data_5WRV
# 
_entry.id   5WRV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.280 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5WRV         
WWPDB D_1300002294 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          5WRW 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5WRV 
_pdbx_database_status.recvd_initial_deposition_date   2016-12-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gao, Y.'  1 
'Chen, Z.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J Mol Cell Biol' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1759-4685 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            9 
_citation.language                  ? 
_citation.page_first                220 
_citation.page_last                 230 
_citation.title                     
'Human apo-SRP72 and SRP68/72 complex structures reveal the molecular basis of protein translocation' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/jmcb/mjx010 
_citation.pdbx_database_id_PubMed   28369529 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gao, Y.'   1  
primary 'Zhang, Q.' 2  
primary 'Lang, Y.'  3  
primary 'Liu, Y.'   4  
primary 'Dong, X.'  5  
primary 'Chen, Z.'  6  
primary 'Tian, W.'  7  
primary 'Tang, J.'  8  
primary 'Wu, W.'    9  
primary 'Tong, Y.'  10 
primary 'Chen, Z.'  11 
# 
_cell.entry_id           5WRV 
_cell.length_a           120.598 
_cell.length_b           120.598 
_cell.length_c           80.001 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5WRV 
_symmetry.space_group_name_H-M             'P 63 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                182 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Signal recognition particle subunit SRP68' 11627.160 1   ? 'E608A, Q609A, K610A' 'UNP residues 509-614' ? 
2 polymer     man 'Signal recognition particle subunit SRP72' 18478.736 1   ? ?                     'UNP residues 1-163'   ? 
3 non-polymer syn 'ACETATE ION'                               59.044    2   ? ?                     ?                      ? 
4 non-polymer syn GLYCEROL                                    92.094    5   ? ?                     ?                      ? 
5 non-polymer syn 'SULFATE ION'                               96.063    2   ? ?                     ?                      ? 
6 non-polymer syn 'SODIUM ION'                                22.990    1   ? ?                     ?                      ? 
7 water       nat water                                       18.015    226 ? ?                     ?                      ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'SRP68,Signal recognition particle 68 kDa protein' 
2 'SRP72,Signal recognition particle 72 kDa protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DLPDVQELITQVRSEKCSLQAAAILDANDAHQTETSSSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKP
LFFDLALNHVAFPPLEDKLAAATKSG
;
;DLPDVQELITQVRSEKCSLQAAAILDANDAHQTETSSSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKP
LFFDLALNHVAFPPLEDKLAAATKSG
;
A ? 
2 'polypeptide(L)' no no 
;MASGGSGGVSVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGSFKEALNVINTHTKVLANNSL
SFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLYRLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSN
WEK
;
;MASGGSGGVSVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGSFKEALNVINTHTKVLANNSL
SFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLYRLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSN
WEK
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   LEU n 
1 3   PRO n 
1 4   ASP n 
1 5   VAL n 
1 6   GLN n 
1 7   GLU n 
1 8   LEU n 
1 9   ILE n 
1 10  THR n 
1 11  GLN n 
1 12  VAL n 
1 13  ARG n 
1 14  SER n 
1 15  GLU n 
1 16  LYS n 
1 17  CYS n 
1 18  SER n 
1 19  LEU n 
1 20  GLN n 
1 21  ALA n 
1 22  ALA n 
1 23  ALA n 
1 24  ILE n 
1 25  LEU n 
1 26  ASP n 
1 27  ALA n 
1 28  ASN n 
1 29  ASP n 
1 30  ALA n 
1 31  HIS n 
1 32  GLN n 
1 33  THR n 
1 34  GLU n 
1 35  THR n 
1 36  SER n 
1 37  SER n 
1 38  SER n 
1 39  GLN n 
1 40  VAL n 
1 41  LYS n 
1 42  ASP n 
1 43  ASN n 
1 44  LYS n 
1 45  PRO n 
1 46  LEU n 
1 47  VAL n 
1 48  GLU n 
1 49  ARG n 
1 50  PHE n 
1 51  GLU n 
1 52  THR n 
1 53  PHE n 
1 54  CYS n 
1 55  LEU n 
1 56  ASP n 
1 57  PRO n 
1 58  SER n 
1 59  LEU n 
1 60  VAL n 
1 61  THR n 
1 62  LYS n 
1 63  GLN n 
1 64  ALA n 
1 65  ASN n 
1 66  LEU n 
1 67  VAL n 
1 68  HIS n 
1 69  PHE n 
1 70  PRO n 
1 71  PRO n 
1 72  GLY n 
1 73  PHE n 
1 74  GLN n 
1 75  PRO n 
1 76  ILE n 
1 77  PRO n 
1 78  CYS n 
1 79  LYS n 
1 80  PRO n 
1 81  LEU n 
1 82  PHE n 
1 83  PHE n 
1 84  ASP n 
1 85  LEU n 
1 86  ALA n 
1 87  LEU n 
1 88  ASN n 
1 89  HIS n 
1 90  VAL n 
1 91  ALA n 
1 92  PHE n 
1 93  PRO n 
1 94  PRO n 
1 95  LEU n 
1 96  GLU n 
1 97  ASP n 
1 98  LYS n 
1 99  LEU n 
1 100 ALA n 
1 101 ALA n 
1 102 ALA n 
1 103 THR n 
1 104 LYS n 
1 105 SER n 
1 106 GLY n 
2 1   MET n 
2 2   ALA n 
2 3   SER n 
2 4   GLY n 
2 5   GLY n 
2 6   SER n 
2 7   GLY n 
2 8   GLY n 
2 9   VAL n 
2 10  SER n 
2 11  VAL n 
2 12  PRO n 
2 13  ALA n 
2 14  LEU n 
2 15  TRP n 
2 16  SER n 
2 17  GLU n 
2 18  VAL n 
2 19  ASN n 
2 20  ARG n 
2 21  TYR n 
2 22  GLY n 
2 23  GLN n 
2 24  ASN n 
2 25  GLY n 
2 26  ASP n 
2 27  PHE n 
2 28  THR n 
2 29  ARG n 
2 30  ALA n 
2 31  LEU n 
2 32  LYS n 
2 33  THR n 
2 34  VAL n 
2 35  ASN n 
2 36  LYS n 
2 37  ILE n 
2 38  LEU n 
2 39  GLN n 
2 40  ILE n 
2 41  ASN n 
2 42  LYS n 
2 43  ASP n 
2 44  ASP n 
2 45  VAL n 
2 46  THR n 
2 47  ALA n 
2 48  LEU n 
2 49  HIS n 
2 50  CYS n 
2 51  LYS n 
2 52  VAL n 
2 53  VAL n 
2 54  CYS n 
2 55  LEU n 
2 56  ILE n 
2 57  GLN n 
2 58  ASN n 
2 59  GLY n 
2 60  SER n 
2 61  PHE n 
2 62  LYS n 
2 63  GLU n 
2 64  ALA n 
2 65  LEU n 
2 66  ASN n 
2 67  VAL n 
2 68  ILE n 
2 69  ASN n 
2 70  THR n 
2 71  HIS n 
2 72  THR n 
2 73  LYS n 
2 74  VAL n 
2 75  LEU n 
2 76  ALA n 
2 77  ASN n 
2 78  ASN n 
2 79  SER n 
2 80  LEU n 
2 81  SER n 
2 82  PHE n 
2 83  GLU n 
2 84  LYS n 
2 85  ALA n 
2 86  TYR n 
2 87  CYS n 
2 88  GLU n 
2 89  TYR n 
2 90  ARG n 
2 91  LEU n 
2 92  ASN n 
2 93  ARG n 
2 94  ILE n 
2 95  GLU n 
2 96  ASN n 
2 97  ALA n 
2 98  LEU n 
2 99  LYS n 
2 100 THR n 
2 101 ILE n 
2 102 GLU n 
2 103 SER n 
2 104 ALA n 
2 105 ASN n 
2 106 GLN n 
2 107 GLN n 
2 108 THR n 
2 109 ASP n 
2 110 LYS n 
2 111 LEU n 
2 112 LYS n 
2 113 GLU n 
2 114 LEU n 
2 115 TYR n 
2 116 GLY n 
2 117 GLN n 
2 118 VAL n 
2 119 LEU n 
2 120 TYR n 
2 121 ARG n 
2 122 LEU n 
2 123 GLU n 
2 124 ARG n 
2 125 TYR n 
2 126 ASP n 
2 127 GLU n 
2 128 CYS n 
2 129 LEU n 
2 130 ALA n 
2 131 VAL n 
2 132 TYR n 
2 133 ARG n 
2 134 ASP n 
2 135 LEU n 
2 136 VAL n 
2 137 ARG n 
2 138 ASN n 
2 139 SER n 
2 140 GLN n 
2 141 ASP n 
2 142 ASP n 
2 143 TYR n 
2 144 ASP n 
2 145 GLU n 
2 146 GLU n 
2 147 ARG n 
2 148 LYS n 
2 149 THR n 
2 150 ASN n 
2 151 LEU n 
2 152 SER n 
2 153 ALA n 
2 154 VAL n 
2 155 VAL n 
2 156 ALA n 
2 157 ALA n 
2 158 GLN n 
2 159 SER n 
2 160 ASN n 
2 161 TRP n 
2 162 GLU n 
