A 1 92  ? -18.486 6.095   33.720  1.00 42.12  ? 134 LEU A CA    1 
ATOM   708  C  C     . LEU A 1 92  ? -17.887 5.405   34.941  1.00 46.67  ? 134 LEU A C     1 
ATOM   709  O  O     . LEU A 1 92  ? -16.699 5.072   34.946  1.00 45.88  ? 134 LEU A O     1 
ATOM   710  C  CB    . LEU A 1 92  ? -18.741 5.084   32.582  1.00 43.07  ? 134 LEU A CB    1 
ATOM   711  C  CG    . LEU A 1 92  ? -19.398 5.566   31.253  1.00 46.22  ? 134 LEU A CG    1 
ATOM   712  C  CD1   . LEU A 1 92  ? -18.481 6.391   30.330  1.00 37.30  ? 134 LEU A CD1   1 
ATOM   713  C  CD2   . LEU A 1 92  ? -19.934 4.382   30.466  1.00 43.56  ? 134 LEU A CD2   1 
ATOM   714  N  N     . SER A 1 93  ? -18.688 5.183   35.976  1.00 46.75  ? 135 SER A N     1 
ATOM   715  C  CA    A SER A 1 93  ? -18.173 4.587   37.200  0.29 46.46  ? 135 SER A CA    1 
ATOM   716  C  CA    B SER A 1 93  ? -18.168 4.579   37.192  0.71 46.48  ? 135 SER A CA    1 
ATOM   717  C  C     . SER A 1 93  ? -19.153 3.558   37.743  1.00 48.94  ? 135 SER A C     1 
ATOM   718  O  O     . SER A 1 93  ? -20.370 3.757   37.682  1.00 46.88  ? 135 SER A O     1 
ATOM   719  C  CB    A SER A 1 93  ? -17.897 5.664   38.256  0.29 46.66  ? 135 SER A CB    1 
ATOM   720  C  CB    B SER A 1 93  ? -17.867 5.643   38.251  0.71 47.49  ? 135 SER A CB    1 
ATOM   721  O  OG    A SER A 1 93  ? -19.031 6.490   38.432  0.29 47.50  ? 135 SER A OG    1 
ATOM   722  O  OG    B SER A 1 93  ? -17.366 5.043   39.430  0.71 45.57  ? 135 SER A OG    1 
ATOM   723  N  N     . ARG A 1 94  ? -18.601 2.465   38.291  1.00 49.15  ? 136 ARG A N     1 
ATOM   724  C  CA    . ARG A 1 94  ? -19.407 1.414   38.924  1.00 50.10  ? 136 ARG A CA    1 
ATOM   725  C  C     . ARG A 1 94  ? -20.187 1.957   40.117  1.00 50.73  ? 136 ARG A C     1 
ATOM   726  O  O     . ARG A 1 94  ? -21.386 1.699   40.265  1.00 50.58  ? 136 ARG A O     1 
ATOM   727  C  CB    . ARG A 1 94  ? -18.503 0.256   39.363  1.00 45.42  ? 136 ARG A CB    1 
ATOM   728  C  CG    . ARG A 1 94  ? -19.192 -0.945  39.986  1.00 44.47  ? 136 ARG A CG    1 
ATOM   729  C  CD    . ARG A 1 94  ? -18.155 -1.958  40.469  1.00 52.23  ? 136 ARG A CD    1 
ATOM   730  N  NE    . ARG A 1 94  ? -17.122 -1.307  41.290  1.00 64.71  ? 136 ARG A NE    1 
ATOM   731  C  CZ    . ARG A 1 94  ? -16.906 -1.523  42.597  1.00 70.14  ? 136 ARG A CZ    1 
ATOM   732  N  NH1   . ARG A 1 94  ? -17.642 -2.404  43.272  1.00 64.56  ? 136 ARG A NH1   1 
ATOM   733  N  NH2   . ARG A 1 94  ? -15.932 -0.862  43.236  1.00 55.18  ? 136 ARG A NH2   1 
ATOM   734  N  N     . GLN A 1 95  ? -19.517 2.696   40.987  1.00 50.31  ? 137 GLN A N     1 
ATOM   735  C  CA    . GLN A 1 95  ? -20.173 3.366   42.097  1.00 54.79  ? 137 GLN A CA    1 
ATOM   736  C  C     . GLN A 1 95  ? -20.352 4.845   41.790  1.00 51.67  ? 137 GLN A C     1 
ATOM   737  O  O     . GLN A 1 95  ? -19.594 5.438   41.017  1.00 53.14  ? 137 GLN A O     1 
ATOM   738  C  CB    . GLN A 1 95  ? -19.376 3.215   43.391  1.00 56.07  ? 137 GLN A CB    1 
ATOM   739  C  CG    . GLN A 1 95  ? -19.455 1.864   44.059  1.00 61.66  ? 137 GLN A CG    1 
ATOM   740  C  CD    . GLN A 1 95  ? -18.671 1.860   45.360  1.00 72.83  ? 137 GLN A CD    1 
ATOM   741  O  OE1   . GLN A 1 95  ? -17.555 1.344   45.417  1.00 65.58  ? 137 GLN A OE1   1 
ATOM   742  N  NE2   . GLN A 1 95  ? -19.245 2.465   46.407  1.00 73.08  ? 137 GLN A NE2   1 
ATOM   743  N  N     . ALA A 1 96  ? -21.351 5.435   42.422  1.00 54.64  ? 138 ALA A N     1 
ATOM   744  C  CA    . ALA A 1 96  ? -21.632 6.850   42.226  1.00 53.88  ? 138 ALA A CA    1 
ATOM   745  C  C     . ALA A 1 96  ? -20.574 7.707   42.917  1.00 49.92  ? 138 ALA A C     1 
ATOM   746  O  O     . ALA A 1 96  ? -20.273 7.484   44.093  1.00 53.19  ? 138 ALA A O     1 
ATOM   747  C  CB    . ALA A 1 96  ? -23.021 7.175   42.769  1.00 50.76  ? 138 ALA A CB    1 
ATOM   748  N  N     . PRO A 1 97  ? -19.974 8.674   42.231  1.00 46.54  ? 139 PRO A N     1 
ATOM   749  C  CA    . PRO A 1 97  ? -19.074 9.603   42.918  1.00 49.81  ? 139 PRO A CA    1 
ATOM   750  C  C     . PRO A 1 97  ? -19.852 10.507  43.867  1.00 54.34  ? 139 PRO A C     1 
ATOM   751  O  O     . PRO A 1 97  ? -21.071 10.637  43.771  1.00 54.97  ? 139 PRO A O     1 
ATOM   752  C  CB    . PRO A 1 97  ? -18.430 10.398  41.771  1.00 45.93  ? 139 PRO A CB    1 
ATOM   753  C  CG    . PRO A 1 97  ? -19.325 10.207  40.613  1.00 45.96  ? 139 PRO A CG    1 
ATOM   754  C  CD    . PRO A 1 97  ? -20.008 8.892   40.775  1.00 44.80  ? 139 PRO A CD    1 
ATOM   755  N  N     . LEU A 1 98  ? -19.134 11.127  44.808  1.00 46.40  ? 140 LEU A N     1 
ATOM   756  C  CA    . LEU A 1 98  ? -19.791 12.041  45.738  1.00 47.26  ? 140 LEU A CA    1 
ATOM   757  C  C     . LEU A 1 98  ? -20.258 13.318  45.046  1.00 51.74  ? 140 LEU A C     1 
ATOM   758  O  O     . LEU A 1 98  ? -21.355 13.813  45.324  1.00 53.88  ? 140 LEU A O     1 
ATOM   759  C  CB    . LEU A 1 98  ? -18.849 12.399  46.877  1.00 52.64  ? 140 LEU A CB    1 
ATOM   760  C  CG    . LEU A 1 98  ? -18.478 11.248  47.794  1.00 56.35  ? 140 LEU A CG    1 
ATOM   761  C  CD1   . LEU A 1 98  ? -17.450 11.735  48.767  1.00 48.23  ? 140 LEU A CD1   1 
ATOM   762  C  CD2   . LEU A 1 98  ? -19.726 10.741  48.512  1.00 62.43  ? 140 LEU A CD2   1 
ATOM   763  N  N     . LYS A 1 99  ? -19.431 13.893  44.181  1.00 48.03  ? 141 LYS A N     1 
ATOM   764  C  CA    . LYS A 1 99  ? -19.781 15.134  43.506  1.00 50.48  ? 141 LYS A CA    1 
ATOM   765  C  C     . LYS A 1 99  ? -19.182 15.098  42.105  1.00 53.59  ? 141 LYS A C     1 
ATOM   766  O  O     . LYS A 1 99  ? -18.091 14.549  41.911  1.00 51.11  ? 141 LYS A O     1 
ATOM   767  C  CB    . LYS A 1 99  ? -19.277 16.352  44.295  1.00 45.61  ? 141 LYS A CB    1 
ATOM   768  C  CG    . LYS A 1 99  ? -19.098 17.609  43.462  1.00 55.42  ? 141 LYS A CG    1 
ATOM   769  C  CD    . LYS A 1 99  ? -18.521 18.756  44.262  1.00 53.72  ? 141 LYS A CD    1 
ATOM   770  C  CE    . LYS A 1 99  ? -17.380 19.425  43.486  1.00 68.39  ? 141 LYS A CE    1 
ATOM   771  N  NZ    . LYS A 1 99  ? -16.130 18.576  43.299  1.00 64.87  ? 141 LYS A NZ    1 
ATOM   772  N  N     . VAL A 1 100 ? -19.906 15.664  41.130  1.00 50.14  ? 142 VAL A N     1 
ATOM   773  C  CA    . VAL A 1 100 ? -19.441 15.755  39.750  1.00 40.49  ? 142 VAL A CA    1 
ATOM   774  C  C     . VAL A 1 100 ? -19.589 17.187  39.263  1.00 44.27  ? 142 VAL A C     1 
ATOM   775  O  O     . VAL A 1 100 ? -20.663 17.784  39.404  1.00 51.98  ? 142 VAL A O     1 
ATOM   776  C  CB    . VAL A 1 100 ? -20.211 14.802  38.829  1.00 45.08  ? 142 VAL A CB    1 
ATOM   777  C  CG1   . VAL A 1 100 ? -19.835 15.053  37.370  1.00 40.87  ? 142 VAL A CG1   1 
ATOM   778  C  CG2   . VAL A 1 100 ? -19.945 13.365  39.232  1.00 43.05  ? 142 VAL A CG2   1 
ATOM   779  N  N     . SER A 1 101 ? -18.514 17.730  38.674  1.00 46.50  ? 143 SER A N     1 
ATOM   780  C  CA    . SER A 1 101 ? -18.480 19.056  38.050  1.00 43.19  ? 143 SER A CA    1 
ATOM   781  C  C     . SER A 1 101 ? -17.900 18.945  36.635  1.00 43.64  ? 143 SER A C     1 
ATOM   782  O  O     . SER A 1 101 ? -17.426 17.882  36.210  1.00 42.92  ? 143 SER A O     1 
ATOM   783  C  CB    . SER A 1 101 ? -17.669 20.055  38.886  1.00 39.90  ? 143 SER A CB    1 
ATOM   784  O  OG    . SER A 1 101 ? -16.269 19.764  38.826  1.00 48.57  ? 143 SER A OG    1 
ATOM   785  N  N     . TYR A 1 102 ? -17.943 20.056  35.892  1.00 36.23  ? 144 TYR A N     1 
ATOM   786  C  CA    . TYR A 1 102 ? -17.532 20.053  34.493  1.00 41.90  ? 144 TYR A CA    1 
ATOM   787  C  C     . TYR A 1 102 ? -16.630 21.250  34.236  1.00 49.02  ? 144 TYR A C     1 
ATOM   788  O  O     . TYR A 1 102 ? -16.818 22.311  34.836  1.00 58.17  ? 144 TYR A O     1 
ATOM   789  C  CB    . TYR A 1 102 ? -18.775 20.059  33.554  1.00 39.59  ? 144 TYR A CB    1 
ATOM   790  C  CG    . TYR A 1 102 ? -19.680 18.871  33.800  1.00 38.82  ? 144 TYR A CG    1 
ATOM   791  C  CD1   . TYR A 1 102 ? -19.422 17.651  33.202  1.00 44.46  ? 144 TYR A CD1   1 
ATOM   792  C  CD2   . TYR A 1 102 ? -20.763 18.955  34.660  1.00 40.90  ? 144 TYR A CD2   1 
ATOM   793  C  CE1   . TYR A 1 102 ? -20.229 16.548  33.430  1.00 45.69  ? 144 TYR A CE1   1 
ATOM   794  C  CE2   . TYR A 1 102 ? -21.584 17.842  34.904  1.00 43.11  ? 144 TYR A CE2   1 
ATOM   795  C  CZ    . TYR A 1 102 ? -21.304 16.641  34.287  1.00 47.46  ? 144 TYR A CZ    1 
ATOM   796  O  OH    . TYR A 1 102 ? -22.096 15.525  34.500  1.00 43.67  ? 144 TYR A OH    1 
ATOM   797  N  N     . GLY A 1 103 ? -15.629 21.072  33.376  1.00 47.45  ? 145 GLY A N     1 
ATOM   798  C  CA    . GLY A 1 103 ? -14.718 22.174  33.098  1.00 53.90  ? 145 GLY A CA    1 
ATOM   799  C  C     . GLY A 1 103 ? -13.787 22.507  34.266  1.00 51.63  ? 145 GLY A C     1 
ATOM   800  O  O     . GLY A 1 103 ? -13.725 21.809  35.274  1.00 50.29  ? 145 GLY A O     1 
ATOM   801  N  N     . ILE A 1 104 ? -13.057 23.613  34.105  1.00 51.49  ? 146 ILE A N     1 
ATOM   802  C  CA    . ILE A 1 104 ? -11.989 23.985  35.022  1.00 55.34  ? 146 ILE A CA    1 
ATOM   803  C  C     . ILE A 1 104 ? -12.240 25.337  35.686  1.00 57.32  ? 146 ILE A C     1 
ATOM   804  O  O     . ILE A 1 104 ? -11.315 25.946  36.198  1.00 60.63  ? 146 ILE A O     1 
ATOM   805  C  CB    . ILE A 1 104 ? -10.616 23.977  34.322  1.00 54.27  ? 146 ILE A CB    1 
ATOM   806  C  CG1   . ILE A 1 104 ? -10.593 24.976  33.158  1.00 53.92  ? 146 ILE A CG1   1 
ATOM   807  C  CG2   . ILE A 1 104 ? -10.288 22.596  33.837  1.00 51.32  ? 146 ILE A CG2   1 
ATOM   808  C  CD1   . ILE A 1 104 ? -9.194  25.462  32.808  1.00 46.57  ? 146 ILE A CD1   1 
ATOM   809  N  N     . GLY A 1 105 ? -13.475 25.818  35.704  1.00 58.49  ? 147 GLY A N     1 
ATOM   810  C  CA    . GLY A 1 105 ? -13.726 27.062  36.410  1.00 58.09  ? 147 GLY A CA    1 
ATOM   811  C  C     . GLY A 1 105 ? -13.217 28.298  35.701  1.00 61.34  ? 147 GLY A C     1 
ATOM   812  O  O     . GLY A 1 105 ? -12.803 29.258  36.359  1.00 59.10  ? 147 GLY A O     1 
ATOM   813  N  N     . ASP A 1 106 ? -13.249 28.302  34.372  1.00 57.99  ? 148 ASP A N     1 
ATOM   814  C  CA    . ASP A 1 106 ? -12.788 29.434  33.577  1.00 61.91  ? 148 ASP A CA    1 
ATOM   815  C  C     . ASP A 1 106 ? -13.594 29.443  32.285  1.00 63.10  ? 148 ASP A C     1 
ATOM   816  O  O     . ASP A 1 106 ? -13.526 28.481  31.515  1.00 58.32  ? 148 ASP A O     1 
ATOM   817  C  CB    . ASP A 1 106 ? -11.284 29.313  33.298  1.00 59.43  ? 148 ASP A CB    1 
ATOM   818  C  CG    . ASP A 1 106 ? -10.696 30.548  32.629  1.00 67.02  ? 148 ASP A CG    1 
ATOM   819  O  OD1   . ASP A 1 106 ? -9.530  30.879  32.944  1.00 71.70  ? 148 ASP A OD1   1 
ATOM   820  O  OD2   . ASP A 1 106 ? -11.381 31.175  31.784  1.00 68.61  ? 148 ASP A OD2   1 
ATOM   821  N  N     . GLU A 1 107 ? -14.335 30.530  32.044  1.00 68.08  ? 149 GLU A N     1 
ATOM   822  C  CA    . GLU A 1 107 ? -15.326 30.542  30.965  1.00 70.17  ? 149 GLU A CA    1 
ATOM   823  C  C     . GLU A 1 107 ? -14.689 30.300  29.594  1.00 68.32  ? 149 GLU A C     1 
ATOM   824  O  O     . GLU A 1 107 ? -15.243 29.552  28.775  1.00 67.76  ? 149 GLU A O     1 
ATOM   825  C  CB    . GLU A 1 107 ? -16.101 31.863  30.983  1.00 70.88  ? 149 GLU A CB    1 
ATOM   826  C  CG    . GLU A 1 107 ? -17.293 31.920  30.022  1.00 84.61  ? 149 GLU A CG    1 
ATOM   827  C  CD    . GLU A 1 107 ? -18.440 32.759  30.565  1.00 86.10  ? 149 GLU A CD    1 
ATOM   828  O  OE1   . GLU A 1 107 ? -19.160 32.266  31.462  1.00 84.46  ? 149 GLU A OE1   1 
ATOM   829  O  OE2   . GLU A 1 107 ? -18.613 33.908  30.103  1.00 83.69  ? 149 GLU A OE2   1 
ATOM   830  N  N     . GLU A 1 108 ? -13.519 30.911  29.335  1.00 69.72  ? 150 GLU A N     1 
ATOM   831  C  CA    . GLU A 1 108 ? -12.823 30.742  28.054  1.00 67.64  ? 150 GLU A CA    1 
ATOM   832  C  C     . GLU A 1 108 ? -12.566 29.273  27.709  1.00 67.47  ? 150 GLU A C     1 
ATOM   833  O  O     . GLU A 1 108 ? -12.558 28.905  26.525  1.00 70.70  ? 150 GLU A O     1 
ATOM   834  C  CB    . GLU A 1 108 ? -11.482 31.516  28.051  1.00 66.18  ? 150 GLU A CB    1 
ATOM   835  C  CG    . GLU A 1 108 ? -10.502 31.056  26.920  1.00 72.65  ? 150 GLU A CG    1 
ATOM   836  C  CD    . GLU A 1 108 ? -9.303  31.974  26.643  1.00 71.73  ? 150 GLU A CD    1 
ATOM   837  O  OE1   . GLU A 1 108 ? -9.435  32.914  25.824  1.00 79.45  ? 150 GLU A OE1   1 
ATOM   838  O  OE2   . GLU A 1 108 ? -8.216  31.728  27.201  1.00 65.03  ? 150 GLU A OE2   1 
ATOM   839  N  N     . HIS A 1 109 ? -12.374 28.416  28.711  1.00 57.06  ? 151 HIS A N     1 
ATOM   840  C  CA    . HIS A 1 109 ? -11.962 27.044  28.465  1.00 56.52  ? 151 HIS A CA    1 
ATOM   841  C  C     . HIS A 1 109 ? -13.026 25.990  28.751  1.00 58.30  ? 151 HIS A C     1 
ATOM   842  O  O     . HIS A 1 109 ? -12.735 24.803  28.604  1.00 64.48  ? 151 HIS A O     1 
ATOM   843  C  CB    . HIS A 1 109 ? -10.724 26.727  29.297  1.00 60.54  ? 151 HIS A CB    1 
ATOM   844  C  CG    . HIS A 1 109 ? -9.635  27.736  29.164  1.00 61.03  ? 151 HIS A CG    1 
ATOM   845  N  ND1   . HIS A 1 109 ? -8.984  27.975  27.972  1.00 62.68  ? 151 HIS A ND1   1 
ATOM   846  C  CD2   . HIS A 1 109 ? -9.063  28.556  30.077  1.00 58.04  ? 151 HIS A CD2   1 
ATOM   847  C  CE1   . HIS A 1 109 ? -8.054  28.895  28.159  1.00 63.15  ? 151 HIS A CE1   1 
ATOM   848  N  NE2   . HIS A 1 109 ? -8.079  29.262  29.429  1.00 59.99  ? 151 HIS A NE2   1 
ATOM   849  N  N     . ASP A 1 110 ? -14.234 26.365  29.165  1.00 62.45  ? 152 ASP A N     1 
ATOM   850  C  CA    . ASP A 1 110 ? -15.272 25.390  29.485  1.00 58.56  ? 152 ASP A CA    1 
ATOM   851  C  C     . ASP A 1 110 ? -16.294 25.222  28.354  1.00 55.76  ? 152 ASP A C     1 
ATOM   852  O  O     . ASP A 1 110 ? -17.352 24.621  28.561  1.00 50.35  ? 152 ASP A O     1 
ATOM   853  C  CB    . ASP A 1 110 ? -15.996 25.781  30.786  1.00 52.12  ? 152 ASP A CB    1 
ATOM   854  C  CG    . ASP A 1 110 ? -15.091 25.728  32.037  1.00 68.25  ? 152 ASP A CG    1 
ATOM   855  O  OD1   . ASP A 1 110 ? -13.932 25.232  31.979  1.00 59.20  ? 152 ASP A OD1   1 
ATOM   856  O  OD2   . ASP A 1 110 ? -15.563 26.202  33.103  1.00 71.48  ? 152 ASP A OD2   1 
ATOM   857  N  N     . GLN A 1 111 ? -16.006 25.737  27.168  1.00 61.26  ? 153 GLN A N     1 
ATOM   858  C  CA    . GLN A 1 111 ? -16.996 25.754  26.094  1.00 56.78  ? 153 GLN A CA    1 
ATOM   859  C  C     . GLN A 1 111 ? -16.951 24.530  25.185  1.00 53.18  ? 153 GLN A C     1 
ATOM   860  O  O     . GLN A 1 111 ? -17.881 24.344  24.391  1.00 56.05  ? 153 GLN A O     1 
ATOM   861  C  CB    . GLN A 1 111 ? -16.828 27.024  25.245  1.00 50.86  ? 153 GLN A CB    1 
ATOM   862  C  CG    . GLN A 1 111 ? -17.467 28.242  25.879  1.00 57.24  ? 153 GLN A CG    1 
ATOM   863  C  CD    . GLN A 1 111 ? -18.914 27.971  26.283  1.00 65.81  ? 153 GLN A CD    1 
ATOM   864  O  OE1   . GLN A 1 111 ? -19.730 27.506  25.473  1.00 71.18  ? 153 GLN A OE1   1 
ATOM   865  N  NE2   . GLN A 1 111 ? -19.237 28.249  27.542  1.00 69.65  ? 153 GLN A NE2   1 
ATOM   866  N  N     . GLU A 1 112 ? -15.920 23.686  25.293  1.00 47.95  ? 154 GLU A N     1 
ATOM   867  C  CA    . GLU A 1 112 ? -15.662 22.633  24.313  1.00 47.94  ? 154 GLU A CA    1 
ATOM   868  C  C     . GLU A 1 112 ? -15.846 21.209  24.846  1.00 50.25  ? 154 GLU A C     1 
ATOM   869  O  O     . GLU A 1 112 ? -15.518 20.258  24.126  1.00 46.85  ? 154 GLU A O     1 
ATOM   870  C  CB    . GLU A 1 112 ? -14.251 22.796  23.737  1.00 45.36  ? 154 GLU A CB    1 
ATOM   871  C  CG    . GLU A 1 112 ? -14.139 24.017  22.848  1.00 50.53  ? 154 GLU A CG    1 
ATOM   872  C  CD    . GLU A 1 112 ? -12.781 24.206  22.207  1.00 48.70  ? 154 GLU A CD    1 
ATOM   873  O  OE1   . GLU A 1 112 ? -12.664 25.118  21.363  1.00 55.14  ? 154 GLU A OE1   1 
ATOM   874  O  OE2   . GLU A 1 112 ? -11.824 23.464  22.530  1.00 50.42  ? 154 GLU A OE2   1 
ATOM   875  N  N     . GLY A 1 113 ? -16.359 21.034  26.073  1.00 46.43  ? 155 GLY A N     1 
ATOM   876  C  CA    . GLY A 1 113 ? -16.617 19.713  26.615  1.00 41.27  ? 155 GLY A CA    1 
ATOM   877  C  C     . GLY A 1 113 ? -15.385 18.836  26.735  1.00 44.67  ? 155 GLY A C     1 
ATOM   878  O  O     . GLY A 1 113 ? -15.337 17.742  26.160  1.00 39.37  ? 155 GLY A O     1 
ATOM   879  N  N     . ARG A 1 114 ? -14.387 19.297  27.495  1.00 41.60  ? 156 ARG A N     1 
ATOM   880  C  CA    . ARG A 1 114 ? -13.096 18.623  27.595  1.00 42.07  ? 156 ARG A CA    1 
ATOM   881  C  C     . ARG A 1 114 ? -12.751 18.067  28.980  1.00 41.67  ? 156 ARG A C     1 
ATOM   882  O  O     . ARG A 1 114 ? -11.903 17.178  29.060  1.00 37.51  ? 156 ARG A O     1 
ATOM   883  C  CB    . ARG A 1 114 ? -11.960 19.574  27.173  1.00 42.31  ? 156 ARG A CB    1 
ATOM   884  C  CG    . ARG A 1 114 ? -12.050 20.052  25.757  1.00 42.78  ? 156 ARG A CG    1 
ATOM   885  C  CD    . ARG A 1 114 ? -10.916 21.002  25.408  1.00 35.47  ? 156 ARG A CD    1 
ATOM   886  N  NE    . ARG A 1 114 ? -10.938 21.283  23.970  1.00 43.79  ? 156 ARG A NE    1 
ATOM   887  C  CZ    . ARG A 1 114 ? -10.411 20.487  23.044  1.00 42.19  ? 156 ARG A CZ    1 
ATOM   888  N  NH1   . ARG A 1 114 ? -9.798  19.365  23.414  1.00 41.26  ? 156 ARG A NH1   1 
ATOM   889  N  NH2   . ARG A 1 114 ? -10.494 20.813  21.755  1.00 40.00  ? 156 ARG A NH2   1 
ATOM   890  N  N     . VAL A 1 115 ? -13.352 18.562  30.062  1.00 40.12  ? 157 VAL A N     1 
ATOM   891  C  CA    . VAL A 1 115 ? -12.963 18.172  31.413  1.00 39.77  ? 157 VAL A CA    1 
ATOM   892  C  C     . VAL A 1 115 ? -14.189 17.715  32.198  1.00 38.85  ? 157 VAL A C     1 
ATOM   893  O  O     . VAL A 1 115 ? -15.218 18.396  32.197  1.00 46.32  ? 157 VAL A O     1 
ATOM   894  C  CB    . VAL A 1 115 ? -12.258 19.331  32.137  1.00 46.65  ? 157 VAL A CB    1 
ATOM   895  C  CG1   . VAL A 1 115 ? -11.913 18.940  33.591  1.00 36.83  ? 157 VAL A CG1   1 
ATOM   896  C  CG2   . VAL A 1 115 ? -11.019 19.749  31.345  1.00 40.46  ? 157 VAL A CG2   1 
ATOM   897  N  N     . ILE A 1 116 ? -14.087 16.554  32.844  1.00 37.63  ? 158 ILE A N     1 
ATOM   898  C  CA    . ILE A 1 116 ? -15.051 16.097  33.841  1.00 37.83  ? 158 ILE A CA    1 
ATOM   899  C  C     . ILE A 1 116 ? -14.282 15.849  35.127  1.00 38.89  ? 158 ILE A C     1 
ATOM   900  O  O     . ILE A 1 116 ? -13.165 15.329  35.090  1.00 39.57  ? 158 ILE A O     1 
ATOM   901  C  CB    . ILE A 1 116 ? -15.801 14.821  33.409  1.00 40.72  ? 158 ILE A CB    1 
ATOM   902  C  CG1   . ILE A 1 116 ? -16.569 15.064  32.095  1.00 45.87  ? 158 ILE A CG1   1 
ATOM   903  C  CG2   . ILE A 1 116 ? -16.802 14.399  34.469  1.00 36.23  ? 158 ILE A CG2   1 
ATOM   904  C  CD1   . ILE A 1 116 ? -17.394 13.898  31.614  1.00 38.05  ? 158 ILE A CD1   1 
ATOM   905  N  N     . VAL A 1 117 ? -14.863 16.243  36.258  1.00 44.05  ? 159 VAL A N     1 
ATOM   906  C  CA    . VAL A 1 117 ? -14.259 16.033  37.576  1.00 44.03  ? 159 VAL A CA    1 
ATOM   907  C  C     . VAL A 1 117 ? -15.214 15.222  38.443  1.00 42.32  ? 159 VAL A C     1 
ATOM   908  O  O     . VAL A 1 117 ? -16.374 15.599  38.625  1.00 46.96  ? 159 VAL A O     1 
ATOM   909  C  CB    . VAL A 1 117 ? -13.901 17.357  38.278  1.00 46.19  ? 159 VAL A CB    1 
ATOM   910  C  CG1   . VAL A 1 117 ? -13.085 17.060  39.532  1.00 38.75  ? 159 VAL A CG1   1 
ATOM   911  C  CG2   . VAL A 1 117 ? -13.132 18.300  37.348  1.00 37.28  ? 159 VAL A CG2   1 
ATOM   912  N  N     . ALA A 1 118 ? -14.726 14.122  38.986  1.00 40.34  ? 160 ALA A N     1 
ATOM   913  C  CA    . ALA A 1 118 ? -15.490 13.303  39.915  1.00 43.76  ? 160 ALA A CA    1 
ATOM   914  C  C     . ALA A 1 118 ? -14.725 13.174  41.234  1.00 46.70  ? 160 ALA A C     1 
ATOM   915  O  O     . ALA A 1 118 ? -13.535 12.823  41.241  1.00 46.31  ? 160 ALA A O     1 
ATOM   916  C  CB    . ALA A 1 118 ? -15.767 11.924  39.302  1.00 41.61  ? 160 ALA A CB    1 
ATOM   917  N  N     . GLU A 1 119 ? -15.393 13.467  42.347  1.00 44.16  ? 161 GLU A N     1 
ATOM   918  C  CA    . GLU A 1 119 ? -14.786 13.281  43.657  1.00 46.85  ? 161 GLU A CA    1 
ATOM   919  C  C     . GLU A 1 119 ? -15.283 11.977  44.267  1.00 47.68  ? 161 GLU A C     1 
ATOM   920  O  O     . GLU A 1 119 ? -16.484 11.695  44.243  1.00 44.86  ? 161 GLU A O     1 
ATOM   921  C  CB    . GLU A 1 119 ? -15.080 14.450  44.596  1.00 52.68  ? 161 GLU A CB    1 
ATOM   922  C  CG    . GLU A 1 119 ? -14.321 14.331  45.929  1.00 49.92  ? 161 GLU A CG    1 
ATOM   923  C  CD    . GLU A 1 119 ? -14.579 15.484  46.883  1.00 57.77  ? 161 GLU A CD    1 
ATOM   924  O  OE1   . GLU A 1 119 ? -14.462 15.283  48.118  1.00 59.50  ? 161 GLU A OE1   1 
ATOM   925  O  OE2   . GLU A 1 119 ? -14.890 16.594  46.404  1.00 66.79  ? 161 GLU A OE2   1 
ATOM   926  N  N     . PHE A 1 120 ? -14.354 11.191  44.812  1.00 46.14  ? 162 PHE A N     1 
ATOM   927  C  CA    . PHE A 1 120 ? -14.615 9.934   45.507  1.00 46.93  ? 162 PHE A CA    1 
ATOM   928  C  C     . PHE A 1 120 ? -14.182 10.087  46.963  1.00 49.61  ? 162 PHE A C     1 
ATOM   929  O  O     . PHE A 1 120 ? -13.751 11.163  47.377  1.00 52.38  ? 162 PHE A O     1 
ATOM   930  C  CB    . PHE A 1 120 ? -13.903 8.780   44.789  1.00 43.48  ? 162 PHE A CB    1 
ATOM   931  C  CG    . PHE A 1 120 ? -14.430 8.543   43.397  1.00 50.45  ? 162 PHE A CG    1 
ATOM   932  C  CD1   . PHE A 1 120 ? -13.838 9.142   42.289  1.00 45.43  ? 162 PHE A CD1   1 
ATOM   933  C  CD2   . PHE A 1 120 ? -15.564 7.769   43.202  1.00 46.49  ? 162 PHE A CD2   1 
ATOM   934  C  CE1   . PHE A 1 120 ? -14.346 8.933   41.007  1.00 44.72  ? 162 PHE A CE1   1 
ATOM   935  C  CE2   . PHE A 1 120 ? -16.078 7.555   41.918  1.00 51.74  ? 162 PHE A CE2   1 
ATOM   936  C  CZ    . PHE A 1 120 ? -15.472 8.140   40.827  1.00 46.74  ? 162 PHE A CZ    1 
ATOM   937  N  N     . ASP A 1 121 ? -14.315 9.014   47.753  1.00 54.97  ? 163 ASP A N     1 
ATOM   938  C  CA    . ASP A 1 121 ? -13.927 9.063   49.169  1.00 50.16  ? 163 ASP A CA    1 
ATOM   939  C  C     . ASP A 1 121 ? -12.486 9.524   49.331  1.00 56.52  ? 163 ASP A C     1 
ATOM   940  O  O     . ASP A 1 121 ? -12.191 10.494  50.041  1.00 54.94  ? 163 ASP A O     1 
ATOM   941  C  CB    . ASP A 1 121 ? -14.080 7.686   49.828  1.00 55.52  ? 163 ASP A CB    1 
ATOM   942  C  CG    . ASP A 1 121 ? -15.532 7.289   50.061  1.00 63.68  ? 163 ASP A CG    1 
ATOM   943  O  OD1   . ASP A 1 121 ? -16.434 8.123   49.809  1.00 62.76  ? 163 ASP A OD1   1 
ATOM   944  O  OD2   . ASP A 1 121 ? -15.767 6.136   50.505  1.00 62.97  ? 163 ASP A OD2   1 
ATOM   945  N  N     . SER A 1 122 ? -11.573 8.827   48.659  1.00 55.24  ? 164 SER A N     1 
ATOM   946  C  CA    . SER A 1 122 ? -10.151 8.935   48.914  1.00 49.27  ? 164 SER A CA    1 
ATOM   947  C  C     . SER A 1 122 ? -9.404  9.785   47.901  1.00 53.36  ? 164 SER A C     1 
ATOM   948  O  O     . SER A 1 122 ? -8.203  10.012  48.091  1.00 58.35  ? 164 SER A O     1 
ATOM   949  C  CB    . SER A 1 122 ? -9.527  7.539   48.940  1.00 50.69  ? 164 SER A CB    1 
ATOM   950  O  OG    . SER A 1 122 ? -10.188 6.710   49.881  1.00 53.07  ? 164 SER A OG    1 
ATOM   951  N  N     . PHE A 1 123 ? -10.056 10.251  46.837  1.00 53.00  ? 165 PHE A N     1 
ATOM   952  C  CA    . PHE A 1 123 ? -9.327  10.962  45.795  1.00 46.78  ? 165 PHE A CA    1 
ATOM   953  C  C     . PHE A 1 123 ? -10.306 11.652  44.859  1.00 52.19  ? 165 PHE A C     1 
ATOM   954  O  O     . PHE A 1 123 ? -11.499 11.336  44.815  1.00 45.05  ? 165 PHE A O     1 
ATOM   955  C  CB    . PHE A 1 123 ? -8.414  10.016  44.997  1.00 44.63  ? 165 PHE A CB    1 
ATOM   956  C  CG    . PHE A 1 123 ? -9.153  9.106   44.062  1.00 46.94  ? 165 PHE A CG    1 
ATOM   957  C  CD1   . PHE A 1 123 ? -9.836  8.002   44.548  1.00 49.28  ? 165 PHE A CD1   1 
ATOM   958  C  CD2   . PHE A 1 123 ? -9.175  9.362   42.684  1.00 47.70  ? 165 PHE A CD2   1 
ATOM   959  C  CE1   . PHE A 1 123 ? -10.555 7.142   43.671  1.00 53.78  ? 165 PHE A CE1   1 
ATOM   960  C  CE2   . PHE A 1 123 ? -9.881  8.518   41.795  1.00 46.09  ? 165 PHE A CE2   1 
ATOM   961  C  CZ    . PHE A 1 123 ? -10.569 7.403   42.290  1.00 48.32  ? 165 PHE A CZ    1 
ATOM   962  N  N     . VAL A 1 124 ? -9.776  12.597  44.100  1.00 50.15  ? 166 VAL A N     1 
ATOM   963  C  CA    . VAL A 1 124 ? -10.514 13.253  43.037  1.00 44.91  ? 166 VAL A CA    1 
ATOM   964  C  C     . VAL A 1 124 ? -9.867  12.841  41.719  1.00 49.08  ? 166 VAL A C     1 
ATOM   965  O  O     . VAL A 1 124 ? -8.637  12.683  41.634  1.00 35.88  ? 166 VAL A O     1 
ATOM   966  C  CB    . VAL A 1 124 ? -10.542 14.781  43.234  1.00 43.05  ? 166 VAL A CB    1 
ATOM   967  C  CG1   . VAL A 1 124 ? -9.143  15.335  43.347  1.00 45.12  ? 166 VAL A CG1   1 
ATOM   968  C  CG2   . VAL A 1 124 ? -11.253 15.448  42.098  1.00 43.60  ? 166 VAL A CG2   1 
ATOM   969  N  N     . LEU A 1 125 ? -10.713 12.571  40.719  1.00 40.82  ? 167 LEU A N     1 
ATOM   970  C  CA    . LEU A 1 125 ? -10.290 12.101  39.409  1.00 34.80  ? 167 LEU A CA    1 
ATOM   971  C  C     . LEU A 1 125 ? -10.740 13.125  38.375  1.00 39.90  ? 167 LEU A C     1 
ATOM   972  O  O     . LEU A 1 125 ? -11.901 13.555  38.372  1.00 37.57  ? 167 LEU A O     1 
ATOM   973  C  CB    . LEU A 1 125 ? -10.866 10.707  39.106  1.00 36.65  ? 167 LEU A CB    1 
ATOM   974  C  CG    . LEU A 1 125 ? -10.724 10.171  37.678  1.00 40.10  ? 167 LEU A CG    1 
ATOM   975  C  CD1   . LEU A 1 125 ? -9.269  9.854   37.316  1.00 36.73  ? 167 LEU A CD1   1 
ATOM   976  C  CD2   . LEU A 1 125 ? -11.605 8.959   37.439  1.00 43.70  ? 167 LEU A CD2   1 
ATOM   977  N  N     . VAL A 1 126 ? -9.807  13.538  37.532  1.00 41.68  ? 168 VAL A N     1 
ATOM   978  C  CA    . VAL A 1 126 ? -10.042 14.486  36.454  1.00 35.62  ? 168 VAL A CA    1 
ATOM   979  C  C     . VAL A 1 126 ? -9.762  13.728  35.176  1.00 42.56  ? 168 VAL A C     1 
ATOM   980  O  O     . VAL A 1 126 ? -8.692  13.121  35.032  1.00 40.88  ? 168 VAL A O     1 
ATOM   981  C  CB    . VAL A 1 126 ? -9.132  15.723  36.563  1.00 37.64  ? 168 VAL A CB    1 
ATOM   982  C  CG1   . VAL A 1 126 ? -9.421  16.705  35.449  1.00 34.28  ? 168 VAL A CG1   1 
ATOM   983  C  CG2   . VAL A 1 126 ? -9.289  16.388  37.891  1.00 36.30  ? 168 VAL A CG2   1 
ATOM   984  N  N     . THR A 1 127 ? -10.723 13.712  34.268  1.00 39.12  ? 169 THR A N     1 
ATOM   985  C  CA    . THR A 1 127 ? -10.451 13.188  32.946  1.00 40.06  ? 169 THR A CA    1 
ATOM   986  C  C     . THR A 1 127 ? -10.433 14.354  31.977  1.00 35.51  ? 169 THR A C     1 
ATOM   987  O  O     . THR A 1 127 ? -11.173 15.322  32.143  1.00 39.09  ? 169 THR A O     1 
ATOM   988  C  CB    . THR A 1 127 ? -11.458 12.134  32.537  1.00 41.28  ? 169 THR A CB    1 
ATOM   989  O  OG1   . THR A 1 127 ? -10.954 11.457  31.381  1.00 40.91  ? 169 THR A OG1   1 
ATOM   990  C  CG2   . THR A 1 127 ? -12.794 12.767  32.244  1.00 38.86  ? 169 THR A CG2   1 
ATOM   991  N  N     . ALA A 1 128 ? -9.521  14.308  31.027  1.00 40.43  ? 170 ALA A N     1 
ATOM   992  C  CA    . ALA A 1 128 ? -9.209  15.504  30.258  1.00 44.15  ? 170 ALA A CA    1 
ATOM   993  C  C     . ALA A 1 128 ? -8.960  15.175  28.789  1.00 38.78  ? 170 ALA A C     1 
ATOM   994  O  O     . ALA A 1 128 ? -8.352  14.153  28.460  1.00 38.93  ? 170 ALA A O     1 
ATOM   995  C  CB    . ALA A 1 128 ? -7.980  16.219  30.837  1.00 37.63  ? 170 ALA A CB    1 
ATOM   996  N  N     . TYR A 1 129 ? -9.394  16.071  27.910  1.00 36.27  ? 171 TYR A N     1 
ATOM   997  C  CA    . TYR A 1 129 ? -9.069  16.000  26.487  1.00 39.26  ? 171 TYR A CA    1 
ATOM   998  C  C     . TYR A 1 129 ? -8.498  17.357  26.103  1.00 42.97  ? 171 TYR A C     1 
ATOM   999  O  O     . TYR A 1 129 ? -9.265  18.231  25.696  1.00 40.62  ? 171 TYR A O     1 
ATOM   1000 C  CB    . TYR A 1 129 ? -10.276 15.650  25.661  1.00 38.25  ? 171 TYR A CB    1 
ATOM   1001 C  CG    . TYR A 1 129 ? -10.019 15.676  24.164  1.00 43.83  ? 171 TYR A CG    1 
ATOM   1002 C  CD1   . TYR A 1 129 ? -8.915  15.040  23.619  1.00 43.57  ? 171 TYR A CD1   1 
ATOM   1003 C  CD2   . TYR A 1 129 ? -10.887 16.330  23.296  1.00 46.01  ? 171 TYR A CD2   1 
ATOM   1004 C  CE1   . TYR A 1 129 ? -8.674  15.060  22.271  1.00 42.43  ? 171 TYR A CE1   1 
ATOM   1005 C  CE2   . TYR A 1 129 ? -10.653 16.342  21.926  1.00 43.78  ? 171 TYR A CE2   1 
ATOM   1006 C  CZ    . TYR A 1 129 ? -9.549  15.705  21.431  1.00 43.67  ? 171 TYR A CZ    1 
ATOM   1007 O  OH    . TYR A 1 129 ? -9.301  15.710  20.079  1.00 46.31  ? 171 TYR A OH    1 
ATOM   1008 N  N     . VAL A 1 130 ? -7.175  17.508  26.243  1.00 44.60  ? 172 VAL A N     1 
ATOM   1009 C  CA    . VAL A 1 130 ? -6.476  18.802  26.153  1.00 42.88  ? 172 VAL A CA    1 
ATOM   1010 C  C     . VAL A 1 130 ? -6.486  19.293  24.706  1.00 45.13  ? 172 VAL A C     1 
ATOM   1011 O  O     . VAL A 1 130 ? -6.280  18.488  23.787  1.00 41.39  ? 172 VAL A O     1 
ATOM   1012 C  CB    . VAL A 1 130 ? -5.035  18.661  26.685  1.00 41.10  ? 172 VAL A CB    1 
ATOM   1013 C  CG1   . VAL A 1 130 ? -4.211  19.876  26.358  1.00 39.16  ? 172 VAL A CG1   1 
ATOM   1014 C  CG2   . VAL A 1 130 ? -5.029  18.370  28.178  1.00 40.76  ? 172 VAL A CG2   1 
ATOM   1015 N  N     . PRO A 1 131 ? -6.687  20.584  24.443  1.00 46.79  ? 173 PRO A N     1 
ATOM   1016 C  CA    . PRO A 1 131 ? -6.726  21.047  23.045  1.00 39.81  ? 173 PRO A CA    1 
ATOM   1017 C  C     . PRO A 1 131 ? -5.419  20.810  22.296  1.00 40.11  ? 173 PRO A C     1 
ATOM   1018 O  O     . PRO A 1 131 ? -4.336  21.261  22.705  1.00 37.95  ? 173 PRO A O     1 
ATOM   1019 C  CB    . PRO A 1 131 ? -7.065  22.544  23.167  1.00 45.85  ? 173 PRO A CB    1 
ATOM   1020 C  CG    . PRO A 1 131 ? -6.990  22.893  24.635  1.00 42.94  ? 173 PRO A CG    1 
ATOM   1021 C  CD    . PRO A 1 131 ? -7.170  21.609  25.393  1.00 42.52  ? 173 PRO A CD    1 
ATOM   1022 N  N     . ASN A 1 132 ? -5.531  20.047  21.202  1.00 38.49  ? 174 ASN A N     1 
ATOM   1023 C  CA    . ASN A 1 132 ? -4.461  19.907  20.223  1.00 41.90  ? 174 ASN A CA    1 
ATOM   1024 C  C     . ASN A 1 132 ? -4.032  21.281  19.732  1.00 41.42  ? 174 ASN A C     1 
ATOM   1025 O  O     . ASN A 1 132 ? -4.850  22.200  19.620  1.00 44.39  ? 174 ASN A O     1 
ATOM   1026 C  CB    . ASN A 1 132 ? -4.934  19.046  19.033  1.00 45.59  ? 174 ASN A CB    1 
ATOM   1027 C  CG    . ASN A 1 132 ? -3.777  18.536  18.169  1.00 40.30  ? 174 ASN A CG    1 
ATOM   1028 O  OD1   . ASN A 1 132 ? -3.252  19.261  17.326  1.00 40.32  ? 174 ASN A OD1   1 
ATOM   1029 N  ND2   . ASN A 1 132 ? -3.387  17.282  18.377  1.00 42.41  ? 174 ASN A ND2   1 
ATOM   1030 N  N     . ALA A 1 133 ? -2.738  21.416  19.452  1.00 34.99  ? 175 ALA A N     1 
ATOM   1031 C  CA    . ALA A 1 133 ? -2.182  22.696  19.042  1.00 42.13  ? 175 ALA A CA    1 
ATOM   1032 C  C     . ALA A 1 133 ? -2.446  22.995  17.566  1.00 48.40  ? 175 ALA A C     1 
ATOM   1033 O  O     . ALA A 1 133 ? -2.248  24.142  17.130  1.00 43.39  ? 175 ALA A O     1 
ATOM   1034 C  CB    . ALA A 1 133 ? -0.679  22.731  19.345  1.00 32.05  ? 175 ALA A CB    1 
ATOM   1035 N  N     . GLY A 1 134 ? -2.864  21.993  16.800  1.00 42.25  ? 176 GLY A N     1 
ATOM   1036 C  CA    . GLY A 1 134 ? -3.442  22.173  15.481  1.00 46.63  ? 176 GLY A CA    1 
ATOM   1037 C  C     . GLY A 1 134 ? -2.424  22.107  14.360  1.00 41.67  ? 176 GLY A C     1 
ATOM   1038 O  O     . GLY A 1 134 ? -1.245  22.427  14.519  1.00 42.64  ? 176 GLY A O     1 
ATOM   1039 N  N     . ARG A 1 135 ? -2.910  21.679  13.201  1.00 43.64  ? 177 ARG A N     1 
ATOM   1040 C  CA    . ARG A 1 135 ? -2.164  21.813  11.956  1.00 52.71  ? 177 ARG A CA    1 
ATOM   1041 C  C     . ARG A 1 135 ? -1.668  23.243  11.801  1.00 50.79  ? 177 ARG A C     1 
ATOM   1042 O  O     . ARG A 1 135 ? -2.439  24.208  11.939  1.00 42.32  ? 177 ARG A O     1 
ATOM   1043 C  CB    . ARG A 1 135 ? -3.032  21.407  10.757  1.00 43.42  ? 177 ARG A CB    1 
ATOM   1044 N  N     . GLY A 1 136 ? -0.355  23.360  11.562  1.00 51.15  ? 178 GLY A N     1 
ATOM   1045 C  CA    . GLY A 1 136 ? 0.303   24.646  11.455  1.00 46.95  ? 178 GLY A CA    1 
ATOM   1046 C  C     . GLY A 1 136 ? 0.357   25.423  12.741  1.00 52.50  ? 178 GLY A C     1 
ATOM   1047 O  O     . GLY A 1 136 ? 0.468   26.645  12.704  1.00 57.32  ? 178 GLY A O     1 
ATOM   1048 N  N     . LEU A 1 137 ? 0.255   24.746  13.882  1.00 50.08  ? 179 LEU A N     1 
ATOM   1049 C  CA    . LEU A 1 137 ? 0.327   25.392  15.191  1.00 47.66  ? 179 LEU A CA    1 
ATOM   1050 C  C     . LEU A 1 137 ? -0.629  26.589  15.328  1.00 45.74  ? 179 LEU A C     1 
ATOM   1051 O  O     . LEU A 1 137 ? -0.369  27.507  16.096  1.00 47.53  ? 179 LEU A O     1 
ATOM   1052 C  CB    . LEU A 1 137 ? 1.767   25.808  15.494  1.00 43.27  ? 179 LEU A CB    1 
ATOM   1053 C  CG    . LEU A 1 137 ? 2.797   24.666  15.444  1.00 42.12  ? 179 LEU A CG    1 
ATOM   1054 C  CD1   . LEU A 1 137 ? 4.215   25.199  15.658  1.00 43.11  ? 179 LEU A CD1   1 
ATOM   1055 C  CD2   . LEU A 1 137 ? 2.458   23.582  16.467  1.00 41.23  ? 179 LEU A CD2   1 
ATOM   1056 N  N     . VAL A 1 138 ? -1.769  26.595  14.622  1.00 51.20  ? 180 VAL A N     1 
ATOM   1057 C  CA    . VAL A 1 138 ? -2.633  27.777  14.683  1.00 50.18  ? 180 VAL A CA    1 
ATOM   1058 C  C     . VAL A 1 138 ? -3.519  27.776  15.915  1.00 51.53  ? 180 VAL A C     1 
ATOM   1059 O  O     . VAL A 1 138 ? -4.327  28.697  16.093  1.00 52.42  ? 180 VAL A O     1 
ATOM   1060 C  CB    . VAL A 1 138 ? -3.515  27.961  13.425  1.00 58.18  ? 180 VAL A CB    1 
ATOM   1061 C  CG1   . VAL A 1 138 ? -2.715  27.683  12.164  1.00 60.38  ? 180 VAL A CG1   1 
ATOM   1062 C  CG2   . VAL A 1 138 ? -4.733  27.092  13.485  1.00 60.66  ? 180 VAL A CG2   1 
ATOM   1063 N  N     . ARG A 1 139 ? -3.395  26.782  16.777  1.00 54.81  ? 181 ARG A N     1 
ATOM   1064 C  CA    . ARG A 1 139 ? -3.979  26.836  18.106  1.00 49.45  ? 181 ARG A CA    1 
ATOM   1065 C  C     . ARG A 1 139 ? -2.935  26.863  19.213  1.00 49.25  ? 181 ARG A C     1 
ATOM   1066 O  O     . ARG A 1 139 ? -3.307  26.940  20.393  1.00 50.62  ? 181 ARG A O     1 
ATOM   1067 C  CB    . ARG A 1 139 ? -4.896  25.646  18.323  1.00 46.41  ? 181 ARG A CB    1 
ATOM   1068 C  CG    . ARG A 1 139 ? -6.246  25.811  17.743  1.00 56.50  ? 181 ARG A CG    1 
ATOM   1069 C  CD    . ARG A 1 139 ? -7.163  24.948  18.531  1.00 55.71  ? 181 ARG A CD    1 
ATOM   1070 N  NE    . ARG A 1 139 ? -8.192  25.736  19.182  1.00 53.94  ? 181 ARG A NE    1 
ATOM   1071 C  CZ    . ARG A 1 139 ? -9.078  25.239  20.036  1.00 51.00  ? 181 ARG A CZ    1 
ATOM   1072 N  NH1   . ARG A 1 139 ? -9.046  23.957  20.374  1.00 44.54  ? 181 ARG A NH1   1 
ATOM   1073 N  NH2   . ARG A 1 139 ? -10.002 26.036  20.543  1.00 52.79  ? 181 ARG A NH2   1 
ATOM   1074 N  N     . LEU A 1 140 ? -1.644  26.797  18.871  1.00 47.50  ? 182 LEU A N     1 
ATOM   1075 C  CA    . LEU A 1 140 ? -0.614  26.726  19.898  1.00 47.04  ? 182 LEU A CA    1 
ATOM   1076 C  C     . LEU A 1 140 ? -0.727  27.887  20.882  1.00 52.75  ? 182 LEU A C     1 
ATOM   1077 O  O     . LEU A 1 140 ? -0.486  27.714  22.081  1.00 48.67  ? 182 LEU A O     1 
ATOM   1078 C  CB    . LEU A 1 140 ? 0.771   26.693  19.253  1.00 46.06  ? 182 LEU A CB    1 
ATOM   1079 C  CG    . LEU A 1 140 ? 1.923   26.595  20.238  1.00 36.56  ? 182 LEU A CG    1 
ATOM   1080 C  CD1   . LEU A 1 140 ? 1.627   25.450  21.152  1.00 41.14  ? 182 LEU A CD1   1 
ATOM   1081 C  CD2   . LEU A 1 140 ? 3.207   26.327  19.511  1.00 37.54  ? 182 LEU A CD2   1 
ATOM   1082 N  N     . GLU A 1 141 ? -1.121  29.072  20.399  1.00 54.58  ? 183 GLU A N     1 
ATOM   1083 C  CA    . GLU A 1 141 ? -1.261  30.218  21.297  1.00 62.61  ? 183 GLU A CA    1 
ATOM   1084 C  C     . GLU A 1 141 ? -2.355  29.959  22.327  1.00 56.64  ? 183 GLU A C     1 
ATOM   1085 O  O     . GLU A 1 141 ? -2.158  30.164  23.532  1.00 56.99  ? 183 GLU A O     1 
ATOM   1086 C  CB    . GLU A 1 141 ? -1.545  31.493  20.494  1.00 60.06  ? 183 GLU A CB    1 
ATOM   1087 C  CG    . GLU A 1 141 ? -1.445  32.780  21.303  1.00 64.85  ? 183 GLU A CG    1 
ATOM   1088 C  CD    . GLU A 1 141 ? -0.554  33.821  20.646  1.00 78.18  ? 183 GLU A CD    1 
ATOM   1089 O  OE1   . GLU A 1 141 ? 0.483   34.180  21.245  1.00 77.56  ? 183 GLU A OE1   1 
ATOM   1090 O  OE2   . GLU A 1 141 ? -0.883  34.278  19.528  1.00 81.45  ? 183 GLU A OE2   1 
ATOM   1091 N  N     . TYR A 1 142 ? -3.511  29.479  21.868  1.00 49.07  ? 184 TYR A N     1 
ATOM   1092 C  CA    . TYR A 1 142 ? -4.579  29.111  22.787  1.00 49.89  ? 184 TYR A CA    1 
ATOM   1093 C  C     . TYR A 1 142 ? -4.151  27.999  23.746  1.00 54.42  ? 184 TYR A C     1 
ATOM   1094 O  O     . TYR A 1 142 ? -4.457  28.054  24.945  1.00 52.16  ? 184 TYR A O     1 
ATOM   1095 C  CB    . TYR A 1 142 ? -5.814  28.682  22.001  1.00 52.70  ? 184 TYR A CB    1 
ATOM   1096 C  CG    . TYR A 1 142 ? -6.874  28.108  22.896  1.00 53.69  ? 184 TYR A CG    1 
ATOM   1097 C  CD1   . TYR A 1 142 ? -7.602  28.932  23.731  1.00 58.29  ? 184 TYR A CD1   1 
ATOM   1098 C  CD2   . TYR A 1 142 ? -7.134  26.744  22.926  1.00 52.30  ? 184 TYR A CD2   1 
ATOM   1099 C  CE1   . TYR A 1 142 ? -8.568  28.430  24.563  1.00 60.20  ? 184 TYR A CE1   1 
ATOM   1100 C  CE2   . TYR A 1 142 ? -8.097  26.225  23.759  1.00 55.18  ? 184 TYR A CE2   1 
ATOM   1101 C  CZ    . TYR A 1 142 ? -8.814  27.083  24.580  1.00 57.52  ? 184 TYR A CZ    1 
ATOM   1102 O  OH    . TYR A 1 142 ? -9.782  26.616  25.437  1.00 56.56  ? 184 TYR A OH    1 
ATOM   1103 N  N     . ARG A 1 143 ? -3.442  26.980  23.236  1.00 51.53  ? 185 ARG A N     1 
ATOM   1104 C  CA    . ARG A 1 143 ? -3.053  25.836  24.060  1.00 46.51  ? 185 ARG A CA    1 
ATOM   1105 C  C     . ARG A 1 143 ? -2.189  26.254  25.254  1.00 51.60  ? 185 ARG A C     1 
ATOM   1106 O  O     . ARG A 1 143 ? -2.300  25.677  26.344  1.00 46.75  ? 185 ARG A O     1 
ATOM   1107 C  CB    . ARG A 1 143 ? -2.332  24.806  23.177  1.00 41.60  ? 185 ARG A CB    1 
ATOM   1108 C  CG    . ARG A 1 143 ? -1.513  23.719  23.900  1.00 40.77  ? 185 ARG A CG    1 
ATOM   1109 C  CD    . ARG A 1 143 ? -2.330  22.798  24.820  1.00 35.76  ? 185 ARG A CD    1 
ATOM   1110 N  NE    . ARG A 1 143 ? -1.471  21.745  25.373  1.00 38.38  ? 185 ARG A NE    1 
ATOM   1111 C  CZ    . ARG A 1 143 ? -1.203  20.598  24.758  1.00 41.14  ? 185 ARG A CZ    1 
ATOM   1112 N  NH1   . ARG A 1 143 ? -1.754  20.335  23.587  1.00 47.51  ? 185 ARG A NH1   1 
ATOM   1113 N  NH2   . ARG A 1 143 ? -0.396  19.702  25.302  1.00 41.20  ? 185 ARG A NH2   1 
ATOM   1114 N  N     . GLN A 1 144 ? -1.325  27.253  25.071  1.00 52.17  ? 186 GLN A N     1 
ATOM   1115 C  CA    . GLN A 1 144 ? -0.549  27.765  26.195  1.00 47.57  ? 186 GLN A CA    1 
ATOM   1116 C  C     . GLN A 1 144 ? -1.456  28.443  27.212  1.00 48.27  ? 186 GLN A C     1 
ATOM   1117 O  O     . GLN A 1 144 ? -1.261  28.298  28.426  1.00 49.16  ? 186 GLN A O     1 
ATOM   1118 C  CB    . GLN A 1 144 ? 0.528   28.714  25.682  1.00 45.45  ? 186 GLN A CB    1 
ATOM   1119 C  CG    . GLN A 1 144 ? 1.749   27.981  25.220  1.00 52.41  ? 186 GLN A CG    1 
ATOM   1120 C  CD    . GLN A 1 144 ? 2.694   28.821  24.394  1.00 59.58  ? 186 GLN A CD    1 
ATOM   1121 O  OE1   . GLN A 1 144 ? 3.841   29.068  24.801  1.00 55.76  ? 186 GLN A OE1   1 
ATOM   1122 N  NE2   . GLN A 1 144 ? 2.240   29.238  23.212  1.00 50.12  ? 186 GLN A NE2   1 
ATOM   1123 N  N     . ARG A 1 145 ? -2.473  29.159  26.733  1.00 50.17  ? 187 ARG A N     1 
ATOM   1124 C  CA    . ARG A 1 145 ? -3.477  29.706  27.636  1.00 51.35  ? 187 ARG A CA    1 
ATOM   1125 C  C     . ARG A 1 145 ? -4.225  28.595  28.354  1.00 50.77  ? 187 ARG A C     1 
ATOM   1126 O  O     . ARG A 1 145 ? -4.568  28.731  29.530  1.00 53.65  ? 187 ARG A O     1 
ATOM   1127 C  CB    . ARG A 1 145 ? -4.455  30.588  26.864  1.00 54.46  ? 187 ARG A CB    1 
ATOM   1128 C  CG    . ARG A 1 145 ? -3.952  31.995  26.626  1.00 57.25  ? 187 ARG A CG    1 
ATOM   1129 C  CD    . ARG A 1 145 ? -4.868  32.733  25.679  1.00 64.87  ? 187 ARG A CD    1 
ATOM   1130 N  NE    . ARG A 1 145 ? -6.167  33.076  26.261  1.00 67.88  ? 187 ARG A NE    1 
ATOM   1131 C  CZ    . ARG A 1 145 ? -6.365  34.078  27.118  1.00 67.68  ? 187 ARG A CZ    1 
ATOM   1132 N  NH1   . ARG A 1 145 ? -5.345  34.826  27.524  1.00 61.81  ? 187 ARG A NH1   1 
ATOM   1133 N  NH2   . ARG A 1 145 ? -7.587  34.322  27.581  1.00 65.69  ? 187 ARG A NH2   1 
ATOM   1134 N  N     . TRP A 1 146 ? -4.498  27.490  27.660  1.00 49.55  ? 188 TRP A N     1 
ATOM   1135 C  CA    . TRP A 1 146 ? -5.107  26.341  28.318  1.00 45.73  ? 188 TRP A CA    1 
ATOM   1136 C  C     . TRP A 1 146 ? -4.181  25.776  29.385  1.00 44.84  ? 188 TRP A C     1 
ATOM   1137 O  O     . TRP A 1 146 ? -4.597  25.557  30.526  1.00 44.94  ? 188 TRP A O     1 
ATOM   1138 C  CB    . TRP A 1 146 ? -5.464  25.247  27.296  1.00 47.19  ? 188 TRP A CB    1 
ATOM   1139 C  CG    . TRP A 1 146 ? -5.757  23.922  27.969  1.00 43.47  ? 188 TRP A CG    1 
ATOM   1140 C  CD1   . TRP A 1 146 ? -4.845  22.989  28.387  1.00 39.79  ? 188 TRP A CD1   1 
ATOM   1141 C  CD2   . TRP A 1 146 ? -7.042  23.410  28.334  1.00 38.61  ? 188 TRP A CD2   1 
ATOM   1142 N  NE1   . TRP A 1 146 ? -5.480  21.937  29.005  1.00 40.80  ? 188 TRP A NE1   1 
ATOM   1143 C  CE2   . TRP A 1 146 ? -6.829  22.167  28.983  1.00 43.01  ? 188 TRP A CE2   1 
ATOM   1144 C  CE3   . TRP A 1 146 ? -8.347  23.880  28.192  1.00 40.08  ? 188 TRP A CE3   1 
ATOM   1145 C  CZ2   . TRP A 1 146 ? -7.875  21.391  29.472  1.00 40.65  ? 188 TRP A CZ2   1 
ATOM   1146 C  CZ3   . TRP A 1 146 ? -9.388  23.105  28.679  1.00 41.56  ? 188 TRP A CZ3   1 
ATOM   1147 C  CH2   . TRP A 1 146 ? -9.145  21.875  29.307  1.00 38.91  ? 188 TRP A CH2   1 
ATOM   1148 N  N     . ASP A 1 147 ? -2.929  25.483  29.009  1.00 46.00  ? 189 ASP A N     1 
ATOM   1149 C  CA    . ASP A 1 147 ? -2.002  24.844  29.928  1.00 41.70  ? 189 ASP A CA    1 
ATOM   1150 C  C     . ASP A 1 147 ? -1.901  25.636  31.215  1.00 49.01  ? 189 ASP A C     1 
ATOM   1151 O  O     . ASP A 1 147 ? -1.945  25.071  32.314  1.00 47.93  ? 189 ASP A O     1 
ATOM   1152 C  CB    . ASP A 1 147 ? -0.622  24.726  29.289  1.00 45.55  ? 189 ASP A CB    1 
ATOM   1153 C  CG    . ASP A 1 147 ? -0.544  23.637  28.238  1.00 49.12  ? 189 ASP A CG    1 
ATOM   1154 O  OD1   . ASP A 1 147 ? -1.523  22.884  28.079  1.00 48.77  ? 189 ASP A OD1   1 
ATOM   1155 O  OD2   . ASP A 1 147 ? 0.516   23.519  27.579  1.00 49.41  ? 189 ASP A OD2   1 
ATOM   1156 N  N     . GLU A 1 148 ? -1.799  26.961  31.090  1.00 56.23  ? 190 GLU A N     1 
ATOM   1157 C  CA    . GLU A 1 148 ? -1.717  27.824  32.258  1.00 53.89  ? 190 GLU A CA    1 
ATOM   1158 C  C     . GLU A 1 148 ? -2.972  27.718  33.114  1.00 52.61  ? 190 GLU A C     1 
ATOM   1159 O  O     . GLU A 1 148 ? -2.884  27.504  34.321  1.00 54.19  ? 190 GLU A O     1 
ATOM   1160 C  CB    . GLU A 1 148 ? -1.488  29.266  31.836  1.00 52.29  ? 190 GLU A CB    1 
ATOM   1161 C  CG    . GLU A 1 148 ? -1.137  30.145  33.009  1.00 68.85  ? 190 GLU A CG    1 
ATOM   1162 C  CD    . GLU A 1 148 ? -1.775  31.516  32.936  1.00 77.79  ? 190 GLU A CD    1 
ATOM   1163 O  OE1   . GLU A 1 148 ? -3.031  31.591  32.820  1.00 76.99  ? 190 GLU A OE1   1 
ATOM   1164 O  OE2   . GLU A 1 148 ? -1.014  32.511  32.999  1.00 75.06  ? 190 GLU A OE2   1 
ATOM   1165 N  N     . ALA A 1 149 ? -4.157  27.849  32.513  1.00 51.15  ? 191 ALA A N     1 
ATOM   1166 C  CA    . ALA A 1 149 ? -5.372  27.783  33.323  1.00 44.04  ? 191 ALA A CA    1 
ATOM   1167 C  C     . ALA A 1 149 ? -5.543  26.411  33.957  1.00 46.55  ? 191 ALA A C     1 
ATOM   1168 O  O     . ALA A 1 149 ? -5.864  26.307  35.146  1.00 48.19  ? 191 ALA A O     1 
ATOM   1169 C  CB    . ALA A 1 149 ? -6.591  28.146  32.491  1.00 42.99  ? 191 ALA A CB    1 
ATOM   1170 N  N     . PHE A 1 150 ? -5.293  25.347  33.187  1.00 45.86  ? 192 PHE A N     1 
ATOM   1171 C  CA    . PHE A 1 150 ? -5.458  23.980  33.686  1.00 47.27  ? 192 PHE A CA    1 
ATOM   1172 C  C     . PHE A 1 150 ? -4.492  23.661  34.837  1.00 46.11  ? 192 PHE A C     1 
ATOM   1173 O  O     . PHE A 1 150 ? -4.869  22.992  35.805  1.00 41.90  ? 192 PHE A O     1 
ATOM   1174 C  CB    . PHE A 1 150 ? -5.243  23.004  32.529  1.00 39.13  ? 192 PHE A CB    1 
ATOM   1175 C  CG    . PHE A 1 150 ? -5.768  21.608  32.778  1.00 39.37  ? 192 PHE A CG    1 
ATOM   1176 C  CD1   . PHE A 1 150 ? -6.981  21.407  33.418  1.00 37.00  ? 192 PHE A CD1   1 
ATOM   1177 C  CD2   . PHE A 1 150 ? -5.075  20.498  32.303  1.00 42.93  ? 192 PHE A CD2   1 
ATOM   1178 C  CE1   . PHE A 1 150 ? -7.472  20.130  33.617  1.00 33.97  ? 192 PHE A CE1   1 
ATOM   1179 C  CE2   . PHE A 1 150 ? -5.579  19.214  32.483  1.00 39.73  ? 192 PHE A CE2   1 
ATOM   1180 C  CZ    . PHE A 1 150 ? -6.774  19.036  33.143  1.00 36.48  ? 192 PHE A CZ    1 
ATOM   1181 N  N     . ARG A 1 151 ? -3.225  24.065  34.708  1.00 46.60  ? 193 ARG A N     1 
ATOM   1182 C  CA    . ARG A 1 151 ? -2.243  23.816  35.764  1.00 50.14  ? 193 ARG A CA    1 
ATOM   1183 C  C     . ARG A 1 151 ? -2.693  24.424  37.093  1.00 53.71  ? 193 ARG A C     1 
ATOM   1184 O  O     . ARG A 1 151 ? -2.705  23.742  38.127  1.00 44.33  ? 193 ARG A O     1 
ATOM   1185 C  CB    . ARG A 1 151 ? -0.878  24.369  35.346  1.00 48.45  ? 193 ARG A CB    1 
ATOM   1186 C  CG    . ARG A 1 151 ? 0.177   24.306  36.435  1.00 53.63  ? 193 ARG A CG    1 
ATOM   1187 C  CD    . ARG A 1 151 ? 1.372   25.246  36.188  1.00 55.37  ? 193 ARG A CD    1 
ATOM   1188 N  NE    . ARG A 1 151 ? 1.609   25.568  34.786  1.00 63.09  ? 193 ARG A NE    1 
ATOM   1189 C  CZ    . ARG A 1 151 ? 1.699   26.810  34.305  1.00 66.80  ? 193 ARG A CZ    1 
ATOM   1190 N  NH1   . ARG A 1 151 ? 1.581   27.861  35.127  1.00 63.04  ? 193 ARG A NH1   1 
ATOM   1191 N  NH2   . ARG A 1 151 ? 1.915   27.000  33.000  1.00 52.05  ? 193 ARG A NH2   1 
ATOM   1192 N  N     . LYS A 1 152 ? -3.089  25.706  37.083  1.00 50.23  ? 194 LYS A N     1 
ATOM   1193 C  CA    . LYS A 1 152 ? -3.568  26.327  38.316  1.00 53.94  ? 194 LYS A CA    1 
ATOM   1194 C  C     . LYS A 1 152 ? -4.717  25.528  38.897  1.00 54.84  ? 194 LYS A C     1 
ATOM   1195 O  O     . LYS A 1 152 ? -4.673  25.100  40.061  1.00 51.19  ? 194 LYS A O     1 
ATOM   1196 C  CB    . LYS A 1 152 ? -4.024  27.771  38.084  1.00 55.56  ? 194 LYS A CB    1 
ATOM   1197 C  CG    . LYS A 1 152 ? -3.221  28.589  37.093  1.00 62.44  ? 194 LYS A CG    1 
ATOM   1198 C  CD    . LYS A 1 152 ? -2.121  29.427  37.701  1.00 64.93  ? 194 LYS A CD    1 
ATOM   1199 C  CE    . LYS A 1 152 ? -1.740  30.563  36.744  1.00 68.96  ? 194 LYS A CE    1 
ATOM   1200 N  NZ    . LYS A 1 152 ? -2.689  31.706  36.836  1.00 63.27  ? 194 LYS A NZ    1 
ATOM   1201 N  N     . PHE A 1 153 ? -5.749  25.300  38.083  1.00 48.65  ? 195 PHE A N     1 
ATOM   1202 C  CA    . PHE A 1 153 ? -6.948  24.624  38.556  1.00 51.39  ? 195 PHE A CA    1 
ATOM   1203 C  C     . PHE A 1 153 ? -6.620  23.301  39.242  1.00 50.95  ? 195 PHE A C     1 
ATOM   1204 O  O     . PHE A 1 153 ? -7.132  23.013  40.331  1.00 50.22  ? 195 PHE A O     1 
ATOM   1205 C  CB    . PHE A 1 153 ? -7.888  24.413  37.380  1.00 49.59  ? 195 PHE A CB    1 
ATOM   1206 C  CG    . PHE A 1 153 ? -9.004  23.477  37.659  1.00 48.32  ? 195 PHE A CG    1 
ATOM   1207 C  CD1   . PHE A 1 153 ? -10.166 23.937  38.242  1.00 52.06  ? 195 PHE A CD1   1 
ATOM   1208 C  CD2   . PHE A 1 153 ? -8.921  22.142  37.288  1.00 51.14  ? 195 PHE A CD2   1 
ATOM   1209 C  CE1   . PHE A 1 153 ? -11.233 23.083  38.470  1.00 53.46  ? 195 PHE A CE1   1 
ATOM   1210 C  CE2   . PHE A 1 153 ? -9.982  21.277  37.515  1.00 52.32  ? 195 PHE A CE2   1 
ATOM   1211 C  CZ    . PHE A 1 153 ? -11.137 21.750  38.108  1.00 53.52  ? 195 PHE A CZ    1 
ATOM   1212 N  N     . LEU A 1 154 ? -5.750  22.489  38.620  1.00 49.52  ? 196 LEU A N     1 
ATOM   1213 C  CA    . LEU A 1 154 ? -5.396  21.195  39.201  1.00 49.64  ? 196 LEU A CA    1 
ATOM   1214 C  C     . LEU A 1 154 ? -4.672  21.364  40.531  1.00 51.41  ? 196 LEU A C     1 
ATOM   1215 O  O     . LEU A 1 154 ? -4.880  20.576  41.457  1.00 51.52  ? 196 LEU A O     1 
ATOM   1216 C  CB    . LEU A 1 154 ? -4.535  20.390  38.236  1.00 42.26  ? 196 LEU A CB    1 
ATOM   1217 C  CG    . LEU A 1 154 ? -5.278  19.952  36.976  1.00 47.45  ? 196 LEU A CG    1 
ATOM   1218 C  CD1   . LEU A 1 154 ? -4.320  19.342  35.956  1.00 42.45  ? 196 LEU A CD1   1 
ATOM   1219 C  CD2   . LEU A 1 154 ? -6.395  18.988  37.331  1.00 38.83  ? 196 LEU A CD2   1 
ATOM   1220 N  N     . LYS A 1 155 ? -3.820  22.387  40.650  1.00 52.15  ? 197 LYS A N     1 
ATOM   1221 C  CA    . LYS A 1 155 ? -3.116  22.596  41.913  1.00 58.48  ? 197 LYS A CA    1 
ATOM   1222 C  C     . LYS A 1 155 ? -4.101  22.874  43.045  1.00 57.25  ? 197 LYS A C     1 
ATOM   1223 O  O     . LYS A 1 155 ? -3.980  22.301  44.143  1.00 54.70  ? 197 LYS A O     1 
ATOM   1224 C  CB    . LYS A 1 155 ? -2.108  23.736  41.781  1.00 53.01  ? 197 LYS A CB    1 
ATOM   1225 C  CG    . LYS A 1 155 ? -1.129  23.774  42.927  1.00 55.45  ? 197 LYS A CG    1 
ATOM   1226 C  CD    . LYS A 1 155 ? 0.046   24.621  42.537  1.00 58.81  ? 197 LYS A CD    1 
ATOM   1227 C  CE    . LYS A 1 155 ? 0.634   25.355  43.728  1.00 60.17  ? 197 LYS A CE    1 
ATOM   1228 N  NZ    . LYS A 1 155 ? 1.452   24.451  44.579  1.00 63.83  ? 197 LYS A NZ    1 
ATOM   1229 N  N     . GLY A 1 156 ? -5.108  23.721  42.783  1.00 50.82  ? 198 GLY A N     1 
ATOM   1230 C  CA    . GLY A 1 156 ? -6.168  23.924  43.757  1.00 47.12  ? 198 GLY A CA    1 
ATOM   1231 C  C     . GLY A 1 156 ? -6.811  22.617  44.191  1.00 52.80  ? 198 GLY A C     1 
ATOM   1232 O  O     . GLY A 1 156 ? -7.057  22.389  45.383  1.00 56.72  ? 198 GLY A O     1 
ATOM   1233 N  N     . LEU A 1 157 ? -7.092  21.733  43.227  1.00 51.38  ? 199 LEU A N     1 
ATOM   1234 C  CA    . LEU A 1 157 ? -7.704  20.448  43.557  1.00 59.48  ? 199 LEU A CA    1 
ATOM   1235 C  C     . LEU A 1 157 ? -6.769  19.574  44.399  1.00 54.40  ? 199 LEU A C     1 
ATOM   1236 O  O     . LEU A 1 157 ? -7.162  19.066  45.460  1.00 52.23  ? 199 LEU A O     1 
ATOM   1237 C  CB    . LEU A 1 157 ? -8.090  19.697  42.277  1.00 54.72  ? 199 LEU A CB    1 
ATOM   1238 C  CG    . LEU A 1 157 ? -9.347  19.917  41.441  1.00 56.14  ? 199 LEU A CG    1 
ATOM   1239 C  CD1   . LEU A 1 157 ? -9.351  18.889  40.310  1.00 50.40  ? 199 LEU A CD1   1 
ATOM   1240 C  CD2   . LEU A 1 157 ? -10.614 19.822  42.270  1.00 47.25  ? 199 LEU A CD2   1 
ATOM   1241 N  N     . ALA A 1 158 ? -5.532  19.361  43.922  1.00 54.76  ? 200 ALA A N     1 
ATOM   1242 C  CA    . ALA A 1 158 ? -4.594  18.479  44.590  1.00 51.24  ? 200 ALA A CA    1 
ATOM   1243 C  C     . ALA A 1 158 ? -4.233  18.953  45.986  1.00 56.78  ? 200 ALA A C     1 
ATOM   1244 O  O     . ALA A 1 158 ? -3.770  18.157  46.805  1.00 54.74  ? 200 ALA A O     1 
ATOM   1245 C  CB    . ALA A 1 158 ? -3.299  18.327  43.798  1.00 51.74  ? 200 ALA A CB    1 
ATOM   1246 N  N     . SER A 1 159 ? -4.436  20.256  46.264  1.00 53.58  ? 201 SER A N     1 
ATOM   1247 C  CA    . SER A 1 159 ? -4.236  20.738  47.623  1.00 59.17  ? 201 SER A CA    1 
ATOM   1248 C  C     . SER A 1 159 ? -5.355  20.319  48.576  1.00 60.41  ? 201 SER A C     1 
ATOM   1249 O  O     . SER A 1 159 ? -5.168  20.413  49.794  1.00 66.92  ? 201 SER A O     1 
ATOM   1250 C  CB    . SER A 1 159 ? -4.074  22.257  47.612  1.00 55.35  ? 201 SER A CB    1 
ATOM   1251 O  OG    . SER A 1 159 ? -5.313  22.926  47.481  1.00 66.15  ? 201 SER A OG    1 
ATOM   1252 N  N     . ARG A 1 160 ? -6.493  19.842  48.073  1.00 53.98  ? 202 ARG A N     1 
ATOM   1253 C  CA    . ARG A 1 160 ? -7.568  19.373  48.940  1.00 54.57  ? 202 ARG A CA    1 
ATOM   1254 C  C     . ARG A 1 160 ? -7.550  17.865  49.160  1.00 55.40  ? 202 ARG A C     1 
ATOM   1255 O  O     . ARG A 1 160 ? -7.725  17.419  50.297  1.00 58.02  ? 202 ARG A O     1 
ATOM   1256 C  CB    . ARG A 1 160 ? -8.930  19.792  48.375  1.00 53.12  ? 202 ARG A CB    1 
ATOM   1257 N  N     . LYS A 1 161 ? -7.336  17.071  48.107  1.00 57.53  ? 203 LYS A N     1 
ATOM   1258 C  CA    . LYS A 1 161 ? -7.390  15.612  48.153  1.00 54.36  ? 203 LYS A CA    1 
ATOM   1259 C  C     . LYS A 1 161 ? -6.413  15.066  47.125  1.00 47.60  ? 203 LYS A C     1 
ATOM   1260 O  O     . LYS A 1 161 ? -6.111  15.765  46.151  1.00 52.85  ? 203 LYS A O     1 
ATOM   1261 C  CB    . LYS A 1 161 ? -8.810  15.092  47.860  1.00 51.89  ? 203 LYS A CB    1 
ATOM   1262 C  CG    . LYS A 1 161 ? -9.217  13.909  48.747  1.00 57.16  ? 203 LYS A CG    1 
ATOM   1263 C  CD    . LYS A 1 161 ? -10.529 13.233  48.313  1.00 60.49  ? 203 LYS A CD    1 
ATOM   1264 C  CE    . LYS A 1 161 ? -11.740 14.061  48.683  1.00 52.39  ? 203 LYS A CE    1 
ATOM   1265 N  NZ    . LYS A 1 161 ? -12.934 13.206  48.938  1.00 54.82  ? 203 LYS A NZ    1 
ATOM   1266 N  N     . PRO A 1 162 ? -5.902  13.842  47.302  1.00 44.72  ? 204 PRO A N     1 
ATOM   1267 C  CA    . PRO A 1 162 ? -5.015  13.252  46.284  1.00 43.47  ? 204 PRO A CA    1 
ATOM   1268 C  C     . PRO A 1 162 ? -5.688  13.141  44.923  1.00 49.86  ? 204 PRO A C     1 
ATOM   1269 O  O     . PRO A 1 162 ? -6.814  12.665  44.795  1.00 52.51  ? 204 PRO A O     1 
ATOM   1270 C  CB    . PRO A 1 162 ? -4.686  11.868  46.848  1.00 46.13  ? 204 PRO A CB    1 
ATOM   1271 C  CG    . PRO A 1 162 ? -5.662  11.650  47.942  1.00 54.31  ? 204 PRO A CG    1 
ATOM   1272 C  CD    . PRO A 1 162 ? -5.955  12.998  48.501  1.00 51.94  ? 204 PRO A CD    1 
ATOM   1273 N  N     . LEU A 1 163 ? -4.972  13.554  43.897  1.00 42.06  ? 205 LEU A N     1 
ATOM   1274 C  CA    . LEU A 1 163 ? -5.544  13.735  42.579  1.00 39.42  ? 205 LEU A CA    1 
ATOM   1275 C  C     . LEU A 1 163 ? -4.982  12.694  41.618  1.00 43.65  ? 205 LEU A C     1 
ATOM   1276 O  O     . LEU A 1 163 ? -3.758  12.444  41.582  1.00 35.19  ? 205 LEU A O     1 
ATOM   1277 C  CB    . LEU A 1 163 ? -5.263  15.158  42.078  1.00 44.26  ? 205 LEU A CB    1 
ATOM   1278 C  CG    . LEU A 1 163 ? -5.774  15.714  40.747  1.00 52.10  ? 205 LEU A CG    1 
ATOM   1279 C  CD1   . LEU A 1 163 ? -5.061  15.016  39.628  1.00 45.38  ? 205 LEU A CD1   1 
ATOM   1280 C  CD2   . LEU A 1 163 ? -7.334  15.624  40.566  1.00 55.45  ? 205 LEU A CD2   1 
ATOM   1281 N  N     . VAL A 1 164 ? -5.887  12.123  40.816  1.00 39.45  ? 206 VAL A N     1 
ATOM   1282 C  CA    . VAL A 1 164 ? -5.549  11.346  39.623  1.00 43.15  ? 206 VAL A CA    1 
ATOM   1283 C  C     . VAL A 1 164 ? -6.060  12.110  38.420  1.00 33.84  ? 206 VAL A C     1 
ATOM   1284 O  O     . VAL A 1 164 ? -7.251  12.429  38.344  1.00 37.42  ? 206 VAL A O     1 
ATOM   1285 C  CB    . VAL A 1 164 ? -6.156  9.936   39.631  1.00 43.03  ? 206 VAL A CB    1 
ATOM   1286 C  CG1   . VAL A 1 164 ? -5.764  9.179   38.337  1.00 37.81  ? 206 VAL A CG1   1 
ATOM   1287 C  CG2   . VAL A 1 164 ? -5.706  9.171   40.841  1.00 36.17  ? 206 VAL A CG2   1 
ATOM   1288 N  N     . LEU A 1 165 ? -5.170  12.400  37.485  1.00 37.99  ? 207 LEU A N     1 
ATOM   1289 C  CA    . LEU A 1 165 ? -5.532  12.969  36.191  1.00 34.29  ? 207 LEU A CA    1 
ATOM   1290 C  C     . LEU A 1 165 ? -5.287  11.931  35.093  1.00 38.84  ? 207 LEU A C     1 
ATOM   1291 O  O     . LEU A 1 165 ? -4.162  11.430  34.934  1.00 37.12  ? 207 LEU A O     1 
ATOM   1292 C  CB    . LEU A 1 165 ? -4.729  14.243  35.914  1.00 34.11  ? 207 LEU A CB    1 
ATOM   1293 C  CG    . LEU A 1 165 ? -4.689  14.701  34.454  1.00 34.05  ? 207 LEU A CG    1 
ATOM   1294 C  CD1   . LEU A 1 165 ? -6.101  14.975  33.957  1.00 38.25  ? 207 LEU A CD1   1 
ATOM   1295 C  CD2   . LEU A 1 165 ? -3.840  15.947  34.289  1.00 34.10  ? 207 LEU A CD2   1 
ATOM   1296 N  N     . CYS A 1 166 ? -6.331  11.614  34.328  1.00 39.30  ? 208 CYS A N     1 
ATOM   1297 C  CA    . CYS A 1 166 ? -6.190  10.675  33.233  1.00 37.83  ? 208 CYS A CA    1 
ATOM   1298 C  C     . CYS A 1 166 ? -6.675  11.291  31.941  1.00 40.05  ? 208 CYS A C     1 
ATOM   1299 O  O     . CYS A 1 166 ? -7.639  12.064  31.918  1.00 42.94  ? 208 CYS A O     1 
ATOM   1300 C  CB    . CYS A 1 166 ? -6.961  9.392   33.470  1.00 39.85  ? 208 CYS A CB    1 
ATOM   1301 S  SG    . CYS A 1 166 ? -8.743  9.555   33.428  1.00 50.43  ? 208 CYS A SG    1 
ATOM   1302 N  N     . GLY A 1 167 ? -6.022  10.910  30.861  1.00 37.92  ? 209 GLY A N     1 
ATOM   1303 C  CA    . GLY A 1 167 ? -6.598  11.172  29.563  1.00 43.45  ? 209 GLY A CA    1 
ATOM   1304 C  C     . GLY A 1 167 ? -5.554  11.591  28.579  1.00 34.35  ? 209 GLY A C     1 
ATOM   1305 O  O     . GLY A 1 167 ? -4.357  11.438  28.818  1.00 36.62  ? 209 GLY A O     1 
ATOM   1306 N  N     . ASP A 1 168 ? -6.061  12.132  27.483  1.00 38.32  ? 210 ASP A N     1 
ATOM   1307 C  CA    . ASP A 1 168 ? -5.293  12.528  26.305  1.00 34.53  ? 210 ASP A CA    1 
ATOM   1308 C  C     . ASP A 1 168 ? -4.804  13.946  26.541  1.00 36.11  ? 210 ASP A C     1 
ATOM   1309 O  O     . ASP A 1 168 ? -5.562  14.907  26.419  1.00 37.89  ? 210 ASP A O     1 
ATOM   1310 C  CB    . ASP A 1 168 ? -6.162  12.427  25.053  1.00 40.48  ? 210 ASP A CB    1 
ATOM   1311 C  CG    . ASP A 1 168 ? -5.409  12.761  23.768  1.00 38.68  ? 210 ASP A CG    1 
ATOM   1312 O  OD1   . ASP A 1 168 ? -4.301  13.317  23.826  1.00 36.94  ? 210 ASP A OD1   1 
ATOM   1313 O  OD2   . ASP A 1 168 ? -5.939  12.453  22.684  1.00 45.15  ? 210 ASP A OD2   1 
ATOM   1314 N  N     . LEU A 1 169 ? -3.535  14.079  26.889  1.00 38.90  ? 211 LEU A N     1 
ATOM   1315 C  CA    . LEU A 1 169 ? -2.951  15.372  27.226  1.00 38.69  ? 211 LEU A CA    1 
ATOM   1316 C  C     . LEU A 1 169 ? -2.265  16.017  26.030  1.00 37.96  ? 211 LEU A C     1 
ATOM   1317 O  O     . LEU A 1 169 ? -1.692  17.112  26.171  1.00 34.20  ? 211 LEU A O     1 
ATOM   1318 C  CB    . LEU A 1 169 ? -1.942  15.217  28.392  1.00 37.07  ? 211 LEU A CB    1 
ATOM   1319 C  CG    . LEU A 1 169 ? -2.446  14.572  29.678  1.00 35.45  ? 211 LEU A CG    1 
ATOM   1320 C  CD1   . LEU A 1 169 ? -1.409  14.655  30.809  1.00 34.46  ? 211 LEU A CD1   1 
ATOM   1321 C  CD2   . LEU A 1 169 ? -3.792  15.146  30.123  1.00 33.02  ? 211 LEU A CD2   1 
ATOM   1322 N  N     . ASN A 1 170 ? -2.287  15.345  24.873  1.00 31.77  ? 212 ASN A N     1 
ATOM   1323 C  CA    . ASN A 1 170 ? -1.844  15.924  23.606  1.00 35.02  ? 212 ASN A CA    1 
ATOM   1324 C  C     . ASN A 1 170 ? -0.442  16.543  23.704  1.00 37.85  ? 212 ASN A C     1 
ATOM   1325 O  O     . ASN A 1 170 ? -0.209  17.684  23.301  1.00 41.15  ? 212 ASN A O     1 
ATOM   1326 C  CB    . ASN A 1 170 ? -2.876  16.936  23.098  1.00 32.73  ? 212 ASN A CB    1 
ATOM   1327 C  CG    . ASN A 1 170 ? -3.760  16.348  21.964  1.00 45.29  ? 212 ASN A CG    1 
ATOM   1328 O  OD1   . ASN A 1 170 ? -3.246  15.692  21.056  1.00 43.28  ? 212 ASN A OD1   1 
ATOM   1329 N  ND2   . ASN A 1 170 ? -5.077  16.577  22.025  1.00 42.24  ? 212 ASN A ND2   1 
ATOM   1330 N  N     . VAL A 1 171 ? 0.511   15.774  24.239  1.00 38.90  ? 213 VAL A N     1 
ATOM   1331 C  CA    . VAL A 1 171 ? 1.927   16.138  24.165  1.00 33.85  ? 213 VAL A CA    1 
ATOM   1332 C  C     . VAL A 1 171 ? 2.778   14.923  24.520  1.00 38.24  ? 213 VAL A C     1 
ATOM   1333 O  O     . VAL A 1 171 ? 2.404   14.121  25.386  1.00 35.55  ? 213 VAL A O     1 
ATOM   1334 C  CB    . VAL A 1 171 ? 2.257   17.326  25.083  1.00 36.25  ? 213 VAL A CB    1 
ATOM   1335 C  CG1   . VAL A 1 171 ? 1.656   17.104  26.450  1.00 31.19  ? 213 VAL A CG1   1 
ATOM   1336 C  CG2   . VAL A 1 171 ? 3.785   17.524  25.199  1.00 35.02  ? 213 VAL A CG2   1 
ATOM   1337 N  N     . ALA A 1 172 ? 3.913   14.756  23.832  1.00 35.57  ? 214 ALA A N     1 
ATOM   1338 C  CA    . ALA A 1 172 ? 4.898   13.736  24.165  1.00 33.22  ? 214 ALA A CA    1 
ATOM   1339 C  C     . ALA A 1 172 ? 5.995   14.438  24.960  1.00 33.45  ? 214 ALA A C     1 
ATOM   1340 O  O     . ALA A 1 172 ? 6.701   15.296  24.424  1.00 37.09  ? 214 ALA A O     1 
ATOM   1341 C  CB    . ALA A 1 172 ? 5.433   13.058  22.903  1.00 27.07  ? 214 ALA A CB    1 
ATOM   1342 N  N     . HIS A 1 173 ? 6.103   14.111  26.250  1.00 34.59  ? 215 HIS A N     1 
ATOM   1343 C  CA    . HIS A 1 173 ? 6.911   14.919  27.166  1.00 36.09  ? 215 HIS A CA    1 
ATOM   1344 C  C     . HIS A 1 173 ? 8.387   14.928  26.767  1.00 40.60  ? 215 HIS A C     1 
ATOM   1345 O  O     . HIS A 1 173 ? 8.970   15.991  26.541  1.00 36.10  ? 215 HIS A O     1 
ATOM   1346 C  CB    . HIS A 1 173 ? 6.764   14.413  28.602  1.00 34.82  ? 215 HIS A CB    1 
ATOM   1347 C  CG    . HIS A 1 173 ? 7.621   15.155  29.588  1.00 42.73  ? 215 HIS A CG    1 
ATOM   1348 N  ND1   . HIS A 1 173 ? 8.110   14.571  30.744  1.00 42.62  ? 215 HIS A ND1   1 
ATOM   1349 C  CD2   . HIS A 1 173 ? 8.066   16.438  29.598  1.00 42.18  ? 215 HIS A CD2   1 
ATOM   1350 C  CE1   . HIS A 1 173 ? 8.811   15.466  31.423  1.00 40.66  ? 215 HIS A CE1   1 
ATOM   1351 N  NE2   . HIS A 1 173 ? 8.802   16.604  30.752  1.00 43.34  ? 215 HIS A NE2   1 
ATOM   1352 N  N     . GLU A 1 174 ? 9.016   13.758  26.689  1.00 34.56  ? 216 GLU A N     1 
ATOM   1353 C  CA    . GLU A 1 174 ? 10.413  13.681  26.302  1.00 39.38  ? 216 GLU A CA    1 
ATOM   1354 C  C     . GLU A 1 174 ? 10.573  12.963  24.962  1.00 44.17  ? 216 GLU A C     1 
ATOM   1355 O  O     . GLU A 1 174 ? 9.631   12.377  24.415  1.00 39.19  ? 216 GLU A O     1 
ATOM   1356 C  CB    . GLU A 1 174 ? 11.254  12.985  27.389  1.00 43.72  ? 216 GLU A CB    1 
ATOM   1357 C  CG    . GLU A 1 174 ? 11.259  13.672  28.780  1.00 42.35  ? 216 GLU A CG    1 
ATOM   1358 C  CD    . GLU A 1 174 ? 11.723  15.147  28.769  1.00 46.13  ? 216 GLU A CD    1 
ATOM   1359 O  OE1   . GLU A 1 174 ? 12.401  15.594  27.807  1.00 49.11  ? 216 GLU A OE1   1 
ATOM   1360 O  OE2   . GLU A 1 174 ? 11.398  15.864  29.743  1.00 48.54  ? 216 GLU A OE2   1 
ATOM   1361 N  N     . GLU A 1 175 ? 11.804  13.033  24.435  1.00 41.72  ? 217 GLU A N     1 
ATOM   1362 C  CA    . GLU A 1 175 ? 12.146  12.349  23.190  1.00 47.45  ? 217 GLU A CA    1 
ATOM   1363 C  C     . GLU A 1 175 ? 11.810  10.869  23.259  1.00 42.39  ? 217 GLU A C     1 
ATOM   1364 O  O     . GLU A 1 175 ? 11.364  10.280  22.273  1.00 44.52  ? 217 GLU A O     1 
ATOM   1365 C  CB    . GLU A 1 175 ? 13.640  12.527  22.872  1.00 47.10  ? 217 GLU A CB    1 
ATOM   1366 C  CG    . GLU A 1 175 ? 14.136  13.970  22.864  1.00 45.67  ? 217 GLU A CG    1 
ATOM   1367 C  CD    . GLU A 1 175 ? 15.202  14.207  21.815  1.00 58.23  ? 217 GLU A CD    1 
ATOM   1368 O  OE1   . GLU A 1 175 ? 15.744  13.201  21.294  1.00 62.27  ? 217 GLU A OE1   1 
ATOM   1369 O  OE2   . GLU A 1 175 ? 15.492  15.393  21.501  1.00 55.41  ? 217 GLU A OE2   1 
ATOM   1370 N  N     . ILE A 1 176 ? 12.045  10.238  24.409  1.00 33.53  ? 218 ILE A N     1 
ATOM   1371 C  CA    . ILE A 1 176 ? 11.662  8.842   24.579  1.00 35.04  ? 218 ILE A CA    1 
ATOM   1372 C  C     . ILE A 1 176 ? 10.152  8.599   24.346  1.00 39.60  ? 218 ILE A C     1 
ATOM   1373 O  O     . ILE A 1 176 ? 9.736   7.456   24.129  1.00 38.96  ? 218 ILE A O     1 
ATOM   1374 C  CB    . ILE A 1 176 ? 12.115  8.414   25.989  1.00 34.94  ? 218 ILE A CB    1 
ATOM   1375 C  CG1   . ILE A 1 176 ? 12.022  6.916   26.191  1.00 37.71  ? 218 ILE A CG1   1 
ATOM   1376 C  CG2   . ILE A 1 176 ? 11.305  9.103   27.037  1.00 35.41  ? 218 ILE A CG2   1 
ATOM   1377 C  CD1   . ILE A 1 176 ? 12.496  6.514   27.568  1.00 39.83  ? 218 ILE A CD1   1 
ATOM   1378 N  N     . ASP A 1 177 ? 9.320   9.640   24.379  1.00 32.82  ? 219 ASP A N     1 
ATOM   1379 C  CA    . ASP A 1 177 ? 7.872   9.460   24.349  1.00 36.31  ? 219 ASP A CA    1 
ATOM   1380 C  C     . ASP A 1 177 ? 7.282   9.506   22.930  1.00 38.92  ? 219 ASP A C     1 
ATOM   1381 O  O     . ASP A 1 177 ? 6.061   9.585   22.781  1.00 44.76  ? 219 ASP A O     1 
ATOM   1382 C  CB    . ASP A 1 177 ? 7.199   10.505  25.251  1.00 34.64  ? 219 ASP A CB    1 
ATOM   1383 C  CG    . ASP A 1 177 ? 7.510   10.272  26.756  1.00 43.97  ? 219 ASP A CG    1 
ATOM   1384 O  OD1   . ASP A 1 177 ? 7.460   9.086   27.188  1.00 38.65  ? 219 ASP A OD1   1 
ATOM   1385 O  OD2   . ASP A 1 177 ? 7.788   11.265  27.504  1.00 39.60  ? 219 ASP A OD2   1 
ATOM   1386 N  N     . LEU A 1 178 ? 8.114   9.433   21.887  1.00 41.11  ? 220 LEU A N     1 
ATOM   1387 C  CA    . LEU A 1 178 ? 7.615   9.338   20.521  1.00 38.41  ? 220 LEU A CA    1 
ATOM   1388 C  C     . LEU A 1 178 ? 8.746   8.800   19.647  1.00 43.09  ? 220 LEU A C     1 
ATOM   1389 O  O     . LEU A 1 178 ? 9.924   8.892   20.015  1.00 42.84  ? 220 LEU A O     1 
ATOM   1390 C  CB    . LEU A 1 178 ? 7.104   10.678  19.973  1.00 39.84  ? 220 LEU A CB    1 
ATOM   1391 C  CG    . LEU A 1 178 ? 8.154   11.707  19.572  1.00 38.46  ? 220 LEU A CG    1 
ATOM   1392 C  CD1   . LEU A 1 178 ? 7.522   12.788  18.756  1.00 39.87  ? 220 LEU A CD1   1 
ATOM   1393 C  CD2   . LEU A 1 178 ? 8.775   12.316  20.792  1.00 39.18  ? 220 LEU A CD2   1 
ATOM   1394 N  N     . ARG A 1 179 ? 8.357   8.225   18.508  1.00 38.27  ? 221 ARG A N     1 
ATOM   1395 C  CA    . ARG A 1 179 ? 9.327   7.522   17.665  1.00 43.96  ? 221 ARG A CA    1 
ATOM   1396 C  C     . ARG A 1 179 ? 10.207  8.465   16.814  1.00 46.26  ? 221 ARG A C     1 
ATOM   1397 O  O     . ARG A 1 179 ? 11.378  8.173   16.584  1.00 45.48  ? 221 ARG A O     1 
ATOM   1398 C  CB    . ARG A 1 179 ? 8.614   6.504   16.767  1.00 38.77  ? 221 ARG A CB    1 
ATOM   1399 C  CG    . ARG A 1 179 ? 9.571   5.806   15.791  1.00 46.44  ? 221 ARG A CG    1 
ATOM   1400 C  CD    . ARG A 1 179 ? 10.353  4.597   16.334  1.00 37.90  ? 221 ARG A CD    1 
ATOM   1401 N  NE    . ARG A 1 179 ? 9.690   3.375   15.918  1.00 54.72  ? 221 ARG A NE    1 
ATOM   1402 C  CZ    . ARG A 1 179 ? 10.219  2.447   15.125  1.00 55.57  ? 221 ARG A CZ    1 
ATOM   1403 N  NH1   . ARG A 1 179 ? 11.446  2.551   14.661  1.00 64.35  ? 221 ARG A NH1   1 
ATOM   1404 N  NH2   . ARG A 1 179 ? 9.504   1.386   14.812  1.00 57.54  ? 221 ARG A NH2   1 
ATOM   1405 N  N     . ASN A 1 180 ? 9.691   9.616   16.353  1.00 43.72  ? 222 ASN A N     1 
ATOM   1406 C  CA    . ASN A 1 180 ? 10.505  10.552  15.577  1.00 42.02  ? 222 ASN A CA    1 
ATOM   1407 C  C     . ASN A 1 180 ? 10.522  11.912  16.260  1.00 44.31  ? 222 ASN A C     1 
ATOM   1408 O  O     . ASN A 1 180 ? 9.870   12.855  15.799  1.00 46.70  ? 222 ASN A O     1 
ATOM   1409 C  CB    . ASN A 1 180 ? 10.008  10.662  14.136  1.00 47.81  ? 222 ASN A CB    1 
ATOM   1410 C  CG    . ASN A 1 180 ? 9.939   9.299   13.448  1.00 51.32  ? 222 ASN A CG    1 
ATOM   1411 O  OD1   . ASN A 1 180 ? 8.845   8.803   13.138  1.00 50.72  ? 222 ASN A OD1   1 
ATOM   1412 N  ND2   . ASN A 1 180 ? 11.108  8.688   13.198  1.00 48.05  ? 222 ASN A ND2   1 
ATOM   1413 N  N     . PRO A 1 181 ? 11.265  12.049  17.361  1.00 47.46  ? 223 PRO A N     1 
ATOM   1414 C  CA    . PRO A 1 181 ? 11.393  13.375  17.982  1.00 48.39  ? 223 PRO A CA    1 
ATOM   1415 C  C     . PRO A 1 181 ? 12.119  14.373  17.109  1.00 50.88  ? 223 PRO A C     1 
ATOM   1416 O  O     . PRO A 1 181 ? 11.705  15.537  17.066  1.00 50.63  ? 223 PRO A O     1 
ATOM   1417 C  CB    . PRO A 1 181 ? 12.171  13.079  19.268  1.00 46.10  ? 223 PRO A CB    1 
ATOM   1418 C  CG    . PRO A 1 181 ? 12.906  11.813  18.979  1.00 48.22  ? 223 PRO A CG    1 
ATOM   1419 C  CD    . PRO A 1 181 ? 11.944  11.012  18.151  1.00 45.74  ? 223 PRO A CD    1 
ATOM   1420 N  N     . LYS A 1 182 ? 13.195  13.956  16.423  1.00 56.29  ? 224 LYS A N     1 
ATOM   1421 C  CA    . LYS A 1 182 ? 14.014  14.910  15.672  1.00 58.00  ? 224 LYS A CA    1 
ATOM   1422 C  C     . LYS A 1 182 ? 13.169  15.679  14.673  1.00 55.26  ? 224 LYS A C     1 
ATOM   1423 O  O     . LYS A 1 182 ? 13.213  16.911  14.630  1.00 57.69  ? 224 LYS A O     1 
ATOM   1424 C  CB    . LYS A 1 182 ? 15.170  14.201  14.960  1.00 64.25  ? 224 LYS A CB    1 
ATOM   1425 C  CG    . LYS A 1 182 ? 16.498  14.216  15.726  1.00 56.40  ? 224 LYS A CG    1 
ATOM   1426 C  CD    . LYS A 1 182 ? 16.543  13.125  16.792  1.00 63.56  ? 224 LYS A CD    1 
ATOM   1427 C  CE    . LYS A 1 182 ? 17.361  13.544  18.033  1.00 61.51  ? 224 LYS A CE    1 
ATOM   1428 N  NZ    . LYS A 1 182 ? 17.310  12.482  19.086  1.00 61.25  ? 224 LYS A NZ    1 
ATOM   1429 N  N     . GLY A 1 183 ? 12.351  14.973  13.901  1.00 51.26  ? 225 GLY A N     1 
ATOM   1430 C  CA    . GLY A 1 183 ? 11.542  15.612  12.881  1.00 54.45  ? 225 GLY A CA    1 
ATOM   1431 C  C     . GLY A 1 183 ? 10.213  16.209  13.314  1.00 52.95  ? 225 GLY A C     1 
ATOM   1432 O  O     . GLY A 1 183 ? 9.517   16.778  12.469  1.00 48.54  ? 225 GLY A O     1 
ATOM   1433 N  N     . ASN A 1 184 ? 9.819   16.109  14.588  1.00 52.91  ? 226 ASN A N     1 
ATOM   1434 C  CA    . ASN A 1 184 ? 8.517   16.616  15.014  1.00 50.03  ? 226 ASN A CA    1 
ATOM   1435 C  C     . ASN A 1 184 ? 8.621   17.820  15.935  1.00 47.02  ? 226 ASN A C     1 
ATOM   1436 O  O     . ASN A 1 184 ? 7.596   18.274  16.456  1.00 47.31  ? 226 ASN A O     1 
ATOM   1437 C  CB    . ASN A 1 184 ? 7.693   15.514  15.677  1.00 43.69  ? 226 ASN A CB    1 
ATOM   1438 C  CG    . ASN A 1 184 ? 6.871   14.732  14.674  1.00 44.16  ? 226 ASN A CG    1 
ATOM   1439 O  OD1   . ASN A 1 184 ? 6.004   15.285  14.019  1.00 46.07  ? 226 ASN A OD1   1 
ATOM   1440 N  ND2   . ASN A 1 184 ? 7.149   13.449  14.541  1.00 46.79  ? 226 ASN A ND2   1 
ATOM   1441 N  N     . LYS A 1 185 ? 9.825   18.382  16.098  1.00 48.07  ? 227 LYS A N     1 
ATOM   1442 C  CA    . LYS A 1 185 ? 10.069  19.457  17.058  1.00 48.30  ? 227 LYS A CA    1 
ATOM   1443 C  C     . LYS A 1 185 ? 9.252   20.714  16.779  1.00 48.71  ? 227 LYS A C     1 
ATOM   1444 O  O     . LYS A 1 185 ? 9.188   21.583  17.658  1.00 53.97  ? 227 LYS A O     1 
ATOM   1445 C  CB    . LYS A 1 185 ? 11.562  19.815  17.092  1.00 43.56  ? 227 LYS A CB    1 
ATOM   1446 C  CG    . LYS A 1 185 ? 12.461  18.700  17.600  1.00 48.91  ? 227 LYS A CG    1 
ATOM   1447 C  CD    . LYS A 1 185 ? 13.963  18.958  17.320  1.00 58.97  ? 227 LYS A CD    1 
ATOM   1448 C  CE    . LYS A 1 185 ? 14.876  17.901  17.996  1.00 61.78  ? 227 LYS A CE    1 
ATOM   1449 N  NZ    . LYS A 1 185 ? 14.835  17.927  19.502  1.00 52.51  ? 227 LYS A NZ    1 
ATOM   1450 N  N     . LYS A 1 186 ? 8.637   20.845  15.594  1.00 45.75  ? 228 LYS A N     1 
ATOM   1451 C  CA    . LYS A 1 186 ? 7.777   21.988  15.294  1.00 44.83  ? 228 LYS A CA    1 
ATOM   1452 C  C     . LYS A 1 186 ? 6.341   21.571  14.958  1.00 49.80  ? 228 LYS A C     1 
ATOM   1453 O  O     . LYS A 1 186 ? 5.579   22.374  14.396  1.00 48.21  ? 228 LYS A O     1 
ATOM   1454 C  CB    . LYS A 1 186 ? 8.375   22.822  14.160  1.00 47.79  ? 228 LYS A CB    1 
ATOM   1455 C  CG    . LYS A 1 186 ? 9.829   23.255  14.401  1.00 53.46  ? 228 LYS A CG    1 
ATOM   1456 C  CD    . LYS A 1 186 ? 10.344  24.236  13.332  1.00 51.31  ? 228 LYS A CD    1 
ATOM   1457 C  CE    . LYS A 1 186 ? 11.880  24.178  13.178  1.00 62.39  ? 228 LYS A CE    1 
ATOM   1458 N  NZ    . LYS A 1 186 ? 12.673  25.032  14.144  1.00 63.10  ? 228 LYS A NZ    1 
ATOM   1459 N  N     . ASN A 1 187 ? 5.951   20.338  15.303  1.00 48.28  ? 229 ASN A N     1 
ATOM   1460 C  CA    . ASN A 1 187 ? 4.609   19.821  15.079  1.00 40.64  ? 229 ASN A CA    1 
ATOM   1461 C  C     . ASN A 1 187 ? 3.830   19.756  16.380  1.00 46.40  ? 229 ASN A C     1 
ATOM   1462 O  O     . ASN A 1 187 ? 4.404   19.655  17.472  1.00 45.26  ? 229 ASN A O     1 
ATOM   1463 C  CB    . ASN A 1 187 ? 4.638   18.429  14.453  1.00 45.02  ? 229 ASN A CB    1 
ATOM   1464 C  CG    . ASN A 1 187 ? 5.118   18.456  13.022  1.00 46.89  ? 229 ASN A CG    1 
ATOM   1465 O  OD1   . ASN A 1 187 ? 5.152   19.516  12.393  1.00 47.38  ? 229 ASN A OD1   1 
ATOM   1466 N  ND2   . ASN A 1 187 ? 5.510   17.299  12.502  1.00 45.04  ? 229 ASN A ND2   1 
ATOM   1467 N  N     . ALA A 1 188 ? 2.503   19.808  16.249  1.00 39.07  ? 230 ALA A N     1 
ATOM   1468 C  CA    . ALA A 1 188 ? 1.632   19.741  17.411  1.00 37.88  ? 230 ALA A CA    1 
ATOM   1469 C  C     . ALA A 1 188 ? 1.947   18.505  18.238  1.00 41.71  ? 230 ALA A C     1 
ATOM   1470 O  O     . ALA A 1 188 ? 2.012   17.390  17.715  1.00 36.76  ? 230 ALA A O     1 
ATOM   1471 C  CB    . ALA A 1 188 ? 0.170   19.709  16.972  1.00 36.81  ? 230 ALA A CB    1 
ATOM   1472 N  N     . GLY A 1 189 ? 2.135   18.706  19.533  1.00 42.97  ? 231 GLY A N     1 
ATOM   1473 C  CA    . GLY A 1 189 ? 2.376   17.615  20.443  1.00 40.47  ? 231 GLY A CA    1 
ATOM   1474 C  C     . GLY A 1 189 ? 3.811   17.484  20.883  1.00 41.22  ? 231 GLY A C     1 
ATOM   1475 O  O     . GLY A 1 189 ? 4.084   16.757  21.842  1.00 37.66  ? 231 GLY A O     1 
ATOM   1476 N  N     . PHE A 1 190 ? 4.735   18.155  20.206  1.00 43.51  ? 232 PHE A N     1 
ATOM   1477 C  CA    . PHE A 1 190 ? 6.136   18.027  20.582  1.00 44.68  ? 232 PHE A CA    1 
ATOM   1478 C  C     . PHE A 1 190 ? 6.888   19.346  20.398  1.00 45.38  ? 232 PHE A C     1 
ATOM   1479 O  O     . PHE A 1 190 ? 8.121   19.342  20.296  1.00 43.65  ? 232 PHE A O     1 
ATOM   1480 C  CB    . PHE A 1 190 ? 6.808   16.886  19.797  1.00 44.23  ? 232 PHE A CB    1 
ATOM   1481 C  CG    . PHE A 1 190 ? 8.079   16.400  20.431  1.00 44.84  ? 232 PHE A CG    1 
ATOM   1482 C  CD1   . PHE A 1 190 ? 8.068   15.923  21.734  1.00 40.36  ? 232 PHE A CD1   1 
ATOM   1483 C  CD2   . PHE A 1 190 ? 9.282   16.435  19.739  1.00 41.99  ? 232 PHE A CD2   1 
ATOM   1484 C  CE1   . PHE A 1 190 ? 9.227   15.477  22.346  1.00 42.14  ? 232 PHE A CE1   1 
ATOM   1485 C  CE2   . PHE A 1 190 ? 10.459  15.994  20.348  1.00 46.55  ? 232 PHE A CE2   1 
ATOM   1486 C  CZ    . PHE A 1 190 ? 10.433  15.517  21.655  1.00 45.80  ? 232 PHE A CZ    1 
ATOM   1487 N  N     . THR A 1 191 ? 6.176   20.471  20.364  1.00 41.85  ? 233 THR A N     1 
ATOM   1488 C  CA    . THR A 1 191 ? 6.829   21.761  20.390  1.00 43.08  ? 233 THR A CA    1 
ATOM   1489 C  C     . THR A 1 191 ? 7.529   21.981  21.739  1.00 47.42  ? 233 THR A C     1 
ATOM   1490 O  O     . THR A 1 191 ? 7.236   21.297  22.722  1.00 44.08  ? 233 THR A O     1 
ATOM   1491 C  CB    . THR A 1 191 ? 5.809   22.865  20.142  1.00 38.80  ? 233 THR A CB    1 
ATOM   1492 O  OG1   . THR A 1 191 ? 4.885   22.910  21.228  1.00 41.52  ? 233 THR A OG1   1 
ATOM   1493 C  CG2   . THR A 1 191 ? 5.051   22.628  18.813  1.00 44.02  ? 233 THR A CG2   1 
ATOM   1494 N  N     . PRO A 1 192 ? 8.466   22.933  21.811  1.00 47.21  ? 234 PRO A N     1 
ATOM   1495 C  CA    . PRO A 1 192 ? 9.021   23.283  23.127  1.00 45.72  ? 234 PRO A CA    1 
ATOM   1496 C  C     . PRO A 1 192 ? 7.985   23.825  24.088  1.00 45.97  ? 234 PRO A C     1 
ATOM   1497 O  O     . PRO A 1 192 ? 8.096   23.595  25.301  1.00 44.47  ? 234 PRO A O     1 
ATOM   1498 C  CB    . PRO A 1 192 ? 10.087  24.339  22.790  1.00 42.66  ? 234 PRO A CB    1 
ATOM   1499 C  CG    . PRO A 1 192 ? 10.501  24.022  21.396  1.00 46.85  ? 234 PRO A CG    1 
ATOM   1500 C  CD    . PRO A 1 192 ? 9.184   23.621  20.721  1.00 45.67  ? 234 PRO A CD    1 
ATOM   1501 N  N     . GLN A 1 193 ? 6.967   24.540  23.599  1.00 45.52  ? 235 GLN A N     1 
ATOM   1502 C  CA    . GLN A 1 193 ? 6.041   25.171  24.539  1.00 46.54  ? 235 GLN A CA    1 
ATOM   1503 C  C     . GLN A 1 193 ? 5.116   24.145  25.194  1.00 44.84  ? 235 GLN A C     1 
ATOM   1504 O  O     . GLN A 1 193 ? 4.806   24.267  26.387  1.00 42.38  ? 235 GLN A O     1 
ATOM   1505 C  CB    . GLN A 1 193 ? 5.259   26.277  23.839  1.00 48.84  ? 235 GLN A CB    1 
ATOM   1506 C  CG    . GLN A 1 193 ? 6.149   27.399  23.281  1.00 48.57  ? 235 GLN A CG    1 
ATOM   1507 C  CD    . GLN A 1 193 ? 6.478   27.261  21.794  1.00 51.38  ? 235 GLN A CD    1 
ATOM   1508 O  OE1   . GLN A 1 193 ? 7.017   26.248  21.334  1.00 49.28  ? 235 GLN A OE1   1 
ATOM   1509 N  NE2   . GLN A 1 193 ? 6.164   28.301  21.038  1.00 55.32  ? 235 GLN A NE2   1 
ATOM   1510 N  N     . GLU A 1 194 ? 4.720   23.097  24.464  1.00 41.63  ? 236 GLU A N     1 
ATOM   1511 C  CA    . GLU A 1 194 ? 3.883   22.070  25.084  1.00 45.97  ? 236 GLU A CA    1 
ATOM   1512 C  C     . GLU A 1 194 ? 4.706   21.133  25.972  1.00 39.06  ? 236 GLU A C     1 
ATOM   1513 O  O     . GLU A 1 194 ? 4.256   20.735  27.056  1.00 42.80  ? 236 GLU A O     1 
ATOM   1514 C  CB    . GLU A 1 194 ? 3.133   21.277  24.008  1.00 43.05  ? 236 GLU A CB    1 
ATOM   1515 C  CG    . GLU A 1 194 ? 2.434   22.100  22.912  1.00 36.23  ? 236 GLU A CG    1 
ATOM   1516 C  CD    . GLU A 1 194 ? 1.937   21.200  21.795  1.00 46.58  ? 236 GLU A CD    1 
ATOM   1517 O  OE1   . GLU A 1 194 ? 2.662   20.986  20.789  1.00 43.11  ? 236 GLU A OE1   1 
ATOM   1518 O  OE2   . GLU A 1 194 ? 0.820   20.664  21.952  1.00 47.79  ? 236 GLU A OE2   1 
ATOM   1519 N  N     . ARG A 1 195 ? 5.918   20.783  25.541  1.00 41.72  ? 237 ARG A N     1 
ATOM   1520 C  CA    . ARG A 1 195 ? 6.812   20.008  26.397  1.00 42.11  ? 237 ARG A CA    1 
ATOM   1521 C  C     . ARG A 1 195 ? 7.078   20.717  27.735  1.00 42.72  ? 237 ARG A C     1 
ATOM   1522 O  O     . ARG A 1 195 ? 6.912   20.125  28.813  1.00 39.92  ? 237 ARG A O     1 
ATOM   1523 C  CB    . ARG A 1 195 ? 8.112   19.731  25.647  1.00 38.35  ? 237 ARG A CB    1 
ATOM   1524 C  CG    . ARG A 1 195 ? 7.963   18.666  24.586  1.00 42.73  ? 237 ARG A CG    1 
ATOM   1525 C  CD    . ARG A 1 195 ? 9.271   18.488  23.818  1.00 44.53  ? 237 ARG A CD    1 
ATOM   1526 N  NE    . ARG A 1 195 ? 10.265  17.753  24.580  1.00 39.84  ? 237 ARG A NE    1 
ATOM   1527 C  CZ    . ARG A 1 195 ? 11.546  17.599  24.225  1.00 41.97  ? 237 ARG A CZ    1 
ATOM   1528 N  NH1   . ARG A 1 195 ? 12.002  18.134  23.105  1.00 35.84  ? 237 ARG A NH1   1 
ATOM   1529 N  NH2   . ARG A 1 195 ? 12.383  16.903  25.007  1.00 42.30  ? 237 ARG A NH2   1 
ATOM   1530 N  N     . GLN A 1 196 ? 7.476   21.994  27.689  1.00 43.15  ? 238 GLN A N     1 
ATOM   1531 C  CA    . GLN A 1 196 ? 7.712   22.734  28.929  1.00 40.41  ? 238 GLN A CA    1 
ATOM   1532 C  C     . GLN A 1 196 ? 6.453   22.800  29.775  1.00 43.84  ? 238 GLN A C     1 
ATOM   1533 O  O     . GLN A 1 196 ? 6.499   22.561  30.989  1.00 43.95  ? 238 GLN A O     1 
ATOM   1534 C  CB    . GLN A 1 196 ? 8.226   24.145  28.624  1.00 47.01  ? 238 GLN A CB    1 
ATOM   1535 C  CG    . GLN A 1 196 ? 9.770   24.238  28.457  1.00 57.96  ? 238 GLN A CG    1 
ATOM   1536 C  CD    . GLN A 1 196 ? 10.225  25.265  27.397  1.00 62.81  ? 238 GLN A CD    1 
ATOM   1537 O  OE1   . GLN A 1 196 ? 9.502   26.227  27.080  1.00 60.25  ? 238 GLN A OE1   1 
ATOM   1538 N  NE2   . GLN A 1 196 ? 11.425  25.051  26.841  1.00 48.73  ? 238 GLN A NE2   1 
ATOM   1539 N  N     . GLY A 1 197 ? 5.312   23.104  29.144  1.00 43.93  ? 239 GLY A N     1 
ATOM   1540 C  CA    . GLY A 1 197 ? 4.056   23.156  29.872  1.00 42.48  ? 239 GLY A CA    1 
ATOM   1541 C  C     . GLY A 1 197 ? 3.798   21.895  30.664  1.00 40.99  ? 239 GLY A C     1 
ATOM   1542 O  O     . GLY A 1 197 ? 3.391   21.951  31.826  1.00 43.48  ? 239 GLY A O     1 
ATOM   1543 N  N     . PHE A 1 198 ? 4.056   20.740  30.050  1.00 41.12  ? 240 PHE A N     1 
ATOM   1544 C  CA    . PHE A 1 198 ? 3.933   19.468  30.754  1.00 42.43  ? 240 PHE A CA    1 
ATOM   1545 C  C     . PHE A 1 198 ? 4.909   19.386  31.922  1.00 43.22  ? 240 PHE A C     1 
ATOM   1546 O  O     . PHE A 1 198 ? 4.537   18.986  33.033  1.00 38.78  ? 240 PHE A O     1 
ATOM   1547 C  CB    . PHE A 1 198 ? 4.181   18.320  29.783  1.00 39.95  ? 240 PHE A CB    1 
ATOM   1548 C  CG    . PHE A 1 198 ? 3.829   16.978  30.329  1.00 39.99  ? 240 PHE A CG    1 
ATOM   1549 C  CD1   . PHE A 1 198 ? 2.514   16.532  30.307  1.00 42.73  ? 240 PHE A CD1   1 
ATOM   1550 C  CD2   . PHE A 1 198 ? 4.806   16.146  30.853  1.00 42.43  ? 240 PHE A CD2   1 
ATOM   1551 C  CE1   . PHE A 1 198 ? 2.176   15.261  30.796  1.00 40.97  ? 240 PHE A CE1   1 
ATOM   1552 C  CE2   . PHE A 1 198 ? 4.481   14.870  31.354  1.00 42.05  ? 240 PHE A CE2   1 
ATOM   1553 C  CZ    . PHE A 1 198 ? 3.172   14.428  31.309  1.00 44.10  ? 240 PHE A CZ    1 
ATOM   1554 N  N     . GLY A 1 199 ? 6.177   19.718  31.679  1.00 39.77  ? 241 GLY A N     1 
ATOM   1555 C  CA    . GLY A 1 199 ? 7.136   19.740  32.772  1.00 42.96  ? 241 GLY A CA    1 
ATOM   1556 C  C     . GLY A 1 199 ? 6.707   20.673  33.886  1.00 43.38  ? 241 GLY A C     1 
ATOM   1557 O  O     . GLY A 1 199 ? 6.801   20.331  35.061  1.00 42.85  ? 241 GLY A O     1 
ATOM   1558 N  N     . GLU A 1 200 ? 6.184   21.850  33.524  1.00 47.51  ? 242 GLU A N     1 
ATOM   1559 C  CA    . GLU A 1 200 ? 5.674   22.786  34.524  1.00 48.72  ? 242 GLU A CA    1 
ATOM   1560 C  C     . GLU A 1 200 ? 4.487   22.205  35.278  1.00 51.46  ? 242 GLU A C     1 
ATOM   1561 O  O     . GLU A 1 200 ? 4.357   22.417  36.492  1.00 51.98  ? 242 GLU A O     1 
ATOM   1562 C  CB    . GLU A 1 200 ? 5.273   24.115  33.871  1.00 52.86  ? 242 GLU A CB    1 
ATOM   1563 C  CG    . GLU A 1 200 ? 6.423   25.079  33.552  1.00 55.31  ? 242 GLU A CG    1 
ATOM   1564 C  CD    . GLU A 1 200 ? 5.992   26.180  32.587  1.00 65.21  ? 242 GLU A CD    1 
ATOM   1565 O  OE1   . GLU A 1 200 ? 6.579   26.279  31.475  1.00 66.15  ? 242 GLU A OE1   1 
ATOM   1566 O  OE2   . GLU A 1 200 ? 5.044   26.931  32.934  1.00 67.39  ? 242 GLU A OE2   1 
ATOM   1567 N  N     . LEU A 1 201 ? 3.584   21.500  34.575  1.00 47.56  ? 243 LEU A N     1 
ATOM   1568 C  CA    . LEU A 1 201 ? 2.466   20.872  35.274  1.00 45.67  ? 243 LEU A CA    1 
ATOM   1569 C  C     . LEU A 1 201 ? 2.963   19.826  36.264  1.00 45.15  ? 243 LEU A C     1 
ATOM   1570 O  O     . LEU A 1 201 ? 2.409   19.698  37.360  1.00 46.85  ? 243 LEU A O     1 
ATOM   1571 C  CB    . LEU A 1 201 ? 1.488   20.235  34.288  1.00 43.69  ? 243 LEU A CB    1 
ATOM   1572 C  CG    . LEU A 1 201 ? 0.337   19.457  34.930  1.00 41.92  ? 243 LEU A CG    1 
ATOM   1573 C  CD1   . LEU A 1 201 ? -0.717  20.405  35.497  1.00 44.35  ? 243 LEU A CD1   1 
ATOM   1574 C  CD2   . LEU A 1 201 ? -0.313  18.518  33.943  1.00 44.16  ? 243 LEU A CD2   1 
ATOM   1575 N  N     . LEU A 1 202 ? 3.999   19.059  35.885  1.00 39.42  ? 244 LEU A N     1 
ATOM   1576 C  CA    . LEU A 1 202 ? 4.545   18.049  36.784  1.00 42.80  ? 244 LEU A CA    1 
ATOM   1577 C  C     . LEU A 1 202 ? 5.192   18.700  38.006  1.00 49.74  ? 244 LEU A C     1 
ATOM   1578 O  O     . LEU A 1 202 ? 4.998   18.250  39.139  1.00 42.97  ? 244 LEU A O     1 
ATOM   1579 C  CB    . LEU A 1 202 ? 5.567   17.166  36.051  1.00 43.03  ? 244 LEU A CB    1 
ATOM   1580 C  CG    . LEU A 1 202 ? 5.187   16.005  35.120  1.00 40.59  ? 244 LEU A CG    1 
ATOM   1581 C  CD1   . LEU A 1 202 ? 6.434   15.228  34.716  1.00 27.89  ? 244 LEU A CD1   1 
ATOM   1582 C  CD2   . LEU A 1 202 ? 4.170   15.068  35.738  1.00 38.48  ? 244 LEU A CD2   1 
ATOM   1583 N  N     . GLN A 1 203 ? 5.956   19.772  37.797  1.00 47.76  ? 245 GLN A N     1 
ATOM   1584 C  CA    . GLN A 1 203 ? 6.735   20.353  38.881  1.00 56.31  ? 245 GLN A CA    1 
ATOM   1585 C  C     . GLN A 1 203 ? 5.902   21.250  39.803  1.00 54.96  ? 245 GLN A C     1 
ATOM   1586 O  O     . GLN A 1 203 ? 6.289   21.448  40.952  1.00 60.82  ? 245 GLN A O     1 
ATOM   1587 C  CB    . GLN A 1 203 ? 7.922   21.122  38.284  1.00 55.47  ? 245 GLN A CB    1 
ATOM   1588 C  CG    . GLN A 1 203 ? 8.982   21.533  39.273  1.00 61.71  ? 245 GLN A CG    1 
ATOM   1589 C  CD    . GLN A 1 203 ? 9.124   23.045  39.372  1.00 74.50  ? 245 GLN A CD    1 
ATOM   1590 O  OE1   . GLN A 1 203 ? 8.849   23.774  38.411  1.00 75.25  ? 245 GLN A OE1   1 
ATOM   1591 N  NE2   . GLN A 1 203 ? 9.547   23.525  40.542  1.00 69.22  ? 245 GLN A NE2   1 
ATOM   1592 N  N     . ALA A 1 204 ? 4.754   21.754  39.347  1.00 51.74  ? 246 ALA A N     1 
ATOM   1593 C  CA    . ALA A 1 204 ? 4.009   22.787  40.059  1.00 49.80  ? 246 ALA A CA    1 
ATOM   1594 C  C     . ALA A 1 204 ? 2.890   22.251  40.951  1.00 55.82  ? 246 ALA A C     1 
ATOM   1595 O  O     . ALA A 1 204 ? 2.607   22.851  41.996  1.00 50.06  ? 246 ALA A O     1 
ATOM   1596 C  CB    . ALA A 1 204 ? 3.405   23.779  39.054  1.00 48.84  ? 246 ALA A CB    1 
ATOM   1597 N  N     . VAL A 1 205 ? 2.234   21.159  40.571  1.00 51.26  ? 247 VAL A N     1 
ATOM   1598 C  CA    . VAL A 1 205 ? 1.060   20.696  41.307  1.00 52.20  ? 247 VAL A CA    1 
ATOM   1599 C  C     . VAL A 1 205 ? 1.412   20.079  42.685  1.00 53.89  ? 247 VAL A C     1 
ATOM   1600 O  O     . VAL A 1 205 ? 0.719   20.363  43.664  1.00 53.76  ? 247 VAL A O     1 
ATOM   1601 C  CB    . VAL A 1 205 ? 0.220   19.732  40.428  1.00 47.47  ? 247 VAL A CB    1 
ATOM   1602 C  CG1   . VAL A 1 205 ? -1.012  19.268  41.167  1.00 43.92  ? 247 VAL A CG1   1 
ATOM   1603 C  CG2   . VAL A 1 205 ? -0.185  20.438  39.160  1.00 42.98  ? 247 VAL A CG2   1 
ATOM   1604 N  N     . PRO A 1 206 ? 2.452   19.218  42.787  1.00 54.68  ? 248 PRO A N     1 
ATOM   1605 C  CA    . PRO A 1 206 ? 3.206   18.432  41.802  1.00 44.84  ? 248 PRO A CA    1 
ATOM   1606 C  C     . PRO A 1 206 ? 2.486   17.122  41.517  1.00 43.60  ? 248 PRO A C     1 
ATOM   1607 O  O     . PRO A 1 206 ? 1.580   16.738  42.267  1.00 47.73  ? 248 PRO A O     1 
ATOM   1608 C  CB    . PRO A 1 206 ? 4.539   18.163  42.509  1.00 48.81  ? 248 PRO A CB    1 
ATOM   1609 C  CG    . PRO A 1 206 ? 4.119   18.015  43.950  1.00 49.60  ? 248 PRO A CG    1 
ATOM   1610 C  CD    . PRO A 1 206 ? 2.994   19.023  44.150  1.00 43.08  ? 248 PRO A CD    1 
ATOM   1611 N  N     . LEU A 1 207 ? 2.889   16.442  40.444  1.00 42.94  ? 249 LEU A N     1 
ATOM   1612 C  CA    . LEU A 1 207 ? 2.283   15.192  40.016  1.00 40.29  ? 249 LEU A CA    1 
ATOM   1613 C  C     . LEU A 1 207 ? 3.379   14.347  39.409  1.00 35.17  ? 249 LEU A C     1 
ATOM   1614 O  O     . LEU A 1 207 ? 4.303   14.877  38.793  1.00 35.70  ? 249 LEU A O     1 
ATOM   1615 C  CB    . LEU A 1 207 ? 1.172   15.402  38.967  1.00 38.73  ? 249 LEU A CB    1 
ATOM   1616 C  CG    . LEU A 1 207 ? -0.090  16.192  39.301  1.00 39.70  ? 249 LEU A CG    1 
ATOM   1617 C  CD1   . LEU A 1 207 ? -0.902  16.518  38.026  1.00 37.74  ? 249 LEU A CD1   1 
ATOM   1618 C  CD2   . LEU A 1 207 ? -0.935  15.418  40.274  1.00 39.20  ? 249 LEU A CD2   1 
ATOM   1619 N  N     . ALA A 1 208 ? 3.272   13.035  39.567  1.00 31.58  ? 250 ALA A N     1 
ATOM   1620 C  CA    . ALA A 1 208 ? 4.183   12.131  38.879  1.00 33.14  ? 250 ALA A CA    1 
ATOM   1621 C  C     . ALA A 1 208 ? 3.513   11.558  37.624  1.00 36.73  ? 250 ALA A C     1 
ATOM   1622 O  O     . ALA A 1 208 ? 2.283   11.464  37.534  1.00 31.56  ? 250 ALA A O     1 
ATOM   1623 C  CB    . ALA A 1 208 ? 4.632   10.992  39.794  1.00 35.00  ? 250 ALA A CB    1 
ATOM   1624 N  N     . ASP A 1 209 ? 4.347   11.209  36.651  1.00 33.11  ? 251 ASP A N     1 
ATOM   1625 C  CA    . ASP A 1 209 ? 3.953   10.471  35.451  1.00 37.05  ? 251 ASP A CA    1 
ATOM   1626 C  C     . ASP A 1 209 ? 4.004   8.987   35.816  1.00 40.27  ? 251 ASP A C     1 
ATOM   1627 O  O     . ASP A 1 209 ? 5.082   8.395   35.900  1.00 39.22  ? 251 ASP A O     1 
ATOM   1628 C  CB    . ASP A 1 209 ? 4.899   10.848  34.317  1.00 36.97  ? 251 ASP A CB    1 
ATOM   1629 C  CG    . ASP A 1 209 ? 4.611   10.147  32.999  1.00 41.63  ? 251 ASP A CG    1 
ATOM   1630 O  OD1   . ASP A 1 209 ? 3.829   9.175   32.949  1.00 40.33  ? 251 ASP A OD1   1 
ATOM   1631 O  OD2   . ASP A 1 209 ? 5.235   10.578  31.995  1.00 41.50  ? 251 ASP A OD2   1 
ATOM   1632 N  N     . SER A 1 210 ? 2.833   8.388   36.061  1.00 34.35  ? 252 SER A N     1 
ATOM   1633 C  CA    . SER A 1 210 ? 2.770   7.036   36.610  1.00 30.49  ? 252 SER A CA    1 
ATOM   1634 C  C     . SER A 1 210 ? 3.611   6.073   35.796  1.00 38.34  ? 252 SER A C     1 
ATOM   1635 O  O     . SER A 1 210 ? 4.431   5.333   36.346  1.00 42.41  ? 252 SER A O     1 
ATOM   1636 C  CB    . SER A 1 210 ? 1.325   6.540   36.643  1.00 40.52  ? 252 SER A CB    1 
ATOM   1637 O  OG    . SER A 1 210 ? 0.902   6.187   35.311  1.00 38.33  ? 252 SER A OG    1 
ATOM   1638 N  N     . PHE A 1 211 ? 3.422   6.061   34.475  1.00 33.59  ? 253 PHE A N     1 
ATOM   1639 C  CA    . PHE A 1 211 ? 4.143   5.097   33.650  1.00 34.39  ? 253 PHE A CA    1 
ATOM   1640 C  C     . PHE A 1 211 ? 5.656   5.275   33.759  1.00 36.55  ? 253 PHE A C     1 
ATOM   1641 O  O     . PHE A 1 211 ? 6.397   4.287   33.745  1.00 33.82  ? 253 PHE A O     1 
ATOM   1642 C  CB    . PHE A 1 211 ? 3.713   5.200   32.172  1.00 34.13  ? 253 PHE A CB    1 
ATOM   1643 C  CG    . PHE A 1 211 ? 4.312   4.130   31.312  1.00 29.87  ? 253 PHE A CG    1 
ATOM   1644 C  CD1   . PHE A 1 211 ? 3.784   2.848   31.318  1.00 30.96  ? 253 PHE A CD1   1 
ATOM   1645 C  CD2   . PHE A 1 211 ? 5.443   4.385   30.551  1.00 26.36  ? 253 PHE A CD2   1 
ATOM   1646 C  CE1   . PHE A 1 211 ? 4.345   1.844   30.511  1.00 29.22  ? 253 PHE A CE1   1 
ATOM   1647 C  CE2   . PHE A 1 211 ? 6.006   3.393   29.768  1.00 28.22  ? 253 PHE A CE2   1 
ATOM   1648 C  CZ    . PHE A 1 211 ? 5.459   2.122   29.747  1.00 26.86  ? 253 PHE A CZ    1 
ATOM   1649 N  N     . ARG A 1 212 ? 6.132   6.531   33.804  1.00 36.38  ? 254 ARG A N     1 
ATOM   1650 C  CA    . ARG A 1 212 ? 7.564   6.809   33.831  1.00 39.76  ? 254 ARG A CA    1 
ATOM   1651 C  C     . ARG A 1 212 ? 8.163   6.567   35.223  1.00 44.74  ? 254 ARG A C     1 
ATOM   1652 O  O     . ARG A 1 212 ? 9.320   6.140   35.340  1.00 39.17  ? 254 ARG A O     1 
ATOM   1653 C  CB    . ARG A 1 212 ? 7.816   8.248   33.369  1.00 38.29  ? 254 ARG A CB    1 
ATOM   1654 C  CG    . ARG A 1 212 ? 8.979   8.386   32.415  1.00 41.87  ? 254 ARG A CG    1 
ATOM   1655 C  CD    . ARG A 1 212 ? 9.031   7.193   31.470  1.00 40.28  ? 254 ARG A CD    1 
ATOM   1656 N  NE    . ARG A 1 212 ? 8.765   7.531   30.075  1.00 39.04  ? 254 ARG A NE    1 
ATOM   1657 C  CZ    . ARG A 1 212 ? 8.783   6.628   29.086  1.00 42.42  ? 254 ARG A CZ    1 
ATOM   1658 N  NH1   . ARG A 1 212 ? 9.072   5.358   29.355  1.00 39.76  ? 254 ARG A NH1   1 
ATOM   1659 N  NH2   . ARG A 1 212 ? 8.534   6.980   27.828  1.00 37.68  ? 254 ARG A NH2   1 
ATOM   1660 N  N     . HIS A 1 213 ? 7.404   6.820   36.287  1.00 37.93  ? 255 HIS A N     1 
ATOM   1661 C  CA    . HIS A 1 213 ? 7.862   6.393   37.594  1.00 40.27  ? 255 HIS A CA    1 
ATOM   1662 C  C     . HIS A 1 213 ? 8.183   4.897   37.612  1.00 42.50  ? 255 HIS A C     1 
ATOM   1663 O  O     . HIS A 1 213 ? 9.162   4.488   38.242  1.00 40.04  ? 255 HIS A O     1 
ATOM   1664 C  CB    . HIS A 1 213 ? 6.811   6.762   38.640  1.00 39.60  ? 255 HIS A CB    1 
ATOM   1665 C  CG    . HIS A 1 213 ? 7.076   6.192   39.993  1.00 39.74  ? 255 HIS A CG    1 
ATOM   1666 N  ND1   . HIS A 1 213 ? 8.079   6.656   40.807  1.00 44.62  ? 255 HIS A ND1   1 
ATOM   1667 C  CD2   . HIS A 1 213 ? 6.466   5.197   40.679  1.00 41.28  ? 255 HIS A CD2   1 
ATOM   1668 C  CE1   . HIS A 1 213 ? 8.086   5.964   41.934  1.00 45.79  ? 255 HIS A CE1   1 
ATOM   1669 N  NE2   . HIS A 1 213 ? 7.123   5.066   41.878  1.00 42.49  ? 255 HIS A NE2   1 
ATOM   1670 N  N     . LEU A 1 214 ? 7.422   4.070   36.887  1.00 36.41  ? 256 LEU A N     1 
ATOM   1671 C  CA    . LEU A 1 214 ? 7.591   2.625   37.038  1.00 42.26  ? 256 LEU A CA    1 
ATOM   1672 C  C     . LEU A 1 214 ? 8.625   2.059   36.073  1.00 40.68  ? 256 LEU A C     1 
ATOM   1673 O  O     . LEU A 1 214 ? 9.349   1.112   36.419  1.00 40.18  ? 256 LEU A O     1 
ATOM   1674 C  CB    . LEU A 1 214 ? 6.254   1.885   36.842  1.00 37.97  ? 256 LEU A CB    1 
ATOM   1675 C  CG    . LEU A 1 214 ? 5.245   1.764   37.995  1.00 41.90  ? 256 LEU A CG    1 
ATOM   1676 C  CD1   . LEU A 1 214 ? 5.606   0.762   39.090  1.00 34.66  ? 256 LEU A CD1   1 
ATOM   1677 C  CD2   . LEU A 1 214 ? 5.156   3.069   38.624  1.00 48.69  ? 256 LEU A CD2   1 
ATOM   1678 N  N     . TYR A 1 215 ? 8.717   2.623   34.880  1.00 36.91  ? 257 TYR A N     1 
ATOM   1679 C  CA    . TYR A 1 215 ? 9.651   2.161   33.862  1.00 35.75  ? 257 TYR A CA    1 
ATOM   1680 C  C     . TYR A 1 215 ? 10.379  3.369   33.284  1.00 38.98  ? 257 TYR A C     1 
ATOM   1681 O  O     . TYR A 1 215 ? 10.198  3.725   32.114  1.00 39.44  ? 257 TYR A O     1 
ATOM   1682 C  CB    . TYR A 1 215 ? 8.925   1.386   32.770  1.00 34.97  ? 257 TYR A CB    1 
ATOM   1683 C  CG    . TYR A 1 215 ? 7.832   0.478   33.264  1.00 36.74  ? 257 TYR A CG    1 
ATOM   1684 C  CD1   . TYR A 1 215 ? 8.094   -0.857  33.533  1.00 31.52  ? 257 TYR A CD1   1 
ATOM   1685 C  CD2   . TYR A 1 215 ? 6.514   0.939   33.403  1.00 32.79  ? 257 TYR A CD2   1 
ATOM   1686 C  CE1   . TYR A 1 215 ? 7.078   -1.718  33.963  1.00 32.69  ? 257 TYR A CE1   1 
ATOM   1687 C  CE2   . TYR A 1 215 ? 5.487   0.082   33.857  1.00 33.02  ? 257 TYR A CE2   1 
ATOM   1688 C  CZ    . TYR A 1 215 ? 5.778   -1.244  34.122  1.00 32.79  ? 257 TYR A CZ    1 
ATOM   1689 O  OH    . TYR A 1 215 ? 4.798   -2.099  34.572  1.00 31.65  ? 257 TYR A OH    1 
ATOM   1690 N  N     . PRO A 1 216 ? 11.240  4.008   34.078  1.00 41.34  ? 258 PRO A N     1 
ATOM   1691 C  CA    . PRO A 1 216 ? 11.889  5.240   33.595  1.00 41.16  ? 258 PRO A CA    1 
ATOM   1692 C  C     . PRO A 1 216 ? 12.642  5.075   32.287  1.00 38.58  ? 258 PRO A C     1 
ATOM   1693 O  O     . PRO A 1 216 ? 12.756  6.050   31.532  1.00 39.28  ? 258 PRO A O     1 
ATOM   1694 C  CB    . PRO A 1 216 ? 12.838  5.605   34.751  1.00 39.66  ? 258 PRO A CB    1 
ATOM   1695 C  CG    . PRO A 1 216 ? 13.107  4.284   35.429  1.00 37.83  ? 258 PRO A CG    1 
ATOM   1696 C  CD    . PRO A 1 216 ? 11.790  3.569   35.375  1.00 35.72  ? 258 PRO A CD    1 
ATOM   1697 N  N     . ASN A 1 217 ? 13.156  3.882   31.982  1.00 34.80  ? 259 ASN A N     1 
ATOM   1698 C  CA    . ASN A 1 217 ? 14.061  3.731   30.849  1.00 38.98  ? 259 ASN A CA    1 
ATOM   1699 C  C     . ASN A 1 217 ? 13.437  3.042   29.631  1.00 42.37  ? 259 ASN A C     1 
ATOM   1700 O  O     . ASN A 1 217 ? 14.160  2.714   28.679  1.00 33.79  ? 259 ASN A O     1 
ATOM   1701 C  CB    . ASN A 1 217 ? 15.309  2.986   31.317  1.00 41.81  ? 259 ASN A CB    1 
ATOM   1702 C  CG    . ASN A 1 217 ? 16.023  3.740   32.414  1.00 43.55  ? 259 ASN A CG    1 
ATOM   1703 O  OD1   . ASN A 1 217 ? 16.544  4.836   32.180  1.00 39.69  ? 259 ASN A OD1   1 
ATOM   1704 N  ND2   . ASN A 1 217 ? 15.991  3.194   33.639  1.00 37.22  ? 259 ASN A ND2   1 
ATOM   1705 N  N     . THR A 1 218 ? 12.113  2.854   29.620  1.00 40.41  ? 260 THR A N     1 
ATOM   1706 C  CA    . THR A 1 218 ? 11.456  2.025   28.624  1.00 37.34  ? 260 THR A CA    1 
ATOM   1707 C  C     . THR A 1 218 ? 11.071  2.874   27.420  1.00 38.33  ? 260 THR A C     1 
ATOM   1708 O  O     . THR A 1 218 ? 10.213  3.761   27.549  1.00 40.38  ? 260 THR A O     1 
ATOM   1709 C  CB    . THR A 1 218 ? 10.236  1.351   29.241  1.00 43.29  ? 260 THR A CB    1 
ATOM   1710 O  OG1   . THR A 1 218 ? 10.688  0.281   30.098  1.00 39.70  ? 260 THR A OG1   1 
ATOM   1711 C  CG2   . THR A 1 218 ? 9.243   0.822   28.171  1.00 29.94  ? 260 THR A CG2   1 
ATOM   1712 N  N     . PRO A 1 219 ? 11.685  2.669   26.263  1.00 38.06  ? 261 PRO A N     1 
ATOM   1713 C  CA    . PRO A 1 219 ? 11.300  3.408   25.059  1.00 38.24  ? 261 PRO A CA    1 
ATOM   1714 C  C     . PRO A 1 219 ? 10.357  2.585   24.187  1.00 39.21  ? 261 PRO A C     1 
ATOM   1715 O  O     . PRO A 1 219 ? 10.129  1.405   24.469  1.00 42.14  ? 261 PRO A O     1 
ATOM   1716 C  CB    . PRO A 1 219 ? 12.648  3.604   24.366  1.00 37.35  ? 261 PRO A CB    1 
ATOM   1717 C  CG    . PRO A 1 219 ? 13.279  2.231   24.585  1.00 41.12  ? 261 PRO A CG    1 
ATOM   1718 C  CD    . PRO A 1 219 ? 12.837  1.791   25.991  1.00 37.69  ? 261 PRO A CD    1 
ATOM   1719 N  N     . TYR A 1 220 ? 9.847   3.177   23.103  1.00 40.59  ? 262 TYR A N     1 
ATOM   1720 C  CA    . TYR A 1 220 ? 8.903   2.556   22.173  1.00 38.11  ? 262 TYR A CA    1 
ATOM   1721 C  C     . TYR A 1 220 ? 7.548   2.293   22.784  1.00 40.31  ? 262 TYR A C     1 
ATOM   1722 O  O     . TYR A 1 220 ? 6.821   1.433   22.290  1.00 41.13  ? 262 TYR A O     1 
ATOM   1723 C  CB    . TYR A 1 220 ? 9.422   1.239   21.581  1.00 39.09  ? 262 TYR A CB    1 
ATOM   1724 C  CG    . TYR A 1 220 ? 10.777  1.375   20.950  1.00 43.22  ? 262 TYR A CG    1 
ATOM   1725 C  CD1   . TYR A 1 220 ? 10.990  2.263   19.907  1.00 43.55  ? 262 TYR A CD1   1 
ATOM   1726 C  CD2   . TYR A 1 220 ? 11.855  0.628   21.406  1.00 42.22  ? 262 TYR A CD2   1 
ATOM   1727 C  CE1   . TYR A 1 220 ? 12.243  2.403   19.327  1.00 41.15  ? 262 TYR A CE1   1 
ATOM   1728 C  CE2   . TYR A 1 220 ? 13.118  0.751   20.817  1.00 41.14  ? 262 TYR A CE2   1 
ATOM   1729 C  CZ    . TYR A 1 220 ? 13.299  1.642   19.784  1.00 41.06  ? 262 TYR A CZ    1 
ATOM   1730 O  OH    . TYR A 1 220 ? 14.530  1.778   19.207  1.00 40.53  ? 262 TYR A OH    1 
ATOM   1731 N  N     . ALA A 1 221 ? 7.170   3.001   23.837  1.00 38.63  ? 263 ALA A N     1 
ATOM   1732 C  CA    . ALA A 1 221 ? 5.898   2.761   24.514  1.00 35.83  ? 263 ALA A CA    1 
ATOM   1733 C  C     . ALA A 1 221 ? 4.972   3.930   24.190  1.00 38.03  ? 263 ALA A C     1 
ATOM   1734 O  O     . ALA A 1 221 ? 5.199   5.067   24.640  1.00 32.92  ? 263 ALA A O     1 
ATOM   1735 C  CB    . ALA A 1 221 ? 6.087   2.583   26.023  1.00 34.82  ? 263 ALA A CB    1 
ATOM   1736 N  N     . TYR A 1 222 ? 3.932   3.642   23.410  1.00 33.08  ? 264 TYR A N     1 
ATOM   1737 C  CA    . TYR A 1 222 ? 3.078   4.669   22.831  1.00 36.26  ? 264 TYR A CA    1 
ATOM   1738 C  C     . TYR A 1 222 ? 1.605   4.302   22.989  1.00 36.06  ? 264 TYR A C     1 
ATOM   1739 O  O     . TYR A 1 222 ? 1.238   3.130   23.159  1.00 32.58  ? 264 TYR A O     1 
ATOM   1740 C  CB    . TYR A 1 222 ? 3.390   4.893   21.335  1.00 40.03  ? 264 TYR A CB    1 
ATOM   1741 C  CG    . TYR A 1 222 ? 4.870   4.970   20.964  1.00 36.03  ? 264 TYR A CG    1 
ATOM   1742 C  CD1   . TYR A 1 222 ? 5.702   5.922   21.530  1.00 37.09  ? 264 TYR A CD1   1 
ATOM   1743 C  CD2   . TYR A 1 222 ? 5.412   4.110   20.014  1.00 35.57  ? 264 TYR A CD2   1 
ATOM   1744 C  CE1   . TYR A 1 222 ? 7.059   5.998   21.186  1.00 38.37  ? 264 TYR A CE1   1 
ATOM   1745 C  CE2   . TYR A 1 222 ? 6.737   4.176   19.664  1.00 39.60  ? 264 TYR A CE2   1 
ATOM   1746 C  CZ    . TYR A 1 222 ? 7.567   5.124   20.250  1.00 41.10  ? 264 TYR A CZ    1 
ATOM   1747 O  OH    . TYR A 1 222 ? 8.899   5.187   19.896  1.00 40.05  ? 264 TYR A OH    1 
ATOM   1748 N  N     . THR A 1 223 ? 0.758   5.341   22.904  1.00 38.24  ? 265 THR A N     1 
ATOM   1749 C  CA    . THR A 1 223 ? -0.690  5.205   23.004  1.00 35.79  ? 265 THR A CA    1 
ATOM   1750 C  C     . THR A 1 223 ? -1.455  5.742   21.795  1.00 38.89  ? 265 THR A C     1 
ATOM   1751 O  O     . THR A 1 223 ? -2.671  5.518   21.702  1.00 34.57  ? 265 THR A O     1 
ATOM   1752 C  CB    . THR A 1 223 ? -1.208  5.907   24.274  1.00 34.43  ? 265 THR A CB    1 
ATOM   1753 O  OG1   . THR A 1 223 ? -0.962  7.324   24.192  1.00 27.79  ? 265 THR A OG1   1 
ATOM   1754 C  CG2   . THR A 1 223 ? -0.547  5.307   25.515  1.00 29.92  ? 265 THR A CG2   1 
ATOM   1755 N  N     . PHE A 1 224 ? -0.786  6.432   20.872  1.00 37.12  ? 266 PHE A N     1 
ATOM   1756 C  CA    . PHE A 1 224 ? -1.389  6.943   19.647  1.00 38.59  ? 266 PHE A CA    1 
ATOM   1757 C  C     . PHE A 1 224 ? -0.472  6.629   18.476  1.00 40.71  ? 266 PHE A C     1 
ATOM   1758 O  O     . PHE A 1 224 ? 0.757   6.684   18.619  1.00 37.66  ? 266 PHE A O     1 
ATOM   1759 C  CB    . PHE A 1 224 ? -1.612  8.460   19.727  1.00 35.96  ? 266 PHE A CB    1 
ATOM   1760 C  CG    . PHE A 1 224 ? -1.764  9.124   18.388  1.00 39.02  ? 266 PHE A CG    1 
ATOM   1761 C  CD1   . PHE A 1 224 ? -2.983  9.154   17.755  1.00 35.64  ? 266 PHE A CD1   1 
ATOM   1762 C  CD2   . PHE A 1 224 ? -0.690  9.748   17.780  1.00 37.17  ? 266 PHE A CD2   1 
ATOM   1763 C  CE1   . PHE A 1 224 ? -3.119  9.784   16.529  1.00 38.66  ? 266 PHE A CE1   1 
ATOM   1764 C  CE2   . PHE A 1 224 ? -0.826  10.385  16.557  1.00 36.40  ? 266 PHE A CE2   1 
ATOM   1765 C  CZ    . PHE A 1 224 ? -2.044  10.404  15.938  1.00 42.77  ? 266 PHE A CZ    1 
ATOM   1766 N  N     . TRP A 1 225 ? -1.075  6.311   17.325  1.00 37.07  ? 267 TRP A N     1 
ATOM   1767 C  CA    . TRP A 1 225 ? -0.394  6.123   16.042  1.00 37.79  ? 267 TRP A CA    1 
ATOM   1768 C  C     . TRP A 1 225 ? -1.311  6.688   14.978  1.00 37.50  ? 267 TRP A C     1 
ATOM   1769 O  O     . TRP A 1 225 ? -2.508  6.376   14.994  1.00 37.00  ? 267 TRP A O     1 
ATOM   1770 C  CB    . TRP A 1 225 ? -0.150  4.648   15.705  1.00 38.30  ? 267 TRP A CB    1 
ATOM   1771 C  CG    . TRP A 1 225 ? 0.478   3.877   16.774  1.00 36.08  ? 267 TRP A CG    1 
ATOM   1772 C  CD1   . TRP A 1 225 ? 1.783   3.530   16.859  1.00 40.03  ? 267 TRP A CD1   1 
ATOM   1773 C  CD2   . TRP A 1 225 ? -0.164  3.331   17.923  1.00 32.48  ? 267 TRP A CD2   1 
ATOM   1774 N  NE1   . TRP A 1 225 ? 2.011   2.819   18.014  1.00 38.84  ? 267 TRP A NE1   1 
ATOM   1775 C  CE2   . TRP A 1 225 ? 0.827   2.678   18.682  1.00 39.76  ? 267 TRP A CE2   1 
ATOM   1776 C  CE3   . TRP A 1 225 ? -1.473  3.347   18.397  1.00 33.93  ? 267 TRP A CE3   1 
ATOM   1777 C  CZ2   . TRP A 1 225 ? 0.545   2.041   19.887  1.00 39.03  ? 267 TRP A CZ2   1 
ATOM   1778 C  CZ3   . TRP A 1 225 ? -1.754  2.720   19.588  1.00 35.81  ? 267 TRP A CZ3   1 
ATOM   1779 C  CH2   . TRP A 1 225 ? -0.749  2.078   20.326  1.00 37.10  ? 267 TRP A CH2   1 
ATOM   1780 N  N     . THR A 1 226 ? -0.775  7.494   14.058  1.00 36.01  ? 268 THR A N     1 
ATOM   1781 C  CA    . THR A 1 226 ? -1.646  8.052   13.034  1.00 40.94  ? 268 THR A CA    1 
ATOM   1782 C  C     . THR A 1 226 ? -2.285  6.932   12.210  1.00 35.73  ? 268 THR A C     1 
ATOM   1783 O  O     . THR A 1 226 ? -1.686  5.869   11.991  1.00 29.12  ? 268 THR A O     1 
ATOM   1784 C  CB    . THR A 1 226 ? -0.893  9.021   12.113  1.00 39.41  ? 268 THR A CB    1 
ATOM   1785 O  OG1   . THR A 1 226 ? -1.763  9.411   11.036  1.00 41.02  ? 268 THR A OG1   1 
ATOM   1786 C  CG2   . THR A 1 226 ? 0.378   8.373   11.537  1.00 37.13  ? 268 THR A CG2   1 
ATOM   1787 N  N     . TYR A 1 227 ? -3.537  7.166   11.793  1.00 28.66  ? 269 TYR A N     1 
ATOM   1788 C  CA    . TYR A 1 227 ? -4.179  6.254   10.837  1.00 37.51  ? 269 TYR A CA    1 
ATOM   1789 C  C     . TYR A 1 227 ? -3.393  6.128   9.530   1.00 32.56  ? 269 TYR A C     1 
ATOM   1790 O  O     . TYR A 1 227 ? -3.344  5.046   8.944   1.00 37.45  ? 269 TYR A O     1 
ATOM   1791 C  CB    . TYR A 1 227 ? -5.612  6.705   10.541  1.00 39.65  ? 269 TYR A CB    1 
ATOM   1792 C  CG    . TYR A 1 227 ? -6.622  6.332   11.608  1.00 36.29  ? 269 TYR A CG    1 
ATOM   1793 C  CD1   . TYR A 1 227 ? -6.700  5.037   12.096  1.00 34.69  ? 269 TYR A CD1   1 
ATOM   1794 C  CD2   . TYR A 1 227 ? -7.484  7.282   12.137  1.00 35.22  ? 269 TYR A CD2   1 
ATOM   1795 C  CE1   . TYR A 1 227 ? -7.625  4.684   13.051  1.00 35.29  ? 269 TYR A CE1   1 
ATOM   1796 C  CE2   . TYR A 1 227 ? -8.403  6.940   13.110  1.00 38.40  ? 269 TYR A CE2   1 
ATOM   1797 C  CZ    . TYR A 1 227 ? -8.474  5.631   13.555  1.00 38.30  ? 269 TYR A CZ    1 
ATOM   1798 O  OH    . TYR A 1 227 ? -9.401  5.264   14.517  1.00 37.78  ? 269 TYR A OH    1 
ATOM   1799 N  N     . MET A 1 228 ? -2.742  7.191   9.082   1.00 37.52  ? 270 MET A N     1 
ATOM   1800 C  CA    . MET A 1 228 ? -2.005  7.167   7.822   1.00 44.71  ? 270 MET A CA    1 
ATOM   1801 C  C     . MET A 1 228 ? -0.702  6.355   7.887   1.00 41.54  ? 270 MET A C     1 
ATOM   1802 O  O     . MET A 1 228 ? -0.177  6.050   8.956   1.00 42.30  ? 270 MET A O     1 
ATOM   1803 C  CB    . MET A 1 228 ? -1.678  8.590   7.395   1.00 50.37  ? 270 MET A CB    1 
ATOM   1804 C  CG    . MET A 1 228 ? -2.915  9.445   7.140   1.00 54.30  ? 270 MET A CG    1 
ATOM   1805 S  SD    . MET A 1 228 ? -2.579  11.040  7.839   1.00 61.90  ? 270 MET A SD    1 
ATOM   1806 C  CE    . MET A 1 228 ? -3.609  12.101  6.917   1.00 56.06  ? 270 MET A CE    1 
ATOM   1807 N  N     . MET A 1 229 ? -0.183  5.999   6.696   1.00 46.91  ? 271 MET A N     1 
ATOM   1808 C  CA    . MET A 1 229 ? 1.149   5.397   6.479   1.00 39.89  ? 271 MET A CA    1 
ATOM   1809 C  C     . MET A 1 229 ? 1.371   4.090   7.251   1.00 44.24  ? 271 MET A C     1 
ATOM   1810 O  O     . MET A 1 229 ? 2.532   3.677   7.485   1.00 41.54  ? 271 MET A O     1 
ATOM   1811 C  CB    . MET A 1 229 ? 2.271   6.394   6.804   1.00 41.54  ? 271 MET A CB    1 
ATOM   1812 C  CG    . MET A 1 229 ? 2.245   7.662   5.955   1.00 53.98  ? 271 MET A CG    1 
ATOM   1813 S  SD    . MET A 1 229 ? 2.425   7.323   4.185   1.00 59.22  ? 271 MET A SD    1 
ATOM   1814 C  CE    . MET A 1 229 ? 3.007   8.888   3.539   1.00 56.87  ? 271 MET A CE    1 
ATOM   1815 N  N     . ASN A 1 230 ? 0.296   3.422   7.658   1.00 41.15  ? 272 ASN A N     1 
ATOM   1816 C  CA    . ASN A 1 230 ? 0.418   2.141   8.350   1.00 49.63  ? 272 ASN A CA    1 
ATOM   1817 C  C     . ASN A 1 230 ? 1.285   2.259   9.620   1.00 45.48  ? 272 ASN A C     1 
ATOM   1818 O  O     . ASN A 1 230 ? 2.042   1.347   9.960   1.00 37.90  ? 272 ASN A O     1 
ATOM   1819 C  CB    . ASN A 1 230 ? 0.972   1.082   7.392   1.00 44.22  ? 272 ASN A CB    1 
ATOM   1820 C  CG    . ASN A 1 230 ? 0.385   -0.287  7.632   1.00 54.44  ? 272 ASN A CG    1 
ATOM   1821 O  OD1   . ASN A 1 230 ? 1.114   -1.275  7.708   1.00 58.71  ? 272 ASN A OD1   1 
ATOM   1822 N  ND2   . ASN A 1 230 ? -0.942  -0.358  7.749   1.00 64.14  ? 272 ASN A ND2   1 
ATOM   1823 N  N     . ALA A 1 231 ? 1.148   3.389   10.331  1.00 42.37  ? 273 ALA A N     1 
ATOM   1824 C  CA    . ALA A 1 231 ? 2.000   3.692   11.484  1.00 40.23  ? 273 ALA A CA    1 
ATOM   1825 C  C     . ALA A 1 231 ? 1.890   2.634   12.582  1.00 41.07  ? 273 ALA A C     1 
ATOM   1826 O  O     . ALA A 1 231 ? 2.908   2.202   13.138  1.00 37.54  ? 273 ALA A O     1 
ATOM   1827 C  CB    . ALA A 1 231 ? 1.649   5.072   12.046  1.00 35.41  ? 273 ALA A CB    1 
ATOM   1828 N  N     . ARG A 1 232 ? 0.667   2.198   12.901  1.00 44.07  ? 274 ARG A N     1 
ATOM   1829 C  CA    . ARG A 1 232 ? 0.470   1.313   14.045  1.00 39.69  ? 274 ARG A CA    1 
ATOM   1830 C  C     . ARG A 1 232 ? 1.202   -0.007  13.875  1.00 37.47  ? 274 ARG A C     1 
ATOM   1831 O  O     . ARG A 1 232 ? 1.671   -0.589  14.853  1.00 44.40  ? 274 ARG A O     1 
ATOM   1832 C  CB    . ARG A 1 232 ? -1.020  1.047   14.280  1.00 34.60  ? 274 ARG A CB    1 
ATOM   1833 C  CG    . ARG A 1 232 ? -1.269  0.293   15.618  1.00 38.23  ? 274 ARG A CG    1 
ATOM   1834 C  CD    . ARG A 1 232 ? -2.590  0.726   16.234  1.00 32.92  ? 274 ARG A CD    1 
ATOM   1835 N  NE    . ARG A 1 232 ? -2.864  0.070   17.504  1.00 31.64  ? 274 ARG A NE    1 
ATOM   1836 C  CZ    . ARG A 1 232 ? -4.022  0.191   18.146  1.00 39.22  ? 274 ARG A CZ    1 
ATOM   1837 N  NH1   . ARG A 1 232 ? -4.998  0.930   17.614  1.00 35.63  ? 274 ARG A NH1   1 
ATOM   1838 N  NH2   . ARG A 1 232 ? -4.218  -0.431  19.301  1.00 38.34  ? 274 ARG A NH2   1 
ATOM   1839 N  N     . SER A 1 233 ? 1.285   -0.515  12.654  1.00 40.38  ? 275 SER A N     1 
ATOM   1840 C  CA    . SER A 1 233 ? 1.951   -1.792  12.455  1.00 41.03  ? 275 SER A CA    1 
ATOM   1841 C  C     . SER A 1 233 ? 3.473   -1.671  12.497  1.00 42.16  ? 275 SER A C     1 
ATOM   1842 O  O     . SER A 1 233 ? 4.159   -2.683  12.688  1.00 40.95  ? 275 SER A O     1 
ATOM   1843 C  CB    . SER A 1 233 ? 1.518   -2.381  11.123  1.00 42.85  ? 275 SER A CB    1 
ATOM   1844 O  OG    . SER A 1 233 ? 1.963   -1.510  10.109  1.00 47.00  ? 275 SER A OG    1 
ATOM   1845 N  N     . LYS A 1 234 ? 4.014   -0.475  12.290  1.00 37.15  ? 276 LYS A N     1 
ATOM   1846 C  CA    . LYS A 1 234 ? 5.434   -0.238  12.458  1.00 40.63  ? 276 LYS A CA    1 
ATOM   1847 C  C     . LYS A 1 234 ? 5.753   0.319   13.843  1.00 40.11  ? 276 LYS A C     1 
ATOM   1848 O  O     . LYS A 1 234 ? 6.915   0.616   14.133  1.00 38.99  ? 276 LYS A O     1 
ATOM   1849 C  CB    . LYS A 1 234 ? 5.938   0.731   11.386  1.00 39.37  ? 276 LYS A CB    1 
ATOM   1850 C  CG    . LYS A 1 234 ? 5.373   0.560   9.973   1.00 40.38  ? 276 LYS A CG    1 
ATOM   1851 C  CD    . LYS A 1 234 ? 5.790   1.751   9.132   1.00 39.83  ? 276 LYS A CD    1 
ATOM   1852 C  CE    . LYS A 1 234 ? 5.141   1.748   7.775   1.00 46.34  ? 276 LYS A CE    1 
ATOM   1853 N  NZ    . LYS A 1 234 ? 5.088   3.144   7.220   1.00 47.82  ? 276 LYS A NZ    1 
ATOM   1854 N  N     . ASN A 1 235 ? 4.733   0.489   14.685  1.00 43.91  ? 277 ASN A N     1 
ATOM   1855 C  CA    . ASN A 1 235 ? 4.869   1.125   15.995  1.00 42.64  ? 277 ASN A CA    1 
ATOM   1856 C  C     . ASN A 1 235 ? 5.561   2.478   15.881  1.00 41.97  ? 277 ASN A C     1 
ATOM   1857 O  O     . ASN A 1 235 ? 6.456   2.814   16.666  1.00 47.48  ? 277 ASN A O     1 
ATOM   1858 C  CB    . ASN A 1 235 ? 5.603   0.210   16.965  1.00 40.35  ? 277 ASN A CB    1 
ATOM   1859 C  CG    . ASN A 1 235 ? 5.521   0.685   18.391  1.00 43.33  ? 277 ASN A CG    1 
ATOM   1860 O  OD1   . ASN A 1 235 ? 4.595   1.400   18.774  1.00 39.13  ? 277 ASN A OD1   1 
ATOM   1861 N  ND2   . ASN A 1 235 ? 6.495   0.278   19.191  1.00 35.37  ? 277 ASN A ND2   1 
ATOM   1862 N  N     . VAL A 1 236 ? 5.150   3.256   14.884  1.00 35.55  ? 278 VAL A N     1 
ATOM   1863 C  CA    . VAL A 1 236 ? 5.565   4.658   14.765  1.00 41.52  ? 278 VAL A CA    1 
ATOM   1864 C  C     . VAL A 1 236 ? 4.493   5.479   15.485  1.00 45.16  ? 278 VAL A C     1 
ATOM   1865 O  O     . VAL A 1 236 ? 3.478   5.883   14.897  1.00 41.87  ? 278 VAL A O     1 
ATOM   1866 C  CB    . VAL A 1 236 ? 5.750   5.079   13.306  1.00 40.40  ? 278 VAL A CB    1 
ATOM   1867 C  CG1   . VAL A 1 236 ? 6.196   6.534   13.223  1.00 43.26  ? 278 VAL A CG1   1 
ATOM   1868 C  CG2   . VAL A 1 236 ? 6.744   4.154   12.586  1.00 36.69  ? 278 VAL A CG2   1 
ATOM   1869 N  N     . GLY A 1 237 ? 4.708   5.732   16.786  1.00 37.29  ? 279 GLY A N     1 
ATOM   1870 C  CA    . GLY A 1 237 ? 3.688   6.361   17.598  1.00 36.38  ? 279 GLY A CA    1 
ATOM   1871 C  C     . GLY A 1 237 ? 4.183   7.401   18.590  1.00 32.63  ? 279 GLY A C     1 
ATOM   1872 O  O     . GLY A 1 237 ? 5.367   7.733   18.670  1.00 35.60  ? 279 GLY A O     1 
ATOM   1873 N  N     . TRP A 1 238 ? 3.221   7.918   19.335  1.00 35.68  ? 280 TRP A N     1 
ATOM   1874 C  CA    . TRP A 1 238 ? 3.407   8.958   20.328  1.00 36.56  ? 280 TRP A CA    1 
ATOM   1875 C  C     . TRP A 1 238 ? 2.837   8.456   21.653  1.00 39.48  ? 280 TRP A C     1 
ATOM   1876 O  O     . TRP A 1 238 ? 1.851   7.712   21.673  1.00 33.60  ? 280 TRP A O     1 
ATOM   1877 C  CB    . TRP A 1 238 ? 2.691   10.252  19.919  1.00 35.26  ? 280 TRP A CB    1 
ATOM   1878 C  CG    . TRP A 1 238 ? 3.066   10.872  18.563  1.00 37.25  ? 280 TRP A CG    1 
ATOM   1879 C  CD1   . TRP A 1 238 ? 3.031   10.267  17.325  1.00 33.55  ? 280 TRP A CD1   1 
ATOM   1880 C  CD2   . TRP A 1 238 ? 3.500   12.230  18.336  1.00 36.06  ? 280 TRP A CD2   1 
ATOM   1881 N  NE1   . TRP A 1 238 ? 3.423   11.169  16.355  1.00 36.29  ? 280 TRP A NE1   1 
ATOM   1882 C  CE2   . TRP A 1 238 ? 3.706   12.376  16.945  1.00 38.10  ? 280 TRP A CE2   1 
ATOM   1883 C  CE3   . TRP A 1 238 ? 3.750   13.332  19.184  1.00 33.67  ? 280 TRP A CE3   1 
ATOM   1884 C  CZ2   . TRP A 1 238 ? 4.134   13.574  16.376  1.00 39.24  ? 280 TRP A CZ2   1 
ATOM   1885 C  CZ3   . TRP A 1 238 ? 4.159   14.529  18.621  1.00 32.87  ? 280 TRP A CZ3   1 
ATOM   1886 C  CH2   . TRP A 1 238 ? 4.358   14.639  17.225  1.00 37.17  ? 280 TRP A CH2   1 
ATOM   1887 N  N     . ARG A 1 239 ? 3.454   8.845   22.773  1.00 36.44  ? 281 ARG A N     1 
ATOM   1888 C  CA    . ARG A 1 239 ? 2.847   8.574   24.074  1.00 34.60  ? 281 ARG A CA    1 
ATOM   1889 C  C     . ARG A 1 239 ? 2.110   9.846   24.483  1.00 34.95  ? 281 ARG A C     1 
ATOM   1890 O  O     . ARG A 1 239 ? 2.723   10.827  24.915  1.00 34.41  ? 281 ARG A O     1 
ATOM   1891 C  CB    . ARG A 1 239 ? 3.874   8.128   25.115  1.00 32.85  ? 281 ARG A CB    1 
ATOM   1892 C  CG    . ARG A 1 239 ? 3.209   7.572   26.412  1.00 37.26  ? 281 ARG A CG    1 
ATOM   1893 C  CD    . ARG A 1 239 ? 4.178   6.866   27.375  1.00 40.73  ? 281 ARG A CD    1 
ATOM   1894 N  NE    . ARG A 1 239 ? 5.083   7.843   27.981  1.00 43.77  ? 281 ARG A NE    1 
ATOM   1895 C  CZ    . ARG A 1 239 ? 4.874   8.401   29.167  1.00 39.71  ? 281 ARG A CZ    1 
ATOM   1896 N  NH1   . ARG A 1 239 ? 3.798   8.072   29.882  1.00 39.07  ? 281 ARG A NH1   1 
ATOM   1897 N  NH2   . ARG A 1 239 ? 5.733   9.287   29.626  1.00 38.50  ? 281 ARG A NH2   1 
ATOM   1898 N  N     . LEU A 1 240 ? 0.783   9.830   24.347  1.00 34.51  ? 282 LEU A N     1 
ATOM   1899 C  CA    . LEU A 1 240 ? -0.013  11.039  24.540  1.00 33.54  ? 282 LEU A CA    1 
ATOM   1900 C  C     . LEU A 1 240 ? -1.024  10.932  25.662  1.00 27.82  ? 282 LEU A C     1 
ATOM   1901 O  O     . LEU A 1 240 ? -1.586  11.958  26.070  1.00 28.63  ? 282 LEU A O     1 
ATOM   1902 C  CB    . LEU A 1 240 ? -0.776  11.390  23.245  1.00 33.57  ? 282 LEU A CB    1 
ATOM   1903 C  CG    . LEU A 1 240 ? -0.008  11.730  21.975  1.00 35.79  ? 282 LEU A CG    1 
ATOM   1904 C  CD1   . LEU A 1 240 ? -1.031  12.152  20.890  1.00 32.63  ? 282 LEU A CD1   1 
ATOM   1905 C  CD2   . LEU A 1 240 ? 1.035   12.817  22.221  1.00 27.96  ? 282 LEU A CD2   1 
ATOM   1906 N  N     . ASP A 1 241 ? -1.341  9.720   26.094  1.00 30.04  ? 283 ASP A N     1 
ATOM   1907 C  CA    . ASP A 1 241 ? -2.358  9.460   27.094  1.00 31.98  ? 283 ASP A CA    1 
ATOM   1908 C  C     . ASP A 1 241 ? -1.666  9.052   28.397  1.00 34.30  ? 283 ASP A C     1 
ATOM   1909 O  O     . ASP A 1 241 ? -0.809  8.165   28.395  1.00 31.31  ? 283 ASP A O     1 
ATOM   1910 C  CB    . ASP A 1 241 ? -3.285  8.367   26.596  1.00 33.09  ? 283 ASP A CB    1 
ATOM   1911 C  CG    . ASP A 1 241 ? -3.905  8.704   25.231  1.00 37.58  ? 283 ASP A CG    1 
ATOM   1912 O  OD1   . ASP A 1 241 ? -4.926  9.421   25.225  1.00 38.19  ? 283 ASP A OD1   1 
ATOM   1913 O  OD2   . ASP A 1 241 ? -3.391  8.235   24.186  1.00 34.19  ? 283 ASP A OD2   1 
ATOM   1914 N  N     . TYR A 1 242 ? -2.030  9.702   29.497  1.00 35.86  ? 284 TYR A N     1 
ATOM   1915 C  CA    . TYR A 1 242 ? -1.297  9.585   30.748  1.00 34.04  ? 284 TYR A CA    1 
ATOM   1916 C  C     . TYR A 1 242 ? -2.222  9.329   31.922  1.00 38.97  ? 284 TYR A C     1 
ATOM   1917 O  O     . TYR A 1 242 ? -3.358  9.827   31.964  1.00 36.60  ? 284 TYR A O     1 
ATOM   1918 C  CB    . TYR A 1 242 ? -0.533  10.847  31.077  1.00 34.47  ? 284 TYR A CB    1 
ATOM   1919 C  CG    . TYR A 1 242 ? 0.512   11.251  30.085  1.00 37.06  ? 284 TYR A CG    1 
ATOM   1920 C  CD1   . TYR A 1 242 ? 0.146   11.810  28.873  1.00 32.06  ? 284 TYR A CD1   1 
ATOM   1921 C  CD2   . TYR A 1 242 ? 1.876   11.112  30.372  1.00 31.66  ? 284 TYR A CD2   1 
ATOM   1922 C  CE1   . TYR A 1 242 ? 1.094   12.206  27.972  1.00 35.03  ? 284 TYR A CE1   1 
ATOM   1923 C  CE2   . TYR A 1 242 ? 2.838   11.522  29.472  1.00 33.11  ? 284 TYR A CE2   1 
ATOM   1924 C  CZ    . TYR A 1 242 ? 2.434   12.077  28.259  1.00 35.70  ? 284 TYR A CZ    1 
ATOM   1925 O  OH    . TYR A 1 242 ? 3.340   12.502  27.308  1.00 30.03  ? 284 TYR A OH    1 
ATOM   1926 N  N     . PHE A 1 243 ? -1.699  8.582   32.907  1.00 35.55  ? 285 PHE A N     1 
ATOM   1927 C  CA    . PHE A 1 243 ? -2.168  8.690   34.286  1.00 35.41  ? 285 PHE A CA    1 
ATOM   1928 C  C     . PHE A 1 243 ? -1.154  9.548   35.042  1.00 40.40  ? 285 PHE A C     1 
ATOM   1929 O  O     . PHE A 1 243 ? -0.001  9.144   35.238  1.00 36.09  ? 285 PHE A O     1 
ATOM   1930 C  CB    . PHE A 1 243 ? -2.364  7.318   34.927  1.00 32.14  ? 285 PHE A CB    1 
ATOM   1931 C  CG    . PHE A 1 243 ? -3.597  6.610   34.435  1.00 35.46  ? 285 PHE A CG    1 
ATOM   1932 C  CD1   . PHE A 1 243 ? -4.838  6.996   34.858  1.00 35.98  ? 285 PHE A CD1   1 
ATOM   1933 C  CD2   . PHE A 1 243 ? -3.508  5.591   33.496  1.00 39.40  ? 285 PHE A CD2   1 
ATOM   1934 C  CE1   . PHE A 1 243 ? -5.969  6.361   34.387  1.00 40.02  ? 285 PHE A CE1   1 
ATOM   1935 C  CE2   . PHE A 1 243 ? -4.615  4.951   33.020  1.00 33.23  ? 285 PHE A CE2   1 
ATOM   1936 C  CZ    . PHE A 1 243 ? -5.851  5.332   33.456  1.00 36.19  ? 285 PHE A CZ    1 
ATOM   1937 N  N     . LEU A 1 244 ? -1.575  10.746  35.433  1.00 37.92  ? 286 LEU A N     1 
ATOM   1938 C  CA    . LEU A 1 244 ? -0.791  11.586  36.319  1.00 36.20  ? 286 LEU A CA    1 
ATOM   1939 C  C     . LEU A 1 244 ? -1.324  11.448  37.750  1.00 40.67  ? 286 LEU A C     1 
ATOM   1940 O  O     . LEU A 1 244 ? -2.546  11.504  37.968  1.00 37.23  ? 286 LEU A O     1 
ATOM   1941 C  CB    . LEU A 1 244 ? -0.831  13.033  35.832  1.00 37.07  ? 286 LEU A CB    1 
ATOM   1942 C  CG    . LEU A 1 244 ? -0.116  13.366  34.518  1.00 36.27  ? 286 LEU A CG    1 
ATOM   1943 C  CD1   . LEU A 1 244 ? 0.245   14.843  34.471  1.00 34.82  ? 286 LEU A CD1   1 
ATOM   1944 C  CD2   . LEU A 1 244 ? 1.135   12.559  34.313  1.00 36.50  ? 286 LEU A CD2   1 
ATOM   1945 N  N     . LEU A 1 245 ? -0.410  11.228  38.718  1.00 33.77  ? 287 LEU A N     1 
ATOM   1946 C  CA    . LEU A 1 245 ? -0.761  10.935  40.113  1.00 37.67  ? 287 LEU A CA    1 
ATOM   1947 C  C     . LEU A 1 245 ? -0.154  11.945  41.066  1.00 34.85  ? 287 LEU A C     1 
ATOM   1948 O  O     . LEU A 1 245 ? 0.985   12.379  40.877  1.00 42.98  ? 287 LEU A O     1 
ATOM   1949 C  CB    . LEU A 1 245 ? -0.285  9.566   40.560  1.00 33.74  ? 287 LEU A CB    1 
ATOM   1950 C  CG    . LEU A 1 245 ? -0.914  8.371   39.877  1.00 38.78  ? 287 LEU A CG    1 
ATOM   1951 C  CD1   . LEU A 1 245 ? -0.346  7.100   40.432  1.00 32.98  ? 287 LEU A CD1   1 
ATOM   1952 C  CD2   . LEU A 1 245 ? -2.409  8.421   40.104  1.00 39.37  ? 287 LEU A CD2   1 
ATOM   1953 N  N     . SER A 1 246 ? -0.912  12.301  42.099  1.00 39.48  ? 288 SER A N     1 
ATOM   1954 C  CA    . SER A 1 246 ? -0.327  12.957  43.270  1.00 46.61  ? 288 SER A CA    1 
ATOM   1955 C  C     . SER A 1 246 ? 0.796   12.107  43.862  1.00 41.13  ? 288 SER A C     1 
ATOM   1956 O  O     . SER A 1 246 ? 0.728   10.876  43.857  1.00 39.69  ? 288 SER A O     1 
ATOM   1957 C  CB    . SER A 1 246 ? -1.394  13.201  44.339  1.00 36.47  ? 288 SER A CB    1 
ATOM   1958 O  OG    . SER A 1 246 ? -1.983  14.478  44.218  1.00 40.66  ? 288 SER A OG    1 
ATOM   1959 N  N     . HIS A 1 247 ? 1.833   12.765  44.392  1.00 40.88  ? 289 HIS A N     1 
ATOM   1960 C  CA    . HIS A 1 247 ? 2.936   11.995  44.968  1.00 37.55  ? 289 HIS A CA    1 
ATOM   1961 C  C     . HIS A 1 247 ? 2.456   11.116  46.117  1.00 38.76  ? 289 HIS A C     1 
ATOM   1962 O  O     . HIS A 1 247 ? 2.991   10.021  46.322  1.00 39.55  ? 289 HIS A O     1 
ATOM   1963 C  CB    . HIS A 1 247 ? 4.063   12.921  45.437  1.00 38.99  ? 289 HIS A CB    1 
ATOM   1964 C  CG    . HIS A 1 247 ? 4.844   13.552  44.326  1.00 39.90  ? 289 HIS A CG    1 
ATOM   1965 N  ND1   . HIS A 1 247 ? 5.880   14.431  44.551  1.00 43.58  ? 289 HIS A ND1   1 
ATOM   1966 C  CD2   . HIS A 1 247 ? 4.745   13.432  42.977  1.00 46.88  ? 289 HIS A CD2   1 
ATOM   1967 C  CE1   . HIS A 1 247 ? 6.394   14.820  43.397  1.00 47.21  ? 289 HIS A CE1   1 
ATOM   1968 N  NE2   . HIS A 1 247 ? 5.719   14.233  42.422  1.00 45.05  ? 289 HIS A NE2   1 
ATOM   1969 N  N     . SER A 1 248 ? 1.429   11.552  46.851  1.00 40.24  ? 290 SER A N     1 
ATOM   1970 C  CA    . SER A 1 248 ? 0.939   10.783  47.990  1.00 35.62  ? 290 SER A CA    1 
ATOM   1971 C  C     . SER A 1 248 ? 0.183   9.520   47.595  1.00 43.72  ? 290 SER A C     1 
ATOM   1972 O  O     . SER A 1 248 ? -0.102  8.698   48.471  1.00 42.05  ? 290 SER A O     1 
ATOM   1973 C  CB    . SER A 1 248 ? 0.023   11.634  48.840  1.00 33.64  ? 290 SER A CB    1 
ATOM   1974 O  OG    . SER A 1 248 ? -1.267  11.602  48.295  1.00 52.28  ? 290 SER A OG    1 