2 163 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 106 Human ? SRP68 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 163 Human ? SRP72 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP SRP68_HUMAN Q9UHB9 ? 1 
;DLPDVQELITQVRSEKCSLQAAAILDANDAHQTETSSSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKP
LFFDLALNHVAFPPLEDKLEQKTKSG
;
509 
2 UNP SRP72_HUMAN O76094 ? 2 
;MASGGSGGVSVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGSFKEALNVINTHTKVLANNSL
SFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLYRLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSN
WEK
;
1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5WRV A 1 ? 106 ? Q9UHB9 509 ? 614 ? 509 614 
2 2 5WRV B 1 ? 163 ? O76094 1   ? 163 ? 1   163 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5WRV ALA A 100 ? UNP Q9UHB9 GLU 608 'engineered mutation' 608 1 
1 5WRV ALA A 101 ? UNP Q9UHB9 GLN 609 'engineered mutation' 609 2 
1 5WRV ALA A 102 ? UNP Q9UHB9 LYS 610 'engineered mutation' 610 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'   ?                               'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ?                               'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5WRV 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.77 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.65 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '(NH4)2SO4' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         RIGAKU 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-05-22 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL19U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9792 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL19U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5WRV 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.700 
_reflns.number_obs                   38126 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.612 
_reflns.pdbx_netI_over_sigmaI        62.2000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              13.20 
_reflns.pdbx_CC_half                 ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5WRV 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     36033 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    99.4 
_refine.ls_R_factor_obs                          0.165 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.164 
_refine.ls_R_factor_R_free                       0.189 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.900 
_refine.ls_number_reflns_R_free                  1868 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.972 
_refine.correlation_coeff_Fo_to_Fc_free          0.963 
_refine.B_iso_mean                               36.78 
_refine.aniso_B[1][1]                            -1.09000 
_refine.aniso_B[2][2]                            -1.09000 
_refine.aniso_B[3][3]                            1.63000 
_refine.aniso_B[1][2]                            -0.54000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN USED IF PRESENT IN
 THE INPUT
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.082 
_refine.pdbx_overall_ESU_R_Free                  0.071 
_refine.overall_SU_ML                            0.048 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.349 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1396 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         49 
_refine_hist.number_atoms_solvent             226 
_refine_hist.number_atoms_total               1671 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.007  0.020  ? 1500 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.007  1.975  ? 2029 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.846  5.000  ? 185  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.942 24.507 ? 71   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.189 15.000 ? 252  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       12.577 15.000 ? 10   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.072  0.200  ? 237  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 1110 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           2.490  3.000  ? 1500 'X-RAY DIFFRACTION' ? 
r_sphericity_free            28.069 5.000  ? 75   'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          12.727 5.000  ? 1634 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.70 
_refine_ls_shell.d_res_low                        1.75 
_refine_ls_shell.number_reflns_R_work             2407 
_refine_ls_shell.R_factor_R_work                  0.3280 
_refine_ls_shell.percent_reflns_obs               99.45 
_refine_ls_shell.R_factor_R_free                  0.3370 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             111 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     5WRV 
_struct.title                        'Complex structure of human SRP72/SRP68' 
_struct.pdbx_descriptor              'Ig gamma-1 chain C region' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5WRV 
_struct_keywords.text            'Complex, human, SRP72, SRP68, signal recognition particle, PROTEIN TRANSPORT' 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 7 ? 
N N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 84  ? VAL A 90  ? ASP A 592 VAL A 598 5 ? 7  
HELX_P HELX_P2  AA2 LEU A 95  ? ALA A 100 ? LEU A 603 ALA A 608 1 ? 6  
HELX_P HELX_P3  AA3 SER B 10  ? ASN B 24  ? SER B 10  ASN B 24  1 ? 15 
HELX_P HELX_P4  AA4 ASP B 26  ? ASN B 41  ? ASP B 26  ASN B 41  1 ? 16 
HELX_P HELX_P5  AA5 ASP B 44  ? ASN B 58  ? ASP B 44  ASN B 58  1 ? 15 
HELX_P HELX_P6  AA6 SER B 60  ? THR B 70  ? SER B 60  THR B 70  1 ? 11 
HELX_P HELX_P7  AA7 LEU B 80  ? LEU B 91  ? LEU B 80  LEU B 91  1 ? 12 
HELX_P HELX_P8  AA8 ARG B 93  ? SER B 103 ? ARG B 93  SER B 103 1 ? 11 
HELX_P HELX_P9  AA9 THR B 108 ? LEU B 122 ? THR B 108 LEU B 122 1 ? 15 
HELX_P HELX_P10 AB1 ARG B 124 ? SER B 139 ? ARG B 124 SER B 139 1 ? 16 
HELX_P HELX_P11 AB2 TYR B 143 ? ASN B 160 ? TYR B 143 ASN B 160 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B GLU 113 OE2 ? ? ? 1_555 G NA . NA ? ? B GLU 113 B NA 203 1_555 ? ? ? ? ? ? ? 2.829 ? 
metalc2 metalc ? ? B TYR 132 OH  ? ? ? 1_555 G NA . NA ? ? B TYR 132 B NA 203 1_555 ? ? ? ? ? ? ? 2.592 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ACT 701 ? 4  'binding site for residue ACT A 701' 
AC2 Software A GOL 702 ? 6  'binding site for residue GOL A 702' 
AC3 Software B SO4 201 ? 10 'binding site for residue SO4 B 201' 
AC4 Software B SO4 202 ? 7  'binding site for residue SO4 B 202' 
AC5 Software B NA  203 ? 5  'binding site for residue NA B 203'  
AC6 Software B ACT 204 ? 7  'binding site for residue ACT B 204' 
AC7 Software B GOL 205 ? 2  'binding site for residue GOL B 205' 
AC8 Software B GOL 206 ? 8  'binding site for residue GOL B 206' 
AC9 Software B GOL 207 ? 5  'binding site for residue GOL B 207' 
AD1 Software B GOL 208 ? 7  'binding site for residue GOL B 208' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  LYS A 98  ? LYS A 606 . ? 1_555  ? 