ATOM   1975 N  N     . LEU A 1 249 ? -0.170  9.347   46.318  1.00 42.41  ? 291 LEU A N     1 
ATOM   1976 C  CA    . LEU A 1 249 ? -0.745  8.084   45.859  1.00 42.89  ? 291 LEU A CA    1 
ATOM   1977 C  C     . LEU A 1 249 ? 0.297   7.107   45.331  1.00 42.30  ? 291 LEU A C     1 
ATOM   1978 O  O     . LEU A 1 249 ? -0.042  5.948   45.073  1.00 40.39  ? 291 LEU A O     1 
ATOM   1979 C  CB    . LEU A 1 249 ? -1.785  8.328   44.772  1.00 37.58  ? 291 LEU A CB    1 
ATOM   1980 C  CG    . LEU A 1 249 ? -3.006  9.139   45.176  1.00 37.88  ? 291 LEU A CG    1 
ATOM   1981 C  CD1   . LEU A 1 249 ? -3.789  9.458   43.926  1.00 43.35  ? 291 LEU A CD1   1 
ATOM   1982 C  CD2   . LEU A 1 249 ? -3.855  8.371   46.135  1.00 34.52  ? 291 LEU A CD2   1 
ATOM   1983 N  N     . LEU A 1 250 ? 1.549   7.542   45.167  1.00 42.42  ? 292 LEU A N     1 
ATOM   1984 C  CA    . LEU A 1 250 ? 2.580   6.646   44.649  1.00 41.05  ? 292 LEU A CA    1 
ATOM   1985 C  C     . LEU A 1 250 ? 2.802   5.404   45.506  1.00 45.46  ? 292 LEU A C     1 
ATOM   1986 O  O     . LEU A 1 250 ? 2.974   4.316   44.923  1.00 46.55  ? 292 LEU A O     1 
ATOM   1987 C  CB    . LEU A 1 250 ? 3.890   7.417   44.463  1.00 42.84  ? 292 LEU A CB    1 
ATOM   1988 C  CG    . LEU A 1 250 ? 4.037   8.335   43.263  1.00 40.26  ? 292 LEU A CG    1 
ATOM   1989 C  CD1   . LEU A 1 250 ? 5.259   9.201   43.454  1.00 39.27  ? 292 LEU A CD1   1 
ATOM   1990 C  CD2   . LEU A 1 250 ? 4.179   7.517   42.002  1.00 41.98  ? 292 LEU A CD2   1 
ATOM   1991 N  N     . PRO A 1 251 ? 2.813   5.471   46.846  1.00 44.14  ? 293 PRO A N     1 
ATOM   1992 C  CA    . PRO A 1 251 ? 2.835   4.227   47.649  1.00 42.95  ? 293 PRO A CA    1 
ATOM   1993 C  C     . PRO A 1 251 ? 1.683   3.269   47.348  1.00 47.36  ? 293 PRO A C     1 
ATOM   1994 O  O     . PRO A 1 251 ? 1.748   2.105   47.768  1.00 52.07  ? 293 PRO A O     1 
ATOM   1995 C  CB    . PRO A 1 251 ? 2.732   4.736   49.092  1.00 34.31  ? 293 PRO A CB    1 
ATOM   1996 C  CG    . PRO A 1 251 ? 3.173   6.147   49.041  1.00 43.34  ? 293 PRO A CG    1 
ATOM   1997 C  CD    . PRO A 1 251 ? 2.797   6.674   47.702  1.00 43.27  ? 293 PRO A CD    1 
ATOM   1998 N  N     . ALA A 1 252 ? 0.617   3.736   46.684  1.00 44.24  ? 294 ALA A N     1 
ATOM   1999 C  CA    . ALA A 1 252 ? -0.549  2.928   46.351  1.00 47.59  ? 294 ALA A CA    1 
ATOM   2000 C  C     . ALA A 1 252 ? -0.496  2.371   44.928  1.00 44.15  ? 294 ALA A C     1 
ATOM   2001 O  O     . ALA A 1 252 ? -1.343  1.548   44.559  1.00 43.62  ? 294 ALA A O     1 
ATOM   2002 C  CB    . ALA A 1 252 ? -1.824  3.760   46.544  1.00 42.08  ? 294 ALA A CB    1 
ATOM   2003 N  N     . LEU A 1 253 ? 0.491   2.778   44.139  1.00 41.39  ? 295 LEU A N     1 
ATOM   2004 C  CA    . LEU A 1 253 ? 0.532   2.456   42.720  1.00 40.02  ? 295 LEU A CA    1 
ATOM   2005 C  C     . LEU A 1 253 ? 0.976   1.014   42.532  1.00 43.27  ? 295 LEU A C     1 
ATOM   2006 O  O     . LEU A 1 253 ? 2.094   0.637   42.910  1.00 44.77  ? 295 LEU A O     1 
ATOM   2007 C  CB    . LEU A 1 253 ? 1.468   3.424   41.991  1.00 40.46  ? 295 LEU A CB    1 
ATOM   2008 C  CG    . LEU A 1 253 ? 1.870   3.229   40.521  1.00 41.50  ? 295 LEU A CG    1 
ATOM   2009 C  CD1   . LEU A 1 253 ? 0.674   2.916   39.657  1.00 36.23  ? 295 LEU A CD1   1 
ATOM   2010 C  CD2   . LEU A 1 253 ? 2.525   4.482   40.010  1.00 35.71  ? 295 LEU A CD2   1 
ATOM   2011 N  N     . CYS A 1 254 ? 0.112   0.211   41.926  1.00 46.68  ? 296 CYS A N     1 
ATOM   2012 C  CA    . CYS A 1 254 ? 0.519   -1.143  41.561  1.00 47.48  ? 296 CYS A CA    1 
ATOM   2013 C  C     . CYS A 1 254 ? 1.050   -1.215  40.130  1.00 44.72  ? 296 CYS A C     1 
ATOM   2014 O  O     . CYS A 1 254 ? 2.123   -1.781  39.900  1.00 42.91  ? 296 CYS A O     1 
ATOM   2015 C  CB    . CYS A 1 254 ? -0.648  -2.116  41.743  1.00 45.39  ? 296 CYS A CB    1 
ATOM   2016 S  SG    . CYS A 1 254 ? -1.506  -1.977  43.328  1.00 46.84  ? 296 CYS A SG    1 
ATOM   2017 N  N     . ASP A 1 255 ? 0.321   -0.657  39.161  1.00 40.75  ? 297 ASP A N     1 
ATOM   2018 C  CA    . ASP A 1 255 ? 0.809   -0.691  37.787  1.00 41.38  ? 297 ASP A CA    1 
ATOM   2019 C  C     . ASP A 1 255 ? 0.090   0.342   36.924  1.00 38.76  ? 297 ASP A C     1 
ATOM   2020 O  O     . ASP A 1 255 ? -1.037  0.755   37.210  1.00 41.87  ? 297 ASP A O     1 
ATOM   2021 C  CB    . ASP A 1 255 ? 0.646   -2.083  37.182  1.00 40.29  ? 297 ASP A CB    1 
ATOM   2022 C  CG    . ASP A 1 255 ? 1.771   -2.441  36.244  1.00 40.07  ? 297 ASP A CG    1 
ATOM   2023 O  OD1   . ASP A 1 255 ? 2.448   -1.515  35.756  1.00 36.16  ? 297 ASP A OD1   1 
ATOM   2024 O  OD2   . ASP A 1 255 ? 1.959   -3.659  35.991  1.00 40.23  ? 297 ASP A OD2   1 
ATOM   2025 N  N     . SER A 1 256 ? 0.764   0.735   35.848  1.00 35.29  ? 298 SER A N     1 
ATOM   2026 C  CA    . SER A 1 256 ? 0.207   1.620   34.834  1.00 37.85  ? 298 SER A CA    1 
ATOM   2027 C  C     . SER A 1 256 ? 0.413   0.964   33.476  1.00 38.67  ? 298 SER A C     1 
ATOM   2028 O  O     . SER A 1 256 ? 1.559   0.747   33.063  1.00 39.18  ? 298 SER A O     1 
ATOM   2029 C  CB    . SER A 1 256 ? 0.877   2.988   34.897  1.00 37.86  ? 298 SER A CB    1 
ATOM   2030 O  OG    . SER A 1 256 ? 0.253   3.874   34.010  1.00 35.90  ? 298 SER A OG    1 
ATOM   2031 N  N     . LYS A 1 257 ? -0.687  0.620   32.795  1.00 36.16  ? 299 LYS A N     1 
ATOM   2032 C  CA    . LYS A 1 257 ? -0.634  -0.256  31.630  1.00 33.13  ? 299 LYS A CA    1 
ATOM   2033 C  C     . LYS A 1 257 ? -0.925  0.495   30.339  1.00 38.39  ? 299 LYS A C     1 
ATOM   2034 O  O     . LYS A 1 257 ? -1.644  1.499   30.325  1.00 40.49  ? 299 LYS A O     1 
ATOM   2035 C  CB    . LYS A 1 257 ? -1.634  -1.413  31.735  1.00 36.14  ? 299 LYS A CB    1 
ATOM   2036 C  CG    . LYS A 1 257 ? -1.575  -2.232  33.035  1.00 40.23  ? 299 LYS A CG    1 
ATOM   2037 C  CD    . LYS A 1 257 ? -0.147  -2.530  33.484  1.00 38.49  ? 299 LYS A CD    1 
ATOM   2038 C  CE    . LYS A 1 257 ? 0.502   -3.635  32.684  1.00 34.42  ? 299 LYS A CE    1 
ATOM   2039 N  NZ    . LYS A 1 257 ? 1.965   -3.655  32.979  1.00 39.27  ? 299 LYS A NZ    1 
ATOM   2040 N  N     . ILE A 1 258 ? -0.362  -0.030  29.249  1.00 36.24  ? 300 ILE A N     1 
ATOM   2041 C  CA    . ILE A 1 258 ? -0.628  0.420   27.894  1.00 34.35  ? 300 ILE A CA    1 
ATOM   2042 C  C     . ILE A 1 258 ? -1.199  -0.786  27.147  1.00 40.46  ? 300 ILE A C     1 
ATOM   2043 O  O     . ILE A 1 258 ? -0.467  -1.741  26.849  1.00 34.36  ? 300 ILE A O     1 
ATOM   2044 C  CB    . ILE A 1 258 ? 0.632   0.955   27.199  1.00 38.20  ? 300 ILE A CB    1 
ATOM   2045 C  CG1   . ILE A 1 258 ? 1.219   2.159   27.931  1.00 35.81  ? 300 ILE A CG1   1 
ATOM   2046 C  CG2   . ILE A 1 258 ? 0.336   1.333   25.730  1.00 29.98  ? 300 ILE A CG2   1 
ATOM   2047 C  CD1   . ILE A 1 258 ? 2.553   2.620   27.318  1.00 29.88  ? 300 ILE A CD1   1 
ATOM   2048 N  N     . ARG A 1 259 ? -2.503  -0.737  26.839  1.00 34.99  ? 301 ARG A N     1 
ATOM   2049 C  CA    . ARG A 1 259 ? -3.223  -1.834  26.180  1.00 36.08  ? 301 ARG A CA    1 
ATOM   2050 C  C     . ARG A 1 259 ? -3.065  -1.747  24.659  1.00 38.50  ? 301 ARG A C     1 
ATOM   2051 O  O     . ARG A 1 259 ? -4.002  -1.426  23.911  1.00 40.05  ? 301 ARG A O     1 
ATOM   2052 C  CB    . ARG A 1 259 ? -4.687  -1.802  26.590  1.00 34.09  ? 301 ARG A CB    1 
ATOM   2053 C  CG    . ARG A 1 259 ? -4.865  -1.787  28.118  1.00 38.51  ? 301 ARG A CG    1 
ATOM   2054 C  CD    . ARG A 1 259 ? -4.157  -2.971  28.773  1.00 33.77  ? 301 ARG A CD    1 
ATOM   2055 N  NE    . ARG A 1 259 ? -4.808  -3.318  30.033  1.00 35.60  ? 301 ARG A NE    1 
ATOM   2056 C  CZ    . ARG A 1 259 ? -4.266  -4.061  30.999  1.00 35.42  ? 301 ARG A CZ    1 
ATOM   2057 N  NH1   . ARG A 1 259 ? -3.035  -4.553  30.882  1.00 31.85  ? 301 ARG A NH1   1 
ATOM   2058 N  NH2   . ARG A 1 259 ? -4.956  -4.300  32.097  1.00 34.37  ? 301 ARG A NH2   1 
ATOM   2059 N  N     . SER A 1 260 ? -1.847  -2.093  24.214  1.00 33.82  ? 302 SER A N     1 
ATOM   2060 C  CA    . SER A 1 260 ? -1.430  -1.879  22.831  1.00 38.42  ? 302 SER A CA    1 
ATOM   2061 C  C     . SER A 1 260 ? -2.271  -2.666  21.834  1.00 41.75  ? 302 SER A C     1 
ATOM   2062 O  O     . SER A 1 260 ? -2.408  -2.250  20.675  1.00 39.62  ? 302 SER A O     1 
ATOM   2063 C  CB    . SER A 1 260 ? 0.043   -2.266  22.661  1.00 41.08  ? 302 SER A CB    1 
ATOM   2064 O  OG    . SER A 1 260 ? 0.887   -1.535  23.554  1.00 39.77  ? 302 SER A OG    1 
ATOM   2065 N  N     . LYS A 1 261 ? -2.805  -3.822  22.233  1.00 41.59  ? 303 LYS A N     1 
ATOM   2066 C  CA    . LYS A 1 261 ? -3.459  -4.666  21.236  1.00 45.77  ? 303 LYS A CA    1 
ATOM   2067 C  C     . LYS A 1 261 ? -4.905  -4.263  20.963  1.00 45.33  ? 303 LYS A C     1 
ATOM   2068 O  O     . LYS A 1 261 ? -5.449  -4.661  19.927  1.00 50.17  ? 303 LYS A O     1 
ATOM   2069 C  CB    . LYS A 1 261 ? -3.379  -6.141  21.658  1.00 46.03  ? 303 LYS A CB    1 
ATOM   2070 C  CG    . LYS A 1 261 ? -1.942  -6.637  21.743  1.00 46.23  ? 303 LYS A CG    1 
ATOM   2071 C  CD    . LYS A 1 261 ? -1.805  -8.137  21.595  1.00 55.56  ? 303 LYS A CD    1 
ATOM   2072 C  CE    . LYS A 1 261 ? -1.955  -8.866  22.931  1.00 69.28  ? 303 LYS A CE    1 
ATOM   2073 N  NZ    . LYS A 1 261 ? -1.467  -10.290 22.860  1.00 70.05  ? 303 LYS A NZ    1 
ATOM   2074 N  N     . ALA A 1 262 ? -5.526  -3.468  21.839  1.00 43.51  ? 304 ALA A N     1 
ATOM   2075 C  CA    . ALA A 1 262 ? -6.955  -3.174  21.742  1.00 43.29  ? 304 ALA A CA    1 
ATOM   2076 C  C     . ALA A 1 262 ? -7.209  -2.156  20.634  1.00 41.19  ? 304 ALA A C     1 
ATOM   2077 O  O     . ALA A 1 262 ? -6.753  -1.010  20.717  1.00 41.97  ? 304 ALA A O     1 
ATOM   2078 C  CB    . ALA A 1 262 ? -7.486  -2.666  23.080  1.00 35.51  ? 304 ALA A CB    1 
ATOM   2079 N  N     . LEU A 1 263 ? -7.937  -2.579  19.598  1.00 38.53  ? 305 LEU A N     1 
ATOM   2080 C  CA    . LEU A 1 263 ? -8.237  -1.760  18.431  1.00 41.99  ? 305 LEU A CA    1 
ATOM   2081 C  C     . LEU A 1 263 ? -9.539  -0.972  18.641  1.00 39.08  ? 305 LEU A C     1 
ATOM   2082 O  O     . LEU A 1 263 ? -10.128 -0.966  19.727  1.00 34.64  ? 305 LEU A O     1 
ATOM   2083 C  CB    . LEU A 1 263 ? -8.296  -2.641  17.174  1.00 41.95  ? 305 LEU A CB    1 
ATOM   2084 C  CG    . LEU A 1 263 ? -7.036  -3.486  16.921  1.00 42.20  ? 305 LEU A CG    1 
ATOM   2085 C  CD1   . LEU A 1 263 ? -7.074  -4.249  15.617  1.00 36.79  ? 305 LEU A CD1   1 
ATOM   2086 C  CD2   . LEU A 1 263 ? -5.800  -2.611  16.976  1.00 41.74  ? 305 LEU A CD2   1 
ATOM   2087 N  N     . GLY A 1 264 ? -9.979  -0.261  17.600  1.00 34.03  ? 306 GLY A N     1 
ATOM   2088 C  CA    . GLY A 1 264 ? -11.154 0.582   17.670  1.00 32.61  ? 306 GLY A CA    1 
ATOM   2089 C  C     . GLY A 1 264 ? -10.886 2.062   17.515  1.00 36.18  ? 306 GLY A C     1 
ATOM   2090 O  O     . GLY A 1 264 ? -11.842 2.848   17.390  1.00 32.65  ? 306 GLY A O     1 
ATOM   2091 N  N     . SER A 1 265 ? -9.629  2.480   17.517  1.00 37.58  ? 307 SER A N     1 
ATOM   2092 C  CA    . SER A 1 265 ? -9.324  3.906   17.560  1.00 36.48  ? 307 SER A CA    1 
ATOM   2093 C  C     . SER A 1 265 ? -7.877  4.068   17.130  1.00 34.85  ? 307 SER A C     1 
ATOM   2094 O  O     . SER A 1 265 ? -7.135  3.091   17.054  1.00 37.81  ? 307 SER A O     1 
ATOM   2095 C  CB    . SER A 1 265 ? -9.587  4.470   18.973  1.00 34.13  ? 307 SER A CB    1 
ATOM   2096 O  OG    . SER A 1 265 ? -9.286  5.845   19.069  1.00 35.56  ? 307 SER A OG    1 
ATOM   2097 N  N     . ASP A 1 266 ? -7.482  5.304   16.827  1.00 30.18  ? 308 ASP A N     1 
ATOM   2098 C  CA    . ASP A 1 266 ? -6.068  5.562   16.628  1.00 34.54  ? 308 ASP A CA    1 
ATOM   2099 C  C     . ASP A 1 266 ? -5.329  5.776   17.953  1.00 39.66  ? 308 ASP A C     1 
ATOM   2100 O  O     . ASP A 1 266 ? -4.101  5.927   17.944  1.00 36.11  ? 308 ASP A O     1 
ATOM   2101 C  CB    . ASP A 1 266 ? -5.850  6.733   15.649  1.00 35.16  ? 308 ASP A CB    1 
ATOM   2102 C  CG    . ASP A 1 266 ? -6.540  7.995   16.075  1.00 37.83  ? 308 ASP A CG    1 
ATOM   2103 O  OD1   . ASP A 1 266 ? -7.287  7.963   17.065  1.00 44.45  ? 308 ASP A OD1   1 
ATOM   2104 O  OD2   . ASP A 1 266 ? -6.331  9.037   15.426  1.00 38.84  ? 308 ASP A OD2   1 
ATOM   2105 N  N     . HIS A 1 267 ? -6.033  5.745   19.083  1.00 36.51  ? 309 HIS A N     1 
ATOM   2106 C  CA    . HIS A 1 267 ? -5.426  5.569   20.396  1.00 35.69  ? 309 HIS A CA    1 
ATOM   2107 C  C     . HIS A 1 267 ? -5.781  4.189   20.919  1.00 38.22  ? 309 HIS A C     1 
ATOM   2108 O  O     . HIS A 1 267 ? -6.838  3.642   20.576  1.00 40.61  ? 309 HIS A O     1 
ATOM   2109 C  CB    . HIS A 1 267 ? -5.922  6.596   21.423  1.00 32.16  ? 309 HIS A CB    1 
ATOM   2110 C  CG    . HIS A 1 267 ? -5.691  8.013   21.031  1.00 35.19  ? 309 HIS A CG    1 
ATOM   2111 N  ND1   . HIS A 1 267 ? -4.786  8.826   21.680  1.00 32.25  ? 309 HIS A ND1   1 
ATOM   2112 C  CD2   . HIS A 1 267 ? -6.264  8.774   20.065  1.00 38.00  ? 309 HIS A CD2   1 
ATOM   2113 C  CE1   . HIS A 1 267 ? -4.810  10.025  21.127  1.00 38.59  ? 309 HIS A CE1   1 
ATOM   2114 N  NE2   . HIS A 1 267 ? -5.697  10.019  20.141  1.00 42.96  ? 309 HIS A NE2   1 
ATOM   2115 N  N     . CYS A 1 268 ? -4.915  3.644   21.765  1.00 34.72  ? 310 CYS A N     1 
ATOM   2116 C  CA    . CYS A 1 268 ? -5.221  2.455   22.549  1.00 39.69  ? 310 CYS A CA    1 
ATOM   2117 C  C     . CYS A 1 268 ? -5.638  2.858   23.952  1.00 38.71  ? 310 CYS A C     1 
ATOM   2118 O  O     . CYS A 1 268 ? -5.461  4.010   24.352  1.00 34.92  ? 310 CYS A O     1 
ATOM   2119 C  CB    . CYS A 1 268 ? -4.006  1.518   22.594  1.00 40.54  ? 310 CYS A CB    1 
ATOM   2120 S  SG    . CYS A 1 268 ? -2.503  2.111   23.474  1.00 35.99  ? 310 CYS A SG    1 
ATOM   2121 N  N     . PRO A 1 269 ? -6.223  1.945   24.730  1.00 38.04  ? 311 PRO A N     1 
ATOM   2122 C  CA    . PRO A 1 269 ? -6.497  2.253   26.142  1.00 37.86  ? 311 PRO A CA    1 
ATOM   2123 C  C     . PRO A 1 269 ? -5.235  2.216   27.005  1.00 36.86  ? 311 PRO A C     1 
ATOM   2124 O  O     . PRO A 1 269 ? -4.275  1.513   26.708  1.00 33.58  ? 311 PRO A O     1 
ATOM   2125 C  CB    . PRO A 1 269 ? -7.477  1.150   26.578  1.00 36.19  ? 311 PRO A CB    1 
ATOM   2126 C  CG    . PRO A 1 269 ? -7.802  0.337   25.364  1.00 36.73  ? 311 PRO A CG    1 
ATOM   2127 C  CD    . PRO A 1 269 ? -6.735  0.620   24.342  1.00 38.07  ? 311 PRO A CD    1 
ATOM   2128 N  N     . ILE A 1 270 ? -5.259  3.002   28.085  1.00 34.63  ? 312 ILE A N     1 
ATOM   2129 C  CA    . ILE A 1 270 ? -4.354  2.859   29.218  1.00 38.56  ? 312 ILE A CA    1 
ATOM   2130 C  C     . ILE A 1 270 ? -5.166  2.497   30.464  1.00 38.84  ? 312 ILE A C     1 
ATOM   2131 O  O     . ILE A 1 270 ? -6.320  2.919   30.626  1.00 43.34  ? 312 ILE A O     1 
ATOM   2132 C  CB    . ILE A 1 270 ? -3.531  4.147   29.451  1.00 38.28  ? 312 ILE A CB    1 
ATOM   2133 C  CG1   . ILE A 1 270 ? -4.440  5.369   29.555  1.00 36.55  ? 312 ILE A CG1   1 
ATOM   2134 C  CG2   . ILE A 1 270 ? -2.519  4.358   28.339  1.00 31.78  ? 312 ILE A CG2   1 
ATOM   2135 C  CD1   . ILE A 1 270 ? -3.704  6.623   30.104  1.00 34.30  ? 312 ILE A CD1   1 
ATOM   2136 N  N     . THR A 1 271 ? -4.580  1.688   31.347  1.00 37.57  ? 313 THR A N     1 
ATOM   2137 C  CA    . THR A 1 271 ? -5.283  1.406   32.593  1.00 35.61  ? 313 THR A CA    1 
ATOM   2138 C  C     . THR A 1 271 ? -4.340  1.476   33.788  1.00 41.60  ? 313 THR A C     1 
ATOM   2139 O  O     . THR A 1 271 ? -3.176  1.063   33.715  1.00 37.63  ? 313 THR A O     1 
ATOM   2140 C  CB    . THR A 1 271 ? -6.014  0.047   32.591  1.00 39.95  ? 313 THR A CB    1 
ATOM   2141 O  OG1   . THR A 1 271 ? -5.142  -0.970  33.073  1.00 48.43  ? 313 THR A OG1   1 
ATOM   2142 C  CG2   . THR A 1 271 ? -6.528  -0.339  31.190  1.00 32.91  ? 313 THR A CG2   1 
ATOM   2143 N  N     . LEU A 1 272 ? -4.881  1.995   34.889  1.00 37.80  ? 314 LEU A N     1 
ATOM   2144 C  CA    . LEU A 1 272 ? -4.177  2.236   36.133  1.00 36.51  ? 314 LEU A CA    1 
ATOM   2145 C  C     . LEU A 1 272 ? -4.714  1.288   37.200  1.00 42.20  ? 314 LEU A C     1 
ATOM   2146 O  O     . LEU A 1 272 ? -5.926  1.070   37.282  1.00 44.51  ? 314 LEU A O     1 
ATOM   2147 C  CB    . LEU A 1 272 ? -4.367  3.697   36.558  1.00 33.87  ? 314 LEU A CB    1 
ATOM   2148 C  CG    . LEU A 1 272 ? -3.630  4.219   37.790  1.00 35.21  ? 314 LEU A CG    1 
ATOM   2149 C  CD1   . LEU A 1 272 ? -2.124  4.237   37.534  1.00 31.90  ? 314 LEU A CD1   1 
ATOM   2150 C  CD2   . LEU A 1 272 ? -4.124  5.608   38.122  1.00 30.91  ? 314 LEU A CD2   1 
ATOM   2151 N  N     . TYR A 1 273 ? -3.817  0.683   37.981  1.00 41.59  ? 315 TYR A N     1 
ATOM   2152 C  CA    . TYR A 1 273 ? -4.187  -0.075  39.175  1.00 40.10  ? 315 TYR A CA    1 
ATOM   2153 C  C     . TYR A 1 273 ? -3.681  0.660   40.409  1.00 44.93  ? 315 TYR A C     1 
ATOM   2154 O  O     . TYR A 1 273 ? -2.502  1.044   40.472  1.00 40.35  ? 315 TYR A O     1 
ATOM   2155 C  CB    . TYR A 1 273 ? -3.583  -1.482  39.191  1.00 40.64  ? 315 TYR A CB    1 
ATOM   2156 C  CG    . TYR A 1 273 ? -4.110  -2.490  38.205  1.00 45.55  ? 315 TYR A CG    1 
ATOM   2157 C  CD1   . TYR A 1 273 ? -5.273  -3.222  38.466  1.00 46.65  ? 315 TYR A CD1   1 
ATOM   2158 C  CD2   . TYR A 1 273 ? -3.404  -2.771  37.040  1.00 45.40  ? 315 TYR A CD2   1 
ATOM   2159 C  CE1   . TYR A 1 273 ? -5.734  -4.178  37.572  1.00 43.96  ? 315 TYR A CE1   1 
ATOM   2160 C  CE2   . TYR A 1 273 ? -3.850  -3.711  36.144  1.00 44.38  ? 315 TYR A CE2   1 
ATOM   2161 C  CZ    . TYR A 1 273 ? -5.013  -4.412  36.407  1.00 48.52  ? 315 TYR A CZ    1 
ATOM   2162 O  OH    . TYR A 1 273 ? -5.427  -5.356  35.492  1.00 47.90  ? 315 TYR A OH    1 
ATOM   2163 N  N     . LEU A 1 274 ? -4.554  0.812   41.403  1.00 43.53  ? 316 LEU A N     1 
ATOM   2164 C  CA    . LEU A 1 274 ? -4.185  1.417   42.668  1.00 44.45  ? 316 LEU A CA    1 
ATOM   2165 C  C     . LEU A 1 274 ? -4.685  0.552   43.817  1.00 50.73  ? 316 LEU A C     1 
ATOM   2166 O  O     . LEU A 1 274 ? -5.789  -0.002  43.756  1.00 52.12  ? 316 LEU A O     1 
ATOM   2167 C  CB    . LEU A 1 274 ? -4.752  2.819   42.801  1.00 40.64  ? 316 LEU A CB    1 
ATOM   2168 C  CG    . LEU A 1 274 ? -4.311  3.877   41.816  1.00 36.76  ? 316 LEU A CG    1 
ATOM   2169 C  CD1   . LEU A 1 274 ? -5.045  5.130   42.183  1.00 34.23  ? 316 LEU A CD1   1 
ATOM   2170 C  CD2   . LEU A 1 274 ? -2.813  4.082   41.886  1.00 36.77  ? 316 LEU A CD2   1 
ATOM   2171 N  N     . ALA A 1 275 ? -3.863  0.448   44.865  1.00 48.03  ? 317 ALA A N     1 
ATOM   2172 C  CA    . ALA A 1 275 ? -4.269  -0.179  46.119  1.00 49.40  ? 317 ALA A CA    1 
ATOM   2173 C  C     . ALA A 1 275 ? -4.809  0.910   47.046  1.00 50.16  ? 317 ALA A C     1 
ATOM   2174 O  O     . ALA A 1 275 ? -4.054  1.577   47.751  1.00 47.96  ? 317 ALA A O     1 
ATOM   2175 C  CB    . ALA A 1 275 ? -3.097  -0.932  46.736  1.00 50.49  ? 317 ALA A CB    1 
ATOM   2176 N  N     . LEU A 1 276 ? -6.128  1.115   47.032  1.00 49.77  ? 318 LEU A N     1 
ATOM   2177 C  CA    . LEU A 1 276 ? -6.768  1.993   48.030  1.00 58.11  ? 318 LEU A CA    1 
ATOM   2178 C  C     . LEU A 1 276 ? -7.759  1.266   48.960  1.00 64.76  ? 318 LEU A C     1 
ATOM   2179 O  O     . LEU A 1 276 ? -8.179  0.124   48.720  1.00 59.77  ? 318 LEU A O     1 
ATOM   2180 C  CB    . LEU A 1 276 ? -7.492  3.164   47.364  1.00 45.06  ? 318 LEU A CB    1 
ATOM   2181 C  CG    . LEU A 1 276 ? -6.586  4.208   46.730  1.00 50.68  ? 318 LEU A CG    1 
ATOM   2182 C  CD1   . LEU A 1 276 ? -6.646  4.029   45.250  1.00 45.81  ? 318 LEU A CD1   1 
ATOM   2183 C  CD2   . LEU A 1 276 ? -6.990  5.622   47.116  1.00 52.88  ? 318 LEU A CD2   1 
ATOM   2184 O  OXT   . LEU A 1 276 ? -8.159  1.825   49.995  1.00 64.93  ? 318 LEU A OXT   1 
ATOM   2185 N  N     . TYR B 1 3   ? 1.515   1.610   65.092  1.00 58.32  ? 45  TYR B N     1 
ATOM   2186 C  CA    . TYR B 1 3   ? 1.867   2.129   63.770  1.00 54.71  ? 45  TYR B CA    1 
ATOM   2187 C  C     . TYR B 1 3   ? 2.922   1.258   63.111  1.00 46.42  ? 45  TYR B C     1 
ATOM   2188 O  O     . TYR B 1 3   ? 3.737   0.638   63.790  1.00 55.97  ? 45  TYR B O     1 
ATOM   2189 C  CB    . TYR B 1 3   ? 2.352   3.579   63.868  1.00 52.46  ? 45  TYR B CB    1 
ATOM   2190 C  CG    . TYR B 1 3   ? 2.997   4.130   62.615  1.00 50.44  ? 45  TYR B CG    1 
ATOM   2191 C  CD1   . TYR B 1 3   ? 2.223   4.509   61.516  1.00 45.98  ? 45  TYR B CD1   1 
ATOM   2192 C  CD2   . TYR B 1 3   ? 4.386   4.294   62.533  1.00 44.14  ? 45  TYR B CD2   1 
ATOM   2193 C  CE1   . TYR B 1 3   ? 2.816   5.022   60.354  1.00 42.98  ? 45  TYR B CE1   1 
ATOM   2194 C  CE2   . TYR B 1 3   ? 4.986   4.813   61.378  1.00 45.36  ? 45  TYR B CE2   1 
ATOM   2195 C  CZ    . TYR B 1 3   ? 4.190   5.176   60.293  1.00 45.82  ? 45  TYR B CZ    1 
ATOM   2196 O  OH    . TYR B 1 3   ? 4.770   5.698   59.160  1.00 44.02  ? 45  TYR B OH    1 
ATOM   2197 N  N     . GLU B 1 4   ? 2.880   1.214   61.776  1.00 56.62  ? 46  GLU B N     1 
ATOM   2198 C  CA    . GLU B 1 4   ? 3.785   0.423   60.944  1.00 55.54  ? 46  GLU B CA    1 
ATOM   2199 C  C     . GLU B 1 4   ? 4.271   1.287   59.788  1.00 53.02  ? 46  GLU B C     1 
ATOM   2200 O  O     . GLU B 1 4   ? 3.508   1.576   58.861  1.00 50.34  ? 46  GLU B O     1 
ATOM   2201 C  CB    . GLU B 1 4   ? 3.099   -0.830  60.401  1.00 61.17  ? 46  GLU B CB    1 
ATOM   2202 C  CG    . GLU B 1 4   ? 2.783   -1.899  61.431  1.00 69.07  ? 46  GLU B CG    1 
ATOM   2203 C  CD    . GLU B 1 4   ? 2.019   -3.069  60.822  1.00 84.05  ? 46  GLU B CD    1 
ATOM   2204 O  OE1   . GLU B 1 4   ? 2.085   -3.248  59.581  1.00 82.23  ? 46  GLU B OE1   1 
ATOM   2205 O  OE2   . GLU B 1 4   ? 1.346   -3.803  61.581  1.00 85.88  ? 46  GLU B OE2   1 
ATOM   2206 N  N     . ASP B 1 5   ? 5.531   1.690   59.846  1.00 49.54  ? 47  ASP B N     1 
ATOM   2207 C  CA    . ASP B 1 5   ? 6.159   2.386   58.733  1.00 49.11  ? 47  ASP B CA    1 
ATOM   2208 C  C     . ASP B 1 5   ? 6.119   1.479   57.504  1.00 47.40  ? 47  ASP B C     1 
ATOM   2209 O  O     . ASP B 1 5   ? 6.506   0.308   57.591  1.00 51.10  ? 47  ASP B O     1 
ATOM   2210 C  CB    . ASP B 1 5   ? 7.610   2.751   59.104  1.00 46.06  ? 47  ASP B CB    1 
ATOM   2211 C  CG    . ASP B 1 5   ? 8.089   4.059   58.483  1.00 44.32  ? 47  ASP B CG    1 
ATOM   2212 O  OD1   . ASP B 1 5   ? 7.324   5.031   58.440  1.00 44.91  ? 47  ASP B OD1   1 
ATOM   2213 O  OD2   . ASP B 1 5   ? 9.255   4.121   58.050  1.00 47.50  ? 47  ASP B OD2   1 
ATOM   2214 N  N     . PRO B 1 6   ? 5.641   1.957   56.363  1.00 49.33  ? 48  PRO B N     1 
ATOM   2215 C  CA    . PRO B 1 6   ? 5.646   1.126   55.156  1.00 49.10  ? 48  PRO B CA    1 
ATOM   2216 C  C     . PRO B 1 6   ? 7.064   0.926   54.656  1.00 52.17  ? 48  PRO B C     1 
ATOM   2217 O  O     . PRO B 1 6   ? 7.958   1.711   55.006  1.00 50.90  ? 48  PRO B O     1 
ATOM   2218 C  CB    . PRO B 1 6   ? 4.812   1.946   54.163  1.00 46.65  ? 48  PRO B CB    1 
ATOM   2219 C  CG    . PRO B 1 6   ? 5.036   3.353   54.590  1.00 48.70  ? 48  PRO B CG    1 
ATOM   2220 C  CD    . PRO B 1 6   ? 5.096   3.300   56.106  1.00 49.28  ? 48  PRO B CD    1 
ATOM   2221 N  N     . PRO B 1 7   ? 7.311   -0.095  53.820  1.00 54.42  ? 49  PRO B N     1 
ATOM   2222 C  CA    . PRO B 1 7   ? 8.685   -0.358  53.344  1.00 42.00  ? 49  PRO B CA    1 
ATOM   2223 C  C     . PRO B 1 7   ? 9.326   0.856   52.679  1.00 45.74  ? 49  PRO B C     1 
ATOM   2224 O  O     . PRO B 1 7   ? 8.654   1.847   52.390  1.00 46.89  ? 49  PRO B O     1 
ATOM   2225 C  CB    . PRO B 1 7   ? 8.501   -1.505  52.339  1.00 53.62  ? 49  PRO B CB    1 
ATOM   2226 C  CG    . PRO B 1 7   ? 7.111   -2.076  52.611  1.00 45.42  ? 49  PRO B CG    1 
ATOM   2227 C  CD    . PRO B 1 7   ? 6.304   -0.979  53.202  1.00 43.48  ? 49  PRO B CD    1 
ATOM   2228 N  N     . ASP B 1 8   ? 10.634  0.776   52.424  1.00 47.56  ? 50  ASP B N     1 
ATOM   2229 C  CA    . ASP B 1 8   ? 11.393  1.911   51.912  1.00 44.74  ? 50  ASP B CA    1 
ATOM   2230 C  C     . ASP B 1 8   ? 11.192  2.048   50.397  1.00 49.30  ? 50  ASP B C     1 
ATOM   2231 O  O     . ASP B 1 8   ? 11.594  1.159   49.632  1.00 52.25  ? 50  ASP B O     1 
ATOM   2232 C  CB    . ASP B 1 8   ? 12.883  1.746   52.242  1.00 37.57  ? 50  ASP B CB    1 
ATOM   2233 C  CG    . ASP B 1 8   ? 13.197  1.821   53.753  1.00 46.64  ? 50  ASP B CG    1 
ATOM   2234 O  OD1   . ASP B 1 8   ? 12.288  2.097   54.556  1.00 43.68  ? 50  ASP B OD1   1 
ATOM   2235 O  OD2   . ASP B 1 8   ? 14.373  1.594   54.141  1.00 46.44  ? 50  ASP B OD2   1 
ATOM   2236 N  N     . GLN B 1 9   ? 10.600  3.166   49.954  1.00 42.51  ? 51  GLN B N     1 
ATOM   2237 C  CA    . GLN B 1 9   ? 10.485  3.481   48.533  1.00 46.75  ? 51  GLN B CA    1 
ATOM   2238 C  C     . GLN B 1 9   ? 11.782  4.170   48.102  1.00 48.80  ? 51  GLN B C     1 
ATOM   2239 O  O     . GLN B 1 9   ? 12.077  5.285   48.542  1.00 47.78  ? 51  GLN B O     1 
ATOM   2240 C  CB    . GLN B 1 9   ? 9.239   4.348   48.284  1.00 51.11  ? 51  GLN B CB    1 
ATOM   2241 C  CG    . GLN B 1 9   ? 9.284   5.309   47.058  1.00 58.94  ? 51  GLN B CG    1 
ATOM   2242 C  CD    . GLN B 1 9   ? 7.895   5.766   46.515  1.00 70.25  ? 51  GLN B CD    1 
ATOM   2243 O  OE1   . GLN B 1 9   ? 7.161   4.977   45.861  1.00 62.76  ? 51  GLN B OE1   1 
ATOM   2244 N  NE2   . GLN B 1 9   ? 7.559   7.054   46.738  1.00 51.67  ? 51  GLN B NE2   1 
ATOM   2245 N  N     . LYS B 1 10  ? 12.575  3.499   47.252  1.00 44.66  ? 52  LYS B N     1 
ATOM   2246 C  CA    . LYS B 1 10  ? 13.863  4.044   46.854  1.00 43.85  ? 52  LYS B CA    1 
ATOM   2247 C  C     . LYS B 1 10  ? 13.870  4.586   45.426  1.00 50.44  ? 52  LYS B C     1 
ATOM   2248 O  O     . LYS B 1 10  ? 14.946  4.718   44.828  1.00 50.74  ? 52  LYS B O     1 
ATOM   2249 C  CB    . LYS B 1 10  ? 14.949  2.985   47.030  1.00 43.26  ? 52  LYS B CB    1 
ATOM   2250 C  CG    . LYS B 1 10  ? 14.930  2.324   48.406  1.00 47.49  ? 52  LYS B CG    1 
ATOM   2251 C  CD    . LYS B 1 10  ? 16.244  1.618   48.776  1.00 49.94  ? 52  LYS B CD    1 
ATOM   2252 C  CE    . LYS B 1 10  ? 15.947  0.413   49.692  1.00 60.26  ? 52  LYS B CE    1 
ATOM   2253 N  NZ    . LYS B 1 10  ? 17.168  -0.143  50.384  1.00 56.06  ? 52  LYS B NZ    1 
ATOM   2254 N  N     . THR B 1 11  ? 12.696  4.910   44.875  1.00 46.79  ? 53  THR B N     1 
ATOM   2255 C  CA    . THR B 1 11  ? 12.554  5.472   43.532  1.00 44.54  ? 53  THR B CA    1 
ATOM   2256 C  C     . THR B 1 11  ? 11.917  6.862   43.610  1.00 41.19  ? 53  THR B C     1 
ATOM   2257 O  O     . THR B 1 11  ? 10.929  7.053   44.324  1.00 45.18  ? 53  THR B O     1 
ATOM   2258 C  CB    . THR B 1 11  ? 11.705  4.527   42.644  1.00 49.88  ? 53  THR B CB    1 
ATOM   2259 O  OG1   . THR B 1 11  ? 12.474  3.370   42.273  1.00 44.17  ? 53  THR B OG1   1 
ATOM   2260 C  CG2   . THR B 1 11  ? 11.248  5.212   41.385  1.00 49.47  ? 53  THR B CG2   1 
ATOM   2261 N  N     . SER B 1 12  ? 12.473  7.829   42.872  1.00 40.00  ? 54  SER B N     1 
ATOM   2262 C  CA    . SER B 1 12  ? 11.965  9.197   42.890  1.00 39.46  ? 54  SER B CA    1 
ATOM   2263 C  C     . SER B 1 12  ? 10.635  9.265   42.124  1.00 45.20  ? 54  SER B C     1 
ATOM   2264 O  O     . SER B 1 12  ? 10.222  8.282   41.513  1.00 37.58  ? 54  SER B O     1 
ATOM   2265 C  CB    . SER B 1 12  ? 12.996  10.148  42.286  1.00 39.95  ? 54  SER B CB    1 
ATOM   2266 O  OG    . SER B 1 12  ? 12.766  10.353  40.896  1.00 49.02  ? 54  SER B OG    1 
ATOM   2267 N  N     . PRO B 1 13  ? 9.919   10.398  42.171  1.00 40.77  ? 55  PRO B N     1 
ATOM   2268 C  CA    . PRO B 1 13  ? 8.651   10.478  41.412  1.00 47.94  ? 55  PRO B CA    1 
ATOM   2269 C  C     . PRO B 1 13  ? 8.819   10.221  39.936  1.00 48.40  ? 55  PRO B C     1 
ATOM   2270 O  O     . PRO B 1 13  ? 7.875   9.744   39.297  1.00 49.68  ? 55  PRO B O     1 
ATOM   2271 C  CB    . PRO B 1 13  ? 8.164   11.908  41.688  1.00 47.51  ? 55  PRO B CB    1 
ATOM   2272 C  CG    . PRO B 1 13  ? 8.646   12.158  43.108  1.00 41.22  ? 55  PRO B CG    1 
ATOM   2273 C  CD    . PRO B 1 13  ? 10.001  11.462  43.190  1.00 43.13  ? 55  PRO B CD    1 
ATOM   2274 N  N     . SER B 1 14  ? 10.012  10.472  39.389  1.00 50.26  ? 56  SER B N     1 
ATOM   2275 C  CA    . SER B 1 14  ? 10.305  10.306  37.972  1.00 43.50  ? 56  SER B CA    1 
ATOM   2276 C  C     . SER B 1 14  ? 11.211  9.105   37.694  1.00 45.57  ? 56  SER B C     1 
ATOM   2277 O  O     . SER B 1 14  ? 11.969  9.118   36.724  1.00 50.81  ? 56  SER B O     1 
ATOM   2278 C  CB    . SER B 1 14  ? 10.942  11.579  37.417  1.00 47.58  ? 56  SER B CB    1 
ATOM   2279 O  OG    . SER B 1 14  ? 12.082  11.980  38.185  1.00 53.79  ? 56  SER B OG    1 
ATOM   2280 N  N     . GLY B 1 15  ? 11.156  8.067   38.526  1.00 38.63  ? 57  GLY B N     1 
ATOM   2281 C  CA    . GLY B 1 15  ? 11.891  6.845   38.256  1.00 40.40  ? 57  GLY B CA    1 
ATOM   2282 C  C     . GLY B 1 15  ? 13.374  6.816   38.615  1.00 46.47  ? 57  GLY B C     1 
ATOM   2283 O  O     . GLY B 1 15  ? 14.009  5.764   38.429  1.00 41.18  ? 57  GLY B O     1 
ATOM   2284 N  N     . LYS B 1 16  ? 13.950  7.913   39.146  1.00 43.88  ? 58  LYS B N     1 
ATOM   2285 C  CA    . LYS B 1 16  ? 15.396  7.957   39.411  1.00 43.47  ? 58  LYS B CA    1 
ATOM   2286 C  C     . LYS B 1 16  ? 15.714  7.227   40.707  1.00 42.69  ? 58  LYS B C     1 
ATOM   2287 O  O     . LYS B 1 16  ? 15.040  7.448   41.720  1.00 45.81  ? 58  LYS B O     1 
ATOM   2288 C  CB    . LYS B 1 16  ? 15.899  9.377   39.516  1.00 41.84  ? 58  LYS B CB    1 
ATOM   2289 C  CG    . LYS B 1 16  ? 15.284  10.315  38.519  1.00 48.48  ? 58  LYS B CG    1 
ATOM   2290 C  CD    . LYS B 1 16  ? 16.000  10.323  37.191  1.00 55.40  ? 58  LYS B CD    1 
ATOM   2291 C  CE    . LYS B 1 16  ? 15.420  11.426  36.273  1.00 67.41  ? 58  LYS B CE    1 
ATOM   2292 N  NZ    . LYS B 1 16  ? 15.455  12.802  36.879  1.00 61.46  ? 58  LYS B NZ    1 
ATOM   2293 N  N     . PRO B 1 17  ? 16.716  6.352   40.715  1.00 45.08  ? 59  PRO B N     1 
ATOM   2294 C  CA    . PRO B 1 17  ? 17.031  5.594   41.937  1.00 47.70  ? 59  PRO B CA    1 
ATOM   2295 C  C     . PRO B 1 17  ? 17.622  6.485   43.030  1.00 41.07  ? 59  PRO B C     1 
ATOM   2296 O  O     . PRO B 1 17  ? 18.287  7.482   42.751  1.00 37.69  ? 59  PRO B O     1 
ATOM   2297 C  CB    . PRO B 1 17  ? 18.052  4.555   41.455  1.00 43.07  ? 59  PRO B CB    1 
ATOM   2298 C  CG    . PRO B 1 17  ? 18.626  5.147   40.180  1.00 43.96  ? 59  PRO B CG    1 
ATOM   2299 C  CD    . PRO B 1 17  ? 17.496  5.900   39.550  1.00 43.28  ? 59  PRO B CD    1 
ATOM   2300 N  N     . ALA B 1 18  ? 17.348  6.132   44.287  1.00 38.97  ? 60  ALA B N     1 
ATOM   2301 C  CA    . ALA B 1 18  ? 17.922  6.889   45.404  1.00 46.60  ? 60  ALA B CA    1 
ATOM   2302 C  C     . ALA B 1 18  ? 19.448  6.799   45.390  1.00 41.67  ? 60  ALA B C     1 
ATOM   2303 O  O     . ALA B 1 18  ? 20.025  5.737   45.135  1.00 44.12  ? 60  ALA B O     1 
ATOM   2304 C  CB    . ALA B 1 18  ? 17.385  6.368   46.737  1.00 40.21  ? 60  ALA B CB    1 
ATOM   2305 N  N     . THR B 1 19  ? 20.112  7.922   45.652  1.00 41.07  ? 61  THR B N     1 
ATOM   2306 C  CA    . THR B 1 19  ? 21.563  7.930   45.768  1.00 39.66  ? 61  THR B CA    1 
ATOM   2307 C  C     . THR B 1 19  ? 22.075  8.337   47.143  1.00 46.52  ? 61  THR B C     1 
ATOM   2308 O  O     . THR B 1 19  ? 23.256  8.108   47.445  1.00 41.87  ? 61  THR B O     1 
ATOM   2309 C  CB    . THR B 1 19  ? 22.178  8.896   44.749  1.00 44.81  ? 61  THR B CB    1 
ATOM   2310 O  OG1   . THR B 1 19  ? 21.630  10.199  44.978  1.00 51.04  ? 61  THR B OG1   1 
ATOM   2311 C  CG2   . THR B 1 19  ? 21.888  8.458   43.318  1.00 47.07  ? 61  THR B CG2   1 
ATOM   2312 N  N     . LEU B 1 20  ? 21.248  8.962   47.966  1.00 43.59  ? 62  LEU B N     1 
ATOM   2313 C  CA    . LEU B 1 20  ? 21.728  9.588   49.190  1.00 41.88  ? 62  LEU B CA    1 
ATOM   2314 C  C     . LEU B 1 20  ? 20.760  9.265   50.313  1.00 38.78  ? 62  LEU B C     1 
ATOM   2315 O  O     . LEU B 1 20  ? 19.548  9.469   50.178  1.00 33.41  ? 62  LEU B O     1 
ATOM   2316 C  CB    . LEU B 1 20  ? 21.870  11.095  48.975  1.00 37.94  ? 62  LEU B CB    1 
ATOM   2317 C  CG    . LEU B 1 20  ? 22.649  12.013  49.894  1.00 42.57  ? 62  LEU B CG    1 
ATOM   2318 C  CD1   . LEU B 1 20  ? 21.679  12.533  50.865  1.00 43.71  ? 62  LEU B CD1   1 
ATOM   2319 C  CD2   . LEU B 1 20  ? 23.786  11.295  50.595  1.00 38.48  ? 62  LEU B CD2   1 
ATOM   2320 N  N     . LYS B 1 21  ? 21.299  8.746   51.411  1.00 39.07  ? 63  LYS B N     1 
ATOM   2321 C  CA    . LYS B 1 21  ? 20.518  8.310   52.562  1.00 37.22  ? 63  LYS B CA    1 
ATOM   2322 C  C     . LYS B 1 21  ? 20.964  9.102   53.783  1.00 42.93  ? 63  LYS B C     1 
ATOM   2323 O  O     . LYS B 1 21  ? 22.132  9.018   54.191  1.00 44.76  ? 63  LYS B O     1 
ATOM   2324 C  CB    . LYS B 1 21  ? 20.690  6.805   52.765  1.00 40.74  ? 63  LYS B CB    1 
ATOM   2325 C  CG    . LYS B 1 21  ? 19.734  6.155   53.743  1.00 47.39  ? 63  LYS B CG    1 
ATOM   2326 C  CD    . LYS B 1 21  ? 19.856  4.638   53.654  1.00 48.43  ? 63  LYS B CD    1 
ATOM   2327 C  CE    . LYS B 1 21  ? 19.169  3.922   54.803  1.00 44.11  ? 63  LYS B CE    1 
ATOM   2328 N  NZ    . LYS B 1 21  ? 19.205  2.438   54.572  1.00 41.36  ? 63  LYS B NZ    1 
ATOM   2329 N  N     . ILE B 1 22  ? 20.056  9.892   54.351  1.00 39.78  ? 64  ILE B N     1 
ATOM   2330 C  CA    . ILE B 1 22  ? 20.334  10.707  55.533  1.00 34.24  ? 64  ILE B CA    1 
ATOM   2331 C  C     . ILE B 1 22  ? 19.496  10.202  56.699  1.00 40.86  ? 64  ILE B C     1 
ATOM   2332 O  O     . ILE B 1 22  ? 18.260  10.084  56.602  1.00 40.20  ? 64  ILE B O     1 
ATOM   2333 C  CB    . ILE B 1 22  ? 20.034  12.187  55.288  1.00 33.31  ? 64  ILE B CB    1 
ATOM   2334 C  CG1   . ILE B 1 22  ? 20.818  12.707  54.099  1.00 35.84  ? 64  ILE B CG1   1 
ATOM   2335 C  CG2   . ILE B 1 22  ? 20.310  12.993  56.529  1.00 34.01  ? 64  ILE B CG2   1 
ATOM   2336 C  CD1   . ILE B 1 22  ? 20.495  14.149  53.770  1.00 32.10  ? 64  ILE B CD1   1 
ATOM   2337 N  N     . CYS B 1 23  ? 20.158  9.916   57.801  1.00 36.71  ? 65  CYS B N     1 
ATOM   2338 C  CA    . CYS B 1 23  ? 19.485  9.452   59.000  1.00 40.13  ? 65  CYS B CA    1 
ATOM   2339 C  C     . CYS B 1 23  ? 19.690  10.492  60.095  1.00 39.45  ? 65  CYS B C     1 
ATOM   2340 O  O     . CYS B 1 23  ? 20.783  11.051  60.241  1.00 40.08  ? 65  CYS B O     1 
ATOM   2341 C  CB    . CYS B 1 23  ? 20.004  8.070   59.422  1.00 34.25  ? 65  CYS B CB    1 
ATOM   2342 S  SG    . CYS B 1 23  ? 19.411  7.551   61.036  1.00 48.32  ? 65  CYS B SG    1 
ATOM   2343 N  N     . SER B 1 24  ? 18.626  10.795  60.825  1.00 39.88  ? 66  SER B N     1 
ATOM   2344 C  CA    . SER B 1 24  ? 18.685  11.796  61.878  1.00 38.29  ? 66  SER B CA    1 
ATOM   2345 C  C     . SER B 1 24  ? 18.075  11.197  63.132  1.00 36.26  ? 66  SER B C     1 
ATOM   2346 O  O     . SER B 1 24  ? 17.141  10.393  63.041  1.00 36.43  ? 66  SER B O     1 
ATOM   2347 C  CB    . SER B 1 24  ? 17.964  13.069  61.457  1.00 39.11  ? 66  SER B CB    1 
ATOM   2348 O  OG    . SER B 1 24  ? 17.914  13.990  62.522  1.00 39.20  ? 66  SER B OG    1 
ATOM   2349 N  N     . TRP B 1 25  ? 18.621  11.566  64.292  1.00 30.72  ? 67  TRP B N     1 
ATOM   2350 C  CA    . TRP B 1 25  ? 18.279  10.895  65.551  1.00 35.68  ? 67  TRP B CA    1 
ATOM   2351 C  C     . TRP B 1 25  ? 18.660  11.773  66.737  1.00 37.04  ? 67  TRP B C     1 
ATOM   2352 O  O     . TRP B 1 25  ? 19.851  12.045  66.959  1.00 39.41  ? 67  TRP B O     1 
ATOM   2353 C  CB    . TRP B 1 25  ? 19.014  9.557   65.660  1.00 33.02  ? 67  TRP B CB    1 
ATOM   2354 C  CG    . TRP B 1 25  ? 18.396  8.582   66.631  1.00 33.33  ? 67  TRP B CG    1 
ATOM   2355 C  CD1   . TRP B 1 25  ? 17.384  8.825   67.520  1.00 32.04  ? 67  TRP B CD1   1 
ATOM   2356 C  CD2   . TRP B 1 25  ? 18.753  7.201   66.795  1.00 32.39  ? 67  TRP B CD2   1 
ATOM   2357 N  NE1   . TRP B 1 25  ? 17.087  7.685   68.216  1.00 33.39  ? 67  TRP B NE1   1 
ATOM   2358 C  CE2   . TRP B 1 25  ? 17.909  6.671   67.790  1.00 34.48  ? 67  TRP B CE2   1 
ATOM   2359 C  CE3   . TRP B 1 25  ? 19.701  6.359   66.185  1.00 32.75  ? 67  TRP B CE3   1 
ATOM   2360 C  CZ2   . TRP B 1 25  ? 17.962  5.325   68.178  1.00 34.13  ? 67  TRP B CZ2   1 
ATOM   2361 C  CZ3   . TRP B 1 25  ? 19.756  5.028   66.566  1.00 34.90  ? 67  TRP B CZ3   1 
ATOM   2362 C  CH2   . TRP B 1 25  ? 18.885  4.521   67.556  1.00 38.08  ? 67  TRP B CH2   1 
ATOM   2363 N  N     . ASN B 1 26  ? 17.674  12.165  67.527  1.00 31.33  ? 68  ASN B N     1 
ATOM   2364 C  CA    . ASN B 1 26  ? 17.922  12.770  68.823  1.00 35.88  ? 68  ASN B CA    1 
ATOM   2365 C  C     . ASN B 1 26  ? 18.283  11.654  69.810  1.00 40.71  ? 68  ASN B C     1 
ATOM   2366 O  O     . ASN B 1 26  ? 17.411  10.890  70.235  1.00 40.96  ? 68  ASN B O     1 
ATOM   2367 C  CB    . ASN B 1 26  ? 16.688  13.555  69.266  1.00 38.03  ? 68  ASN B CB    1 
ATOM   2368 C  CG    . ASN B 1 26  ? 16.846  14.141  70.658  1.00 36.36  ? 68  ASN B CG    1 
ATOM   2369 O  OD1   . ASN B 1 26  ? 17.575  13.590  71.472  1.00 39.77  ? 68  ASN B OD1   1 
ATOM   2370 N  ND2   . ASN B 1 26  ? 16.167  15.249  70.938  1.00 29.17  ? 68  ASN B ND2   1 
ATOM   2371 N  N     . VAL B 1 27  ? 19.558  11.570  70.205  1.00 35.13  ? 69  VAL B N     1 
ATOM   2372 C  CA    . VAL B 1 27  ? 20.012  10.424  70.995  1.00 38.84  ? 69  VAL B CA    1 
ATOM   2373 C  C     . VAL B 1 27  ? 19.812  10.611  72.500  1.00 40.67  ? 69  VAL B C     1 
ATOM   2374 O  O     . VAL B 1 27  ? 19.859  9.621   73.244  1.00 39.91  ? 69  VAL B O     1 
ATOM   2375 C  CB    . VAL B 1 27  ? 21.495  10.081  70.706  1.00 40.79  ? 69  VAL B CB    1 
ATOM   2376 C  CG1   . VAL B 1 27  ? 21.719  9.759   69.198  1.00 35.14  ? 69  VAL B CG1   1 
ATOM   2377 C  CG2   . VAL B 1 27  ? 22.442  11.195  71.185  1.00 34.10  ? 69  VAL B CG2   1 
ATOM   2378 N  N     . ASP B 1 28  ? 19.591  11.842  72.966  1.00 36.03  ? 70  ASP B N     1 
ATOM   2379 C  CA    . ASP B 1 28  ? 19.272  12.140  74.365  1.00 42.77  ? 70  ASP B CA    1 
ATOM   2380 C  C     . ASP B 1 28  ? 20.333  11.575  75.323  1.00 38.57  ? 70  ASP B C     1 
ATOM   2381 O  O     . ASP B 1 28  ? 20.049  10.767  76.206  1.00 39.45  ? 70  ASP B O     1 
ATOM   2382 C  CB    . ASP B 1 28  ? 17.868  11.635  74.730  1.00 40.65  ? 70  ASP B CB    1 
ATOM   2383 C  CG    . ASP B 1 28  ? 17.170  12.545  75.756  1.00 46.78  ? 70  ASP B CG    1 
ATOM   2384 O  OD1   . ASP B 1 28  ? 17.885  13.378  76.353  1.00 40.33  ? 70  ASP B OD1   1 
ATOM   2385 O  OD2   . ASP B 1 28  ? 15.932  12.438  75.952  1.00 44.82  ? 70  ASP B OD2   1 
ATOM   2386 N  N     . GLY B 1 29  ? 21.569  12.033  75.145  1.00 34.51  ? 71  GLY B N     1 
ATOM   2387 C  CA    . GLY B 1 29  ? 22.696  11.398  75.815  1.00 36.80  ? 71  GLY B CA    1 
ATOM   2388 C  C     . GLY B 1 29  ? 23.494  10.466  74.912  1.00 38.68  ? 71  GLY B C     1 
ATOM   2389 O  O     . GLY B 1 29  ? 23.241  9.256   74.832  1.00 33.65  ? 71  GLY B O     1 
ATOM   2390 N  N     . LEU B 1 30  ? 24.477  11.036  74.224  1.00 35.58  ? 72  LEU B N     1 
ATOM   2391 C  CA    . LEU B 1 30  ? 25.235  10.277  73.243  1.00 35.29  ? 72  LEU B CA    1 
ATOM   2392 C  C     . LEU B 1 30  ? 25.863  9.032   73.854  1.00 42.35  ? 72  LEU B C     1 
ATOM   2393 O  O     . LEU B 1 30  ? 25.840  7.952   73.245  1.00 40.20  ? 72  LEU B O     1 
ATOM   2394 C  CB    . LEU B 1 30  ? 26.303  11.175  72.640  1.00 38.22  ? 72  LEU B CB    1 
ATOM   2395 C  CG    . LEU B 1 30  ? 27.372  10.464  71.832  1.00 43.57  ? 72  LEU B CG    1 
ATOM   2396 C  CD1   . LEU B 1 30  ? 26.825  10.137  70.464  1.00 35.94  ? 72  LEU B CD1   1 
ATOM   2397 C  CD2   . LEU B 1 30  ? 28.581  11.371  71.747  1.00 45.26  ? 72  LEU B CD2   1 
ATOM   2398 N  N     . ARG B 1 31  ? 26.432  9.163   75.062  1.00 41.55  ? 73  ARG B N     1 
ATOM   2399 C  CA    . ARG B 1 31  ? 27.128  8.040   75.685  1.00 41.16  ? 73  ARG B CA    1 
ATOM   2400 C  C     . ARG B 1 31  ? 26.143  6.992   76.192  1.00 41.06  ? 73  ARG B C     1 
ATOM   2401 O  O     . ARG B 1 31  ? 26.360  5.787   75.999  1.00 41.38  ? 73  ARG B O     1 
ATOM   2402 C  CB    . ARG B 1 31  ? 28.054  8.553   76.798  1.00 38.75  ? 73  ARG B CB    1 
ATOM   2403 C  CG    . ARG B 1 31  ? 29.181  9.421   76.211  1.00 42.70  ? 73  ARG B CG    1 
ATOM   2404 C  CD    . ARG B 1 31  ? 29.871  10.347  77.217  1.00 45.19  ? 73  ARG B CD    1 
ATOM   2405 N  NE    . ARG B 1 31  ? 29.067  11.484  77.677  1.00 42.76  ? 73  ARG B NE    1 
ATOM   2406 C  CZ    . ARG B 1 31  ? 29.414  12.263  78.706  1.00 45.76  ? 73  ARG B CZ    1 
ATOM   2407 N  NH1   . ARG B 1 31  ? 30.540  12.026  79.351  1.00 48.18  ? 73  ARG B NH1   1 
ATOM   2408 N  NH2   . ARG B 1 31  ? 28.653  13.281  79.101  1.00 42.97  ? 73  ARG B NH2   1 
ATOM   2409 N  N     . ALA B 1 32  ? 25.036  7.411   76.806  1.00 37.25  ? 74  ALA B N     1 
ATOM   2410 C  CA    . ALA B 1 32  ? 24.021  6.420   77.133  1.00 39.74  ? 74  ALA B CA    1 
ATOM   2411 C  C     . ALA B 1 32  ? 23.564  5.699   75.866  1.00 42.74  ? 74  ALA B C     1 
ATOM   2412 O  O     . ALA B 1 32  ? 23.354  4.475   75.864  1.00 41.48  ? 74  ALA B O     1 
ATOM   2413 C  CB    . ALA B 1 32  ? 22.849  7.081   77.853  1.00 39.44  ? 74  ALA B CB    1 
ATOM   2414 N  N     . TRP B 1 33  ? 23.483  6.433   74.758  1.00 38.36  ? 75  TRP B N     1 
ATOM   2415 C  CA    . TRP B 1 33  ? 22.944  5.857   73.531  1.00 43.65  ? 75  TRP B CA    1 
ATOM   2416 C  C     . TRP B 1 33  ? 23.924  4.865   72.910  1.00 44.00  ? 75  TRP B C     1 
ATOM   2417 O  O     . TRP B 1 33  ? 23.506  3.793   72.448  1.00 41.23  ? 75  TRP B O     1 
ATOM   2418 C  CB    . TRP B 1 33  ? 22.580  6.993   72.570  1.00 39.76  ? 75  TRP B CB    1 
ATOM   2419 C  CG    . TRP B 1 33  ? 22.257  6.647   71.169  1.00 33.73  ? 75  TRP B CG    1 
ATOM   2420 C  CD1   . TRP B 1 33  ? 21.065  6.186   70.677  1.00 37.50  ? 75  TRP B CD1   1 
ATOM   2421 C  CD2   . TRP B 1 33  ? 23.112  6.825   70.046  1.00 42.47  ? 75  TRP B CD2   1 
ATOM   2422 N  NE1   . TRP B 1 33  ? 21.140  6.039   69.302  1.00 36.46  ? 75  TRP B NE1   1 
ATOM   2423 C  CE2   . TRP B 1 33  ? 22.388  6.442   68.894  1.00 39.61  ? 75  TRP B CE2   1 
ATOM   2424 C  CE3   . TRP B 1 33  ? 24.427  7.280   69.894  1.00 43.37  ? 75  TRP B CE3   1 
ATOM   2425 C  CZ2   . TRP B 1 33  ? 22.943  6.476   67.629  1.00 40.75  ? 75  TRP B CZ2   1 
ATOM   2426 C  CZ3   . TRP B 1 33  ? 24.971  7.327   68.622  1.00 41.95  ? 75  TRP B CZ3   1 
ATOM   2427 C  CH2   . TRP B 1 33  ? 24.230  6.918   67.509  1.00 41.97  ? 75  TRP B CH2   1 
ATOM   2428 N  N     . ILE B 1 34  ? 25.228  5.191   72.892  1.00 41.64  ? 76  ILE B N     1 
ATOM   2429 C  CA    . ILE B 1 34  ? 26.225  4.219   72.436  1.00 37.27  ? 76  ILE B CA    1 
ATOM   2430 C  C     . ILE B 1 34  ? 26.146  2.951   73.279  1.00 42.09  ? 76  ILE B C     1 
ATOM   2431 O  O     . ILE B 1 34  ? 26.213  1.832   72.755  1.00 43.79  ? 76  ILE B O     1 
ATOM   2432 C  CB    . ILE B 1 34  ? 27.641  4.825   72.479  1.00 46.64  ? 76  ILE B CB    1 
ATOM   2433 C  CG1   . ILE B 1 34  ? 27.825  5.894   71.398  1.00 46.52  ? 76  ILE B CG1   1 
ATOM   2434 C  CG2   . ILE B 1 34  ? 28.710  3.730   72.349  1.00 37.17  ? 76  ILE B CG2   1 
ATOM   2435 C  CD1   . ILE B 1 34  ? 29.113  6.680   71.540  1.00 44.09  ? 76  ILE B CD1   1 
ATOM   2436 N  N     . LYS B 1 35  ? 25.963  3.098   74.594  1.00 38.44  ? 77  LYS B N     1 
ATOM   2437 C  CA    . LYS B 1 35  ? 25.956  1.921   75.456  1.00 43.07  ? 77  LYS B CA    1 
ATOM   2438 C  C     . LYS B 1 35  ? 24.665  1.136   75.332  1.00 46.27  ? 77  LYS B C     1 
ATOM   2439 O  O     . LYS B 1 35  ? 24.628  -0.044  75.694  1.00 48.09  ? 77  LYS B O     1 
ATOM   2440 C  CB    . LYS B 1 35  ? 26.219  2.320   76.916  1.00 43.64  ? 77  LYS B CB    1 
ATOM   2441 C  CG    . LYS B 1 35  ? 27.624  2.861   77.124  1.00 45.40  ? 77  LYS B CG    1 
ATOM   2442 C  CD    . LYS B 1 35  ? 28.150  2.634   78.545  1.00 55.25  ? 77  LYS B CD    1 
ATOM   2443 C  CE    . LYS B 1 35  ? 27.504  3.555   79.555  1.00 47.43  ? 77  LYS B CE    1 
ATOM   2444 N  NZ    . LYS B 1 35  ? 28.258  4.817   79.645  1.00 48.67  ? 77  LYS B NZ    1 
ATOM   2445 N  N     . LYS B 1 36  ? 23.615  1.754   74.800  1.00 48.73  ? 78  LYS B N     1 
ATOM   2446 C  CA    . LYS B 1 36  ? 22.370  1.059   74.521  1.00 41.26  ? 78  LYS B CA    1 
ATOM   2447 C  C     . LYS B 1 36  ? 22.293  0.533   73.085  1.00 47.94  ? 78  LYS B C     1 
ATOM   2448 O  O     . LYS B 1 36  ? 21.186  0.381   72.546  1.00 47.07  ? 78  LYS B O     1 
ATOM   2449 C  CB    . LYS B 1 36  ? 21.193  1.984   74.841  1.00 40.53  ? 78  LYS B CB    1 
ATOM   2450 C  CG    . LYS B 1 36  ? 21.052  2.244   76.319  1.00 37.85  ? 78  LYS B CG    1 
ATOM   2451 C  CD    . LYS B 1 36  ? 19.957  3.217   76.635  1.00 36.49  ? 78  LYS B CD    1 
ATOM   2452 C  CE    . LYS B 1 36  ? 20.348  4.629   76.258  1.00 38.21  ? 78  LYS B CE    1 
ATOM   2453 N  NZ    . LYS B 1 36  ? 19.511  5.582   77.041  1.00 40.41  ? 78  LYS B NZ    1 
ATOM   2454 N  N     . LYS B 1 37  ? 23.434  0.262   72.446  1.00 45.73  ? 79  LYS B N     1 
ATOM   2455 C  CA    . LYS B 1 37  ? 23.505  -0.358  71.114  1.00 54.15  ? 79  LYS B CA    1 
ATOM   2456 C  C     . LYS B 1 37  ? 23.058  0.546   69.959  1.00 50.74  ? 79  LYS B C     1 
ATOM   2457 O  O     . LYS B 1 37  ? 22.829  0.048   68.841  1.00 50.25  ? 79  LYS B O     1 
ATOM   2458 C  CB    . LYS B 1 37  ? 22.697  -1.665  71.057  1.00 52.61  ? 79  LYS B CB    1 
ATOM   2459 C  CG    . LYS B 1 37  ? 23.180  -2.739  72.032  1.00 55.25  ? 79  LYS B CG    1 
ATOM   2460 C  CD    . LYS B 1 37  ? 24.709  -2.705  72.166  1.00 59.82  ? 79  LYS B CD    1 
ATOM   2461 C  CE    . LYS B 1 37  ? 25.343  -4.094  72.421  1.00 73.07  ? 79  LYS B CE    1 
ATOM   2462 N  NZ    . LYS B 1 37  ? 26.716  -4.033  73.080  1.00 56.03  ? 79  LYS B NZ    1 
ATOM   2463 N  N     . GLY B 1 38  ? 22.951  1.858   70.172  1.00 47.17  ? 80  GLY B N     1 
ATOM   2464 C  CA    . GLY B 1 38  ? 22.533  2.744   69.094  1.00 46.49  ? 80  GLY B CA    1 
ATOM   2465 C  C     . GLY B 1 38  ? 23.458  2.698   67.888  1.00 51.40  ? 80  GLY B C     1 
ATOM   2466 O  O     . GLY B 1 38  ? 22.994  2.604   66.742  1.00 45.67  ? 80  GLY B O     1 
ATOM   2467 N  N     . LEU B 1 39  ? 24.781  2.740   68.127  1.00 43.04  ? 81  LEU B N     1 
ATOM   2468 C  CA    . LEU B 1 39  ? 25.747  2.699   67.032  1.00 42.92  ? 81  LEU B CA    1 
ATOM   2469 C  C     . LEU B 1 39  ? 25.679  1.391   66.241  1.00 48.68  ? 81  LEU B C     1 
ATOM   2470 O  O     . LEU B 1 39  ? 25.970  1.378   65.040  1.00 51.10  ? 81  LEU B O     1 
ATOM   2471 C  CB    . LEU B 1 39  ? 27.169  2.916   67.566  1.00 49.59  ? 81  LEU B CB    1 
ATOM   2472 C  CG    . LEU B 1 39  ? 27.671  4.331   67.842  1.00 46.87  ? 81  LEU B CG    1 
ATOM   2473 C  CD1   . LEU B 1 39  ? 29.046  4.268   68.486  1.00 52.51  ? 81  LEU B CD1   1 
ATOM   2474 C  CD2   . LEU B 1 39  ? 27.738  5.141   66.544  1.00 47.06  ? 81  LEU B CD2   1 
ATOM   2475 N  N     . ASP B 1 40  ? 25.327  0.276   66.879  1.00 48.24  ? 82  ASP B N     1 
ATOM   2476 C  CA    . ASP B 1 40  ? 25.134  -0.938  66.096  1.00 46.78  ? 82  ASP B CA    1 
ATOM   2477 C  C     . ASP B 1 40  ? 23.961  -0.761  65.140  1.00 55.21  ? 82  ASP B C     1 
ATOM   2478 O  O     . ASP B 1 40  ? 24.008  -1.211  63.982  1.00 53.23  ? 82  ASP B O     1 
ATOM   2479 C  CB    . ASP B 1 40  ? 24.916  -2.148  67.008  1.00 50.16  ? 82  ASP B CB    1 
ATOM   2480 C  CG    . ASP B 1 40  ? 26.103  -2.417  67.929  1.00 58.57  ? 82  ASP B CG    1 
ATOM   2481 O  OD1   . ASP B 1 40  ? 27.266  -2.180  67.520  1.00 61.32  ? 82  ASP B OD1   1 
ATOM   2482 O  OD2   . ASP B 1 40  ? 25.877  -2.860  69.080  1.00 62.83  ? 82  ASP B OD2   1 
ATOM   2483 N  N     . TRP B 1 41  ? 22.907  -0.079  65.594  1.00 47.90  ? 83  TRP B N     1 
ATOM   2484 C  CA    . TRP B 1 41  ? 21.786  0.174   64.703  1.00 51.57  ? 83  TRP B CA    1 
ATOM   2485 C  C     . TRP B 1 41  ? 22.230  1.038   63.524  1.00 52.97  ? 83  TRP B C     1 
ATOM   2486 O  O     . TRP B 1 41  ? 22.000  0.687   62.362  1.00 46.60  ? 83  TRP B O     1 
ATOM   2487 C  CB    . TRP B 1 41  ? 20.633  0.812   65.474  1.00 51.77  ? 83  TRP B CB    1 
ATOM   2488 C  CG    . TRP B 1 41  ? 19.423  1.033   64.591  1.00 50.30  ? 83  TRP B CG    1 
ATOM   2489 C  CD1   . TRP B 1 41  ? 18.346  0.206   64.451  1.00 44.70  ? 83  TRP B CD1   1 
ATOM   2490 C  CD2   . TRP B 1 41  ? 19.191  2.149   63.726  1.00 46.34  ? 83  TRP B CD2   1 
ATOM   2491 N  NE1   . TRP B 1 41  ? 17.461  0.732   63.542  1.00 49.66  ? 83  TRP B NE1   1 
ATOM   2492 C  CE2   . TRP B 1 41  ? 17.954  1.924   63.080  1.00 53.35  ? 83  TRP B CE2   1 
ATOM   2493 C  CE3   . TRP B 1 41  ? 19.915  3.308   63.419  1.00 45.53  ? 83  TRP B CE3   1 
ATOM   2494 C  CZ2   . TRP B 1 41  ? 17.418  2.826   62.145  1.00 52.03  ? 83  TRP B CZ2   1 
ATOM   2495 C  CZ3   . TRP B 1 41  ? 19.382  4.206   62.486  1.00 46.65  ? 83  TRP B CZ3   1 
ATOM   2496 C  CH2   . TRP B 1 41  ? 18.146  3.956   61.862  1.00 50.74  ? 83  TRP B CH2   1 
ATOM   2497 N  N     . VAL B 1 42  ? 22.947  2.134   63.808  1.00 51.33  ? 84  VAL B N     1 
ATOM   2498 C  CA    . VAL B 1 42  ? 23.451  3.003   62.746  1.00 47.84  ? 84  VAL B CA    1 
ATOM   2499 C  C     . VAL B 1 42  ? 24.303  2.216   61.758  1.00 55.48  ? 84  VAL B C     1 
ATOM   2500 O  O     . VAL B 1 42  ? 24.194  2.410   60.539  1.00 49.12  ? 84  VAL B O     1 
ATOM   2501 C  CB    . VAL B 1 42  ? 24.227  4.192   63.346  1.00 44.24  ? 84  VAL B CB    1 
ATOM   2502 C  CG1   . VAL B 1 42  ? 24.983  4.960   62.274  1.00 42.49  ? 84  VAL B CG1   1 
ATOM   2503 C  CG2   . VAL B 1 42  ? 23.278  5.117   64.065  1.00 41.74  ? 84  VAL B CG2   1 
ATOM   2504 N  N     . LYS B 1 43  ? 25.178  1.324   62.263  1.00 59.56  ? 85  LYS B N     1 
ATOM   2505 C  CA    . LYS B 1 43  ? 26.019  0.517   61.375  1.00 53.08  ? 85  LYS B CA    1 
ATOM   2506 C  C     . LYS B 1 43  ? 25.168  -0.318  60.437  1.00 55.09  ? 85  LYS B C     1 
ATOM   2507 O  O     . LYS B 1 43  ? 25.540  -0.515  59.273  1.00 53.20  ? 85  LYS B O     1 
ATOM   2508 C  CB    . LYS B 1 43  ? 26.966  -0.397  62.176  1.00 60.35  ? 85  LYS B CB    1 
ATOM   2509 C  CG    . LYS B 1 43  ? 28.284  0.246   62.717  1.00 56.70  ? 85  LYS B CG    1 
ATOM   2510 C  CD    . LYS B 1 43  ? 28.900  -0.608  63.858  1.00 58.36  ? 85  LYS B CD    1 
ATOM   2511 C  CE    . LYS B 1 43  ? 29.893  -1.663  63.326  1.00 76.98  ? 85  LYS B CE    1 
ATOM   2512 N  NZ    . LYS B 1 43  ? 30.039  -2.917  64.157  1.00 72.87  ? 85  LYS B NZ    1 
ATOM   2513 N  N     . GLU B 1 44  ? 24.004  -0.776  60.907  1.00 56.32  ? 86  GLU B N     1 
ATOM   2514 C  CA    . GLU B 1 44  ? 23.112  -1.566  60.064  1.00 54.86  ? 86  GLU B CA    1 
ATOM   2515 C  C     . GLU B 1 44  ? 22.333  -0.712  59.064  1.00 49.61  ? 86  GLU B C     1 
ATOM   2516 O  O     . GLU B 1 44  ? 22.029  -1.173  57.962  1.00 52.92  ? 86  GLU B O     1 
ATOM   2517 C  CB    . GLU B 1 44  ? 22.146  -2.352  60.950  1.00 58.96  ? 86  GLU B CB    1 
ATOM   2518 C  CG    . GLU B 1 44  ? 21.569  -3.586  60.306  1.00 63.29  ? 86  GLU B CG    1 
ATOM   2519 C  CD    . GLU B 1 44  ? 20.389  -4.115  61.075  1.00 68.85  ? 86  GLU B CD    1 
ATOM   2520 O  OE1   . GLU B 1 44  ? 19.264  -3.606  60.847  1.00 71.96  ? 86  GLU B OE1   1 
ATOM   2521 O  OE2   . GLU B 1 44  ? 20.586  -5.023  61.915  1.00 72.62  ? 86  GLU B OE2   1 
ATOM   2522 N  N     . GLU B 1 45  ? 21.989  0.520   59.430  1.00 52.57  ? 87  GLU B N     1 
ATOM   2523 C  CA    . GLU B 1 45  ? 21.275  1.403   58.514  1.00 50.93  ? 87  GLU B CA    1 
ATOM   2524 C  C     . GLU B 1 45  ? 22.206  1.954   57.439  1.00 52.47  ? 87  GLU B C     1 
ATOM   2525 O  O     . GLU B 1 45  ? 21.749  2.297   56.335  1.00 53.07  ? 87  GLU B O     1 
ATOM   2526 C  CB    . GLU B 1 45  ? 20.615  2.540   59.310  1.00 47.64  ? 87  GLU B CB    1 
ATOM   2527 C  CG    . GLU B 1 45  ? 19.836  3.566   58.476  1.00 53.14  ? 87  GLU B CG    1 
ATOM   2528 C  CD    . GLU B 1 45  ? 18.368  3.198   58.241  1.00 50.38  ? 87  GLU B CD    1 
ATOM   2529 O  OE1   . GLU B 1 45  ? 17.954  2.051   58.515  1.00 51.15  ? 87  GLU B OE1   1 
ATOM   2530 O  OE2   . GLU B 1 45  ? 17.626  4.077   57.768  1.00 53.19  ? 87  GLU B OE2   1 
ATOM   2531 N  N     . ALA B 1 46  ? 23.507  2.015   57.739  1.00 47.42  ? 88  ALA B N     1 
ATOM   2532 C  CA    . ALA B 1 46  ? 24.567  2.497   56.856  1.00 47.99  ? 88  ALA B CA    1 
ATOM   2533 C  C     . ALA B 1 46  ? 24.161  3.763   56.082  1.00 46.95  ? 88  ALA B C     1 
ATOM   2534 O  O     . ALA B 1 46  ? 24.209  3.775   54.854  1.00 46.23  ? 88  ALA B O     1 
ATOM   2535 C  CB    . ALA B 1 46  ? 25.020  1.400   55.896  1.00 40.34  ? 88  ALA B CB    1 
ATOM   2536 N  N     . PRO B 1 47  ? 23.763  4.832   56.780  1.00 48.37  ? 89  PRO B N     1 
ATOM   2537 C  CA    . PRO B 1 47  ? 23.407  6.069   56.076  1.00 42.84  ? 89  PRO B CA    1 
ATOM   2538 C  C     . PRO B 1 47  ? 24.640  6.737   55.510  1.00 40.06  ? 89  PRO B C     1 
ATOM   2539 O  O     . PRO B 1 47  ? 25.761  6.512   55.963  1.00 48.63  ? 89  PRO B O     1 
ATOM   2540 C  CB    . PRO B 1 47  ? 22.771  6.934   57.165  1.00 38.63  ? 89  PRO B CB    1 
ATOM   2541 C  CG    . PRO B 1 47  ? 23.439  6.511   58.378  1.00 42.66  ? 89  PRO B CG    1 
ATOM   2542 C  CD    . PRO B 1 47  ? 23.718  5.023   58.238  1.00 44.67  ? 89  PRO B CD    1 
ATOM   2543 N  N     . ASP B 1 48  ? 24.426  7.577   54.502  1.00 40.00  ? 90  ASP B N     1 
ATOM   2544 C  CA    . ASP B 1 48  ? 25.538  8.359   53.971  1.00 46.76  ? 90  ASP B CA    1 
ATOM   2545 C  C     . ASP B 1 48  ? 25.916  9.497   54.911  1.00 44.47  ? 90  ASP B C     1 
ATOM   2546 O  O     . ASP B 1 48  ? 27.082  9.919   54.955  1.00 45.34  ? 90  ASP B O     1 
ATOM   2547 C  CB    . ASP B 1 48  ? 25.183  8.926   52.602  1.00 37.01  ? 90  ASP B CB    1 
ATOM   2548 C  CG    . ASP B 1 48  ? 25.198  7.885   51.512  1.00 51.19  ? 90  ASP B CG    1 
ATOM   2549 O  OD1   . ASP B 1 48  ? 26.309  7.428   51.170  1.00 56.89  ? 90  ASP B OD1   1 
ATOM   2550 O  OD2   . ASP B 1 48  ? 24.112  7.549   50.971  1.00 45.83  ? 90  ASP B OD2   1 
ATOM   2551 N  N     . ILE B 1 49  ? 24.933  10.013  55.636  1.00 37.08  ? 91  ILE B N     1 
ATOM   2552 C  CA    . ILE B 1 49  ? 25.083  11.115  56.563  1.00 38.63  ? 91  ILE B CA    1 
ATOM   2553 C  C     . ILE B 1 49  ? 24.255  10.755  57.779  1.00 42.92  ? 91  ILE B C     1 
ATOM   2554 O  O     . ILE B 1 49  ? 23.164  10.186  57.644  1.00 39.48  ? 91  ILE B O     1 
ATOM   2555 C  CB    . ILE B 1 49  ? 24.600  12.455  55.975  1.00 37.23  ? 91  ILE B CB    1 
ATOM   2556 C  CG1   . ILE B 1 49  ? 25.301  12.763  54.654  1.00 40.58  ? 91  ILE B CG1   1 
ATOM   2557 C  CG2   . ILE B 1 49  ? 24.795  13.597  57.006  1.00 39.13  ? 91  ILE B CG2   1 
ATOM   2558 C  CD1   . ILE B 1 49  ? 24.766  14.001  53.986  1.00 36.81  ? 91  ILE B CD1   1 
ATOM   2559 N  N     . LEU B 1 50  ? 24.775  11.082  58.964  1.00 39.25  ? 92  LEU B N     1 
ATOM   2560 C  CA    . LEU B 1 50  ? 24.077  10.876  60.226  1.00 37.16  ? 92  LEU B CA    1 
ATOM   2561 C  C     . LEU B 1 50  ? 24.102  12.175  61.013  1.00 39.91  ? 92  LEU B C     1 
ATOM   2562 O  O     . LEU B 1 50  ? 25.166  12.788  61.167  1.00 39.19  ? 92  LEU B O     1 
ATOM   2563 C  CB    . LEU B 1 50  ? 24.727  9.760   61.044  1.00 40.58  ? 92  LEU B CB    1 
ATOM   2564 C  CG    . LEU B 1 50  ? 24.223  9.531   62.466  1.00 37.44  ? 92  LEU B CG    1 
ATOM   2565 C  CD1   . LEU B 1 50  ? 22.746  9.137   62.441  1.00 35.06  ? 92  LEU B CD1   1 
ATOM   2566 C  CD2   . LEU B 1 50  ? 25.057  8.478   63.152  1.00 36.66  ? 92  LEU B CD2   1 
ATOM   2567 N  N     . CYS B 1 51  ? 22.931  12.580  61.505  1.00 38.48  ? 93  CYS B N     1 
ATOM   2568 C  CA    . CYS B 1 51  ? 22.747  13.757  62.348  1.00 38.25  ? 93  CYS B CA    1 
ATOM   2569 C  C     . CYS B 1 51  ? 22.223  13.324  63.708  1.00 40.69  ? 93  CYS B C     1 
ATOM   2570 O  O     . CYS B 1 51  ? 21.197  12.633  63.791  1.00 38.22  ? 93  CYS B O     1 
ATOM   2571 C  CB    . CYS B 1 51  ? 21.755  14.746  61.736  1.00 38.83  ? 93  CYS B CB    1 
ATOM   2572 S  SG    . CYS B 1 51  ? 22.194  15.265  60.074  1.00 51.85  ? 93  CYS B SG    1 
ATOM   2573 N  N     . LEU B 1 52  ? 22.913  13.750  64.765  1.00 35.77  ? 94  LEU B N     1 
ATOM   2574 C  CA    . LEU B 1 52  ? 22.521  13.491  66.141  1.00 38.79  ? 94  LEU B CA    1 
ATOM   2575 C  C     . LEU B 1 52  ? 22.128  14.798  66.812  1.00 39.14  ? 94  LEU B C     1 
ATOM   2576 O  O     . LEU B 1 52  ? 22.760  15.839  66.578  1.00 38.54  ? 94  LEU B O     1 
ATOM   2577 C  CB    . LEU B 1 52  ? 23.664  12.848  66.923  1.00 35.53  ? 94  LEU B CB    1 
ATOM   2578 C  CG    . LEU B 1 52  ? 24.374  11.715  66.180  1.00 46.05  ? 94  LEU B CG    1 
ATOM   2579 C  CD1   . LEU B 1 52  ? 25.597  11.110  66.952  1.00 30.85  ? 94  LEU B CD1   1 
ATOM   2580 C  CD2   . LEU B 1 52  ? 23.332  10.666  65.839  1.00 37.90  ? 94  LEU B CD2   1 
ATOM   2581 N  N     . GLN B 1 53  ? 21.091  14.742  67.649  1.00 31.43  ? 95  GLN B N     1 
ATOM   2582 C  CA    . GLN B 1 53  ? 20.734  15.877  68.483  1.00 33.88  ? 95  GLN B CA    1 
ATOM   2583 C  C     . GLN B 1 53  ? 20.731  15.476  69.954  1.00 34.18  ? 95  GLN B C     1 
ATOM   2584 O  O     . GLN B 1 53  ? 20.603  14.298  70.305  1.00 34.71  ? 95  GLN B O     1 
ATOM   2585 C  CB    . GLN B 1 53  ? 19.370  16.456  68.091  1.00 36.36  ? 95  GLN B CB    1 
ATOM   2586 C  CG    . GLN B 1 53  ? 19.276  16.932  66.633  1.00 36.67  ? 95  GLN B CG    1 
ATOM   2587 C  CD    . GLN B 1 53  ? 19.004  15.800  65.639  1.00 36.42  ? 95  GLN B CD    1 
ATOM   2588 O  OE1   . GLN B 1 53  ? 18.374  14.792  65.965  1.00 37.52  ? 95  GLN B OE1   1 
ATOM   2589 N  NE2   . GLN B 1 53  ? 19.497  15.964  64.423  1.00 36.40  ? 95  GLN B NE2   1 
ATOM   2590 N  N     . GLU B 1 54  ? 20.869  16.488  70.805  1.00 34.34  ? 96  GLU B N     1 
ATOM   2591 C  CA    . GLU B 1 54  ? 20.936  16.330  72.267  1.00 42.18  ? 96  GLU B CA    1 
ATOM   2592 C  C     . GLU B 1 54  ? 22.048  15.368  72.715  1.00 31.71  ? 96  GLU B C     1 
ATOM   2593 O  O     . GLU B 1 54  ? 21.831  14.466  73.525  1.00 34.42  ? 96  GLU B O     1 
ATOM   2594 C  CB    . GLU B 1 54  ? 19.576  15.899  72.830  1.00 39.22  ? 96  GLU B CB    1 
ATOM   2595 C  CG    . GLU B 1 54  ? 19.351  16.396  74.268  1.00 43.33  ? 96  GLU B CG    1 
ATOM   2596 C  CD    . GLU B 1 54  ? 17.924  16.156  74.734  1.00 51.63  ? 96  GLU B CD    1 
ATOM   2597 O  OE1   . GLU B 1 54  ? 17.526  16.681  75.818  1.00 57.42  ? 96  GLU B OE1   1 
ATOM   2598 O  OE2   . GLU B 1 54  ? 17.202  15.421  74.013  1.00 47.44  ? 96  GLU B OE2   1 
ATOM   2599 N  N     . THR B 1 55  ? 23.256  15.574  72.190  1.00 30.11  ? 97  THR B N     1 
ATOM   2600 C  CA    . THR B 1 55  ? 24.365  14.659  72.501  1.00 36.74  ? 97  THR B CA    1 
ATOM   2601 C  C     . THR B 1 55  ? 24.736  14.664  73.980  1.00 38.58  ? 97  THR B C     1 
ATOM   2602 O  O     . THR B 1 55  ? 25.138  13.618  74.507  1.00 40.35  ? 97  THR B O     1 
ATOM   2603 C  CB    . THR B 1 55  ? 25.613  15.004  71.698  1.00 35.93  ? 97  THR B CB    1 
ATOM   2604 O  OG1   . THR B 1 55  ? 25.838  16.413  71.800  1.00 35.91  ? 97  THR B OG1   1 
ATOM   2605 C  CG2   . THR B 1 55  ? 25.457  14.587  70.207  1.00 32.87  ? 97  THR B CG2   1 
ATOM   2606 N  N     . LYS B 1 56  ? 24.632  15.817  74.655  1.00 36.48  ? 98  LYS B N     1 
ATOM   2607 C  CA    . LYS B 1 56  ? 24.904  15.931  76.098  1.00 44.25  ? 98  LYS B CA    1 
ATOM   2608 C  C     . LYS B 1 56  ? 26.326  15.455  76.433  1.00 41.14  ? 98  LYS B C     1 