2  AC1 4  ASP B 44  ? ASP B 44  . ? 1_555  ? 
3  AC1 4  VAL B 45  ? VAL B 45  . ? 1_555  ? 
4  AC1 4  THR B 46  ? THR B 46  . ? 1_555  ? 
5  AC2 6  PHE A 83  ? PHE A 591 . ? 1_555  ? 
6  AC2 6  ASP A 84  ? ASP A 592 . ? 1_555  ? 
7  AC2 6  LEU A 85  ? LEU A 593 . ? 1_555  ? 
8  AC2 6  ASN A 88  ? ASN A 596 . ? 1_555  ? 
9  AC2 6  ASN B 24  ? ASN B 24  . ? 11_554 ? 
10 AC2 6  HOH N .   ? HOH B 319 . ? 11_554 ? 
11 AC3 10 ASN B 77  ? ASN B 77  . ? 1_555  ? 
12 AC3 10 ASN B 78  ? ASN B 78  . ? 1_555  ? 
13 AC3 10 SER B 79  ? SER B 79  . ? 1_555  ? 
14 AC3 10 LEU B 80  ? LEU B 80  . ? 1_555  ? 
15 AC3 10 SER B 81  ? SER B 81  . ? 1_555  ? 
16 AC3 10 ALA B 104 ? ALA B 104 . ? 1_555  ? 
17 AC3 10 ASN B 105 ? ASN B 105 . ? 1_555  ? 
18 AC3 10 GLN B 106 ? GLN B 106 . ? 1_555  ? 
19 AC3 10 HOH N .   ? HOH B 316 . ? 1_555  ? 
20 AC3 10 HOH N .   ? HOH B 394 . ? 1_555  ? 
21 AC4 7  SER B 60  ? SER B 60  . ? 1_555  ? 
22 AC4 7  PHE B 61  ? PHE B 61  . ? 1_555  ? 
23 AC4 7  LYS B 62  ? LYS B 62  . ? 1_555  ? 
24 AC4 7  GLU B 63  ? GLU B 63  . ? 1_555  ? 
25 AC4 7  HOH N .   ? HOH B 305 . ? 1_555  ? 
26 AC4 7  HOH N .   ? HOH B 374 . ? 1_555  ? 
27 AC4 7  HOH N .   ? HOH B 488 . ? 11_554 ? 
28 AC5 5  LEU A 85  ? LEU A 593 . ? 1_555  ? 
29 AC5 5  GLU B 113 ? GLU B 113 . ? 1_555  ? 
30 AC5 5  GLN B 117 ? GLN B 117 . ? 1_555  ? 
31 AC5 5  TYR B 132 ? TYR B 132 . ? 1_555  ? 
32 AC5 5  ASN B 150 ? ASN B 150 . ? 1_555  ? 
33 AC6 7  LEU A 87  ? LEU A 595 . ? 1_555  ? 
34 AC6 7  HOH M .   ? HOH A 806 . ? 1_555  ? 
35 AC6 7  ASN B 24  ? ASN B 24  . ? 11_554 ? 
36 AC6 7  GLY B 25  ? GLY B 25  . ? 11_554 ? 
37 AC6 7  GLN B 57  ? GLN B 57  . ? 1_555  ? 
38 AC6 7  HOH N .   ? HOH B 396 . ? 1_555  ? 
39 AC6 7  HOH N .   ? HOH B 457 . ? 11_554 ? 
40 AC7 2  ILE B 101 ? ILE B 101 . ? 1_555  ? 
41 AC7 2  GLN B 107 ? GLN B 107 . ? 1_555  ? 
42 AC8 8  ALA A 91  ? ALA A 599 . ? 1_555  ? 
43 AC8 8  PHE A 92  ? PHE A 600 . ? 1_555  ? 
44 AC8 8  HOH M .   ? HOH A 803 . ? 1_555  ? 
45 AC8 8  HOH M .   ? HOH A 807 . ? 1_555  ? 
46 AC8 8  GLY B 22  ? GLY B 22  . ? 1_555  ? 
47 AC8 8  GLN B 23  ? GLN B 23  . ? 1_555  ? 
48 AC8 8  PHE B 27  ? PHE B 27  . ? 1_555  ? 
49 AC8 8  HOH N .   ? HOH B 349 . ? 1_555  ? 
50 AC9 5  ARG B 29  ? ARG B 29  . ? 11_554 ? 
51 AC9 5  LYS B 32  ? LYS B 32  . ? 11_554 ? 
52 AC9 5  ARG B 121 ? ARG B 121 . ? 1_555  ? 
53 AC9 5  HOH N .   ? HOH B 303 . ? 1_555  ? 
54 AC9 5  HOH N .   ? HOH B 346 . ? 1_555  ? 
55 AD1 7  SER B 16  ? SER B 16  . ? 1_555  ? 
56 AD1 7  ASN B 19  ? ASN B 19  . ? 1_555  ? 
57 AD1 7  ARG B 20  ? ARG B 20  . ? 1_555  ? 
58 AD1 7  LYS B 148 ? LYS B 148 . ? 2_445  ? 
59 AD1 7  THR B 149 ? THR B 149 . ? 2_445  ? 
60 AD1 7  SER B 152 ? SER B 152 . ? 2_445  ? 
61 AD1 7  HOH N .   ? HOH B 368 . ? 2_445  ? 
# 
_atom_sites.entry_id                    5WRV 
_atom_sites.fract_transf_matrix[1][1]   0.008292 
_atom_sites.fract_transf_matrix[1][2]   0.004787 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009575 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012500 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 80  ? 24.182  -55.137 -15.136 1.00 84.76 ? 588 PRO A N   1 
ATOM   2    C  CA  . PRO A 1 80  ? 24.282  -53.948 -15.974 1.00 76.56 ? 588 PRO A CA  1 
ATOM   3    C  C   . PRO A 1 80  ? 22.956  -53.185 -16.056 1.00 63.47 ? 588 PRO A C   1 
ATOM   4    O  O   . PRO A 1 80  ? 22.943  -51.954 -15.948 1.00 67.62 ? 588 PRO A O   1 
ATOM   5    C  CB  . PRO A 1 80  ? 24.679  -54.513 -17.349 1.00 70.14 ? 588 PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 80  ? 25.050  -55.950 -17.120 1.00 84.40 ? 588 PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 80  ? 25.026  -56.224 -15.645 1.00 86.85 ? 588 PRO A CD  1 
ATOM   8    N  N   . LEU A 1 81  ? 21.858  -53.912 -16.251 1.00 53.16 ? 589 LEU A N   1 
ATOM   9    C  CA  . LEU A 1 81  ? 20.523  -53.309 -16.232 1.00 44.95 ? 589 LEU A CA  1 
ATOM   10   C  C   . LEU A 1 81  ? 20.022  -53.150 -14.810 1.00 32.68 ? 589 LEU A C   1 
ATOM   11   O  O   . LEU A 1 81  ? 20.324  -53.971 -13.951 1.00 35.47 ? 589 LEU A O   1 