ATOM   2609 O  O     . LYS B 1 56  ? 26.551  14.576  77.275  1.00 40.66  ? 98  LYS B O     1 
ATOM   2610 C  CB    . LYS B 1 56  ? 23.858  15.160  76.910  1.00 34.23  ? 98  LYS B CB    1 
ATOM   2611 C  CG    . LYS B 1 56  ? 22.446  15.726  76.806  1.00 35.93  ? 98  LYS B CG    1 
ATOM   2612 C  CD    . LYS B 1 56  ? 21.823  15.740  78.187  1.00 49.00  ? 98  LYS B CD    1 
ATOM   2613 C  CE    . LYS B 1 56  ? 20.324  15.563  78.183  1.00 50.52  ? 98  LYS B CE    1 
ATOM   2614 N  NZ    . LYS B 1 56  ? 19.953  15.107  79.572  1.00 41.45  ? 98  LYS B NZ    1 
ATOM   2615 N  N     . CYS B 1 57  ? 27.290  16.054  75.743  1.00 38.72  ? 99  CYS B N     1 
ATOM   2616 C  CA    . CYS B 1 57  ? 28.668  15.576  75.788  1.00 40.81  ? 99  CYS B CA    1 
ATOM   2617 C  C     . CYS B 1 57  ? 29.597  16.627  75.195  1.00 41.66  ? 99  CYS B C     1 
ATOM   2618 O  O     . CYS B 1 57  ? 29.452  17.017  74.029  1.00 47.33  ? 99  CYS B O     1 
ATOM   2619 C  CB    . CYS B 1 57  ? 28.768  14.246  75.036  1.00 44.12  ? 99  CYS B CB    1 
ATOM   2620 S  SG    . CYS B 1 57  ? 30.318  13.342  75.105  1.00 53.35  ? 99  CYS B SG    1 
ATOM   2621 N  N     . SER B 1 58  ? 30.524  17.124  76.003  1.00 49.94  ? 100 SER B N     1 
ATOM   2622 C  CA    . SER B 1 58  ? 31.532  18.042  75.505  1.00 49.77  ? 100 SER B CA    1 
ATOM   2623 C  C     . SER B 1 58  ? 32.443  17.310  74.531  1.00 53.62  ? 100 SER B C     1 
ATOM   2624 O  O     . SER B 1 58  ? 32.552  16.080  74.558  1.00 50.88  ? 100 SER B O     1 
ATOM   2625 C  CB    . SER B 1 58  ? 32.340  18.621  76.668  1.00 56.46  ? 100 SER B CB    1 
ATOM   2626 O  OG    . SER B 1 58  ? 33.163  17.619  77.248  1.00 55.57  ? 100 SER B OG    1 
ATOM   2627 N  N     . GLU B 1 59  ? 33.076  18.074  73.634  1.00 56.00  ? 101 GLU B N     1 
ATOM   2628 C  CA    . GLU B 1 59  ? 34.002  17.462  72.677  1.00 59.86  ? 101 GLU B CA    1 
ATOM   2629 C  C     . GLU B 1 59  ? 35.096  16.673  73.400  1.00 67.03  ? 101 GLU B C     1 
ATOM   2630 O  O     . GLU B 1 59  ? 35.430  15.539  73.015  1.00 58.20  ? 101 GLU B O     1 
ATOM   2631 C  CB    . GLU B 1 59  ? 34.626  18.534  71.782  1.00 59.79  ? 101 GLU B CB    1 
ATOM   2632 C  CG    . GLU B 1 59  ? 34.118  18.528  70.353  1.00 67.00  ? 101 GLU B CG    1 
ATOM   2633 C  CD    . GLU B 1 59  ? 34.845  19.534  69.488  1.00 72.98  ? 101 GLU B CD    1 
ATOM   2634 O  OE1   . GLU B 1 59  ? 35.712  19.121  68.676  1.00 69.45  ? 101 GLU B OE1   1 
ATOM   2635 O  OE2   . GLU B 1 59  ? 34.552  20.741  69.638  1.00 75.72  ? 101 GLU B OE2   1 
ATOM   2636 N  N     . ASN B 1 60  ? 35.649  17.269  74.470  1.00 68.33  ? 102 ASN B N     1 
ATOM   2637 C  CA    . ASN B 1 60  ? 36.742  16.688  75.246  1.00 58.81  ? 102 ASN B CA    1 
ATOM   2638 C  C     . ASN B 1 60  ? 36.412  15.271  75.708  1.00 59.33  ? 102 ASN B C     1 
ATOM   2639 O  O     . ASN B 1 60  ? 37.316  14.453  75.895  1.00 62.61  ? 102 ASN B O     1 
ATOM   2640 C  CB    . ASN B 1 60  ? 37.021  17.628  76.431  1.00 67.20  ? 102 ASN B CB    1 
ATOM   2641 C  CG    . ASN B 1 60  ? 38.379  17.412  77.084  1.00 82.43  ? 102 ASN B CG    1 
ATOM   2642 O  OD1   . ASN B 1 60  ? 38.469  16.912  78.217  1.00 78.94  ? 102 ASN B OD1   1 
ATOM   2643 N  ND2   . ASN B 1 60  ? 39.442  17.836  76.400  1.00 88.21  ? 102 ASN B ND2   1 
ATOM   2644 N  N     . LYS B 1 61  ? 35.123  14.946  75.849  1.00 59.70  ? 103 LYS B N     1 
ATOM   2645 C  CA    . LYS B 1 61  ? 34.688  13.683  76.435  1.00 54.78  ? 103 LYS B CA    1 
ATOM   2646 C  C     . LYS B 1 61  ? 34.051  12.725  75.428  1.00 53.76  ? 103 LYS B C     1 
ATOM   2647 O  O     . LYS B 1 61  ? 33.373  11.780  75.841  1.00 50.34  ? 103 LYS B O     1 
ATOM   2648 C  CB    . LYS B 1 61  ? 33.727  13.953  77.596  1.00 54.06  ? 103 LYS B CB    1 
ATOM   2649 C  CG    . LYS B 1 61  ? 34.301  14.944  78.621  1.00 60.41  ? 103 LYS B CG    1 
ATOM   2650 C  CD    . LYS B 1 61  ? 33.829  14.692  80.049  1.00 62.72  ? 103 LYS B CD    1 
ATOM   2651 C  CE    . LYS B 1 61  ? 32.596  15.527  80.401  1.00 59.71  ? 103 LYS B CE    1 
ATOM   2652 N  NZ    . LYS B 1 61  ? 32.864  16.994  80.445  1.00 60.68  ? 103 LYS B NZ    1 
ATOM   2653 N  N     . LEU B 1 62  ? 34.282  12.917  74.120  1.00 56.06  ? 104 LEU B N     1 
ATOM   2654 C  CA    . LEU B 1 62  ? 33.575  12.117  73.110  1.00 57.00  ? 104 LEU B CA    1 
ATOM   2655 C  C     . LEU B 1 62  ? 34.142  10.703  73.056  1.00 55.82  ? 104 LEU B C     1 
ATOM   2656 O  O     . LEU B 1 62  ? 35.363  10.533  72.966  1.00 62.16  ? 104 LEU B O     1 
ATOM   2657 C  CB    . LEU B 1 62  ? 33.654  12.766  71.716  1.00 56.20  ? 104 LEU B CB    1 
ATOM   2658 C  CG    . LEU B 1 62  ? 32.687  13.925  71.373  1.00 47.82  ? 104 LEU B CG    1 
ATOM   2659 C  CD1   . LEU B 1 62  ? 33.287  14.858  70.343  1.00 42.15  ? 104 LEU B CD1   1 
ATOM   2660 C  CD2   . LEU B 1 62  ? 31.335  13.414  70.898  1.00 42.27  ? 104 LEU B CD2   1 
ATOM   2661 N  N     . PRO B 1 63  ? 33.300  9.675   73.084  1.00 55.95  ? 105 PRO B N     1 
ATOM   2662 C  CA    . PRO B 1 63  ? 33.807  8.303   73.173  1.00 54.15  ? 105 PRO B CA    1 
ATOM   2663 C  C     . PRO B 1 63  ? 34.636  7.932   71.958  1.00 63.67  ? 105 PRO B C     1 
ATOM   2664 O  O     . PRO B 1 63  ? 34.475  8.495   70.871  1.00 58.84  ? 105 PRO B O     1 
ATOM   2665 C  CB    . PRO B 1 63  ? 32.535  7.455   73.245  1.00 58.51  ? 105 PRO B CB    1 
ATOM   2666 C  CG    . PRO B 1 63  ? 31.457  8.404   73.640  1.00 58.45  ? 105 PRO B CG    1 
ATOM   2667 C  CD    . PRO B 1 63  ? 31.831  9.725   73.065  1.00 52.58  ? 105 PRO B CD    1 
ATOM   2668 N  N     . ALA B 1 64  ? 35.530  6.946   72.162  1.00 64.53  ? 106 ALA B N     1 
ATOM   2669 C  CA    . ALA B 1 64  ? 36.429  6.457   71.119  1.00 60.23  ? 106 ALA B CA    1 
ATOM   2670 C  C     . ALA B 1 64  ? 35.740  5.595   70.071  1.00 57.51  ? 106 ALA B C     1 
ATOM   2671 O  O     . ALA B 1 64  ? 36.321  5.382   69.004  1.00 60.14  ? 106 ALA B O     1 
ATOM   2672 C  CB    . ALA B 1 64  ? 37.583  5.658   71.731  1.00 60.47  ? 106 ALA B CB    1 
ATOM   2673 N  N     . GLU B 1 65  ? 34.527  5.092   70.331  1.00 61.66  ? 107 GLU B N     1 
ATOM   2674 C  CA    . GLU B 1 65  ? 33.801  4.372   69.283  1.00 63.98  ? 107 GLU B CA    1 
ATOM   2675 C  C     . GLU B 1 65  ? 33.533  5.227   68.046  1.00 60.27  ? 107 GLU B C     1 
ATOM   2676 O  O     . GLU B 1 65  ? 33.334  4.668   66.963  1.00 59.70  ? 107 GLU B O     1 
ATOM   2677 C  CB    . GLU B 1 65  ? 32.473  3.833   69.810  1.00 50.96  ? 107 GLU B CB    1 
ATOM   2678 C  CG    . GLU B 1 65  ? 32.593  2.693   70.777  1.00 49.15  ? 107 GLU B CG    1 
ATOM   2679 C  CD    . GLU B 1 65  ? 32.704  3.156   72.222  1.00 62.71  ? 107 GLU B CD    1 
ATOM   2680 O  OE1   . GLU B 1 65  ? 33.371  4.184   72.493  1.00 60.13  ? 107 GLU B OE1   1 
ATOM   2681 O  OE2   . GLU B 1 65  ? 32.112  2.481   73.087  1.00 58.03  ? 107 GLU B OE2   1 
ATOM   2682 N  N     . LEU B 1 66  ? 33.534  6.559   68.177  1.00 55.76  ? 108 LEU B N     1 
ATOM   2683 C  CA    . LEU B 1 66  ? 33.153  7.419   67.063  1.00 50.44  ? 108 LEU B CA    1 
ATOM   2684 C  C     . LEU B 1 66  ? 34.200  7.416   65.952  1.00 61.53  ? 108 LEU B C     1 
ATOM   2685 O  O     . LEU B 1 66  ? 33.842  7.453   64.767  1.00 71.77  ? 108 LEU B O     1 
ATOM   2686 C  CB    . LEU B 1 66  ? 32.908  8.832   67.561  1.00 47.07  ? 108 LEU B CB    1 
ATOM   2687 C  CG    . LEU B 1 66  ? 31.725  8.986   68.512  1.00 52.53  ? 108 LEU B CG    1 
ATOM   2688 C  CD1   . LEU B 1 66  ? 31.747  10.383  69.113  1.00 47.63  ? 108 LEU B CD1   1 
ATOM   2689 C  CD2   . LEU B 1 66  ? 30.402  8.678   67.806  1.00 50.45  ? 108 LEU B CD2   1 
ATOM   2690 N  N     . GLN B 1 67  ? 35.493  7.385   66.297  1.00 63.36  ? 109 GLN B N     1 
ATOM   2691 C  CA    . GLN B 1 67  ? 36.529  7.299   65.266  1.00 66.35  ? 109 GLN B CA    1 
ATOM   2692 C  C     . GLN B 1 67  ? 36.303  6.083   64.372  1.00 75.62  ? 109 GLN B C     1 
ATOM   2693 O  O     . GLN B 1 67  ? 36.255  6.192   63.137  1.00 75.54  ? 109 GLN B O     1 
ATOM   2694 C  CB    . GLN B 1 67  ? 37.915  7.230   65.905  1.00 67.66  ? 109 GLN B CB    1 
ATOM   2695 C  CG    . GLN B 1 67  ? 38.372  8.501   66.623  1.00 72.67  ? 109 GLN B CG    1 
ATOM   2696 C  CD    . GLN B 1 67  ? 39.236  8.211   67.851  1.00 77.50  ? 109 GLN B CD    1 
ATOM   2697 O  OE1   . GLN B 1 67  ? 39.341  7.063   68.304  1.00 77.87  ? 109 GLN B OE1   1 
ATOM   2698 N  NE2   . GLN B 1 67  ? 39.849  9.253   68.402  1.00 75.53  ? 109 GLN B NE2   1 
ATOM   2699 N  N     . GLU B 1 68  ? 36.112  4.919   64.989  1.00 72.95  ? 110 GLU B N     1 
ATOM   2700 C  CA    . GLU B 1 68  ? 35.957  3.660   64.267  1.00 68.73  ? 110 GLU B CA    1 
ATOM   2701 C  C     . GLU B 1 68  ? 34.528  3.453   63.736  1.00 70.21  ? 110 GLU B C     1 
ATOM   2702 O  O     . GLU B 1 68  ? 33.846  2.474   64.041  1.00 65.71  ? 110 GLU B O     1 
ATOM   2703 C  CB    . GLU B 1 68  ? 36.378  2.518   65.179  1.00 71.78  ? 110 GLU B CB    1 
ATOM   2704 N  N     . LEU B 1 69  ? 34.074  4.402   62.920  1.00 68.73  ? 111 LEU B N     1 
ATOM   2705 C  CA    . LEU B 1 69  ? 32.975  4.181   61.973  1.00 66.19  ? 111 LEU B CA    1 
ATOM   2706 C  C     . LEU B 1 69  ? 33.472  4.746   60.656  1.00 62.84  ? 111 LEU B C     1 
ATOM   2707 O  O     . LEU B 1 69  ? 33.390  5.964   60.429  1.00 59.86  ? 111 LEU B O     1 
ATOM   2708 C  CB    . LEU B 1 69  ? 31.672  4.864   62.362  1.00 59.34  ? 111 LEU B CB    1 
ATOM   2709 C  CG    . LEU B 1 69  ? 31.011  4.600   63.702  1.00 60.27  ? 111 LEU B CG    1 
ATOM   2710 C  CD1   . LEU B 1 69  ? 30.761  5.937   64.365  1.00 58.83  ? 111 LEU B CD1   1 
ATOM   2711 C  CD2   . LEU B 1 69  ? 29.711  3.804   63.529  1.00 58.37  ? 111 LEU B CD2   1 
ATOM   2712 N  N     . PRO B 1 70  ? 34.023  3.915   59.777  1.00 70.97  ? 112 PRO B N     1 
ATOM   2713 C  CA    . PRO B 1 70  ? 34.718  4.459   58.604  1.00 67.40  ? 112 PRO B CA    1 
ATOM   2714 C  C     . PRO B 1 70  ? 33.801  4.766   57.428  1.00 66.58  ? 112 PRO B C     1 
ATOM   2715 O  O     . PRO B 1 70  ? 34.266  5.344   56.434  1.00 64.55  ? 112 PRO B O     1 
ATOM   2716 C  CB    . PRO B 1 70  ? 35.740  3.360   58.263  1.00 67.69  ? 112 PRO B CB    1 
ATOM   2717 C  CG    . PRO B 1 70  ? 35.446  2.190   59.252  1.00 72.12  ? 112 PRO B CG    1 
ATOM   2718 C  CD    . PRO B 1 70  ? 34.096  2.449   59.833  1.00 69.31  ? 112 PRO B CD    1 
ATOM   2719 N  N     . GLY B 1 71  ? 32.512  4.420   57.512  1.00 63.03  ? 113 GLY B N     1 
ATOM   2720 C  CA    . GLY B 1 71  ? 31.584  4.984   56.555  1.00 60.04  ? 113 GLY B CA    1 
ATOM   2721 C  C     . GLY B 1 71  ? 31.180  6.413   56.846  1.00 60.77  ? 113 GLY B C     1 
ATOM   2722 O  O     . GLY B 1 71  ? 30.533  7.048   56.002  1.00 54.93  ? 113 GLY B O     1 
ATOM   2723 N  N     . LEU B 1 72  ? 31.533  6.918   58.032  1.00 51.45  ? 114 LEU B N     1 
ATOM   2724 C  CA    . LEU B 1 72  ? 31.209  8.260   58.498  1.00 46.11  ? 114 LEU B CA    1 
ATOM   2725 C  C     . LEU B 1 72  ? 32.447  8.914   59.119  1.00 49.50  ? 114 LEU B C     1 
ATOM   2726 O  O     . LEU B 1 72  ? 32.440  9.377   60.260  1.00 45.55  ? 114 LEU B O     1 
ATOM   2727 C  CB    . LEU B 1 72  ? 30.043  8.183   59.480  1.00 49.00  ? 114 LEU B CB    1 
ATOM   2728 C  CG    . LEU B 1 72  ? 28.806  7.498   58.908  1.00 49.60  ? 114 LEU B CG    1 
ATOM   2729 C  CD1   . LEU B 1 72  ? 27.881  7.059   60.008  1.00 45.94  ? 114 LEU B CD1   1 
ATOM   2730 C  CD2   . LEU B 1 72  ? 28.099  8.433   57.919  1.00 47.58  ? 114 LEU B CD2   1 
ATOM   2731 N  N     . SER B 1 73  ? 33.539  8.961   58.357  1.00 49.26  ? 115 SER B N     1 
ATOM   2732 C  CA    . SER B 1 73  ? 34.823  9.374   58.918  1.00 47.90  ? 115 SER B CA    1 
ATOM   2733 C  C     . SER B 1 73  ? 34.904  10.875  59.203  1.00 50.92  ? 115 SER B C     1 
ATOM   2734 O  O     . SER B 1 73  ? 35.779  11.299  59.975  1.00 40.80  ? 115 SER B O     1 
ATOM   2735 C  CB    . SER B 1 73  ? 35.957  8.985   57.967  1.00 44.93  ? 115 SER B CB    1 
ATOM   2736 O  OG    . SER B 1 73  ? 35.981  9.841   56.814  1.00 49.33  ? 115 SER B OG    1 
ATOM   2737 N  N     . HIS B 1 74  ? 34.042  11.696  58.590  1.00 40.64  ? 116 HIS B N     1 
ATOM   2738 C  CA    . HIS B 1 74  ? 34.121  13.146  58.745  1.00 38.85  ? 116 HIS B CA    1 
ATOM   2739 C  C     . HIS B 1 74  ? 33.048  13.583  59.720  1.00 46.68  ? 116 HIS B C     1 
ATOM   2740 O  O     . HIS B 1 74  ? 31.855  13.537  59.396  1.00 44.87  ? 116 HIS B O     1 
ATOM   2741 C  CB    . HIS B 1 74  ? 33.983  13.853  57.409  1.00 43.89  ? 116 HIS B CB    1 
ATOM   2742 C  CG    . HIS B 1 74  ? 34.892  13.297  56.366  1.00 54.72  ? 116 HIS B CG    1 
ATOM   2743 N  ND1   . HIS B 1 74  ? 34.443  12.488  55.342  1.00 53.05  ? 116 HIS B ND1   1 
ATOM   2744 C  CD2   . HIS B 1 74  ? 36.236  13.387  56.222  1.00 50.64  ? 116 HIS B CD2   1 
ATOM   2745 C  CE1   . HIS B 1 74  ? 35.472  12.127  54.594  1.00 59.67  ? 116 HIS B CE1   1 
ATOM   2746 N  NE2   . HIS B 1 74  ? 36.570  12.656  55.107  1.00 52.59  ? 116 HIS B NE2   1 
ATOM   2747 N  N     . GLN B 1 75  ? 33.484  14.017  60.912  1.00 41.58  ? 117 GLN B N     1 
ATOM   2748 C  CA    . GLN B 1 75  ? 32.602  14.207  62.053  1.00 45.23  ? 117 GLN B CA    1 
ATOM   2749 C  C     . GLN B 1 75  ? 32.723  15.633  62.567  1.00 43.07  ? 117 GLN B C     1 
ATOM   2750 O  O     . GLN B 1 75  ? 33.830  16.107  62.806  1.00 40.16  ? 117 GLN B O     1 
ATOM   2751 C  CB    . GLN B 1 75  ? 32.934  13.191  63.156  1.00 38.92  ? 117 GLN B CB    1 
ATOM   2752 C  CG    . GLN B 1 75  ? 33.165  11.772  62.581  1.00 41.73  ? 117 GLN B CG    1 
ATOM   2753 C  CD    . GLN B 1 75  ? 33.128  10.677  63.624  1.00 46.31  ? 117 GLN B CD    1 
ATOM   2754 O  OE1   . GLN B 1 75  ? 33.071  10.947  64.819  1.00 47.17  ? 117 GLN B OE1   1 
ATOM   2755 N  NE2   . GLN B 1 75  ? 33.162  9.429   63.175  1.00 46.67  ? 117 GLN B NE2   1 
ATOM   2756 N  N     . TYR B 1 76  ? 31.578  16.310  62.742  1.00 47.25  ? 118 TYR B N     1 
ATOM   2757 C  CA    . TYR B 1 76  ? 31.523  17.690  63.214  1.00 40.14  ? 118 TYR B CA    1 
ATOM   2758 C  C     . TYR B 1 76  ? 30.633  17.752  64.443  1.00 41.22  ? 118 TYR B C     1 
ATOM   2759 O  O     . TYR B 1 76  ? 29.645  17.027  64.525  1.00 43.13  ? 118 TYR B O     1 
ATOM   2760 C  CB    . TYR B 1 76  ? 31.008  18.608  62.096  1.00 43.76  ? 118 TYR B CB    1 
ATOM   2761 C  CG    . TYR B 1 76  ? 31.807  18.397  60.832  1.00 43.57  ? 118 TYR B CG    1 
ATOM   2762 C  CD1   . TYR B 1 76  ? 32.990  19.090  60.635  1.00 43.23  ? 118 TYR B CD1   1 
ATOM   2763 C  CD2   . TYR B 1 76  ? 31.433  17.452  59.891  1.00 38.19  ? 118 TYR B CD2   1 
ATOM   2764 C  CE1   . TYR B 1 76  ? 33.752  18.889  59.528  1.00 42.43  ? 118 TYR B CE1   1 
ATOM   2765 C  CE2   . TYR B 1 76  ? 32.200  17.237  58.765  1.00 42.16  ? 118 TYR B CE2   1 
ATOM   2766 C  CZ    . TYR B 1 76  ? 33.366  17.961  58.595  1.00 41.73  ? 118 TYR B CZ    1 
ATOM   2767 O  OH    . TYR B 1 76  ? 34.180  17.807  57.502  1.00 40.32  ? 118 TYR B OH    1 
ATOM   2768 N  N     . TRP B 1 77  ? 31.001  18.586  65.416  1.00 43.70  ? 119 TRP B N     1 
ATOM   2769 C  CA    . TRP B 1 77  ? 30.298  18.641  66.693  1.00 42.87  ? 119 TRP B CA    1 
ATOM   2770 C  C     . TRP B 1 77  ? 30.105  20.086  67.125  1.00 45.96  ? 119 TRP B C     1 
ATOM   2771 O  O     . TRP B 1 77  ? 30.919  20.957  66.820  1.00 42.38  ? 119 TRP B O     1 
ATOM   2772 C  CB    . TRP B 1 77  ? 31.050  17.872  67.778  1.00 42.92  ? 119 TRP B CB    1 
ATOM   2773 C  CG    . TRP B 1 77  ? 31.283  16.469  67.373  1.00 40.95  ? 119 TRP B CG    1 
ATOM   2774 C  CD1   . TRP B 1 77  ? 32.377  15.969  66.730  1.00 40.17  ? 119 TRP B CD1   1 
ATOM   2775 C  CD2   . TRP B 1 77  ? 30.370  15.385  67.522  1.00 37.25  ? 119 TRP B CD2   1 
ATOM   2776 N  NE1   . TRP B 1 77  ? 32.214  14.629  66.496  1.00 39.62  ? 119 TRP B NE1   1 
ATOM   2777 C  CE2   . TRP B 1 77  ? 30.987  14.245  66.975  1.00 39.68  ? 119 TRP B CE2   1 
ATOM   2778 C  CE3   . TRP B 1 77  ? 29.096  15.265  68.080  1.00 31.11  ? 119 TRP B CE3   1 
ATOM   2779 C  CZ2   . TRP B 1 77  ? 30.374  13.000  66.972  1.00 38.24  ? 119 TRP B CZ2   1 
ATOM   2780 C  CZ3   . TRP B 1 77  ? 28.497  14.034  68.086  1.00 34.84  ? 119 TRP B CZ3   1 
ATOM   2781 C  CH2   . TRP B 1 77  ? 29.126  12.915  67.523  1.00 38.49  ? 119 TRP B CH2   1 
ATOM   2782 N  N     . SER B 1 78  ? 29.007  20.341  67.828  1.00 49.79  ? 120 SER B N     1 
ATOM   2783 C  CA    . SER B 1 78  ? 28.758  21.672  68.361  1.00 45.18  ? 120 SER B CA    1 
ATOM   2784 C  C     . SER B 1 78  ? 28.251  21.552  69.792  1.00 41.03  ? 120 SER B C     1 
ATOM   2785 O  O     . SER B 1 78  ? 27.173  21.011  70.024  1.00 39.03  ? 120 SER B O     1 
ATOM   2786 C  CB    . SER B 1 78  ? 27.766  22.429  67.480  1.00 48.34  ? 120 SER B CB    1 
ATOM   2787 O  OG    . SER B 1 78  ? 27.527  23.714  68.017  1.00 53.65  ? 120 SER B OG    1 
ATOM   2788 N  N     . ALA B 1 79  ? 29.023  22.041  70.750  1.00 39.97  ? 121 ALA B N     1 
ATOM   2789 C  CA    . ALA B 1 79  ? 28.576  22.047  72.133  1.00 43.76  ? 121 ALA B CA    1 
ATOM   2790 C  C     . ALA B 1 79  ? 28.220  23.463  72.572  1.00 40.03  ? 121 ALA B C     1 
ATOM   2791 O  O     . ALA B 1 79  ? 28.573  24.439  71.899  1.00 39.46  ? 121 ALA B O     1 
ATOM   2792 C  CB    . ALA B 1 79  ? 29.649  21.461  73.060  1.00 33.43  ? 121 ALA B CB    1 
ATOM   2793 N  N     . PRO B 1 80  ? 27.454  23.609  73.656  1.00 38.19  ? 122 PRO B N     1 
ATOM   2794 C  CA    . PRO B 1 80  ? 27.270  24.942  74.251  1.00 42.08  ? 122 PRO B CA    1 
ATOM   2795 C  C     . PRO B 1 80  ? 28.586  25.492  74.794  1.00 46.07  ? 122 PRO B C     1 
ATOM   2796 O  O     . PRO B 1 80  ? 29.512  24.750  75.130  1.00 42.74  ? 122 PRO B O     1 
ATOM   2797 C  CB    . PRO B 1 80  ? 26.262  24.708  75.381  1.00 41.74  ? 122 PRO B CB    1 
ATOM   2798 C  CG    . PRO B 1 80  ? 26.068  23.221  75.466  1.00 44.47  ? 122 PRO B CG    1 
ATOM   2799 C  CD    . PRO B 1 80  ? 26.563  22.586  74.235  1.00 36.40  ? 122 PRO B CD    1 
ATOM   2800 N  N     . SER B 1 81  ? 28.662  26.815  74.879  1.00 38.84  ? 123 SER B N     1 
ATOM   2801 C  CA    . SER B 1 81  ? 29.899  27.422  75.337  1.00 51.15  ? 123 SER B CA    1 
ATOM   2802 C  C     . SER B 1 81  ? 30.022  27.356  76.860  1.00 58.09  ? 123 SER B C     1 
ATOM   2803 O  O     . SER B 1 81  ? 31.113  27.105  77.386  1.00 61.34  ? 123 SER B O     1 
ATOM   2804 C  CB    . SER B 1 81  ? 29.975  28.862  74.835  1.00 47.55  ? 123 SER B CB    1 
ATOM   2805 O  OG    . SER B 1 81  ? 28.772  29.546  75.128  1.00 43.29  ? 123 SER B OG    1 
ATOM   2806 N  N     . ASP B 1 82  ? 28.915  27.545  77.579  1.00 48.83  ? 124 ASP B N     1 
ATOM   2807 C  CA    . ASP B 1 82  ? 28.927  27.667  79.030  1.00 59.24  ? 124 ASP B CA    1 
ATOM   2808 C  C     . ASP B 1 82  ? 28.271  26.473  79.715  1.00 59.96  ? 124 ASP B C     1 
ATOM   2809 O  O     . ASP B 1 82  ? 28.918  25.800  80.515  1.00 59.55  ? 124 ASP B O     1 
ATOM   2810 C  CB    . ASP B 1 82  ? 28.237  28.980  79.445  1.00 57.34  ? 124 ASP B CB    1 
ATOM   2811 N  N     . LYS B 1 83  ? 27.002  26.182  79.411  1.00 61.97  ? 125 LYS B N     1 
ATOM   2812 C  CA    . LYS B 1 83  ? 26.289  25.095  80.071  1.00 52.73  ? 125 LYS B CA    1 
ATOM   2813 C  C     . LYS B 1 83  ? 26.836  23.748  79.607  1.00 58.09  ? 125 LYS B C     1 
ATOM   2814 O  O     . LYS B 1 83  ? 26.882  23.470  78.405  1.00 54.43  ? 125 LYS B O     1 
ATOM   2815 C  CB    . LYS B 1 83  ? 24.787  25.197  79.784  1.00 43.49  ? 125 LYS B CB    1 
ATOM   2816 N  N     . GLU B 1 84  ? 27.235  22.902  80.563  1.00 55.80  ? 126 GLU B N     1 
ATOM   2817 C  CA    . GLU B 1 84  ? 27.801  21.582  80.294  1.00 50.44  ? 126 GLU B CA    1 
ATOM   2818 C  C     . GLU B 1 84  ? 26.775  20.458  80.511  1.00 43.91  ? 126 GLU B C     1 
ATOM   2819 O  O     . GLU B 1 84  ? 25.817  20.598  81.273  1.00 41.33  ? 126 GLU B O     1 
ATOM   2820 C  CB    . GLU B 1 84  ? 29.029  21.360  81.180  1.00 52.85  ? 126 GLU B CB    1 
ATOM   2821 C  CG    . GLU B 1 84  ? 29.671  20.007  81.020  1.00 58.39  ? 126 GLU B CG    1 
ATOM   2822 C  CD    . GLU B 1 84  ? 31.169  20.077  80.874  1.00 63.37  ? 126 GLU B CD    1 
ATOM   2823 O  OE1   . GLU B 1 84  ? 31.711  21.194  81.030  1.00 63.54  ? 126 GLU B OE1   1 
ATOM   2824 O  OE2   . GLU B 1 84  ? 31.787  19.015  80.599  1.00 57.50  ? 126 GLU B OE2   1 
ATOM   2825 N  N     . GLY B 1 85  ? 26.978  19.340  79.812  1.00 43.65  ? 127 GLY B N     1 
ATOM   2826 C  CA    . GLY B 1 85  ? 26.066  18.213  79.891  1.00 39.11  ? 127 GLY B CA    1 
ATOM   2827 C  C     . GLY B 1 85  ? 24.694  18.470  79.285  1.00 51.98  ? 127 GLY B C     1 
ATOM   2828 O  O     . GLY B 1 85  ? 23.714  17.833  79.696  1.00 48.65  ? 127 GLY B O     1 
ATOM   2829 N  N     . TYR B 1 86  ? 24.613  19.351  78.281  1.00 39.79  ? 128 TYR B N     1 
ATOM   2830 C  CA    . TYR B 1 86  ? 23.367  19.970  77.873  1.00 43.21  ? 128 TYR B CA    1 
ATOM   2831 C  C     . TYR B 1 86  ? 23.405  20.191  76.368  1.00 44.31  ? 128 TYR B C     1 
ATOM   2832 O  O     . TYR B 1 86  ? 24.461  20.527  75.816  1.00 34.14  ? 128 TYR B O     1 
ATOM   2833 C  CB    . TYR B 1 86  ? 23.187  21.282  78.641  1.00 45.90  ? 128 TYR B CB    1 
ATOM   2834 C  CG    . TYR B 1 86  ? 22.125  22.225  78.117  1.00 39.82  ? 128 TYR B CG    1 
ATOM   2835 C  CD1   . TYR B 1 86  ? 20.774  21.996  78.352  1.00 35.82  ? 128 TYR B CD1   1 
ATOM   2836 C  CD2   . TYR B 1 86  ? 22.490  23.379  77.441  1.00 41.87  ? 128 TYR B CD2   1 
ATOM   2837 C  CE1   . TYR B 1 86  ? 19.797  22.890  77.892  1.00 43.69  ? 128 TYR B CE1   1 
ATOM   2838 C  CE2   . TYR B 1 86  ? 21.537  24.276  76.979  1.00 43.39  ? 128 TYR B CE2   1 
ATOM   2839 C  CZ    . TYR B 1 86  ? 20.189  24.035  77.203  1.00 46.48  ? 128 TYR B CZ    1 
ATOM   2840 O  OH    . TYR B 1 86  ? 19.261  24.952  76.730  1.00 41.66  ? 128 TYR B OH    1 
ATOM   2841 N  N     . SER B 1 87  ? 22.260  19.959  75.708  1.00 36.92  ? 129 SER B N     1 
ATOM   2842 C  CA    . SER B 1 87  ? 22.158  20.136  74.262  1.00 34.98  ? 129 SER B CA    1 
ATOM   2843 C  C     . SER B 1 87  ? 23.281  19.436  73.484  1.00 38.83  ? 129 SER B C     1 
ATOM   2844 O  O     . SER B 1 87  ? 23.670  18.304  73.810  1.00 42.14  ? 129 SER B O     1 
ATOM   2845 C  CB    . SER B 1 87  ? 22.155  21.622  73.949  1.00 34.27  ? 129 SER B CB    1 
ATOM   2846 O  OG    . SER B 1 87  ? 21.858  21.853  72.581  1.00 39.18  ? 129 SER B OG    1 
ATOM   2847 N  N     . GLY B 1 88  ? 23.834  20.102  72.469  1.00 32.20  ? 130 GLY B N     1 
ATOM   2848 C  CA    . GLY B 1 88  ? 24.840  19.466  71.633  1.00 34.29  ? 130 GLY B CA    1 
ATOM   2849 C  C     . GLY B 1 88  ? 24.330  18.709  70.417  1.00 35.83  ? 130 GLY B C     1 
ATOM   2850 O  O     . GLY B 1 88  ? 23.501  17.800  70.549  1.00 36.24  ? 130 GLY B O     1 
ATOM   2851 N  N     . VAL B 1 89  ? 24.827  19.062  69.223  1.00 36.81  ? 131 VAL B N     1 
ATOM   2852 C  CA    . VAL B 1 89  ? 24.515  18.352  67.986  1.00 35.69  ? 131 VAL B CA    1 
ATOM   2853 C  C     . VAL B 1 89  ? 25.800  17.924  67.286  1.00 40.01  ? 131 VAL B C     1 
ATOM   2854 O  O     . VAL B 1 89  ? 26.845  18.581  67.399  1.00 41.42  ? 131 VAL B O     1 
ATOM   2855 C  CB    . VAL B 1 89  ? 23.652  19.197  67.024  1.00 34.25  ? 131 VAL B CB    1 
ATOM   2856 C  CG1   . VAL B 1 89  ? 22.397  19.662  67.722  1.00 33.86  ? 131 VAL B CG1   1 
ATOM   2857 C  CG2   . VAL B 1 89  ? 24.440  20.386  66.508  1.00 38.84  ? 131 VAL B CG2   1 
ATOM   2858 N  N     . GLY B 1 90  ? 25.707  16.802  66.555  1.00 36.73  ? 132 GLY B N     1 
ATOM   2859 C  CA    . GLY B 1 90  ? 26.802  16.325  65.735  1.00 35.13  ? 132 GLY B CA    1 
ATOM   2860 C  C     . GLY B 1 90  ? 26.339  16.007  64.322  1.00 44.80  ? 132 GLY B C     1 
ATOM   2861 O  O     . GLY B 1 90  ? 25.164  15.722  64.072  1.00 38.12  ? 132 GLY B O     1 
ATOM   2862 N  N     . LEU B 1 91  ? 27.294  16.074  63.387  1.00 36.48  ? 133 LEU B N     1 
ATOM   2863 C  CA    . LEU B 1 91  ? 27.077  15.700  61.993  1.00 40.32  ? 133 LEU B CA    1 
ATOM   2864 C  C     . LEU B 1 91  ? 28.244  14.836  61.524  1.00 37.23  ? 133 LEU B C     1 
ATOM   2865 O  O     . LEU B 1 91  ? 29.394  15.271  61.558  1.00 48.53  ? 133 LEU B O     1 
ATOM   2866 C  CB    . LEU B 1 91  ? 26.917  16.942  61.097  1.00 41.04  ? 133 LEU B CB    1 
ATOM   2867 C  CG    . LEU B 1 91  ? 26.356  16.739  59.676  1.00 39.86  ? 133 LEU B CG    1 
ATOM   2868 C  CD1   . LEU B 1 91  ? 25.730  18.018  59.124  1.00 43.15  ? 133 LEU B CD1   1 
ATOM   2869 C  CD2   . LEU B 1 91  ? 27.434  16.283  58.718  1.00 41.84  ? 133 LEU B CD2   1 
ATOM   2870 N  N     . LEU B 1 92  ? 27.945  13.627  61.069  1.00 40.08  ? 134 LEU B N     1 
ATOM   2871 C  CA    . LEU B 1 92  ? 28.918  12.698  60.515  1.00 41.14  ? 134 LEU B CA    1 
ATOM   2872 C  C     . LEU B 1 92  ? 28.508  12.396  59.085  1.00 44.94  ? 134 LEU B C     1 
ATOM   2873 O  O     . LEU B 1 92  ? 27.344  12.072  58.834  1.00 45.05  ? 134 LEU B O     1 
ATOM   2874 C  CB    . LEU B 1 92  ? 28.970  11.397  61.311  1.00 41.12  ? 134 LEU B CB    1 
ATOM   2875 C  CG    . LEU B 1 92  ? 29.100  11.511  62.829  1.00 43.77  ? 134 LEU B CG    1 
ATOM   2876 C  CD1   . LEU B 1 92  ? 27.780  11.883  63.537  1.00 36.71  ? 134 LEU B CD1   1 
ATOM   2877 C  CD2   . LEU B 1 92  ? 29.689  10.207  63.378  1.00 40.86  ? 134 LEU B CD2   1 
ATOM   2878 N  N     . SER B 1 93  ? 29.460  12.475  58.162  1.00 44.12  ? 135 SER B N     1 
ATOM   2879 C  CA    A SER B 1 93  ? 29.188  12.266  56.748  0.29 45.78  ? 135 SER B CA    1 
ATOM   2880 C  CA    B SER B 1 93  ? 29.192  12.269  56.747  0.71 45.75  ? 135 SER B CA    1 
ATOM   2881 C  C     . SER B 1 93  ? 30.248  11.360  56.138  1.00 52.67  ? 135 SER B C     1 
ATOM   2882 O  O     . SER B 1 93  ? 31.408  11.327  56.589  1.00 40.10  ? 135 SER B O     1 
ATOM   2883 C  CB    A SER B 1 93  ? 29.137  13.598  55.980  0.29 46.49  ? 135 SER B CB    1 
ATOM   2884 C  CB    B SER B 1 93  ? 29.165  13.597  55.989  0.71 47.72  ? 135 SER B CB    1 
ATOM   2885 O  OG    A SER B 1 93  ? 30.414  14.207  55.897  0.29 47.15  ? 135 SER B OG    1 
ATOM   2886 O  OG    B SER B 1 93  ? 29.472  13.403  54.618  0.71 51.04  ? 135 SER B OG    1 
ATOM   2887 N  N     . ARG B 1 94  ? 29.831  10.634  55.085  1.00 48.70  ? 136 ARG B N     1 
ATOM   2888 C  CA    . ARG B 1 94  ? 30.737  9.725   54.392  1.00 47.63  ? 136 ARG B CA    1 
ATOM   2889 C  C     . ARG B 1 94  ? 31.809  10.497  53.637  1.00 46.79  ? 136 ARG B C     1 
ATOM   2890 O  O     . ARG B 1 94  ? 33.007  10.222  53.771  1.00 48.45  ? 136 ARG B O     1 
ATOM   2891 C  CB    . ARG B 1 94  ? 29.957  8.825   53.431  1.00 50.47  ? 136 ARG B CB    1 
ATOM   2892 C  CG    . ARG B 1 94  ? 30.835  7.691   52.915  1.00 56.31  ? 136 ARG B CG    1 
ATOM   2893 C  CD    . ARG B 1 94  ? 30.403  7.090   51.594  1.00 61.11  ? 136 ARG B CD    1 
ATOM   2894 N  NE    . ARG B 1 94  ? 29.415  6.023   51.761  1.00 65.35  ? 136 ARG B NE    1 
ATOM   2895 C  CZ    . ARG B 1 94  ? 29.696  4.770   52.114  1.00 73.18  ? 136 ARG B CZ    1 
ATOM   2896 N  NH1   . ARG B 1 94  ? 30.952  4.402   52.359  1.00 76.68  ? 136 ARG B NH1   1 
ATOM   2897 N  NH2   . ARG B 1 94  ? 28.717  3.881   52.235  1.00 73.65  ? 136 ARG B NH2   1 
ATOM   2898 N  N     . GLN B 1 95  ? 31.388  11.434  52.808  1.00 48.85  ? 137 GLN B N     1 
ATOM   2899 C  CA    . GLN B 1 95  ? 32.266  12.373  52.134  1.00 51.26  ? 137 GLN B CA    1 
ATOM   2900 C  C     . GLN B 1 95  ? 32.369  13.641  52.972  1.00 53.76  ? 137 GLN B C     1 
ATOM   2901 O  O     . GLN B 1 95  ? 31.478  13.963  53.765  1.00 49.39  ? 137 GLN B O     1 
ATOM   2902 C  CB    . GLN B 1 95  ? 31.735  12.700  50.739  1.00 43.94  ? 137 GLN B CB    1 
ATOM   2903 C  CG    . GLN B 1 95  ? 31.731  11.492  49.779  1.00 56.32  ? 137 GLN B CG    1 
ATOM   2904 C  CD    . GLN B 1 95  ? 30.811  11.659  48.577  1.00 60.44  ? 137 GLN B CD    1 
ATOM   2905 O  OE1   . GLN B 1 95  ? 30.202  10.691  48.119  1.00 69.20  ? 137 GLN B OE1   1 
ATOM   2906 N  NE2   . GLN B 1 95  ? 30.705  12.881  48.061  1.00 65.29  ? 137 GLN B NE2   1 
ATOM   2907 N  N     . ALA B 1 96  ? 33.476  14.367  52.790  1.00 50.49  ? 138 ALA B N     1 
ATOM   2908 C  CA    . ALA B 1 96  ? 33.567  15.631  53.497  1.00 45.61  ? 138 ALA B CA    1 
ATOM   2909 C  C     . ALA B 1 96  ? 32.720  16.689  52.794  1.00 41.70  ? 138 ALA B C     1 
ATOM   2910 O  O     . ALA B 1 96  ? 32.636  16.709  51.563  1.00 46.97  ? 138 ALA B O     1 
ATOM   2911 C  CB    . ALA B 1 96  ? 35.012  16.099  53.581  1.00 39.20  ? 138 ALA B CB    1 
ATOM   2912 N  N     . PRO B 1 97  ? 32.068  17.558  53.550  1.00 43.10  ? 139 PRO B N     1 
ATOM   2913 C  CA    . PRO B 1 97  ? 31.381  18.705  52.941  1.00 45.35  ? 139 PRO B CA    1 
ATOM   2914 C  C     . PRO B 1 97  ? 32.370  19.696  52.352  1.00 41.37  ? 139 PRO B C     1 
ATOM   2915 O  O     . PRO B 1 97  ? 33.563  19.673  52.642  1.00 42.81  ? 139 PRO B O     1 
ATOM   2916 C  CB    . PRO B 1 97  ? 30.605  19.326  54.110  1.00 46.21  ? 139 PRO B CB    1 
ATOM   2917 C  CG    . PRO B 1 97  ? 31.167  18.696  55.346  1.00 47.17  ? 139 PRO B CG    1 
ATOM   2918 C  CD    . PRO B 1 97  ? 31.752  17.379  54.975  1.00 42.57  ? 139 PRO B CD    1 
ATOM   2919 N  N     . LEU B 1 98  ? 31.854  20.576  51.496  1.00 40.91  ? 140 LEU B N     1 
ATOM   2920 C  CA    . LEU B 1 98  ? 32.675  21.669  50.985  1.00 43.07  ? 140 LEU B CA    1 
ATOM   2921 C  C     . LEU B 1 98  ? 32.992  22.675  52.088  1.00 41.36  ? 140 LEU B C     1 
ATOM   2922 O  O     . LEU B 1 98  ? 34.116  23.172  52.178  1.00 45.74  ? 140 LEU B O     1 
ATOM   2923 C  CB    . LEU B 1 98  ? 31.967  22.362  49.818  1.00 40.65  ? 140 LEU B CB    1 
ATOM   2924 C  CG    . LEU B 1 98  ? 31.350  21.511  48.700  1.00 47.07  ? 140 LEU B CG    1 
ATOM   2925 C  CD1   . LEU B 1 98  ? 30.368  22.331  47.871  1.00 42.08  ? 140 LEU B CD1   1 
ATOM   2926 C  CD2   . LEU B 1 98  ? 32.407  20.905  47.784  1.00 39.43  ? 140 LEU B CD2   1 
ATOM   2927 N  N     . LYS B 1 99  ? 32.018  22.984  52.940  1.00 44.00  ? 141 LYS B N     1 
ATOM   2928 C  CA    . LYS B 1 99  ? 32.143  23.999  53.982  1.00 37.39  ? 141 LYS B CA    1 
ATOM   2929 C  C     . LYS B 1 99  ? 31.252  23.574  55.145  1.00 43.86  ? 141 LYS B C     1 
ATOM   2930 O  O     . LYS B 1 99  ? 30.196  22.947  54.937  1.00 43.15  ? 141 LYS B O     1 
ATOM   2931 C  CB    . LYS B 1 99  ? 31.736  25.368  53.416  1.00 39.53  ? 141 LYS B CB    1 
ATOM   2932 C  CG    . LYS B 1 99  ? 31.810  26.559  54.345  1.00 47.78  ? 141 LYS B CG    1 
ATOM   2933 C  CD    . LYS B 1 99  ? 30.757  27.609  53.917  1.00 54.24  ? 141 LYS B CD    1 
ATOM   2934 C  CE    . LYS B 1 99  ? 31.286  29.062  53.953  1.00 51.25  ? 141 LYS B CE    1 
ATOM   2935 N  NZ    . LYS B 1 99  ? 32.159  29.412  55.139  1.00 46.72  ? 141 LYS B NZ    1 
ATOM   2936 N  N     . VAL B 1 100 ? 31.679  23.893  56.372  1.00 37.96  ? 142 VAL B N     1 
ATOM   2937 C  CA    . VAL B 1 100 ? 30.886  23.648  57.579  1.00 36.56  ? 142 VAL B CA    1 
ATOM   2938 C  C     . VAL B 1 100 ? 30.806  24.926  58.405  1.00 41.72  ? 142 VAL B C     1 
ATOM   2939 O  O     . VAL B 1 100 ? 31.796  25.657  58.526  1.00 49.57  ? 142 VAL B O     1 
ATOM   2940 C  CB    . VAL B 1 100 ? 31.481  22.501  58.414  1.00 41.84  ? 142 VAL B CB    1 
ATOM   2941 C  CG1   . VAL B 1 100 ? 30.675  22.250  59.682  1.00 38.24  ? 142 VAL B CG1   1 
ATOM   2942 C  CG2   . VAL B 1 100 ? 31.537  21.266  57.579  1.00 40.40  ? 142 VAL B CG2   1 
ATOM   2943 N  N     . SER B 1 101 ? 29.642  25.194  58.994  1.00 37.97  ? 143 SER B N     1 
ATOM   2944 C  CA    . SER B 1 101 ? 29.515  26.323  59.907  1.00 42.51  ? 143 SER B CA    1 
ATOM   2945 C  C     . SER B 1 101 ? 28.602  25.944  61.076  1.00 42.42  ? 143 SER B C     1 
ATOM   2946 O  O     . SER B 1 101 ? 27.785  25.018  60.966  1.00 35.32  ? 143 SER B O     1 
ATOM   2947 C  CB    . SER B 1 101 ? 28.996  27.552  59.165  1.00 41.14  ? 143 SER B CB    1 
ATOM   2948 O  OG    . SER B 1 101 ? 27.668  27.316  58.739  1.00 41.40  ? 143 SER B OG    1 
ATOM   2949 N  N     . TYR B 1 102 ? 28.751  26.677  62.198  1.00 33.51  ? 144 TYR B N     1 
ATOM   2950 C  CA    . TYR B 1 102 ? 28.049  26.422  63.457  1.00 30.97  ? 144 TYR B CA    1 
ATOM   2951 C  C     . TYR B 1 102 ? 27.176  27.611  63.852  1.00 35.85  ? 144 TYR B C     1 
ATOM   2952 O  O     . TYR B 1 102 ? 27.597  28.767  63.741  1.00 37.56  ? 144 TYR B O     1 
ATOM   2953 C  CB    . TYR B 1 102 ? 29.040  26.139  64.587  1.00 39.00  ? 144 TYR B CB    1 
ATOM   2954 C  CG    . TYR B 1 102 ? 29.966  25.004  64.253  1.00 43.03  ? 144 TYR B CG    1 
ATOM   2955 C  CD1   . TYR B 1 102 ? 29.506  23.698  64.261  1.00 42.70  ? 144 TYR B CD1   1 
ATOM   2956 C  CD2   . TYR B 1 102 ? 31.298  25.238  63.894  1.00 41.48  ? 144 TYR B CD2   1 
ATOM   2957 C  CE1   . TYR B 1 102 ? 30.341  22.647  63.940  1.00 44.02  ? 144 TYR B CE1   1 
ATOM   2958 C  CE2   . TYR B 1 102 ? 32.137  24.193  63.556  1.00 42.21  ? 144 TYR B CE2   1 
ATOM   2959 C  CZ    . TYR B 1 102 ? 31.655  22.891  63.590  1.00 43.82  ? 144 TYR B CZ    1 
ATOM   2960 O  OH    . TYR B 1 102 ? 32.465  21.823  63.259  1.00 41.13  ? 144 TYR B OH    1 
ATOM   2961 N  N     . GLY B 1 103 ? 25.958  27.327  64.326  1.00 31.96  ? 145 GLY B N     1 
ATOM   2962 C  CA    . GLY B 1 103 ? 25.028  28.381  64.679  1.00 32.14  ? 145 GLY B CA    1 
ATOM   2963 C  C     . GLY B 1 103 ? 24.318  28.956  63.469  1.00 43.37  ? 145 GLY B C     1 
ATOM   2964 O  O     . GLY B 1 103 ? 24.471  28.487  62.343  1.00 43.64  ? 145 GLY B O     1 
ATOM   2965 N  N     . ILE B 1 104 ? 23.519  30.002  63.707  1.00 45.67  ? 146 ILE B N     1 
ATOM   2966 C  CA    . ILE B 1 104 ? 22.689  30.612  62.672  1.00 47.03  ? 146 ILE B CA    1 
ATOM   2967 C  C     . ILE B 1 104 ? 23.062  32.063  62.406  1.00 44.78  ? 146 ILE B C     1 
ATOM   2968 O  O     . ILE B 1 104 ? 22.332  32.765  61.705  1.00 51.81  ? 146 ILE B O     1 
ATOM   2969 C  CB    . ILE B 1 104 ? 21.192  30.513  63.020  1.00 41.49  ? 146 ILE B CB    1 
ATOM   2970 C  CG1   . ILE B 1 104 ? 20.860  31.518  64.128  1.00 40.15  ? 146 ILE B CG1   1 
ATOM   2971 C  CG2   . ILE B 1 104 ? 20.855  29.103  63.436  1.00 42.11  ? 146 ILE B CG2   1 
ATOM   2972 C  CD1   . ILE B 1 104 ? 19.469  31.373  64.673  1.00 38.93  ? 146 ILE B CD1   1 
ATOM   2973 N  N     . GLY B 1 105 ? 24.167  32.538  62.967  1.00 49.52  ? 147 GLY B N     1 
ATOM   2974 C  CA    . GLY B 1 105 ? 24.618  33.887  62.714  1.00 45.17  ? 147 GLY B CA    1 
ATOM   2975 C  C     . GLY B 1 105 ? 24.094  34.925  63.670  1.00 47.84  ? 147 GLY B C     1 
ATOM   2976 O  O     . GLY B 1 105 ? 24.241  36.119  63.398  1.00 53.03  ? 147 GLY B O     1 
ATOM   2977 N  N     . ASP B 1 106 ? 23.506  34.519  64.786  1.00 46.94  ? 148 ASP B N     1 
ATOM   2978 C  CA    . ASP B 1 106 ? 22.929  35.446  65.745  1.00 48.57  ? 148 ASP B CA    1 
ATOM   2979 C  C     . ASP B 1 106 ? 23.429  35.059  67.133  1.00 47.90  ? 148 ASP B C     1 
ATOM   2980 O  O     . ASP B 1 106 ? 23.243  33.919  67.568  1.00 65.81  ? 148 ASP B O     1 
ATOM   2981 C  CB    . ASP B 1 106 ? 21.400  35.421  65.647  1.00 43.52  ? 148 ASP B CB    1 
ATOM   2982 C  CG    . ASP B 1 106 ? 20.741  36.552  66.398  1.00 48.91  ? 148 ASP B CG    1 
ATOM   2983 O  OD1   . ASP B 1 106 ? 21.355  37.075  67.354  1.00 51.14  ? 148 ASP B OD1   1 
ATOM   2984 O  OD2   . ASP B 1 106 ? 19.580  36.890  66.052  1.00 57.94  ? 148 ASP B OD2   1 
ATOM   2985 N  N     . GLU B 1 107 ? 24.079  36.006  67.808  1.00 45.61  ? 149 GLU B N     1 
ATOM   2986 C  CA    . GLU B 1 107 ? 24.790  35.704  69.046  1.00 46.17  ? 149 GLU B CA    1 
ATOM   2987 C  C     . GLU B 1 107 ? 23.857  35.123  70.095  1.00 46.81  ? 149 GLU B C     1 
ATOM   2988 O  O     . GLU B 1 107 ? 24.176  34.111  70.729  1.00 49.03  ? 149 GLU B O     1 
ATOM   2989 C  CB    . GLU B 1 107 ? 25.467  36.968  69.578  1.00 48.58  ? 149 GLU B CB    1 
ATOM   2990 C  CG    . GLU B 1 107 ? 26.235  36.790  70.868  1.00 50.53  ? 149 GLU B CG    1 
ATOM   2991 C  CD    . GLU B 1 107 ? 27.553  36.024  70.711  1.00 58.81  ? 149 GLU B CD    1 
ATOM   2992 O  OE1   . GLU B 1 107 ? 28.019  35.480  71.737  1.00 64.73  ? 149 GLU B OE1   1 
ATOM   2993 O  OE2   . GLU B 1 107 ? 28.121  35.962  69.597  1.00 53.05  ? 149 GLU B OE2   1 
ATOM   2994 N  N     . GLU B 1 108 ? 22.696  35.744  70.297  1.00 43.26  ? 150 GLU B N     1 
ATOM   2995 C  CA    . GLU B 1 108 ? 21.843  35.273  71.379  1.00 45.82  ? 150 GLU B CA    1 
ATOM   2996 C  C     . GLU B 1 108 ? 21.422  33.826  71.149  1.00 43.67  ? 150 GLU B C     1 
ATOM   2997 O  O     . GLU B 1 108 ? 21.198  33.090  72.115  1.00 43.99  ? 150 GLU B O     1 
ATOM   2998 C  CB    . GLU B 1 108 ? 20.652  36.245  71.585  1.00 45.13  ? 150 GLU B CB    1 
ATOM   2999 C  CG    . GLU B 1 108 ? 19.346  35.962  70.859  1.00 49.53  ? 150 GLU B CG    1 
ATOM   3000 C  CD    . GLU B 1 108 ? 18.117  36.742  71.423  1.00 56.68  ? 150 GLU B CD    1 
ATOM   3001 O  OE1   . GLU B 1 108 ? 18.028  37.986  71.273  1.00 55.28  ? 150 GLU B OE1   1 
ATOM   3002 O  OE2   . GLU B 1 108 ? 17.213  36.101  72.011  1.00 57.69  ? 150 GLU B OE2   1 
ATOM   3003 N  N     . HIS B 1 109 ? 21.440  33.367  69.899  1.00 45.35  ? 151 HIS B N     1 
ATOM   3004 C  CA    . HIS B 1 109 ? 20.923  32.058  69.539  1.00 39.20  ? 151 HIS B CA    1 
ATOM   3005 C  C     . HIS B 1 109 ? 22.002  31.015  69.321  1.00 41.89  ? 151 HIS B C     1 
ATOM   3006 O  O     . HIS B 1 109 ? 21.667  29.838  69.192  1.00 39.80  ? 151 HIS B O     1 
ATOM   3007 C  CB    . HIS B 1 109 ? 20.067  32.180  68.279  1.00 45.38  ? 151 HIS B CB    1 
ATOM   3008 C  CG    . HIS B 1 109 ? 18.854  33.031  68.474  1.00 46.91  ? 151 HIS B CG    1 
ATOM   3009 N  ND1   . HIS B 1 109 ? 17.933  32.780  69.468  1.00 43.40  ? 151 HIS B ND1   1 
ATOM   3010 C  CD2   . HIS B 1 109 ? 18.428  34.145  67.835  1.00 45.89  ? 151 HIS B CD2   1 
ATOM   3011 C  CE1   . HIS B 1 109 ? 16.975  33.689  69.415  1.00 48.48  ? 151 HIS B CE1   1 
ATOM   3012 N  NE2   . HIS B 1 109 ? 17.252  34.531  68.435  1.00 51.18  ? 151 HIS B NE2   1 
ATOM   3013 N  N     . ASP B 1 110 ? 23.280  31.401  69.327  1.00 42.39  ? 152 ASP B N     1 
ATOM   3014 C  CA    . ASP B 1 110 ? 24.382  30.513  68.974  1.00 45.78  ? 152 ASP B CA    1 
ATOM   3015 C  C     . ASP B 1 110 ? 25.189  30.029  70.177  1.00 48.55  ? 152 ASP B C     1 
ATOM   3016 O  O     . ASP B 1 110 ? 26.370  29.735  70.036  1.00 41.34  ? 152 ASP B O     1 
ATOM   3017 C  CB    . ASP B 1 110 ? 25.326  31.203  67.991  1.00 43.46  ? 152 ASP B CB    1 
ATOM   3018 C  CG    . ASP B 1 110 ? 24.714  31.368  66.635  1.00 44.08  ? 152 ASP B CG    1 
ATOM   3019 O  OD1   . ASP B 1 110 ? 25.141  32.249  65.851  1.00 44.54  ? 152 ASP B OD1   1 
ATOM   3020 O  OD2   . ASP B 1 110 ? 23.768  30.612  66.360  1.00 49.84  ? 152 ASP B OD2   1 
ATOM   3021 N  N     . GLN B 1 111 ? 24.597  29.909  71.360  1.00 47.86  ? 153 GLN B N     1 
ATOM   3022 C  CA    . GLN B 1 111 ? 25.409  29.572  72.526  1.00 46.62  ? 153 GLN B CA    1 
ATOM   3023 C  C     . GLN B 1 111 ? 25.080  28.227  73.167  1.00 44.79  ? 153 GLN B C     1 
ATOM   3024 O  O     . GLN B 1 111 ? 25.691  27.888  74.179  1.00 43.97  ? 153 GLN B O     1 
ATOM   3025 C  CB    . GLN B 1 111 ? 25.307  30.690  73.560  1.00 47.55  ? 153 GLN B CB    1 
ATOM   3026 C  CG    . GLN B 1 111 ? 26.067  31.924  73.115  1.00 55.02  ? 153 GLN B CG    1 
ATOM   3027 C  CD    . GLN B 1 111 ? 25.680  33.140  73.907  1.00 63.45  ? 153 GLN B CD    1 
ATOM   3028 O  OE1   . GLN B 1 111 ? 24.536  33.255  74.362  1.00 64.53  ? 153 GLN B OE1   1 
ATOM   3029 N  NE2   . GLN B 1 111 ? 26.626  34.063  74.082  1.00 59.84  ? 153 GLN B NE2   1 
ATOM   3030 N  N     . GLU B 1 112 ? 24.171  27.425  72.591  1.00 45.77  ? 154 GLU B N     1 
ATOM   3031 C  CA    . GLU B 1 112 ? 23.764  26.157  73.199  1.00 42.62  ? 154 GLU B CA    1 
ATOM   3032 C  C     . GLU B 1 112 ? 24.016  24.930  72.312  1.00 43.83  ? 154 GLU B C     1 
ATOM   3033 O  O     . GLU B 1 112 ? 23.366  23.901  72.506  1.00 44.87  ? 154 GLU B O     1 
ATOM   3034 C  CB    . GLU B 1 112 ? 22.293  26.223  73.595  1.00 34.35  ? 154 GLU B CB    1 
ATOM   3035 C  CG    . GLU B 1 112 ? 22.051  27.256  74.654  1.00 37.19  ? 154 GLU B CG    1 
ATOM   3036 C  CD    . GLU B 1 112 ? 20.599  27.423  75.015  1.00 40.82  ? 154 GLU B CD    1 
ATOM   3037 O  OE1   . GLU B 1 112 ? 19.700  26.957  74.273  1.00 49.65  ? 154 GLU B OE1   1 
ATOM   3038 O  OE2   . GLU B 1 112 ? 20.335  28.062  76.039  1.00 42.93  ? 154 GLU B OE2   1 
ATOM   3039 N  N     . GLY B 1 113 ? 24.946  25.000  71.357  1.00 39.53  ? 155 GLY B N     1 
ATOM   3040 C  CA    . GLY B 1 113 ? 25.255  23.847  70.522  1.00 43.17  ? 155 GLY B CA    1 
ATOM   3041 C  C     . GLY B 1 113 ? 24.034  23.232  69.866  1.00 44.13  ? 155 GLY B C     1 
ATOM   3042 O  O     . GLY B 1 113 ? 23.698  22.066  70.139  1.00 36.95  ? 155 GLY B O     1 
ATOM   3043 N  N     . ARG B 1 114 ? 23.336  24.009  69.020  1.00 40.53  ? 156 ARG B N     1 
ATOM   3044 C  CA    . ARG B 1 114 ? 22.085  23.529  68.448  1.00 39.09  ? 156 ARG B CA    1 
ATOM   3045 C  C     . ARG B 1 114 ? 22.060  23.418  66.934  1.00 34.37  ? 156 ARG B C     1 
ATOM   3046 O  O     . ARG B 1 114 ? 21.159  22.751  66.416  1.00 40.26  ? 156 ARG B O     1 
ATOM   3047 C  CB    . ARG B 1 114 ? 20.909  24.419  68.885  1.00 43.19  ? 156 ARG B CB    1 
ATOM   3048 C  CG    . ARG B 1 114 ? 20.660  24.457  70.396  1.00 43.50  ? 156 ARG B CG    1 
ATOM   3049 C  CD    . ARG B 1 114 ? 19.382  25.223  70.757  1.00 38.68  ? 156 ARG B CD    1 
ATOM   3050 N  NE    . ARG B 1 114 ? 19.130  25.176  72.190  1.00 38.56  ? 156 ARG B NE    1 
ATOM   3051 C  CZ    . ARG B 1 114 ? 18.399  24.251  72.801  1.00 41.05  ? 156 ARG B CZ    1 
ATOM   3052 N  NH1   . ARG B 1 114 ? 17.821  23.278  72.104  1.00 37.85  ? 156 ARG B NH1   1 
ATOM   3053 N  NH2   . ARG B 1 114 ? 18.252  24.295  74.120  1.00 39.71  ? 156 ARG B NH2   1 
ATOM   3054 N  N     . VAL B 1 115 ? 22.986  24.037  66.201  1.00 32.38  ? 157 VAL B N     1 
ATOM   3055 C  CA    . VAL B 1 115 ? 22.874  24.069  64.740  1.00 37.51  ? 157 VAL B CA    1 
ATOM   3056 C  C     . VAL B 1 115 ? 24.231  23.808  64.096  1.00 39.75  ? 157 VAL B C     1 
ATOM   3057 O  O     . VAL B 1 115 ? 25.218  24.492  64.401  1.00 36.75  ? 157 VAL B O     1 
ATOM   3058 C  CB    . VAL B 1 115 ? 22.287  25.402  64.224  1.00 35.54  ? 157 VAL B CB    1 
ATOM   3059 C  CG1   . VAL B 1 115 ? 22.530  25.546  62.716  1.00 36.10  ? 157 VAL B CG1   1 
ATOM   3060 C  CG2   . VAL B 1 115 ? 20.795  25.494  64.519  1.00 32.37  ? 157 VAL B CG2   1 
ATOM   3061 N  N     . ILE B 1 116 ? 24.269  22.840  63.179  1.00 36.60  ? 158 ILE B N     1 
ATOM   3062 C  CA    . ILE B 1 116 ? 25.391  22.645  62.273  1.00 38.05  ? 158 ILE B CA    1 
ATOM   3063 C  C     . ILE B 1 116 ? 24.866  22.826  60.853  1.00 39.82  ? 158 ILE B C     1 
ATOM   3064 O  O     . ILE B 1 116 ? 23.804  22.300  60.513  1.00 39.88  ? 158 ILE B O     1 
ATOM   3065 C  CB    . ILE B 1 116 ? 26.046  21.262  62.445  1.00 37.87  ? 158 ILE B CB    1 
ATOM   3066 C  CG1   . ILE B 1 116 ? 26.701  21.132  63.827  1.00 47.75  ? 158 ILE B CG1   1 
ATOM   3067 C  CG2   . ILE B 1 116 ? 27.099  21.035  61.389  1.00 37.17  ? 158 ILE B CG2   1 
ATOM   3068 C  CD1   . ILE B 1 116 ? 27.192  19.702  64.153  1.00 39.53  ? 158 ILE B CD1   1 
ATOM   3069 N  N     . VAL B 1 117 ? 25.600  23.579  60.041  1.00 41.02  ? 159 VAL B N     1 
ATOM   3070 C  CA    . VAL B 1 117 ? 25.295  23.798  58.630  1.00 38.07  ? 159 VAL B CA    1 
ATOM   3071 C  C     . VAL B 1 117 ? 26.398  23.144  57.798  1.00 42.22  ? 159 VAL B C     1 
ATOM   3072 O  O     . VAL B 1 117 ? 27.585  23.402  58.018  1.00 42.76  ? 159 VAL B O     1 
ATOM   3073 C  CB    . VAL B 1 117 ? 25.157  25.299  58.311  1.00 37.45  ? 159 VAL B CB    1 
ATOM   3074 C  CG1   . VAL B 1 117 ? 24.681  25.504  56.874  1.00 44.13  ? 159 VAL B CG1   1 
ATOM   3075 C  CG2   . VAL B 1 117 ? 24.137  25.949  59.232  1.00 35.02  ? 159 VAL B CG2   1 
ATOM   3076 N  N     . ALA B 1 118 ? 26.015  22.269  56.871  1.00 42.13  ? 160 ALA B N     1 
ATOM   3077 C  CA    . ALA B 1 118 ? 26.979  21.559  56.035  1.00 42.67  ? 160 ALA B CA    1 
ATOM   3078 C  C     . ALA B 1 118 ? 26.564  21.711  54.579  1.00 39.33  ? 160 ALA B C     1 
ATOM   3079 O  O     . ALA B 1 118 ? 25.455  21.306  54.199  1.00 41.28  ? 160 ALA B O     1 
ATOM   3080 C  CB    . ALA B 1 118 ? 27.072  20.085  56.422  1.00 34.11  ? 160 ALA B CB    1 
ATOM   3081 N  N     . GLU B 1 119 ? 27.447  22.308  53.780  1.00 39.11  ? 161 GLU B N     1 
ATOM   3082 C  CA    . GLU B 1 119 ? 27.225  22.562  52.362  1.00 38.97  ? 161 GLU B CA    1 
ATOM   3083 C  C     . GLU B 1 119 ? 27.863  21.458  51.533  1.00 44.18  ? 161 GLU B C     1 
ATOM   3084 O  O     . GLU B 1 119 ? 29.046  21.149  51.716  1.00 45.59  ? 161 GLU B O     1 
ATOM   3085 C  CB    . GLU B 1 119 ? 27.794  23.919  51.939  1.00 41.84  ? 161 GLU B CB    1 
ATOM   3086 C  CG    . GLU B 1 119 ? 27.482  24.269  50.473  1.00 46.05  ? 161 GLU B CG    1 
ATOM   3087 C  CD    . GLU B 1 119 ? 28.056  25.596  50.028  1.00 60.84  ? 161 GLU B CD    1 
ATOM   3088 O  OE1   . GLU B 1 119 ? 27.416  26.649  50.271  1.00 68.66  ? 161 GLU B OE1   1 
ATOM   3089 O  OE2   . GLU B 1 119 ? 29.148  25.585  49.419  1.00 64.86  ? 161 GLU B OE2   1 
ATOM   3090 N  N     . PHE B 1 120 ? 27.075  20.867  50.631  1.00 40.23  ? 162 PHE B N     1 
ATOM   3091 C  CA    . PHE B 1 120 ? 27.501  19.844  49.680  1.00 44.64  ? 162 PHE B CA    1 
ATOM   3092 C  C     . PHE B 1 120 ? 27.338  20.371  48.264  1.00 41.02  ? 162 PHE B C     1 
ATOM   3093 O  O     . PHE B 1 120 ? 26.957  21.522  48.049  1.00 42.41  ? 162 PHE B O     1 
ATOM   3094 C  CB    . PHE B 1 120 ? 26.713  18.549  49.860  1.00 43.74  ? 162 PHE B CB    1 
ATOM   3095 C  CG    . PHE B 1 120 ? 26.933  17.898  51.197  1.00 42.98  ? 162 PHE B CG    1 
ATOM   3096 C  CD1   . PHE B 1 120 ? 26.143  18.241  52.290  1.00 44.15  ? 162 PHE B CD1   1 
ATOM   3097 C  CD2   . PHE B 1 120 ? 27.927  16.944  51.361  1.00 44.79  ? 162 PHE B CD2   1 
ATOM   3098 C  CE1   . PHE B 1 120 ? 26.332  17.650  53.525  1.00 42.61  ? 162 PHE B CE1   1 
ATOM   3099 C  CE2   . PHE B 1 120 ? 28.139  16.348  52.604  1.00 49.69  ? 162 PHE B CE2   1 
ATOM   3100 C  CZ    . PHE B 1 120 ? 27.343  16.704  53.686  1.00 48.96  ? 162 PHE B CZ    1 
ATOM   3101 N  N     . ASP B 1 121 ? 27.657  19.514  47.292  1.00 46.95  ? 163 ASP B N     1 
ATOM   3102 C  CA    . ASP B 1 121 ? 27.583  19.919  45.889  1.00 43.86  ? 163 ASP B CA    1 
ATOM   3103 C  C     . ASP B 1 121 ? 26.166  20.316  45.503  1.00 51.29  ? 163 ASP B C     1 
ATOM   3104 O  O     . ASP B 1 121 ? 25.943  21.395  44.937  1.00 49.91  ? 163 ASP B O     1 
ATOM   3105 C  CB    . ASP B 1 121 ? 28.070  18.790  44.986  1.00 43.32  ? 163 ASP B CB    1 
ATOM   3106 C  CG    . ASP B 1 121 ? 29.569  18.612  45.033  1.00 61.91  ? 163 ASP B CG    1 
ATOM   3107 O  OD1   . ASP B 1 121 ? 30.280  19.631  45.218  1.00 62.73  ? 163 ASP B OD1   1 
ATOM   3108 O  OD2   . ASP B 1 121 ? 30.039  17.454  44.897  1.00 65.19  ? 163 ASP B OD2   1 
ATOM   3109 N  N     . SER B 1 122 ? 25.187  19.459  45.808  1.00 46.31  ? 164 SER B N     1 
ATOM   3110 C  CA    . SER B 1 122 ? 23.836  19.657  45.288  1.00 54.45  ? 164 SER B CA    1 
ATOM   3111 C  C     . SER B 1 122 ? 22.938  20.482  46.197  1.00 55.12  ? 164 SER B C     1 
ATOM   3112 O  O     . SER B 1 122 ? 21.942  21.023  45.700  1.00 49.69  ? 164 SER B O     1 
ATOM   3113 C  CB    . SER B 1 122 ? 23.155  18.308  45.039  1.00 52.49  ? 164 SER B CB    1 
ATOM   3114 O  OG    . SER B 1 122 ? 24.008  17.437  44.307  1.00 65.38  ? 164 SER B OG    1 
ATOM   3115 N  N     . PHE B 1 123 ? 23.255  20.582  47.499  1.00 48.20  ? 165 PHE B N     1 
ATOM   3116 C  CA    . PHE B 1 123 ? 22.354  21.153  48.499  1.00 43.33  ? 165 PHE B CA    1 
ATOM   3117 C  C     . PHE B 1 123 ? 23.105  21.472  49.798  1.00 42.00  ? 165 PHE B C     1 
ATOM   3118 O  O     . PHE B 1 123 ? 24.263  21.091  49.996  1.00 36.88  ? 165 PHE B O     1 
ATOM   3119 C  CB    . PHE B 1 123 ? 21.206  20.195  48.805  1.00 44.37  ? 165 PHE B CB    1 
ATOM   3120 C  CG    . PHE B 1 123 ? 21.623  19.010  49.629  1.00 43.36  ? 165 PHE B CG    1 
ATOM   3121 C  CD1   . PHE B 1 123 ? 22.286  17.947  49.047  1.00 42.63  ? 165 PHE B CD1   1 
ATOM   3122 C  CD2   . PHE B 1 123 ? 21.359  18.970  50.987  1.00 38.41  ? 165 PHE B CD2   1 
ATOM   3123 C  CE1   . PHE B 1 123 ? 22.691  16.850  49.809  1.00 50.25  ? 165 PHE B CE1   1 
ATOM   3124 C  CE2   . PHE B 1 123 ? 21.755  17.890  51.751  1.00 46.46  ? 165 PHE B CE2   1 
ATOM   3125 C  CZ    . PHE B 1 123 ? 22.432  16.825  51.168  1.00 45.88  ? 165 PHE B CZ    1 
ATOM   3126 N  N     . VAL B 1 124 ? 22.399  22.157  50.696  1.00 41.25  ? 166 VAL B N     1 
ATOM   3127 C  CA    . VAL B 1 124 ? 22.872  22.459  52.040  1.00 45.37  ? 166 VAL B CA    1 
ATOM   3128 C  C     . VAL B 1 124 ? 22.075  21.627  53.036  1.00 40.55  ? 166 VAL B C     1 
ATOM   3129 O  O     . VAL B 1 124 ? 20.862  21.443  52.885  1.00 44.14  ? 166 VAL B O     1 
ATOM   3130 C  CB    . VAL B 1 124 ? 22.751  23.958  52.369  1.00 44.29  ? 166 VAL B CB    1 
ATOM   3131 C  CG1   . VAL B 1 124 ? 23.709  24.324  53.501  1.00 43.36  ? 166 VAL B CG1   1 
ATOM   3132 C  CG2   . VAL B 1 124 ? 23.048  24.770  51.161  1.00 50.01  ? 166 VAL B CG2   1 
ATOM   3133 N  N     . LEU B 1 125 ? 22.763  21.113  54.050  1.00 46.63  ? 167 LEU B N     1 
ATOM   3134 C  CA    . LEU B 1 125 ? 22.128  20.357  55.123  1.00 39.13  ? 167 LEU B CA    1 
ATOM   3135 C  C     . LEU B 1 125 ? 22.238  21.178  56.390  1.00 36.42  ? 167 LEU B C     1 
ATOM   3136 O  O     . LEU B 1 125 ? 23.320  21.640  56.738  1.00 47.47  ? 167 LEU B O     1 
ATOM   3137 C  CB    . LEU B 1 125 ? 22.770  18.989  55.300  1.00 32.38  ? 167 LEU B CB    1 
ATOM   3138 C  CG    . LEU B 1 125 ? 22.384  18.195  56.538  1.00 38.70  ? 167 LEU B CG    1 
ATOM   3139 C  CD1   . LEU B 1 125 ? 20.889  18.067  56.645  1.00 45.15  ? 167 LEU B CD1   1 
ATOM   3140 C  CD2   . LEU B 1 125 ? 22.979  16.837  56.435  1.00 35.61  ? 167 LEU B CD2   1 
ATOM   3141 N  N     . VAL B 1 126 ? 21.111  21.433  57.021  1.00 36.68  ? 168 VAL B N     1 
ATOM   3142 C  CA    . VAL B 1 126 ? 21.051  22.033  58.337  1.00 37.93  ? 168 VAL B CA    1 
ATOM   3143 C  C     . VAL B 1 126 ? 20.498  20.963  59.264  1.00 37.03  ? 168 VAL B C     1 
ATOM   3144 O  O     . VAL B 1 126 ? 19.465  20.346  58.966  1.00 38.14  ? 168 VAL B O     1 
ATOM   3145 C  CB    . VAL B 1 126 ? 20.171  23.301  58.356  1.00 35.43  ? 168 VAL B CB    1 
ATOM   3146 C  CG1   . VAL B 1 126 ? 20.019  23.840  59.788  1.00 38.73  ? 168 VAL B CG1   1 
ATOM   3147 C  CG2   . VAL B 1 126 ? 20.742  24.365  57.463  1.00 40.34  ? 168 VAL B CG2   1 
ATOM   3148 N  N     . THR B 1 127 ? 21.192  20.715  60.365  1.00 39.78  ? 169 THR B N     1 
ATOM   3149 C  CA    . THR B 1 127 ? 20.612  19.919  61.429  1.00 34.36  ? 169 THR B CA    1 
ATOM   3150 C  C     . THR B 1 127 ? 20.418  20.807  62.646  1.00 34.75  ? 169 THR B C     1 
ATOM   3151 O  O     . THR B 1 127 ? 21.235  21.687  62.929  1.00 40.18  ? 169 THR B O     1 
ATOM   3152 C  CB    . THR B 1 127 ? 21.448  18.695  61.754  1.00 38.13  ? 169 THR B CB    1 
ATOM   3153 O  OG1   . THR B 1 127 ? 20.666  17.840  62.597  1.00 39.70  ? 169 THR B OG1   1 
ATOM   3154 C  CG2   . THR B 1 127 ? 22.744  19.074  62.480  1.00 41.66  ? 169 THR B CG2   1 
ATOM   3155 N  N     . ALA B 1 128 ? 19.312  20.608  63.336  1.00 34.03  ? 170 ALA B N     1 
ATOM   3156 C  CA    . ALA B 1 128 ? 18.921  21.539  64.373  1.00 39.32  ? 170 ALA B CA    1 
ATOM   3157 C  C     . ALA B 1 128 ? 18.352  20.769  65.555  1.00 40.48  ? 170 ALA B C     1 
ATOM   3158 O  O     . ALA B 1 128 ? 17.678  19.743  65.378  1.00 42.24  ? 170 ALA B O     1 
ATOM   3159 C  CB    . ALA B 1 128 ? 17.906  22.572  63.837  1.00 36.06  ? 170 ALA B CB    1 
ATOM   3160 N  N     . TYR B 1 129 ? 18.661  21.257  66.758  1.00 35.05  ? 171 TYR B N     1 
ATOM   3161 C  CA    . TYR B 1 129 ? 18.005  20.845  67.992  1.00 32.00  ? 171 TYR B CA    1 
ATOM   3162 C  C     . TYR B 1 129 ? 17.388  22.123  68.554  1.00 36.44  ? 171 TYR B C     1 
ATOM   3163 O  O     . TYR B 1 129 ? 18.031  22.868  69.289  1.00 37.67  ? 171 TYR B O     1 
ATOM   3164 C  CB    . TYR B 1 129 ? 18.966  20.199  68.923  1.00 39.24  ? 171 TYR B CB    1 
ATOM   3165 C  CG    . TYR B 1 129 ? 18.395  19.876  70.273  1.00 39.54  ? 171 TYR B CG    1 
ATOM   3166 C  CD1   . TYR B 1 129 ? 17.278  19.060  70.404  1.00 42.23  ? 171 TYR B CD1   1 
ATOM   3167 C  CD2   . TYR B 1 129 ? 18.973  20.393  71.426  1.00 40.82  ? 171 TYR B CD2   1 
ATOM   3168 C  CE1   . TYR B 1 129 ? 16.751  18.775  71.661  1.00 42.91  ? 171 TYR B CE1   1 
ATOM   3169 C  CE2   . TYR B 1 129 ? 18.471  20.110  72.673  1.00 38.20  ? 171 TYR B CE2   1 
ATOM   3170 C  CZ    . TYR B 1 129 ? 17.366  19.306  72.791  1.00 45.73  ? 171 TYR B CZ    1 
ATOM   3171 O  OH    . TYR B 1 129 ? 16.879  19.047  74.044  1.00 50.68  ? 171 TYR B OH    1 
ATOM   3172 N  N     . VAL B 1 130 ? 16.137  22.366  68.169  1.00 39.16  ? 172 VAL B N     1 
ATOM   3173 C  CA    . VAL B 1 130 ? 15.348  23.569  68.433  1.00 32.55  ? 172 VAL B CA    1 
ATOM   3174 C  C     . VAL B 1 130 ? 15.033  23.606  69.926  1.00 34.43  ? 172 VAL B C     1 
ATOM   3175 O  O     . VAL B 1 130 ? 14.882  22.552  70.565  1.00 34.95  ? 172 VAL B O     1 
ATOM   3176 C  CB    . VAL B 1 130 ? 14.085  23.576  67.529  1.00 39.38  ? 172 VAL B CB    1 
ATOM   3177 C  CG1   . VAL B 1 130 ? 12.972  24.544  68.019  1.00 34.34  ? 172 VAL B CG1   1 
ATOM   3178 C  CG2   . VAL B 1 130 ? 14.455  23.896  66.071  1.00 31.18  ? 172 VAL B CG2   1 
ATOM   3179 N  N     . PRO B 1 131 ? 14.983  24.786  70.546  1.00 37.75  ? 173 PRO B N     1 
ATOM   3180 C  CA    . PRO B 1 131 ? 14.807  24.852  72.009  1.00 26.16  ? 173 PRO B CA    1 
ATOM   3181 C  C     . PRO B 1 131 ? 13.374  24.548  72.423  1.00 34.30  ? 173 PRO B C     1 
ATOM   3182 O  O     . PRO B 1 131 ? 12.434  25.235  72.014  1.00 38.47  ? 173 PRO B O     1 
ATOM   3183 C  CB    . PRO B 1 131 ? 15.205  26.290  72.356  1.00 31.22  ? 173 PRO B CB    1 
ATOM   3184 C  CG    . PRO B 1 131 ? 15.308  27.037  71.063  1.00 37.15  ? 173 PRO B CG    1 
ATOM   3185 C  CD    . PRO B 1 131 ? 15.425  26.058  69.945  1.00 32.87  ? 173 PRO B CD    1 
ATOM   3186 N  N     . ASN B 1 132 ? 13.217  23.493  73.224  1.00 36.75  ? 174 ASN B N     1 
ATOM   3187 C  CA    . ASN B 1 132 ? 11.960  23.154  73.874  1.00 30.70  ? 174 ASN B CA    1 
ATOM   3188 C  C     . ASN B 1 132 ? 11.425  24.328  74.684  1.00 34.07  ? 174 ASN B C     1 
ATOM   3189 O  O     . ASN B 1 132 ? 12.178  25.098  75.283  1.00 34.64  ? 174 ASN B O     1 
ATOM   3190 C  CB    . ASN B 1 132 ? 12.157  21.937  74.790  1.00 38.89  ? 174 ASN B CB    1 
ATOM   3191 C  CG    . ASN B 1 132 ? 10.834  21.308  75.243  1.00 38.19  ? 174 ASN B CG    1 
ATOM   3192 O  OD1   . ASN B 1 132 ? 10.162  21.799  76.141  1.00 36.73  ? 174 ASN B OD1   1 
ATOM   3193 N  ND2   . ASN B 1 132 ? 10.489  20.197  74.634  1.00 36.39  ? 174 ASN B ND2   1 
ATOM   3194 N  N     . ALA B 1 133 ? 10.102  24.465  74.686  1.00 34.21  ? 175 ALA B N     1 
ATOM   3195 C  CA    . ALA B 1 133 ? 9.477   25.605  75.318  1.00 33.03  ? 175 ALA B CA    1 
ATOM   3196 C  C     . ALA B 1 133 ? 9.410   25.410  76.811  1.00 35.07  ? 175 ALA B C     1 
ATOM   3197 O  O     . ALA B 1 133 ? 9.239   26.386  77.558  1.00 38.42  ? 175 ALA B O     1 
ATOM   3198 C  CB    . ALA B 1 133 ? 8.081   25.843  74.725  1.00 32.67  ? 175 ALA B CB    1 
ATOM   3199 N  N     . GLY B 1 134 ? 9.558   24.178  77.257  1.00 35.15  ? 176 GLY B N     1 
ATOM   3200 C  CA    . GLY B 1 134 ? 9.803   23.939  78.661  1.00 31.34  ? 176 GLY B CA    1 
ATOM   3201 C  C     . GLY B 1 134 ? 8.560   23.506  79.400  1.00 41.22  ? 176 GLY B C     1 
ATOM   3202 O  O     . GLY B 1 134 ? 7.423   23.824  79.029  1.00 40.36  ? 176 GLY B O     1 
ATOM   3203 N  N     . ARG B 1 135 ? 8.775   22.726  80.447  1.00 45.92  ? 177 ARG B N     1 
ATOM   3204 C  CA    . ARG B 1 135 ? 7.737   22.516  81.428  1.00 40.68  ? 177 ARG B CA    1 
ATOM   3205 C  C     . ARG B 1 135 ? 7.323   23.879  81.985  1.00 41.65  ? 177 ARG B C     1 
ATOM   3206 O  O     . ARG B 1 135 ? 8.153   24.774  82.151  1.00 38.13  ? 177 ARG B O     1 
ATOM   3207 C  CB    . ARG B 1 135 ? 8.275   21.578  82.503  1.00 40.55  ? 177 ARG B CB    1 
ATOM   3208 C  CG    . ARG B 1 135 ? 7.274   21.114  83.506  1.00 48.04  ? 177 ARG B CG    1 
ATOM   3209 C  CD    . ARG B 1 135 ? 7.849   20.012  84.356  1.00 51.40  ? 177 ARG B CD    1 
ATOM   3210 N  NE    . ARG B 1 135 ? 7.809   18.728  83.664  1.00 57.87  ? 177 ARG B NE    1 
ATOM   3211 C  CZ    . ARG B 1 135 ? 7.902   17.559  84.288  1.00 56.76  ? 177 ARG B CZ    1 
ATOM   3212 N  NH1   . ARG B 1 135 ? 7.854   16.420  83.605  1.00 55.14  ? 177 ARG B NH1   1 
ATOM   3213 N  NH2   . ARG B 1 135 ? 8.034   17.532  85.603  1.00 56.72  ? 177 ARG B NH2   1 
ATOM   3214 N  N     . GLY B 1 136 ? 6.021   24.071  82.194  1.00 43.16  ? 178 GLY B N     1 
ATOM   3215 C  CA    . GLY B 1 136 ? 5.527   25.370  82.606  1.00 36.07  ? 178 GLY B CA    1 
ATOM   3216 C  C     . GLY B 1 136 ? 5.592   26.452  81.548  1.00 48.06  ? 178 GLY B C     1 
ATOM   3217 O  O     . GLY B 1 136 ? 5.185   27.595  81.824  1.00 43.89  ? 178 GLY B O     1 
ATOM   3218 N  N     . LEU B 1 137 ? 6.077   26.135  80.343  1.00 43.51  ? 179 LEU B N     1 
ATOM   3219 C  CA    . LEU B 1 137 ? 6.243   27.115  79.271  1.00 44.05  ? 179 LEU B CA    1 
ATOM   3220 C  C     . LEU B 1 137 ? 7.273   28.181  79.640  1.00 41.42  ? 179 LEU B C     1 
ATOM   3221 O  O     . LEU B 1 137 ? 7.226   29.307  79.141  1.00 46.94  ? 179 LEU B O     1 
ATOM   3222 C  CB    . LEU B 1 137 ? 4.902   27.760  78.893  1.00 33.60  ? 179 LEU B CB    1 
ATOM   3223 C  CG    . LEU B 1 137 ? 3.875   26.743  78.379  1.00 41.79  ? 179 LEU B CG    1 
ATOM   3224 C  CD1   . LEU B 1 137 ? 2.605   27.428  77.904  1.00 49.14  ? 179 LEU B CD1   1 
ATOM   3225 C  CD2   . LEU B 1 137 ? 4.462   25.908  77.253  1.00 35.50  ? 179 LEU B CD2   1 
ATOM   3226 N  N     . VAL B 1 138 ? 8.218   27.836  80.509  1.00 41.87  ? 180 VAL B N     1 
ATOM   3227 C  CA    . VAL B 1 138 ? 9.139   28.847  81.019  1.00 47.40  ? 180 VAL B CA    1 
ATOM   3228 C  C     . VAL B 1 138 ? 10.038  29.435  79.921  1.00 53.79  ? 180 VAL B C     1 
ATOM   3229 O  O     . VAL B 1 138 ? 10.541  30.559  80.065  1.00 51.50  ? 180 VAL B O     1 
ATOM   3230 C  CB    . VAL B 1 138 ? 9.962   28.235  82.160  1.00 37.15  ? 180 VAL B CB    1 
ATOM   3231 C  CG1   . VAL B 1 138 ? 10.912  27.177  81.615  1.00 44.21  ? 180 VAL B CG1   1 
ATOM   3232 C  CG2   . VAL B 1 138 ? 10.690  29.312  82.905  1.00 54.62  ? 180 VAL B CG2   1 
ATOM   3233 N  N     . ARG B 1 139 ? 10.219  28.721  78.805  1.00 43.89  ? 181 ARG B N     1 
ATOM   3234 C  CA    . ARG B 1 139 ? 11.048  29.180  77.700  1.00 43.96  ? 181 ARG B CA    1 
ATOM   3235 C  C     . ARG B 1 139 ? 10.227  29.566  76.460  1.00 47.01  ? 181 ARG B C     1 
ATOM   3236 O  O     . ARG B 1 139 ? 10.805  29.816  75.392  1.00 44.36  ? 181 ARG B O     1 
ATOM   3237 C  CB    . ARG B 1 139 ? 12.080  28.098  77.353  1.00 41.24  ? 181 ARG B CB    1 
ATOM   3238 C  CG    . ARG B 1 139 ? 13.170  27.886  78.414  1.00 41.93  ? 181 ARG B CG    1 
ATOM   3239 C  CD    . ARG B 1 139 ? 14.503  28.476  77.959  1.00 42.35  ? 181 ARG B CD    1 
ATOM   3240 N  NE    . ARG B 1 139 ? 15.122  27.708  76.872  1.00 38.99  ? 181 ARG B NE    1 
ATOM   3241 C  CZ    . ARG B 1 139 ? 16.344  27.941  76.380  1.00 47.75  ? 181 ARG B CZ    1 
ATOM   3242 N  NH1   . ARG B 1 139 ? 17.096  28.924  76.862  1.00 37.22  ? 181 ARG B NH1   1 
ATOM   3243 N  NH2   . ARG B 1 139 ? 16.828  27.182  75.398  1.00 44.48  ? 181 ARG B NH2   1 
ATOM   3244 N  N     . LEU B 1 140 ? 8.898   29.659  76.585  1.00 39.75  ? 182 LEU B N     1 
ATOM   3245 C  CA    . LEU B 1 140 ? 8.051   29.858  75.414  1.00 39.63  ? 182 LEU B CA    1 
ATOM   3246 C  C     . LEU B 1 140 ? 8.385   31.151  74.677  1.00 44.23  ? 182 LEU B C     1 
ATOM   3247 O  O     . LEU B 1 140 ? 8.377   31.190  73.437  1.00 42.90  ? 182 LEU B O     1 
ATOM   3248 C  CB    . LEU B 1 140 ? 6.579   29.838  75.827  1.00 43.68  ? 182 LEU B CB    1 
ATOM   3249 C  CG    . LEU B 1 140 ? 5.556   29.973  74.700  1.00 48.55  ? 182 LEU B CG    1 
ATOM   3250 C  CD1   . LEU B 1 140 ? 5.814   28.914  73.637  1.00 39.37  ? 182 LEU B CD1   1 
ATOM   3251 C  CD2   . LEU B 1 140 ? 4.125   29.874  75.267  1.00 46.55  ? 182 LEU B CD2   1 
ATOM   3252 N  N     . GLU B 1 141 ? 8.694   32.220  75.410  1.00 43.39  ? 183 GLU B N     1 
ATOM   3253 C  CA    . GLU B 1 141 ? 8.979   33.475  74.729  1.00 47.65  ? 183 GLU B CA    1 
ATOM   3254 C  C     . GLU B 1 141 ? 10.347  33.447  74.056  1.00 46.29  ? 183 GLU B C     1 
ATOM   3255 O  O     . GLU B 1 141 ? 10.516  34.040  72.979  1.00 40.83  ? 183 GLU B O     1 
ATOM   3256 C  CB    . GLU B 1 141 ? 8.876   34.650  75.701  1.00 53.97  ? 183 GLU B CB    1 
ATOM   3257 C  CG    . GLU B 1 141 ? 10.207  35.129  76.246  1.00 57.60  ? 183 GLU B CG    1 
ATOM   3258 C  CD    . GLU B 1 141 ? 10.125  36.511  76.854  1.00 65.09  ? 183 GLU B CD    1 
ATOM   3259 O  OE1   . GLU B 1 141 ? 10.827  36.777  77.856  1.00 67.91  ? 183 GLU B OE1   1 
ATOM   3260 O  OE2   . GLU B 1 141 ? 9.345   37.327  76.327  1.00 70.33  ? 183 GLU B OE2   1 
ATOM   3261 N  N     . TYR B 1 142 ? 11.328  32.751  74.651  1.00 47.34  ? 184 TYR B N     1 
ATOM   3262 C  CA    . TYR B 1 142 ? 12.615  32.591  73.970  1.00 43.16  ? 184 TYR B CA    1 
ATOM   3263 C  C     . TYR B 1 142 ? 12.448  31.754  72.696  1.00 45.22  ? 184 TYR B C     1 
ATOM   3264 O  O     . TYR B 1 142 ? 13.036  32.070  71.654  1.00 42.79  ? 184 TYR B O     1 
ATOM   3265 C  CB    . TYR B 1 142 ? 13.663  31.967  74.910  1.00 42.22  ? 184 TYR B CB    1 
ATOM   3266 C  CG    . TYR B 1 142 ? 14.932  31.658  74.163  1.00 40.93  ? 184 TYR B CG    1 
ATOM   3267 C  CD1   . TYR B 1 142 ? 15.756  32.692  73.717  1.00 39.11  ? 184 TYR B CD1   1 
ATOM   3268 C  CD2   . TYR B 1 142 ? 15.266  30.353  73.823  1.00 40.62  ? 184 TYR B CD2   1 
ATOM   3269 C  CE1   . TYR B 1 142 ? 16.886  32.444  72.964  1.00 41.22  ? 184 TYR B CE1   1 
ATOM   3270 C  CE2   . TYR B 1 142 ? 16.415  30.079  73.078  1.00 43.62  ? 184 TYR B CE2   1 
ATOM   3271 C  CZ    . TYR B 1 142 ? 17.217  31.138  72.645  1.00 46.20  ? 184 TYR B CZ    1 
ATOM   3272 O  OH    . TYR B 1 142 ? 18.364  30.915  71.918  1.00 53.24  ? 184 TYR B OH    1 
ATOM   3273 N  N     . ARG B 1 143 ? 11.631  30.693  72.766  1.00 40.02  ? 185 ARG B N     1 
ATOM   3274 C  CA    . ARG B 1 143 ? 11.299  29.873  71.602  1.00 40.25  ? 185 ARG B CA    1 
ATOM   3275 C  C     . ARG B 1 143 ? 10.807  30.721  70.432  1.00 42.09  ? 185 ARG B C     1 
ATOM   3276 O  O     . ARG B 1 143 ? 11.193  30.499  69.274  1.00 32.78  ? 185 ARG B O     1 
ATOM   3277 C  CB    . ARG B 1 143 ? 10.233  28.849  72.008  1.00 39.41  ? 185 ARG B CB    1 
ATOM   3278 C  CG    . ARG B 1 143 ? 9.613   28.060  70.845  1.00 43.27  ? 185 ARG B CG    1 
ATOM   3279 C  CD    . ARG B 1 143 ? 10.675  27.393  70.029  1.00 37.99  ? 185 ARG B CD    1 
ATOM   3280 N  NE    . ARG B 1 143 ? 10.105  26.620  68.952  1.00 37.08  ? 185 ARG B NE    1 
ATOM   3281 C  CZ    . ARG B 1 143 ? 9.724   25.360  69.077  1.00 39.50  ? 185 ARG B CZ    1 
ATOM   3282 N  NH1   . ARG B 1 143 ? 9.861   24.748  70.252  1.00 39.17  ? 185 ARG B NH1   1 
ATOM   3283 N  NH2   . ARG B 1 143 ? 9.214   24.718  68.031  1.00 36.80  ? 185 ARG B NH2   1 
ATOM   3284 N  N     . GLN B 1 144 ? 9.947   31.695  70.719  1.00 42.15  ? 186 GLN B N     1 
ATOM   3285 C  CA    . GLN B 1 144 ? 9.368   32.514  69.664  1.00 42.36  ? 186 GLN B CA    1 
ATOM   3286 C  C     . GLN B 1 144 ? 10.419  33.404  69.025  1.00 39.36  ? 186 GLN B C     1 
ATOM   3287 O  O     . GLN B 1 144 ? 10.445  33.552  67.801  1.00 42.53  ? 186 GLN B O     1 
ATOM   3288 C  CB    . GLN B 1 144 ? 8.214   33.338  70.232  1.00 41.94  ? 186 GLN B CB    1 
ATOM   3289 C  CG    . GLN B 1 144 ? 7.111   32.464  70.792  1.00 40.55  ? 186 GLN B CG    1 
ATOM   3290 C  CD    . GLN B 1 144 ? 5.950   33.254  71.353  1.00 51.42  ? 186 GLN B CD    1 
ATOM   3291 O  OE1   . GLN B 1 144 ? 5.124   33.790  70.603  1.00 56.89  ? 186 GLN B OE1   1 
ATOM   3292 N  NE2   . GLN B 1 144 ? 5.863   33.315  72.679  1.00 49.11  ? 186 GLN B NE2   1 
ATOM   3293 N  N     . ARG B 1 145 ? 11.300  33.993  69.835  1.00 43.62  ? 187 ARG B N     1 
ATOM   3294 C  CA    . ARG B 1 145 ? 12.443  34.721  69.292  1.00 46.07  ? 187 ARG B CA    1 
ATOM   3295 C  C     . ARG B 1 145 ? 13.287  33.819  68.400  1.00 43.61  ? 187 ARG B C     1 
ATOM   3296 O  O     . ARG B 1 145 ? 13.671  34.209  67.286  1.00 42.22  ? 187 ARG B O     1 
ATOM   3297 C  CB    . ARG B 1 145 ? 13.287  35.300  70.433  1.00 42.81  ? 187 ARG B CB    1 
ATOM   3298 C  CG    . ARG B 1 145 ? 12.460  36.063  71.467  1.00 48.38  ? 187 ARG B CG    1 
ATOM   3299 C  CD    . ARG B 1 145 ? 13.306  36.546  72.650  1.00 44.01  ? 187 ARG B CD    1 
ATOM   3300 N  NE    . ARG B 1 145 ? 14.463  37.278  72.167  1.00 51.80  ? 187 ARG B NE    1 
ATOM   3301 C  CZ    . ARG B 1 145 ? 14.409  38.485  71.619  1.00 55.59  ? 187 ARG B CZ    1 
ATOM   3302 N  NH1   . ARG B 1 145 ? 13.251  39.107  71.485  1.00 67.44  ? 187 ARG B NH1   1 
ATOM   3303 N  NH2   . ARG B 1 145 ? 15.519  39.070  71.193  1.00 59.33  ? 187 ARG B NH2   1 
ATOM   3304 N  N     . TRP B 1 146 ? 13.566  32.599  68.872  1.00 42.00  ? 188 TRP B N     1 
ATOM   3305 C  CA    . TRP B 1 146 ? 14.347  31.650  68.085  1.00 38.01  ? 188 TRP B CA    1 
ATOM   3306 C  C     . TRP B 1 146 ? 13.653  31.335  66.758  1.00 36.45  ? 188 TRP B C     1 
ATOM   3307 O  O     . TRP B 1 146 ? 14.296  31.257  65.706  1.00 36.20  ? 188 TRP B O     1 
ATOM   3308 C  CB    . TRP B 1 146 ? 14.606  30.373  68.915  1.00 35.65  ? 188 TRP B CB    1 
ATOM   3309 C  CG    . TRP B 1 146 ? 15.001  29.190  68.059  1.00 36.88  ? 188 TRP B CG    1 
ATOM   3310 C  CD1   . TRP B 1 146 ? 14.167  28.395  67.320  1.00 31.94  ? 188 TRP B CD1   1 
ATOM   3311 C  CD2   . TRP B 1 146 ? 16.324  28.682  67.848  1.00 33.88  ? 188 TRP B CD2   1 
ATOM   3312 N  NE1   . TRP B 1 146 ? 14.891  27.438  66.649  1.00 35.81  ? 188 TRP B NE1   1 
ATOM   3313 C  CE2   . TRP B 1 146 ? 16.220  27.597  66.954  1.00 37.94  ? 188 TRP B CE2   1 
ATOM   3314 C  CE3   . TRP B 1 146 ? 17.585  29.042  68.323  1.00 37.48  ? 188 TRP B CE3   1 
ATOM   3315 C  CZ2   . TRP B 1 146 ? 17.328  26.866  66.533  1.00 37.46  ? 188 TRP B CZ2   1 
ATOM   3316 C  CZ3   . TRP B 1 146 ? 18.689  28.328  67.881  1.00 38.95  ? 188 TRP B CZ3   1 
ATOM   3317 C  CH2   . TRP B 1 146 ? 18.549  27.247  67.003  1.00 39.60  ? 188 TRP B CH2   1 
ATOM   3318 N  N     . ASP B 1 147 ? 12.338  31.158  66.789  1.00 41.67  ? 189 ASP B N     1 
ATOM   3319 C  CA    . ASP B 1 147 ? 11.601  30.757  65.597  1.00 34.86  ? 189 ASP B CA    1 
ATOM   3320 C  C     . ASP B 1 147 ? 11.720  31.799  64.491  1.00 40.92  ? 189 ASP B C     1 
ATOM   3321 O  O     . ASP B 1 147 ? 12.023  31.464  63.338  1.00 40.01  ? 189 ASP B O     1 
ATOM   3322 C  CB    . ASP B 1 147 ? 10.139  30.507  65.968  1.00 38.25  ? 189 ASP B CB    1 
ATOM   3323 C  CG    . ASP B 1 147 ? 9.918   29.100  66.532  1.00 44.32  ? 189 ASP B CG    1 
ATOM   3324 O  OD1   . ASP B 1 147 ? 10.865  28.264  66.486  1.00 37.16  ? 189 ASP B OD1   1 
ATOM   3325 O  OD2   . ASP B 1 147 ? 8.791   28.832  67.004  1.00 41.55  ? 189 ASP B OD2   1 
ATOM   3326 N  N     . GLU B 1 148 ? 11.485  33.070  64.831  1.00 42.12  ? 190 GLU B N     1 
ATOM   3327 C  CA    . GLU B 1 148 ? 11.695  34.170  63.893  1.00 40.42  ? 190 GLU B CA    1 
ATOM   3328 C  C     . GLU B 1 148 ? 13.127  34.187  63.354  1.00 39.48  ? 190 GLU B C     1 
ATOM   3329 O  O     . GLU B 1 148 ? 13.338  34.243  62.141  1.00 38.93  ? 190 GLU B O     1 
ATOM   3330 C  CB    . GLU B 1 148 ? 11.362  35.502  64.580  1.00 44.97  ? 190 GLU B CB    1 
ATOM   3331 C  CG    . GLU B 1 148 ? 10.899  36.613  63.635  1.00 58.08  ? 190 GLU B CG    1 
ATOM   3332 C  CD    . GLU B 1 148 ? 11.012  38.002  64.243  1.00 54.45  ? 190 GLU B CD    1 
ATOM   3333 O  OE1   . GLU B 1 148 ? 10.869  38.137  65.479  1.00 57.13  ? 190 GLU B OE1   1 
ATOM   3334 O  OE2   . GLU B 1 148 ? 11.258  38.959  63.472  1.00 62.04  ? 190 GLU B OE2   1 
ATOM   3335 N  N     . ALA B 1 149 ? 14.131  34.153  64.242  1.00 36.10  ? 191 ALA B N     1 
ATOM   3336 C  CA    . ALA B 1 149 ? 15.517  34.204  63.768  1.00 37.51  ? 191 ALA B CA    1 
ATOM   3337 C  C     . ALA B 1 149 ? 15.860  32.987  62.915  1.00 33.58  ? 191 ALA B C     1 
ATOM   3338 O  O     . ALA B 1 149 ? 16.466  33.114  61.853  1.00 36.45  ? 191 ALA B O     1 
ATOM   3339 C  CB    . ALA B 1 149 ? 16.494  34.305  64.946  1.00 35.35  ? 191 ALA B CB    1 
ATOM   3340 N  N     . PHE B 1 150 ? 15.507  31.797  63.386  1.00 33.66  ? 192 PHE B N     1 
ATOM   3341 C  CA    . PHE B 1 150 ? 15.768  30.584  62.627  1.00 34.49  ? 192 PHE B CA    1 
ATOM   3342 C  C     . PHE B 1 150 ? 15.117  30.674  61.249  1.00 38.12  ? 192 PHE B C     1 
ATOM   3343 O  O     . PHE B 1 150 ? 15.765  30.414  60.227  1.00 38.35  ? 192 PHE B O     1 
ATOM   3344 C  CB    . PHE B 1 150 ? 15.255  29.379  63.432  1.00 34.85  ? 192 PHE B CB    1 
ATOM   3345 C  CG    . PHE B 1 150 ? 15.756  28.047  62.963  1.00 33.98  ? 192 PHE B CG    1 
ATOM   3346 C  CD1   . PHE B 1 150 ? 17.059  27.876  62.553  1.00 32.74  ? 192 PHE B CD1   1 
ATOM   3347 C  CD2   . PHE B 1 150 ? 14.910  26.943  62.960  1.00 39.36  ? 192 PHE B CD2   1 
ATOM   3348 C  CE1   . PHE B 1 150 ? 17.521  26.623  62.137  1.00 28.71  ? 192 PHE B CE1   1 
ATOM   3349 C  CE2   . PHE B 1 150 ? 15.367  25.692  62.557  1.00 33.23  ? 192 PHE B CE2   1 
ATOM   3350 C  CZ    . PHE B 1 150 ? 16.673  25.541  62.148  1.00 33.51  ? 192 PHE B CZ    1 
ATOM   3351 N  N     . ARG B 1 151 ? 13.846  31.103  61.205  1.00 37.22  ? 193 ARG B N     1 
ATOM   3352 C  CA    . ARG B 1 151 ? 13.141  31.272  59.935  1.00 37.21  ? 193 ARG B CA    1 
ATOM   3353 C  C     . ARG B 1 151 ? 13.895  32.220  59.003  1.00 36.13  ? 193 ARG B C     1 
ATOM   3354 O  O     . ARG B 1 151 ? 14.218  31.865  57.865  1.00 39.61  ? 193 ARG B O     1 
ATOM   3355 C  CB    . ARG B 1 151 ? 11.714  31.776  60.200  1.00 37.86  ? 193 ARG B CB    1 
ATOM   3356 C  CG    . ARG B 1 151 ? 10.992  32.244  58.964  1.00 40.32  ? 193 ARG B CG    1 
ATOM   3357 C  CD    . ARG B 1 151 ? 9.844   33.218  59.278  1.00 47.58  ? 193 ARG B CD    1 
ATOM   3358 N  NE    . ARG B 1 151 ? 9.140   32.867  60.507  1.00 53.09  ? 193 ARG B NE    1 
ATOM   3359 C  CZ    . ARG B 1 151 ? 8.720   33.762  61.400  1.00 55.19  ? 193 ARG B CZ    1 
ATOM   3360 N  NH1   . ARG B 1 151 ? 8.942   35.061  61.185  1.00 46.71  ? 193 ARG B NH1   1 
ATOM   3361 N  NH2   . ARG B 1 151 ? 8.105   33.359  62.520  1.00 48.64  ? 193 ARG B NH2   1 
ATOM   3362 N  N     . LYS B 1 152 ? 14.182  33.434  59.470  1.00 35.62  ? 194 LYS B N     1 
ATOM   3363 C  CA    . LYS B 1 152 ? 14.939  34.385  58.654  1.00 43.31  ? 194 LYS B CA    1 
ATOM   3364 C  C     . LYS B 1 152 ? 16.253  33.792  58.151  1.00 39.95  ? 194 LYS B C     1 
ATOM   3365 O  O     . LYS B 1 152 ? 16.647  34.036  57.006  1.00 45.75  ? 194 LYS B O     1 
ATOM   3366 C  CB    . LYS B 1 152 ? 15.194  35.665  59.454  1.00 44.53  ? 194 LYS B CB    1 
ATOM   3367 C  CG    . LYS B 1 152 ? 16.338  36.544  58.969  1.00 37.85  ? 194 LYS B CG    1 
ATOM   3368 C  CD    . LYS B 1 152 ? 16.346  37.842  59.834  1.00 59.06  ? 194 LYS B CD    1 
ATOM   3369 C  CE    . LYS B 1 152 ? 17.725  38.529  59.938  1.00 63.38  ? 194 LYS B CE    1 
ATOM   3370 N  NZ    . LYS B 1 152 ? 18.105  38.836  61.362  1.00 60.11  ? 194 LYS B NZ    1 
ATOM   3371 N  N     . PHE B 1 153 ? 16.923  32.967  58.967  1.00 41.09  ? 195 PHE B N     1 
ATOM   3372 C  CA    . PHE B 1 153 ? 18.204  32.379  58.549  1.00 43.81  ? 195 PHE B CA    1 
ATOM   3373 C  C     . PHE B 1 153 ? 18.017  31.291  57.491  1.00 39.52  ? 195 PHE B C     1 
ATOM   3374 O  O     . PHE B 1 153 ? 18.801  31.198  56.533  1.00 37.28  ? 195 PHE B O     1 
ATOM   3375 C  CB    . PHE B 1 153 ? 18.954  31.812  59.762  1.00 37.98  ? 195 PHE B CB    1 
ATOM   3376 C  CG    . PHE B 1 153 ? 20.124  30.925  59.409  1.00 37.10  ? 195 PHE B CG    1 
ATOM   3377 C  CD1   . PHE B 1 153 ? 21.304  31.464  58.936  1.00 34.72  ? 195 PHE B CD1   1 
ATOM   3378 C  CD2   . PHE B 1 153 ? 20.047  29.547  59.587  1.00 41.67  ? 195 PHE B CD2   1 
ATOM   3379 C  CE1   . PHE B 1 153 ? 22.395  30.644  58.628  1.00 38.68  ? 195 PHE B CE1   1 
ATOM   3380 C  CE2   . PHE B 1 153 ? 21.134  28.716  59.285  1.00 40.16  ? 195 PHE B CE2   1 
ATOM   3381 C  CZ    . PHE B 1 153 ? 22.307  29.274  58.803  1.00 41.30  ? 195 PHE B CZ    1 
ATOM   3382 N  N     . LEU B 1 154 ? 17.014  30.433  57.666  1.00 36.55  ? 196 LEU B N     1 
ATOM   3383 C  CA    . LEU B 1 154 ? 16.778  29.413  56.657  1.00 41.28  ? 196 LEU B CA    1 
ATOM   3384 C  C     . LEU B 1 154 ? 16.320  30.032  55.338  1.00 42.22  ? 196 LEU B C     1 
ATOM   3385 O  O     . LEU B 1 154 ? 16.590  29.472  54.268  1.00 39.10  ? 196 LEU B O     1 
ATOM   3386 C  CB    . LEU B 1 154 ? 15.767  28.396  57.179  1.00 41.38  ? 196 LEU B CB    1 
ATOM   3387 C  CG    . LEU B 1 154 ? 16.367  27.616  58.350  1.00 44.11  ? 196 LEU B CG    1 
ATOM   3388 C  CD1   . LEU B 1 154 ? 15.290  26.936  59.186  1.00 40.42  ? 196 LEU B CD1   1 
ATOM   3389 C  CD2   . LEU B 1 154 ? 17.404  26.610  57.823  1.00 41.88  ? 196 LEU B CD2   1 
ATOM   3390 N  N     . LYS B 1 155 ? 15.660  31.195  55.387  1.00 38.96  ? 197 LYS B N     1 
ATOM   3391 C  CA    . LYS B 1 155 ? 15.150  31.783  54.151  1.00 46.00  ? 197 LYS B CA    1 
ATOM   3392 C  C     . LYS B 1 155 ? 16.291  32.354  53.322  1.00 46.41  ? 197 LYS B C     1 
ATOM   3393 O  O     . LYS B 1 155 ? 16.366  32.124  52.105  1.00 40.65  ? 197 LYS B O     1 
ATOM   3394 C  CB    . LYS B 1 155 ? 14.107  32.860  54.453  1.00 43.70  ? 197 LYS B CB    1 
ATOM   3395 C  CG    . LYS B 1 155 ? 13.592  33.590  53.206  1.00 49.25  ? 197 LYS B CG    1 
ATOM   3396 C  CD    . LYS B 1 155 ? 13.103  34.988  53.551  1.00 44.19  ? 197 LYS B CD    1 
ATOM   3397 C  CE    . LYS B 1 155 ? 11.581  35.065  53.516  1.00 55.92  ? 197 LYS B CE    1 
ATOM   3398 N  NZ    . LYS B 1 155 ? 11.059  35.275  52.139  1.00 51.44  ? 197 LYS B NZ    1 
ATOM   3399 N  N     . GLY B 1 156 ? 17.206  33.084  53.975  1.00 49.05  ? 198 GLY B N     1 
ATOM   3400 C  CA    . GLY B 1 156 ? 18.406  33.536  53.285  1.00 41.10  ? 198 GLY B CA    1 
ATOM   3401 C  C     . GLY B 1 156 ? 19.233  32.380  52.751  1.00 46.01  ? 198 GLY B C     1 
ATOM   3402 O  O     . GLY B 1 156 ? 19.804  32.460  51.662  1.00 48.83  ? 198 GLY B O     1 
ATOM   3403 N  N     . LEU B 1 157 ? 19.293  31.282  53.500  1.00 39.79  ? 199 LEU B N     1 
ATOM   3404 C  CA    . LEU B 1 157 ? 20.055  30.122  53.044  1.00 41.72  ? 199 LEU B CA    1 
ATOM   3405 C  C     . LEU B 1 157 ? 19.381  29.468  51.839  1.00 51.74  ? 199 LEU B C     1 
ATOM   3406 O  O     . LEU B 1 157 ? 20.033  29.189  50.821  1.00 47.06  ? 199 LEU B O     1 
ATOM   3407 C  CB    . LEU B 1 157 ? 20.205  29.136  54.201  1.00 41.87  ? 199 LEU B CB    1 
ATOM   3408 C  CG    . LEU B 1 157 ? 21.178  27.960  54.265  1.00 51.32  ? 199 LEU B CG    1 
ATOM   3409 C  CD1   . LEU B 1 157 ? 20.914  26.988  53.132  1.00 56.57  ? 199 LEU B CD1   1 
ATOM   3410 C  CD2   . LEU B 1 157 ? 22.618  28.412  54.268  1.00 49.12  ? 199 LEU B CD2   1 
ATOM   3411 N  N     . ALA B 1 158 ? 18.064  29.217  51.940  1.00 48.06  ? 200 ALA B N     1 
ATOM   3412 C  CA    . ALA B 1 158 ? 17.338  28.572  50.851  1.00 45.74  ? 200 ALA B CA    1 
ATOM   3413 C  C     . ALA B 1 158 ? 17.423  29.380  49.566  1.00 47.48  ? 200 ALA B C     1 
ATOM   3414 O  O     . ALA B 1 158 ? 17.347  28.809  48.470  1.00 52.73  ? 200 ALA B O     1 
ATOM   3415 C  CB    . ALA B 1 158 ? 15.872  28.355  51.233  1.00 39.44  ? 200 ALA B CB    1 
ATOM   3416 N  N     . SER B 1 159 ? 17.586  30.698  49.670  1.00 44.27  ? 201 SER B N     1 
ATOM   3417 C  CA    . SER B 1 159 ? 17.678  31.483  48.448  1.00 48.12  ? 201 SER B CA    1 
ATOM   3418 C  C     . SER B 1 159 ? 18.986  31.265  47.697  1.00 48.16  ? 201 SER B C     1 
ATOM   3419 O  O     . SER B 1 159 ? 19.076  31.666  46.534  1.00 56.04  ? 201 SER B O     1 
ATOM   3420 C  CB    . SER B 1 159 ? 17.499  32.966  48.757  1.00 45.79  ? 201 SER B CB    1 
ATOM   3421 O  OG    . SER B 1 159 ? 18.636  33.475  49.423  1.00 54.22  ? 201 SER B OG    1 
ATOM   3422 N  N     . ARG B 1 160 ? 19.982  30.623  48.304  1.00 44.37  ? 202 ARG B N     1 
ATOM   3423 C  CA    . ARG B 1 160 ? 21.267  30.431  47.650  1.00 45.92  ? 202 ARG B CA    1 
ATOM   3424 C  C     . ARG B 1 160 ? 21.531  28.996  47.203  1.00 47.89  ? 202 ARG B C     1 
ATOM   3425 O  O     . ARG B 1 160 ? 22.316  28.777  46.279  1.00 47.11  ? 202 ARG B O     1 
ATOM   3426 C  CB    . ARG B 1 160 ? 22.390  30.894  48.582  1.00 37.79  ? 202 ARG B CB    1 
ATOM   3427 N  N     . LYS B 1 161 ? 20.897  28.009  47.820  1.00 48.50  ? 203 LYS B N     1 
ATOM   3428 C  CA    . LYS B 1 161 ? 21.091  26.620  47.428  1.00 43.41  ? 203 LYS B CA    1 
ATOM   3429 C  C     . LYS B 1 161 ? 19.887  25.845  47.920  1.00 45.82  ? 203 LYS B C     1 
ATOM   3430 O  O     . LYS B 1 161 ? 19.226  26.291  48.865  1.00 42.45  ? 203 LYS B O     1 
ATOM   3431 C  CB    . LYS B 1 161 ? 22.381  26.058  48.039  1.00 48.01  ? 203 LYS B CB    1 
ATOM   3432 C  CG    . LYS B 1 161 ? 23.211  25.227  47.100  1.00 49.26  ? 203 LYS B CG    1 
ATOM   3433 C  CD    . LYS B 1 161 ? 24.499  24.755  47.748  1.00 49.39  ? 203 LYS B CD    1 
ATOM   3434 C  CE    . LYS B 1 161 ? 25.592  24.614  46.700  1.00 48.13  ? 203 LYS B CE    1 
ATOM   3435 N  NZ    . LYS B 1 161 ? 26.448  23.434  46.956  1.00 46.80  ? 203 LYS B NZ    1 
ATOM   3436 N  N     . PRO B 1 162 ? 19.536  24.722  47.283  1.00 49.14  ? 204 PRO B N     1 
ATOM   3437 C  CA    . PRO B 1 162 ? 18.463  23.875  47.831  1.00 46.96  ? 204 PRO B CA    1 
ATOM   3438 C  C     . PRO B 1 162 ? 18.799  23.368  49.232  1.00 46.36  ? 204 PRO B C     1 
ATOM   3439 O  O     . PRO B 1 162 ? 19.935  22.978  49.519  1.00 40.62  ? 204 PRO B O     1 
ATOM   3440 C  CB    . PRO B 1 162 ? 18.351  22.726  46.819  1.00 44.23  ? 204 PRO B CB    1 
ATOM   3441 C  CG    . PRO B 1 162 ? 19.476  22.907  45.860  1.00 44.55  ? 204 PRO B CG    1 
ATOM   3442 C  CD    . PRO B 1 162 ? 19.904  24.327  45.920  1.00 46.19  ? 204 PRO B CD    1 
ATOM   3443 N  N     . LEU B 1 163 ? 17.786  23.371  50.104  1.00 39.81  ? 205 LEU B N     1 
ATOM   3444 C  CA    . LEU B 1 163 ? 17.963  23.176  51.537  1.00 40.32  ? 205 LEU B CA    1 
ATOM   3445 C  C     . LEU B 1 163 ? 17.290  21.895  52.017  1.00 40.94  ? 205 LEU B C     1 
ATOM   3446 O  O     . LEU B 1 163 ? 16.201  21.532  51.554  1.00 41.57  ? 205 LEU B O     1 
ATOM   3447 C  CB    . LEU B 1 163 ? 17.402  24.367  52.295  1.00 39.01  ? 205 LEU B CB    1 
ATOM   3448 C  CG    . LEU B 1 163 ? 17.210  24.224  53.803  1.00 44.99  ? 205 LEU B CG    1 
ATOM   3449 C  CD1   . LEU B 1 163 ? 18.560  24.016  54.522  1.00 45.94  ? 205 LEU B CD1   1 
ATOM   3450 C  CD2   . LEU B 1 163 ? 16.522  25.464  54.329  1.00 44.18  ? 205 LEU B CD2   1 
ATOM   3451 N  N     . VAL B 1 164 ? 17.954  21.214  52.947  1.00 36.85  ? 206 VAL B N     1 
ATOM   3452 C  CA    . VAL B 1 164 ? 17.404  20.078  53.686  1.00 37.08  ? 206 VAL B CA    1 
ATOM   3453 C  C     . VAL B 1 164 ? 17.573  20.390  55.160  1.00 40.01  ? 206 VAL B C     1 
ATOM   3454 O  O     . VAL B 1 164 ? 18.708  20.492  55.646  1.00 44.03  ? 206 VAL B O     1 
ATOM   3455 C  CB    . VAL B 1 164 ? 18.114  18.754  53.347  1.00 38.94  ? 206 VAL B CB    1 
ATOM   3456 C  CG1   . VAL B 1 164 ? 17.593  17.605  54.219  1.00 31.89  ? 206 VAL B CG1   1 
ATOM   3457 C  CG2   . VAL B 1 164 ? 17.985  18.436  51.862  1.00 41.63  ? 206 VAL B CG2   1 
ATOM   3458 N  N     . LEU B 1 165 ? 16.464  20.559  55.870  1.00 38.51  ? 207 LEU B N     1 
ATOM   3459 C  CA    . LEU B 1 165 ? 16.500  20.803  57.306  1.00 38.07  ? 207 LEU B CA    1 
ATOM   3460 C  C     . LEU B 1 165 ? 16.075  19.527  58.015  1.00 36.33  ? 207 LEU B C     1 
ATOM   3461 O  O     . LEU B 1 165 ? 14.960  19.042  57.804  1.00 34.77  ? 207 LEU B O     1 
ATOM   3462 C  CB    . LEU B 1 165 ? 15.587  21.966  57.694  1.00 35.63  ? 207 LEU B CB    1 
ATOM   3463 C  CG    . LEU B 1 165 ? 15.262  22.052  59.191  1.00 38.89  ? 207 LEU B CG    1 
ATOM   3464 C  CD1   . LEU B 1 165 ? 16.526  22.284  59.953  1.00 34.04  ? 207 LEU B CD1   1 
ATOM   3465 C  CD2   . LEU B 1 165 ? 14.261  23.157  59.471  1.00 39.41  ? 207 LEU B CD2   1 
ATOM   3466 N  N     . CYS B 1 166 ? 16.958  18.967  58.838  1.00 35.16  ? 208 CYS B N     1 
ATOM   3467 C  CA    . CYS B 1 166 ? 16.563  17.813  59.633  1.00 35.67  ? 208 CYS B CA    1 
ATOM   3468 C  C     . CYS B 1 166 ? 16.801  18.082  61.102  1.00 40.89  ? 208 CYS B C     1 
ATOM   3469 O  O     . CYS B 1 166 ? 17.612  18.930  61.486  1.00 42.33  ? 208 CYS B O     1 
ATOM   3470 C  CB    . CYS B 1 166 ? 17.277  16.523  59.220  1.00 39.81  ? 208 CYS B CB    1 
ATOM   3471 S  SG    . CYS B 1 166 ? 19.025  16.334  59.592  1.00 45.30  ? 208 CYS B SG    1 
ATOM   3472 N  N     . GLY B 1 167 ? 16.067  17.365  61.921  1.00 37.14  ? 209 GLY B N     1 
ATOM   3473 C  CA    . GLY B 1 167 ? 16.331  17.416  63.331  1.00 42.21  ? 209 GLY B CA    1 
ATOM   3474 C  C     . GLY B 1 167 ? 15.056  17.466  64.120  1.00 40.36  ? 209 GLY B C     1 
ATOM   3475 O  O     . GLY B 1 167 ? 13.969  17.240  63.595  1.00 39.42  ? 209 GLY B O     1 
ATOM   3476 N  N     . ASP B 1 168 ? 15.238  17.729  65.410  1.00 37.43  ? 210 ASP B N     1 
ATOM   3477 C  CA    . ASP B 1 168 ? 14.174  17.803  66.398  1.00 36.80  ? 210 ASP B CA    1 
ATOM   3478 C  C     . ASP B 1 168 ? 13.746  19.258  66.448  1.00 34.42  ? 210 ASP B C     1 
ATOM   3479 O  O     . ASP B 1 168 ? 14.433  20.104  67.019  1.00 34.65  ? 210 ASP B O     1 
ATOM   3480 C  CB    . ASP B 1 168 ? 14.679  17.301  67.754  1.00 38.76  ? 210 ASP B CB    1 
ATOM   3481 C  CG    . ASP B 1 168 ? 13.614  17.347  68.862  1.00 39.62  ? 210 ASP B CG    1 
ATOM   3482 O  OD1   . ASP B 1 168 ? 12.483  17.844  68.635  1.00 35.95  ? 210 ASP B OD1   1 
ATOM   3483 O  OD2   . ASP B 1 168 ? 13.924  16.867  69.982  1.00 36.31  ? 210 ASP B OD2   1 
ATOM   3484 N  N     . LEU B 1 169 ? 12.601  19.548  65.849  1.00 39.64  ? 211 LEU B N     1 
ATOM   3485 C  CA    . LEU B 1 169 ? 12.064  20.892  65.819  1.00 35.46  ? 211 LEU B CA    1 
ATOM   3486 C  C     . LEU B 1 169 ? 11.191  21.207  67.025  1.00 34.93  ? 211 LEU B C     1 
ATOM   3487 O  O     . LEU B 1 169 ? 10.632  22.310  67.095  1.00 36.61  ? 211 LEU B O     1 
ATOM   3488 C  CB    . LEU B 1 169 ? 11.270  21.090  64.526  1.00 38.34  ? 211 LEU B CB    1 
ATOM   3489 C  CG    . LEU B 1 169 ? 12.170  20.874  63.312  1.00 40.48  ? 211 LEU B CG    1 
ATOM   3490 C  CD1   . LEU B 1 169 ? 11.475  21.265  61.993  1.00 39.55  ? 211 LEU B CD1   1 
ATOM   3491 C  CD2   . LEU B 1 169 ? 13.474  21.644  63.537  1.00 40.43  ? 211 LEU B CD2   1 
ATOM   3492 N  N     . ASN B 1 170 ? 11.027  20.251  67.936  1.00 33.17  ? 212 ASN B N     1 
ATOM   3493 C  CA    . ASN B 1 170 ? 10.250  20.407  69.170  1.00 34.06  ? 212 ASN B CA    1 
ATOM   3494 C  C     . ASN B 1 170 ? 8.915   21.129  68.968  1.00 34.49  ? 212 ASN B C     1 
ATOM   3495 O  O     . ASN B 1 170 ? 8.548   22.037  69.729  1.00 30.25  ? 212 ASN B O     1 
ATOM   3496 C  CB    . ASN B 1 170 ? 11.082  21.097  70.230  1.00 30.93  ? 212 ASN B CB    1 
ATOM   3497 C  CG    . ASN B 1 170 ? 11.835  20.114  71.058  1.00 38.44  ? 212 ASN B CG    1 
ATOM   3498 O  OD1   . ASN B 1 170 ? 11.239  19.194  71.622  1.00 32.48  ? 212 ASN B OD1   1 
ATOM   3499 N  ND2   . ASN B 1 170 ? 13.167  20.253  71.097  1.00 37.92  ? 212 ASN B ND2   1 
ATOM   3500 N  N     . VAL B 1 171 ? 8.170   20.676  67.957  1.00 34.50  ? 213 VAL B N     1 
ATOM   3501 C  CA    . VAL B 1 171 ? 6.792   21.122  67.728  1.00 33.91  ? 213 VAL B CA    1 
ATOM   3502 C  C     . VAL B 1 171 ? 6.052   20.021  66.984  1.00 40.07  ? 213 VAL B C     1 
ATOM   3503 O  O     . VAL B 1 171 ? 6.603   19.381  66.088  1.00 37.59  ? 213 VAL B O     1 
ATOM   3504 C  CB    . VAL B 1 171 ? 6.727   22.455  66.945  1.00 36.71  ? 213 VAL B CB    1 
ATOM   3505 C  CG1   . VAL B 1 171 ? 7.469   22.345  65.635  1.00 34.85  ? 213 VAL B CG1   1 
ATOM   3506 C  CG2   . VAL B 1 171 ? 5.263   22.832  66.681  1.00 35.29  ? 213 VAL B CG2   1 
ATOM   3507 N  N     . ALA B 1 172 ? 4.811   19.787  67.382  1.00 39.35  ? 214 ALA B N     1 
ATOM   3508 C  CA    . ALA B 1 172 ? 3.922   18.868  66.685  1.00 33.73  ? 214 ALA B CA    1 
ATOM   3509 C  C     . ALA B 1 172 ? 2.983   19.745  65.868  1.00 37.87  ? 214 ALA B C     1 
ATOM   3510 O  O     . ALA B 1 172 ? 2.211   20.521  66.436  1.00 39.03  ? 214 ALA B O     1 
ATOM   3511 C  CB    . ALA B 1 172 ? 3.150   17.976  67.657  1.00 41.06  ? 214 ALA B CB    1 
ATOM   3512 N  N     . HIS B 1 173 ? 3.075   19.648  64.537  1.00 32.19  ? 215 HIS B N     1 
ATOM   3513 C  CA    . HIS B 1 173 ? 2.486   20.673  63.680  1.00 35.04  ? 215 HIS B CA    1 
ATOM   3514 C  C     . HIS B 1 173 ? 0.978   20.752  63.852  1.00 37.20  ? 215 HIS B C     1 
ATOM   3515 O  O     . HIS B 1 173 ? 0.414   21.836  64.061  1.00 39.23  ? 215 HIS B O     1 
ATOM   3516 C  CB    . HIS B 1 173 ? 2.829   20.385  62.226  1.00 36.55  ? 215 HIS B CB    1 
ATOM   3517 C  CG    . HIS B 1 173 ? 2.383   21.456  61.284  1.00 38.42  ? 215 HIS B CG    1 
ATOM   3518 N  ND1   . HIS B 1 173 ? 2.093   22.738  61.699  1.00 40.35  ? 215 HIS B ND1   1 
ATOM   3519 C  CD2   . HIS B 1 173 ? 2.202   21.446  59.944  1.00 35.11  ? 215 HIS B CD2   1 
ATOM   3520 C  CE1   . HIS B 1 173 ? 1.734   23.468  60.662  1.00 37.24  ? 215 HIS B CE1   1 
ATOM   3521 N  NE2   . HIS B 1 173 ? 1.800   22.709  59.584  1.00 40.50  ? 215 HIS B NE2   1 
ATOM   3522 N  N     . GLU B 1 174 ? 0.312   19.606  63.771  1.00 35.04  ? 216 GLU B N     1 
ATOM   3523 C  CA    . GLU B 1 174 ? -1.131  19.522  63.655  1.00 37.36  ? 216 GLU B CA    1 
ATOM   3524 C  C     . GLU B 1 174 ? -1.642  18.436  64.584  1.00 45.39  ? 216 GLU B C     1 
ATOM   3525 O  O     . GLU B 1 174 ? -0.868  17.656  65.156  1.00 45.21  ? 216 GLU B O     1 
ATOM   3526 C  CB    . GLU B 1 174 ? -1.562  19.210  62.210  1.00 40.95  ? 216 GLU B CB    1 
ATOM   3527 C  CG    . GLU B 1 174 ? -1.306  20.338  61.237  1.00 36.10  ? 216 GLU B CG    1 
ATOM   3528 C  CD    . GLU B 1 174 ? -2.135  21.575  61.563  1.00 47.15  ? 216 GLU B CD    1 
ATOM   3529 O  OE1   . GLU B 1 174 ? -3.142  21.457  62.309  1.00 49.90  ? 216 GLU B OE1   1 
ATOM   3530 O  OE2   . GLU B 1 174 ? -1.775  22.671  61.070  1.00 52.63  ? 216 GLU B OE2   1 
ATOM   3531 N  N     . GLU B 1 175 ? -2.970  18.367  64.694  1.00 45.97  ? 217 GLU B N     1 
ATOM   3532 C  CA    . GLU B 1 175 ? -3.585  17.469  65.665  1.00 49.08  ? 217 GLU B CA    1 
ATOM   3533 C  C     . GLU B 1 175 ? -3.231  16.021  65.370  1.00 43.96  ? 217 GLU B C     1 
ATOM   3534 O  O     . GLU B 1 175 ? -3.033  15.229  66.296  1.00 40.21  ? 217 GLU B O     1 
ATOM   3535 C  CB    . GLU B 1 175 ? -5.111  17.698  65.702  1.00 46.69  ? 217 GLU B CB    1 
ATOM   3536 C  CG    . GLU B 1 175 ? -5.507  18.923  66.586  1.00 51.61  ? 217 GLU B CG    1 
ATOM   3537 C  CD    . GLU B 1 175 ? -6.995  19.275  66.558  1.00 59.12  ? 217 GLU B CD    1 
ATOM   3538 O  OE1   . GLU B 1 175 ? -7.635  19.369  67.634  1.00 59.68  ? 217 GLU B OE1   1 
ATOM   3539 O  OE2   . GLU B 1 175 ? -7.526  19.487  65.454  1.00 72.69  ? 217 GLU B OE2   1 
ATOM   3540 N  N     . ILE B 1 176 ? -3.082  15.670  64.093  1.00 39.70  ? 218 ILE B N     1 
ATOM   3541 C  CA    . ILE B 1 176 ? -2.687  14.314  63.747  1.00 38.62  ? 218 ILE B CA    1 
ATOM   3542 C  C     . ILE B 1 176 ? -1.272  13.981  64.215  1.00 37.38  ? 218 ILE B C     1 
ATOM   3543 O  O     . ILE B 1 176 ? -0.936  12.806  64.353  1.00 44.48  ? 218 ILE B O     1 
ATOM   3544 C  CB    . ILE B 1 176 ? -2.824  14.107  62.227  1.00 37.70  ? 218 ILE B CB    1 
ATOM   3545 C  CG1   . ILE B 1 176 ? -2.677  12.638  61.860  1.00 35.53  ? 218 ILE B CG1   1 
ATOM   3546 C  CG2   . ILE B 1 176 ? -1.791  14.920  61.484  1.00 34.12  ? 218 ILE B CG2   1 
ATOM   3547 C  CD1   . ILE B 1 176 ? -2.551  12.435  60.390  1.00 40.23  ? 218 ILE B CD1   1 
ATOM   3548 N  N     . ASP B 1 177 ? -0.440  14.973  64.515  1.00 38.55  ? 219 ASP B N     1 
ATOM   3549 C  CA    . ASP B 1 177 ? 0.979   14.746  64.796  1.00 38.65  ? 219 ASP B CA    1 
ATOM   3550 C  C     . ASP B 1 177 ? 1.295   14.349  66.263  1.00 45.49  ? 219 ASP B C     1 
ATOM   3551 O  O     . ASP B 1 177 ? 2.486   14.301  66.637  1.00 38.58  ? 219 ASP B O     1 
ATOM   3552 C  CB    . ASP B 1 177 ? 1.760   15.998  64.405  1.00 33.33  ? 219 ASP B CB    1 
ATOM   3553 C  CG    . ASP B 1 177 ? 1.786   16.197  62.926  1.00 34.68  ? 219 ASP B CG    1 
ATOM   3554 O  OD1   . ASP B 1 177 ? 1.982   15.191  62.222  1.00 35.08  ? 219 ASP B OD1   1 
ATOM   3555 O  OD2   . ASP B 1 177 ? 1.638   17.346  62.452  1.00 37.08  ? 219 ASP B OD2   1 
ATOM   3556 N  N     . LEU B 1 178 ? 0.275   14.060  67.085  1.00 38.72  ? 220 LEU B N     1 
ATOM   3557 C  CA    . LEU B 1 178 ? 0.470   13.613  68.466  1.00 41.43  ? 220 LEU B CA    1 
ATOM   3558 C  C     . LEU B 1 178 ? -0.777  12.871  68.925  1.00 43.65  ? 220 LEU B C     1 
ATOM   3559 O  O     . LEU B 1 178 ? -1.850  13.028  68.344  1.00 37.66  ? 220 LEU B O     1 
ATOM   3560 C  CB    . LEU B 1 178 ? 0.778   14.779  69.412  1.00 40.55  ? 220 LEU B CB    1 
ATOM   3561 C  CG    . LEU B 1 178 ? -0.407  15.573  69.925  1.00 38.22  ? 220 LEU B CG    1 
ATOM   3562 C  CD1   . LEU B 1 178 ? 0.060   16.471  71.080  1.00 36.37  ? 220 LEU B CD1   1 
ATOM   3563 C  CD2   . LEU B 1 178 ? -0.963  16.420  68.805  1.00 39.36  ? 220 LEU B CD2   1 
ATOM   3564 N  N     . ARG B 1 179 ? -0.632  12.057  69.979  1.00 42.43  ? 221 ARG B N     1 
ATOM   3565 C  CA    . ARG B 1 179 ? -1.734  11.173  70.374  1.00 43.34  ? 221 ARG B CA    1 
ATOM   3566 C  C     . ARG B 1 179 ? -2.856  11.924  71.092  1.00 44.41  ? 221 ARG B C     1 
ATOM   3567 O  O     . ARG B 1 179 ? -4.030  11.597  70.919  1.00 44.03  ? 221 ARG B O     1 
ATOM   3568 C  CB    . ARG B 1 179 ? -1.206  10.029  71.252  1.00 48.34  ? 221 ARG B CB    1 
ATOM   3569 C  CG    . ARG B 1 179 ? -2.276  9.013   71.681  1.00 50.12  ? 221 ARG B CG    1 
ATOM   3570 C  CD    . ARG B 1 179 ? -2.812  8.246   70.488  1.00 47.09  ? 221 ARG B CD    1 
ATOM   3571 N  NE    . ARG B 1 179 ? -3.986  7.417   70.790  1.00 58.53  ? 221 ARG B NE    1 
ATOM   3572 C  CZ    . ARG B 1 179 ? -5.232  7.883   70.885  1.00 65.36  ? 221 ARG B CZ    1 
ATOM   3573 N  NH1   . ARG B 1 179 ? -5.482  9.179   70.734  1.00 64.28  ? 221 ARG B NH1   1 
ATOM   3574 N  NH2   . ARG B 1 179 ? -6.236  7.054   71.135  1.00 81.51  ? 221 ARG B NH2   1 
ATOM   3575 N  N     . ASN B 1 180 ? -2.533  12.919  71.916  1.00 43.12  ? 222 ASN B N     1 
ATOM   3576 C  CA    . ASN B 1 180 ? -3.525  13.644  72.709  1.00 45.90  ? 222 ASN B CA    1 
ATOM   3577 C  C     . ASN B 1 180 ? -3.433  15.135  72.396  1.00 44.91  ? 222 ASN B C     1 
ATOM   3578 O  O     . ASN B 1 180 ? -2.869  15.912  73.181  1.00 46.53  ? 222 ASN B O     1 
ATOM   3579 C  CB    . ASN B 1 180 ? -3.345  13.414  74.213  1.00 53.32  ? 222 ASN B CB    1 
ATOM   3580 C  CG    . ASN B 1 180 ? -3.321  11.936  74.601  1.00 56.75  ? 222 ASN B CG    1 
ATOM   3581 O  OD1   . ASN B 1 180 ? -4.326  11.215  74.459  1.00 53.34  ? 222 ASN B OD1   1 
ATOM   3582 N  ND2   . ASN B 1 180 ? -2.178  11.490  75.154  1.00 56.36  ? 222 ASN B ND2   1 
ATOM   3583 N  N     . PRO B 1 181 ? -4.000  15.581  71.270  1.00 48.40  ? 223 PRO B N     1 
ATOM   3584 C  CA    . PRO B 1 181 ? -3.981  17.026  70.991  1.00 48.05  ? 223 PRO B CA    1 
ATOM   3585 C  C     . PRO B 1 181 ? -4.839  17.839  71.943  1.00 45.59  ? 223 PRO B C     1 
ATOM   3586 O  O     . PRO B 1 181 ? -4.420  18.930  72.344  1.00 46.78  ? 223 PRO B O     1 
ATOM   3587 C  CB    . PRO B 1 181 ? -4.484  17.114  69.536  1.00 46.31  ? 223 PRO B CB    1 
ATOM   3588 C  CG    . PRO B 1 181 ? -5.170  15.859  69.289  1.00 40.21  ? 223 PRO B CG    1 
ATOM   3589 C  CD    . PRO B 1 181 ? -4.510  14.810  70.129  1.00 41.23  ? 223 PRO B CD    1 
ATOM   3590 N  N     . LYS B 1 182 ? -6.028  17.358  72.313  1.00 48.24  ? 224 LYS B N     1 
ATOM   3591 C  CA    . LYS B 1 182 ? -6.882  18.143  73.204  1.00 48.62  ? 224 LYS B CA    1 
ATOM   3592 C  C     . LYS B 1 182 ? -6.189  18.429  74.533  1.00 51.36  ? 224 LYS B C     1 
ATOM   3593 O  O     . LYS B 1 182 ? -6.152  19.576  74.997  1.00 53.93  ? 224 LYS B O     1 
ATOM   3594 C  CB    . LYS B 1 182 ? -8.203  17.422  73.444  1.00 48.41  ? 224 LYS B CB    1 
ATOM   3595 C  CG    . LYS B 1 182 ? -9.247  17.701  72.367  1.00 67.05  ? 224 LYS B CG    1 
ATOM   3596 C  CD    . LYS B 1 182 ? -10.659 17.554  72.917  1.00 57.31  ? 224 LYS B CD    1 
ATOM   3597 C  CE    . LYS B 1 182 ? -10.843 18.346  74.216  1.00 63.73  ? 224 LYS B CE    1 
ATOM   3598 N  NZ    . LYS B 1 182 ? -10.297 19.748  74.189  1.00 63.24  ? 224 LYS B NZ    1 
ATOM   3599 N  N     . GLY B 1 183 ? -5.629  17.405  75.160  1.00 40.80  ? 225 GLY B N     1 
ATOM   3600 C  CA    . GLY B 1 183 ? -5.010  17.676  76.440  1.00 48.63  ? 225 GLY B CA    1 
ATOM   3601 C  C     . GLY B 1 183 ? -3.662  18.370  76.440  1.00 46.43  ? 225 GLY B C     1 
ATOM   3602 O  O     . GLY B 1 183 ? -3.120  18.604  77.519  1.00 52.56  ? 225 GLY B O     1 
ATOM   3603 N  N     . ASN B 1 184 ? -3.099  18.736  75.288  1.00 46.18  ? 226 ASN B N     1 
ATOM   3604 C  CA    . ASN B 1 184 ? -1.736  19.265  75.236  1.00 42.23  ? 226 ASN B CA    1 
ATOM   3605 C  C     . ASN B 1 184 ? -1.652  20.666  74.633  1.00 45.72  ? 226 ASN B C     1 
ATOM   3606 O  O     . ASN B 1 184 ? -0.544  21.183  74.430  1.00 42.67  ? 226 ASN B O     1 
ATOM   3607 C  CB    . ASN B 1 184 ? -0.834  18.317  74.449  1.00 36.57  ? 226 ASN B CB    1 
ATOM   3608 C  CG    . ASN B 1 184 ? -0.080  17.374  75.331  1.00 46.20  ? 226 ASN B CG    1 
ATOM   3609 O  OD1   . ASN B 1 184 ? 0.525   17.793  76.313  1.00 50.87  ? 226 ASN B OD1   1 
ATOM   3610 N  ND2   . ASN B 1 184 ? -0.092  16.092  74.988  1.00 41.58  ? 226 ASN B ND2   1 
ATOM   3611 N  N     . LYS B 1 185 ? -2.787  21.307  74.375  1.00 42.17  ? 227 LYS B N     1 
ATOM   3612 C  CA    . LYS B 1 185 ? -2.819  22.580  73.664  1.00 42.62  ? 227 LYS B CA    1 
ATOM   3613 C  C     . LYS B 1 185 ? -2.138  23.718  74.410  1.00 47.61  ? 227 LYS B C     1 
ATOM   3614 O  O     . LYS B 1 185 ? -1.895  24.766  73.804  1.00 51.80  ? 227 LYS B O     1 
ATOM   3615 C  CB    . LYS B 1 185 ? -4.275  22.940  73.347  1.00 42.94  ? 227 LYS B CB    1 
ATOM   3616 C  CG    . LYS B 1 185 ? -4.884  21.971  72.320  1.00 49.43  ? 227 LYS B CG    1 
ATOM   3617 C  CD    . LYS B 1 185 ? -6.093  22.524  71.546  1.00 52.44  ? 227 LYS B CD    1 
ATOM   3618 C  CE    . LYS B 1 185 ? -6.316  21.743  70.231  1.00 54.91  ? 227 LYS B CE    1 
ATOM   3619 N  NZ    . LYS B 1 185 ? -7.695  21.154  70.044  1.00 59.32  ? 227 LYS B NZ    1 
ATOM   3620 N  N     . LYS B 1 186 ? -1.817  23.553  75.695  1.00 45.78  ? 228 LYS B N     1 
ATOM   3621 C  CA    . LYS B 1 186 ? -1.059  24.563  76.417  1.00 47.98  ? 228 LYS B CA    1 
ATOM   3622 C  C     . LYS B 1 186 ? 0.254   24.021  76.977  1.00 44.50  ? 228 LYS B C     1 
ATOM   3623 O  O     . LYS B 1 186 ? 0.810   24.622  77.894  1.00 43.23  ? 228 LYS B O     1 
ATOM   3624 C  CB    . LYS B 1 186 ? -1.918  25.175  77.523  1.00 49.20  ? 228 LYS B CB    1 
ATOM   3625 C  CG    . LYS B 1 186 ? -3.074  26.006  76.963  1.00 58.23  ? 228 LYS B CG    1 
ATOM   3626 C  CD    . LYS B 1 186 ? -3.974  26.580  78.060  1.00 67.48  ? 228 LYS B CD    1 
ATOM   3627 C  CE    . LYS B 1 186 ? -3.336  27.779  78.776  1.00 68.56  ? 228 LYS B CE    1 
ATOM   3628 N  NZ    . LYS B 1 186 ? -2.577  27.434  80.029  1.00 68.82  ? 228 LYS B NZ    1 
ATOM   3629 N  N     . ASN B 1 187 ? 0.768   22.912  76.434  1.00 44.06  ? 229 ASN B N     1 
ATOM   3630 C  CA    . ASN B 1 187 ? 2.060   22.345  76.820  1.00 42.18  ? 229 ASN B CA    1 
ATOM   3631 C  C     . ASN B 1 187 ? 3.085   22.504  75.706  1.00 44.72  ? 229 ASN B C     1 
ATOM   3632 O  O     . ASN B 1 187 ? 2.736   22.576  74.522  1.00 40.21  ? 229 ASN B O     1 
ATOM   3633 C  CB    . ASN B 1 187 ? 1.940   20.857  77.171  1.00 44.99  ? 229 ASN B CB    1 
ATOM   3634 C  CG    . ASN B 1 187 ? 1.145   20.625  78.447  1.00 47.52  ? 229 ASN B CG    1 
ATOM   3635 O  OD1   . ASN B 1 187 ? 1.186   21.445  79.365  1.00 48.38  ? 229 ASN B OD1   1 
ATOM   3636 N  ND2   . ASN B 1 187 ? 0.399   19.515  78.501  1.00 40.50  ? 229 ASN B ND2   1 
ATOM   3637 N  N     . ALA B 1 188 ? 4.367   22.522  76.104  1.00 43.72  ? 230 ALA B N     1 
ATOM   3638 C  CA    . ALA B 1 188 ? 5.466   22.718  75.162  1.00 38.59  ? 230 ALA B CA    1 
ATOM   3639 C  C     . ALA B 1 188 ? 5.364   21.776  73.970  1.00 38.05  ? 230 ALA B C     1 
ATOM   3640 O  O     . ALA B 1 188 ? 5.197   20.563  74.130  1.00 38.71  ? 230 ALA B O     1 
ATOM   3641 C  CB    . ALA B 1 188 ? 6.809   22.500  75.863  1.00 35.62  ? 230 ALA B CB    1 
ATOM   3642 N  N     . GLY B 1 189 ? 5.506   22.336  72.768  1.00 37.49  ? 231 GLY B N     1 
ATOM   3643 C  CA    . GLY B 1 189 ? 5.439   21.547  71.557  1.00 33.40  ? 231 GLY B CA    1 
ATOM   3644 C  C     . GLY B 1 189 ? 4.068   21.458  70.924  1.00 39.38  ? 231 GLY B C     1 
ATOM   3645 O  O     . GLY B 1 189 ? 3.953   20.955  69.792  1.00 41.45  ? 231 GLY B O     1 
ATOM   3646 N  N     . PHE B 1 190 ? 3.025   21.914  71.612  1.00 34.81  ? 232 PHE B N     1 
ATOM   3647 C  CA    . PHE B 1 190 ? 1.736   22.023  70.942  1.00 42.73  ? 232 PHE B CA    1 
ATOM   3648 C  C     . PHE B 1 190 ? 0.976   23.319  71.266  1.00 41.58  ? 232 PHE B C     1 
ATOM   3649 O  O     . PHE B 1 190 ? -0.235  23.386  71.036  1.00 38.24  ? 232 PHE B O     1 
ATOM   3650 C  CB    . PHE B 1 190 ? 0.877   20.801  71.255  1.00 38.73  ? 232 PHE B CB    1 
ATOM   3651 C  CG    . PHE B 1 190 ? -0.175  20.551  70.223  1.00 41.57  ? 232 PHE B CG    1 
ATOM   3652 C  CD1   . PHE B 1 190 ? 0.179   20.307  68.918  1.00 42.91  ? 232 PHE B CD1   1 
ATOM   3653 C  CD2   . PHE B 1 190 ? -1.528  20.592  70.554  1.00 42.85  ? 232 PHE B CD2   1 
ATOM   3654 C  CE1   . PHE B 1 190 ? -0.797  20.095  67.953  1.00 45.18  ? 232 PHE B CE1   1 
ATOM   3655 C  CE2   . PHE B 1 190 ? -2.502  20.374  69.599  1.00 42.43  ? 232 PHE B CE2   1 
ATOM   3656 C  CZ    . PHE B 1 190 ? -2.140  20.129  68.302  1.00 44.26  ? 232 PHE B CZ    1 
ATOM   3657 N  N     . THR B 1 191 ? 1.643   24.353  71.783  1.00 43.24  ? 233 THR B N     1 
ATOM   3658 C  CA    . THR B 1 191 ? 0.963   25.615  72.014  1.00 42.63  ? 233 THR B CA    1 
ATOM   3659 C  C     . THR B 1 191 ? 0.633   26.261  70.674  1.00 43.30  ? 233 THR B C     1 
ATOM   3660 O  O     . THR B 1 191 ? 1.213   25.896  69.646  1.00 43.00  ? 233 THR B O     1 
ATOM   3661 C  CB    . THR B 1 191 ? 1.838   26.559  72.824  1.00 41.59  ? 233 THR B CB    1 
ATOM   3662 O  OG1   . THR B 1 191 ? 2.949   26.927  72.014  1.00 46.73  ? 233 THR B OG1   1 
ATOM   3663 C  CG2   . THR B 1 191 ? 2.340   25.895  74.108  1.00 43.52  ? 233 THR B CG2   1 
ATOM   3664 N  N     . PRO B 1 192 ? -0.298  27.231  70.650  1.00 45.79  ? 234 PRO B N     1 
ATOM   3665 C  CA    . PRO B 1 192 ? -0.611  27.892  69.357  1.00 46.38  ? 234 PRO B CA    1 
ATOM   3666 C  C     . PRO B 1 192 ? 0.578   28.628  68.744  1.00 41.16  ? 234 PRO B C     1 
ATOM   3667 O  O     . PRO B 1 192 ? 0.784   28.568  67.521  1.00 38.57  ? 234 PRO B O     1 
ATOM   3668 C  CB    . PRO B 1 192 ? -1.762  28.855  69.714  1.00 44.59  ? 234 PRO B CB    1 
ATOM   3669 C  CG    . PRO B 1 192 ? -2.360  28.313  70.974  1.00 44.98  ? 234 PRO B CG    1 
ATOM   3670 C  CD    . PRO B 1 192 ? -1.248  27.603  71.717  1.00 42.67  ? 234 PRO B CD    1 
ATOM   3671 N  N     . GLN B 1 193 ? 1.381   29.305  69.568  1.00 39.43  ? 235 GLN B N     1 
ATOM   3672 C  CA    . GLN B 1 193 ? 2.558   30.004  69.052  1.00 43.42  ? 235 GLN B CA    1 
ATOM   3673 C  C     . GLN B 1 193 ? 3.535   29.041  68.378  1.00 38.58  ? 235 GLN B C     1 
ATOM   3674 O  O     . GLN B 1 193 ? 4.130   29.374  67.342  1.00 37.15  ? 235 GLN B O     1 
ATOM   3675 C  CB    . GLN B 1 193 ? 3.255   30.789  70.177  1.00 40.99  ? 235 GLN B CB    1 
ATOM   3676 C  CG    . GLN B 1 193 ? 2.315   31.705  70.935  1.00 45.02  ? 235 GLN B CG    1 
ATOM   3677 C  CD    . GLN B 1 193 ? 1.540   30.956  71.997  1.00 51.04  ? 235 GLN B CD    1 
ATOM   3678 O  OE1   . GLN B 1 193 ? 0.426   30.496  71.761  1.00 57.24  ? 235 GLN B OE1   1 
ATOM   3679 N  NE2   . GLN B 1 193 ? 2.143   30.785  73.152  1.00 60.60  ? 235 GLN B NE2   1 
ATOM   3680 N  N     . GLU B 1 194 ? 3.714   27.838  68.936  1.00 37.85  ? 236 GLU B N     1 
ATOM   3681 C  CA    . GLU B 1 194 ? 4.702   26.938  68.347  1.00 38.40  ? 236 GLU B CA    1 
ATOM   3682 C  C     . GLU B 1 194 ? 4.202   26.380  67.024  1.00 36.08  ? 236 GLU B C     1 
ATOM   3683 O  O     . GLU B 1 194 ? 4.961   26.307  66.053  1.00 33.68  ? 236 GLU B O     1 
ATOM   3684 C  CB    . GLU B 1 194 ? 5.070   25.806  69.317  1.00 39.49  ? 236 GLU B CB    1 
ATOM   3685 C  CG    . GLU B 1 194 ? 5.777   26.275  70.603  1.00 41.56  ? 236 GLU B CG    1 
ATOM   3686 C  CD    . GLU B 1 194 ? 6.118   25.133  71.559  1.00 43.15  ? 236 GLU B CD    1 
ATOM   3687 O  OE1   . GLU B 1 194 ? 5.249   24.726  72.364  1.00 41.69  ? 236 GLU B OE1   1 
ATOM   3688 O  OE2   . GLU B 1 194 ? 7.272   24.641  71.506  1.00 44.34  ? 236 GLU B OE2   1 
ATOM   3689 N  N     . ARG B 1 195 ? 2.924   25.997  66.960  1.00 40.99  ? 237 ARG B N     1 
ATOM   3690 C  CA    . ARG B 1 195 ? 2.372   25.497  65.709  1.00 32.59  ? 237 ARG B CA    1 
ATOM   3691 C  C     . ARG B 1 195 ? 2.370   26.584  64.651  1.00 36.35  ? 237 ARG B C     1 
ATOM   3692 O  O     . ARG B 1 195 ? 2.670   26.316  63.484  1.00 33.80  ? 237 ARG B O     1 
ATOM   3693 C  CB    . ARG B 1 195 ? 0.971   24.941  65.932  1.00 37.68  ? 237 ARG B CB    1 
ATOM   3694 C  CG    . ARG B 1 195 ? 0.965   23.656  66.738  1.00 39.60  ? 237 ARG B CG    1 
ATOM   3695 C  CD    . ARG B 1 195 ? -0.423  23.348  67.200  1.00 37.40  ? 237 ARG B CD    1 
ATOM   3696 N  NE    . ARG B 1 195 ? -1.259  23.006  66.060  1.00 43.20  ? 237 ARG B NE    1 
ATOM   3697 C  CZ    . ARG B 1 195 ? -2.577  22.822  66.129  1.00 43.80  ? 237 ARG B CZ    1 
ATOM   3698 N  NH1   . ARG B 1 195 ? -3.195  22.955  67.304  1.00 40.84  ? 237 ARG B NH1   1 
ATOM   3699 N  NH2   . ARG B 1 195 ? -3.269  22.486  65.035  1.00 39.93  ? 237 ARG B NH2   1 
ATOM   3700 N  N     . GLN B 1 196 ? 2.089   27.829  65.039  1.00 35.78  ? 238 GLN B N     1 
ATOM   3701 C  CA    . GLN B 1 196 ? 2.024   28.882  64.027  1.00 37.64  ? 238 GLN B CA    1 
ATOM   3702 C  C     . GLN B 1 196 ? 3.411   29.230  63.507  1.00 37.55  ? 238 GLN B C     1 
ATOM   3703 O  O     . GLN B 1 196 ? 3.604   29.384  62.290  1.00 41.03  ? 238 GLN B O     1 
ATOM   3704 C  CB    . GLN B 1 196 ? 1.304   30.110  64.587  1.00 40.17  ? 238 GLN B CB    1 
ATOM   3705 C  CG    . GLN B 1 196 ? -0.189  29.836  64.818  1.00 40.91  ? 238 GLN B CG    1 
ATOM   3706 C  CD    . GLN B 1 196 ? -0.830  30.796  65.793  1.00 48.38  ? 238 GLN B CD    1 
ATOM   3707 O  OE1   . GLN B 1 196 ? -0.267  31.846  66.124  1.00 46.62  ? 238 GLN B OE1   1 
ATOM   3708 N  NE2   . GLN B 1 196 ? -2.023  30.437  66.268  1.00 48.83  ? 238 GLN B NE2   1 
ATOM   3709 N  N     . GLY B 1 197 ? 4.400   29.310  64.398  1.00 37.55  ? 239 GLY B N     1 
ATOM   3710 C  CA    . GLY B 1 197 ? 5.775   29.424  63.939  1.00 35.59  ? 239 GLY B CA    1 
ATOM   3711 C  C     . GLY B 1 197 ? 6.138   28.344  62.936  1.00 34.32  ? 239 GLY B C     1 
ATOM   3712 O  O     . GLY B 1 197 ? 6.767   28.623  61.915  1.00 39.36  ? 239 GLY B O     1 
ATOM   3713 N  N     . PHE B 1 198 ? 5.718   27.099  63.195  1.00 30.31  ? 240 PHE B N     1 
ATOM   3714 C  CA    . PHE B 1 198 ? 6.033   26.021  62.263  1.00 34.52  ? 240 PHE B CA    1 
ATOM   3715 C  C     . PHE B 1 198 ? 5.374   26.263  60.899  1.00 40.46  ? 240 PHE B C     1 
ATOM   3716 O  O     . PHE B 1 198 ? 6.026   26.145  59.852  1.00 36.06  ? 240 PHE B O     1 
ATOM   3717 C  CB    . PHE B 1 198 ? 5.619   24.665  62.852  1.00 31.36  ? 240 PHE B CB    1 
ATOM   3718 C  CG    . PHE B 1 198 ? 6.152   23.474  62.066  1.00 35.05  ? 240 PHE B CG    1 
ATOM   3719 C  CD1   . PHE B 1 198 ? 7.488   23.113  62.138  1.00 40.54  ? 240 PHE B CD1   1 
ATOM   3720 C  CD2   . PHE B 1 198 ? 5.327   22.731  61.249  1.00 39.62  ? 240 PHE B CD2   1 
ATOM   3721 C  CE1   . PHE B 1 198 ? 7.991   22.026  61.416  1.00 37.73  ? 240 PHE B CE1   1 
ATOM   3722 C  CE2   . PHE B 1 198 ? 5.823   21.641  60.523  1.00 43.73  ? 240 PHE B CE2   1 
ATOM   3723 C  CZ    . PHE B 1 198 ? 7.155   21.285  60.615  1.00 39.86  ? 240 PHE B CZ    1 
ATOM   3724 N  N     . GLY B 1 199 ? 4.091   26.641  60.888  1.00 35.71  ? 241 GLY B N     1 
ATOM   3725 C  CA    . GLY B 1 199 ? 3.445   26.970  59.621  1.00 36.15  ? 241 GLY B CA    1 
ATOM   3726 C  C     . GLY B 1 199 ? 4.101   28.137  58.901  1.00 37.54  ? 241 GLY B C     1 
ATOM   3727 O  O     . GLY B 1 199 ? 4.281   28.106  57.683  1.00 37.38  ? 241 GLY B O     1 
ATOM   3728 N  N     . GLU B 1 200 ? 4.494   29.173  59.645  1.00 36.32  ? 242 GLU B N     1 
ATOM   3729 C  CA    . GLU B 1 200 ? 5.134   30.313  59.002  1.00 38.13  ? 242 GLU B CA    1 
ATOM   3730 C  C     . GLU B 1 200 ? 6.468   29.922  58.378  1.00 43.72  ? 242 GLU B C     1 
ATOM   3731 O  O     . GLU B 1 200 ? 6.830   30.434  57.306  1.00 40.69  ? 242 GLU B O     1 
ATOM   3732 C  CB    . GLU B 1 200 ? 5.309   31.452  60.003  1.00 40.61  ? 242 GLU B CB    1 
ATOM   3733 C  CG    . GLU B 1 200 ? 3.963   32.040  60.405  1.00 51.72  ? 242 GLU B CG    1 
ATOM   3734 C  CD    . GLU B 1 200 ? 4.058   33.181  61.416  1.00 66.47  ? 242 GLU B CD    1 
ATOM   3735 O  OE1   . GLU B 1 200 ? 5.090   33.287  62.144  1.00 59.89  ? 242 GLU B OE1   1 
ATOM   3736 O  OE2   . GLU B 1 200 ? 3.084   33.975  61.470  1.00 57.93  ? 242 GLU B OE2   1 
ATOM   3737 N  N     . LEU B 1 201 ? 7.217   29.014  59.029  1.00 41.52  ? 243 LEU B N     1 
ATOM   3738 C  CA    . LEU B 1 201 ? 8.461   28.516  58.437  1.00 39.16  ? 243 LEU B CA    1 
ATOM   3739 C  C     . LEU B 1 201 ? 8.203   27.846  57.087  1.00 37.23  ? 243 LEU B C     1 
ATOM   3740 O  O     . LEU B 1 201 ? 8.884   28.137  56.098  1.00 34.31  ? 243 LEU B O     1 
ATOM   3741 C  CB    . LEU B 1 201 ? 9.150   27.535  59.383  1.00 36.84  ? 243 LEU B CB    1 
ATOM   3742 C  CG    . LEU B 1 201 ? 10.542  27.093  58.915  1.00 46.90  ? 243 LEU B CG    1 
ATOM   3743 C  CD1   . LEU B 1 201 ? 11.476  28.271  58.983  1.00 39.54  ? 243 LEU B CD1   1 
ATOM   3744 C  CD2   . LEU B 1 201 ? 11.084  25.944  59.770  1.00 43.06  ? 243 LEU B CD2   1 
ATOM   3745 N  N     . LEU B 1 202 ? 7.226   26.926  57.041  1.00 36.01  ? 244 LEU B N     1 
ATOM   3746 C  CA    . LEU B 1 202 ? 6.906   26.194  55.814  1.00 43.12  ? 244 LEU B CA    1 
ATOM   3747 C  C     . LEU B 1 202 ? 6.603   27.129  54.657  1.00 39.76  ? 244 LEU B C     1 
ATOM   3748 O  O     . LEU B 1 202 ? 6.915   26.813  53.506  1.00 38.37  ? 244 LEU B O     1 
ATOM   3749 C  CB    . LEU B 1 202 ? 5.696   25.287  56.024  1.00 38.71  ? 244 LEU B CB    1 
ATOM   3750 C  CG    . LEU B 1 202 ? 5.807   24.162  57.035  1.00 44.74  ? 244 LEU B CG    1 
ATOM   3751 C  CD1   . LEU B 1 202 ? 4.565   23.275  56.881  1.00 35.49  ? 244 LEU B CD1   1 
ATOM   3752 C  CD2   . LEU B 1 202 ? 7.097   23.379  56.800  1.00 39.29  ? 244 LEU B CD2   1 
ATOM   3753 N  N     . GLN B 1 203 ? 6.018   28.290  54.952  1.00 43.68  ? 245 GLN B N     1 
ATOM   3754 C  CA    . GLN B 1 203 ? 5.442   29.170  53.948  1.00 49.02  ? 245 GLN B CA    1 
ATOM   3755 C  C     . GLN B 1 203 ? 6.370   30.299  53.529  1.00 46.55  ? 245 GLN B C     1 
ATOM   3756 O  O     . GLN B 1 203 ? 6.332   30.708  52.365  1.00 50.45  ? 245 GLN B O     1 
ATOM   3757 C  CB    . GLN B 1 203 ? 4.120   29.737  54.477  1.00 44.86  ? 245 GLN B CB    1 
ATOM   3758 C  CG    . GLN B 1 203 ? 3.720   31.079  53.944  1.00 56.10  ? 245 GLN B CG    1 
ATOM   3759 C  CD    . GLN B 1 203 ? 2.441   31.578  54.600  1.00 73.01  ? 245 GLN B CD    1 
ATOM   3760 O  OE1   . GLN B 1 203 ? 1.783   30.839  55.352  1.00 69.91  ? 245 GLN B OE1   1 
ATOM   3761 N  NE2   . GLN B 1 203 ? 2.077   32.833  54.319  1.00 71.46  ? 245 GLN B NE2   1 
ATOM   3762 N  N     . ALA B 1 204 ? 7.217   30.792  54.432  1.00 47.42  ? 246 ALA B N     1 
ATOM   3763 C  CA    . ALA B 1 204 ? 8.127   31.895  54.141  1.00 43.29  ? 246 ALA B CA    1 
ATOM   3764 C  C     . ALA B 1 204 ? 9.439   31.451  53.523  1.00 43.67  ? 246 ALA B C     1 
ATOM   3765 O  O     . ALA B 1 204 ? 10.097  32.264  52.867  1.00 51.55  ? 246 ALA B O     1 
ATOM   3766 C  CB    . ALA B 1 204 ? 8.443   32.697  55.414  1.00 40.52  ? 246 ALA B CB    1 
ATOM   3767 N  N     . VAL B 1 205 ? 9.857   30.209  53.729  1.00 45.57  ? 247 VAL B N     1 
ATOM   3768 C  CA    . VAL B 1 205 ? 11.181  29.812  53.259  1.00 41.89  ? 247 VAL B CA    1 
ATOM   3769 C  C     . VAL B 1 205 ? 11.156  29.621  51.741  1.00 45.39  ? 247 VAL B C     1 
ATOM   3770 O  O     . VAL B 1 205 ? 11.997  30.204  51.064  1.00 45.80  ? 247 VAL B O     1 
ATOM   3771 C  CB    . VAL B 1 205 ? 11.713  28.561  53.998  1.00 43.29  ? 247 VAL B CB    1 
ATOM   3772 C  CG1   . VAL B 1 205 ? 12.978  28.060  53.319  1.00 41.17  ? 247 VAL B CG1   1 
ATOM   3773 C  CG2   . VAL B 1 205 ? 11.980  28.883  55.460  1.00 40.77  ? 247 VAL B CG2   1 
ATOM   3774 N  N     . PRO B 1 206 ? 10.206  28.823  51.181  1.00 43.44  ? 248 PRO B N     1 
ATOM   3775 C  CA    . PRO B 1 206 ? 9.229   27.883  51.757  1.00 43.36  ? 248 PRO B CA    1 
ATOM   3776 C  C     . PRO B 1 206 ? 9.842   26.504  51.896  1.00 37.13  ? 248 PRO B C     1 
ATOM   3777 O  O     . PRO B 1 206 ? 10.857  26.258  51.277  1.00 41.27  ? 248 PRO B O     1 
ATOM   3778 C  CB    . PRO B 1 206 ? 8.086   27.864  50.715  1.00 42.02  ? 248 PRO B CB    1 
ATOM   3779 C  CG    . PRO B 1 206 ? 8.798   28.056  49.397  1.00 40.29  ? 248 PRO B CG    1 
ATOM   3780 C  CD    . PRO B 1 206 ? 10.011  28.962  49.719  1.00 43.63  ? 248 PRO B CD    1 
ATOM   3781 N  N     . LEU B 1 207 ? 9.238   25.617  52.676  1.00 38.24  ? 249 LEU B N     1 
ATOM   3782 C  CA    . LEU B 1 207 ? 9.701   24.245  52.765  1.00 35.07  ? 249 LEU B CA    1 
ATOM   3783 C  C     . LEU B 1 207 ? 8.494   23.336  52.881  1.00 37.24  ? 249 LEU B C     1 
ATOM   3784 O  O     . LEU B 1 207 ? 7.416   23.751  53.305  1.00 42.24  ? 249 LEU B O     1 
ATOM   3785 C  CB    . LEU B 1 207 ? 10.625  24.014  53.965  1.00 41.32  ? 249 LEU B CB    1 
ATOM   3786 C  CG    . LEU B 1 207 ? 11.924  24.790  54.148  1.00 39.89  ? 249 LEU B CG    1 
ATOM   3787 C  CD1   . LEU B 1 207 ? 12.178  24.975  55.627  1.00 39.10  ? 249 LEU B CD1   1 
ATOM   3788 C  CD2   . LEU B 1 207 ? 13.058  24.017  53.530  1.00 40.36  ? 249 LEU B CD2   1 
ATOM   3789 N  N     . ALA B 1 208 ? 8.702   22.079  52.526  1.00 39.35  ? 250 ALA B N     1 
ATOM   3790 C  CA    . ALA B 1 208 ? 7.673   21.056  52.568  1.00 39.71  ? 250 ALA B CA    1 
ATOM   3791 C  C     . ALA B 1 208 ? 8.020   20.020  53.628  1.00 39.85  ? 250 ALA B C     1 
ATOM   3792 O  O     . ALA B 1 208 ? 9.186   19.645  53.778  1.00 38.52  ? 250 ALA B O     1 
ATOM   3793 C  CB    . ALA B 1 208 ? 7.551   20.378  51.205  1.00 31.89  ? 250 ALA B CB    1 
ATOM   3794 N  N     . ASP B 1 209 ? 7.008   19.539  54.340  1.00 35.50  ? 251 ASP B N     1 
ATOM   3795 C  CA    . ASP B 1 209 ? 7.183   18.501  55.348  1.00 34.37  ? 251 ASP B CA    1 
ATOM   3796 C  C     . ASP B 1 209 ? 7.238   17.150  54.642  1.00 38.64  ? 251 ASP B C     1 
ATOM   3797 O  O     . ASP B 1 209 ? 6.202   16.581  54.292  1.00 32.56  ? 251 ASP B O     1 
ATOM   3798 C  CB    . ASP B 1 209 ? 6.044   18.574  56.359  1.00 38.55  ? 251 ASP B CB    1 
ATOM   3799 C  CG    . ASP B 1 209 ? 6.141   17.520  57.475  1.00 38.26  ? 251 ASP B CG    1 
ATOM   3800 O  OD1   . ASP B 1 209 ? 6.899   16.514  57.368  1.00 39.35  ? 251 ASP B OD1   1 
ATOM   3801 O  OD2   . ASP B 1 209 ? 5.412   17.709  58.485  1.00 38.59  ? 251 ASP B OD2   1 
ATOM   3802 N  N     . SER B 1 210 ? 8.454   16.589  54.517  1.00 37.06  ? 252 SER B N     1 
ATOM   3803 C  CA    . SER B 1 210 ? 8.647   15.422  53.657  1.00 36.54  ? 252 SER B CA    1 
ATOM   3804 C  C     . SER B 1 210 ? 7.725   14.280  54.050  1.00 37.19  ? 252 SER B C     1 
ATOM   3805 O  O     . SER B 1 210 ? 7.109   13.658  53.180  1.00 44.77  ? 252 SER B O     1 
ATOM   3806 C  CB    . SER B 1 210 ? 10.111  14.959  53.660  1.00 35.62  ? 252 SER B CB    1 
ATOM   3807 O  OG    . SER B 1 210 ? 10.446  14.196  54.820  1.00 39.97  ? 252 SER B OG    1 
ATOM   3808 N  N     . PHE B 1 211 ? 7.579   13.998  55.345  1.00 35.13  ? 253 PHE B N     1 
ATOM   3809 C  CA    . PHE B 1 211 ? 6.699   12.888  55.696  1.00 40.14  ? 253 PHE B CA    1 
ATOM   3810 C  C     . PHE B 1 211 ? 5.241   13.161  55.296  1.00 43.09  ? 253 PHE B C     1 
ATOM   3811 O  O     . PHE B 1 211 ? 4.555   12.264  54.790  1.00 38.46  ? 253 PHE B O     1 
ATOM   3812 C  CB    . PHE B 1 211 ? 6.779   12.585  57.176  1.00 33.07  ? 253 PHE B CB    1 
ATOM   3813 C  CG    . PHE B 1 211 ? 5.923   11.424  57.599  1.00 33.25  ? 253 PHE B CG    1 
ATOM   3814 C  CD1   . PHE B 1 211 ? 6.360   10.116  57.416  1.00 37.28  ? 253 PHE B CD1   1 
ATOM   3815 C  CD2   . PHE B 1 211 ? 4.692   11.637  58.195  1.00 34.57  ? 253 PHE B CD2   1 
ATOM   3816 C  CE1   . PHE B 1 211 ? 5.576   9.044   57.808  1.00 37.62  ? 253 PHE B CE1   1 
ATOM   3817 C  CE2   . PHE B 1 211 ? 3.903   10.566  58.604  1.00 35.33  ? 253 PHE B CE2   1 
ATOM   3818 C  CZ    . PHE B 1 211 ? 4.337   9.269   58.397  1.00 34.97  ? 253 PHE B CZ    1 
ATOM   3819 N  N     . ARG B 1 212 ? 4.744   14.382  55.539  1.00 43.77  ? 254 ARG B N     1 
ATOM   3820 C  CA    . ARG B 1 212 ? 3.329   14.677  55.296  1.00 39.20  ? 254 ARG B CA    1 
ATOM   3821 C  C     . ARG B 1 212 ? 3.026   14.802  53.806  1.00 43.09  ? 254 ARG B C     1 
ATOM   3822 O  O     . ARG B 1 212 ? 1.905   14.507  53.359  1.00 41.73  ? 254 ARG B O     1 
ATOM   3823 C  CB    . ARG B 1 212 ? 2.951   15.954  56.043  1.00 41.30  ? 254 ARG B CB    1 
ATOM   3824 C  CG    . ARG B 1 212 ? 1.735   15.852  56.921  1.00 44.20  ? 254 ARG B CG    1 
ATOM   3825 C  CD    . ARG B 1 212 ? 1.512   14.447  57.430  1.00 38.01  ? 254 ARG B CD    1 
ATOM   3826 N  NE    . ARG B 1 212 ? 1.348   14.441  58.875  1.00 39.34  ? 254 ARG B NE    1 
ATOM   3827 C  CZ    . ARG B 1 212 ? 1.096   13.344  59.590  1.00 43.93  ? 254 ARG B CZ    1 
ATOM   3828 N  NH1   . ARG B 1 212 ? 0.972   12.166  58.983  1.00 42.77  ? 254 ARG B NH1   1 
ATOM   3829 N  NH2   . ARG B 1 212 ? 0.971   13.421  60.908  1.00 37.80  ? 254 ARG B NH2   1 
ATOM   3830 N  N     . HIS B 1 213 ? 4.021   15.212  53.025  1.00 42.03  ? 255 HIS B N     1 
ATOM   3831 C  CA    . HIS B 1 213 ? 3.877   15.285  51.579  1.00 37.85  ? 255 HIS B CA    1 
ATOM   3832 C  C     . HIS B 1 213 ? 3.635   13.916  50.961  1.00 40.25  ? 255 HIS B C     1 
ATOM   3833 O  O     . HIS B 1 213 ? 2.978   13.825  49.921  1.00 46.79  ? 255 HIS B O     1 
ATOM   3834 C  CB    . HIS B 1 213 ? 5.128   15.935  50.991  1.00 42.53  ? 255 HIS B CB    1 
ATOM   3835 C  CG    . HIS B 1 213 ? 5.174   15.948  49.496  1.00 44.97  ? 255 HIS B CG    1 
ATOM   3836 N  ND1   . HIS B 1 213 ? 4.591   16.943  48.743  1.00 45.92  ? 255 HIS B ND1   1 
ATOM   3837 C  CD2   . HIS B 1 213 ? 5.776   15.112  48.616  1.00 43.18  ? 255 HIS B CD2   1 
ATOM   3838 C  CE1   . HIS B 1 213 ? 4.824   16.714  47.462  1.00 47.90  ? 255 HIS B CE1   1 
ATOM   3839 N  NE2   . HIS B 1 213 ? 5.542   15.609  47.359  1.00 41.03  ? 255 HIS B NE2   1 
ATOM   3840 N  N     . LEU B 1 214 ? 4.130   12.843  51.586  1.00 41.66  ? 256 LEU B N     1 
ATOM   3841 C  CA    . LEU B 1 214 ? 3.920   11.486  51.082  1.00 40.17  ? 256 LEU B CA    1 
ATOM   3842 C  C     . LEU B 1 214 ? 2.769   10.759  51.763  1.00 41.36  ? 256 LEU B C     1 
ATOM   3843 O  O     . LEU B 1 214 ? 2.114   9.921   51.132  1.00 39.83  ? 256 LEU B O     1 
ATOM   3844 C  CB    . LEU B 1 214 ? 5.194   10.645  51.240  1.00 31.57  ? 256 LEU B CB    1 
ATOM   3845 C  CG    . LEU B 1 214 ? 6.429   11.222  50.535  1.00 38.40  ? 256 LEU B CG    1 
ATOM   3846 C  CD1   . LEU B 1 214 ? 7.648   10.356  50.773  1.00 37.84  ? 256 LEU B CD1   1 
ATOM   3847 C  CD2   . LEU B 1 214 ? 6.197   11.379  49.052  1.00 36.93  ? 256 LEU B CD2   1 
ATOM   3848 N  N     . TYR B 1 215 ? 2.517   11.051  53.036  1.00 40.67  ? 257 TYR B N     1 
ATOM   3849 C  CA    . TYR B 1 215 ? 1.505   10.360  53.836  1.00 34.57  ? 257 TYR B CA    1 
ATOM   3850 C  C     . TYR B 1 215 ? 0.638   11.386  54.560  1.00 39.21  ? 257 TYR B C     1 
ATOM   3851 O  O     . TYR B 1 215 ? 0.573   11.402  55.792  1.00 42.33  ? 257 TYR B O     1 
ATOM   3852 C  CB    . TYR B 1 215 ? 2.172   9.424   54.838  1.00 37.88  ? 257 TYR B CB    1 
ATOM   3853 C  CG    . TYR B 1 215 ? 3.214   8.524   54.239  1.00 36.75  ? 257 TYR B CG    1 
ATOM   3854 C  CD1   . TYR B 1 215 ? 2.867   7.342   53.586  1.00 35.99  ? 257 TYR B CD1   1 
ATOM   3855 C  CD2   . TYR B 1 215 ? 4.545   8.858   54.326  1.00 39.26  ? 257 TYR B CD2   1 
ATOM   3856 C  CE1   . TYR B 1 215 ? 3.827   6.520   53.040  1.00 39.58  ? 257 TYR B CE1   1 
ATOM   3857 C  CE2   . TYR B 1 215 ? 5.519   8.044   53.794  1.00 39.30  ? 257 TYR B CE2   1 
ATOM   3858 C  CZ    . TYR B 1 215 ? 5.172   6.879   53.156  1.00 41.28  ? 257 TYR B CZ    1 
ATOM   3859 O  OH    . TYR B 1 215 ? 6.184   6.103   52.646  1.00 36.73  ? 257 TYR B OH    1 
ATOM   3860 N  N     . PRO B 1 216 ? -0.047  12.265  53.818  1.00 46.77  ? 258 PRO B N     1 
ATOM   3861 C  CA    . PRO B 1 216 ? -0.742  13.391  54.468  1.00 44.65  ? 258 PRO B CA    1 
ATOM   3862 C  C     . PRO B 1 216 ? -1.824  12.976  55.430  1.00 42.59  ? 258 PRO B C     1 
ATOM   3863 O  O     . PRO B 1 216 ? -2.246  13.803  56.245  1.00 48.33  ? 258 PRO B O     1 
ATOM   3864 C  CB    . PRO B 1 216 ? -1.340  14.178  53.281  1.00 40.07  ? 258 PRO B CB    1 
ATOM   3865 C  CG    . PRO B 1 216 ? -1.442  13.206  52.202  1.00 42.29  ? 258 PRO B CG    1 
ATOM   3866 C  CD    . PRO B 1 216 ? -0.291  12.241  52.360  1.00 40.83  ? 258 PRO B CD    1 
ATOM   3867 N  N     . ASN B 1 217 ? -2.318  11.745  55.349  1.00 38.88  ? 259 ASN B N     1 
ATOM   3868 C  CA    . ASN B 1 217 ? -3.434  11.337  56.189  1.00 44.39  ? 259 ASN B CA    1 
ATOM   3869 C  C     . ASN B 1 217 ? -3.097  10.129  57.058  1.00 43.53  ? 259 ASN B C     1 
ATOM   3870 O  O     . ASN B 1 217 ? -4.011  9.449   57.524  1.00 48.37  ? 259 ASN B O     1 
ATOM   3871 C  CB    . ASN B 1 217 ? -4.674  11.057  55.329  1.00 48.02  ? 259 ASN B CB    1 
ATOM   3872 C  CG    . ASN B 1 217 ? -5.074  12.261  54.460  1.00 53.72  ? 259 ASN B CG    1 
ATOM   3873 O  OD1   . ASN B 1 217 ? -5.261  12.133  53.244  1.00 58.35  ? 259 ASN B OD1   1 
ATOM   3874 N  ND2   . ASN B 1 217 ? -5.188  13.438  55.083  1.00 53.41  ? 259 ASN B ND2   1 
ATOM   3875 N  N     . THR B 1 218 ? -1.813  9.845   57.301  1.00 39.26  ? 260 THR B N     1 
ATOM   3876 C  CA    . THR B 1 218 ? -1.441  8.717   58.148  1.00 42.31  ? 260 THR B CA    1 