ATOM   12   C  CB  . LEU A 1 81  ? 19.530  -54.161 -17.031 1.00 45.92 ? 589 LEU A CB  1 
ATOM   13   C  CG  . LEU A 1 81  ? 19.135  -53.712 -18.441 1.00 51.98 ? 589 LEU A CG  1 
ATOM   14   C  CD1 . LEU A 1 81  ? 20.345  -53.450 -19.331 1.00 60.17 ? 589 LEU A CD1 1 
ATOM   15   C  CD2 . LEU A 1 81  ? 18.223  -54.756 -19.071 1.00 52.43 ? 589 LEU A CD2 1 
ATOM   16   N  N   . PHE A 1 82  ? 19.251  -52.093 -14.565 1.00 32.04 ? 590 PHE A N   1 
ATOM   17   C  CA  . PHE A 1 82  ? 18.554  -51.928 -13.294 1.00 28.86 ? 590 PHE A CA  1 
ATOM   18   C  C   . PHE A 1 82  ? 17.087  -51.648 -13.599 1.00 28.78 ? 590 PHE A C   1 
ATOM   19   O  O   . PHE A 1 82  ? 16.772  -50.690 -14.302 1.00 32.37 ? 590 PHE A O   1 
ATOM   20   C  CB  . PHE A 1 82  ? 19.153  -50.777 -12.476 1.00 28.60 ? 590 PHE A CB  1 
ATOM   21   C  CG  . PHE A 1 82  ? 18.678  -50.730 -11.048 1.00 29.15 ? 590 PHE A CG  1 
ATOM   22   C  CD1 . PHE A 1 82  ? 17.575  -49.956 -10.681 1.00 28.16 ? 590 PHE A CD1 1 
ATOM   23   C  CD2 . PHE A 1 82  ? 19.340  -51.455 -10.059 1.00 26.52 ? 590 PHE A CD2 1 
ATOM   24   C  CE1 . PHE A 1 82  ? 17.149  -49.907 -9.356  1.00 26.32 ? 590 PHE A CE1 1 
ATOM   25   C  CE2 . PHE A 1 82  ? 18.913  -51.416 -8.742  1.00 25.61 ? 590 PHE A CE2 1 
ATOM   26   C  CZ  . PHE A 1 82  ? 17.815  -50.642 -8.388  1.00 26.30 ? 590 PHE A CZ  1 
ATOM   27   N  N   . PHE A 1 83  ? 16.201  -52.484 -13.068 1.00 25.93 ? 591 PHE A N   1 
ATOM   28   C  CA  . PHE A 1 83  ? 14.768  -52.392 -13.375 1.00 26.17 ? 591 PHE A CA  1 
ATOM   29   C  C   . PHE A 1 83  ? 13.993  -51.580 -12.347 1.00 25.53 ? 591 PHE A C   1 
ATOM   30   O  O   . PHE A 1 83  ? 14.177  -51.762 -11.140 1.00 25.35 ? 591 PHE A O   1 
ATOM   31   C  CB  . PHE A 1 83  ? 14.148  -53.792 -13.453 1.00 27.28 ? 591 PHE A CB  1 
ATOM   32   C  CG  . PHE A 1 83  ? 14.667  -54.621 -14.589 1.00 30.79 ? 591 PHE A CG  1 
ATOM   33   C  CD1 . PHE A 1 83  ? 14.232  -54.392 -15.892 1.00 36.48 ? 591 PHE A CD1 1 
ATOM   34   C  CD2 . PHE A 1 83  ? 15.588  -55.637 -14.356 1.00 31.84 ? 591 PHE A CD2 1 
ATOM   35   C  CE1 . PHE A 1 83  ? 14.712  -55.158 -16.944 1.00 36.55 ? 591 PHE A CE1 1 
ATOM   36   C  CE2 . PHE A 1 83  ? 16.070  -56.409 -15.408 1.00 35.18 ? 591 PHE A CE2 1 
ATOM   37   C  CZ  . PHE A 1 83  ? 15.632  -56.167 -16.701 1.00 37.04 ? 591 PHE A CZ  1 
ATOM   38   N  N   . ASP A 1 84  ? 13.115  -50.700 -12.834 1.00 24.82 ? 592 ASP A N   1 
ATOM   39   C  CA  . ASP A 1 84  ? 12.147  -50.017 -11.973 1.00 24.37 ? 592 ASP A CA  1 
ATOM   40   C  C   . ASP A 1 84  ? 10.976  -50.961 -11.707 1.00 23.96 ? 592 ASP A C   1 
ATOM   41   O  O   . ASP A 1 84  ? 9.921   -50.872 -12.357 1.00 25.96 ? 592 ASP A O   1 
ATOM   42   C  CB  . ASP A 1 84  ? 11.674  -48.702 -12.621 1.00 24.23 ? 592 ASP A CB  1 
ATOM   43   C  CG  . ASP A 1 84  ? 10.617  -47.964 -11.791 1.00 21.33 ? 592 ASP A CG  1 
ATOM   44   O  OD1 . ASP A 1 84  ? 10.295  -48.383 -10.655 1.00 22.34 ? 592 ASP A OD1 1 
ATOM   45   O  OD2 . ASP A 1 84  ? 10.107  -46.940 -12.282 1.00 23.89 ? 592 ASP A OD2 1 
ATOM   46   N  N   . LEU A 1 85  ? 11.157  -51.864 -10.750 1.00 21.94 ? 593 LEU A N   1 
ATOM   47   C  CA  . LEU A 1 85  ? 10.093  -52.806 -10.373 1.00 23.39 ? 593 LEU A CA  1 
ATOM   48   C  C   . LEU A 1 85  ? 8.990   -52.143 -9.555  1.00 24.50 ? 593 LEU A C   1 
ATOM   49   O  O   . LEU A 1 85  ? 7.861   -52.633 -9.520  1.00 26.05 ? 593 LEU A O   1 
ATOM   50   C  CB  . LEU A 1 85  ? 10.662  -54.020 -9.626  1.00 25.38 ? 593 LEU A CB  1 
ATOM   51   C  CG  . LEU A 1 85  ? 11.658  -54.860 -10.429 1.00 27.73 ? 593 LEU A CG  1 
ATOM   52   C  CD1 . LEU A 1 85  ? 12.236  -55.977 -9.569  1.00 30.24 ? 593 LEU A CD1 1 
ATOM   53   C  CD2 . LEU A 1 85  ? 11.020  -55.411 -11.705 1.00 30.07 ? 593 LEU A CD2 1 
ATOM   54   N  N   . ALA A 1 86  ? 9.307   -51.025 -8.900  1.00 22.53 ? 594 ALA A N   1 
ATOM   55   C  CA  . ALA A 1 86  ? 8.287   -50.267 -8.166  1.00 23.04 ? 594 ALA A CA  1 
ATOM   56   C  C   . ALA A 1 86  ? 7.107   -49.867 -9.067  1.00 22.50 ? 594 ALA A C   1 
ATOM   57   O  O   . ALA A 1 86  ? 5.951   -49.874 -8.626  1.00 23.93 ? 594 ALA A O   1 