ATOM   3877 C  C     . THR B 1 218 ? -1.370  9.164   59.608  1.00 45.12  ? 260 THR B C     1 
ATOM   3878 O  O     . THR B 1 218 ? -0.480  9.961   59.963  1.00 38.75  ? 260 THR B O     1 
ATOM   3879 C  CB    . THR B 1 218 ? -0.110  8.124   57.712  1.00 42.24  ? 260 THR B CB    1 
ATOM   3880 O  OG1   . THR B 1 218 ? -0.215  7.644   56.377  1.00 46.01  ? 260 THR B OG1   1 
ATOM   3881 C  CG2   . THR B 1 218 ? 0.254   6.942   58.590  1.00 41.68  ? 260 THR B CG2   1 
ATOM   3882 N  N     . PRO B 1 219 ? -2.268  8.707   60.471  1.00 46.31  ? 261 PRO B N     1 
ATOM   3883 C  CA    . PRO B 1 219 ? -2.219  9.082   61.889  1.00 40.31  ? 261 PRO B CA    1 
ATOM   3884 C  C     . PRO B 1 219 ? -1.363  8.107   62.691  1.00 38.34  ? 261 PRO B C     1 
ATOM   3885 O  O     . PRO B 1 219 ? -0.985  7.041   62.205  1.00 44.12  ? 261 PRO B O     1 
ATOM   3886 C  CB    . PRO B 1 219 ? -3.683  8.974   62.306  1.00 40.28  ? 261 PRO B CB    1 
ATOM   3887 C  CG    . PRO B 1 219 ? -4.167  7.769   61.493  1.00 40.75  ? 261 PRO B CG    1 
ATOM   3888 C  CD    . PRO B 1 219 ? -3.450  7.882   60.150  1.00 36.13  ? 261 PRO B CD    1 
ATOM   3889 N  N     . TYR B 1 220 ? -1.079  8.488   63.945  1.00 41.97  ? 262 TYR B N     1 
ATOM   3890 C  CA    . TYR B 1 220 ? -0.362  7.649   64.913  1.00 38.90  ? 262 TYR B CA    1 
ATOM   3891 C  C     . TYR B 1 220 ? 1.102   7.420   64.536  1.00 42.65  ? 262 TYR B C     1 
ATOM   3892 O  O     . TYR B 1 220 ? 1.731   6.480   65.043  1.00 42.44  ? 262 TYR B O     1 
ATOM   3893 C  CB    . TYR B 1 220 ? -1.048  6.285   65.115  1.00 39.53  ? 262 TYR B CB    1 
ATOM   3894 C  CG    . TYR B 1 220 ? -2.537  6.373   65.404  1.00 39.94  ? 262 TYR B CG    1 
ATOM   3895 C  CD1   . TYR B 1 220 ? -3.000  7.053   66.513  1.00 38.97  ? 262 TYR B CD1   1 
ATOM   3896 C  CD2   . TYR B 1 220 ? -3.464  5.781   64.565  1.00 45.11  ? 262 TYR B CD2   1 
ATOM   3897 C  CE1   . TYR B 1 220 ? -4.328  7.150   66.797  1.00 48.47  ? 262 TYR B CE1   1 
ATOM   3898 C  CE2   . TYR B 1 220 ? -4.837  5.876   64.822  1.00 49.09  ? 262 TYR B CE2   1 
ATOM   3899 C  CZ    . TYR B 1 220 ? -5.262  6.563   65.946  1.00 59.36  ? 262 TYR B CZ    1 
ATOM   3900 O  OH    . TYR B 1 220 ? -6.606  6.668   66.237  1.00 52.69  ? 262 TYR B OH    1 
ATOM   3901 N  N     . ALA B 1 221 ? 1.651   8.233   63.635  1.00 39.21  ? 263 ALA B N     1 
ATOM   3902 C  CA    . ALA B 1 221 ? 3.051   8.147   63.222  1.00 38.66  ? 263 ALA B CA    1 
ATOM   3903 C  C     . ALA B 1 221 ? 3.817   9.176   64.047  1.00 39.80  ? 263 ALA B C     1 
ATOM   3904 O  O     . ALA B 1 221 ? 3.822   10.376  63.723  1.00 29.70  ? 263 ALA B O     1 
ATOM   3905 C  CB    . ALA B 1 221 ? 3.221   8.400   61.727  1.00 39.49  ? 263 ALA B CB    1 
ATOM   3906 N  N     . TYR B 1 222 ? 4.464   8.691   65.113  1.00 35.06  ? 264 TYR B N     1 
ATOM   3907 C  CA    . TYR B 1 222 ? 5.213   9.512   66.049  1.00 38.88  ? 264 TYR B CA    1 
ATOM   3908 C  C     . TYR B 1 222 ? 6.699   9.182   66.021  1.00 37.92  ? 264 TYR B C     1 
ATOM   3909 O  O     . TYR B 1 222 ? 7.152   8.152   65.507  1.00 33.02  ? 264 TYR B O     1 
ATOM   3910 C  CB    . TYR B 1 222 ? 4.669   9.336   67.464  1.00 41.29  ? 264 TYR B CB    1 
ATOM   3911 C  CG    . TYR B 1 222 ? 3.176   9.441   67.522  1.00 39.70  ? 264 TYR B CG    1 
ATOM   3912 C  CD1   . TYR B 1 222 ? 2.505   10.523  66.947  1.00 41.70  ? 264 TYR B CD1   1 
ATOM   3913 C  CD2   . TYR B 1 222 ? 2.429   8.444   68.120  1.00 39.04  ? 264 TYR B CD2   1 
ATOM   3914 C  CE1   . TYR B 1 222 ? 1.111   10.606  66.989  1.00 35.87  ? 264 TYR B CE1   1 
ATOM   3915 C  CE2   . TYR B 1 222 ? 1.062   8.510   68.170  1.00 39.51  ? 264 TYR B CE2   1 
ATOM   3916 C  CZ    . TYR B 1 222 ? 0.408   9.585   67.612  1.00 39.66  ? 264 TYR B CZ    1 
ATOM   3917 O  OH    . TYR B 1 222 ? -0.956  9.603   67.695  1.00 43.19  ? 264 TYR B OH    1 
ATOM   3918 N  N     . THR B 1 223 ? 7.457   10.085  66.634  1.00 42.07  ? 265 THR B N     1 
ATOM   3919 C  CA    . THR B 1 223 ? 8.897   9.974   66.690  1.00 35.35  ? 265 THR B CA    1 
ATOM   3920 C  C     . THR B 1 223 ? 9.455   10.160  68.095  1.00 42.49  ? 265 THR B C     1 
ATOM   3921 O  O     . THR B 1 223 ? 10.677  10.034  68.292  1.00 42.99  ? 265 THR B O     1 
ATOM   3922 C  CB    . THR B 1 223 ? 9.518   10.984  65.720  1.00 38.86  ? 265 THR B CB    1 
ATOM   3923 O  OG1   . THR B 1 223 ? 10.893  10.670  65.510  1.00 52.48  ? 265 THR B OG1   1 
ATOM   3924 C  CG2   . THR B 1 223 ? 9.419   12.333  66.263  1.00 31.20  ? 265 THR B CG2   1 
ATOM   3925 N  N     . PHE B 1 224 ? 8.596   10.395  69.084  1.00 40.88  ? 266 PHE B N     1 
ATOM   3926 C  CA    . PHE B 1 224 ? 9.031   10.640  70.450  1.00 39.33  ? 266 PHE B CA    1 
ATOM   3927 C  C     . PHE B 1 224 ? 7.945   10.143  71.391  1.00 41.36  ? 266 PHE B C     1 
ATOM   3928 O  O     . PHE B 1 224 ? 6.754   10.225  71.083  1.00 39.21  ? 266 PHE B O     1 
ATOM   3929 C  CB    . PHE B 1 224 ? 9.324   12.123  70.725  1.00 31.82  ? 266 PHE B CB    1 
ATOM   3930 C  CG    . PHE B 1 224 ? 9.221   12.507  72.204  1.00 42.02  ? 266 PHE B CG    1 
ATOM   3931 C  CD1   . PHE B 1 224 ? 10.317  12.399  73.060  1.00 36.20  ? 266 PHE B CD1   1 
ATOM   3932 C  CD2   . PHE B 1 224 ? 8.018   12.951  72.739  1.00 37.98  ? 266 PHE B CD2   1 
ATOM   3933 C  CE1   . PHE B 1 224 ? 10.198  12.756  74.409  1.00 39.25  ? 266 PHE B CE1   1 
ATOM   3934 C  CE2   . PHE B 1 224 ? 7.897   13.298  74.072  1.00 36.35  ? 266 PHE B CE2   1 
ATOM   3935 C  CZ    . PHE B 1 224 ? 8.986   13.214  74.913  1.00 41.92  ? 266 PHE B CZ    1 
ATOM   3936 N  N     . TRP B 1 225 ? 8.371   9.648   72.553  1.00 38.12  ? 267 TRP B N     1 
ATOM   3937 C  CA    . TRP B 1 225 ? 7.463   9.138   73.564  1.00 37.93  ? 267 TRP B CA    1 
ATOM   3938 C  C     . TRP B 1 225 ? 8.123   9.368   74.911  1.00 38.87  ? 267 TRP B C     1 
ATOM   3939 O  O     . TRP B 1 225 ? 9.306   9.042   75.069  1.00 41.17  ? 267 TRP B O     1 
ATOM   3940 C  CB    . TRP B 1 225 ? 7.180   7.642   73.373  1.00 37.56  ? 267 TRP B CB    1 
ATOM   3941 C  CG    . TRP B 1 225 ? 6.739   7.171   71.992  1.00 44.14  ? 267 TRP B CG    1 
ATOM   3942 C  CD1   . TRP B 1 225 ? 5.459   6.850   71.606  1.00 39.98  ? 267 TRP B CD1   1 
ATOM   3943 C  CD2   . TRP B 1 225 ? 7.575   6.908   70.849  1.00 39.70  ? 267 TRP B CD2   1 
ATOM   3944 N  NE1   . TRP B 1 225 ? 5.454   6.421   70.306  1.00 37.48  ? 267 TRP B NE1   1 
ATOM   3945 C  CE2   . TRP B 1 225 ? 6.732   6.441   69.816  1.00 39.27  ? 267 TRP B CE2   1 
ATOM   3946 C  CE3   . TRP B 1 225 ? 8.950   7.020   70.602  1.00 39.48  ? 267 TRP B CE3   1 
ATOM   3947 C  CZ2   . TRP B 1 225 ? 7.219   6.090   68.543  1.00 37.69  ? 267 TRP B CZ2   1 
ATOM   3948 C  CZ3   . TRP B 1 225 ? 9.436   6.680   69.347  1.00 37.36  ? 267 TRP B CZ3   1 
ATOM   3949 C  CH2   . TRP B 1 225 ? 8.565   6.221   68.325  1.00 42.86  ? 267 TRP B CH2   1 
ATOM   3950 N  N     . THR B 1 226 ? 7.373   9.907   75.877  1.00 36.03  ? 268 THR B N     1 
ATOM   3951 C  CA    . THR B 1 226 ? 7.960   10.134  77.190  1.00 41.97  ? 268 THR B CA    1 
ATOM   3952 C  C     . THR B 1 226 ? 8.344   8.813   77.848  1.00 43.85  ? 268 THR B C     1 
ATOM   3953 O  O     . THR B 1 226 ? 7.643   7.802   77.730  1.00 42.99  ? 268 THR B O     1 
ATOM   3954 C  CB    . THR B 1 226 ? 7.003   10.897  78.095  1.00 42.91  ? 268 THR B CB    1 
ATOM   3955 O  OG1   . THR B 1 226 ? 7.516   10.876  79.430  1.00 49.71  ? 268 THR B OG1   1 
ATOM   3956 C  CG2   . THR B 1 226 ? 5.644   10.242  78.097  1.00 45.54  ? 268 THR B CG2   1 
ATOM   3957 N  N     . TYR B 1 227 ? 9.486   8.826   78.535  1.00 42.27  ? 269 TYR B N     1 
ATOM   3958 C  CA    . TYR B 1 227 ? 9.937   7.652   79.276  1.00 46.08  ? 269 TYR B CA    1 
ATOM   3959 C  C     . TYR B 1 227 ? 8.934   7.213   80.343  1.00 44.17  ? 269 TYR B C     1 
ATOM   3960 O  O     . TYR B 1 227 ? 8.958   6.051   80.767  1.00 44.57  ? 269 TYR B O     1 
ATOM   3961 C  CB    . TYR B 1 227 ? 11.291  7.942   79.951  1.00 45.78  ? 269 TYR B CB    1 
ATOM   3962 C  CG    . TYR B 1 227 ? 12.523  7.807   79.077  1.00 38.23  ? 269 TYR B CG    1 
ATOM   3963 C  CD1   . TYR B 1 227 ? 12.826  6.604   78.440  1.00 40.66  ? 269 TYR B CD1   1 
ATOM   3964 C  CD2   . TYR B 1 227 ? 13.400  8.870   78.919  1.00 34.86  ? 269 TYR B CD2   1 
ATOM   3965 C  CE1   . TYR B 1 227 ? 13.952  6.475   77.659  1.00 35.22  ? 269 TYR B CE1   1 
ATOM   3966 C  CE2   . TYR B 1 227 ? 14.544  8.746   78.156  1.00 33.47  ? 269 TYR B CE2   1 
ATOM   3967 C  CZ    . TYR B 1 227 ? 14.817  7.546   77.533  1.00 35.52  ? 269 TYR B CZ    1 
ATOM   3968 O  OH    . TYR B 1 227 ? 15.955  7.407   76.779  1.00 33.82  ? 269 TYR B OH    1 
ATOM   3969 N  N     . MET B 1 228 ? 8.080   8.122   80.803  1.00 46.71  ? 270 MET B N     1 
ATOM   3970 C  CA    . MET B 1 228 ? 7.107   7.829   81.841  1.00 47.85  ? 270 MET B CA    1 
ATOM   3971 C  C     . MET B 1 228 ? 5.912   7.085   81.268  1.00 53.26  ? 270 MET B C     1 
ATOM   3972 O  O     . MET B 1 228 ? 5.628   7.149   80.066  1.00 57.96  ? 270 MET B O     1 
ATOM   3973 C  CB    . MET B 1 228 ? 6.655   9.122   82.501  1.00 44.44  ? 270 MET B CB    1 
ATOM   3974 C  CG    . MET B 1 228 ? 7.741   9.668   83.413  1.00 54.29  ? 270 MET B CG    1 
ATOM   3975 S  SD    . MET B 1 228 ? 7.875   11.468  83.488  1.00 68.06  ? 270 MET B SD    1 
ATOM   3976 C  CE    . MET B 1 228 ? 9.093   11.786  82.208  1.00 53.10  ? 270 MET B CE    1 
ATOM   3977 N  N     . MET B 1 229 ? 5.235   6.338   82.140  1.00 50.31  ? 271 MET B N     1 
ATOM   3978 C  CA    . MET B 1 229 ? 3.896   5.807   81.891  1.00 50.13  ? 271 MET B CA    1 
ATOM   3979 C  C     . MET B 1 229 ? 3.843   4.774   80.762  1.00 55.72  ? 271 MET B C     1 
ATOM   3980 O  O     . MET B 1 229 ? 2.767   4.540   80.177  1.00 53.25  ? 271 MET B O     1 
ATOM   3981 C  CB    . MET B 1 229 ? 2.909   6.949   81.603  1.00 52.79  ? 271 MET B CB    1 
ATOM   3982 C  CG    . MET B 1 229 ? 2.844   8.016   82.707  1.00 56.71  ? 271 MET B CG    1 
ATOM   3983 S  SD    . MET B 1 229 ? 2.097   7.439   84.256  1.00 67.83  ? 271 MET B SD    1 
ATOM   3984 C  CE    . MET B 1 229 ? 2.080   8.938   85.248  1.00 58.43  ? 271 MET B CE    1 
ATOM   3985 N  N     . ASN B 1 230 ? 4.965   4.115   80.473  1.00 53.44  ? 272 ASN B N     1 
ATOM   3986 C  CA    . ASN B 1 230 ? 5.068   3.166   79.362  1.00 57.42  ? 272 ASN B CA    1 
ATOM   3987 C  C     . ASN B 1 230 ? 4.464   3.752   78.085  1.00 52.97  ? 272 ASN B C     1 
ATOM   3988 O  O     . ASN B 1 230 ? 3.791   3.063   77.319  1.00 46.69  ? 272 ASN B O     1 
ATOM   3989 C  CB    . ASN B 1 230 ? 4.418   1.827   79.718  1.00 57.85  ? 272 ASN B CB    1 
ATOM   3990 C  CG    . ASN B 1 230 ? 4.809   1.340   81.103  1.00 72.86  ? 272 ASN B CG    1 
ATOM   3991 O  OD1   . ASN B 1 230 ? 5.926   0.847   81.317  1.00 77.09  ? 272 ASN B OD1   1 
ATOM   3992 N  ND2   . ASN B 1 230 ? 3.886   1.475   82.059  1.00 65.95  ? 272 ASN B ND2   1 
ATOM   3993 N  N     . ALA B 1 231 ? 4.721   5.042   77.858  1.00 46.94  ? 273 ALA B N     1 
ATOM   3994 C  CA    . ALA B 1 231 ? 4.108   5.759   76.744  1.00 46.91  ? 273 ALA B CA    1 
ATOM   3995 C  C     . ALA B 1 231 ? 4.483   5.165   75.384  1.00 44.43  ? 273 ALA B C     1 
ATOM   3996 O  O     . ALA B 1 231 ? 3.636   5.075   74.495  1.00 46.42  ? 273 ALA B O     1 
ATOM   3997 C  CB    . ALA B 1 231 ? 4.500   7.228   76.807  1.00 41.31  ? 273 ALA B CB    1 
ATOM   3998 N  N     . ARG B 1 232 ? 5.743   4.756   75.202  1.00 47.47  ? 274 ARG B N     1 
ATOM   3999 C  CA    . ARG B 1 232 ? 6.173   4.188   73.926  1.00 46.34  ? 274 ARG B CA    1 
ATOM   4000 C  C     . ARG B 1 232 ? 5.443   2.889   73.627  1.00 51.62  ? 274 ARG B C     1 
ATOM   4001 O  O     . ARG B 1 232 ? 4.971   2.682   72.504  1.00 47.61  ? 274 ARG B O     1 
ATOM   4002 C  CB    . ARG B 1 232 ? 7.688   3.951   73.918  1.00 46.66  ? 274 ARG B CB    1 
ATOM   4003 C  CG    . ARG B 1 232 ? 8.263   3.506   72.561  1.00 42.52  ? 274 ARG B CG    1 
ATOM   4004 C  CD    . ARG B 1 232 ? 9.729   3.878   72.407  1.00 32.41  ? 274 ARG B CD    1 
ATOM   4005 N  NE    . ARG B 1 232 ? 10.239  3.607   71.064  1.00 42.48  ? 274 ARG B NE    1 
ATOM   4006 C  CZ    . ARG B 1 232 ? 11.479  3.870   70.651  1.00 38.22  ? 274 ARG B CZ    1 
ATOM   4007 N  NH1   . ARG B 1 232 ? 12.341  4.414   71.494  1.00 36.53  ? 274 ARG B NH1   1 
ATOM   4008 N  NH2   . ARG B 1 232 ? 11.859  3.583   69.401  1.00 35.53  ? 274 ARG B NH2   1 
ATOM   4009 N  N     . SER B 1 233 ? 5.372   1.983   74.611  1.00 50.24  ? 275 SER B N     1 
ATOM   4010 C  CA    . SER B 1 233 ? 4.657   0.725   74.411  1.00 49.80  ? 275 SER B CA    1 
ATOM   4011 C  C     . SER B 1 233 ? 3.160   0.935   74.205  1.00 51.33  ? 275 SER B C     1 
ATOM   4012 O  O     . SER B 1 233 ? 2.495   0.043   73.666  1.00 45.49  ? 275 SER B O     1 
ATOM   4013 C  CB    . SER B 1 233 ? 4.889   -0.216  75.592  1.00 59.26  ? 275 SER B CB    1 
ATOM   4014 O  OG    . SER B 1 233 ? 4.443   0.380   76.804  1.00 64.83  ? 275 SER B OG    1 
ATOM   4015 N  N     . LYS B 1 234 ? 2.619   2.087   74.611  1.00 47.68  ? 276 LYS B N     1 
ATOM   4016 C  CA    . LYS B 1 234 ? 1.235   2.445   74.320  1.00 50.93  ? 276 LYS B CA    1 
ATOM   4017 C  C     . LYS B 1 234 ? 1.085   3.276   73.044  1.00 54.88  ? 276 LYS B C     1 
ATOM   4018 O  O     . LYS B 1 234 ? -0.045  3.628   72.700  1.00 53.52  ? 276 LYS B O     1 
ATOM   4019 C  CB    . LYS B 1 234 ? 0.609   3.231   75.485  1.00 50.49  ? 276 LYS B CB    1 
ATOM   4020 C  CG    . LYS B 1 234 ? 0.557   2.529   76.859  1.00 53.39  ? 276 LYS B CG    1 
ATOM   4021 C  CD    . LYS B 1 234 ? -0.491  3.199   77.780  1.00 47.42  ? 276 LYS B CD    1 
ATOM   4022 C  CE    . LYS B 1 234 ? -0.324  2.838   79.253  1.00 59.88  ? 276 LYS B CE    1 
ATOM   4023 N  NZ    . LYS B 1 234 ? 0.611   3.766   79.954  1.00 61.35  ? 276 LYS B NZ    1 
ATOM   4024 N  N     . ASN B 1 235 ? 2.188   3.591   72.343  1.00 44.80  ? 277 ASN B N     1 
ATOM   4025 C  CA    . ASN B 1 235 ? 2.227   4.532   71.209  1.00 40.06  ? 277 ASN B CA    1 
ATOM   4026 C  C     . ASN B 1 235 ? 1.485   5.836   71.513  1.00 44.28  ? 277 ASN B C     1 
ATOM   4027 O  O     . ASN B 1 235 ? 0.756   6.379   70.673  1.00 45.66  ? 277 ASN B O     1 
ATOM   4028 C  CB    . ASN B 1 235 ? 1.709   3.893   69.921  1.00 41.74  ? 277 ASN B CB    1 
ATOM   4029 C  CG    . ASN B 1 235 ? 2.180   4.630   68.677  1.00 43.41  ? 277 ASN B CG    1 
ATOM   4030 O  OD1   . ASN B 1 235 ? 3.200   5.315   68.697  1.00 45.02  ? 277 ASN B OD1   1 
ATOM   4031 N  ND2   . ASN B 1 235 ? 1.441   4.493   67.588  1.00 45.59  ? 277 ASN B ND2   1 
ATOM   4032 N  N     . VAL B 1 236 ? 1.680   6.351   72.727  1.00 43.58  ? 278 VAL B N     1 
ATOM   4033 C  CA    . VAL B 1 236 ? 1.262   7.704   73.097  1.00 43.69  ? 278 VAL B CA    1 
ATOM   4034 C  C     . VAL B 1 236 ? 2.467   8.613   72.837  1.00 44.73  ? 278 VAL B C     1 
ATOM   4035 O  O     . VAL B 1 236 ? 3.385   8.720   73.661  1.00 44.54  ? 278 VAL B O     1 
ATOM   4036 C  CB    . VAL B 1 236 ? 0.770   7.771   74.548  1.00 47.62  ? 278 VAL B CB    1 
ATOM   4037 C  CG1   . VAL B 1 236 ? 0.221   9.147   74.891  1.00 43.41  ? 278 VAL B CG1   1 
ATOM   4038 C  CG2   . VAL B 1 236 ? -0.299  6.699   74.801  1.00 49.41  ? 278 VAL B CG2   1 
ATOM   4039 N  N     . GLY B 1 237 ? 2.487   9.253   71.662  1.00 42.99  ? 279 GLY B N     1 
ATOM   4040 C  CA    . GLY B 1 237 ? 3.679   9.924   71.197  1.00 35.63  ? 279 GLY B CA    1 
ATOM   4041 C  C     . GLY B 1 237 ? 3.375   11.209  70.456  1.00 36.68  ? 279 GLY B C     1 
ATOM   4042 O  O     . GLY B 1 237 ? 2.220   11.602  70.296  1.00 42.70  ? 279 GLY B O     1 
ATOM   4043 N  N     . TRP B 1 238 ? 4.457   11.858  70.025  1.00 39.24  ? 280 TRP B N     1 
ATOM   4044 C  CA    . TRP B 1 238 ? 4.463   13.093  69.258  1.00 35.89  ? 280 TRP B CA    1 
ATOM   4045 C  C     . TRP B 1 238 ? 5.419   12.916  68.086  1.00 42.24  ? 280 TRP B C     1 
ATOM   4046 O  O     . TRP B 1 238 ? 6.500   12.343  68.268  1.00 38.29  ? 280 TRP B O     1 
ATOM   4047 C  CB    . TRP B 1 238 ? 4.970   14.303  70.051  1.00 35.30  ? 280 TRP B CB    1 
ATOM   4048 C  CG    . TRP B 1 238 ? 4.368   14.594  71.389  1.00 33.70  ? 280 TRP B CG    1 
ATOM   4049 C  CD1   . TRP B 1 238 ? 4.121   13.719  72.407  1.00 30.27  ? 280 TRP B CD1   1 
ATOM   4050 C  CD2   . TRP B 1 238 ? 3.979   15.884  71.861  1.00 30.67  ? 280 TRP B CD2   1 
ATOM   4051 N  NE1   . TRP B 1 238 ? 3.580   14.386  73.492  1.00 36.81  ? 280 TRP B NE1   1 
ATOM   4052 C  CE2   . TRP B 1 238 ? 3.483   15.719  73.184  1.00 39.97  ? 280 TRP B CE2   1 
ATOM   4053 C  CE3   . TRP B 1 238 ? 4.008   17.172  71.299  1.00 30.41  ? 280 TRP B CE3   1 
ATOM   4054 C  CZ2   . TRP B 1 238 ? 3.017   16.796  73.958  1.00 38.08  ? 280 TRP B CZ2   1 
ATOM   4055 C  CZ3   . TRP B 1 238 ? 3.550   18.259  72.076  1.00 35.70  ? 280 TRP B CZ3   1 
ATOM   4056 C  CH2   . TRP B 1 238 ? 3.064   18.055  73.397  1.00 36.87  ? 280 TRP B CH2   1 
ATOM   4057 N  N     . ARG B 1 239 ? 5.046   13.451  66.900  1.00 36.44  ? 281 ARG B N     1 
ATOM   4058 C  CA    . ARG B 1 239 ? 5.978   13.603  65.781  1.00 36.48  ? 281 ARG B CA    1 
ATOM   4059 C  C     . ARG B 1 239 ? 6.709   14.934  65.946  1.00 36.08  ? 281 ARG B C     1 
ATOM   4060 O  O     . ARG B 1 239 ? 6.120   16.003  65.759  1.00 33.29  ? 281 ARG B O     1 
ATOM   4061 C  CB    . ARG B 1 239 ? 5.257   13.528  64.433  1.00 35.76  ? 281 ARG B CB    1 
ATOM   4062 C  CG    . ARG B 1 239 ? 6.197   13.326  63.233  1.00 35.43  ? 281 ARG B CG    1 
ATOM   4063 C  CD    . ARG B 1 239 ? 5.460   13.010  61.918  1.00 30.40  ? 281 ARG B CD    1 
ATOM   4064 N  NE    . ARG B 1 239 ? 4.591   14.110  61.527  1.00 31.39  ? 281 ARG B NE    1 
ATOM   4065 C  CZ    . ARG B 1 239 ? 4.938   15.062  60.661  1.00 35.53  ? 281 ARG B CZ    1 
ATOM   4066 N  NH1   . ARG B 1 239 ? 6.142   15.029  60.100  1.00 31.79  ? 281 ARG B NH1   1 
ATOM   4067 N  NH2   . ARG B 1 239 ? 4.079   16.044  60.348  1.00 32.18  ? 281 ARG B NH2   1 
ATOM   4068 N  N     . LEU B 1 240 ? 7.995   14.865  66.322  1.00 37.26  ? 282 LEU B N     1 
ATOM   4069 C  CA    . LEU B 1 240 ? 8.806   16.045  66.593  1.00 36.63  ? 282 LEU B CA    1 
ATOM   4070 C  C     . LEU B 1 240 ? 10.029  16.149  65.705  1.00 33.98  ? 282 LEU B C     1 
ATOM   4071 O  O     . LEU B 1 240 ? 10.639  17.225  65.649  1.00 34.61  ? 282 LEU B O     1 
ATOM   4072 C  CB    . LEU B 1 240 ? 9.268   16.065  68.060  1.00 30.82  ? 282 LEU B CB    1 
ATOM   4073 C  CG    . LEU B 1 240 ? 8.190   15.985  69.133  1.00 37.54  ? 282 LEU B CG    1 
ATOM   4074 C  CD1   . LEU B 1 240 ? 8.861   15.998  70.519  1.00 35.40  ? 282 LEU B CD1   1 
ATOM   4075 C  CD2   . LEU B 1 240 ? 7.147   17.107  69.019  1.00 34.98  ? 282 LEU B CD2   1 
ATOM   4076 N  N     . ASP B 1 241 ? 10.389  15.081  64.999  1.00 30.66  ? 283 ASP B N     1 
ATOM   4077 C  CA    . ASP B 1 241 ? 11.620  15.013  64.228  1.00 33.98  ? 283 ASP B CA    1 
ATOM   4078 C  C     . ASP B 1 241 ? 11.278  14.989  62.739  1.00 35.65  ? 283 ASP B C     1 
ATOM   4079 O  O     . ASP B 1 241 ? 10.615  14.062  62.274  1.00 38.13  ? 283 ASP B O     1 
ATOM   4080 C  CB    . ASP B 1 241 ? 12.433  13.784  64.651  1.00 35.72  ? 283 ASP B CB    1 
ATOM   4081 C  CG    . ASP B 1 241 ? 12.845  13.842  66.147  1.00 41.64  ? 283 ASP B CG    1 
ATOM   4082 O  OD1   . ASP B 1 241 ? 13.853  14.525  66.460  1.00 42.65  ? 283 ASP B OD1   1 
ATOM   4083 O  OD2   . ASP B 1 241 ? 12.170  13.218  67.010  1.00 37.09  ? 283 ASP B OD2   1 
ATOM   4084 N  N     . TYR B 1 242 ? 11.758  15.978  61.990  1.00 30.26  ? 284 TYR B N     1 
ATOM   4085 C  CA    . TYR B 1 242 ? 11.323  16.170  60.615  1.00 36.36  ? 284 TYR B CA    1 
ATOM   4086 C  C     . TYR B 1 242 ? 12.475  16.120  59.624  1.00 38.82  ? 284 TYR B C     1 
ATOM   4087 O  O     . TYR B 1 242 ? 13.649  16.288  59.968  1.00 36.87  ? 284 TYR B O     1 
ATOM   4088 C  CB    . TYR B 1 242 ? 10.619  17.524  60.426  1.00 31.61  ? 284 TYR B CB    1 
ATOM   4089 C  CG    . TYR B 1 242 ? 9.371   17.698  61.236  1.00 35.84  ? 284 TYR B CG    1 
ATOM   4090 C  CD1   . TYR B 1 242 ? 9.449   17.882  62.624  1.00 31.21  ? 284 TYR B CD1   1 
ATOM   4091 C  CD2   . TYR B 1 242 ? 8.099   17.690  60.613  1.00 31.50  ? 284 TYR B CD2   1 
ATOM   4092 C  CE1   . TYR B 1 242 ? 8.335   18.043  63.381  1.00 30.11  ? 284 TYR B CE1   1 
ATOM   4093 C  CE2   . TYR B 1 242 ? 6.954   17.844  61.363  1.00 29.99  ? 284 TYR B CE2   1 
ATOM   4094 C  CZ    . TYR B 1 242 ? 7.081   18.029  62.761  1.00 37.15  ? 284 TYR B CZ    1 
ATOM   4095 O  OH    . TYR B 1 242 ? 5.976   18.193  63.558  1.00 33.04  ? 284 TYR B OH    1 
ATOM   4096 N  N     . PHE B 1 243 ? 12.094  15.923  58.371  1.00 32.73  ? 285 PHE B N     1 
ATOM   4097 C  CA    . PHE B 1 243 ? 12.864  16.363  57.224  1.00 33.27  ? 285 PHE B CA    1 
ATOM   4098 C  C     . PHE B 1 243 ? 12.012  17.384  56.462  1.00 38.10  ? 285 PHE B C     1 
ATOM   4099 O  O     . PHE B 1 243 ? 10.939  17.039  55.954  1.00 37.90  ? 285 PHE B O     1 
ATOM   4100 C  CB    . PHE B 1 243 ? 13.212  15.171  56.337  1.00 34.54  ? 285 PHE B CB    1 
ATOM   4101 C  CG    . PHE B 1 243 ? 14.267  14.256  56.902  1.00 38.04  ? 285 PHE B CG    1 
ATOM   4102 C  CD1   . PHE B 1 243 ? 15.607  14.636  56.926  1.00 40.18  ? 285 PHE B CD1   1 
ATOM   4103 C  CD2   . PHE B 1 243 ? 13.931  13.000  57.358  1.00 36.83  ? 285 PHE B CD2   1 
ATOM   4104 C  CE1   . PHE B 1 243 ? 16.583  13.797  57.404  1.00 31.94  ? 285 PHE B CE1   1 
ATOM   4105 C  CE2   . PHE B 1 243 ? 14.898  12.154  57.847  1.00 36.87  ? 285 PHE B CE2   1 
ATOM   4106 C  CZ    . PHE B 1 243 ? 16.229  12.557  57.875  1.00 35.68  ? 285 PHE B CZ    1 
ATOM   4107 N  N     . LEU B 1 244 ? 12.466  18.633  56.398  1.00 34.42  ? 286 LEU B N     1 
ATOM   4108 C  CA    . LEU B 1 244 ? 11.838  19.663  55.576  1.00 37.89  ? 286 LEU B CA    1 
ATOM   4109 C  C     . LEU B 1 244 ? 12.753  19.991  54.406  1.00 40.75  ? 286 LEU B C     1 
ATOM   4110 O  O     . LEU B 1 244 ? 13.966  20.172  54.603  1.00 42.89  ? 286 LEU B O     1 
ATOM   4111 C  CB    . LEU B 1 244 ? 11.555  20.934  56.375  1.00 37.62  ? 286 LEU B CB    1 
ATOM   4112 C  CG    . LEU B 1 244 ? 10.957  20.769  57.758  1.00 35.83  ? 286 LEU B CG    1 
ATOM   4113 C  CD1   . LEU B 1 244 ? 10.612  22.134  58.295  1.00 39.73  ? 286 LEU B CD1   1 
ATOM   4114 C  CD2   . LEU B 1 244 ? 9.724   19.923  57.717  1.00 40.63  ? 286 LEU B CD2   1 
ATOM   4115 N  N     . LEU B 1 245 ? 12.172  20.076  53.195  1.00 33.84  ? 287 LEU B N     1 
ATOM   4116 C  CA    . LEU B 1 245 ? 12.919  20.268  51.953  1.00 34.42  ? 287 LEU B CA    1 
ATOM   4117 C  C     . LEU B 1 245 ? 12.468  21.513  51.204  1.00 37.04  ? 287 LEU B C     1 
ATOM   4118 O  O     . LEU B 1 245 ? 11.296  21.899  51.246  1.00 39.55  ? 287 LEU B O     1 
ATOM   4119 C  CB    . LEU B 1 245 ? 12.768  19.086  51.008  1.00 37.88  ? 287 LEU B CB    1 
ATOM   4120 C  CG    . LEU B 1 245 ? 12.730  17.716  51.662  1.00 41.82  ? 287 LEU B CG    1 
ATOM   4121 C  CD1   . LEU B 1 245 ? 12.635  16.667  50.571  1.00 39.27  ? 287 LEU B CD1   1 
ATOM   4122 C  CD2   . LEU B 1 245 ? 13.973  17.511  52.498  1.00 37.98  ? 287 LEU B CD2   1 
ATOM   4123 N  N     . SER B 1 246 ? 13.419  22.132  50.509  1.00 37.79  ? 288 SER B N     1 
ATOM   4124 C  CA    . SER B 1 246 ? 13.080  23.081  49.462  1.00 39.19  ? 288 SER B CA    1 
ATOM   4125 C  C     . SER B 1 246 ? 12.105  22.441  48.474  1.00 39.18  ? 288 SER B C     1 
ATOM   4126 O  O     . SER B 1 246 ? 12.202  21.252  48.168  1.00 37.69  ? 288 SER B O     1 
ATOM   4127 C  CB    . SER B 1 246 ? 14.344  23.516  48.728  1.00 40.43  ? 288 SER B CB    1 
ATOM   4128 O  OG    . SER B 1 246 ? 15.079  24.447  49.488  1.00 47.64  ? 288 SER B OG    1 
ATOM   4129 N  N     . HIS B 1 247 ? 11.162  23.238  47.962  1.00 44.96  ? 289 HIS B N     1 
ATOM   4130 C  CA    . HIS B 1 247 ? 10.262  22.702  46.939  1.00 48.27  ? 289 HIS B CA    1 
ATOM   4131 C  C     . HIS B 1 247 ? 11.037  22.194  45.724  1.00 47.75  ? 289 HIS B C     1 
ATOM   4132 O  O     . HIS B 1 247 ? 10.626  21.201  45.105  1.00 52.17  ? 289 HIS B O     1 
ATOM   4133 C  CB    . HIS B 1 247 ? 9.211   23.745  46.539  1.00 47.57  ? 289 HIS B CB    1 
ATOM   4134 C  CG    . HIS B 1 247 ? 8.221   24.036  47.629  1.00 53.75  ? 289 HIS B CG    1 
ATOM   4135 N  ND1   . HIS B 1 247 ? 7.368   25.120  47.600  1.00 63.51  ? 289 HIS B ND1   1 
ATOM   4136 C  CD2   . HIS B 1 247 ? 7.975   23.399  48.800  1.00 46.32  ? 289 HIS B CD2   1 
ATOM   4137 C  CE1   . HIS B 1 247 ? 6.629   25.130  48.698  1.00 54.72  ? 289 HIS B CE1   1 
ATOM   4138 N  NE2   . HIS B 1 247 ? 6.981   24.098  49.446  1.00 51.76  ? 289 HIS B NE2   1 
ATOM   4139 N  N     . SER B 1 248 ? 12.187  22.809  45.408  1.00 41.41  ? 290 SER B N     1 
ATOM   4140 C  CA    . SER B 1 248 ? 13.020  22.321  44.316  1.00 41.30  ? 290 SER B CA    1 
ATOM   4141 C  C     . SER B 1 248 ? 13.602  20.916  44.544  1.00 49.82  ? 290 SER B C     1 
ATOM   4142 O  O     . SER B 1 248 ? 14.057  20.292  43.574  1.00 48.37  ? 290 SER B O     1 
ATOM   4143 C  CB    . SER B 1 248 ? 14.150  23.299  44.058  1.00 41.62  ? 290 SER B CB    1 
ATOM   4144 O  OG    . SER B 1 248 ? 15.141  23.164  45.058  1.00 56.13  ? 290 SER B OG    1 
ATOM   4145 N  N     . LEU B 1 249 ? 13.584  20.384  45.773  1.00 40.36  ? 291 LEU B N     1 
ATOM   4146 C  CA    . LEU B 1 249 ? 14.034  19.017  46.008  1.00 37.23  ? 291 LEU B CA    1 
ATOM   4147 C  C     . LEU B 1 249 ? 12.889  18.015  46.098  1.00 41.91  ? 291 LEU B C     1 
ATOM   4148 O  O     . LEU B 1 249 ? 13.145  16.805  46.131  1.00 45.58  ? 291 LEU B O     1 
ATOM   4149 C  CB    . LEU B 1 249 ? 14.886  18.948  47.293  1.00 48.19  ? 291 LEU B CB    1 
ATOM   4150 C  CG    . LEU B 1 249 ? 16.272  19.624  47.282  1.00 43.31  ? 291 LEU B CG    1 
ATOM   4151 C  CD1   . LEU B 1 249 ? 16.736  19.981  48.686  1.00 45.38  ? 291 LEU B CD1   1 
ATOM   4152 C  CD2   . LEU B 1 249 ? 17.301  18.733  46.608  1.00 38.73  ? 291 LEU B CD2   1 
ATOM   4153 N  N     . LEU B 1 250 ? 11.639  18.473  46.116  1.00 43.78  ? 292 LEU B N     1 
ATOM   4154 C  CA    . LEU B 1 250 ? 10.509  17.545  46.041  1.00 40.46  ? 292 LEU B CA    1 
ATOM   4155 C  C     . LEU B 1 250 ? 10.591  16.569  44.872  1.00 44.19  ? 292 LEU B C     1 
ATOM   4156 O  O     . LEU B 1 250 ? 10.160  15.412  45.043  1.00 40.72  ? 292 LEU B O     1 
ATOM   4157 C  CB    . LEU B 1 250 ? 9.191   18.337  46.005  1.00 42.01  ? 292 LEU B CB    1 
ATOM   4158 C  CG    . LEU B 1 250 ? 8.741   18.929  47.353  1.00 45.49  ? 292 LEU B CG    1 
ATOM   4159 C  CD1   . LEU B 1 250 ? 7.373   19.549  47.232  1.00 42.59  ? 292 LEU B CD1   1 
ATOM   4160 C  CD2   . LEU B 1 250 ? 8.742   17.860  48.459  1.00 41.71  ? 292 LEU B CD2   1 
ATOM   4161 N  N     . PRO B 1 251 ? 11.096  16.932  43.686  1.00 41.66  ? 293 PRO B N     1 
ATOM   4162 C  CA    . PRO B 1 251 ? 11.278  15.910  42.644  1.00 45.74  ? 293 PRO B CA    1 
ATOM   4163 C  C     . PRO B 1 251 ? 12.424  14.929  42.934  1.00 47.63  ? 293 PRO B C     1 
ATOM   4164 O  O     . PRO B 1 251 ? 12.591  13.964  42.166  1.00 45.81  ? 293 PRO B O     1 
ATOM   4165 C  CB    . PRO B 1 251 ? 11.543  16.737  41.369  1.00 48.23  ? 293 PRO B CB    1 
ATOM   4166 C  CG    . PRO B 1 251 ? 11.071  18.131  41.675  1.00 39.99  ? 293 PRO B CG    1 
ATOM   4167 C  CD    . PRO B 1 251 ? 11.269  18.306  43.152  1.00 40.73  ? 293 PRO B CD    1 
ATOM   4168 N  N     . ALA B 1 252 ? 13.203  15.124  44.009  1.00 45.08  ? 294 ALA B N     1 
ATOM   4169 C  CA    . ALA B 1 252 ? 14.225  14.164  44.410  1.00 38.93  ? 294 ALA B CA    1 
ATOM   4170 C  C     . ALA B 1 252 ? 13.783  13.283  45.565  1.00 42.16  ? 294 ALA B C     1 
ATOM   4171 O  O     . ALA B 1 252 ? 14.462  12.292  45.879  1.00 39.61  ? 294 ALA B O     1 
ATOM   4172 C  CB    . ALA B 1 252 ? 15.516  14.890  44.790  1.00 35.81  ? 294 ALA B CB    1 
ATOM   4173 N  N     . LEU B 1 253 ? 12.666  13.613  46.201  1.00 47.38  ? 295 LEU B N     1 
ATOM   4174 C  CA    . LEU B 1 253 ? 12.223  12.886  47.386  1.00 46.26  ? 295 LEU B CA    1 
ATOM   4175 C  C     . LEU B 1 253 ? 11.806  11.484  46.981  1.00 48.98  ? 295 LEU B C     1 
ATOM   4176 O  O     . LEU B 1 253 ? 10.929  11.324  46.120  1.00 49.04  ? 295 LEU B O     1 
ATOM   4177 C  CB    . LEU B 1 253 ? 11.061  13.625  48.047  1.00 37.05  ? 295 LEU B CB    1 
ATOM   4178 C  CG    . LEU B 1 253 ? 10.361  12.958  49.210  1.00 40.96  ? 295 LEU B CG    1 
ATOM   4179 C  CD1   . LEU B 1 253 ? 11.379  12.593  50.297  1.00 40.67  ? 295 LEU B CD1   1 
ATOM   4180 C  CD2   . LEU B 1 253 ? 9.317   13.922  49.738  1.00 34.51  ? 295 LEU B CD2   1 
ATOM   4181 N  N     . CYS B 1 254 ? 12.463  10.474  47.560  1.00 41.38  ? 296 CYS B N     1 
ATOM   4182 C  CA    . CYS B 1 254 ? 12.070  9.080   47.373  1.00 40.60  ? 296 CYS B CA    1 
ATOM   4183 C  C     . CYS B 1 254 ? 11.226  8.576   48.532  1.00 45.99  ? 296 CYS B C     1 
ATOM   4184 O  O     . CYS B 1 254 ? 10.189  7.933   48.325  1.00 37.03  ? 296 CYS B O     1 
ATOM   4185 C  CB    . CYS B 1 254 ? 13.304  8.183   47.202  1.00 42.02  ? 296 CYS B CB    1 
ATOM   4186 S  SG    . CYS B 1 254 ? 14.258  8.525   45.717  1.00 40.54  ? 296 CYS B SG    1 
ATOM   4187 N  N     . ASP B 1 255 ? 11.645  8.859   49.760  1.00 39.59  ? 297 ASP B N     1 
ATOM   4188 C  CA    . ASP B 1 255 ? 10.840  8.438   50.894  1.00 38.81  ? 297 ASP B CA    1 
ATOM   4189 C  C     . ASP B 1 255 ? 11.332  9.163   52.131  1.00 37.43  ? 297 ASP B C     1 
ATOM   4190 O  O     . ASP B 1 255 ? 12.465  9.655   52.182  1.00 42.27  ? 297 ASP B O     1 
ATOM   4191 C  CB    . ASP B 1 255 ? 10.904  6.917   51.109  1.00 44.15  ? 297 ASP B CB    1 
ATOM   4192 C  CG    . ASP B 1 255 ? 9.635   6.359   51.727  1.00 42.35  ? 297 ASP B CG    1 
ATOM   4193 O  OD1   . ASP B 1 255 ? 9.500   5.117   51.801  1.00 40.39  ? 297 ASP B OD1   1 
ATOM   4194 O  OD2   . ASP B 1 255 ? 8.781   7.169   52.142  1.00 40.11  ? 297 ASP B OD2   1 
ATOM   4195 N  N     . SER B 1 256 ? 10.465  9.193   53.133  1.00 35.79  ? 298 SER B N     1 
ATOM   4196 C  CA    . SER B 1 256 ? 10.743  9.756   54.446  1.00 36.04  ? 298 SER B CA    1 
ATOM   4197 C  C     . SER B 1 256 ? 10.183  8.756   55.436  1.00 38.33  ? 298 SER B C     1 
ATOM   4198 O  O     . SER B 1 256 ? 8.990   8.450   55.382  1.00 40.60  ? 298 SER B O     1 
ATOM   4199 C  CB    . SER B 1 256 ? 10.095  11.135  54.601  1.00 36.78  ? 298 SER B CB    1 
ATOM   4200 O  OG    . SER B 1 256 ? 10.382  11.769  55.830  1.00 37.48  ? 298 SER B OG    1 
ATOM   4201 N  N     . LYS B 1 257 ? 11.043  8.234   56.314  1.00 35.87  ? 299 LYS B N     1 
ATOM   4202 C  CA    . LYS B 1 257 ? 10.750  7.081   57.146  1.00 38.50  ? 299 LYS B CA    1 
ATOM   4203 C  C     . LYS B 1 257 ? 10.771  7.443   58.631  1.00 43.89  ? 299 LYS B C     1 
ATOM   4204 O  O     . LYS B 1 257 ? 11.455  8.376   59.067  1.00 41.81  ? 299 LYS B O     1 
ATOM   4205 C  CB    . LYS B 1 257 ? 11.775  5.942   56.927  1.00 43.16  ? 299 LYS B CB    1 
ATOM   4206 C  CG    . LYS B 1 257 ? 12.115  5.621   55.495  1.00 39.63  ? 299 LYS B CG    1 
ATOM   4207 C  CD    . LYS B 1 257 ? 10.852  5.437   54.656  1.00 38.32  ? 299 LYS B CD    1 
ATOM   4208 C  CE    . LYS B 1 257 ? 10.089  4.185   55.021  1.00 40.13  ? 299 LYS B CE    1 
ATOM   4209 N  NZ    . LYS B 1 257 ? 8.768   4.068   54.294  1.00 43.41  ? 299 LYS B NZ    1 
ATOM   4210 N  N     . ILE B 1 258 ? 10.042  6.647   59.405  1.00 37.53  ? 300 ILE B N     1 
ATOM   4211 C  CA    . ILE B 1 258 ? 10.097  6.659   60.849  1.00 47.23  ? 300 ILE B CA    1 
ATOM   4212 C  C     . ILE B 1 258 ? 10.512  5.259   61.299  1.00 47.97  ? 300 ILE B C     1 
ATOM   4213 O  O     . ILE B 1 258 ? 9.704   4.325   61.265  1.00 47.73  ? 300 ILE B O     1 
ATOM   4214 C  CB    . ILE B 1 258 ? 8.763   7.084   61.460  1.00 40.09  ? 300 ILE B CB    1 
ATOM   4215 C  CG1   . ILE B 1 258 ? 8.334   8.420   60.867  1.00 37.45  ? 300 ILE B CG1   1 
ATOM   4216 C  CG2   . ILE B 1 258 ? 8.908   7.256   62.930  1.00 32.41  ? 300 ILE B CG2   1 
ATOM   4217 C  CD1   . ILE B 1 258 ? 7.062   8.985   61.512  1.00 35.19  ? 300 ILE B CD1   1 
ATOM   4218 N  N     . ARG B 1 259 ? 11.781  5.111   61.703  1.00 45.52  ? 301 ARG B N     1 
ATOM   4219 C  CA    . ARG B 1 259 ? 12.339  3.838   62.184  1.00 48.96  ? 301 ARG B CA    1 
ATOM   4220 C  C     . ARG B 1 259 ? 11.856  3.556   63.610  1.00 44.13  ? 301 ARG B C     1 
ATOM   4221 O  O     . ARG B 1 259 ? 12.628  3.565   64.564  1.00 36.39  ? 301 ARG B O     1 
ATOM   4222 C  CB    . ARG B 1 259 ? 13.861  3.871   62.135  1.00 41.45  ? 301 ARG B CB    1 
ATOM   4223 C  CG    . ARG B 1 259 ? 14.425  4.345   60.823  1.00 40.45  ? 301 ARG B CG    1 
ATOM   4224 C  CD    . ARG B 1 259 ? 13.843  3.522   59.675  1.00 49.61  ? 301 ARG B CD    1 
ATOM   4225 N  NE    . ARG B 1 259 ? 14.711  3.512   58.500  1.00 41.69  ? 301 ARG B NE    1 
ATOM   4226 C  CZ    . ARG B 1 259 ? 14.379  2.965   57.333  1.00 47.10  ? 301 ARG B CZ    1 
ATOM   4227 N  NH1   . ARG B 1 259 ? 13.188  2.382   57.167  1.00 40.24  ? 301 ARG B NH1   1 
ATOM   4228 N  NH2   . ARG B 1 259 ? 15.242  2.999   56.326  1.00 44.62  ? 301 ARG B NH2   1 
ATOM   4229 N  N     . SER B 1 260 ? 10.556  3.232   63.706  1.00 37.85  ? 302 SER B N     1 
ATOM   4230 C  CA    . SER B 1 260 ? 9.839   3.187   64.977  1.00 37.24  ? 302 SER B CA    1 
ATOM   4231 C  C     . SER B 1 260 ? 10.477  2.247   66.004  1.00 43.97  ? 302 SER B C     1 
ATOM   4232 O  O     . SER B 1 260 ? 10.410  2.518   67.212  1.00 44.56  ? 302 SER B O     1 
ATOM   4233 C  CB    . SER B 1 260 ? 8.394   2.762   64.739  1.00 36.30  ? 302 SER B CB    1 
ATOM   4234 O  OG    . SER B 1 260 ? 7.547   3.877   64.533  1.00 47.23  ? 302 SER B OG    1 
ATOM   4235 N  N     . LYS B 1 261 ? 11.049  1.120   65.560  1.00 43.83  ? 303 LYS B N     1 
ATOM   4236 C  CA    . LYS B 1 261 ? 11.466  0.042   66.453  1.00 39.39  ? 303 LYS B CA    1 
ATOM   4237 C  C     . LYS B 1 261 ? 12.891  0.189   66.977  1.00 44.05  ? 303 LYS B C     1 
ATOM   4238 O  O     . LYS B 1 261 ? 13.324  -0.653  67.772  1.00 44.07  ? 303 LYS B O     1 
ATOM   4239 C  CB    . LYS B 1 261 ? 11.345  -1.320  65.756  1.00 41.72  ? 303 LYS B CB    1 
ATOM   4240 C  CG    . LYS B 1 261 ? 9.921   -1.813  65.586  1.00 55.72  ? 303 LYS B CG    1 
ATOM   4241 C  CD    . LYS B 1 261 ? 9.894   -3.247  65.082  1.00 62.38  ? 303 LYS B CD    1 
ATOM   4242 C  CE    . LYS B 1 261 ? 10.560  -3.357  63.733  1.00 54.70  ? 303 LYS B CE    1 
ATOM   4243 N  NZ    . LYS B 1 261 ? 9.619   -2.799  62.726  1.00 64.15  ? 303 LYS B NZ    1 
ATOM   4244 N  N     . ALA B 1 262 ? 13.635  1.217   66.565  1.00 42.92  ? 304 ALA B N     1 
ATOM   4245 C  CA    . ALA B 1 262 ? 15.026  1.352   66.986  1.00 37.52  ? 304 ALA B CA    1 
ATOM   4246 C  C     . ALA B 1 262 ? 15.082  2.044   68.345  1.00 44.27  ? 304 ALA B C     1 
ATOM   4247 O  O     . ALA B 1 262 ? 14.672  3.206   68.465  1.00 42.79  ? 304 ALA B O     1 
ATOM   4248 C  CB    . ALA B 1 262 ? 15.828  2.118   65.939  1.00 37.50  ? 304 ALA B CB    1 
ATOM   4249 N  N     . LEU B 1 263 ? 15.580  1.325   69.362  1.00 41.42  ? 305 LEU B N     1 
ATOM   4250 C  CA    . LEU B 1 263 ? 15.658  1.794   70.747  1.00 44.17  ? 305 LEU B CA    1 
ATOM   4251 C  C     . LEU B 1 263 ? 16.955  2.550   71.022  1.00 36.86  ? 305 LEU B C     1 
ATOM   4252 O  O     . LEU B 1 263 ? 17.875  2.574   70.206  1.00 38.54  ? 305 LEU B O     1 
ATOM   4253 C  CB    . LEU B 1 263 ? 15.580  0.630   71.750  1.00 44.80  ? 305 LEU B CB    1 
ATOM   4254 C  CG    . LEU B 1 263 ? 14.317  -0.220  71.837  1.00 47.57  ? 305 LEU B CG    1 
ATOM   4255 C  CD1   . LEU B 1 263 ? 13.060  0.634   71.845  1.00 45.49  ? 305 LEU B CD1   1 
ATOM   4256 C  CD2   . LEU B 1 263 ? 14.293  -1.171  70.691  1.00 55.14  ? 305 LEU B CD2   1 
ATOM   4257 N  N     . GLY B 1 264 ? 17.043  3.129   72.229  1.00 39.72  ? 306 GLY B N     1 
ATOM   4258 C  CA    . GLY B 1 264 ? 18.242  3.833   72.654  1.00 35.11  ? 306 GLY B CA    1 
ATOM   4259 C  C     . GLY B 1 264 ? 17.985  5.239   73.162  1.00 41.89  ? 306 GLY B C     1 
ATOM   4260 O  O     . GLY B 1 264 ? 18.870  5.900   73.732  1.00 40.54  ? 306 GLY B O     1 
ATOM   4261 N  N     . SER B 1 265 ? 16.759  5.706   72.977  1.00 36.65  ? 307 SER B N     1 
ATOM   4262 C  CA    . SER B 1 265 ? 16.436  7.086   73.294  1.00 34.80  ? 307 SER B CA    1 
ATOM   4263 C  C     . SER B 1 265 ? 14.941  7.161   73.513  1.00 36.60  ? 307 SER B C     1 
ATOM   4264 O  O     . SER B 1 265 ? 14.212  6.193   73.270  1.00 44.83  ? 307 SER B O     1 
ATOM   4265 C  CB    . SER B 1 265 ? 16.896  8.020   72.172  1.00 37.62  ? 307 SER B CB    1 
ATOM   4266 O  OG    . SER B 1 265 ? 16.437  9.337   72.382  1.00 39.97  ? 307 SER B OG    1 
ATOM   4267 N  N     . ASP B 1 266 ? 14.479  8.320   73.970  1.00 33.66  ? 308 ASP B N     1 
ATOM   4268 C  CA    . ASP B 1 266 ? 13.052  8.583   73.902  1.00 42.00  ? 308 ASP B CA    1 
ATOM   4269 C  C     . ASP B 1 266 ? 12.651  9.154   72.535  1.00 43.64  ? 308 ASP B C     1 
ATOM   4270 O  O     . ASP B 1 266 ? 11.469  9.426   72.300  1.00 41.52  ? 308 ASP B O     1 
ATOM   4271 C  CB    . ASP B 1 266 ? 12.613  9.474   75.077  1.00 36.04  ? 308 ASP B CB    1 
ATOM   4272 C  CG    . ASP B 1 266 ? 13.389  10.770  75.166  1.00 40.22  ? 308 ASP B CG    1 
ATOM   4273 O  OD1   . ASP B 1 266 ? 14.331  10.923  74.354  1.00 38.35  ? 308 ASP B OD1   1 
ATOM   4274 O  OD2   . ASP B 1 266 ? 13.054  11.620  76.047  1.00 33.37  ? 308 ASP B OD2   1 
ATOM   4275 N  N     . HIS B 1 267 ? 13.613  9.291   71.620  1.00 42.98  ? 309 HIS B N     1 
ATOM   4276 C  CA    . HIS B 1 267 ? 13.368  9.538   70.211  1.00 39.28  ? 309 HIS B CA    1 
ATOM   4277 C  C     . HIS B 1 267 ? 13.774  8.315   69.406  1.00 43.15  ? 309 HIS B C     1 
ATOM   4278 O  O     . HIS B 1 267 ? 14.685  7.577   69.793  1.00 44.09  ? 309 HIS B O     1 
ATOM   4279 C  CB    . HIS B 1 267 ? 14.155  10.743  69.713  1.00 39.48  ? 309 HIS B CB    1 
ATOM   4280 C  CG    . HIS B 1 267 ? 13.665  12.041  70.258  1.00 41.49  ? 309 HIS B CG    1 
ATOM   4281 N  ND1   . HIS B 1 267 ? 13.066  12.998  69.467  1.00 39.22  ? 309 HIS B ND1   1 
ATOM   4282 C  CD2   . HIS B 1 267 ? 13.690  12.548  71.514  1.00 38.56  ? 309 HIS B CD2   1 
ATOM   4283 C  CE1   . HIS B 1 267 ? 12.745  14.041  70.216  1.00 42.02  ? 309 HIS B CE1   1 
ATOM   4284 N  NE2   . HIS B 1 267 ? 13.114  13.793  71.462  1.00 40.98  ? 309 HIS B NE2   1 
ATOM   4285 N  N     . CYS B 1 268 ? 13.070  8.092   68.282  1.00 40.86  ? 310 CYS B N     1 
ATOM   4286 C  CA    . CYS B 1 268 ? 13.515  7.102   67.325  1.00 35.04  ? 310 CYS B CA    1 
ATOM   4287 C  C     . CYS B 1 268 ? 14.169  7.803   66.151  1.00 33.68  ? 310 CYS B C     1 
ATOM   4288 O  O     . CYS B 1 268 ? 14.031  9.016   65.993  1.00 34.94  ? 310 CYS B O     1 
ATOM   4289 C  CB    . CYS B 1 268 ? 12.334  6.248   66.852  1.00 40.50  ? 310 CYS B CB    1 
ATOM   4290 S  SG    . CYS B 1 268 ? 11.225  7.056   65.699  1.00 37.22  ? 310 CYS B SG    1 
ATOM   4291 N  N     . PRO B 1 269 ? 14.956  7.094   65.349  1.00 35.07  ? 311 PRO B N     1 
ATOM   4292 C  CA    . PRO B 1 269 ? 15.520  7.695   64.135  1.00 34.66  ? 311 PRO B CA    1 
ATOM   4293 C  C     . PRO B 1 269 ? 14.445  7.977   63.085  1.00 38.06  ? 311 PRO B C     1 
ATOM   4294 O  O     . PRO B 1 269 ? 13.379  7.370   63.082  1.00 39.23  ? 311 PRO B O     1 
ATOM   4295 C  CB    . PRO B 1 269 ? 16.485  6.621   63.622  1.00 40.81  ? 311 PRO B CB    1 
ATOM   4296 C  CG    . PRO B 1 269 ? 16.684  5.663   64.737  1.00 35.83  ? 311 PRO B CG    1 
ATOM   4297 C  CD    . PRO B 1 269 ? 15.451  5.728   65.580  1.00 37.24  ? 311 PRO B CD    1 
ATOM   4298 N  N     . ILE B 1 270 ? 14.746  8.932   62.192  1.00 38.31  ? 312 ILE B N     1 
ATOM   4299 C  CA    . ILE B 1 270 ? 14.065  9.112   60.911  1.00 40.25  ? 312 ILE B CA    1 
ATOM   4300 C  C     . ILE B 1 270 ? 15.111  9.017   59.802  1.00 41.11  ? 312 ILE B C     1 
ATOM   4301 O  O     . ILE B 1 270 ? 16.292  9.323   60.006  1.00 42.13  ? 312 ILE B O     1 
ATOM   4302 C  CB    . ILE B 1 270 ? 13.301  10.455  60.802  1.00 37.15  ? 312 ILE B CB    1 
ATOM   4303 C  CG1   . ILE B 1 270 ? 14.221  11.608  61.188  1.00 29.91  ? 312 ILE B CG1   1 
ATOM   4304 C  CG2   . ILE B 1 270 ? 12.003  10.422  61.593  1.00 28.20  ? 312 ILE B CG2   1 
ATOM   4305 C  CD1   . ILE B 1 270 ? 13.568  12.937  61.151  1.00 29.83  ? 312 ILE B CD1   1 
ATOM   4306 N  N     . THR B 1 271 ? 14.666  8.596   58.614  1.00 43.41  ? 313 THR B N     1 
ATOM   4307 C  CA    . THR B 1 271 ? 15.565  8.392   57.484  1.00 38.85  ? 313 THR B CA    1 
ATOM   4308 C  C     . THR B 1 271 ? 14.933  8.953   56.221  1.00 40.31  ? 313 THR B C     1 
ATOM   4309 O  O     . THR B 1 271 ? 13.748  8.717   55.956  1.00 36.31  ? 313 THR B O     1 
ATOM   4310 C  CB    . THR B 1 271 ? 15.910  6.901   57.317  1.00 42.43  ? 313 THR B CB    1 
ATOM   4311 O  OG1   . THR B 1 271 ? 16.654  6.463   58.462  1.00 47.40  ? 313 THR B OG1   1 
ATOM   4312 C  CG2   . THR B 1 271 ? 16.762  6.672   56.077  1.00 43.03  ? 313 THR B CG2   1 
ATOM   4313 N  N     . LEU B 1 272 ? 15.736  9.708   55.462  1.00 41.37  ? 314 LEU B N     1 
ATOM   4314 C  CA    . LEU B 1 272 ? 15.333  10.352  54.217  1.00 38.74  ? 314 LEU B CA    1 
ATOM   4315 C  C     . LEU B 1 272 ? 16.137  9.768   53.060  1.00 37.76  ? 314 LEU B C     1 
ATOM   4316 O  O     . LEU B 1 272 ? 17.365  9.656   53.144  1.00 39.57  ? 314 LEU B O     1 
ATOM   4317 C  CB    . LEU B 1 272 ? 15.553  11.866  54.270  1.00 34.50  ? 314 LEU B CB    1 
ATOM   4318 C  CG    . LEU B 1 272 ? 15.014  12.605  53.031  1.00 34.00  ? 314 LEU B CG    1 
ATOM   4319 C  CD1   . LEU B 1 272 ? 13.514  12.780  53.189  1.00 30.71  ? 314 LEU B CD1   1 
ATOM   4320 C  CD2   . LEU B 1 272 ? 15.625  13.970  52.795  1.00 30.44  ? 314 LEU B CD2   1 
ATOM   4321 N  N     . TYR B 1 273 ? 15.443  9.381   51.996  1.00 38.57  ? 315 TYR B N     1 
ATOM   4322 C  CA    . TYR B 1 273 ? 16.053  8.942   50.742  1.00 38.49  ? 315 TYR B CA    1 
ATOM   4323 C  C     . TYR B 1 273 ? 15.865  10.015  49.670  1.00 41.53  ? 315 TYR B C     1 
ATOM   4324 O  O     . TYR B 1 273 ? 14.728  10.431  49.388  1.00 41.89  ? 315 TYR B O     1 
ATOM   4325 C  CB    . TYR B 1 273 ? 15.419  7.644   50.256  1.00 36.53  ? 315 TYR B CB    1 
ATOM   4326 C  CG    . TYR B 1 273 ? 15.735  6.393   51.032  1.00 39.16  ? 315 TYR B CG    1 
ATOM   4327 C  CD1   . TYR B 1 273 ? 16.947  5.715   50.838  1.00 42.34  ? 315 TYR B CD1   1 
ATOM   4328 C  CD2   . TYR B 1 273 ? 14.814  5.842   51.904  1.00 35.80  ? 315 TYR B CD2   1 
ATOM   4329 C  CE1   . TYR B 1 273 ? 17.231  4.540   51.505  1.00 35.98  ? 315 TYR B CE1   1 
ATOM   4330 C  CE2   . TYR B 1 273 ? 15.098  4.658   52.586  1.00 39.13  ? 315 TYR B CE2   1 
ATOM   4331 C  CZ    . TYR B 1 273 ? 16.311  4.018   52.376  1.00 39.12  ? 315 TYR B CZ    1 
ATOM   4332 O  OH    . TYR B 1 273 ? 16.607  2.847   53.031  1.00 42.89  ? 315 TYR B OH    1 
ATOM   4333 N  N     . LEU B 1 274 ? 16.966  10.452  49.060  1.00 37.22  ? 316 LEU B N     1 
ATOM   4334 C  CA    . LEU B 1 274 ? 16.910  11.414  47.966  1.00 37.69  ? 316 LEU B CA    1 
ATOM   4335 C  C     . LEU B 1 274 ? 17.668  10.869  46.768  1.00 43.58  ? 316 LEU B C     1 
ATOM   4336 O  O     . LEU B 1 274 ? 18.727  10.246  46.923  1.00 48.93  ? 316 LEU B O     1 
ATOM   4337 C  CB    . LEU B 1 274 ? 17.511  12.772  48.335  1.00 37.77  ? 316 LEU B CB    1 
ATOM   4338 C  CG    . LEU B 1 274 ? 16.913  13.649  49.432  1.00 41.82  ? 316 LEU B CG    1 
ATOM   4339 C  CD1   . LEU B 1 274 ? 17.653  14.966  49.405  1.00 41.43  ? 316 LEU B CD1   1 
ATOM   4340 C  CD2   . LEU B 1 274 ? 15.406  13.862  49.282  1.00 40.27  ? 316 LEU B CD2   1 
ATOM   4341 N  N     . ALA B 1 275 ? 17.134  11.121  45.579  1.00 37.47  ? 317 ALA B N     1 
ATOM   4342 C  CA    . ALA B 1 275 ? 17.787  10.755  44.333  1.00 40.68  ? 317 ALA B CA    1 
ATOM   4343 C  C     . ALA B 1 275 ? 18.444  12.018  43.808  1.00 43.77  ? 317 ALA B C     1 
ATOM   4344 O  O     . ALA B 1 275 ? 17.812  12.837  43.145  1.00 44.59  ? 317 ALA B O     1 
ATOM   4345 C  CB    . ALA B 1 275 ? 16.784  10.194  43.342  1.00 42.26  ? 317 ALA B CB    1 
ATOM   4346 N  N     . LEU B 1 276 ? 19.722  12.180  44.108  1.00 45.29  ? 318 LEU B N     1 
ATOM   4347 C  CA    . LEU B 1 276 ? 20.410  13.422  43.773  1.00 53.50  ? 318 LEU B CA    1 
ATOM   4348 C  C     . LEU B 1 276 ? 21.379  13.283  42.612  1.00 66.77  ? 318 LEU B C     1 
ATOM   4349 O  O     . LEU B 1 276 ? 21.938  12.202  42.414  1.00 70.37  ? 318 LEU B O     1 
ATOM   4350 C  CB    . LEU B 1 276 ? 21.164  13.948  44.982  1.00 52.17  ? 318 LEU B CB    1 
ATOM   4351 C  CG    . LEU B 1 276 ? 20.359  14.986  45.754  1.00 58.26  ? 318 LEU B CG    1 
ATOM   4352 C  CD1   . LEU B 1 276 ? 21.254  15.663  46.756  1.00 51.70  ? 318 LEU B CD1   1 
ATOM   4353 C  CD2   . LEU B 1 276 ? 19.762  15.998  44.790  1.00 55.35  ? 318 LEU B CD2   1 
ATOM   4354 O  OXT   . LEU B 1 276 ? 21.635  14.254  41.879  1.00 72.13  ? 318 LEU B OXT   1 
ATOM   4355 O  OP3   . DT  C 2 1   ? 6.240   10.269  13.494  1.00 42.69  ? 1   DT  C OP3   1 
ATOM   4356 P  P     . DT  C 2 1   ? 4.797   10.615  12.906  1.00 43.07  ? 1   DT  C P     1 
ATOM   4357 O  OP1   . DT  C 2 1   ? 4.647   12.091  12.720  1.00 49.04  ? 1   DT  C OP1   1 
ATOM   4358 O  OP2   . DT  C 2 1   ? 3.755   9.964   13.746  1.00 38.08  ? 1   DT  C OP2   1 
ATOM   4359 O  "O5'" . DT  C 2 1   ? 4.789   9.949   11.461  1.00 44.82  ? 1   DT  C "O5'" 1 
ATOM   4360 C  "C5'" . DT  C 2 1   ? 4.073   8.792   11.239  1.00 44.07  ? 1   DT  C "C5'" 1 
ATOM   4361 C  "C4'" . DT  C 2 1   ? 4.339   8.267   9.852   1.00 47.81  ? 1   DT  C "C4'" 1 
ATOM   4362 O  "O4'" . DT  C 2 1   ? 3.853   9.222   8.889   1.00 50.80  ? 1   DT  C "O4'" 1 
ATOM   4363 C  "C3'" . DT  C 2 1   ? 5.801   8.015   9.509   1.00 50.14  ? 1   DT  C "C3'" 1 
ATOM   4364 O  "O3'" . DT  C 2 1   ? 5.865   6.847   8.717   1.00 47.53  ? 1   DT  C "O3'" 1 
ATOM   4365 C  "C2'" . DT  C 2 1   ? 6.201   9.269   8.738   1.00 47.62  ? 1   DT  C "C2'" 1 
ATOM   4366 C  "C1'" . DT  C 2 1   ? 4.888   9.661   8.062   1.00 53.20  ? 1   DT  C "C1'" 1 
ATOM   4367 N  N1    . DT  C 2 1   ? 4.709   11.113  7.884   1.00 59.24  ? 1   DT  C N1    1 
ATOM   4368 C  C2    . DT  C 2 1   ? 4.238   11.584  6.681   1.00 59.38  ? 1   DT  C C2    1 
ATOM   4369 O  O2    . DT  C 2 1   ? 3.970   10.865  5.740   1.00 63.83  ? 1   DT  C O2    1 
ATOM   4370 N  N3    . DT  C 2 1   ? 4.093   12.935  6.611   1.00 60.45  ? 1   DT  C N3    1 
ATOM   4371 C  C4    . DT  C 2 1   ? 4.360   13.851  7.590   1.00 61.51  ? 1   DT  C C4    1 
ATOM   4372 O  O4    . DT  C 2 1   ? 4.198   15.054  7.414   1.00 66.71  ? 1   DT  C O4    1 
ATOM   4373 C  C5    . DT  C 2 1   ? 4.845   13.302  8.840   1.00 59.87  ? 1   DT  C C5    1 
ATOM   4374 C  C7    . DT  C 2 1   ? 5.172   14.213  9.978   1.00 62.88  ? 1   DT  C C7    1 
ATOM   4375 C  C6    . DT  C 2 1   ? 4.996   11.971  8.931   1.00 56.34  ? 1   DT  C C6    1 
ATOM   4376 P  P     . DC  C 2 2   ? 7.256   6.246   8.196   1.00 55.55  ? 2   DC  C P     1 
ATOM   4377 O  OP1   . DC  C 2 2   ? 7.088   4.768   8.100   1.00 47.37  ? 2   DC  C OP1   1 
ATOM   4378 O  OP2   . DC  C 2 2   ? 8.372   6.802   8.992   1.00 56.20  ? 2   DC  C OP2   1 
ATOM   4379 O  "O5'" . DC  C 2 2   ? 7.336   6.829   6.718   1.00 53.02  ? 2   DC  C "O5'" 1 
ATOM   4380 C  "C5'" . DC  C 2 2   ? 6.210   6.702   5.865   1.00 59.01  ? 2   DC  C "C5'" 1 
ATOM   4381 C  "C4'" . DC  C 2 2   ? 6.448   7.409   4.553   1.00 64.28  ? 2   DC  C "C4'" 1 
ATOM   4382 O  "O4'" . DC  C 2 2   ? 6.149   8.810   4.722   1.00 60.83  ? 2   DC  C "O4'" 1 
ATOM   4383 C  "C3'" . DC  C 2 2   ? 7.900   7.326   4.047   1.00 72.91  ? 2   DC  C "C3'" 1 
ATOM   4384 O  "O3'" . DC  C 2 2   ? 7.963   6.726   2.729   1.00 71.83  ? 2   DC  C "O3'" 1 
ATOM   4385 C  "C2'" . DC  C 2 2   ? 8.383   8.783   4.054   1.00 70.91  ? 2   DC  C "C2'" 1 
ATOM   4386 C  "C1'" . DC  C 2 2   ? 7.074   9.558   3.986   1.00 68.97  ? 2   DC  C "C1'" 1 
ATOM   4387 N  N1    . DC  C 2 2   ? 7.155   10.919  4.578   1.00 70.40  ? 2   DC  C N1    1 
ATOM   4388 C  C2    . DC  C 2 2   ? 6.595   11.991  3.884   1.00 64.81  ? 2   DC  C C2    1 
ATOM   4389 O  O2    . DC  C 2 2   ? 6.050   11.772  2.796   1.00 64.04  ? 2   DC  C O2    1 
ATOM   4390 N  N3    . DC  C 2 2   ? 6.673   13.240  4.421   1.00 63.58  ? 2   DC  C N3    1 
ATOM   4391 C  C4    . DC  C 2 2   ? 7.270   13.423  5.601   1.00 65.50  ? 2   DC  C C4    1 
ATOM   4392 N  N4    . DC  C 2 2   ? 7.316   14.666  6.089   1.00 70.53  ? 2   DC  C N4    1 
ATOM   4393 C  C5    . DC  C 2 2   ? 7.852   12.336  6.331   1.00 61.75  ? 2   DC  C C5    1 
ATOM   4394 C  C6    . DC  C 2 2   ? 7.775   11.111  5.788   1.00 63.25  ? 2   DC  C C6    1 
ATOM   4395 P  P     . DG  C 2 3   ? 9.343   6.089   2.172   1.00 74.26  ? 3   DG  C P     1 
ATOM   4396 O  OP1   . DG  C 2 3   ? 9.198   4.627   2.045   1.00 72.99  ? 3   DG  C OP1   1 
ATOM   4397 O  OP2   . DG  C 2 3   ? 10.501  6.636   2.922   1.00 77.19  ? 3   DG  C OP2   1 
ATOM   4398 O  "O5'" . DG  C 2 3   ? 9.438   6.687   0.709   1.00 80.35  ? 3   DG  C "O5'" 1 
ATOM   4399 C  "C5'" . DG  C 2 3   ? 8.257   6.928   -0.032  1.00 83.81  ? 3   DG  C "C5'" 1 
ATOM   4400 C  "C4'" . DG  C 2 3   ? 8.353   8.263   -0.726  1.00 77.86  ? 3   DG  C "C4'" 1 
ATOM   4401 O  "O4'" . DG  C 2 3   ? 8.249   9.298   0.256   1.00 74.40  ? 3   DG  C "O4'" 1 
ATOM   4402 C  "C3'" . DG  C 2 3   ? 9.687   8.512   -1.421  1.00 84.14  ? 3   DG  C "C3'" 1 
ATOM   4403 O  "O3'" . DG  C 2 3   ? 9.563   8.282   -2.842  1.00 99.74  ? 3   DG  C "O3'" 1 
ATOM   4404 C  "C2'" . DG  C 2 3   ? 10.017  9.981   -1.113  1.00 79.48  ? 3   DG  C "C2'" 1 
ATOM   4405 C  "C1'" . DG  C 2 3   ? 8.846   10.451  -0.258  1.00 76.24  ? 3   DG  C "C1'" 1 
ATOM   4406 N  N9    . DG  C 2 3   ? 9.254   11.291  0.854   1.00 72.70  ? 3   DG  C N9    1 
ATOM   4407 C  C8    . DG  C 2 3   ? 9.979   10.906  1.965   1.00 70.21  ? 3   DG  C C8    1 
ATOM   4408 N  N7    . DG  C 2 3   ? 10.208  11.879  2.798   1.00 62.17  ? 3   DG  C N7    1 
ATOM   4409 C  C5    . DG  C 2 3   ? 9.611   12.982  2.198   1.00 72.50  ? 3   DG  C C5    1 
ATOM   4410 C  C6    . DG  C 2 3   ? 9.526   14.325  2.638   1.00 73.47  ? 3   DG  C C6    1 
ATOM   4411 O  O6    . DG  C 2 3   ? 9.986   14.824  3.685   1.00 70.82  ? 3   DG  C O6    1 
ATOM   4412 N  N1    . DG  C 2 3   ? 8.819   15.123  1.727   1.00 71.43  ? 3   DG  C N1    1 
ATOM   4413 C  C2    . DG  C 2 3   ? 8.269   14.676  0.544   1.00 73.49  ? 3   DG  C C2    1 
ATOM   4414 N  N2    . DG  C 2 3   ? 7.632   15.597  -0.206  1.00 70.46  ? 3   DG  C N2    1 
ATOM   4415 N  N3    . DG  C 2 3   ? 8.342   13.416  0.123   1.00 69.97  ? 3   DG  C N3    1 
ATOM   4416 C  C4    . DG  C 2 3   ? 9.018   12.631  0.997   1.00 70.66  ? 3   DG  C C4    1 
ATOM   4417 P  P     . DA  C 2 4   ? 10.833  8.465   -3.822  1.00 89.15  ? 4   DA  C P     1 
ATOM   4418 O  OP1   . DA  C 2 4   ? 10.614  7.522   -4.945  1.00 90.86  ? 4   DA  C OP1   1 
ATOM   4419 O  OP2   . DA  C 2 4   ? 12.082  8.370   -3.023  1.00 86.73  ? 4   DA  C OP2   1 
ATOM   4420 O  "O5'" . DA  C 2 4   ? 10.710  9.976   -4.316  1.00 74.59  ? 4   DA  C "O5'" 1 
ATOM   4421 C  "C5'" . DA  C 2 4   ? 9.432   10.529  -4.624  1.00 81.42  ? 4   DA  C "C5'" 1 
ATOM   4422 C  "C4'" . DA  C 2 4   ? 9.589   11.966  -5.059  1.00 77.92  ? 4   DA  C "C4'" 1 
ATOM   4423 O  "O4'" . DA  C 2 4   ? 9.605   12.819  -3.887  1.00 74.27  ? 4   DA  C "O4'" 1 
ATOM   4424 C  "C3'" . DA  C 2 4   ? 10.897  12.238  -5.805  1.00 90.73  ? 4   DA  C "C3'" 1 
ATOM   4425 O  "O3'" . DA  C 2 4   ? 10.709  13.168  -6.889  1.00 99.95  ? 4   DA  C "O3'" 1 
ATOM   4426 C  "C2'" . DA  C 2 4   ? 11.798  12.808  -4.723  1.00 89.45  ? 4   DA  C "C2'" 1 
ATOM   4427 C  "C1'" . DA  C 2 4   ? 10.805  13.558  -3.854  1.00 81.83  ? 4   DA  C "C1'" 1 
ATOM   4428 N  N9    . DA  C 2 4   ? 11.263  13.662  -2.481  1.00 81.47  ? 4   DA  C N9    1 
ATOM   4429 C  C8    . DA  C 2 4   ? 11.876  12.687  -1.739  1.00 80.84  ? 4   DA  C C8    1 
ATOM   4430 N  N7    . DA  C 2 4   ? 12.211  13.074  -0.527  1.00 77.27  ? 4   DA  C N7    1 
ATOM   4431 C  C5    . DA  C 2 4   ? 11.808  14.397  -0.482  1.00 76.80  ? 4   DA  C C5    1 
ATOM   4432 C  C6    . DA  C 2 4   ? 11.878  15.368  0.524   1.00 73.40  ? 4   DA  C C6    1 
ATOM   4433 N  N6    . DA  C 2 4   ? 12.405  15.140  1.728   1.00 67.88  ? 4   DA  C N6    1 
ATOM   4434 N  N1    . DA  C 2 4   ? 11.381  16.589  0.245   1.00 77.91  ? 4   DA  C N1    1 
ATOM   4435 C  C2    . DA  C 2 4   ? 10.853  16.817  -0.967  1.00 78.94  ? 4   DA  C C2    1 
ATOM   4436 N  N3    . DA  C 2 4   ? 10.729  15.982  -1.995  1.00 80.96  ? 4   DA  C N3    1 
ATOM   4437 C  C4    . DA  C 2 4   ? 11.229  14.777  -1.683  1.00 80.94  ? 4   DA  C C4    1 
ATOM   4438 P  P     . DC  C 2 5   ? 11.947  13.553  -7.855  1.00 102.77 ? 5   DC  C P     1 
ATOM   4439 O  OP1   . DC  C 2 5   ? 11.395  13.806  -9.207  1.00 96.76  ? 5   DC  C OP1   1 
ATOM   4440 O  OP2   . DC  C 2 5   ? 13.051  12.573  -7.652  1.00 92.62  ? 5   DC  C OP2   1 
ATOM   4441 O  "O5'" . DC  C 2 5   ? 12.469  14.940  -7.269  1.00 90.12  ? 5   DC  C "O5'" 1 
ATOM   4442 C  "C5'" . DC  C 2 5   ? 11.611  16.064  -7.233  1.00 91.88  ? 5   DC  C "C5'" 1 
ATOM   4443 C  "C4'" . DC  C 2 5   ? 12.323  17.247  -6.609  1.00 95.00  ? 5   DC  C "C4'" 1 
ATOM   4444 O  "O4'" . DC  C 2 5   ? 12.267  17.145  -5.174  1.00 92.91  ? 5   DC  C "O4'" 1 
ATOM   4445 C  "C3'" . DC  C 2 5   ? 13.812  17.330  -6.916  1.00 100.15 ? 5   DC  C "C3'" 1 
ATOM   4446 O  "O3'" . DC  C 2 5   ? 14.026  18.002  -8.198  1.00 103.62 ? 5   DC  C "O3'" 1 
ATOM   4447 C  "C2'" . DC  C 2 5   ? 14.367  18.119  -5.719  1.00 93.51  ? 5   DC  C "C2'" 1 
ATOM   4448 C  "C1'" . DC  C 2 5   ? 13.296  17.947  -4.631  1.00 90.16  ? 5   DC  C "C1'" 1 
ATOM   4449 N  N1    . DC  C 2 5   ? 13.806  17.298  -3.397  1.00 86.01  ? 5   DC  C N1    1 
ATOM   4450 C  C2    . DC  C 2 5   ? 13.887  18.035  -2.197  1.00 87.20  ? 5   DC  C C2    1 
ATOM   4451 O  O2    . DC  C 2 5   ? 13.524  19.229  -2.186  1.00 80.72  ? 5   DC  C O2    1 
ATOM   4452 N  N3    . DC  C 2 5   ? 14.364  17.411  -1.073  1.00 85.82  ? 5   DC  C N3    1 
ATOM   4453 C  C4    . DC  C 2 5   ? 14.739  16.124  -1.126  1.00 81.66  ? 5   DC  C C4    1 
ATOM   4454 N  N4    . DC  C 2 5   ? 15.195  15.553  -0.002  1.00 76.75  ? 5   DC  C N4    1 
ATOM   4455 C  C5    . DC  C 2 5   ? 14.664  15.371  -2.339  1.00 83.77  ? 5   DC  C C5    1 
ATOM   4456 C  C6    . DC  C 2 5   ? 14.198  15.990  -3.437  1.00 84.84  ? 5   DC  C C6    1 
ATOM   4457 P  P     . DG  C 2 6   ? 15.261  19.012  -8.451  1.00 107.33 ? 6   DG  C P     1 
ATOM   4458 O  OP1   . DG  C 2 6   ? 15.268  19.274  -9.909  1.00 104.12 ? 6   DG  C OP1   1 
ATOM   4459 O  OP2   . DG  C 2 6   ? 16.502  18.484  -7.821  1.00 99.11  ? 6   DG  C OP2   1 
ATOM   4460 O  "O5'" . DG  C 2 6   ? 14.810  20.354  -7.696  1.00 96.66  ? 6   DG  C "O5'" 1 
ATOM   4461 C  "C5'" . DG  C 2 6   ? 15.602  21.512  -7.774  1.00 93.28  ? 6   DG  C "C5'" 1 
ATOM   4462 C  "C4'" . DG  C 2 6   ? 16.046  21.963  -6.395  1.00 89.68  ? 6   DG  C "C4'" 1 
ATOM   4463 O  "O4'" . DG  C 2 6   ? 15.964  20.870  -5.468  1.00 90.19  ? 6   DG  C "O4'" 1 
ATOM   4464 C  "C3'" . DG  C 2 6   ? 17.495  22.434  -6.325  1.00 94.98  ? 6   DG  C "C3'" 1 
ATOM   4465 O  "O3'" . DG  C 2 6   ? 17.554  23.850  -6.272  1.00 100.65 ? 6   DG  C "O3'" 1 
ATOM   4466 C  "C2'" . DG  C 2 6   ? 18.059  21.797  -5.045  1.00 91.59  ? 6   DG  C "C2'" 1 
ATOM   4467 C  "C1'" . DG  C 2 6   ? 16.848  21.136  -4.411  1.00 88.70  ? 6   DG  C "C1'" 1 
ATOM   4468 N  N9    . DG  C 2 6   ? 17.166  19.882  -3.725  1.00 89.05  ? 6   DG  C N9    1 
ATOM   4469 C  C8    . DG  C 2 6   ? 17.348  18.646  -4.304  1.00 88.31  ? 6   DG  C C8    1 
ATOM   4470 N  N7    . DG  C 2 6   ? 17.626  17.702  -3.444  1.00 84.39  ? 6   DG  C N7    1 
ATOM   4471 C  C5    . DG  C 2 6   ? 17.634  18.352  -2.210  1.00 84.41  ? 6   DG  C C5    1 
ATOM   4472 C  C6    . DG  C 2 6   ? 17.871  17.840  -0.909  1.00 84.67  ? 6   DG  C C6    1 
ATOM   4473 O  O6    . DG  C 2 6   ? 18.132  16.672  -0.579  1.00 83.86  ? 6   DG  C O6    1 
ATOM   4474 N  N1    . DG  C 2 6   ? 17.788  18.839  0.065   1.00 83.06  ? 6   DG  C N1    1 
ATOM   4475 C  C2    . DG  C 2 6   ? 17.506  20.160  -0.184  1.00 79.19  ? 6   DG  C C2    1 
ATOM   4476 N  N2    . DG  C 2 6   ? 17.471  20.967  0.885   1.00 75.72  ? 6   DG  C N2    1 
ATOM   4477 N  N3    . DG  C 2 6   ? 17.276  20.655  -1.396  1.00 83.63  ? 6   DG  C N3    1 
ATOM   4478 C  C4    . DG  C 2 6   ? 17.357  19.696  -2.362  1.00 86.63  ? 6   DG  C C4    1 
ATOM   4479 P  P     . DG  C 2 7   ? 18.978  24.598  -6.321  1.00 103.85 ? 7   DG  C P     1 
ATOM   4480 O  OP1   . DG  C 2 7   ? 18.722  25.995  -6.749  1.00 96.78  ? 7   DG  C OP1   1 
ATOM   4481 O  OP2   . DG  C 2 7   ? 19.948  23.733  -7.038  1.00 101.42 ? 7   DG  C OP2   1 
ATOM   4482 O  "O5'" . DG  C 2 7   ? 19.467  24.593  -4.810  1.00 90.62  ? 7   DG  C "O5'" 1 
ATOM   4483 C  "C5'" . DG  C 2 7   ? 18.684  25.203  -3.816  1.00 93.33  ? 7   DG  C "C5'" 1 
ATOM   4484 C  "C4'" . DG  C 2 7   ? 19.348  25.038  -2.472  1.00 93.92  ? 7   DG  C "C4'" 1 
ATOM   4485 O  "O4'" . DG  C 2 7   ? 19.270  23.641  -2.060  1.00 96.50  ? 7   DG  C "O4'" 1 
ATOM   4486 C  "C3'" . DG  C 2 7   ? 20.834  25.395  -2.455  1.00 94.04  ? 7   DG  C "C3'" 1 
ATOM   4487 O  "O3'" . DG  C 2 7   ? 21.139  26.076  -1.264  1.00 97.62  ? 7   DG  C "O3'" 1 
ATOM   4488 C  "C2'" . DG  C 2 7   ? 21.514  24.027  -2.504  1.00 94.90  ? 7   DG  C "C2'" 1 
ATOM   4489 C  "C1'" . DG  C 2 7   ? 20.553  23.206  -1.669  1.00 91.01  ? 7   DG  C "C1'" 1 
ATOM   4490 N  N9    . DG  C 2 7   ? 20.663  21.768  -1.890  1.00 83.83  ? 7   DG  C N9    1 
ATOM   4491 C  C8    . DG  C 2 7   ? 20.632  21.098  -3.094  1.00 83.98  ? 7   DG  C C8    1 
ATOM   4492 N  N7    . DG  C 2 7   ? 20.762  19.804  -2.973  1.00 84.07  ? 7   DG  C N7    1 
ATOM   4493 C  C5    . DG  C 2 7   ? 20.890  19.607  -1.601  1.00 80.94  ? 7   DG  C C5    1 
ATOM   4494 C  C6    . DG  C 2 7   ? 21.059  18.412  -0.861  1.00 75.65  ? 7   DG  C C6    1 
ATOM   4495 O  O6    . DG  C 2 7   ? 21.133  17.249  -1.285  1.00 75.54  ? 7   DG  C O6    1 
ATOM   4496 N  N1    . DG  C 2 7   ? 21.138  18.667  0.506   1.00 78.38  ? 7   DG  C N1    1 
ATOM   4497 C  C2    . DG  C 2 7   ? 21.069  19.919  1.084   1.00 79.13  ? 7   DG  C C2    1 
ATOM   4498 N  N2    . DG  C 2 7   ? 21.178  19.971  2.428   1.00 79.60  ? 7   DG  C N2    1 
ATOM   4499 N  N3    . DG  C 2 7   ? 20.911  21.041  0.399   1.00 76.53  ? 7   DG  C N3    1 
ATOM   4500 C  C4    . DG  C 2 7   ? 20.830  20.811  -0.927  1.00 79.16  ? 7   DG  C C4    1 
ATOM   4501 P  P     . DA  C 2 8   ? 22.596  26.714  -1.044  1.00 101.05 ? 8   DA  C P     1 
ATOM   4502 O  OP1   . DA  C 2 8   ? 22.548  27.455  0.244   1.00 89.92  ? 8   DA  C OP1   1 
ATOM   4503 O  OP2   . DA  C 2 8   ? 22.934  27.414  -2.303  1.00 99.81  ? 8   DA  C OP2   1 
ATOM   4504 O  "O5'" . DA  C 2 8   ? 23.568  25.445  -0.918  1.00 88.49  ? 8   DA  C "O5'" 1 
ATOM   4505 C  "C5'" . DA  C 2 8   ? 24.720  25.497  -0.086  1.00 91.61  ? 8   DA  C "C5'" 1 
ATOM   4506 C  "C4'" . DA  C 2 8   ? 24.369  25.274  1.383   1.00 88.60  ? 8   DA  C "C4'" 1 
ATOM   4507 O  "O4'" . DA  C 2 8   ? 23.468  24.150  1.522   1.00 82.76  ? 8   DA  C "O4'" 1 
ATOM   4508 C  "C3'" . DA  C 2 8   ? 25.561  24.958  2.268   1.00 85.30  ? 8   DA  C "C3'" 1 
ATOM   4509 O  "O3'" . DA  C 2 8   ? 25.382  25.497  3.549   1.00 89.00  ? 8   DA  C "O3'" 1 