ATOM   58   C  CB  . ALA A 1 86  ? 8.901   -49.038 -7.496  1.00 24.22 ? 594 ALA A CB  1 
ATOM   59   N  N   . LEU A 1 87  ? 7.398   -49.538 -10.321 1.00 21.98 ? 595 LEU A N   1 
ATOM   60   C  CA  . LEU A 1 87  ? 6.351   -49.156 -11.292 1.00 22.30 ? 595 LEU A CA  1 
ATOM   61   C  C   . LEU A 1 87  ? 5.290   -50.245 -11.450 1.00 23.73 ? 595 LEU A C   1 
ATOM   62   O  O   . LEU A 1 87  ? 4.095   -49.944 -11.620 1.00 24.10 ? 595 LEU A O   1 
ATOM   63   C  CB  . LEU A 1 87  ? 6.964   -48.813 -12.650 1.00 23.97 ? 595 LEU A CB  1 
ATOM   64   C  CG  . LEU A 1 87  ? 6.032   -48.381 -13.798 1.00 25.31 ? 595 LEU A CG  1 
ATOM   65   C  CD1 . LEU A 1 87  ? 5.117   -47.234 -13.382 1.00 26.13 ? 595 LEU A CD1 1 
ATOM   66   C  CD2 . LEU A 1 87  ? 6.860   -47.980 -15.014 1.00 26.45 ? 595 LEU A CD2 1 
ATOM   67   N  N   . ASN A 1 88  ? 5.726   -51.501 -11.373 1.00 22.86 ? 596 ASN A N   1 
ATOM   68   C  CA  . ASN A 1 88  ? 4.813   -52.651 -11.466 1.00 25.24 ? 596 ASN A CA  1 
ATOM   69   C  C   . ASN A 1 88  ? 3.808   -52.735 -10.313 1.00 26.24 ? 596 ASN A C   1 
ATOM   70   O  O   . ASN A 1 88  ? 2.797   -53.418 -10.433 1.00 30.77 ? 596 ASN A O   1 
ATOM   71   C  CB  . ASN A 1 88  ? 5.602   -53.962 -11.533 1.00 25.99 ? 596 ASN A CB  1 
ATOM   72   C  CG  . ASN A 1 88  ? 6.439   -54.084 -12.788 1.00 31.01 ? 596 ASN A CG  1 
ATOM   73   O  OD1 . ASN A 1 88  ? 6.030   -53.681 -13.872 1.00 35.45 ? 596 ASN A OD1 1 
ATOM   74   N  ND2 . ASN A 1 88  ? 7.616   -54.666 -12.645 1.00 35.55 ? 596 ASN A ND2 1 
ATOM   75   N  N   . HIS A 1 89  ? 4.106   -52.059 -9.200  1.00 24.30 ? 597 HIS A N   1 
ATOM   76   C  CA  . HIS A 1 89  ? 3.247   -52.050 -8.010  1.00 26.54 ? 597 HIS A CA  1 
ATOM   77   C  C   . HIS A 1 89  ? 2.302   -50.866 -7.948  1.00 23.76 ? 597 HIS A C   1 
ATOM   78   O  O   . HIS A 1 89  ? 1.536   -50.729 -6.987  1.00 26.07 ? 597 HIS A O   1 
ATOM   79   C  CB  . HIS A 1 89  ? 4.092   -52.087 -6.726  1.00 28.02 ? 597 HIS A CB  1 
ATOM   80   C  CG  . HIS A 1 89  ? 5.109   -53.204 -6.686  1.00 35.43 ? 597 HIS A CG  1 
ATOM   81   N  ND1 . HIS A 1 89  ? 4.807   -54.474 -7.009  1.00 43.40 ? 597 HIS A ND1 1 
ATOM   82   C  CD2 . HIS A 1 89  ? 6.455   -53.199 -6.330  1.00 35.46 ? 597 HIS A CD2 1 
ATOM   83   C  CE1 . HIS A 1 89  ? 5.904   -55.243 -6.876  1.00 46.60 ? 597 HIS A CE1 1 
ATOM   84   N  NE2 . HIS A 1 89  ? 6.912   -54.459 -6.457  1.00 38.55 ? 597 HIS A NE2 1 
ATOM   85   N  N   . VAL A 1 90  ? 2.357   -49.991 -8.951  1.00 23.41 ? 598 VAL A N   1 
ATOM   86   C  CA  . VAL A 1 90  ? 1.490   -48.811 -9.011  1.00 25.16 ? 598 VAL A CA  1 
ATOM   87   C  C   . VAL A 1 90  ? 0.130   -49.277 -9.541  1.00 24.52 ? 598 VAL A C   1 
ATOM   88   O  O   . VAL A 1 90  ? -0.051  -49.451 -10.753 1.00 24.78 ? 598 VAL A O   1 
ATOM   89   C  CB  . VAL A 1 90  ? 2.092   -47.695 -9.906  1.00 24.31 ? 598 VAL A CB  1 
ATOM   90   C  CG1 . VAL A 1 90  ? 1.129   -46.517 -10.047 1.00 25.64 ? 598 VAL A CG1 1 
ATOM   91   C  CG2 . VAL A 1 90  ? 3.435   -47.215 -9.344  1.00 24.21 ? 598 VAL A CG2 1 
ATOM   92   N  N   . ALA A 1 91  ? -0.801  -49.505 -8.614  1.00 23.59 ? 599 ALA A N   1 
ATOM   93   C  CA  . ALA A 1 91  ? -2.073  -50.166 -8.915  1.00 23.25 ? 599 ALA A CA  1 
ATOM   94   C  C   . ALA A 1 91  ? -3.189  -49.646 -8.018  1.00 24.42 ? 599 ALA A C   1 
ATOM   95   O  O   . ALA A 1 91  ? -2.941  -49.211 -6.890  1.00 24.03 ? 599 ALA A O   1 
ATOM   96   C  CB  . ALA A 1 91  ? -1.928  -51.677 -8.740  1.00 22.68 ? 599 ALA A CB  1 
ATOM   97   N  N   . PHE A 1 92  ? -4.420  -49.700 -8.524  1.00 23.93 ? 600 PHE A N   1 
ATOM   98   C  CA  . PHE A 1 92  ? -5.584  -49.321 -7.727  1.00 24.80 ? 600 PHE A CA  1 
ATOM   99   C  C   . PHE A 1 92  ? -5.658  -50.151 -6.448  1.00 24.25 ? 600 PHE A C   1 
ATOM   100  O  O   . PHE A 1 92  ? -5.288  -51.332 -6.444  1.00 24.75 ? 600 PHE A O   1 
ATOM   101  C  CB  . PHE A 1 92  ? -6.894  -49.559 -8.505  1.00 24.86 ? 600 PHE A CB  1 
ATOM   102  C  CG  . PHE A 1 92  ? -7.080  -48.686 -9.717  1.00 23.93 ? 600 PHE A CG  1 
ATOM   103  C  CD1 . PHE A 1 92  ? -6.302  -47.552 -9.941  1.00 22.99 ? 600 PHE A CD1 1 
ATOM   104  C  CD2 . PHE A 1 92  ? -8.096  -48.992 -10.638 1.00 23.43 ? 600 PHE A CD2 1 
ATOM   105  C  CE1 . PHE A 1 92  ? -6.504  -46.762 -11.074 1.00 24.83 ? 600 PHE A CE1 1 
ATOM   106  C  CE2 . PHE A 1 92  ? -8.307  -48.202 -11.763 1.00 23.54 ? 600 PHE A CE2 1 
ATOM   107  C  CZ  . PHE A 1 92  ? -7.513  -47.082 -11.983 1.00 24.32 ? 600 PHE A CZ  1 
ATOM   108  N  N   . PRO A 1 93  ? -6.157  -49.541 -5.357  1.00 26.03 ? 601 PRO A N   1 
ATOM   109  C  CA  . PRO A 1 93  ? -6.485  -50.278 -4.139  1.00 28.24 ? 601 PRO A CA  1 
ATOM   110  C  C   . PRO A 1 93  ? -7.694  -51.192 -4.405  1.00 26.64 ? 601 PRO A C   1 
ATOM   111  O  O   . PRO A 1 93  ? -8.339  -51.042 -5.447  1.00 26.42 ? 601 PRO A O   1 
ATOM   112  C  CB  . PRO A 1 93  ? -6.867  -49.163 -3.160  1.00 30.39 ? 601 PRO A CB  1 
ATOM   113  C  CG  . PRO A 1 93  ? -7.403  -48.073 -4.029  1.00 27.99 ? 601 PRO A CG  1 
ATOM   114  C  CD  . PRO A 1 93  ? -6.542  -48.118 -5.266  1.00 26.72 ? 601 PRO A CD  1 
ATOM   115  N  N   . PRO A 1 94  ? -8.008  -52.124 -3.483  1.00 29.24 ? 602 PRO A N   1 
ATOM   116  C  CA  . PRO A 1 94  ? -9.205  -52.962 -3.668  1.00 30.93 ? 602 PRO A CA  1 
ATOM   117  C  C   . PRO A 1 94  ? -10.469 -52.123 -3.874  1.00 29.41 ? 602 PRO A C   1 
ATOM   118  O  O   . PRO A 1 94  ? -10.669 -51.127 -3.175  1.00 30.30 ? 602 PRO A O   1 
ATOM   119  C  CB  . PRO A 1 94  ? -9.288  -53.742 -2.355  1.00 32.67 ? 602 PRO A CB  1 
ATOM   120  C  CG  . PRO A 1 94  ? -7.866  -53.829 -1.893  1.00 33.27 ? 602 PRO A CG  1 
ATOM   121  C  CD  . PRO A 1 94  ? -7.253  -52.511 -2.273  1.00 31.02 ? 602 PRO A CD  1 
ATOM   122  N  N   . LEU A 1 95  ? -11.308 -52.513 -4.831  1.00 27.36 ? 603 LEU A N   1 
ATOM   123  C  CA  . LEU A 1 95  ? -12.470 -51.690 -5.181  1.00 26.87 ? 603 LEU A CA  1 
ATOM   124  C  C   . LEU A 1 95  ? -13.833 -52.293 -4.824  1.00 28.13 ? 603 LEU A C   1 
ATOM   125  O  O   . LEU A 1 95  ? -14.869 -51.672 -5.087  1.00 28.76 ? 603 LEU A O   1 
ATOM   126  C  CB  . LEU A 1 95  ? -12.439 -51.300 -6.665  1.00 26.38 ? 603 LEU A CB  1 
ATOM   127  C  CG  . LEU A 1 95  ? -11.289 -50.392 -7.132  1.00 25.14 ? 603 LEU A CG  1 
ATOM   128  C  CD1 . LEU A 1 95  ? -11.495 -50.002 -8.587  1.00 25.74 ? 603 LEU A CD1 1 
ATOM   129  C  CD2 . LEU A 1 95  ? -11.123 -49.142 -6.271  1.00 26.67 ? 603 LEU A CD2 1 
ATOM   130  N  N   . GLU A 1 96  ? -13.845 -53.481 -4.227  1.00 25.99 ? 604 GLU A N   1 
ATOM   131  C  CA  . GLU A 1 96  ? -15.121 -54.191 -4.032  1.00 28.80 ? 604 GLU A CA  1 
ATOM   132  C  C   . GLU A 1 96  ? -16.113 -53.412 -3.154  1.00 31.36 ? 604 GLU A C   1 
ATOM   133  O  O   . GLU A 1 96  ? -17.322 -53.461 -3.389  1.00 29.86 ? 604 GLU A O   1 
ATOM   134  C  CB  . GLU A 1 96  ? -14.919 -55.630 -3.527  1.00 29.52 ? 604 GLU A CB  1 
ATOM   135  C  CG  . GLU A 1 96  ? -14.250 -55.763 -2.170  1.00 33.28 ? 604 GLU A CG  1 
ATOM   136  C  CD  . GLU A 1 96  ? -12.732 -55.833 -2.236  1.00 37.84 ? 604 GLU A CD  1 
ATOM   137  O  OE1 . GLU A 1 96  ? -12.129 -56.173 -1.200  1.00 46.59 ? 604 GLU A OE1 1 
ATOM   138  O  OE2 . GLU A 1 96  ? -12.137 -55.556 -3.306  1.00 35.70 ? 604 GLU A OE2 1 
ATOM   139  N  N   . ASP A 1 97  ? -15.599 -52.681 -2.169  1.00 30.61 ? 605 ASP A N   1 
ATOM   140  C  CA  . ASP A 1 97  ? -16.461 -51.874 -1.294  1.00 33.10 ? 605 ASP A CA  1 
ATOM   141  C  C   . ASP A 1 97  ? -17.138 -50.751 -2.065  1.00 31.45 ? 605 ASP A C   1 
ATOM   142  O  O   . ASP A 1 97  ? -18.312 -50.445 -1.831  1.00 34.50 ? 605 ASP A O   1 
ATOM   143  C  CB  . ASP A 1 97  ? -15.679 -51.325 -0.095  1.00 36.65 ? 605 ASP A CB  1 
ATOM   144  C  CG  . ASP A 1 97  ? -15.283 -52.413 0.889   1.00 43.33 ? 605 ASP A CG  1 
ATOM   145  O  OD1 . ASP A 1 97  ? -15.779 -53.554 0.757   1.00 44.08 ? 605 ASP A OD1 1 
ATOM   146  O  OD2 . ASP A 1 97  ? -14.478 -52.130 1.800   1.00 48.30 ? 605 ASP A OD2 1 
ATOM   147  N  N   . LYS A 1 98  ? -16.402 -50.157 -3.001  1.00 30.10 ? 606 LYS A N   1 
ATOM   148  C  CA  . LYS A 1 98  ? -16.942 -49.094 -3.841  1.00 27.47 ? 606 LYS A CA  1 