ATOM   4510 C  "C2'" . DA  C 2 8   ? 25.605  23.430  2.305   1.00 85.14  ? 8   DA  C "C2'" 1 
ATOM   4511 C  "C1'" . DA  C 2 8   ? 24.179  23.004  1.954   1.00 82.02  ? 8   DA  C "C1'" 1 
ATOM   4512 N  N9    . DA  C 2 8   ? 24.140  21.998  0.898   1.00 77.14  ? 8   DA  C N9    1 
ATOM   4513 C  C8    . DA  C 2 8   ? 23.925  22.205  -0.435  1.00 81.34  ? 8   DA  C C8    1 
ATOM   4514 N  N7    . DA  C 2 8   ? 23.954  21.108  -1.152  1.00 75.28  ? 8   DA  C N7    1 
ATOM   4515 C  C5    . DA  C 2 8   ? 24.212  20.116  -0.228  1.00 71.76  ? 8   DA  C C5    1 
ATOM   4516 C  C6    . DA  C 2 8   ? 24.360  18.728  -0.353  1.00 71.36  ? 8   DA  C C6    1 
ATOM   4517 N  N6    . DA  C 2 8   ? 24.262  18.080  -1.516  1.00 68.00  ? 8   DA  C N6    1 
ATOM   4518 N  N1    . DA  C 2 8   ? 24.618  18.025  0.768   1.00 74.02  ? 8   DA  C N1    1 
ATOM   4519 C  C2    . DA  C 2 8   ? 24.705  18.675  1.940   1.00 75.32  ? 8   DA  C C2    1 
ATOM   4520 N  N3    . DA  C 2 8   ? 24.585  19.979  2.182   1.00 74.00  ? 8   DA  C N3    1 
ATOM   4521 C  C4    . DA  C 2 8   ? 24.337  20.649  1.042   1.00 76.28  ? 8   DA  C C4    1 
ATOM   4522 P  P     . DT  C 2 9   ? 26.669  25.748  4.481   1.00 94.69  ? 9   DT  C P     1 
ATOM   4523 O  OP1   . DT  C 2 9   ? 26.202  26.414  5.732   1.00 87.47  ? 9   DT  C OP1   1 
ATOM   4524 O  OP2   . DT  C 2 9   ? 27.695  26.369  3.611   1.00 91.97  ? 9   DT  C OP2   1 
ATOM   4525 O  "O5'" . DT  C 2 9   ? 27.202  24.269  4.820   1.00 90.55  ? 9   DT  C "O5'" 1 
ATOM   4526 C  "C5'" . DT  C 2 9   ? 26.527  23.469  5.786   1.00 85.51  ? 9   DT  C "C5'" 1 
ATOM   4527 C  "C4'" . DT  C 2 9   ? 27.087  22.056  5.818   1.00 81.51  ? 9   DT  C "C4'" 1 
ATOM   4528 O  "O4'" . DT  C 2 9   ? 26.839  21.391  4.560   1.00 80.47  ? 9   DT  C "O4'" 1 
ATOM   4529 C  "C3'" . DT  C 2 9   ? 28.599  21.954  6.057   1.00 81.81  ? 9   DT  C "C3'" 1 
ATOM   4530 O  "O3'" . DT  C 2 9   ? 28.849  21.208  7.239   1.00 88.32  ? 9   DT  C "O3'" 1 
ATOM   4531 C  "C2'" . DT  C 2 9   ? 29.127  21.230  4.812   1.00 74.92  ? 9   DT  C "C2'" 1 
ATOM   4532 C  "C1'" . DT  C 2 9   ? 27.892  20.490  4.349   1.00 78.59  ? 9   DT  C "C1'" 1 
ATOM   4533 N  N1    . DT  C 2 9   ? 27.921  20.120  2.925   1.00 70.71  ? 9   DT  C N1    1 
ATOM   4534 C  C2    . DT  C 2 9   ? 27.812  18.801  2.580   1.00 65.61  ? 9   DT  C C2    1 
ATOM   4535 O  O2    . DT  C 2 9   ? 27.681  17.910  3.389   1.00 74.40  ? 9   DT  C O2    1 
ATOM   4536 N  N3    . DT  C 2 9   ? 27.844  18.557  1.250   1.00 66.28  ? 9   DT  C N3    1 
ATOM   4537 C  C4    . DT  C 2 9   ? 27.973  19.486  0.243   1.00 70.68  ? 9   DT  C C4    1 
ATOM   4538 O  O4    . DT  C 2 9   ? 27.990  19.165  -0.938  1.00 72.16  ? 9   DT  C O4    1 
ATOM   4539 C  C5    . DT  C 2 9   ? 28.093  20.859  0.678   1.00 67.05  ? 9   DT  C C5    1 
ATOM   4540 C  C7    . DT  C 2 9   ? 28.242  21.964  -0.322  1.00 68.19  ? 9   DT  C C7    1 
ATOM   4541 C  C6    . DT  C 2 9   ? 28.063  21.101  1.983   1.00 69.85  ? 9   DT  C C6    1 
ATOM   4542 P  P     . DC  C 2 10  ? 30.325  21.160  7.871   1.00 93.20  ? 10  DC  C P     1 
ATOM   4543 O  OP1   . DC  C 2 10  ? 30.192  21.296  9.341   1.00 91.37  ? 10  DC  C OP1   1 
ATOM   4544 O  OP2   . DC  C 2 10  ? 31.178  22.121  7.130   1.00 84.34  ? 10  DC  C OP2   1 
ATOM   4545 O  "O5'" . DC  C 2 10  ? 30.817  19.680  7.526   1.00 84.89  ? 10  DC  C "O5'" 1 
ATOM   4546 C  "C5'" . DC  C 2 10  ? 29.944  18.580  7.740   1.00 83.92  ? 10  DC  C "C5'" 1 
ATOM   4547 C  "C4'" . DC  C 2 10  ? 30.464  17.359  7.020   1.00 84.11  ? 10  DC  C "C4'" 1 
ATOM   4548 O  "O4'" . DC  C 2 10  ? 30.189  17.491  5.605   1.00 79.47  ? 10  DC  C "O4'" 1 
ATOM   4549 C  "C3'" . DC  C 2 10  ? 31.979  17.161  7.152   1.00 82.23  ? 10  DC  C "C3'" 1 
ATOM   4550 O  "O3'" . DC  C 2 10  ? 32.266  15.927  7.792   1.00 89.45  ? 10  DC  C "O3'" 1 
ATOM   4551 C  "C2'" . DC  C 2 10  ? 32.508  17.192  5.714   1.00 77.46  ? 10  DC  C "C2'" 1 
ATOM   4552 C  "C1'" . DC  C 2 10  ? 31.259  16.933  4.889   1.00 78.43  ? 10  DC  C "C1'" 1 
ATOM   4553 N  N1    . DC  C 2 10  ? 31.311  17.548  3.558   1.00 69.28  ? 10  DC  C N1    1 
ATOM   4554 C  C2    . DC  C 2 10  ? 31.419  16.726  2.455   1.00 62.24  ? 10  DC  C C2    1 
ATOM   4555 O  O2    . DC  C 2 10  ? 31.453  15.512  2.628   1.00 63.44  ? 10  DC  C O2    1 
ATOM   4556 N  N3    . DC  C 2 10  ? 31.478  17.279  1.226   1.00 64.23  ? 10  DC  C N3    1 
ATOM   4557 C  C4    . DC  C 2 10  ? 31.431  18.600  1.084   1.00 62.42  ? 10  DC  C C4    1 
ATOM   4558 N  N4    . DC  C 2 10  ? 31.476  19.090  -0.160  1.00 60.05  ? 10  DC  C N4    1 
ATOM   4559 C  C5    . DC  C 2 10  ? 31.328  19.472  2.208   1.00 65.79  ? 10  DC  C C5    1 
ATOM   4560 C  C6    . DC  C 2 10  ? 31.276  18.906  3.420   1.00 70.07  ? 10  DC  C C6    1 
ATOM   4561 P  P     . DC  C 2 11  ? 33.463  15.841  8.866   1.00 97.39  ? 11  DC  C P     1 
ATOM   4562 O  OP1   . DC  C 2 11  ? 33.523  14.443  9.370   1.00 84.12  ? 11  DC  C OP1   1 
ATOM   4563 O  OP2   . DC  C 2 11  ? 33.311  17.009  9.768   1.00 88.35  ? 11  DC  C OP2   1 
ATOM   4564 O  "O5'" . DC  C 2 11  ? 34.787  16.122  8.014   1.00 86.48  ? 11  DC  C "O5'" 1 
ATOM   4565 C  "C5'" . DC  C 2 11  ? 35.913  15.274  8.168   1.00 84.64  ? 11  DC  C "C5'" 1 
ATOM   4566 C  "C4'" . DC  C 2 11  ? 35.984  14.251  7.047   1.00 80.78  ? 11  DC  C "C4'" 1 
ATOM   4567 O  "O4'" . DC  C 2 11  ? 35.249  14.748  5.889   1.00 84.88  ? 11  DC  C "O4'" 1 
ATOM   4568 C  "C3'" . DC  C 2 11  ? 37.400  13.961  6.548   1.00 81.31  ? 11  DC  C "C3'" 1 
ATOM   4569 O  "O3'" . DC  C 2 11  ? 37.510  12.607  6.088   1.00 83.66  ? 11  DC  C "O3'" 1 
ATOM   4570 C  "C2'" . DC  C 2 11  ? 37.545  14.959  5.408   1.00 81.09  ? 11  DC  C "C2'" 1 
ATOM   4571 C  "C1'" . DC  C 2 11  ? 36.141  14.932  4.808   1.00 79.09  ? 11  DC  C "C1'" 1 
ATOM   4572 N  N1    . DC  C 2 11  ? 35.790  16.183  4.075   1.00 74.57  ? 11  DC  C N1    1 
ATOM   4573 C  C2    . DC  C 2 11  ? 35.424  16.106  2.718   1.00 76.39  ? 11  DC  C C2    1 
ATOM   4574 O  O2    . DC  C 2 11  ? 35.378  14.989  2.167   1.00 70.61  ? 11  DC  C O2    1 
ATOM   4575 N  N3    . DC  C 2 11  ? 35.120  17.259  2.047   1.00 62.80  ? 11  DC  C N3    1 
ATOM   4576 C  C4    . DC  C 2 11  ? 35.178  18.435  2.678   1.00 64.29  ? 11  DC  C C4    1 
ATOM   4577 N  N4    . DC  C 2 11  ? 34.876  19.532  1.976   1.00 55.54  ? 11  DC  C N4    1 
ATOM   4578 C  C5    . DC  C 2 11  ? 35.554  18.533  4.061   1.00 65.05  ? 11  DC  C C5    1 
ATOM   4579 C  C6    . DC  C 2 11  ? 35.856  17.394  4.709   1.00 70.25  ? 11  DC  C C6    1 
ATOM   4580 O  "O5'" . DG  D 3 1   ? -32.022 6.546   0.905   1.00 63.58  ? 1   DG  D "O5'" 1 
ATOM   4581 C  "C5'" . DG  D 3 1   ? -32.161 5.871   -0.336  1.00 49.83  ? 1   DG  D "C5'" 1 
ATOM   4582 C  "C4'" . DG  D 3 1   ? -31.007 6.219   -1.250  1.00 58.44  ? 1   DG  D "C4'" 1 
ATOM   4583 O  "O4'" . DG  D 3 1   ? -31.174 7.581   -1.686  1.00 55.83  ? 1   DG  D "O4'" 1 
ATOM   4584 C  "C3'" . DG  D 3 1   ? -29.622 6.131   -0.617  1.00 59.43  ? 1   DG  D "C3'" 1 
ATOM   4585 O  "O3'" . DG  D 3 1   ? -28.942 4.913   -0.912  1.00 73.87  ? 1   DG  D "O3'" 1 
ATOM   4586 C  "C2'" . DG  D 3 1   ? -28.894 7.421   -0.955  1.00 48.29  ? 1   DG  D "C2'" 1 
ATOM   4587 C  "C1'" . DG  D 3 1   ? -29.937 8.278   -1.678  1.00 50.49  ? 1   DG  D "C1'" 1 
ATOM   4588 N  N9    . DG  D 3 1   ? -30.178 9.605   -1.096  1.00 46.00  ? 1   DG  D N9    1 
ATOM   4589 C  C8    . DG  D 3 1   ? -30.831 9.889   0.080   1.00 50.63  ? 1   DG  D C8    1 
ATOM   4590 N  N7    . DG  D 3 1   ? -30.921 11.168  0.335   1.00 46.60  ? 1   DG  D N7    1 
ATOM   4591 C  C5    . DG  D 3 1   ? -30.302 11.769  -0.738  1.00 44.06  ? 1   DG  D C5    1 
ATOM   4592 C  C6    . DG  D 3 1   ? -30.124 13.134  -1.017  1.00 46.56  ? 1   DG  D C6    1 
ATOM   4593 O  O6    . DG  D 3 1   ? -30.486 14.099  -0.328  1.00 43.49  ? 1   DG  D O6    1 
ATOM   4594 N  N1    . DG  D 3 1   ? -29.452 13.338  -2.235  1.00 44.69  ? 1   DG  D N1    1 
ATOM   4595 C  C2    . DG  D 3 1   ? -29.012 12.326  -3.064  1.00 47.36  ? 1   DG  D C2    1 
ATOM   4596 N  N2    . DG  D 3 1   ? -28.367 12.704  -4.182  1.00 47.19  ? 1   DG  D N2    1 
ATOM   4597 N  N3    . DG  D 3 1   ? -29.201 11.025  -2.817  1.00 44.79  ? 1   DG  D N3    1 
ATOM   4598 C  C4    . DG  D 3 1   ? -29.850 10.825  -1.641  1.00 44.21  ? 1   DG  D C4    1 
ATOM   4599 P  P     . DC  D 3 2   ? -28.771 4.351   -2.456  1.00 51.55  ? 2   DC  D P     1 
ATOM   4600 O  OP1   . DC  D 3 2   ? -30.049 4.081   -3.076  1.00 70.09  ? 2   DC  D OP1   1 
ATOM   4601 O  OP2   . DC  D 3 2   ? -27.751 3.208   -2.422  1.00 65.47  ? 2   DC  D OP2   1 
ATOM   4602 O  "O5'" . DC  D 3 2   ? -27.977 5.445   -3.236  1.00 59.81  ? 2   DC  D "O5'" 1 
ATOM   4603 C  "C5'" . DC  D 3 2   ? -26.648 5.641   -2.958  1.00 48.66  ? 2   DC  D "C5'" 1 
ATOM   4604 C  "C4'" . DC  D 3 2   ? -26.051 6.704   -3.848  1.00 47.25  ? 2   DC  D "C4'" 1 
ATOM   4605 O  "O4'" . DC  D 3 2   ? -26.614 8.007   -3.530  1.00 43.28  ? 2   DC  D "O4'" 1 
ATOM   4606 C  "C3'" . DC  D 3 2   ? -24.562 6.810   -3.638  1.00 44.65  ? 2   DC  D "C3'" 1 
ATOM   4607 O  "O3'" . DC  D 3 2   ? -23.896 6.541   -4.813  1.00 45.64  ? 2   DC  D "O3'" 1 
ATOM   4608 C  "C2'" . DC  D 3 2   ? -24.297 8.219   -3.097  1.00 41.27  ? 2   DC  D "C2'" 1 
ATOM   4609 C  "C1'" . DC  D 3 2   ? -25.582 8.974   -3.402  1.00 45.69  ? 2   DC  D "C1'" 1 
ATOM   4610 N  N1    . DC  D 3 2   ? -25.958 9.995   -2.325  1.00 41.62  ? 2   DC  D N1    1 
ATOM   4611 C  C2    . DC  D 3 2   ? -25.743 11.373  -2.552  1.00 43.53  ? 2   DC  D C2    1 
ATOM   4612 O  O2    . DC  D 3 2   ? -25.249 11.744  -3.625  1.00 45.03  ? 2   DC  D O2    1 
ATOM   4613 N  N3    . DC  D 3 2   ? -26.083 12.265  -1.575  1.00 43.28  ? 2   DC  D N3    1 
ATOM   4614 C  C4    . DC  D 3 2   ? -26.604 11.830  -0.420  1.00 42.84  ? 2   DC  D C4    1 
ATOM   4615 N  N4    . DC  D 3 2   ? -26.920 12.740  0.501   1.00 45.62  ? 2   DC  D N4    1 
ATOM   4616 C  C5    . DC  D 3 2   ? -26.823 10.441  -0.166  1.00 40.60  ? 2   DC  D C5    1 
ATOM   4617 C  C6    . DC  D 3 2   ? -26.478 9.570   -1.136  1.00 41.85  ? 2   DC  D C6    1 
ATOM   4618 P  P     . DT  D 3 3   ? -22.344 6.180   -4.696  1.00 40.22  ? 3   DT  D P     1 
ATOM   4619 O  OP1   . DT  D 3 3   ? -21.851 5.422   -5.875  1.00 42.27  ? 3   DT  D OP1   1 
ATOM   4620 O  OP2   . DT  D 3 3   ? -22.184 5.574   -3.364  1.00 38.35  ? 3   DT  D OP2   1 
ATOM   4621 O  "O5'" . DT  D 3 3   ? -21.705 7.611   -4.749  1.00 41.90  ? 3   DT  D "O5'" 1 
ATOM   4622 C  "C5'" . DT  D 3 3   ? -21.764 8.340   -5.936  1.00 36.42  ? 3   DT  D "C5'" 1 
ATOM   4623 C  "C4'" . DT  D 3 3   ? -21.204 9.706   -5.689  1.00 41.11  ? 3   DT  D "C4'" 1 
ATOM   4624 O  "O4'" . DT  D 3 3   ? -21.987 10.353  -4.661  1.00 34.08  ? 3   DT  D "O4'" 1 
ATOM   4625 C  "C3'" . DT  D 3 3   ? -19.761 9.708   -5.172  1.00 36.84  ? 3   DT  D "C3'" 1 
ATOM   4626 O  "O3'" . DT  D 3 3   ? -18.923 10.276  -6.174  1.00 44.06  ? 3   DT  D "O3'" 1 
ATOM   4627 C  "C2'" . DT  D 3 3   ? -19.815 10.560  -3.882  1.00 35.65  ? 3   DT  D "C2'" 1 
ATOM   4628 C  "C1'" . DT  D 3 3   ? -21.157 11.269  -4.003  1.00 39.12  ? 3   DT  D "C1'" 1 
ATOM   4629 N  N1    . DT  D 3 3   ? -21.802 11.620  -2.706  1.00 42.33  ? 3   DT  D N1    1 
ATOM   4630 C  C2    . DT  D 3 3   ? -22.089 12.943  -2.430  1.00 43.73  ? 3   DT  D C2    1 
ATOM   4631 O  O2    . DT  D 3 3   ? -21.830 13.850  -3.186  1.00 45.10  ? 3   DT  D O2    1 
ATOM   4632 N  N3    . DT  D 3 3   ? -22.695 13.164  -1.218  1.00 41.71  ? 3   DT  D N3    1 
ATOM   4633 C  C4    . DT  D 3 3   ? -23.042 12.216  -0.272  1.00 39.56  ? 3   DT  D C4    1 
ATOM   4634 O  O4    . DT  D 3 3   ? -23.585 12.520  0.788   1.00 41.08  ? 3   DT  D O4    1 
ATOM   4635 C  C5    . DT  D 3 3   ? -22.711 10.852  -0.618  1.00 40.44  ? 3   DT  D C5    1 
ATOM   4636 C  C7    . DT  D 3 3   ? -23.036 9.732   0.327   1.00 44.62  ? 3   DT  D C7    1 
ATOM   4637 C  C6    . DT  D 3 3   ? -22.118 10.622  -1.809  1.00 39.75  ? 3   DT  D C6    1 
ATOM   4638 P  P     . DG  D 3 4   ? -17.314 10.223  -6.048  1.00 37.11  ? 4   DG  D P     1 
ATOM   4639 O  OP1   . DG  D 3 4   ? -16.741 10.440  -7.386  1.00 40.63  ? 4   DG  D OP1   1 
ATOM   4640 O  OP2   . DG  D 3 4   ? -16.955 8.985   -5.306  1.00 38.92  ? 4   DG  D OP2   1 
ATOM   4641 O  "O5'" . DG  D 3 4   ? -17.005 11.521  -5.196  1.00 40.55  ? 4   DG  D "O5'" 1 
ATOM   4642 C  "C5'" . DG  D 3 4   ? -17.173 12.800  -5.775  1.00 37.42  ? 4   DG  D "C5'" 1 
ATOM   4643 C  "C4'" . DG  D 3 4   ? -16.985 13.854  -4.718  1.00 42.52  ? 4   DG  D "C4'" 1 
ATOM   4644 O  "O4'" . DG  D 3 4   ? -17.980 13.666  -3.682  1.00 44.10  ? 4   DG  D "O4'" 1 
ATOM   4645 C  "C3'" . DG  D 3 4   ? -15.629 13.814  -3.984  1.00 41.12  ? 4   DG  D "C3'" 1 
ATOM   4646 O  "O3'" . DG  D 3 4   ? -15.129 15.125  -3.897  1.00 46.34  ? 4   DG  D "O3'" 1 
ATOM   4647 C  "C2'" . DG  D 3 4   ? -16.003 13.287  -2.595  1.00 40.46  ? 4   DG  D "C2'" 1 
ATOM   4648 C  "C1'" . DG  D 3 4   ? -17.373 13.911  -2.452  1.00 40.18  ? 4   DG  D "C1'" 1 
ATOM   4649 N  N9    . DG  D 3 4   ? -18.179 13.334  -1.411  1.00 38.83  ? 4   DG  D N9    1 
ATOM   4650 C  C8    . DG  D 3 4   ? -18.293 12.010  -1.100  1.00 39.21  ? 4   DG  D C8    1 
ATOM   4651 N  N7    . DG  D 3 4   ? -19.091 11.784  -0.083  1.00 44.31  ? 4   DG  D N7    1 
ATOM   4652 C  C5    . DG  D 3 4   ? -19.528 13.052  0.301   1.00 42.71  ? 4   DG  D C5    1 
ATOM   4653 C  C6    . DG  D 3 4   ? -20.403 13.449  1.348   1.00 42.24  ? 4   DG  D C6    1 
ATOM   4654 O  O6    . DG  D 3 4   ? -20.982 12.735  2.186   1.00 43.94  ? 4   DG  D O6    1 
ATOM   4655 N  N1    . DG  D 3 4   ? -20.570 14.824  1.383   1.00 39.71  ? 4   DG  D N1    1 
ATOM   4656 C  C2    . DG  D 3 4   ? -19.965 15.702  0.532   1.00 41.53  ? 4   DG  D C2    1 
ATOM   4657 N  N2    . DG  D 3 4   ? -20.239 16.990  0.727   1.00 43.34  ? 4   DG  D N2    1 
ATOM   4658 N  N3    . DG  D 3 4   ? -19.136 15.351  -0.446  1.00 39.72  ? 4   DG  D N3    1 
ATOM   4659 C  C4    . DG  D 3 4   ? -18.966 14.015  -0.503  1.00 42.24  ? 4   DG  D C4    1 
ATOM   4660 P  P     . DA  D 3 5   ? -13.610 15.389  -3.466  1.00 41.98  ? 5   DA  D P     1 
ATOM   4661 O  OP1   . DA  D 3 5   ? -12.910 15.970  -4.621  1.00 44.21  ? 5   DA  D OP1   1 
ATOM   4662 O  OP2   . DA  D 3 5   ? -13.079 14.154  -2.838  1.00 47.46  ? 5   DA  D OP2   1 
ATOM   4663 O  "O5'" . DA  D 3 5   ? -13.744 16.464  -2.292  1.00 46.27  ? 5   DA  D "O5'" 1 
ATOM   4664 C  "C5'" . DA  D 3 5   ? -13.885 17.804  -2.602  1.00 45.74  ? 5   DA  D "C5'" 1 
ATOM   4665 C  "C4'" . DA  D 3 5   ? -14.858 18.516  -1.668  1.00 48.55  ? 5   DA  D "C4'" 1 
ATOM   4666 O  "O4'" . DA  D 3 5   ? -15.980 17.667  -1.330  1.00 45.89  ? 5   DA  D "O4'" 1 
ATOM   4667 C  "C3'" . DA  D 3 5   ? -14.274 18.982  -0.356  1.00 47.69  ? 5   DA  D "C3'" 1 
ATOM   4668 O  "O3'" . DA  D 3 5   ? -13.810 20.282  -0.523  1.00 53.87  ? 5   DA  D "O3'" 1 
ATOM   4669 C  "C2'" . DA  D 3 5   ? -15.464 18.972  0.601   1.00 47.94  ? 5   DA  D "C2'" 1 
ATOM   4670 C  "C1'" . DA  D 3 5   ? -16.414 17.953  -0.005  1.00 44.18  ? 5   DA  D "C1'" 1 
ATOM   4671 N  N9    . DA  D 3 5   ? -16.470 16.686  0.690   1.00 45.06  ? 5   DA  D N9    1 
ATOM   4672 C  C8    . DA  D 3 5   ? -15.951 15.503  0.242   1.00 44.98  ? 5   DA  D C8    1 
ATOM   4673 N  N7    . DA  D 3 5   ? -16.204 14.487  1.020   1.00 41.36  ? 5   DA  D N7    1 
ATOM   4674 C  C5    . DA  D 3 5   ? -16.944 15.035  2.042   1.00 41.35  ? 5   DA  D C5    1 
ATOM   4675 C  C6    . DA  D 3 5   ? -17.510 14.462  3.177   1.00 43.03  ? 5   DA  D C6    1 
ATOM   4676 N  N6    . DA  D 3 5   ? -17.413 13.146  3.446   1.00 37.84  ? 5   DA  D N6    1 
ATOM   4677 N  N1    . DA  D 3 5   ? -18.194 15.284  4.017   1.00 45.28  ? 5   DA  D N1    1 
ATOM   4678 C  C2    . DA  D 3 5   ? -18.287 16.593  3.708   1.00 46.72  ? 5   DA  D C2    1 
ATOM   4679 N  N3    . DA  D 3 5   ? -17.787 17.244  2.654   1.00 44.57  ? 5   DA  D N3    1 
ATOM   4680 C  C4    . DA  D 3 5   ? -17.119 16.397  1.858   1.00 39.89  ? 5   DA  D C4    1 
ATOM   4681 P  P     . DT  D 3 6   ? -12.671 20.854  0.443   1.00 55.82  ? 6   DT  D P     1 
ATOM   4682 O  OP1   . DT  D 3 6   ? -12.308 22.191  -0.090  1.00 51.79  ? 6   DT  D OP1   1 
ATOM   4683 O  OP2   . DT  D 3 6   ? -11.698 19.751  0.594   1.00 40.89  ? 6   DT  D OP2   1 
ATOM   4684 O  "O5'" . DT  D 3 6   ? -13.433 21.087  1.826   1.00 48.88  ? 6   DT  D "O5'" 1 
ATOM   4685 C  "C5'" . DT  D 3 6   ? -14.588 21.916  1.867   1.00 48.29  ? 6   DT  D "C5'" 1 
ATOM   4686 C  "C4'" . DT  D 3 6   ? -15.117 21.995  3.280   1.00 54.43  ? 6   DT  D "C4'" 1 
ATOM   4687 O  "O4'" . DT  D 3 6   ? -15.707 20.718  3.645   1.00 51.33  ? 6   DT  D "O4'" 1 
ATOM   4688 C  "C3'" . DT  D 3 6   ? -14.025 22.291  4.311   1.00 53.20  ? 6   DT  D "C3'" 1 
ATOM   4689 O  "O3'" . DT  D 3 6   ? -14.393 23.347  5.158   1.00 53.97  ? 6   DT  D "O3'" 1 
ATOM   4690 C  "C2'" . DT  D 3 6   ? -13.851 20.989  5.074   1.00 50.17  ? 6   DT  D "C2'" 1 
ATOM   4691 C  "C1'" . DT  D 3 6   ? -15.186 20.284  4.886   1.00 53.16  ? 6   DT  D "C1'" 1 
ATOM   4692 N  N1    . DT  D 3 6   ? -15.017 18.809  4.843   1.00 52.77  ? 6   DT  D N1    1 
ATOM   4693 C  C2    . DT  D 3 6   ? -15.734 18.017  5.713   1.00 51.78  ? 6   DT  D C2    1 
ATOM   4694 O  O2    . DT  D 3 6   ? -16.550 18.461  6.513   1.00 52.12  ? 6   DT  D O2    1 
ATOM   4695 N  N3    . DT  D 3 6   ? -15.484 16.673  5.590   1.00 49.33  ? 6   DT  D N3    1 
ATOM   4696 C  C4    . DT  D 3 6   ? -14.591 16.060  4.712   1.00 46.34  ? 6   DT  D C4    1 
ATOM   4697 O  O4    . DT  D 3 6   ? -14.420 14.841  4.685   1.00 44.04  ? 6   DT  D O4    1 
ATOM   4698 C  C5    . DT  D 3 6   ? -13.866 16.957  3.843   1.00 47.35  ? 6   DT  D C5    1 
ATOM   4699 C  C7    . DT  D 3 6   ? -12.862 16.414  2.862   1.00 43.06  ? 6   DT  D C7    1 
ATOM   4700 C  C6    . DT  D 3 6   ? -14.106 18.269  3.957   1.00 49.76  ? 6   DT  D C6    1 
ATOM   4701 P  P     . DG  D 3 7   ? -13.264 24.046  6.061   1.00 67.26  ? 7   DG  D P     1 
ATOM   4702 O  OP1   . DG  D 3 7   ? -13.658 25.447  6.316   1.00 67.58  ? 7   DG  D OP1   1 
ATOM   4703 O  OP2   . DG  D 3 7   ? -11.940 23.680  5.470   1.00 57.64  ? 7   DG  D OP2   1 
ATOM   4704 O  "O5'" . DG  D 3 7   ? -13.420 23.321  7.472   1.00 53.87  ? 7   DG  D "O5'" 1 
ATOM   4705 C  "C5'" . DG  D 3 7   ? -14.609 23.451  8.206   1.00 44.94  ? 7   DG  D "C5'" 1 
ATOM   4706 C  "C4'" . DG  D 3 7   ? -14.446 22.754  9.522   1.00 46.47  ? 7   DG  D "C4'" 1 
ATOM   4707 O  "O4'" . DG  D 3 7   ? -14.404 21.330  9.287   1.00 48.38  ? 7   DG  D "O4'" 1 
ATOM   4708 C  "C3'" . DG  D 3 7   ? -13.147 23.099  10.245  1.00 48.71  ? 7   DG  D "C3'" 1 
ATOM   4709 O  "O3'" . DG  D 3 7   ? -13.391 23.250  11.624  1.00 50.32  ? 7   DG  D "O3'" 1 
ATOM   4710 C  "C2'" . DG  D 3 7   ? -12.233 21.905  9.945   1.00 42.96  ? 7   DG  D "C2'" 1 
ATOM   4711 C  "C1'" . DG  D 3 7   ? -13.235 20.773  9.866   1.00 48.34  ? 7   DG  D "C1'" 1 
ATOM   4712 N  N9    . DG  D 3 7   ? -12.821 19.657  9.019   1.00 48.33  ? 7   DG  D N9    1 
ATOM   4713 C  C8    . DG  D 3 7   ? -12.233 19.731  7.787   1.00 48.00  ? 7   DG  D C8    1 
ATOM   4714 N  N7    . DG  D 3 7   ? -12.021 18.568  7.240   1.00 47.56  ? 7   DG  D N7    1 
ATOM   4715 C  C5    . DG  D 3 7   ? -12.512 17.662  8.163   1.00 45.37  ? 7   DG  D C5    1 
ATOM   4716 C  C6    . DG  D 3 7   ? -12.549 16.251  8.120   1.00 46.17  ? 7   DG  D C6    1 
ATOM   4717 O  O6    . DG  D 3 7   ? -12.137 15.501  7.224   1.00 45.55  ? 7   DG  D O6    1 
ATOM   4718 N  N1    . DG  D 3 7   ? -13.134 15.718  9.274   1.00 47.27  ? 7   DG  D N1    1 
ATOM   4719 C  C2    . DG  D 3 7   ? -13.622 16.461  10.328  1.00 42.99  ? 7   DG  D C2    1 
ATOM   4720 N  N2    . DG  D 3 7   ? -14.153 15.775  11.351  1.00 45.61  ? 7   DG  D N2    1 
ATOM   4721 N  N3    . DG  D 3 7   ? -13.587 17.781  10.379  1.00 45.34  ? 7   DG  D N3    1 
ATOM   4722 C  C4    . DG  D 3 7   ? -13.016 18.314  9.265   1.00 47.07  ? 7   DG  D C4    1 
ATOM   4723 P  P     . DC  D 3 8   ? -12.217 23.743  12.622  1.00 51.25  ? 8   DC  D P     1 
ATOM   4724 O  OP1   . DC  D 3 8   ? -12.958 24.386  13.738  1.00 45.63  ? 8   DC  D OP1   1 
ATOM   4725 O  OP2   . DC  D 3 8   ? -11.091 24.391  11.906  1.00 41.51  ? 8   DC  D OP2   1 
ATOM   4726 O  "O5'" . DC  D 3 8   ? -11.537 22.387  13.117  1.00 47.47  ? 8   DC  D "O5'" 1 
ATOM   4727 C  "C5'" . DC  D 3 8   ? -12.299 21.403  13.776  1.00 45.38  ? 8   DC  D "C5'" 1 
ATOM   4728 C  "C4'" . DC  D 3 8   ? -11.483 20.128  13.955  1.00 45.61  ? 8   DC  D "C4'" 1 
ATOM   4729 O  "O4'" . DC  D 3 8   ? -11.404 19.413  12.709  1.00 44.59  ? 8   DC  D "O4'" 1 
ATOM   4730 C  "C3'" . DC  D 3 8   ? -10.026 20.312  14.414  1.00 40.59  ? 8   DC  D "C3'" 1 
ATOM   4731 O  "O3'" . DC  D 3 8   ? -9.911  19.876  15.754  1.00 50.57  ? 8   DC  D "O3'" 1 
ATOM   4732 C  "C2'" . DC  D 3 8   ? -9.212  19.413  13.448  1.00 40.11  ? 8   DC  D "C2'" 1 
ATOM   4733 C  "C1'" . DC  D 3 8   ? -10.300 18.567  12.778  1.00 44.68  ? 8   DC  D "C1'" 1 
ATOM   4734 N  N1    . DC  D 3 8   ? -9.971  18.087  11.386  1.00 46.17  ? 8   DC  D N1    1 
ATOM   4735 C  C2    . DC  D 3 8   ? -10.167 16.737  11.050  1.00 45.40  ? 8   DC  D C2    1 
ATOM   4736 O  O2    . DC  D 3 8   ? -10.606 15.963  11.893  1.00 44.87  ? 8   DC  D O2    1 
ATOM   4737 N  N3    . DC  D 3 8   ? -9.866  16.319  9.801   1.00 46.85  ? 8   DC  D N3    1 
ATOM   4738 C  C4    . DC  D 3 8   ? -9.392  17.186  8.893   1.00 48.16  ? 8   DC  D C4    1 
ATOM   4739 N  N4    . DC  D 3 8   ? -9.115  16.715  7.650   1.00 43.50  ? 8   DC  D N4    1 
ATOM   4740 C  C5    . DC  D 3 8   ? -9.188  18.568  9.213   1.00 40.64  ? 8   DC  D C5    1 
ATOM   4741 C  C6    . DC  D 3 8   ? -9.492  18.971  10.454  1.00 44.03  ? 8   DC  D C6    1 
ATOM   4742 P  P     . DG  D 3 9   ? -8.522  20.002  16.585  1.00 50.72  ? 9   DG  D P     1 
ATOM   4743 O  OP1   . DG  D 3 9   ? -8.963  20.084  17.987  1.00 42.22  ? 9   DG  D OP1   1 
ATOM   4744 O  OP2   . DG  D 3 9   ? -7.647  21.029  15.984  1.00 43.46  ? 9   DG  D OP2   1 
ATOM   4745 O  "O5'" . DG  D 3 9   ? -7.782  18.608  16.344  1.00 47.14  ? 9   DG  D "O5'" 1 
ATOM   4746 C  "C5'" . DG  D 3 9   ? -8.331  17.412  16.919  1.00 53.77  ? 9   DG  D "C5'" 1 
ATOM   4747 C  "C4'" . DG  D 3 9   ? -7.797  16.158  16.235  1.00 48.39  ? 9   DG  D "C4'" 1 
ATOM   4748 O  "O4'" . DG  D 3 9   ? -8.041  16.231  14.810  1.00 56.69  ? 9   DG  D "O4'" 1 
ATOM   4749 C  "C3'" . DG  D 3 9   ? -6.293  15.956  16.333  1.00 51.74  ? 9   DG  D "C3'" 1 
ATOM   4750 O  "O3'" . DG  D 3 9   ? -5.949  15.166  17.489  1.00 58.30  ? 9   DG  D "O3'" 1 
ATOM   4751 C  "C2'" . DG  D 3 9   ? -5.946  15.204  15.033  1.00 57.68  ? 9   DG  D "C2'" 1 
ATOM   4752 C  "C1'" . DG  D 3 9   ? -7.241  15.242  14.221  1.00 52.29  ? 9   DG  D "C1'" 1 
ATOM   4753 N  N9    . DG  D 3 9   ? -6.974  15.561  12.831  1.00 54.88  ? 9   DG  D N9    1 
ATOM   4754 C  C8    . DG  D 3 9   ? -6.541  16.759  12.320  1.00 49.22  ? 9   DG  D C8    1 
ATOM   4755 N  N7    . DG  D 3 9   ? -6.314  16.719  11.046  1.00 49.58  ? 9   DG  D N7    1 
ATOM   4756 C  C5    . DG  D 3 9   ? -6.580  15.403  10.694  1.00 49.33  ? 9   DG  D C5    1 
ATOM   4757 C  C6    . DG  D 3 9   ? -6.518  14.773  9.431   1.00 45.79  ? 9   DG  D C6    1 
ATOM   4758 O  O6    . DG  D 3 9   ? -6.187  15.276  8.365   1.00 44.48  ? 9   DG  D O6    1 
ATOM   4759 N  N1    . DG  D 3 9   ? -6.878  13.414  9.499   1.00 47.48  ? 9   DG  D N1    1 
ATOM   4760 C  C2    . DG  D 3 9   ? -7.262  12.761  10.673  1.00 47.65  ? 9   DG  D C2    1 
ATOM   4761 N  N2    . DG  D 3 9   ? -7.583  11.452  10.577  1.00 36.95  ? 9   DG  D N2    1 
ATOM   4762 N  N3    . DG  D 3 9   ? -7.330  13.362  11.858  1.00 50.45  ? 9   DG  D N3    1 
ATOM   4763 C  C4    . DG  D 3 9   ? -6.968  14.675  11.788  1.00 48.28  ? 9   DG  D C4    1 
ATOM   4764 O  "O5'" . DG  E 4 1   ? 35.970  16.285  -8.831  1.00 47.04  ? 1   DG  E "O5'" 1 
ATOM   4765 C  "C5'" . DG  E 4 1   ? 35.781  14.925  -8.456  1.00 48.12  ? 1   DG  E "C5'" 1 
ATOM   4766 C  "C4'" . DG  E 4 1   ? 34.656  14.780  -7.430  1.00 44.92  ? 1   DG  E "C4'" 1 
ATOM   4767 O  "O4'" . DG  E 4 1   ? 34.911  15.641  -6.287  1.00 44.32  ? 1   DG  E "O4'" 1 
ATOM   4768 C  "C3'" . DG  E 4 1   ? 33.221  15.151  -7.918  1.00 52.83  ? 1   DG  E "C3'" 1 
ATOM   4769 O  "O3'" . DG  E 4 1   ? 32.305  14.063  -7.655  1.00 55.38  ? 1   DG  E "O3'" 1 
ATOM   4770 C  "C2'" . DG  E 4 1   ? 32.859  16.383  -7.074  1.00 50.34  ? 1   DG  E "C2'" 1 
ATOM   4771 C  "C1'" . DG  E 4 1   ? 33.661  16.076  -5.820  1.00 51.37  ? 1   DG  E "C1'" 1 
ATOM   4772 N  N9    . DG  E 4 1   ? 33.832  17.181  -4.877  1.00 53.41  ? 1   DG  E N9    1 
ATOM   4773 C  C8    . DG  E 4 1   ? 33.742  18.543  -5.112  1.00 51.62  ? 1   DG  E C8    1 
ATOM   4774 N  N7    . DG  E 4 1   ? 33.928  19.262  -4.025  1.00 49.37  ? 1   DG  E N7    1 
ATOM   4775 C  C5    . DG  E 4 1   ? 34.139  18.310  -3.018  1.00 46.90  ? 1   DG  E C5    1 
ATOM   4776 C  C6    . DG  E 4 1   ? 34.395  18.474  -1.617  1.00 59.49  ? 1   DG  E C6    1 
ATOM   4777 O  O6    . DG  E 4 1   ? 34.496  19.540  -0.965  1.00 50.28  ? 1   DG  E O6    1 
ATOM   4778 N  N1    . DG  E 4 1   ? 34.545  17.226  -0.965  1.00 58.90  ? 1   DG  E N1    1 
ATOM   4779 C  C2    . DG  E 4 1   ? 34.454  15.992  -1.593  1.00 57.69  ? 1   DG  E C2    1 
ATOM   4780 N  N2    . DG  E 4 1   ? 34.613  14.900  -0.823  1.00 55.59  ? 1   DG  E N2    1 
ATOM   4781 N  N3    . DG  E 4 1   ? 34.221  15.842  -2.892  1.00 55.82  ? 1   DG  E N3    1 
ATOM   4782 C  C4    . DG  E 4 1   ? 34.074  17.036  -3.533  1.00 51.42  ? 1   DG  E C4    1 
ATOM   4783 P  P     . DG  E 4 2   ? 31.768  13.116  -8.850  1.00 46.28  ? 2   DG  E P     1 
ATOM   4784 O  OP1   . DG  E 4 2   ? 32.937  12.786  -9.698  1.00 47.83  ? 2   DG  E OP1   1 
ATOM   4785 O  OP2   . DG  E 4 2   ? 30.633  13.799  -9.506  1.00 49.38  ? 2   DG  E OP2   1 
ATOM   4786 O  "O5'" . DG  E 4 2   ? 31.248  11.780  -8.064  1.00 57.05  ? 2   DG  E "O5'" 1 
ATOM   4787 C  "C5'" . DG  E 4 2   ? 32.171  10.866  -7.417  1.00 48.05  ? 2   DG  E "C5'" 1 
ATOM   4788 C  "C4'" . DG  E 4 2   ? 31.619  10.291  -6.100  1.00 56.07  ? 2   DG  E "C4'" 1 
ATOM   4789 O  "O4'" . DG  E 4 2   ? 31.880  11.205  -5.008  1.00 52.40  ? 2   DG  E "O4'" 1 
ATOM   4790 C  "C3'" . DG  E 4 2   ? 30.126  9.948   -6.045  1.00 57.35  ? 2   DG  E "C3'" 1 
ATOM   4791 O  "O3'" . DG  E 4 2   ? 29.935  8.646   -5.458  1.00 65.02  ? 2   DG  E "O3'" 1 
ATOM   4792 C  "C2'" . DG  E 4 2   ? 29.524  11.050  -5.168  1.00 54.41  ? 2   DG  E "C2'" 1 
ATOM   4793 C  "C1'" . DG  E 4 2   ? 30.698  11.526  -4.316  1.00 56.71  ? 2   DG  E "C1'" 1 
ATOM   4794 N  N9    . DG  E 4 2   ? 30.708  12.970  -4.114  1.00 58.99  ? 2   DG  E N9    1 
ATOM   4795 C  C8    . DG  E 4 2   ? 30.595  13.931  -5.089  1.00 57.50  ? 2   DG  E C8    1 
ATOM   4796 N  N7    . DG  E 4 2   ? 30.661  15.150  -4.627  1.00 62.77  ? 2   DG  E N7    1 
ATOM   4797 C  C5    . DG  E 4 2   ? 30.834  14.989  -3.254  1.00 59.34  ? 2   DG  E C5    1 
ATOM   4798 C  C6    . DG  E 4 2   ? 30.968  15.961  -2.227  1.00 56.54  ? 2   DG  E C6    1 
ATOM   4799 O  O6    . DG  E 4 2   ? 30.958  17.194  -2.323  1.00 61.06  ? 2   DG  E O6    1 
ATOM   4800 N  N1    . DG  E 4 2   ? 31.122  15.375  -0.985  1.00 59.24  ? 2   DG  E N1    1 
ATOM   4801 C  C2    . DG  E 4 2   ? 31.149  14.018  -0.754  1.00 65.85  ? 2   DG  E C2    1 
ATOM   4802 N  N2    . DG  E 4 2   ? 31.317  13.634  0.528   1.00 70.61  ? 2   DG  E N2    1 
ATOM   4803 N  N3    . DG  E 4 2   ? 31.024  13.098  -1.706  1.00 60.11  ? 2   DG  E N3    1 
ATOM   4804 C  C4    . DG  E 4 2   ? 30.868  13.653  -2.924  1.00 55.74  ? 2   DG  E C4    1 
ATOM   4805 P  P     . DA  E 4 3   ? 28.460  8.036   -5.212  1.00 64.22  ? 3   DA  E P     1 
ATOM   4806 O  OP1   . DA  E 4 3   ? 28.579  6.546   -5.271  1.00 54.81  ? 3   DA  E OP1   1 
ATOM   4807 O  OP2   . DA  E 4 3   ? 27.531  8.686   -6.147  1.00 66.38  ? 3   DA  E OP2   1 
ATOM   4808 O  "O5'" . DA  E 4 3   ? 28.114  8.501   -3.716  1.00 63.86  ? 3   DA  E "O5'" 1 
ATOM   4809 C  "C5'" . DA  E 4 3   ? 28.909  8.014   -2.621  1.00 66.14  ? 3   DA  E "C5'" 1 
ATOM   4810 C  "C4'" . DA  E 4 3   ? 28.616  8.755   -1.314  1.00 71.67  ? 3   DA  E "C4'" 1 
ATOM   4811 O  "O4'" . DA  E 4 3   ? 28.858  10.161  -1.486  1.00 68.44  ? 3   DA  E "O4'" 1 
ATOM   4812 C  "C3'" . DA  E 4 3   ? 27.190  8.625   -0.761  1.00 73.60  ? 3   DA  E "C3'" 1 
ATOM   4813 O  "O3'" . DA  E 4 3   ? 27.208  7.830   0.436   1.00 85.44  ? 3   DA  E "O3'" 1 
ATOM   4814 C  "C2'" . DA  E 4 3   ? 26.754  10.069  -0.468  1.00 71.24  ? 3   DA  E "C2'" 1 
ATOM   4815 C  "C1'" . DA  E 4 3   ? 28.037  10.884  -0.618  1.00 64.17  ? 3   DA  E "C1'" 1 
ATOM   4816 N  N9    . DA  E 4 3   ? 27.821  12.199  -1.221  1.00 65.71  ? 3   DA  E N9    1 
ATOM   4817 C  C8    . DA  E 4 3   ? 27.474  12.458  -2.519  1.00 61.04  ? 3   DA  E C8    1 
ATOM   4818 N  N7    . DA  E 4 3   ? 27.352  13.733  -2.794  1.00 56.11  ? 3   DA  E N7    1 
ATOM   4819 C  C5    . DA  E 4 3   ? 27.641  14.361  -1.601  1.00 61.52  ? 3   DA  E C5    1 
ATOM   4820 C  C6    . DA  E 4 3   ? 27.687  15.721  -1.232  1.00 67.48  ? 3   DA  E C6    1 
ATOM   4821 N  N6    . DA  E 4 3   ? 27.422  16.719  -2.086  1.00 63.47  ? 3   DA  E N6    1 
ATOM   4822 N  N1    . DA  E 4 3   ? 28.020  16.017  0.056   1.00 64.96  ? 3   DA  E N1    1 
ATOM   4823 C  C2    . DA  E 4 3   ? 28.278  15.013  0.898   1.00 61.98  ? 3   DA  E C2    1 
ATOM   4824 N  N3    . DA  E 4 3   ? 28.266  13.699  0.665   1.00 64.92  ? 3   DA  E N3    1 
ATOM   4825 C  C4    . DA  E 4 3   ? 27.938  13.435  -0.614  1.00 65.96  ? 3   DA  E C4    1 
ATOM   4826 P  P     . DT  E 4 4   ? 25.841  7.434   1.196   1.00 94.41  ? 4   DT  E P     1 
ATOM   4827 O  OP1   . DT  E 4 4   ? 26.136  6.291   2.098   1.00 84.85  ? 4   DT  E OP1   1 
ATOM   4828 O  OP2   . DT  E 4 4   ? 24.763  7.351   0.179   1.00 84.54  ? 4   DT  E OP2   1 
ATOM   4829 O  "O5'" . DT  E 4 4   ? 25.560  8.682   2.142   1.00 81.17  ? 4   DT  E "O5'" 1 
ATOM   4830 C  "C5'" . DT  E 4 4   ? 26.515  9.040   3.098   1.00 72.29  ? 4   DT  E "C5'" 1 
ATOM   4831 C  "C4'" . DT  E 4 4   ? 26.124  10.337  3.756   1.00 79.95  ? 4   DT  E "C4'" 1 
ATOM   4832 O  "O4'" . DT  E 4 4   ? 26.198  11.418  2.789   1.00 79.94  ? 4   DT  E "O4'" 1 
ATOM   4833 C  "C3'" . DT  E 4 4   ? 24.694  10.366  4.324   1.00 83.53  ? 4   DT  E "C3'" 1 
ATOM   4834 O  "O3'" . DT  E 4 4   ? 24.725  10.856  5.669   1.00 94.76  ? 4   DT  E "O3'" 1 
ATOM   4835 C  "C2'" . DT  E 4 4   ? 23.960  11.328  3.391   1.00 81.08  ? 4   DT  E "C2'" 1 
ATOM   4836 C  "C1'" . DT  E 4 4   ? 25.091  12.262  2.988   1.00 79.98  ? 4   DT  E "C1'" 1 
ATOM   4837 N  N1    . DT  E 4 4   ? 24.830  13.053  1.738   1.00 66.69  ? 4   DT  E N1    1 
ATOM   4838 C  C2    . DT  E 4 4   ? 24.863  14.433  1.795   1.00 69.56  ? 4   DT  E C2    1 
ATOM   4839 O  O2    . DT  E 4 4   ? 25.100  15.065  2.814   1.00 71.15  ? 4   DT  E O2    1 
ATOM   4840 N  N3    . DT  E 4 4   ? 24.612  15.056  0.608   1.00 67.75  ? 4   DT  E N3    1 
ATOM   4841 C  C4    . DT  E 4 4   ? 24.322  14.465  -0.601  1.00 65.15  ? 4   DT  E C4    1 
ATOM   4842 O  O4    . DT  E 4 4   ? 24.099  15.117  -1.617  1.00 65.49  ? 4   DT  E O4    1 
ATOM   4843 C  C5    . DT  E 4 4   ? 24.297  13.030  -0.596  1.00 65.24  ? 4   DT  E C5    1 
ATOM   4844 C  C7    . DT  E 4 4   ? 23.995  12.295  -1.871  1.00 66.21  ? 4   DT  E C7    1 
ATOM   4845 C  C6    . DT  E 4 4   ? 24.545  12.394  0.563   1.00 63.16  ? 4   DT  E C6    1 
ATOM   4846 P  P     . DC  E 4 5   ? 23.488  10.609  6.665   1.00 98.62  ? 5   DC  E P     1 
ATOM   4847 O  OP1   . DC  E 4 5   ? 24.044  10.012  7.908   1.00 82.79  ? 5   DC  E OP1   1 
ATOM   4848 O  OP2   . DC  E 4 5   ? 22.408  9.949   5.885   1.00 85.06  ? 5   DC  E OP2   1 
ATOM   4849 O  "O5'" . DC  E 4 5   ? 23.014  12.088  7.035   1.00 86.93  ? 5   DC  E "O5'" 1 
ATOM   4850 C  "C5'" . DC  E 4 5   ? 23.912  12.957  7.718   1.00 88.42  ? 5   DC  E "C5'" 1 
ATOM   4851 C  "C4'" . DC  E 4 5   ? 23.609  14.405  7.387   1.00 86.84  ? 5   DC  E "C4'" 1 
ATOM   4852 O  "O4'" . DC  E 4 5   ? 23.588  14.573  5.951   1.00 84.07  ? 5   DC  E "O4'" 1 
ATOM   4853 C  "C3'" . DC  E 4 5   ? 22.256  14.895  7.901   1.00 91.92  ? 5   DC  E "C3'" 1 
ATOM   4854 O  "O3'" . DC  E 4 5   ? 22.439  15.865  8.946   1.00 91.93  ? 5   DC  E "O3'" 1 
ATOM   4855 C  "C2'" . DC  E 4 5   ? 21.549  15.494  6.670   1.00 85.67  ? 5   DC  E "C2'" 1 
ATOM   4856 C  "C1'" . DC  E 4 5   ? 22.638  15.547  5.606   1.00 82.58  ? 5   DC  E "C1'" 1 
ATOM   4857 N  N1    . DC  E 4 5   ? 22.130  15.246  4.240   1.00 82.12  ? 5   DC  E N1    1 
ATOM   4858 C  C2    . DC  E 4 5   ? 21.871  16.290  3.353   1.00 79.07  ? 5   DC  E C2    1 
ATOM   4859 O  O2    . DC  E 4 5   ? 22.072  17.456  3.717   1.00 76.20  ? 5   DC  E O2    1 
ATOM   4860 N  N3    . DC  E 4 5   ? 21.399  15.996  2.114   1.00 79.90  ? 5   DC  E N3    1 
ATOM   4861 C  C4    . DC  E 4 5   ? 21.198  14.728  1.756   1.00 75.30  ? 5   DC  E C4    1 
ATOM   4862 N  N4    . DC  E 4 5   ? 20.740  14.492  0.521   1.00 76.83  ? 5   DC  E N4    1 
ATOM   4863 C  C5    . DC  E 4 5   ? 21.457  13.652  2.645   1.00 73.11  ? 5   DC  E C5    1 
ATOM   4864 C  C6    . DC  E 4 5   ? 21.913  13.954  3.868   1.00 80.47  ? 5   DC  E C6    1 
ATOM   4865 P  P     . DC  E 4 6   ? 21.187  16.348  9.841   1.00 102.35 ? 6   DC  E P     1 
ATOM   4866 O  OP1   . DC  E 4 6   ? 21.755  17.027  11.027  1.00 99.10  ? 6   DC  E OP1   1 
ATOM   4867 O  OP2   . DC  E 4 6   ? 20.260  15.205  10.042  1.00 84.76  ? 6   DC  E OP2   1 
ATOM   4868 O  "O5'" . DC  E 4 6   ? 20.475  17.468  8.934   1.00 90.73  ? 6   DC  E "O5'" 1 
ATOM   4869 C  "C5'" . DC  E 4 6   ? 21.112  18.737  8.739   1.00 86.59  ? 6   DC  E "C5'" 1 
ATOM   4870 C  "C4'" . DC  E 4 6   ? 20.386  19.562  7.690   1.00 88.95  ? 6   DC  E "C4'" 1 
ATOM   4871 O  "O4'" . DC  E 4 6   ? 20.371  18.849  6.440   1.00 90.13  ? 6   DC  E "O4'" 1 
ATOM   4872 C  "C3'" . DC  E 4 6   ? 18.918  19.850  7.993   1.00 88.30  ? 6   DC  E "C3'" 1 
ATOM   4873 O  "O3'" . DC  E 4 6   ? 18.781  21.125  8.664   1.00 90.23  ? 6   DC  E "O3'" 1 
ATOM   4874 C  "C2'" . DC  E 4 6   ? 18.238  19.858  6.606   1.00 82.02  ? 6   DC  E "C2'" 1 
ATOM   4875 C  "C1'" . DC  E 4 6   ? 19.325  19.369  5.645   1.00 86.12  ? 6   DC  E "C1'" 1 
ATOM   4876 N  N1    . DC  E 4 6   ? 18.862  18.299  4.655   1.00 83.44  ? 6   DC  E N1    1 
ATOM   4877 C  C2    . DC  E 4 6   ? 18.291  18.679  3.431   1.00 81.68  ? 6   DC  E C2    1 
ATOM   4878 O  O2    . DC  E 4 6   ? 18.151  19.884  3.170   1.00 77.70  ? 6   DC  E O2    1 
ATOM   4879 N  N3    . DC  E 4 6   ? 17.898  17.708  2.562   1.00 83.98  ? 6   DC  E N3    1 
ATOM   4880 C  C4    . DC  E 4 6   ? 18.063  16.419  2.874   1.00 80.32  ? 6   DC  E C4    1 
ATOM   4881 N  N4    . DC  E 4 6   ? 17.663  15.506  1.986   1.00 77.47  ? 6   DC  E N4    1 
ATOM   4882 C  C5    . DC  E 4 6   ? 18.643  16.013  4.106   1.00 78.54  ? 6   DC  E C5    1 
ATOM   4883 C  C6    . DC  E 4 6   ? 19.026  16.974  4.956   1.00 84.11  ? 6   DC  E C6    1 
ATOM   4884 P  P     . DG  E 4 7   ? 17.529  21.409  9.646   1.00 98.22  ? 7   DG  E P     1 
ATOM   4885 O  OP1   . DG  E 4 7   ? 17.895  22.513  10.553  1.00 95.40  ? 7   DG  E OP1   1 
ATOM   4886 O  OP2   . DG  E 4 7   ? 17.082  20.106  10.201  1.00 91.95  ? 7   DG  E OP2   1 
ATOM   4887 O  "O5'" . DG  E 4 7   ? 16.377  21.959  8.676   1.00 91.80  ? 7   DG  E "O5'" 1 
ATOM   4888 C  "C5'" . DG  E 4 7   ? 16.397  23.315  8.244   1.00 87.66  ? 7   DG  E "C5'" 1 
ATOM   4889 C  "C4'" . DG  E 4 7   ? 15.590  23.499  6.963   1.00 92.87  ? 7   DG  E "C4'" 1 
ATOM   4890 O  "O4'" . DG  E 4 7   ? 15.812  22.379  6.054   1.00 92.90  ? 7   DG  E "O4'" 1 
ATOM   4891 C  "C3'" . DG  E 4 7   ? 14.078  23.587  7.148   1.00 96.87  ? 7   DG  E "C3'" 1 
ATOM   4892 O  "O3'" . DG  E 4 7   ? 13.539  24.544  6.236   1.00 100.14 ? 7   DG  E "O3'" 1 
ATOM   4893 C  "C2'" . DG  E 4 7   ? 13.610  22.173  6.801   1.00 89.27  ? 7   DG  E "C2'" 1 
ATOM   4894 C  "C1'" . DG  E 4 7   ? 14.567  21.809  5.679   1.00 87.00  ? 7   DG  E "C1'" 1 
ATOM   4895 N  N9    . DG  E 4 7   ? 14.746  20.365  5.526   1.00 83.51  ? 7   DG  E N9    1 
ATOM   4896 C  C8    . DG  E 4 7   ? 15.023  19.463  6.528   1.00 86.74  ? 7   DG  E C8    1 
ATOM   4897 N  N7    . DG  E 4 7   ? 15.144  18.235  6.109   1.00 83.42  ? 7   DG  E N7    1 
ATOM   4898 C  C5    . DG  E 4 7   ? 14.927  18.322  4.746   1.00 80.00  ? 7   DG  E C5    1 
ATOM   4899 C  C6    . DG  E 4 7   ? 14.927  17.302  3.768   1.00 83.50  ? 7   DG  E C6    1 
ATOM   4900 O  O6    . DG  E 4 7   ? 15.122  16.080  3.936   1.00 83.16  ? 7   DG  E O6    1 
ATOM   4901 N  N1    . DG  E 4 7   ? 14.663  17.813  2.490   1.00 74.35  ? 7   DG  E N1    1 
ATOM   4902 C  C2    . DG  E 4 7   ? 14.427  19.148  2.210   1.00 77.34  ? 7   DG  E C2    1 
ATOM   4903 N  N2    . DG  E 4 7   ? 14.196  19.454  0.925   1.00 76.62  ? 7   DG  E N2    1 
ATOM   4904 N  N3    . DG  E 4 7   ? 14.422  20.114  3.126   1.00 74.11  ? 7   DG  E N3    1 
ATOM   4905 C  C4    . DG  E 4 7   ? 14.679  19.630  4.366   1.00 78.47  ? 7   DG  E C4    1 
ATOM   4906 P  P     . DT  E 4 8   ? 12.616  25.750  6.764   1.00 104.92 ? 8   DT  E P     1 
ATOM   4907 O  OP1   . DT  E 4 8   ? 12.534  26.772  5.693   1.00 98.97  ? 8   DT  E OP1   1 
ATOM   4908 O  OP2   . DT  E 4 8   ? 13.156  26.125  8.096   1.00 103.84 ? 8   DT  E OP2   1 
ATOM   4909 O  "O5'" . DT  E 4 8   ? 11.161  25.089  6.941   1.00 99.31  ? 8   DT  E "O5'" 1 
ATOM   4910 C  "C5'" . DT  E 4 8   ? 10.770  23.951  6.153   1.00 93.35  ? 8   DT  E "C5'" 1 
ATOM   4911 C  "C4'" . DT  E 4 8   ? 10.712  24.286  4.667   1.00 92.84  ? 8   DT  E "C4'" 1 
ATOM   4912 O  "O4'" . DT  E 4 8   ? 11.425  23.269  3.908   1.00 90.85  ? 8   DT  E "O4'" 1 
ATOM   4913 C  "C3'" . DT  E 4 8   ? 9.311   24.315  4.080   1.00 91.11  ? 8   DT  E "C3'" 1 
ATOM   4914 O  "O3'" . DT  E 4 8   ? 9.248   25.249  3.011   1.00 101.17 ? 8   DT  E "O3'" 1 
ATOM   4915 C  "C2'" . DT  E 4 8   ? 9.114   22.877  3.598   1.00 84.35  ? 8   DT  E "C2'" 1 
ATOM   4916 C  "C1'" . DT  E 4 8   ? 10.513  22.488  3.144   1.00 85.50  ? 8   DT  E "C1'" 1 
ATOM   4917 N  N1    . DT  E 4 8   ? 10.835  21.004  3.340   1.00 81.15  ? 8   DT  E N1    1 
ATOM   4918 C  C2    . DT  E 4 8   ? 10.859  20.159  2.245   1.00 76.26  ? 8   DT  E C2    1 
ATOM   4919 O  O2    . DT  E 4 8   ? 10.633  20.527  1.106   1.00 76.93  ? 8   DT  E O2    1 
ATOM   4920 N  N3    . DT  E 4 8   ? 11.161  18.855  2.531   1.00 73.28  ? 8   DT  E N3    1 
ATOM   4921 C  C4    . DT  E 4 8   ? 11.439  18.309  3.772   1.00 76.55  ? 8   DT  E C4    1 
ATOM   4922 O  O4    . DT  E 4 8   ? 11.701  17.119  3.924   1.00 73.11  ? 8   DT  E O4    1 
ATOM   4923 C  C5    . DT  E 4 8   ? 11.402  19.238  4.878   1.00 80.25  ? 8   DT  E C5    1 
ATOM   4924 C  C7    . DT  E 4 8   ? 11.689  18.758  6.275   1.00 73.92  ? 8   DT  E C7    1 
ATOM   4925 C  C6    . DT  E 4 8   ? 11.105  20.526  4.613   1.00 80.58  ? 8   DT  E C6    1 
ATOM   4926 P  P     . DC  E 4 9   ? 7.819   25.735  2.443   1.00 109.10 ? 9   DC  E P     1 
ATOM   4927 O  OP1   . DC  E 4 9   ? 7.965   26.971  1.634   1.00 105.92 ? 9   DC  E OP1   1 
ATOM   4928 O  OP2   . DC  E 4 9   ? 6.814   25.651  3.528   1.00 89.05  ? 9   DC  E OP2   1 
ATOM   4929 O  "O5'" . DC  E 4 9   ? 7.462   24.603  1.420   1.00 94.42  ? 9   DC  E "O5'" 1 
ATOM   4930 C  "C5'" . DC  E 4 9   ? 6.453   23.756  1.709   1.00 88.84  ? 9   DC  E "C5'" 1 
ATOM   4931 C  "C4'" . DC  E 4 9   ? 6.190   22.930  0.509   1.00 87.68  ? 9   DC  E "C4'" 1 
ATOM   4932 O  "O4'" . DC  E 4 9   ? 7.053   21.773  0.533   1.00 84.21  ? 9   DC  E "O4'" 1 
ATOM   4933 C  "C3'" . DC  E 4 9   ? 4.772   22.443  0.401   1.00 84.38  ? 9   DC  E "C3'" 1 
ATOM   4934 O  "O3'" . DC  E 4 9   ? 4.378   22.538  -0.927  1.00 95.08  ? 9   DC  E "O3'" 1 
ATOM   4935 C  "C2'" . DC  E 4 9   ? 4.837   20.998  0.897   1.00 84.51  ? 9   DC  E "C2'" 1 
ATOM   4936 C  "C1'" . DC  E 4 9   ? 6.300   20.596  0.703   1.00 83.61  ? 9   DC  E "C1'" 1 
ATOM   4937 N  N1    . DC  E 4 9   ? 6.864   19.847  1.869   1.00 80.35  ? 9   DC  E N1    1 
ATOM   4938 C  C2    . DC  E 4 9   ? 7.369   18.550  1.681   1.00 77.44  ? 9   DC  E C2    1 
ATOM   4939 O  O2    . DC  E 4 9   ? 7.351   18.045  0.541   1.00 69.75  ? 9   DC  E O2    1 
ATOM   4940 N  N3    . DC  E 4 9   ? 7.879   17.885  2.759   1.00 80.05  ? 9   DC  E N3    1 
ATOM   4941 C  C4    . DC  E 4 9   ? 7.892   18.465  3.965   1.00 77.93  ? 9   DC  E C4    1 
ATOM   4942 N  N4    . DC  E 4 9   ? 8.400   17.764  4.990   1.00 71.52  ? 9   DC  E N4    1 
ATOM   4943 C  C5    . DC  E 4 9   ? 7.376   19.784  4.172   1.00 78.51  ? 9   DC  E C5    1 
ATOM   4944 C  C6    . DC  E 4 9   ? 6.874   20.428  3.110   1.00 79.93  ? 9   DC  E C6    1 
ATOM   4945 P  P     . DG  E 4 10  ? 2.858   22.277  -1.363  1.00 99.22  ? 10  DG  E P     1 
ATOM   4946 O  OP1   . DG  E 4 10  ? 2.401   23.496  -2.081  1.00 91.86  ? 10  DG  E OP1   1 
ATOM   4947 O  OP2   . DG  E 4 10  ? 2.076   21.756  -0.209  1.00 84.16  ? 10  DG  E OP2   1 
ATOM   4948 O  "O5'" . DG  E 4 10  ? 3.028   21.102  -2.417  1.00 80.92  ? 10  DG  E "O5'" 1 
ATOM   4949 C  "C5'" . DG  E 4 10  ? 1.915   20.426  -2.851  1.00 94.63  ? 10  DG  E "C5'" 1 
ATOM   4950 C  "C4'" . DG  E 4 10  ? 1.889   19.028  -2.284  1.00 88.90  ? 10  DG  E "C4'" 1 
ATOM   4951 O  "O4'" . DG  E 4 10  ? 2.739   18.901  -1.140  1.00 82.28  ? 10  DG  E "O4'" 1 
ATOM   4952 C  "C3'" . DG  E 4 10  ? 0.529   18.580  -1.808  1.00 85.38  ? 10  DG  E "C3'" 1 
ATOM   4953 O  "O3'" . DG  E 4 10  ? -0.049  17.863  -2.844  1.00 90.17  ? 10  DG  E "O3'" 1 
ATOM   4954 C  "C2'" . DG  E 4 10  ? 0.821   17.695  -0.565  1.00 76.89  ? 10  DG  E "C2'" 1 
ATOM   4955 C  "C1'" . DG  E 4 10  ? 2.346   17.715  -0.494  1.00 79.69  ? 10  DG  E "C1'" 1 
ATOM   4956 N  N9    . DG  E 4 10  ? 2.942   17.671  0.856   1.00 72.80  ? 10  DG  E N9    1 
ATOM   4957 C  C8    . DG  E 4 10  ? 2.899   18.633  1.843   1.00 71.97  ? 10  DG  E C8    1 
ATOM   4958 N  N7    . DG  E 4 10  ? 3.578   18.309  2.918   1.00 72.85  ? 10  DG  E N7    1 
ATOM   4959 C  C5    . DG  E 4 10  ? 4.101   17.049  2.620   1.00 74.54  ? 10  DG  E C5    1 
ATOM   4960 C  C6    . DG  E 4 10  ? 4.929   16.168  3.394   1.00 75.73  ? 10  DG  E C6    1 
ATOM   4961 O  O6    . DG  E 4 10  ? 5.377   16.321  4.543   1.00 73.14  ? 10  DG  E O6    1 
ATOM   4962 N  N1    . DG  E 4 10  ? 5.225   14.995  2.696   1.00 75.25  ? 10  DG  E N1    1 
ATOM   4963 C  C2    . DG  E 4 10  ? 4.788   14.698  1.421   1.00 75.01  ? 10  DG  E C2    1 
ATOM   4964 N  N2    . DG  E 4 10  ? 5.175   13.511  0.915   1.00 74.01  ? 10  DG  E N2    1 
ATOM   4965 N  N3    . DG  E 4 10  ? 4.019   15.506  0.693   1.00 75.06  ? 10  DG  E N3    1 
ATOM   4966 C  C4    . DG  E 4 10  ? 3.719   16.656  1.353   1.00 72.27  ? 10  DG  E C4    1 
ATOM   4967 P  P     . DA  E 4 11  ? -1.597  17.509  -2.790  1.00 89.89  ? 11  DA  E P     1 
ATOM   4968 O  OP1   . DA  E 4 11  ? -2.077  17.549  -4.196  1.00 88.56  ? 11  DA  E OP1   1 
ATOM   4969 O  OP2   . DA  E 4 11  ? -2.166  18.359  -1.699  1.00 79.58  ? 11  DA  E OP2   1 
ATOM   4970 O  "O5'" . DA  E 4 11  ? -1.591  15.989  -2.307  1.00 79.89  ? 11  DA  E "O5'" 1 
ATOM   4971 C  "C5'" . DA  E 4 11  ? -0.524  15.135  -2.696  1.00 78.46  ? 11  DA  E "C5'" 1 
ATOM   4972 C  "C4'" . DA  E 4 11  ? -0.570  13.843  -1.910  1.00 82.44  ? 11  DA  E "C4'" 1 
ATOM   4973 O  "O4'" . DA  E 4 11  ? 0.255   13.961  -0.716  1.00 76.30  ? 11  DA  E "O4'" 1 
ATOM   4974 C  "C3'" . DA  E 4 11  ? -1.960  13.446  -1.418  1.00 82.44  ? 11  DA  E "C3'" 1 
ATOM   4975 O  "O3'" . DA  E 4 11  ? -2.082  12.047  -1.493  1.00 82.77  ? 11  DA  E "O3'" 1 
ATOM   4976 C  "C2'" . DA  E 4 11  ? -1.953  13.932  0.036   1.00 79.06  ? 11  DA  E "C2'" 1 
ATOM   4977 C  "C1'" . DA  E 4 11  ? -0.515  13.623  0.417   1.00 74.03  ? 11  DA  E "C1'" 1 
ATOM   4978 N  N9    . DA  E 4 11  ? -0.001  14.381  1.551   1.00 73.92  ? 11  DA  E N9    1 
ATOM   4979 C  C8    . DA  E 4 11  ? -0.356  15.646  1.944   1.00 71.83  ? 11  DA  E C8    1 
ATOM   4980 N  N7    . DA  E 4 11  ? 0.298   16.075  2.999   1.00 68.93  ? 11  DA  E N7    1 
ATOM   4981 C  C5    . DA  E 4 11  ? 1.157   15.018  3.310   1.00 73.75  ? 11  DA  E C5    1 
ATOM   4982 C  C6    . DA  E 4 11  ? 2.135   14.825  4.338   1.00 69.12  ? 11  DA  E C6    1 
ATOM   4983 N  N6    . DA  E 4 11  ? 2.423   15.735  5.269   1.00 70.65  ? 11  DA  E N6    1 
ATOM   4984 N  N1    . DA  E 4 11  ? 2.805   13.649  4.358   1.00 65.42  ? 11  DA  E N1    1 
ATOM   4985 C  C2    . DA  E 4 11  ? 2.515   12.727  3.421   1.00 72.33  ? 11  DA  E C2    1 
ATOM   4986 N  N3    . DA  E 4 11  ? 1.630   12.790  2.417   1.00 67.16  ? 11  DA  E N3    1 
ATOM   4987 C  C4    . DA  E 4 11  ? 0.980   13.972  2.421   1.00 69.48  ? 11  DA  E C4    1 
ATOM   4988 P  P     . DT  E 4 12  ? -3.512  11.367  -1.729  1.00 84.38  ? 12  DT  E P     1 
ATOM   4989 O  OP1   . DT  E 4 12  ? -3.324  10.495  -2.911  1.00 89.01  ? 12  DT  E OP1   1 
ATOM   4990 O  OP2   . DT  E 4 12  ? -4.588  12.401  -1.621  1.00 73.30  ? 12  DT  E OP2   1 
ATOM   4991 O  "O5'" . DT  E 4 12  ? -3.652  10.359  -0.517  1.00 85.98  ? 12  DT  E "O5'" 1 
ATOM   4992 C  "C5'" . DT  E 4 12  ? -2.659  9.377   -0.310  1.00 82.38  ? 12  DT  E "C5'" 1 
ATOM   4993 C  "C4'" . DT  E 4 12  ? -2.597  9.010   1.156   1.00 82.19  ? 12  DT  E "C4'" 1 
ATOM   4994 O  "O4'" . DT  E 4 12  ? -1.634  9.851   1.824   1.00 79.84  ? 12  DT  E "O4'" 1 
ATOM   4995 C  "C3'" . DT  E 4 12  ? -3.877  9.262   1.939   1.00 78.67  ? 12  DT  E "C3'" 1 
ATOM   4996 O  "O3'" . DT  E 4 12  ? -4.889  8.214   1.701   1.00 82.02  ? 12  DT  E "O3'" 1 
ATOM   4997 C  "C2'" . DT  E 4 12  ? -3.362  9.298   3.378   1.00 72.97  ? 12  DT  E "C2'" 1 
ATOM   4998 C  "C1'" . DT  E 4 12  ? -1.921  9.827   3.207   1.00 71.93  ? 12  DT  E "C1'" 1 
ATOM   4999 N  N1    . DT  E 4 12  ? -1.683  11.190  3.813   1.00 68.79  ? 12  DT  E N1    1 
ATOM   5000 C  C2    . DT  E 4 12  ? -0.575  11.362  4.603   1.00 75.30  ? 12  DT  E C2    1 
ATOM   5001 O  O2    . DT  E 4 12  ? 0.237   10.471  4.806   1.00 75.54  ? 12  DT  E O2    1 
ATOM   5002 N  N3    . DT  E 4 12  ? -0.442  12.619  5.155   1.00 74.13  ? 12  DT  E N3    1 
ATOM   5003 C  C4    . DT  E 4 12  ? -1.293  13.702  4.997   1.00 73.77  ? 12  DT  E C4    1 
ATOM   5004 O  O4    . DT  E 4 12  ? -1.081  14.795  5.537   1.00 74.69  ? 12  DT  E O4    1 
ATOM   5005 C  C5    . DT  E 4 12  ? -2.448  13.457  4.155   1.00 70.98  ? 12  DT  E C5    1 
ATOM   5006 C  C7    . DT  E 4 12  ? -3.449  14.551  3.917   1.00 67.02  ? 12  DT  E C7    1 
ATOM   5007 C  C6    . DT  E 4 12  ? -2.592  12.221  3.615   1.00 71.95  ? 12  DT  E C6    1 
ATOM   5008 P  P     . DC  E 4 13  ? -4.737  6.697   2.252   1.00 92.32  ? 13  DC  E P     1 
ATOM   5009 O  OP1   . DC  E 4 13  ? -3.302  6.316   2.409   1.00 86.85  ? 13  DC  E OP1   1 
ATOM   5010 O  OP2   . DC  E 4 13  ? -5.644  5.885   1.409   1.00 77.63  ? 13  DC  E OP2   1 
ATOM   5011 O  "O5'" . DC  E 4 13  ? -5.351  6.729   3.739   1.00 73.12  ? 13  DC  E "O5'" 1 
ATOM   5012 C  "C5'" . DC  E 4 13  ? -4.692  6.009   4.778   1.00 56.16  ? 13  DC  E "C5'" 1 
ATOM   5013 C  "C4'" . DC  E 4 13  ? -5.442  6.121   6.097   1.00 53.00  ? 13  DC  E "C4'" 1 
ATOM   5014 O  "O4'" . DC  E 4 13  ? -5.304  7.452   6.658   1.00 49.41  ? 13  DC  E "O4'" 1 
ATOM   5015 C  "C3'" . DC  E 4 13  ? -6.930  5.806   6.025   1.00 50.81  ? 13  DC  E "C3'" 1 
ATOM   5016 O  "O3'" . DC  E 4 13  ? -7.227  4.825   6.999   1.00 43.49  ? 13  DC  E "O3'" 1 
ATOM   5017 C  "C2'" . DC  E 4 13  ? -7.623  7.150   6.313   1.00 49.60  ? 13  DC  E "C2'" 1 
ATOM   5018 C  "C1'" . DC  E 4 13  ? -6.561  7.957   7.055   1.00 47.42  ? 13  DC  E "C1'" 1 
ATOM   5019 N  N1    . DC  E 4 13  ? -6.579  9.409   6.719   1.00 51.65  ? 13  DC  E N1    1 
ATOM   5020 C  C2    . DC  E 4 13  ? -6.753  10.358  7.733   1.00 44.38  ? 13  DC  E C2    1 
ATOM   5021 O  O2    . DC  E 4 13  ? -6.924  9.977   8.876   1.00 46.95  ? 13  DC  E O2    1 
ATOM   5022 N  N3    . DC  E 4 13  ? -6.740  11.673  7.425   1.00 48.25  ? 13  DC  E N3    1 
ATOM   5023 C  C4    . DC  E 4 13  ? -6.578  12.056  6.151   1.00 54.96  ? 13  DC  E C4    1 
ATOM   5024 N  N4    . DC  E 4 13  ? -6.560  13.373  5.888   1.00 54.86  ? 13  DC  E N4    1 
ATOM   5025 C  C5    . DC  E 4 13  ? -6.371  11.102  5.101   1.00 52.35  ? 13  DC  E C5    1 
ATOM   5026 C  C6    . DC  E 4 13  ? -6.380  9.803   5.429   1.00 49.73  ? 13  DC  E C6    1 
ATOM   5027 P  P     . DG  E 4 14  ? -8.628  4.054   7.000   1.00 52.24  ? 14  DG  E P     1 
ATOM   5028 O  OP1   . DG  E 4 14  ? -8.377  2.741   7.630   1.00 48.04  ? 14  DG  E OP1   1 
ATOM   5029 O  OP2   . DG  E 4 14  ? -9.248  4.132   5.644   1.00 56.90  ? 14  DG  E OP2   1 
ATOM   5030 O  "O5'" . DG  E 4 14  ? -9.528  4.923   7.970   1.00 44.52  ? 14  DG  E "O5'" 1 
ATOM   5031 C  "C5'" . DG  E 4 14  ? -9.274  4.928   9.359   1.00 41.94  ? 14  DG  E "C5'" 1 
ATOM   5032 C  "C4'" . DG  E 4 14  ? -10.112 5.995   10.025  1.00 42.18  ? 14  DG  E "C4'" 1 
ATOM   5033 O  "O4'" . DG  E 4 14  ? -9.652  7.294   9.607   1.00 39.61  ? 14  DG  E "O4'" 1 
ATOM   5034 C  "C3'" . DG  E 4 14  ? -11.604 5.955   9.672   1.00 39.18  ? 14  DG  E "C3'" 1 
ATOM   5035 O  "O3'" . DG  E 4 14  ? -12.309 5.346   10.756  1.00 33.66  ? 14  DG  E "O3'" 1 
ATOM   5036 C  "C2'" . DG  E 4 14  ? -12.000 7.435   9.451   1.00 35.26  ? 14  DG  E "C2'" 1 
ATOM   5037 C  "C1'" . DG  E 4 14  ? -10.711 8.212   9.758   1.00 40.76  ? 14  DG  E "C1'" 1 
ATOM   5038 N  N9    . DG  E 4 14  ? -10.437 9.359   8.870   1.00 46.10  ? 14  DG  E N9    1 
ATOM   5039 C  C8    . DG  E 4 14  ? -10.082 9.317   7.527   1.00 41.91  ? 14  DG  E C8    1 
ATOM   5040 N  N7    . DG  E 4 14  ? -9.861  10.494  7.005   1.00 35.68  ? 14  DG  E N7    1 
ATOM   5041 C  C5    . DG  E 4 14  ? -10.072 11.373  8.040   1.00 38.52  ? 14  DG  E C5    1 
ATOM   5042 C  C6    . DG  E 4 14  ? -9.981  12.774  8.059   1.00 45.16  ? 14  DG  E C6    1 
ATOM   5043 O  O6    . DG  E 4 14  ? -9.678  13.535  7.129   1.00 50.71  ? 14  DG  E O6    1 
ATOM   5044 N  N1    . DG  E 4 14  ? -10.273 13.296  9.330   1.00 46.57  ? 14  DG  E N1    1 
ATOM   5045 C  C2    . DG  E 4 14  ? -10.606 12.540  10.438  1.00 47.19  ? 14  DG  E C2    1 
ATOM   5046 N  N2    . DG  E 4 14  ? -10.835 13.224  11.577  1.00 44.05  ? 14  DG  E N2    1 
ATOM   5047 N  N3    . DG  E 4 14  ? -10.691 11.214  10.433  1.00 39.97  ? 14  DG  E N3    1 
ATOM   5048 C  C4    . DG  E 4 14  ? -10.412 10.698  9.212   1.00 40.29  ? 14  DG  E C4    1 
ATOM   5049 P  P     . DC  E 4 15  ? -13.919 5.268   10.807  1.00 37.01  ? 15  DC  E P     1 
ATOM   5050 O  OP1   . DC  E 4 15  ? -14.163 4.170   11.778  1.00 34.18  ? 15  DC  E OP1   1 
ATOM   5051 O  OP2   . DC  E 4 15  ? -14.535 5.154   9.443   1.00 40.84  ? 15  DC  E OP2   1 
ATOM   5052 O  "O5'" . DC  E 4 15  ? -14.358 6.662   11.411  1.00 37.49  ? 15  DC  E "O5'" 1 
ATOM   5053 C  "C5'" . DC  E 4 15  ? -13.949 7.013   12.753  1.00 35.03  ? 15  DC  E "C5'" 1 
ATOM   5054 C  "C4'" . DC  E 4 15  ? -14.572 8.321   13.145  1.00 32.59  ? 15  DC  E "C4'" 1 
ATOM   5055 O  "O4'" . DC  E 4 15  ? -14.028 9.350   12.311  1.00 35.19  ? 15  DC  E "O4'" 1 
ATOM   5056 C  "C3'" . DC  E 4 15  ? -16.084 8.389   12.966  1.00 36.49  ? 15  DC  E "C3'" 1 
ATOM   5057 O  "O3'" . DC  E 4 15  ? -16.674 8.745   14.181  1.00 42.18  ? 15  DC  E "O3'" 1 
ATOM   5058 C  "C2'" . DC  E 4 15  ? -16.301 9.470   11.887  1.00 41.24  ? 15  DC  E "C2'" 1 
ATOM   5059 C  "C1'" . DC  E 4 15  ? -15.019 10.273  11.965  1.00 38.42  ? 15  DC  E "C1'" 1 
ATOM   5060 N  N1    . DC  E 4 15  ? -14.562 10.908  10.666  1.00 40.45  ? 15  DC  E N1    1 
ATOM   5061 C  C2    . DC  E 4 15  ? -14.371 12.296  10.597  1.00 42.58  ? 15  DC  E C2    1 
ATOM   5062 O  O2    . DC  E 4 15  ? -14.637 12.990  11.586  1.00 49.89  ? 15  DC  E O2    1 
ATOM   5063 N  N3    . DC  E 4 15  ? -13.918 12.848  9.432   1.00 43.47  ? 15  DC  E N3    1 
ATOM   5064 C  C4    . DC  E 4 15  ? -13.633 12.077  8.391   1.00 35.59  ? 15  DC  E C4    1 
ATOM   5065 N  N4    . DC  E 4 15  ? -13.157 12.663  7.310   1.00 34.82  ? 15  DC  E N4    1 
ATOM   5066 C  C5    . DC  E 4 15  ? -13.800 10.665  8.435   1.00 39.08  ? 15  DC  E C5    1 
ATOM   5067 C  C6    . DC  E 4 15  ? -14.247 10.120  9.593   1.00 39.75  ? 15  DC  E C6    1 
ATOM   5068 P  P     . DA  E 4 16  ? -18.264 8.645   14.330  1.00 46.37  ? 16  DA  E P     1 
ATOM   5069 O  OP1   . DA  E 4 16  ? -18.612 8.297   15.738  1.00 43.70  ? 16  DA  E OP1   1 
ATOM   5070 O  OP2   . DA  E 4 16  ? -18.683 7.735   13.253  1.00 40.94  ? 16  DA  E OP2   1 
ATOM   5071 O  "O5'" . DA  E 4 16  ? -18.786 10.100  13.944  1.00 45.59  ? 16  DA  E "O5'" 1 
ATOM   5072 C  "C5'" . DA  E 4 16  ? -18.482 11.210  14.750  1.00 43.75  ? 16  DA  E "C5'" 1 
ATOM   5073 C  "C4'" . DA  E 4 16  ? -18.843 12.499  14.037  1.00 42.76  ? 16  DA  E "C4'" 1 
ATOM   5074 O  "O4'" . DA  E 4 16  ? -18.032 12.628  12.844  1.00 43.10  ? 16  DA  E "O4'" 1 
ATOM   5075 C  "C3'" . DA  E 4 16  ? -20.302 12.597  13.586  1.00 46.32  ? 16  DA  E "C3'" 1 
ATOM   5076 O  "O3'" . DA  E 4 16  ? -20.926 13.735  14.208  1.00 50.21  ? 16  DA  E "O3'" 1 
ATOM   5077 C  "C2'" . DA  E 4 16  ? -20.228 12.714  12.044  1.00 38.47  ? 16  DA  E "C2'" 1 
ATOM   5078 C  "C1'" . DA  E 4 16  ? -18.806 13.231  11.829  1.00 49.22  ? 16  DA  E "C1'" 1 
ATOM   5079 N  N9    . DA  E 4 16  ? -18.225 12.914  10.501  1.00 42.74  ? 16  DA  E N9    1 
ATOM   5080 C  C8    . DA  E 4 16  ? -18.255 11.708  9.849   1.00 42.13  ? 16  DA  E C8    1 
ATOM   5081 N  N7    . DA  E 4 16  ? -17.646 11.717  8.675   1.00 40.41  ? 16  DA  E N7    1 
ATOM   5082 C  C5    . DA  E 4 16  ? -17.201 13.019  8.535   1.00 40.02  ? 16  DA  E C5    1 
ATOM   5083 C  C6    . DA  E 4 16  ? -16.489 13.677  7.501   1.00 43.31  ? 16  DA  E C6    1 
ATOM   5084 N  N6    . DA  E 4 16  ? -16.103 13.071  6.367   1.00 36.18  ? 16  DA  E N6    1 
ATOM   5085 N  N1    . DA  E 4 16  ? -16.185 14.992  7.684   1.00 44.91  ? 16  DA  E N1    1 
ATOM   5086 C  C2    . DA  E 4 16  ? -16.582 15.596  8.814   1.00 43.25  ? 16  DA  E C2    1 
ATOM   5087 N  N3    . DA  E 4 16  ? -17.259 15.083  9.850   1.00 40.33  ? 16  DA  E N3    1 
ATOM   5088 C  C4    . DA  E 4 16  ? -17.539 13.778  9.649   1.00 41.00  ? 16  DA  E C4    1 
ATOM   5089 P  P     . DT  E 4 17  ? -22.424 14.202  13.802  1.00 51.22  ? 17  DT  E P     1 
ATOM   5090 O  OP1   . DT  E 4 17  ? -22.959 15.048  14.886  1.00 57.47  ? 17  DT  E OP1   1 
ATOM   5091 O  OP2   . DT  E 4 17  ? -23.240 13.053  13.365  1.00 55.97  ? 17  DT  E OP2   1 
ATOM   5092 O  "O5'" . DT  E 4 17  ? -22.163 15.176  12.565  1.00 43.43  ? 17  DT  E "O5'" 1 
ATOM   5093 C  "C5'" . DT  E 4 17  ? -21.434 16.381  12.812  1.00 45.71  ? 17  DT  E "C5'" 1 
ATOM   5094 C  "C4'" . DT  E 4 17  ? -21.238 17.162  11.544  1.00 44.80  ? 17  DT  E "C4'" 1 
ATOM   5095 O  "O4'" . DT  E 4 17  ? -20.469 16.381  10.615  1.00 43.84  ? 17  DT  E "O4'" 1 
ATOM   5096 C  "C3'" . DT  E 4 17  ? -22.544 17.515  10.825  1.00 50.84  ? 17  DT  E "C3'" 1 
ATOM   5097 O  "O3'" . DT  E 4 17  ? -22.758 18.919  10.889  1.00 45.95  ? 17  DT  E "O3'" 1 
ATOM   5098 C  "C2'" . DT  E 4 17  ? -22.342 17.021  9.383   1.00 48.69  ? 17  DT  E "C2'" 1 
ATOM   5099 C  "C1'" . DT  E 4 17  ? -20.839 16.750  9.318   1.00 44.65  ? 17  DT  E "C1'" 1 
ATOM   5100 N  N1    . DT  E 4 17  ? -20.520 15.645  8.409   1.00 40.20  ? 17  DT  E N1    1 
ATOM   5101 C  C2    . DT  E 4 17  ? -19.830 15.910  7.265   1.00 41.97  ? 17  DT  E C2    1 
ATOM   5102 O  O2    . DT  E 4 17  ? -19.428 17.021  6.985   1.00 48.28  ? 17  DT  E O2    1 
ATOM   5103 N  N3    . DT  E 4 17  ? -19.612 14.824  6.460   1.00 42.13  ? 17  DT  E N3    1 
ATOM   5104 C  C4    . DT  E 4 17  ? -20.033 13.522  6.683   1.00 41.44  ? 17  DT  E C4    1 
ATOM   5105 O  O4    . DT  E 4 17  ? -19.783 12.606  5.902   1.00 43.93  ? 17  DT  E O4    1 
ATOM   5106 C  C5    . DT  E 4 17  ? -20.780 13.320  7.903   1.00 44.21  ? 17  DT  E C5    1 
ATOM   5107 C  C7    . DT  E 4 17  ? -21.298 11.956  8.265   1.00 41.37  ? 17  DT  E C7    1 
ATOM   5108 C  C6    . DT  E 4 17  ? -20.989 14.383  8.695   1.00 42.03  ? 17  DT  E C6    1 
ATOM   5109 P  P     . DC  E 4 18  ? -24.062 19.567  10.217  1.00 57.24  ? 18  DC  E P     1 
ATOM   5110 O  OP1   . DC  E 4 18  ? -24.228 20.843  10.966  1.00 52.12  ? 18  DC  E OP1   1 
ATOM   5111 O  OP2   . DC  E 4 18  ? -25.149 18.565  10.084  1.00 49.67  ? 18  DC  E OP2   1 
ATOM   5112 O  "O5'" . DC  E 4 18  ? -23.596 19.869  8.730   1.00 44.32  ? 18  DC  E "O5'" 1 
ATOM   5113 C  "C5'" . DC  E 4 18  ? -22.430 20.660  8.529   1.00 49.63  ? 18  DC  E "C5'" 1 
ATOM   5114 C  "C4'" . DC  E 4 18  ? -22.154 20.842  7.053   1.00 52.69  ? 18  DC  E "C4'" 1 
ATOM   5115 O  "O4'" . DC  E 4 18  ? -21.719 19.584  6.467   1.00 46.78  ? 18  DC  E "O4'" 1 
ATOM   5116 C  "C3'" . DC  E 4 18  ? -23.360 21.325  6.226   1.00 51.98  ? 18  DC  E "C3'" 1 
ATOM   5117 O  "O3'" . DC  E 4 18  ? -22.925 22.406  5.453   1.00 55.70  ? 18  DC  E "O3'" 1 
ATOM   5118 C  "C2'" . DC  E 4 18  ? -23.733 20.106  5.372   1.00 46.10  ? 18  DC  E "C2'" 1 
ATOM   5119 C  "C1'" . DC  E 4 18  ? -22.384 19.377  5.256   1.00 48.25  ? 18  DC  E "C1'" 1 
ATOM   5120 N  N1    . DC  E 4 18  ? -22.488 17.908  5.049   1.00 44.76  ? 18  DC  E N1    1 
ATOM   5121 C  C2    . DC  E 4 18  ? -21.834 17.336  3.962   1.00 42.25  ? 18  DC  E C2    1 
ATOM   5122 O  O2    . DC  E 4 18  ? -21.204 18.076  3.192   1.00 46.87  ? 18  DC  E O2    1 
ATOM   5123 N  N3    . DC  E 4 18  ? -21.897 15.987  3.784   1.00 38.32  ? 18  DC  E N3    1 
ATOM   5124 C  C4    . DC  E 4 18  ? -22.595 15.227  4.632   1.00 40.87  ? 18  DC  E C4    1 
ATOM   5125 N  N4    . DC  E 4 18  ? -22.638 13.910  4.395   1.00 36.11  ? 18  DC  E N4    1 
ATOM   5126 C  C5    . DC  E 4 18  ? -23.264 15.789  5.771   1.00 42.91  ? 18  DC  E C5    1 
ATOM   5127 C  C6    . DC  E 4 18  ? -23.184 17.127  5.938   1.00 46.17  ? 18  DC  E C6    1 
ATOM   5128 P  P     . DA  E 4 19  ? -23.907 23.194  4.474   1.00 51.57  ? 19  DA  E P     1 
ATOM   5129 O  OP1   . DA  E 4 19  ? -23.370 24.576  4.489   1.00 52.94  ? 19  DA  E OP1   1 
ATOM   5130 O  OP2   . DA  E 4 19  ? -25.325 22.907  4.838   1.00 52.24  ? 19  DA  E OP2   1 
ATOM   5131 O  "O5'" . DA  E 4 19  ? -23.535 22.574  3.058   1.00 45.09  ? 19  DA  E "O5'" 1 
ATOM   5132 C  "C5'" . DA  E 4 19  ? -22.187 22.624  2.632   1.00 42.15  ? 19  DA  E "C5'" 1 
ATOM   5133 C  "C4'" . DA  E 4 19  ? -22.067 22.573  1.130   1.00 45.21  ? 19  DA  E "C4'" 1 
ATOM   5134 O  "O4'" . DA  E 4 19  ? -22.018 21.205  0.673   1.00 47.58  ? 19  DA  E "O4'" 1 
ATOM   5135 C  "C3'" . DA  E 4 19  ? -23.198 23.210  0.354   1.00 48.37  ? 19  DA  E "C3'" 1 
ATOM   5136 O  "O3'" . DA  E 4 19  ? -22.663 23.668  -0.874  1.00 44.15  ? 19  DA  E "O3'" 1 
ATOM   5137 C  "C2'" . DA  E 4 19  ? -24.173 22.043  0.169   1.00 44.35  ? 19  DA  E "C2'" 1 
ATOM   5138 C  "C1'" . DA  E 4 19  ? -23.220 20.859  0.013   1.00 42.89  ? 19  DA  E "C1'" 1 
ATOM   5139 N  N9    . DA  E 4 19  ? -23.685 19.593  0.595   1.00 42.19  ? 19  DA  E N9    1 
ATOM   5140 C  C8    . DA  E 4 19  ? -24.266 19.396  1.822   1.00 39.17  ? 19  DA  E C8    1 
ATOM   5141 N  N7    . DA  E 4 19  ? -24.532 18.126  2.083   1.00 39.43  ? 19  DA  E N7    1 
ATOM   5142 C  C5    . DA  E 4 19  ? -24.074 17.445  0.967   1.00 35.61  ? 19  DA  E C5    1 
ATOM   5143 C  C6    . DA  E 4 19  ? -24.073 16.072  0.615   1.00 41.64  ? 19  DA  E C6    1 