ATOM   149  C  C   . LYS A 1 98  ? -17.910 -49.641 -4.874  1.00 29.27 ? 606 LYS A C   1 
ATOM   150  O  O   . LYS A 1 98  ? -18.922 -49.008 -5.163  1.00 31.85 ? 606 LYS A O   1 
ATOM   151  C  CB  . LYS A 1 98  ? -15.822 -48.297 -4.517  1.00 29.71 ? 606 LYS A CB  1 
ATOM   152  C  CG  . LYS A 1 98  ? -14.953 -47.499 -3.551  1.00 30.52 ? 606 LYS A CG  1 
ATOM   153  C  CD  . LYS A 1 98  ? -15.735 -46.351 -2.920  1.00 35.11 ? 606 LYS A CD  1 
ATOM   154  C  CE  . LYS A 1 98  ? -14.924 -45.675 -1.832  1.00 39.08 ? 606 LYS A CE  1 
ATOM   155  N  NZ  . LYS A 1 98  ? -15.671 -44.559 -1.196  1.00 40.62 ? 606 LYS A NZ  1 
ATOM   156  N  N   . LEU A 1 99  ? -17.606 -50.818 -5.425  1.00 26.59 ? 607 LEU A N   1 
ATOM   157  C  CA  . LEU A 1 99  ? -18.522 -51.475 -6.356  1.00 27.60 ? 607 LEU A CA  1 
ATOM   158  C  C   . LEU A 1 99  ? -19.856 -51.818 -5.691  1.00 30.05 ? 607 LEU A C   1 
ATOM   159  O  O   . LEU A 1 99  ? -20.897 -51.780 -6.338  1.00 30.52 ? 607 LEU A O   1 
ATOM   160  C  CB  . LEU A 1 99  ? -17.899 -52.752 -6.916  1.00 28.42 ? 607 LEU A CB  1 
ATOM   161  C  CG  . LEU A 1 99  ? -16.694 -52.542 -7.832  1.00 28.58 ? 607 LEU A CG  1 
ATOM   162  C  CD1 . LEU A 1 99  ? -16.068 -53.884 -8.182  1.00 33.74 ? 607 LEU A CD1 1 
ATOM   163  C  CD2 . LEU A 1 99  ? -17.123 -51.824 -9.086  1.00 30.93 ? 607 LEU A CD2 1 
ATOM   164  N  N   . ALA A 1 100 ? -19.797 -52.164 -4.409  1.00 30.21 ? 608 ALA A N   1 
ATOM   165  C  CA  . ALA A 1 100 ? -20.970 -52.585 -3.640  1.00 31.32 ? 608 ALA A CA  1 
ATOM   166  C  C   . ALA A 1 100 ? -21.755 -51.413 -3.052  1.00 38.04 ? 608 ALA A C   1 
ATOM   167  O  O   . ALA A 1 100 ? -22.866 -51.606 -2.541  1.00 39.23 ? 608 ALA A O   1 
ATOM   168  C  CB  . ALA A 1 100 ? -20.543 -53.527 -2.513  1.00 32.45 ? 608 ALA A CB  1 
ATOM   169  N  N   . ALA A 1 101 ? -21.175 -50.214 -3.134  1.00 36.30 ? 609 ALA A N   1 
ATOM   170  C  CA  . ALA A 1 101 ? -21.700 -48.994 -2.493  1.00 42.73 ? 609 ALA A CA  1 
ATOM   171  C  C   . ALA A 1 101 ? -21.788 -49.149 -0.973  1.00 52.26 ? 609 ALA A C   1 
ATOM   172  O  O   . ALA A 1 101 ? -22.771 -48.740 -0.344  1.00 58.77 ? 609 ALA A O   1 
ATOM   173  C  CB  . ALA A 1 101 ? -23.046 -48.571 -3.101  1.00 43.35 ? 609 ALA A CB  1 
ATOM   174  N  N   . ALA A 1 102 ? -20.741 -49.741 -0.398  1.00 54.96 ? 610 ALA A N   1 
ATOM   175  C  CA  . ALA A 1 102 ? -20.671 -50.017 1.037   1.00 63.83 ? 610 ALA A CA  1 
ATOM   176  C  C   . ALA A 1 102 ? -20.414 -48.752 1.853   1.00 70.23 ? 610 ALA A C   1 
ATOM   177  O  O   . ALA A 1 102 ? -19.589 -47.917 1.480   1.00 74.80 ? 610 ALA A O   1 
ATOM   178  C  CB  . ALA A 1 102 ? -19.587 -51.060 1.323   1.00 58.04 ? 610 ALA A CB  1 
ATOM   179  N  N   . VAL B 2 9   ? -23.637 -43.900 -14.763 1.00 64.88 ? 9   VAL B N   1 
ATOM   180  C  CA  . VAL B 2 9   ? -24.648 -42.893 -14.318 1.00 64.86 ? 9   VAL B CA  1 
ATOM   181  C  C   . VAL B 2 9   ? -24.657 -42.750 -12.794 1.00 55.03 ? 9   VAL B C   1 
ATOM   182  O  O   . VAL B 2 9   ? -24.350 -41.678 -12.271 1.00 65.06 ? 9   VAL B O   1 
ATOM   183  C  CB  . VAL B 2 9   ? -26.061 -43.228 -14.840 1.00 72.44 ? 9   VAL B CB  1 
ATOM   184  N  N   . SER B 2 10  ? -25.005 -43.828 -12.088 1.00 43.41 ? 10  SER B N   1 
ATOM   185  C  CA  . SER B 2 10  ? -24.879 -43.872 -10.630 1.00 41.75 ? 10  SER B CA  1 
ATOM   186  C  C   . SER B 2 10  ? -23.400 -43.997 -10.261 1.00 39.09 ? 10  SER B C   1 
ATOM   187  O  O   . SER B 2 10  ? -22.582 -44.411 -11.095 1.00 37.74 ? 10  SER B O   1 
ATOM   188  C  CB  . SER B 2 10  ? -25.668 -45.049 -10.044 1.00 45.23 ? 10  SER B CB  1 
ATOM   189  O  OG  . SER B 2 10  ? -24.984 -46.282 -10.234 1.00 41.92 ? 10  SER B OG  1 
ATOM   190  N  N   . VAL B 2 11  ? -23.066 -43.646 -9.021  1.00 34.69 ? 11  VAL B N   1 
ATOM   191  C  CA  . VAL B 2 11  ? -21.685 -43.739 -8.529  1.00 34.09 ? 11  VAL B CA  1 
ATOM   192  C  C   . VAL B 2 11  ? -21.142 -45.183 -8.555  1.00 33.59 ? 11  VAL B C   1 
ATOM   193  O  O   . VAL B 2 11  ? -20.037 -45.402 -9.064  1.00 30.70 ? 11  VAL B O   1 