ATOM   5144 N  N6    . DA  E 4 19  ? -24.547 15.104  1.401   1.00 39.41  ? 19  DA  E N6    1 
ATOM   5145 N  N1    . DA  E 4 19  ? -23.558 15.730  -0.592  1.00 41.39  ? 19  DA  E N1    1 
ATOM   5146 C  C2    . DA  E 4 19  ? -23.063 16.697  -1.381  1.00 40.34  ? 19  DA  E C2    1 
ATOM   5147 N  N3    . DA  E 4 19  ? -23.013 18.018  -1.158  1.00 41.12  ? 19  DA  E N3    1 
ATOM   5148 C  C4    . DA  E 4 19  ? -23.545 18.328  0.042   1.00 38.54  ? 19  DA  E C4    1 
ATOM   5149 P  P     . DG  E 4 20  ? -23.559 24.492  -1.913  1.00 52.97  ? 20  DG  E P     1 
ATOM   5150 O  OP1   . DG  E 4 20  ? -22.619 25.263  -2.760  1.00 54.94  ? 20  DG  E OP1   1 
ATOM   5151 O  OP2   . DG  E 4 20  ? -24.656 25.214  -1.238  1.00 46.81  ? 20  DG  E OP2   1 
ATOM   5152 O  "O5'" . DG  E 4 20  ? -24.132 23.323  -2.798  1.00 48.01  ? 20  DG  E "O5'" 1 
ATOM   5153 C  "C5'" . DG  E 4 20  ? -23.235 22.414  -3.392  1.00 43.09  ? 20  DG  E "C5'" 1 
ATOM   5154 C  "C4'" . DG  E 4 20  ? -24.003 21.383  -4.179  1.00 52.12  ? 20  DG  E "C4'" 1 
ATOM   5155 O  "O4'" . DG  E 4 20  ? -24.342 20.283  -3.320  1.00 51.39  ? 20  DG  E "O4'" 1 
ATOM   5156 C  "C3'" . DG  E 4 20  ? -25.341 21.884  -4.773  1.00 49.92  ? 20  DG  E "C3'" 1 
ATOM   5157 O  "O3'" . DG  E 4 20  ? -25.223 21.915  -6.178  1.00 54.72  ? 20  DG  E "O3'" 1 
ATOM   5158 C  "C2'" . DG  E 4 20  ? -26.397 20.857  -4.289  1.00 41.64  ? 20  DG  E "C2'" 1 
ATOM   5159 C  "C1'" . DG  E 4 20  ? -25.527 19.693  -3.808  1.00 48.24  ? 20  DG  E "C1'" 1 
ATOM   5160 N  N9    . DG  E 4 20  ? -26.094 18.906  -2.715  1.00 42.39  ? 20  DG  E N9    1 
ATOM   5161 C  C8    . DG  E 4 20  ? -26.679 19.374  -1.559  1.00 38.39  ? 20  DG  E C8    1 
ATOM   5162 N  N7    . DG  E 4 20  ? -27.057 18.420  -0.753  1.00 43.47  ? 20  DG  E N7    1 
ATOM   5163 C  C5    . DG  E 4 20  ? -26.683 17.249  -1.416  1.00 40.67  ? 20  DG  E C5    1 
ATOM   5164 C  C6    . DG  E 4 20  ? -26.824 15.890  -1.026  1.00 44.44  ? 20  DG  E C6    1 
ATOM   5165 O  O6    . DG  E 4 20  ? -27.325 15.432  0.023   1.00 47.90  ? 20  DG  E O6    1 
ATOM   5166 N  N1    . DG  E 4 20  ? -26.290 15.017  -1.989  1.00 43.52  ? 20  DG  E N1    1 
ATOM   5167 C  C2    . DG  E 4 20  ? -25.696 15.414  -3.172  1.00 42.60  ? 20  DG  E C2    1 
ATOM   5168 N  N2    . DG  E 4 20  ? -25.234 14.433  -3.973  1.00 39.51  ? 20  DG  E N2    1 
ATOM   5169 N  N3    . DG  E 4 20  ? -25.562 16.686  -3.538  1.00 41.52  ? 20  DG  E N3    1 
ATOM   5170 C  C4    . DG  E 4 20  ? -26.074 17.539  -2.612  1.00 37.96  ? 20  DG  E C4    1 
ATOM   5171 P  P     . DC  E 4 21  ? -26.474 22.311  -7.110  1.00 56.36  ? 21  DC  E P     1 
ATOM   5172 O  OP1   . DC  E 4 21  ? -25.811 22.531  -8.411  1.00 45.58  ? 21  DC  E OP1   1 
ATOM   5173 O  OP2   . DC  E 4 21  ? -27.354 23.308  -6.416  1.00 45.43  ? 21  DC  E OP2   1 
ATOM   5174 O  "O5'" . DC  E 4 21  ? -27.299 20.961  -7.227  1.00 43.59  ? 21  DC  E "O5'" 1 
ATOM   5175 C  "C5'" . DC  E 4 21  ? -26.713 19.839  -7.864  1.00 46.68  ? 21  DC  E "C5'" 1 
ATOM   5176 C  "C4'" . DC  E 4 21  ? -27.652 18.662  -7.782  1.00 43.73  ? 21  DC  E "C4'" 1 
ATOM   5177 O  "O4'" . DC  E 4 21  ? -27.722 18.188  -6.410  1.00 44.99  ? 21  DC  E "O4'" 1 
ATOM   5178 C  "C3'" . DC  E 4 21  ? -29.108 18.985  -8.188  1.00 45.07  ? 21  DC  E "C3'" 1 
ATOM   5179 O  "O3'" . DC  E 4 21  ? -29.460 18.247  -9.344  1.00 48.49  ? 21  DC  E "O3'" 1 
ATOM   5180 C  "C2'" . DC  E 4 21  ? -29.948 18.557  -6.972  1.00 41.90  ? 21  DC  E "C2'" 1 
ATOM   5181 C  "C1'" . DC  E 4 21  ? -28.993 17.620  -6.237  1.00 42.08  ? 21  DC  E "C1'" 1 
ATOM   5182 N  N1    . DC  E 4 21  ? -29.304 17.471  -4.794  1.00 42.08  ? 21  DC  E N1    1 
ATOM   5183 C  C2    . DC  E 4 21  ? -29.148 16.223  -4.186  1.00 43.93  ? 21  DC  E C2    1 
ATOM   5184 O  O2    . DC  E 4 21  ? -28.692 15.286  -4.845  1.00 46.35  ? 21  DC  E O2    1 
ATOM   5185 N  N3    . DC  E 4 21  ? -29.480 16.080  -2.884  1.00 45.31  ? 21  DC  E N3    1 
ATOM   5186 C  C4    . DC  E 4 21  ? -29.953 17.130  -2.204  1.00 49.59  ? 21  DC  E C4    1 
ATOM   5187 N  N4    . DC  E 4 21  ? -30.268 16.953  -0.918  1.00 44.18  ? 21  DC  E N4    1 
ATOM   5188 C  C5    . DC  E 4 21  ? -30.132 18.409  -2.822  1.00 43.17  ? 21  DC  E C5    1 
ATOM   5189 C  C6    . DC  E 4 21  ? -29.806 18.523  -4.107  1.00 40.92  ? 21  DC  E C6    1 
HETATM 5190 CL CL    . CL  F 5 .   ? 29.082  3.305   59.132  1.00 72.03  ? 401 CL  B CL    1 
HETATM 5191 NA NA    . NA  G 6 .   ? -0.084  29.886  75.652  1.00 63.22  ? 402 NA  B NA    1 
HETATM 5192 CA CA    . CA  H 7 .   ? -27.745 19.029  -11.369 1.00 66.55  ? 101 CA  E CA    1 
HETATM 5193 NA NA    . NA  I 6 .   ? -18.878 20.142  8.106   1.00 57.81  ? 102 NA  E NA    1 
HETATM 5194 O  O     . HOH J 8 .   ? 15.212  17.011  23.154  1.00 56.34  ? 401 HOH A O     1 
HETATM 5195 O  O     . HOH J 8 .   ? -7.637  22.154  19.654  1.00 43.41  ? 402 HOH A O     1 
HETATM 5196 O  O     . HOH J 8 .   ? 1.690   0.744   22.968  1.00 32.47  ? 403 HOH A O     1 
HETATM 5197 O  O     . HOH J 8 .   ? -25.720 7.554   29.736  1.00 57.59  ? 404 HOH A O     1 
HETATM 5198 O  O     . HOH J 8 .   ? -4.859  13.378  20.661  1.00 40.34  ? 405 HOH A O     1 
HETATM 5199 O  O     . HOH J 8 .   ? -18.242 22.465  27.730  1.00 52.76  ? 406 HOH A O     1 
HETATM 5200 O  O     . HOH J 8 .   ? -16.816 3.125   40.934  1.00 42.27  ? 407 HOH A O     1 
HETATM 5201 O  O     . HOH J 8 .   ? -25.247 16.758  24.323  1.00 51.78  ? 408 HOH A O     1 
HETATM 5202 O  O     . HOH J 8 .   ? -1.018  -9.481  33.028  1.00 49.61  ? 409 HOH A O     1 
HETATM 5203 O  O     . HOH J 8 .   ? -23.497 14.262  32.775  1.00 52.28  ? 410 HOH A O     1 
HETATM 5204 O  O     . HOH J 8 .   ? -0.797  -4.380  28.899  1.00 36.66  ? 411 HOH A O     1 
HETATM 5205 O  O     . HOH J 8 .   ? -11.320 4.394   49.889  1.00 46.02  ? 412 HOH A O     1 
HETATM 5206 O  O     . HOH J 8 .   ? 11.081  6.324   12.040  1.00 50.51  ? 413 HOH A O     1 
HETATM 5207 O  O     . HOH J 8 .   ? -11.785 24.904  25.367  1.00 47.91  ? 414 HOH A O     1 
HETATM 5208 O  O     . HOH J 8 .   ? 10.463  5.859   22.148  1.00 37.66  ? 415 HOH A O     1 
HETATM 5209 O  O     . HOH J 8 .   ? -1.926  3.239   11.781  1.00 38.17  ? 416 HOH A O     1 
HETATM 5210 O  O     . HOH J 8 .   ? -18.151 25.931  33.615  1.00 57.36  ? 417 HOH A O     1 
HETATM 5211 O  O     . HOH J 8 .   ? -7.308  1.422   19.189  1.00 29.35  ? 418 HOH A O     1 
HETATM 5212 O  O     . HOH J 8 .   ? 11.080  -1.056  24.970  1.00 39.41  ? 419 HOH A O     1 
HETATM 5213 O  O     . HOH J 8 .   ? -4.907  31.391  30.907  1.00 53.26  ? 420 HOH A O     1 
HETATM 5214 O  O     . HOH J 8 .   ? 2.956   -1.255  31.926  1.00 34.69  ? 421 HOH A O     1 
HETATM 5215 O  O     . HOH J 8 .   ? -10.043 2.378   14.256  1.00 38.65  ? 422 HOH A O     1 
HETATM 5216 O  O     . HOH J 8 .   ? -3.353  -4.941  24.667  1.00 40.09  ? 423 HOH A O     1 
HETATM 5217 O  O     . HOH J 8 .   ? 14.016  14.166  26.119  1.00 41.38  ? 424 HOH A O     1 
HETATM 5218 O  O     . HOH J 8 .   ? 5.191   -5.389  45.705  1.00 50.99  ? 425 HOH A O     1 
HETATM 5219 O  O     . HOH J 8 .   ? 8.932   19.398  13.081  1.00 48.29  ? 426 HOH A O     1 
HETATM 5220 O  O     . HOH J 8 .   ? -18.570 -2.028  21.190  1.00 45.58  ? 427 HOH A O     1 
HETATM 5221 O  O     . HOH J 8 .   ? 1.500   20.828  27.378  1.00 42.36  ? 428 HOH A O     1 
HETATM 5222 O  O     . HOH J 8 .   ? 8.244   10.683  30.186  1.00 38.48  ? 429 HOH A O     1 
HETATM 5223 O  O     . HOH J 8 .   ? 8.039   5.554   25.247  1.00 35.72  ? 430 HOH A O     1 
HETATM 5224 O  O     . HOH J 8 .   ? -12.903 5.336   16.418  1.00 41.22  ? 431 HOH A O     1 
HETATM 5225 O  O     . HOH J 8 .   ? -27.836 5.571   25.715  1.00 52.76  ? 432 HOH A O     1 
HETATM 5226 O  O     . HOH J 8 .   ? -3.549  3.891   14.185  1.00 37.70  ? 433 HOH A O     1 
HETATM 5227 O  O     . HOH J 8 .   ? -2.572  3.705   6.590   1.00 49.24  ? 434 HOH A O     1 
HETATM 5228 O  O     . HOH J 8 .   ? -6.632  8.275   27.154  1.00 35.12  ? 435 HOH A O     1 
HETATM 5229 O  O     . HOH J 8 .   ? 7.122   11.722  36.758  1.00 33.56  ? 436 HOH A O     1 
HETATM 5230 O  O     . HOH J 8 .   ? -9.166  0.313   14.956  1.00 41.40  ? 437 HOH A O     1 
HETATM 5231 O  O     . HOH J 8 .   ? -23.791 15.966  36.719  1.00 50.37  ? 438 HOH A O     1 
HETATM 5232 O  O     . HOH J 8 .   ? -6.129  6.730   24.821  1.00 37.75  ? 439 HOH A O     1 
HETATM 5233 O  O     . HOH J 8 .   ? 1.300   7.876   32.889  1.00 38.36  ? 440 HOH A O     1 
HETATM 5234 O  O     . HOH J 8 .   ? -1.579  14.412  48.679  1.00 40.88  ? 441 HOH A O     1 
HETATM 5235 O  O     . HOH J 8 .   ? 2.880   -9.134  22.470  1.00 64.24  ? 442 HOH A O     1 
HETATM 5236 O  O     . HOH J 8 .   ? -0.710  -1.984  18.348  1.00 34.12  ? 443 HOH A O     1 
HETATM 5237 O  O     . HOH J 8 .   ? -26.255 -1.359  37.130  1.00 51.89  ? 444 HOH A O     1 
HETATM 5238 O  O     . HOH J 8 .   ? 0.264   31.530  30.585  1.00 52.62  ? 445 HOH A O     1 
HETATM 5239 O  O     . HOH J 8 .   ? -6.094  -7.051  43.031  1.00 50.04  ? 446 HOH A O     1 
HETATM 5240 O  O     . HOH J 8 .   ? 3.915   1.088   21.909  1.00 36.83  ? 447 HOH A O     1 
HETATM 5241 O  O     . HOH J 8 .   ? 10.922  19.968  20.983  1.00 41.68  ? 448 HOH A O     1 
HETATM 5242 O  O     . HOH J 8 .   ? -5.175  2.178   14.939  1.00 39.88  ? 449 HOH A O     1 
HETATM 5243 O  O     . HOH J 8 .   ? -15.826 20.590  29.733  1.00 49.37  ? 450 HOH A O     1 
HETATM 5244 O  O     . HOH J 8 .   ? 1.212   6.399   29.647  1.00 35.30  ? 451 HOH A O     1 
HETATM 5245 O  O     . HOH J 8 .   ? -20.130 21.833  36.807  1.00 42.73  ? 452 HOH A O     1 
HETATM 5246 O  O     . HOH J 8 .   ? -27.681 4.391   37.077  1.00 50.44  ? 453 HOH A O     1 
HETATM 5247 O  O     . HOH J 8 .   ? -7.174  -7.296  32.487  1.00 48.26  ? 454 HOH A O     1 
HETATM 5248 O  O     . HOH J 8 .   ? -8.291  10.719  13.905  1.00 37.41  ? 455 HOH A O     1 
HETATM 5249 O  O     . HOH J 8 .   ? -22.207 19.700  28.084  1.00 45.32  ? 456 HOH A O     1 
HETATM 5250 O  O     . HOH J 8 .   ? 12.437  0.989   32.484  1.00 32.08  ? 457 HOH A O     1 
HETATM 5251 O  O     . HOH J 8 .   ? 0.374   7.417   51.184  1.00 34.01  ? 458 HOH A O     1 
HETATM 5252 O  O     . HOH J 8 .   ? -4.928  10.109  12.836  1.00 35.70  ? 459 HOH A O     1 
HETATM 5253 O  O     . HOH J 8 .   ? 13.986  11.276  26.732  1.00 38.35  ? 460 HOH A O     1 
HETATM 5254 O  O     . HOH J 8 .   ? 0.013   -9.651  39.802  1.00 47.15  ? 461 HOH A O     1 
HETATM 5255 O  O     . HOH J 8 .   ? -8.169  -7.097  28.072  1.00 59.55  ? 462 HOH A O     1 
HETATM 5256 O  O     . HOH J 8 .   ? -10.143 22.148  46.733  1.00 54.72  ? 463 HOH A O     1 
HETATM 5257 O  O     . HOH J 8 .   ? -1.718  0.599   11.026  1.00 46.02  ? 464 HOH A O     1 
HETATM 5258 O  O     . HOH J 8 .   ? 2.287   -10.115 42.123  1.00 60.37  ? 465 HOH A O     1 
HETATM 5259 O  O     . HOH J 8 .   ? -21.755 -3.271  17.996  1.00 50.30  ? 466 HOH A O     1 
HETATM 5260 O  O     . HOH J 8 .   ? 14.390  8.867   14.956  1.00 56.01  ? 467 HOH A O     1 
HETATM 5261 O  O     . HOH J 8 .   ? -3.669  15.433  49.971  1.00 48.38  ? 468 HOH A O     1 
HETATM 5262 O  O     . HOH J 8 .   ? -19.112 -3.980  32.690  1.00 53.61  ? 469 HOH A O     1 
HETATM 5263 O  O     . HOH J 8 .   ? 6.284   -3.028  38.071  1.00 44.10  ? 470 HOH A O     1 
HETATM 5264 O  O     . HOH J 8 .   ? 8.589   11.792  34.229  1.00 33.93  ? 471 HOH A O     1 
HETATM 5265 O  O     . HOH J 8 .   ? 0.548   13.874  14.892  1.00 51.94  ? 472 HOH A O     1 
HETATM 5266 O  O     . HOH J 8 .   ? -1.592  -3.893  16.202  1.00 49.58  ? 473 HOH A O     1 
HETATM 5267 O  O     . HOH J 8 .   ? 4.587   27.067  11.211  1.00 51.54  ? 474 HOH A O     1 
HETATM 5268 O  O     . HOH J 8 .   ? -33.330 9.033   19.776  1.00 51.07  ? 475 HOH A O     1 
HETATM 5269 O  O     . HOH J 8 .   ? 11.544  11.118  30.644  1.00 48.22  ? 476 HOH A O     1 
HETATM 5270 O  O     . HOH J 8 .   ? -3.838  -2.412  12.793  1.00 48.39  ? 477 HOH A O     1 
HETATM 5271 O  O     . HOH J 8 .   ? -33.501 9.946   17.242  1.00 53.38  ? 478 HOH A O     1 
HETATM 5272 O  O     . HOH K 8 .   ? 12.539  17.154  71.946  1.00 38.00  ? 501 HOH B O     1 
HETATM 5273 O  O     . HOH K 8 .   ? 15.527  2.992   74.135  1.00 39.89  ? 502 HOH B O     1 
HETATM 5274 O  O     . HOH K 8 .   ? 7.703   26.783  66.124  1.00 40.64  ? 503 HOH B O     1 
HETATM 5275 O  O     . HOH K 8 .   ? 19.172  3.420   45.528  1.00 51.24  ? 504 HOH B O     1 
HETATM 5276 O  O     . HOH K 8 .   ? 11.083  1.952   58.521  1.00 45.32  ? 505 HOH B O     1 
HETATM 5277 O  O     . HOH K 8 .   ? 11.686  26.319  65.052  1.00 32.38  ? 506 HOH B O     1 
HETATM 5278 O  O     . HOH K 8 .   ? 14.314  12.751  40.681  1.00 48.12  ? 507 HOH B O     1 
HETATM 5279 O  O     . HOH K 8 .   ? 23.415  5.107   50.416  1.00 52.43  ? 508 HOH B O     1 
HETATM 5280 O  O     . HOH K 8 .   ? 8.714   22.930  72.842  1.00 36.17  ? 509 HOH B O     1 
HETATM 5281 O  O     . HOH K 8 .   ? 7.558   6.290   55.769  1.00 42.50  ? 510 HOH B O     1 
HETATM 5282 O  O     . HOH K 8 .   ? 19.089  12.744  78.783  1.00 39.96  ? 511 HOH B O     1 
HETATM 5283 O  O     . HOH K 8 .   ? 14.518  12.062  78.207  1.00 38.81  ? 512 HOH B O     1 
HETATM 5284 O  O     . HOH K 8 .   ? 16.036  14.020  64.912  1.00 29.83  ? 513 HOH B O     1 
HETATM 5285 O  O     . HOH K 8 .   ? 26.504  1.607   70.100  1.00 46.49  ? 514 HOH B O     1 
HETATM 5286 O  O     . HOH K 8 .   ? 36.334  19.225  56.758  1.00 42.24  ? 515 HOH B O     1 
HETATM 5287 O  O     . HOH K 8 .   ? 32.665  27.368  60.408  1.00 42.77  ? 516 HOH B O     1 
HETATM 5288 O  O     . HOH K 8 .   ? -0.770  18.705  80.783  1.00 55.84  ? 517 HOH B O     1 
HETATM 5289 O  O     . HOH K 8 .   ? 1.365   17.515  59.781  1.00 40.96  ? 518 HOH B O     1 
HETATM 5290 O  O     . HOH K 8 .   ? 0.957   11.226  63.265  1.00 35.93  ? 519 HOH B O     1 
HETATM 5291 O  O     . HOH K 8 .   ? 4.106   6.045   66.261  1.00 39.00  ? 520 HOH B O     1 
HETATM 5292 O  O     . HOH K 8 .   ? 17.610  9.521   77.082  1.00 36.75  ? 521 HOH B O     1 
HETATM 5293 O  O     . HOH K 8 .   ? 3.094   19.103  58.277  1.00 40.61  ? 522 HOH B O     1 
HETATM 5294 O  O     . HOH K 8 .   ? 5.045   22.519  78.978  1.00 44.49  ? 523 HOH B O     1 
HETATM 5295 O  O     . HOH K 8 .   ? 7.999   5.175   77.136  1.00 41.73  ? 524 HOH B O     1 
HETATM 5296 O  O     . HOH K 8 .   ? 19.879  7.836   75.546  1.00 40.54  ? 525 HOH B O     1 
HETATM 5297 O  O     . HOH K 8 .   ? 22.073  30.474  72.255  1.00 38.97  ? 526 HOH B O     1 
HETATM 5298 O  O     . HOH K 8 .   ? 9.484   15.320  57.691  1.00 35.77  ? 527 HOH B O     1 
HETATM 5299 O  O     . HOH K 8 .   ? 5.368   24.984  51.540  1.00 40.25  ? 528 HOH B O     1 
HETATM 5300 O  O     . HOH K 8 .   ? -4.979  19.359  62.385  1.00 45.96  ? 529 HOH B O     1 
HETATM 5301 O  O     . HOH K 8 .   ? 22.549  27.407  70.247  1.00 38.97  ? 530 HOH B O     1 
HETATM 5302 O  O     . HOH K 8 .   ? 16.981  25.246  78.322  1.00 46.47  ? 531 HOH B O     1 
HETATM 5303 O  O     . HOH K 8 .   ? 3.835   6.439   56.626  1.00 46.43  ? 532 HOH B O     1 
HETATM 5304 O  O     . HOH K 8 .   ? 14.971  25.048  75.746  1.00 34.36  ? 533 HOH B O     1 
HETATM 5305 O  O     . HOH K 8 .   ? 16.943  4.741   76.081  1.00 41.11  ? 534 HOH B O     1 
HETATM 5306 O  O     . HOH K 8 .   ? 1.501   14.881  47.667  1.00 44.69  ? 535 HOH B O     1 
HETATM 5307 O  O     . HOH K 8 .   ? 26.804  18.585  74.411  1.00 36.66  ? 536 HOH B O     1 
HETATM 5308 O  O     . HOH K 8 .   ? 28.808  17.320  71.204  1.00 43.11  ? 537 HOH B O     1 
HETATM 5309 O  O     . HOH K 8 .   ? 11.236  32.359  77.868  1.00 46.70  ? 538 HOH B O     1 
HETATM 5310 O  O     . HOH K 8 .   ? 36.132  13.809  62.160  1.00 53.59  ? 539 HOH B O     1 
HETATM 5311 O  O     . HOH K 8 .   ? 17.355  0.536   55.872  1.00 43.83  ? 540 HOH B O     1 
HETATM 5312 O  O     . HOH K 8 .   ? 25.299  28.632  50.853  1.00 55.85  ? 541 HOH B O     1 
HETATM 5313 O  O     . HOH K 8 .   ? 31.301  27.541  81.198  1.00 59.25  ? 542 HOH B O     1 
HETATM 5314 O  O     . HOH K 8 .   ? -4.825  16.945  61.946  1.00 40.12  ? 543 HOH B O     1 
HETATM 5315 O  O     . HOH K 8 .   ? 9.003   12.852  59.985  1.00 31.52  ? 544 HOH B O     1 
HETATM 5316 O  O     . HOH K 8 .   ? 34.942  30.596  54.723  1.00 40.16  ? 545 HOH B O     1 
HETATM 5317 O  O     . HOH K 8 .   ? 7.198   18.323  80.633  1.00 38.17  ? 546 HOH B O     1 
HETATM 5318 O  O     . HOH K 8 .   ? 10.937  11.918  78.369  1.00 39.45  ? 547 HOH B O     1 
HETATM 5319 O  O     . HOH K 8 .   ? 30.985  16.786  48.873  1.00 53.36  ? 548 HOH B O     1 
HETATM 5320 O  O     . HOH K 8 .   ? -4.948  23.596  60.630  1.00 55.43  ? 549 HOH B O     1 
HETATM 5321 O  O     . HOH K 8 .   ? 7.586   2.488   77.154  1.00 51.86  ? 550 HOH B O     1 
HETATM 5322 O  O     . HOH K 8 .   ? 31.588  24.829  82.452  1.00 49.21  ? 551 HOH B O     1 
HETATM 5323 O  O     . HOH K 8 .   ? -0.264  25.826  61.247  1.00 44.10  ? 552 HOH B O     1 
HETATM 5324 O  O     . HOH K 8 .   ? 4.019   23.298  52.556  1.00 38.45  ? 553 HOH B O     1 
HETATM 5325 O  O     . HOH K 8 .   ? 9.493   26.323  63.840  1.00 33.10  ? 554 HOH B O     1 
HETATM 5326 O  O     . HOH K 8 .   ? 35.026  21.006  55.655  1.00 40.87  ? 555 HOH B O     1 
HETATM 5327 O  O     . HOH K 8 .   ? 17.798  -1.656  68.626  1.00 48.30  ? 556 HOH B O     1 
HETATM 5328 O  O     . HOH K 8 .   ? -1.424  17.678  58.599  1.00 39.08  ? 557 HOH B O     1 
HETATM 5329 O  O     . HOH K 8 .   ? 21.098  4.717   49.238  1.00 51.08  ? 558 HOH B O     1 
HETATM 5330 O  O     . HOH K 8 .   ? 13.301  1.970   75.138  1.00 48.65  ? 559 HOH B O     1 
HETATM 5331 O  O     . HOH K 8 .   ? 17.376  28.846  43.200  1.00 58.31  ? 560 HOH B O     1 
HETATM 5332 O  O     . HOH L 8 .   ? 2.747   13.420  12.952  1.00 49.02  ? 101 HOH C O     1 
HETATM 5333 O  O     . HOH L 8 .   ? 35.306  18.566  8.271   1.00 62.69  ? 102 HOH C O     1 
HETATM 5334 O  O     . HOH L 8 .   ? 2.033   8.150   14.395  1.00 35.03  ? 103 HOH C O     1 
HETATM 5335 O  O     . HOH L 8 .   ? 20.254  15.784  -3.280  1.00 60.11  ? 104 HOH C O     1 
HETATM 5336 O  O     . HOH M 8 .   ? -6.639  15.701  19.576  1.00 32.95  ? 101 HOH D O     1 
HETATM 5337 O  O     . HOH M 8 .   ? -13.125 23.488  -2.046  1.00 52.53  ? 102 HOH D O     1 
HETATM 5338 O  O     . HOH M 8 .   ? -10.715 13.323  -3.288  1.00 42.22  ? 103 HOH D O     1 
HETATM 5339 O  O     . HOH M 8 .   ? -15.101 11.865  -8.828  1.00 36.44  ? 104 HOH D O     1 
HETATM 5340 O  O     . HOH M 8 .   ? -7.826  18.305  5.752   1.00 49.39  ? 105 HOH D O     1 
HETATM 5341 O  O     . HOH M 8 .   ? -20.484 10.017  3.147   1.00 43.92  ? 106 HOH D O     1 
HETATM 5342 O  O     . HOH M 8 .   ? -12.512 12.786  3.555   1.00 40.92  ? 107 HOH D O     1 
HETATM 5343 O  O     . HOH M 8 .   ? -6.336  12.244  18.169  1.00 47.24  ? 108 HOH D O     1 
HETATM 5344 O  O     . HOH M 8 .   ? -10.378 17.418  4.786   1.00 49.34  ? 109 HOH D O     1 
HETATM 5345 O  O     . HOH M 8 .   ? -17.123 9.997   2.217   1.00 48.62  ? 110 HOH D O     1 
HETATM 5346 O  O     . HOH N 8 .   ? -30.683 19.131  0.084   1.00 51.82  ? 201 HOH E O     1 
HETATM 5347 O  O     . HOH N 8 .   ? -1.390  6.079   3.896   1.00 58.86  ? 202 HOH E O     1 
HETATM 5348 O  O     . HOH N 8 .   ? -19.672 9.218   17.743  1.00 41.26  ? 203 HOH E O     1 
HETATM 5349 O  O     . HOH N 8 .   ? -17.614 9.682   7.229   1.00 42.74  ? 204 HOH E O     1 
HETATM 5350 O  O     . HOH N 8 .   ? 34.112  21.769  -4.014  1.00 48.43  ? 205 HOH E O     1 
HETATM 5351 O  O     . HOH N 8 .   ? -0.636  18.096  4.235   1.00 55.22  ? 206 HOH E O     1 
HETATM 5352 O  O     . HOH N 8 .   ? 11.120  21.561  -1.181  1.00 51.73  ? 207 HOH E O     1 
HETATM 5353 O  O     . HOH N 8 .   ? 34.632  10.850  -10.316 1.00 42.05  ? 208 HOH E O     1 
HETATM 5354 O  O     . HOH N 8 .   ? -26.043 22.035  -11.134 1.00 40.20  ? 209 HOH E O     1 
HETATM 5355 O  O     . HOH N 8 .   ? 2.018   10.395  0.594   1.00 58.92  ? 210 HOH E O     1 
HETATM 5356 O  O     . HOH N 8 .   ? -26.433 16.350  3.761   1.00 49.06  ? 211 HOH E O     1 
HETATM 5357 O  O     . HOH N 8 .   ? -19.933 19.598  -1.291  1.00 46.50  ? 212 HOH E O     1 
HETATM 5358 O  O     . HOH N 8 .   ? 34.689  12.288  -3.220  1.00 56.12  ? 213 HOH E O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   43  43  ALA ALA A . n 
A 1 2   LEU 2   44  44  LEU LEU A . n 
A 1 3   TYR 3   45  45  TYR TYR A . n 
A 1 4   GLU 4   46  46  GLU GLU A . n 
A 1 5   ASP 5   47  47  ASP ASP A . n 
A 1 6   PRO 6   48  48  PRO PRO A . n 
A 1 7   PRO 7   49  49  PRO PRO A . n 
A 1 8   ASP 8   50  50  ASP ASP A . n 
A 1 9   GLN 9   51  51  GLN GLN A . n 
A 1 10  LYS 10  52  52  LYS LYS A . n 
A 1 11  THR 11  53  53  THR THR A . n 
A 1 12  SER 12  54  54  SER SER A . n 
A 1 13  PRO 13  55  55  PRO PRO A . n 
A 1 14  SER 14  56  56  SER SER A . n 
A 1 15  GLY 15  57  57  GLY GLY A . n 
A 1 16  LYS 16  58  58  LYS LYS A . n 
A 1 17  PRO 17  59  59  PRO PRO A . n 
A 1 18  ALA 18  60  60  ALA ALA A . n 
A 1 19  THR 19  61  61  THR THR A . n 
A 1 20  LEU 20  62  62  LEU LEU A . n 
A 1 21  LYS 21  63  63  LYS LYS A . n 
A 1 22  ILE 22  64  64  ILE ILE A . n 
A 1 23  CYS 23  65  65  CYS CYS A . n 
A 1 24  SER 24  66  66  SER SER A . n 
A 1 25  TRP 25  67  67  TRP TRP A . n 
A 1 26  ASN 26  68  68  ASN ASN A . n 
A 1 27  VAL 27  69  69  VAL VAL A . n 
A 1 28  ASP 28  70  70  ASP ASP A . n 
A 1 29  GLY 29  71  71  GLY GLY A . n 
A 1 30  LEU 30  72  72  LEU LEU A . n 
A 1 31  ARG 31  73  73  ARG ARG A . n 
A 1 32  ALA 32  74  74  ALA ALA A . n 
A 1 33  TRP 33  75  75  TRP TRP A . n 
A 1 34  ILE 34  76  76  ILE ILE A . n 
A 1 35  LYS 35  77  77  LYS LYS A . n 
A 1 36  LYS 36  78  78  LYS LYS A . n 
A 1 37  LYS 37  79  79  LYS LYS A . n 
A 1 38  GLY 38  80  80  GLY GLY A . n 
A 1 39  LEU 39  81  81  LEU LEU A . n 
A 1 40  ASP 40  82  82  ASP ASP A . n 
A 1 41  TRP 41  83  83  TRP TRP A . n 
A 1 42  VAL 42  84  84  VAL VAL A . n 
A 1 43  LYS 43  85  85  LYS LYS A . n 
A 1 44  GLU 44  86  86  GLU GLU A . n 
A 1 45  GLU 45  87  87  GLU GLU A . n 
A 1 46  ALA 46  88  88  ALA ALA A . n 
A 1 47  PRO 47  89  89  PRO PRO A . n 
A 1 48  ASP 48  90  90  ASP ASP A . n 
A 1 49  ILE 49  91  91  ILE ILE A . n 
A 1 50  LEU 50  92  92  LEU LEU A . n 
A 1 51  CYS 51  93  93  CYS CYS A . n 
A 1 52  LEU 52  94  94  LEU LEU A . n 
A 1 53  GLN 53  95  95  GLN GLN A . n 
A 1 54  GLU 54  96  96  GLU GLU A . n 
A 1 55  THR 55  97  97  THR THR A . n 
A 1 56  LYS 56  98  98  LYS LYS A . n 
A 1 57  CYS 57  99  99  CYS CYS A . n 
A 1 58  SER 58  100 100 SER SER A . n 
A 1 59  GLU 59  101 101 GLU GLU A . n 
A 1 60  ASN 60  102 102 ASN ASN A . n 
A 1 61  LYS 61  103 103 LYS LYS A . n 
A 1 62  LEU 62  104 104 LEU LEU A . n 
A 1 63  PRO 63  105 105 PRO PRO A . n 
A 1 64  ALA 64  106 106 ALA ALA A . n 
A 1 65  GLU 65  107 107 GLU GLU A . n 
A 1 66  LEU 66  108 108 LEU LEU A . n 
A 1 67  GLN 67  109 109 GLN GLN A . n 
A 1 68  GLU 68  110 110 GLU GLU A . n 
A 1 69  LEU 69  111 111 LEU LEU A . n 
A 1 70  PRO 70  112 112 PRO PRO A . n 
A 1 71  GLY 71  113 113 GLY GLY A . n 
A 1 72  LEU 72  114 114 LEU LEU A . n 
A 1 73  SER 73  115 115 SER SER A . n 
A 1 74  HIS 74  116 116 HIS HIS A . n 
A 1 75  GLN 75  117 117 GLN GLN A . n 
A 1 76  TYR 76  118 118 TYR TYR A . n 
A 1 77  TRP 77  119 119 TRP TRP A . n 
A 1 78  SER 78  120 120 SER SER A . n 
A 1 79  ALA 79  121 121 ALA ALA A . n 
A 1 80  PRO 80  122 122 PRO PRO A . n 
A 1 81  SER 81  123 123 SER SER A . n 
A 1 82  ASP 82  124 124 ASP ASP A . n 
A 1 83  LYS 83  125 125 LYS LYS A . n 
A 1 84  GLU 84  126 126 GLU GLU A . n 
A 1 85  GLY 85  127 127 GLY GLY A . n 
A 1 86  TYR 86  128 128 TYR TYR A . n 
A 1 87  SER 87  129 129 SER SER A . n 
A 1 88  GLY 88  130 130 GLY GLY A . n 
A 1 89  VAL 89  131 131 VAL VAL A . n 
A 1 90  GLY 90  132 132 GLY GLY A . n 
A 1 91  LEU 91  133 133 LEU LEU A . n 
A 1 92  LEU 92  134 134 LEU LEU A . n 
A 1 93  SER 93  135 135 SER SER A . n 
A 1 94  ARG 94  136 136 ARG ARG A . n 
A 1 95  GLN 95  137 137 GLN GLN A . n 
A 1 96  ALA 96  138 138 ALA ALA A . n 
A 1 97  PRO 97  139 139 PRO PRO A . n 
A 1 98  LEU 98  140 140 LEU LEU A . n 
A 1 99  LYS 99  141 141 LYS LYS A . n 
A 1 100 VAL 100 142 142 VAL VAL A . n 
A 1 101 SER 101 143 143 SER SER A . n 
A 1 102 TYR 102 144 144 TYR TYR A . n 
A 1 103 GLY 103 145 145 GLY GLY A . n 
A 1 104 ILE 104 146 146 ILE ILE A . n 
A 1 105 GLY 105 147 147 GLY GLY A . n 
A 1 106 ASP 106 148 148 ASP ASP A . n 
A 1 107 GLU 107 149 149 GLU GLU A . n 
A 1 108 GLU 108 150 150 GLU GLU A . n 
A 1 109 HIS 109 151 151 HIS HIS A . n 
A 1 110 ASP 110 152 152 ASP ASP A . n 
A 1 111 GLN 111 153 153 GLN GLN A . n 
A 1 112 GLU 112 154 154 GLU GLU A . n 
A 1 113 GLY 113 155 155 GLY GLY A . n 
A 1 114 ARG 114 156 156 ARG ARG A . n 
A 1 115 VAL 115 157 157 VAL VAL A . n 
A 1 116 ILE 116 158 158 ILE ILE A . n 
A 1 117 VAL 117 159 159 VAL VAL A . n 
A 1 118 ALA 118 160 160 ALA ALA A . n 
A 1 119 GLU 119 161 161 GLU GLU A . n 
A 1 120 PHE 120 162 162 PHE PHE A . n 
A 1 121 ASP 121 163 163 ASP ASP A . n 
A 1 122 SER 122 164 164 SER SER A . n 
A 1 123 PHE 123 165 165 PHE PHE A . n 
A 1 124 VAL 124 166 166 VAL VAL A . n 
A 1 125 LEU 125 167 167 LEU LEU A . n 
A 1 126 VAL 126 168 168 VAL VAL A . n 
A 1 127 THR 127 169 169 THR THR A . n 
A 1 128 ALA 128 170 170 ALA ALA A . n 
A 1 129 TYR 129 171 171 TYR TYR A . n 
A 1 130 VAL 130 172 172 VAL VAL A . n 
A 1 131 PRO 131 173 173 PRO PRO A . n 
A 1 132 ASN 132 174 174 ASN ASN A . n 
A 1 133 ALA 133 175 175 ALA ALA A . n 
A 1 134 GLY 134 176 176 GLY GLY A . n 
A 1 135 ARG 135 177 177 ARG ARG A . n 
A 1 136 GLY 136 178 178 GLY GLY A . n 
A 1 137 LEU 137 179 179 LEU LEU A . n 
A 1 138 VAL 138 180 180 VAL VAL A . n 
A 1 139 ARG 139 181 181 ARG ARG A . n 
A 1 140 LEU 140 182 182 LEU LEU A . n 
A 1 141 GLU 141 183 183 GLU GLU A . n 
A 1 142 TYR 142 184 184 TYR TYR A . n 
A 1 143 ARG 143 185 185 ARG ARG A . n 
A 1 144 GLN 144 186 186 GLN GLN A . n 
A 1 145 ARG 145 187 187 ARG ARG A . n 
A 1 146 TRP 146 188 188 TRP TRP A . n 
A 1 147 ASP 147 189 189 ASP ASP A . n 
A 1 148 GLU 148 190 190 GLU GLU A . n 
A 1 149 ALA 149 191 191 ALA ALA A . n 
A 1 150 PHE 150 192 192 PHE PHE A . n 
A 1 151 ARG 151 193 193 ARG ARG A . n 
A 1 152 LYS 152 194 194 LYS LYS A . n 
A 1 153 PHE 153 195 195 PHE PHE A . n 
A 1 154 LEU 154 196 196 LEU LEU A . n 
A 1 155 LYS 155 197 197 LYS LYS A . n 
A 1 156 GLY 156 198 198 GLY GLY A . n 
A 1 157 LEU 157 199 199 LEU LEU A . n 
A 1 158 ALA 158 200 200 ALA ALA A . n 
A 1 159 SER 159 201 201 SER SER A . n 
A 1 160 ARG 160 202 202 ARG ARG A . n 
A 1 161 LYS 161 203 203 LYS LYS A . n 
A 1 162 PRO 162 204 204 PRO PRO A . n 
A 1 163 LEU 163 205 205 LEU LEU A . n 
A 1 164 VAL 164 206 206 VAL VAL A . n 
A 1 165 LEU 165 207 207 LEU LEU A . n 
A 1 166 CYS 166 208 208 CYS CYS A . n 
A 1 167 GLY 167 209 209 GLY GLY A . n 
A 1 168 ASP 168 210 210 ASP ASP A . n 
A 1 169 LEU 169 211 211 LEU LEU A . n 
A 1 170 ASN 170 212 212 ASN ASN A . n 
A 1 171 VAL 171 213 213 VAL VAL A . n 
A 1 172 ALA 172 214 214 ALA ALA A . n 
A 1 173 HIS 173 215 215 HIS HIS A . n 
A 1 174 GLU 174 216 216 GLU GLU A . n 
A 1 175 GLU 175 217 217 GLU GLU A . n 
A 1 176 ILE 176 218 218 ILE ILE A . n 
A 1 177 ASP 177 219 219 ASP ASP A . n 
A 1 178 LEU 178 220 220 LEU LEU A . n 
A 1 179 ARG 179 221 221 ARG ARG A . n 
A 1 180 ASN 180 222 222 ASN ASN A . n 
A 1 181 PRO 181 223 223 PRO PRO A . n 
A 1 182 LYS 182 224 224 LYS LYS A . n 
A 1 183 GLY 183 225 225 GLY GLY A . n 
A 1 184 ASN 184 226 226 ASN ASN A . n 
A 1 185 LYS 185 227 227 LYS LYS A . n 
A 1 186 LYS 186 228 228 LYS LYS A . n 
A 1 187 ASN 187 229 229 ASN ASN A . n 
A 1 188 ALA 188 230 230 ALA ALA A . n 
A 1 189 GLY 189 231 231 GLY GLY A . n 
A 1 190 PHE 190 232 232 PHE PHE A . n 
A 1 191 THR 191 233 233 THR THR A . n 
A 1 192 PRO 192 234 234 PRO PRO A . n 
A 1 193 GLN 193 235 235 GLN GLN A . n 
A 1 194 GLU 194 236 236 GLU GLU A . n 
A 1 195 ARG 195 237 237 ARG ARG A . n 
A 1 196 GLN 196 238 238 GLN GLN A . n 
A 1 197 GLY 197 239 239 GLY GLY A . n 
A 1 198 PHE 198 240 240 PHE PHE A . n 
A 1 199 GLY 199 241 241 GLY GLY A . n 
A 1 200 GLU 200 242 242 GLU GLU A . n 
A 1 201 LEU 201 243 243 LEU LEU A . n 
A 1 202 LEU 202 244 244 LEU LEU A . n 
A 1 203 GLN 203 245 245 GLN GLN A . n 
A 1 204 ALA 204 246 246 ALA ALA A . n 
A 1 205 VAL 205 247 247 VAL VAL A . n 
A 1 206 PRO 206 248 248 PRO PRO A . n 
A 1 207 LEU 207 249 249 LEU LEU A . n 
A 1 208 ALA 208 250 250 ALA ALA A . n 
A 1 209 ASP 209 251 251 ASP ASP A . n 
A 1 210 SER 210 252 252 SER SER A . n 
A 1 211 PHE 211 253 253 PHE PHE A . n 
A 1 212 ARG 212 254 254 ARG ARG A . n 
A 1 213 HIS 213 255 255 HIS HIS A . n 
A 1 214 LEU 214 256 256 LEU LEU A . n 
A 1 215 TYR 215 257 257 TYR TYR A . n 
A 1 216 PRO 216 258 258 PRO PRO A . n 
A 1 217 ASN 217 259 259 ASN ASN A . n 
A 1 218 THR 218 260 260 THR THR A . n 
A 1 219 PRO 219 261 261 PRO PRO A . n 
A 1 220 TYR 220 262 262 TYR TYR A . n 
A 1 221 ALA 221 263 263 ALA ALA A . n 
A 1 222 TYR 222 264 264 TYR TYR A . n 
A 1 223 THR 223 265 265 THR THR A . n 
A 1 224 PHE 224 266 266 PHE PHE A . n 
A 1 225 TRP 225 267 267 TRP TRP A . n 
A 1 226 THR 226 268 268 THR THR A . n 
A 1 227 TYR 227 269 269 TYR TYR A . n 
A 1 228 MET 228 270 270 MET MET A . n 
A 1 229 MET 229 271 271 MET MET A . n 
A 1 230 ASN 230 272 272 ASN ASN A . n 
A 1 231 ALA 231 273 273 ALA ALA A . n 
A 1 232 ARG 232 274 274 ARG ARG A . n 
A 1 233 SER 233 275 275 SER SER A . n 
A 1 234 LYS 234 276 276 LYS LYS A . n 
A 1 235 ASN 235 277 277 ASN ASN A . n 
A 1 236 VAL 236 278 278 VAL VAL A . n 
A 1 237 GLY 237 279 279 GLY GLY A . n 
A 1 238 TRP 238 280 280 TRP TRP A . n 
A 1 239 ARG 239 281 281 ARG ARG A . n 
A 1 240 LEU 240 282 282 LEU LEU A . n 
A 1 241 ASP 241 283 283 ASP ASP A . n 
A 1 242 TYR 242 284 284 TYR TYR A . n 
A 1 243 PHE 243 285 285 PHE PHE A . n 
A 1 244 LEU 244 286 286 LEU LEU A . n 
A 1 245 LEU 245 287 287 LEU LEU A . n 
A 1 246 SER 246 288 288 SER SER A . n 
A 1 247 HIS 247 289 289 HIS HIS A . n 
A 1 248 SER 248 290 290 SER SER A . n 
A 1 249 LEU 249 291 291 LEU LEU A . n 
A 1 250 LEU 250 292 292 LEU LEU A . n 
A 1 251 PRO 251 293 293 PRO PRO A . n 
A 1 252 ALA 252 294 294 ALA ALA A . n 
A 1 253 LEU 253 295 295 LEU LEU A . n 
A 1 254 CYS 254 296 296 CYS CYS A . n 
A 1 255 ASP 255 297 297 ASP ASP A . n 
A 1 256 SER 256 298 298 SER SER A . n 
A 1 257 LYS 257 299 299 LYS LYS A . n 
A 1 258 ILE 258 300 300 ILE ILE A . n 
A 1 259 ARG 259 301 301 ARG ARG A . n 
A 1 260 SER 260 302 302 SER SER A . n 
A 1 261 LYS 261 303 303 LYS LYS A . n 
A 1 262 ALA 262 304 304 ALA ALA A . n 
A 1 263 LEU 263 305 305 LEU LEU A . n 
A 1 264 GLY 264 306 306 GLY GLY A . n 
A 1 265 SER 265 307 307 SER SER A . n 
A 1 266 ASP 266 308 308 ASP ASP A . n 
A 1 267 HIS 267 309 309 HIS HIS A . n 
A 1 268 CYS 268 310 310 CYS CYS A . n 
A 1 269 PRO 269 311 311 PRO PRO A . n 
A 1 270 ILE 270 312 312 ILE ILE A . n 
A 1 271 THR 271 313 313 THR THR A . n 
A 1 272 LEU 272 314 314 LEU LEU A . n 
A 1 273 TYR 273 315 315 TYR TYR A . n 
A 1 274 LEU 274 316 316 LEU LEU A . n 
A 1 275 ALA 275 317 317 ALA ALA A . n 
A 1 276 LEU 276 318 318 LEU LEU A . n 
B 1 1   ALA 1   43  ?   ?   ?   B . n 
B 1 2   LEU 2   44  ?   ?   ?   B . n 
B 1 3   TYR 3   45  45  TYR TYR B . n 
B 1 4   GLU 4   46  46  GLU GLU B . n 
B 1 5   ASP 5   47  47  ASP ASP B . n 
B 1 6   PRO 6   48  48  PRO PRO B . n 
B 1 7   PRO 7   49  49  PRO PRO B . n 
B 1 8   ASP 8   50  50  ASP ASP B . n 
B 1 9   GLN 9   51  51  GLN GLN B . n 
B 1 10  LYS 10  52  52  LYS LYS B . n 
B 1 11  THR 11  53  53  THR THR B . n 
B 1 12  SER 12  54  54  SER SER B . n 
B 1 13  PRO 13  55  55  PRO PRO B . n 
B 1 14  SER 14  56  56  SER SER B . n 
B 1 15  GLY 15  57  57  GLY GLY B . n 
B 1 16  LYS 16  58  58  LYS LYS B . n 
B 1 17  PRO 17  59  59  PRO PRO B . n 
B 1 18  ALA 18  60  60  ALA ALA B . n 
B 1 19  THR 19  61  61  THR THR B . n 
B 1 20  LEU 20  62  62  LEU LEU B . n 
B 1 21  LYS 21  63  63  LYS LYS B . n 
B 1 22  ILE 22  64  64  ILE ILE B . n 
B 1 23  CYS 23  65  65  CYS CYS B . n 
B 1 24  SER 24  66  66  SER SER B . n 
B 1 25  TRP 25  67  67  TRP TRP B . n 
B 1 26  ASN 26  68  68  ASN ASN B . n 
B 1 27  VAL 27  69  69  VAL VAL B . n 
B 1 28  ASP 28  70  70  ASP ASP B . n 
B 1 29  GLY 29  71  71  GLY GLY B . n 
B 1 30  LEU 30  72  72  LEU LEU B . n 
B 1 31  ARG 31  73  73  ARG ARG B . n 
B 1 32  ALA 32  74  74  ALA ALA B . n 
B 1 33  TRP 33  75  75  TRP TRP B . n 
B 1 34  ILE 34  76  76  ILE ILE B . n 
B 1 35  LYS 35  77  77  LYS LYS B . n 
B 1 36  LYS 36  78  78  LYS LYS B . n 
B 1 37  LYS 37  79  79  LYS LYS B . n 
B 1 38  GLY 38  80  80  GLY GLY B . n 
B 1 39  LEU 39  81  81  LEU LEU B . n 
B 1 40  ASP 40  82  82  ASP ASP B . n 
B 1 41  TRP 41  83  83  TRP TRP B . n 
B 1 42  VAL 42  84  84  VAL VAL B . n 
B 1 43  LYS 43  85  85  LYS LYS B . n 
B 1 44  GLU 44  86  86  GLU GLU B . n 
B 1 45  GLU 45  87  87  GLU GLU B . n 
B 1 46  ALA 46  88  88  ALA ALA B . n 
B 1 47  PRO 47  89  89  PRO PRO B . n 
B 1 48  ASP 48  90  90  ASP ASP B . n 
B 1 49  ILE 49  91  91  ILE ILE B . n 
B 1 50  LEU 50  92  92  LEU LEU B . n 
B 1 51  CYS 51  93  93  CYS CYS B . n 
B 1 52  LEU 52  94  94  LEU LEU B . n 
B 1 53  GLN 53  95  95  GLN GLN B . n 
B 1 54  GLU 54  96  96  GLU GLU B . n 
B 1 55  THR 55  97  97  THR THR B . n 
B 1 56  LYS 56  98  98  LYS LYS B . n 
B 1 57  CYS 57  99  99  CYS CYS B . n 
B 1 58  SER 58  100 100 SER SER B . n 
B 1 59  GLU 59  101 101 GLU GLU B . n 
B 1 60  ASN 60  102 102 ASN ASN B . n 
B 1 61  LYS 61  103 103 LYS LYS B . n 
B 1 62  LEU 62  104 104 LEU LEU B . n 
B 1 63  PRO 63  105 105 PRO PRO B . n 
B 1 64  ALA 64  106 106 ALA ALA B . n 
B 1 65  GLU 65  107 107 GLU GLU B . n 
B 1 66  LEU 66  108 108 LEU LEU B . n 
B 1 67  GLN 67  109 109 GLN GLN B . n 
B 1 68  GLU 68  110 110 GLU GLU B . n 
B 1 69  LEU 69  111 111 LEU LEU B . n 
B 1 70  PRO 70  112 112 PRO PRO B . n 
B 1 71  GLY 71  113 113 GLY GLY B . n 
B 1 72  LEU 72  114 114 LEU LEU B . n 
B 1 73  SER 73  115 115 SER SER B . n 
B 1 74  HIS 74  116 116 HIS HIS B . n 
B 1 75  GLN 75  117 117 GLN GLN B . n 
B 1 76  TYR 76  118 118 TYR TYR B . n 
B 1 77  TRP 77  119 119 TRP TRP B . n 
B 1 78  SER 78  120 120 SER SER B . n 
B 1 79  ALA 79  121 121 ALA ALA B . n 
B 1 80  PRO 80  122 122 PRO PRO B . n 
B 1 81  SER 81  123 123 SER SER B . n 
B 1 82  ASP 82  124 124 ASP ASP B . n 
B 1 83  LYS 83  125 125 LYS LYS B . n 
B 1 84  GLU 84  126 126 GLU GLU B . n 
B 1 85  GLY 85  127 127 GLY GLY B . n 
B 1 86  TYR 86  128 128 TYR TYR B . n 
B 1 87  SER 87  129 129 SER SER B . n 
B 1 88  GLY 88  130 130 GLY GLY B . n 
B 1 89  VAL 89  131 131 VAL VAL B . n 
B 1 90  GLY 90  132 132 GLY GLY B . n 
B 1 91  LEU 91  133 133 LEU LEU B . n 
B 1 92  LEU 92  134 134 LEU LEU B . n 
B 1 93  SER 93  135 135 SER SER B . n 
B 1 94  ARG 94  136 136 ARG ARG B . n 
B 1 95  GLN 95  137 137 GLN GLN B . n 
B 1 96  ALA 96  138 138 ALA ALA B . n 
B 1 97  PRO 97  139 139 PRO PRO B . n 
B 1 98  LEU 98  140 140 LEU LEU B . n 
B 1 99  LYS 99  141 141 LYS LYS B . n 
B 1 100 VAL 100 142 142 VAL VAL B . n 
B 1 101 SER 101 143 143 SER SER B . n 
B 1 102 TYR 102 144 144 TYR TYR B . n 
B 1 103 GLY 103 145 145 GLY GLY B . n 
B 1 104 ILE 104 146 146 ILE ILE B . n 
B 1 105 GLY 105 147 147 GLY GLY B . n 
B 1 106 ASP 106 148 148 ASP ASP B . n 
B 1 107 GLU 107 149 149 GLU GLU B . n 
B 1 108 GLU 108 150 150 GLU GLU B . n 
B 1 109 HIS 109 151 151 HIS HIS B . n 
B 1 110 ASP 110 152 152 ASP ASP B . n 
B 1 111 GLN 111 153 153 GLN GLN B . n 
B 1 112 GLU 112 154 154 GLU GLU B . n 
B 1 113 GLY 113 155 155 GLY GLY B . n 
B 1 114 ARG 114 156 156 ARG ARG B . n 
B 1 115 VAL 115 157 157 VAL VAL B . n 
B 1 116 ILE 116 158 158 ILE ILE B . n 
B 1 117 VAL 117 159 159 VAL VAL B . n 
B 1 118 ALA 118 160 160 ALA ALA B . n 
B 1 119 GLU 119 161 161 GLU GLU B . n 
B 1 120 PHE 120 162 162 PHE PHE B . n 
B 1 121 ASP 121 163 163 ASP ASP B . n 
B 1 122 SER 122 164 164 SER SER B . n 
B 1 123 PHE 123 165 165 PHE PHE B . n 
B 1 124 VAL 124 166 166 VAL VAL B . n 
B 1 125 LEU 125 167 167 LEU LEU B . n 
B 1 126 VAL 126 168 168 VAL VAL B . n 
B 1 127 THR 127 169 169 THR THR B . n 
B 1 128 ALA 128 170 170 ALA ALA B . n 
B 1 129 TYR 129 171 171 TYR TYR B . n 
B 1 130 VAL 130 172 172 VAL VAL B . n 
B 1 131 PRO 131 173 173 PRO PRO B . n 
B 1 132 ASN 132 174 174 ASN ASN B . n 
B 1 133 ALA 133 175 175 ALA ALA B . n 
B 1 134 GLY 134 176 176 GLY GLY B . n 
B 1 135 ARG 135 177 177 ARG ARG B . n 
B 1 136 GLY 136 178 178 GLY GLY B . n 
B 1 137 LEU 137 179 179 LEU LEU B . n 
B 1 138 VAL 138 180 180 VAL VAL B . n 
B 1 139 ARG 139 181 181 ARG ARG B . n 
B 1 140 LEU 140 182 182 LEU LEU B . n 
B 1 141 GLU 141 183 183 GLU GLU B . n 
B 1 142 TYR 142 184 184 TYR TYR B . n 
B 1 143 ARG 143 185 185 ARG ARG B . n 
B 1 144 GLN 144 186 186 GLN GLN B . n 
B 1 145 ARG 145 187 187 ARG ARG B . n 
B 1 146 TRP 146 188 188 TRP TRP B . n 
B 1 147 ASP 147 189 189 ASP ASP B . n 
B 1 148 GLU 148 190 190 GLU GLU B . n 
B 1 149 ALA 149 191 191 ALA ALA B . n 
B 1 150 PHE 150 192 192 PHE PHE B . n 
B 1 151 ARG 151 193 193 ARG ARG B . n 
B 1 152 LYS 152 194 194 LYS LYS B . n 
B 1 153 PHE 153 195 195 PHE PHE B . n 
B 1 154 LEU 154 196 196 LEU LEU B . n 
B 1 155 LYS 155 197 197 LYS LYS B . n 
B 1 156 GLY 156 198 198 GLY GLY B . n 
B 1 157 LEU 157 199 199 LEU LEU B . n 
B 1 158 ALA 158 200 200 ALA ALA B . n 
B 1 159 SER 159 201 201 SER SER B . n 
B 1 160 ARG 160 202 202 ARG ARG B . n 
B 1 161 LYS 161 203 203 LYS LYS B . n 
B 1 162 PRO 162 204 204 PRO PRO B . n 
B 1 163 LEU 163 205 205 LEU LEU B . n 
B 1 164 VAL 164 206 206 VAL VAL B . n 
B 1 165 LEU 165 207 207 LEU LEU B . n 
B 1 166 CYS 166 208 208 CYS CYS B . n 
B 1 167 GLY 167 209 209 GLY GLY B . n 
B 1 168 ASP 168 210 210 ASP ASP B . n 
B 1 169 LEU 169 211 211 LEU LEU B . n 
B 1 170 ASN 170 212 212 ASN ASN B . n 
B 1 171 VAL 171 213 213 VAL VAL B . n 
B 1 172 ALA 172 214 214 ALA ALA B . n 
B 1 173 HIS 173 215 215 HIS HIS B . n 
B 1 174 GLU 174 216 216 GLU GLU B . n 
B 1 175 GLU 175 217 217 GLU GLU B . n 
B 1 176 ILE 176 218 218 ILE ILE B . n 
B 1 177 ASP 177 219 219 ASP ASP B . n 
B 1 178 LEU 178 220 220 LEU LEU B . n 
B 1 179 ARG 179 221 221 ARG ARG B . n 
B 1 180 ASN 180 222 222 ASN ASN B . n 
B 1 181 PRO 181 223 223 PRO PRO B . n 
B 1 182 LYS 182 224 224 LYS LYS B . n 
B 1 183 GLY 183 225 225 GLY GLY B . n 
B 1 184 ASN 184 226 226 ASN ASN B . n 
B 1 185 LYS 185 227 227 LYS LYS B . n 
B 1 186 LYS 186 228 228 LYS LYS B . n 
B 1 187 ASN 187 229 229 ASN ASN B . n 
B 1 188 ALA 188 230 230 ALA ALA B . n 
B 1 189 GLY 189 231 231 GLY GLY B . n 
B 1 190 PHE 190 232 232 PHE PHE B . n 
B 1 191 THR 191 233 233 THR THR B . n 
B 1 192 PRO 192 234 234 PRO PRO B . n 
B 1 193 GLN 193 235 235 GLN GLN B . n 
B 1 194 GLU 194 236 236 GLU GLU B . n 
B 1 195 ARG 195 237 237 ARG ARG B . n 
B 1 196 GLN 196 238 238 GLN GLN B . n 
B 1 197 GLY 197 239 239 GLY GLY B . n 
B 1 198 PHE 198 240 240 PHE PHE B . n 
B 1 199 GLY 199 241 241 GLY GLY B . n 
B 1 200 GLU 200 242 242 GLU GLU B . n 
B 1 201 LEU 201 243 243 LEU LEU B . n 
B 1 202 LEU 202 244 244 LEU LEU B . n 
B 1 203 GLN 203 245 245 GLN GLN B . n 
B 1 204 ALA 204 246 246 ALA ALA B . n 
B 1 205 VAL 205 247 247 VAL VAL B . n 
B 1 206 PRO 206 248 248 PRO PRO B . n 
B 1 207 LEU 207 249 249 LEU LEU B . n 
B 1 208 ALA 208 250 250 ALA ALA B . n 
B 1 209 ASP 209 251 251 ASP ASP B . n 
B 1 210 SER 210 252 252 SER SER B . n 
B 1 211 PHE 211 253 253 PHE PHE B . n 
B 1 212 ARG 212 254 254 ARG ARG B . n 
B 1 213 HIS 213 255 255 HIS HIS B . n 
B 1 214 LEU 214 256 256 LEU LEU B . n 
B 1 215 TYR 215 257 257 TYR TYR B . n 
B 1 216 PRO 216 258 258 PRO PRO B . n 
B 1 217 ASN 217 259 259 ASN ASN B . n 
B 1 218 THR 218 260 260 THR THR B . n 
B 1 219 PRO 219 261 261 PRO PRO B . n 
B 1 220 TYR 220 262 262 TYR TYR B . n 
B 1 221 ALA 221 263 263 ALA ALA B . n 
B 1 222 TYR 222 264 264 TYR TYR B . n 
B 1 223 THR 223 265 265 THR THR B . n 
B 1 224 PHE 224 266 266 PHE PHE B . n 
B 1 225 TRP 225 267 267 TRP TRP B . n 
B 1 226 THR 226 268 268 THR THR B . n 
B 1 227 TYR 227 269 269 TYR TYR B . n 
B 1 228 MET 228 270 270 MET MET B . n 
B 1 229 MET 229 271 271 MET MET B . n 
B 1 230 ASN 230 272 272 ASN ASN B . n 
B 1 231 ALA 231 273 273 ALA ALA B . n 
B 1 232 ARG 232 274 274 ARG ARG B . n 
B 1 233 SER 233 275 275 SER SER B . n 
B 1 234 LYS 234 276 276 LYS LYS B . n 
B 1 235 ASN 235 277 277 ASN ASN B . n 
B 1 236 VAL 236 278 278 VAL VAL B . n 
B 1 237 GLY 237 279 279 GLY GLY B . n 
B 1 238 TRP 238 280 280 TRP TRP B . n 
B 1 239 ARG 239 281 281 ARG ARG B . n 
B 1 240 LEU 240 282 282 LEU LEU B . n 
B 1 241 ASP 241 283 283 ASP ASP B . n 
B 1 242 TYR 242 284 284 TYR TYR B . n 
B 1 243 PHE 243 285 285 PHE PHE B . n 
B 1 244 LEU 244 286 286 LEU LEU B . n 
B 1 245 LEU 245 287 287 LEU LEU B . n 
B 1 246 SER 246 288 288 SER SER B . n 
B 1 247 HIS 247 289 289 HIS HIS B . n 
B 1 248 SER 248 290 290 SER SER B . n 
B 1 249 LEU 249 291 291 LEU LEU B . n 
B 1 250 LEU 250 292 292 LEU LEU B . n 
B 1 251 PRO 251 293 293 PRO PRO B . n 
B 1 252 ALA 252 294 294 ALA ALA B . n 
B 1 253 LEU 253 295 295 LEU LEU B . n 
B 1 254 CYS 254 296 296 CYS CYS B . n 
B 1 255 ASP 255 297 297 ASP ASP B . n 
B 1 256 SER 256 298 298 SER SER B . n 
B 1 257 LYS 257 299 299 LYS LYS B . n 
B 1 258 ILE 258 300 300 ILE ILE B . n 
B 1 259 ARG 259 301 301 ARG ARG B . n 
B 1 260 SER 260 302 302 SER SER B . n 
B 1 261 LYS 261 303 303 LYS LYS B . n 
B 1 262 ALA 262 304 304 ALA ALA B . n 
B 1 263 LEU 263 305 305 LEU LEU B . n 
B 1 264 GLY 264 306 306 GLY GLY B . n 
B 1 265 SER 265 307 307 SER SER B . n 
B 1 266 ASP 266 308 308 ASP ASP B . n 
B 1 267 HIS 267 309 309 HIS HIS B . n 
B 1 268 CYS 268 310 310 CYS CYS B . n 
B 1 269 PRO 269 311 311 PRO PRO B . n 
B 1 270 ILE 270 312 312 ILE ILE B . n 
B 1 271 THR 271 313 313 THR THR B . n 
B 1 272 LEU 272 314 314 LEU LEU B . n 
B 1 273 TYR 273 315 315 TYR TYR B . n 
B 1 274 LEU 274 316 316 LEU LEU B . n 
B 1 275 ALA 275 317 317 ALA ALA B . n 
B 1 276 LEU 276 318 318 LEU LEU B . n 
C 2 1   DT  1   1   1   DT  DT  C . n 
C 2 2   DC  2   2   2   DC  DC  C . n 
C 2 3   DG  3   3   3   DG  DG  C . n 
C 2 4   DA  4   4   4   DA  DA  C . n 
C 2 5   DC  5   5   5   DC  DC  C . n 
C 2 6   DG  6   6   6   DG  DG  C . n 
C 2 7   DG  7   7   7   DG  DG  C . n 
C 2 8   DA  8   8   8   DA  DA  C . n 
C 2 9   DT  9   9   9   DT  DT  C . n 
C 2 10  DC  10  10  10  DC  DC  C . n 
C 2 11  DC  11  11  11  DC  DC  C . n 
D 3 1   DG  1   1   1   DG  DG  D . n 
D 3 2   DC  2   2   2   DC  DC  D . n 
D 3 3   DT  3   3   3   DT  DT  D . n 
D 3 4   DG  4   4   4   DG  DG  D . n 
D 3 5   DA  5   5   5   DA  DA  D . n 
D 3 6   DT  6   6   6   DT  DT  D . n 
D 3 7   DG  7   7   7   DG  DG  D . n 
D 3 8   DC  8   8   8   DC  DC  D . n 
D 3 9   DG  9   9   9   DG  DG  D . n 
E 4 1   DG  1   1   1   DG  DG  E . n 
E 4 2   DG  2   2   2   DG  DG  E . n 
E 4 3   DA  3   3   3   DA  DA  E . n 
E 4 4   DT  4   4   4   DT  DT  E . n 
E 4 5   DC  5   5   5   DC  DC  E . n 
E 4 6   DC  6   6   6   DC  DC  E . n 
E 4 7   DG  7   7   7   DG  DG  E . n 
E 4 8   DT  8   8   8   DT  DT  E . n 
E 4 9   DC  9   9   9   DC  DC  E . n 
E 4 10  DG  10  10  10  DG  DG  E . n 
E 4 11  DA  11  11  11  DA  DA  E . n 
E 4 12  DT  12  12  12  DT  DT  E . n 
E 4 13  DC  13  13  13  DC  DC  E . n 
E 4 14  DG  14  14  14  DG  DG  E . n 
E 4 15  DC  15  15  15  DC  DC  E . n 
E 4 16  DA  16  16  16  DA  DA  E . n 
E 4 17  DT  17  17  17  DT  DT  E . n 
E 4 18  DC  18  18  18  DC  DC  E . n 
E 4 19  DA  19  19  19  DA  DA  E . n 
E 4 20  DG  20  20  20  DG  DG  E . n 
E 4 21  DC  21  21  21  DC  DC  E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 5 CL  1  401 2   CL  CL  B . 
G 6 NA  1  402 3   NA  NA  B . 
H 7 CA  1  101 1   CA  CA  E . 
I 6 NA  1  102 4   NA  NA  E . 
J 8 HOH 1  401 167 HOH HOH A . 
J 8 HOH 2  402 117 HOH HOH A . 
J 8 HOH 3  403 5   HOH HOH A . 
J 8 HOH 4  404 36  HOH HOH A . 
J 8 HOH 5  405 73  HOH HOH A . 
J 8 HOH 6  406 133 HOH HOH A . 
J 8 HOH 7  407 30  HOH HOH A . 
J 8 HOH 8  408 132 HOH HOH A . 
J 8 HOH 9  409 48  HOH HOH A . 
J 8 HOH 10 410 111 HOH HOH A . 
J 8 HOH 11 411 62  HOH HOH A . 
J 8 HOH 12 412 93  HOH HOH A . 
J 8 HOH 13 413 84  HOH HOH A . 
J 8 HOH 14 414 60  HOH HOH A . 
J 8 HOH 15 415 37  HOH HOH A . 
J 8 HOH 16 416 23  HOH HOH A . 
J 8 HOH 17 417 138 HOH HOH A . 
J 8 HOH 18 418 1   HOH HOH A . 
J 8 HOH 19 419 25  HOH HOH A . 
J 8 HOH 20 420 76  HOH HOH A . 
J 8 HOH 21 421 140 HOH HOH A . 
J 8 HOH 22 422 29  HOH HOH A . 
J 8 HOH 23 423 160 HOH HOH A . 
J 8 HOH 24 424 43  HOH HOH A . 
J 8 HOH 25 425 52  HOH HOH A . 
J 8 HOH 26 426 68  HOH HOH A . 
J 8 HOH 27 427 123 HOH HOH A . 
J 8 HOH 28 428 34  HOH HOH A . 
J 8 HOH 29 429 74  HOH HOH A . 
J 8 HOH 30 430 70  HOH HOH A . 
J 8 HOH 31 431 57  HOH HOH A . 
J 8 HOH 32 432 50  HOH HOH A . 
J 8 HOH 33 433 170 HOH HOH A . 
J 8 HOH 34 434 46  HOH HOH A . 
J 8 HOH 35 435 135 HOH HOH A . 
J 8 HOH 36 436 20  HOH HOH A . 
J 8 HOH 37 437 106 HOH HOH A . 
J 8 HOH 38 438 107 HOH HOH A . 
J 8 HOH 39 439 71  HOH HOH A . 
J 8 HOH 40 440 38  HOH HOH A . 
J 8 HOH 41 441 44  HOH HOH A . 
J 8 HOH 42 442 114 HOH HOH A . 
J 8 HOH 43 443 56  HOH HOH A . 
J 8 HOH 44 444 66  HOH HOH A . 
J 8 HOH 45 445 82  HOH HOH A . 
J 8 HOH 46 446 115 HOH HOH A . 
J 8 HOH 47 447 27  HOH HOH A . 
J 8 HOH 48 448 94  HOH HOH A . 
J 8 HOH 49 449 18  HOH HOH A . 
J 8 HOH 50 450 134 HOH HOH A . 
J 8 HOH 51 451 171 HOH HOH A . 
J 8 HOH 52 452 59  HOH HOH A . 
J 8 HOH 53 453 110 HOH HOH A . 
J 8 HOH 54 454 159 HOH HOH A . 
J 8 HOH 55 455 161 HOH HOH A . 
J 8 HOH 56 456 14  HOH HOH A . 
J 8 HOH 57 457 4   HOH HOH A . 
J 8 HOH 58 458 33  HOH HOH A . 
J 8 HOH 59 459 162 HOH HOH A . 
J 8 HOH 60 460 166 HOH HOH A . 
J 8 HOH 61 461 109 HOH HOH A . 
J 8 HOH 62 462 69  HOH HOH A . 
J 8 HOH 63 463 88  HOH HOH A . 
J 8 HOH 64 464 83  HOH HOH A . 
J 8 HOH 65 465 163 HOH HOH A . 
J 8 HOH 66 466 164 HOH HOH A . 
J 8 HOH 67 467 95  HOH HOH A . 
J 8 HOH 68 468 49  HOH HOH A . 
J 8 HOH 69 469 165 HOH HOH A . 
J 8 HOH 70 470 119 HOH HOH A . 
J 8 HOH 71 471 54  HOH HOH A . 
J 8 HOH 72 472 145 HOH HOH A . 
J 8 HOH 73 473 169 HOH HOH A . 
J 8 HOH 74 474 125 HOH HOH A . 
J 8 HOH 75 475 87  HOH HOH A . 
J 8 HOH 76 476 136 HOH HOH A . 
J 8 HOH 77 477 168 HOH HOH A . 
J 8 HOH 78 478 85  HOH HOH A . 
K 8 HOH 1  501 143 HOH HOH B . 
K 8 HOH 2  502 8   HOH HOH B . 
K 8 HOH 3  503 64  HOH HOH B . 
K 8 HOH 4  504 58  HOH HOH B . 
K 8 HOH 5  505 116 HOH HOH B . 
K 8 HOH 6  506 10  HOH HOH B . 
K 8 HOH 7  507 31  HOH HOH B . 
K 8 HOH 8  508 90  HOH HOH B . 
K 8 HOH 9  509 17  HOH HOH B . 
K 8 HOH 10 510 142 HOH HOH B . 
K 8 HOH 11 511 152 HOH HOH B . 
K 8 HOH 12 512 150 HOH HOH B . 
K 8 HOH 13 513 7   HOH HOH B . 
K 8 HOH 14 514 47  HOH HOH B . 
K 8 HOH 15 515 103 HOH HOH B . 
K 8 HOH 16 516 19  HOH HOH B . 
K 8 HOH 17 517 121 HOH HOH B . 
K 8 HOH 18 518 63  HOH HOH B . 
K 8 HOH 19 519 16  HOH HOH B . 
K 8 HOH 20 520 65  HOH HOH B . 
K 8 HOH 21 521 97  HOH HOH B . 
K 8 HOH 22 522 176 HOH HOH B . 
K 8 HOH 23 523 42  HOH HOH B . 
K 8 HOH 24 524 101 HOH HOH B . 
K 8 HOH 25 525 28  HOH HOH B . 
K 8 HOH 26 526 155 HOH HOH B . 
K 8 HOH 27 527 100 HOH HOH B . 
K 8 HOH 28 528 35  HOH HOH B . 
K 8 HOH 29 529 92  HOH HOH B . 
K 8 HOH 30 530 156 HOH HOH B . 
K 8 HOH 31 531 24  HOH HOH B . 
K 8 HOH 32 532 21  HOH HOH B . 
K 8 HOH 33 533 3   HOH HOH B . 
K 8 HOH 34 534 153 HOH HOH B . 
K 8 HOH 35 535 112 HOH HOH B . 
K 8 HOH 36 536 77  HOH HOH B . 
K 8 HOH 37 537 98  HOH HOH B . 
K 8 HOH 38 538 108 HOH HOH B . 
K 8 HOH 39 539 173 HOH HOH B . 
K 8 HOH 40 540 86  HOH HOH B . 
K 8 HOH 41 541 51  HOH HOH B . 
K 8 HOH 42 542 89  HOH HOH B . 
K 8 HOH 43 543 75  HOH HOH B . 
K 8 HOH 44 544 177 HOH HOH B . 
K 8 HOH 45 545 141 HOH HOH B . 
K 8 HOH 46 546 148 HOH HOH B . 
K 8 HOH 47 547 151 HOH HOH B . 
K 8 HOH 48 548 174 HOH HOH B . 
K 8 HOH 49 549 80  HOH HOH B . 
K 8 HOH 50 550 154 HOH HOH B . 
K 8 HOH 51 551 104 HOH HOH B . 
K 8 HOH 52 552 175 HOH HOH B . 
K 8 HOH 53 553 61  HOH HOH B . 
K 8 HOH 54 554 22  HOH HOH B . 
K 8 HOH 55 555 99  HOH HOH B . 
K 8 HOH 56 556 172 HOH HOH B . 
K 8 HOH 57 557 12  HOH HOH B . 
K 8 HOH 58 558 91  HOH HOH B . 
K 8 HOH 59 559 79  HOH HOH B . 
K 8 HOH 60 560 55  HOH HOH B . 
L 8 HOH 1  101 144 HOH HOH C . 
L 8 HOH 2  102 67  HOH HOH C . 
L 8 HOH 3  103 32  HOH HOH C . 
L 8 HOH 4  104 127 HOH HOH C . 
M 8 HOH 1  101 2   HOH HOH D . 
M 8 HOH 2  102 45  HOH HOH D . 
M 8 HOH 3  103 39  HOH HOH D . 
M 8 HOH 4  104 9   HOH HOH D . 
M 8 HOH 5  105 26  HOH HOH D . 
M 8 HOH 6  106 130 HOH HOH D . 
M 8 HOH 7  107 178 HOH HOH D . 
M 8 HOH 8  108 118 HOH HOH D . 
M 8 HOH 9  109 81  HOH HOH D . 
M 8 HOH 10 110 131 HOH HOH D . 
N 8 HOH 1  201 105 HOH HOH E . 
N 8 HOH 2  202 157 HOH HOH E . 
N 8 HOH 3  203 122 HOH HOH E . 
N 8 HOH 4  204 11  HOH HOH E . 
N 8 HOH 5  205 15  HOH HOH E . 
N 8 HOH 6  206 124 HOH HOH E . 
N 8 HOH 7  207 40  HOH HOH E . 
N 8 HOH 8  208 126 HOH HOH E . 
N 8 HOH 9  209 41  HOH HOH E . 
N 8 HOH 10 210 53  HOH HOH E . 
N 8 HOH 11 211 129 HOH HOH E . 
N 8 HOH 12 212 147 HOH HOH E . 
N 8 HOH 13 213 158 HOH HOH E . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 author_and_software_defined_assembly PISA monomeric  1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,H,I,J,L,M,N 
2 1 B,F,G,K             
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4030  ? 
1 MORE         -38   ? 
1 'SSA (A^2)'  18160 ? 
2 'ABSA (A^2)' 370   ? 
2 MORE         -29   ? 
2 'SSA (A^2)'  12440 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 "O3'" ? E DC  21  ? E DC  21  ? 1_555 CA ? H CA . ? E CA 101 ? 1_555 OH ? B TYR 129 ? B TYR 171 ? 1_555 68.8  ? 
2 "O3'" ? E DC  21  ? E DC  21  ? 1_555 CA ? H CA . ? E CA 101 ? 1_555 O  ? K HOH .   ? B HOH 501 ? 1_454 91.5  ? 
3 OH    ? B TYR 129 ? B TYR 171 ? 1_555 CA ? H CA . ? E CA 101 ? 1_555 O  ? K HOH .   ? B HOH 501 ? 1_454 142.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-02-28 
2 'Structure model' 1 1 2019-11-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Author supporting evidence' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_pdbx_audit_support.funding_organization' 
2 2 'Structure model' '_pdbx_audit_support.grant_number'         
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.10_2155 1 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .         2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .         3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22      4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .         5 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .         6 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            "O3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_1            D 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DC 
_pdbx_validate_rmsd_bond.auth_seq_id_1             2 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            "C3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_2            D 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DC 
_pdbx_validate_rmsd_bond.auth_seq_id_2             2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.377 
_pdbx_validate_rmsd_bond.bond_target_value         1.419 
_pdbx_validate_rmsd_bond.bond_deviation            -0.042 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.006 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" D DG 9  ? ? "C1'" D DG 9  ? ? N9 D DG 9  ? ? 110.64 108.30 2.34 0.30 N 
2 1 "O4'" E DG 1  ? ? "C1'" E DG 1  ? ? N9 E DG 1  ? ? 110.15 108.30 1.85 0.30 N 
3 1 "O4'" E DT 12 ? ? "C1'" E DT 12 ? ? N1 E DT 12 ? ? 110.21 108.30 1.91 0.30 N 
4 1 "O4'" E DC 21 ? ? "C1'" E DC 21 ? ? N1 E DC 21 ? ? 110.52 108.30 2.22 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TRP A 67  ? ? -164.48 113.39  
2 1 SER A 129 ? ? 43.84   -137.24 
3 1 SER A 129 ? ? 40.95   -135.58 
4 1 PHE A 232 ? ? -144.49 21.12   
5 1 TRP B 67  ? ? -161.32 118.14  
6 1 CYS B 99  ? ? -166.25 118.75  
7 1 SER B 129 ? ? 49.83   -137.68 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 124 ? CG  ? A ASP 82  CG  
2  1 Y 1 A ASP 124 ? OD1 ? A ASP 82  OD1 
3  1 Y 1 A ASP 124 ? OD2 ? A ASP 82  OD2 
4  1 Y 1 A LYS 125 ? CG  ? A LYS 83  CG  
5  1 Y 1 A LYS 125 ? CD  ? A LYS 83  CD  
6  1 Y 1 A LYS 125 ? CE  ? A LYS 83  CE  
7  1 Y 1 A LYS 125 ? NZ  ? A LYS 83  NZ  
8  1 Y 1 A ARG 177 ? CG  ? A ARG 135 CG  
9  1 Y 1 A ARG 177 ? CD  ? A ARG 135 CD  
10 1 Y 1 A ARG 177 ? NE  ? A ARG 135 NE  
11 1 Y 1 A ARG 177 ? CZ  ? A ARG 135 CZ  
12 1 Y 1 A ARG 177 ? NH1 ? A ARG 135 NH1 
13 1 Y 1 A ARG 177 ? NH2 ? A ARG 135 NH2 
14 1 Y 1 A ARG 202 ? CG  ? A ARG 160 CG  
15 1 Y 1 A ARG 202 ? CD  ? A ARG 160 CD  
16 1 Y 1 A ARG 202 ? NE  ? A ARG 160 NE  
17 1 Y 1 A ARG 202 ? CZ  ? A ARG 160 CZ  
18 1 Y 1 A ARG 202 ? NH1 ? A ARG 160 NH1 
19 1 Y 1 A ARG 202 ? NH2 ? A ARG 160 NH2 
20 1 Y 1 B GLU 110 ? CG  ? B GLU 68  CG  
21 1 Y 1 B GLU 110 ? CD  ? B GLU 68  CD  
22 1 Y 1 B GLU 110 ? OE1 ? B GLU 68  OE1 
23 1 Y 1 B GLU 110 ? OE2 ? B GLU 68  OE2 
24 1 Y 1 B ASP 124 ? CG  ? B ASP 82  CG  
25 1 Y 1 B ASP 124 ? OD1 ? B ASP 82  OD1 
26 1 Y 1 B ASP 124 ? OD2 ? B ASP 82  OD2 
27 1 Y 1 B LYS 125 ? CG  ? B LYS 83  CG  
28 1 Y 1 B LYS 125 ? CD  ? B LYS 83  CD  
29 1 Y 1 B LYS 125 ? CE  ? B LYS 83  CE  
30 1 Y 1 B LYS 125 ? NZ  ? B LYS 83  NZ  
31 1 Y 1 B ARG 202 ? CG  ? B ARG 160 CG  
32 1 Y 1 B ARG 202 ? CD  ? B ARG 160 CD  
33 1 Y 1 B ARG 202 ? NE  ? B ARG 160 NE  
34 1 Y 1 B ARG 202 ? CZ  ? B ARG 160 CZ  
35 1 Y 1 B ARG 202 ? NH1 ? B ARG 160 NH1 
36 1 Y 1 B ARG 202 ? NH2 ? B ARG 160 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B ALA 43 ? B ALA 1 
2 1 Y 1 B LEU 44 ? B LEU 2 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5WN1 'double helix'        
5WN1 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DT 1  1_555 E DA 11 1_555 0.080  -0.188 0.336  -25.952 -8.112  1.788  1  C_DT1:DA11_E C 1  ? E 11 ? 20 1 
1 C DC 2  1_555 E DG 10 1_555 0.597  -0.208 0.280  -12.770 -11.579 2.881  2  C_DC2:DG10_E C 2  ? E 10 ? 19 1 
1 C DG 3  1_555 E DC 9  1_555 -0.647 0.102  0.417  -9.708  -17.036 9.404  3  C_DG3:DC9_E  C 3  ? E 9  ? 19 1 
1 C DA 4  1_555 E DT 8  1_555 0.282  0.194  0.229  -3.752  -13.290 -9.899 4  C_DA4:DT8_E  C 4  ? E 8  ? 20 1 
1 C DC 5  1_555 E DG 7  1_555 -1.444 0.470  0.435  -0.994  -9.940  8.196  5  C_DC5:DG7_E  C 5  ? E 7  ? ?  1 
1 C DG 6  1_555 E DC 6  1_555 -0.386 -0.426 1.045  17.190  -12.375 -2.779 6  C_DG6:DC6_E  C 6  ? E 6  ? 19 1 
1 C DG 7  1_555 E DC 5  1_555 -0.627 0.026  0.387  5.823   -16.672 2.403  7  C_DG7:DC5_E  C 7  ? E 5  ? 19 1 
1 C DA 8  1_555 E DT 4  1_555 -0.068 -0.044 0.047  -7.496  -5.280  -3.718 8  C_DA8:DT4_E  C 8  ? E 4  ? 20 1 
1 C DT 9  1_555 E DA 3  1_555 -0.437 -0.191 -0.239 -0.261  -18.808 -4.964 9  C_DT9:DA3_E  C 9  ? E 3  ? 20 1 
1 C DC 10 1_555 E DG 2  1_555 0.286  -0.119 0.503  -10.793 -3.097  -0.312 10 C_DC10:DG2_E C 10 ? E 2  ? 19 1 
1 C DC 11 1_555 E DG 1  1_555 0.010  0.066  -0.231 5.622   3.497   -2.783 11 C_DC11:DG1_E C 11 ? E 1  ? 19 1 
1 D DG 1  1_555 E DC 21 1_555 -0.540 -0.226 -0.377 -20.458 3.092   0.965  12 D_DG1:DC21_E D 1  ? E 21 ? 19 1 
1 D DC 2  1_555 E DG 20 1_555 -0.215 -0.226 0.545  -6.080  -4.715  -2.021 13 D_DC2:DG20_E D 2  ? E 20 ? 19 1 
1 D DT 3  1_555 E DA 19 1_555 -0.219 -0.203 0.348  10.977  -4.375  -2.250 14 D_DT3:DA19_E D 3  ? E 19 ? 20 1 
1 D DG 4  1_555 E DC 18 1_555 -0.130 -0.020 -0.102 10.014  -6.794  1.690  15 D_DG4:DC18_E D 4  ? E 18 ? 19 1 
1 D DA 5  1_555 E DT 17 1_555 0.144  -0.011 0.179  -1.267  -21.619 8.081  16 D_DA5:DT17_E D 5  ? E 17 ? 20 1 
1 D DT 6  1_555 E DA 16 1_555 -0.122 -0.235 -0.540 -0.443  -25.159 3.614  17 D_DT6:DA16_E D 6  ? E 16 ? 20 1 
1 D DG 7  1_555 E DC 15 1_555 0.088  -0.056 0.496  -1.629  -7.288  -0.603 18 D_DG7:DC15_E D 7  ? E 15 ? 19 1 
1 D DC 8  1_555 E DG 14 1_555 0.317  0.100  0.051  6.789   -5.094  4.234  19 D_DC8:DG14_E D 8  ? E 14 ? 19 1 
1 D DG 9  1_555 E DC 13 1_555 -0.096 -0.175 0.331  10.144  -12.495 8.179  20 D_DG9:DC13_E D 9  ? E 13 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DT 1  1_555 E DA 11 1_555 C DC 2  1_555 E DG 10 1_555 0.213  0.008  3.017 0.028  4.072  32.528 -0.633 -0.373 2.996 7.233  
-0.050  32.776 1  CC_DT1DC2:DG10DA11_EE C 1  ? E 11 ? C 2  ? E 10 ? 
1 C DC 2  1_555 E DG 10 1_555 C DG 3  1_555 E DC 9  1_555 0.316  0.490  3.263 -1.474 5.414  27.198 -0.295 -1.017 3.275 11.360 
3.093   27.760 2  CC_DC2DG3:DC9DG10_EE  C 2  ? E 10 ? C 3  ? E 9  ? 
1 C DG 3  1_555 E DC 9  1_555 C DA 4  1_555 E DT 8  1_555 -0.918 0.044  3.130 -1.294 7.106  39.423 -0.719 1.198  3.119 10.427 
1.899   40.054 3  CC_DG3DA4:DT8DC9_EE   C 3  ? E 9  ? C 4  ? E 8  ? 
1 C DA 4  1_555 E DT 8  1_555 C DC 5  1_555 E DG 7  1_555 0.969  -1.023 3.087 1.086  3.126  23.051 -3.533 -2.054 2.965 7.770  
-2.700  23.284 4  CC_DA4DC5:DG7DT8_EE   C 4  ? E 8  ? C 5  ? E 7  ? 
1 C DC 5  1_555 E DG 7  1_555 C DG 6  1_555 E DC 6  1_555 -0.047 0.580  2.930 -5.442 5.507  35.958 0.237  -0.601 2.959 8.795  
8.692   36.755 5  CC_DC5DG6:DC6DG7_EE   C 5  ? E 7  ? C 6  ? E 6  ? 
1 C DG 6  1_555 E DC 6  1_555 C DG 7  1_555 E DC 5  1_555 0.257  -0.881 3.461 5.178  2.988  34.532 -1.937 0.393  3.377 4.988  
-8.642  35.030 6  CC_DG6DG7:DC5DC6_EE   C 6  ? E 6  ? C 7  ? E 5  ? 
1 C DG 7  1_555 E DC 5  1_555 C DA 8  1_555 E DT 4  1_555 -0.386 -0.405 3.536 -0.912 -2.288 41.756 -0.307 0.437  3.560 -3.207 
1.279   41.826 7  CC_DG7DA8:DT4DC5_EE   C 7  ? E 5  ? C 8  ? E 4  ? 
1 C DA 8  1_555 E DT 4  1_555 C DT 9  1_555 E DA 3  1_555 -0.343 -0.788 3.213 3.940  -5.089 31.315 -0.514 1.334  3.231 -9.305 
-7.204  31.953 8  CC_DA8DT9:DA3DT4_EE   C 8  ? E 4  ? C 9  ? E 3  ? 
1 C DT 9  1_555 E DA 3  1_555 C DC 10 1_555 E DG 2  1_555 0.246  -0.506 3.658 -5.006 -1.345 36.347 -0.598 -1.155 3.609 -2.142 
7.975   36.702 9  CC_DT9DC10:DG2DA3_EE  C 9  ? E 3  ? C 10 ? E 2  ? 
1 C DC 10 1_555 E DG 2  1_555 C DC 11 1_555 E DG 1  1_555 1.097  1.320  3.087 10.525 4.614  35.524 1.442  -0.296 3.404 7.329  
-16.719 37.279 10 CC_DC10DC11:DG1DG2_EE C 10 ? E 2  ? C 11 ? E 1  ? 
1 D DG 1  1_555 E DC 21 1_555 D DC 2  1_555 E DG 20 1_555 -0.958 -0.366 3.066 -8.118 0.209  25.918 -0.831 0.032  3.209 0.452  
17.559  27.139 11 DD_DG1DC2:DG20DC21_EE D 1  ? E 21 ? D 2  ? E 20 ? 
1 D DC 2  1_555 E DG 20 1_555 D DT 3  1_555 E DA 19 1_555 -0.290 -0.582 2.900 1.237  0.253  27.150 -1.295 0.891  2.879 0.539  
-2.632  27.179 12 DD_DC2DT3:DA19DG20_EE D 2  ? E 20 ? D 3  ? E 19 ? 
1 D DT 3  1_555 E DA 19 1_555 D DG 4  1_555 E DC 18 1_555 0.977  -0.060 3.387 6.212  9.134  34.674 -1.449 -0.646 3.384 14.866 
-10.110 36.340 13 DD_DT3DG4:DC18DA19_EE D 3  ? E 19 ? D 4  ? E 18 ? 
1 D DG 4  1_555 E DC 18 1_555 D DA 5  1_555 E DT 17 1_555 -0.105 -0.385 3.505 -5.638 -1.966 39.184 -0.321 -0.556 3.501 -2.910 
8.348   39.619 14 DD_DG4DA5:DT17DC18_EE D 4  ? E 18 ? D 5  ? E 17 ? 
1 D DA 5  1_555 E DT 17 1_555 D DT 6  1_555 E DA 16 1_555 -0.707 -0.659 3.197 6.283  2.304  33.695 -1.460 2.134  2.970 3.927  
-10.708 34.334 15 DD_DA5DT6:DA16DT17_EE D 5  ? E 17 ? D 6  ? E 16 ? 
1 D DT 6  1_555 E DA 16 1_555 D DG 7  1_555 E DC 15 1_555 -0.390 0.282  3.471 -7.470 10.158 34.417 -1.074 -0.499 3.424 16.497 
12.132  36.588 16 DD_DT6DG7:DC15DA16_EE D 6  ? E 16 ? D 7  ? E 15 ? 
1 D DG 7  1_555 E DC 15 1_555 D DC 8  1_555 E DG 14 1_555 1.025  -0.521 3.054 4.004  6.599  29.269 -2.251 -1.203 2.978 12.782 
-7.754  30.248 17 DD_DG7DC8:DG14DC15_EE D 7  ? E 15 ? D 8  ? E 14 ? 
1 D DC 8  1_555 E DG 14 1_555 D DG 9  1_555 E DC 13 1_555 0.634  -0.583 3.118 1.669  6.102  26.289 -2.706 -0.958 2.944 13.175 
-3.604  27.026 18 DD_DC8DG9:DC13DG14_EE D 8  ? E 14 ? D 9  ? E 13 ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of Environmental Health Sciences (NIH/NIEHS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           ES024431 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'CHLORIDE ION' CL  
6 'SODIUM ION'   NA  
7 'CALCIUM ION'  CA  
8 water          HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#