ATOM   194  C  CB  . VAL B 2 11  ? -21.510 -43.071 -7.145  1.00 35.17 ? 11  VAL B CB  1 
ATOM   195  C  CG1 . VAL B 2 11  ? -20.130 -43.351 -6.570  1.00 34.68 ? 11  VAL B CG1 1 
ATOM   196  C  CG2 . VAL B 2 11  ? -21.733 -41.567 -7.260  1.00 35.11 ? 11  VAL B CG2 1 
ATOM   197  N  N   . PRO B 2 12  ? -21.912 -46.170 -8.040  1.00 35.81 ? 12  PRO B N   1 
ATOM   198  C  CA  . PRO B 2 12  ? -21.430 -47.567 -8.127  1.00 32.20 ? 12  PRO B CA  1 
ATOM   199  C  C   . PRO B 2 12  ? -21.204 -48.057 -9.559  1.00 31.79 ? 12  PRO B C   1 
ATOM   200  O  O   . PRO B 2 12  ? -20.296 -48.868 -9.795  1.00 32.44 ? 12  PRO B O   1 
ATOM   201  C  CB  . PRO B 2 12  ? -22.555 -48.374 -7.470  1.00 34.98 ? 12  PRO B CB  1 
ATOM   202  C  CG  . PRO B 2 12  ? -23.260 -47.399 -6.585  1.00 39.15 ? 12  PRO B CG  1 
ATOM   203  C  CD  . PRO B 2 12  ? -23.181 -46.078 -7.285  1.00 37.40 ? 12  PRO B CD  1 
ATOM   204  N  N   . ALA B 2 13  ? -22.024 -47.583 -10.498 1.00 31.03 ? 13  ALA B N   1 
ATOM   205  C  CA  . ALA B 2 13  ? -21.843 -47.895 -11.911 1.00 32.43 ? 13  ALA B CA  1 
ATOM   206  C  C   . ALA B 2 13  ? -20.572 -47.244 -12.464 1.00 32.45 ? 13  ALA B C   1 
ATOM   207  O  O   . ALA B 2 13  ? -19.883 -47.833 -13.296 1.00 32.20 ? 13  ALA B O   1 
ATOM   208  C  CB  . ALA B 2 13  ? -23.059 -47.466 -12.721 1.00 37.12 ? 13  ALA B CB  1 
ATOM   209  N  N   . LEU B 2 14  ? -20.268 -46.031 -12.009 1.00 32.29 ? 14  LEU B N   1 
ATOM   210  C  CA  . LEU B 2 14  ? -19.013 -45.376 -12.384 1.00 29.52 ? 14  LEU B CA  1 
ATOM   211  C  C   . LEU B 2 14  ? -17.827 -46.191 -11.866 1.00 26.14 ? 14  LEU B C   1 
ATOM   212  O  O   . LEU B 2 14  ? -16.846 -46.399 -12.581 1.00 26.79 ? 14  LEU B O   1 
ATOM   213  C  CB  . LEU B 2 14  ? -18.960 -43.939 -11.853 1.00 28.83 ? 14  LEU B CB  1 
ATOM   214  C  CG  . LEU B 2 14  ? -19.899 -42.926 -12.521 1.00 28.92 ? 14  LEU B CG  1 
ATOM   215  C  CD1 . LEU B 2 14  ? -19.895 -41.609 -11.758 1.00 32.25 ? 14  LEU B CD1 1 
ATOM   216  C  CD2 . LEU B 2 14  ? -19.533 -42.697 -13.981 1.00 31.56 ? 14  LEU B CD2 1 
ATOM   217  N  N   . TRP B 2 15  ? -17.926 -46.662 -10.628 1.00 24.69 ? 15  TRP B N   1 
ATOM   218  C  CA  . TRP B 2 15  ? -16.873 -47.513 -10.047 1.00 25.47 ? 15  TRP B CA  1 
ATOM   219  C  C   . TRP B 2 15  ? -16.675 -48.787 -10.818 1.00 27.63 ? 15  TRP B C   1 
ATOM   220  O  O   . TRP B 2 15  ? -15.538 -49.269 -10.963 1.00 26.66 ? 15  TRP B O   1 
ATOM   221  C  CB  . TRP B 2 15  ? -17.168 -47.812 -8.590  1.00 26.21 ? 15  TRP B CB  1 
ATOM   222  C  CG  . TRP B 2 15  ? -16.724 -46.698 -7.680  1.00 28.59 ? 15  TRP B CG  1 
ATOM   223  C  CD1 . TRP B 2 15  ? -17.523 -45.845 -6.917  1.00 30.39 ? 15  TRP B CD1 1 
ATOM   224  C  CD2 . TRP B 2 15  ? -15.345 -46.275 -7.419  1.00 28.38 ? 15  TRP B CD2 1 
ATOM   225  N  NE1 . TRP B 2 15  ? -16.750 -44.951 -6.219  1.00 31.66 ? 15  TRP B NE1 1 
ATOM   226  C  CE2 . TRP B 2 15  ? -15.430 -45.153 -6.480  1.00 30.06 ? 15  TRP B CE2 1 
ATOM   227  C  CE3 . TRP B 2 15  ? -14.089 -46.700 -7.861  1.00 29.21 ? 15  TRP B CE3 1 
ATOM   228  C  CZ2 . TRP B 2 15  ? -14.295 -44.501 -6.007  1.00 29.90 ? 15  TRP B CZ2 1 
ATOM   229  C  CZ3 . TRP B 2 15  ? -12.954 -46.034 -7.382  1.00 28.36 ? 15  TRP B CZ3 1 
ATOM   230  C  CH2 . TRP B 2 15  ? -13.055 -44.960 -6.477  1.00 29.92 ? 15  TRP B CH2 1 
ATOM   231  N  N   . SER B 2 16  ? -17.773 -49.342 -11.334 1.00 25.78 ? 16  SER B N   1 
ATOM   232  C  CA  . SER B 2 16  ? -17.691 -50.526 -12.196 1.00 27.17 ? 16  SER B CA  1 
ATOM   233  C  C   . SER B 2 16  ? -16.825 -50.248 -13.431 1.00 26.84 ? 16  SER B C   1 
ATOM   234  O  O   . SER B 2 16  ? -16.022 -51.096 -13.842 1.00 26.99 ? 16  SER B O   1 
ATOM   235  C  CB  . SER B 2 16  ? -19.093 -51.000 -12.605 1.00 32.28 ? 16  SER B CB  1 
ATOM   236  O  OG  . SER B 2 16  ? -19.005 -52.149 -13.434 1.00 37.84 ? 16  SER B OG  1 
ATOM   237  N  N   . GLU B 2 17  ? -16.987 -49.056 -14.007 1.00 25.31 ? 17  GLU B N   1 
ATOM   238  C  CA  . GLU B 2 17  ? -16.203 -48.636 -15.163 1.00 26.44 ? 17  GLU B CA  1 
ATOM   239  C  C   . GLU B 2 17  ? -14.745 -48.390 -14.772 1.00 25.37 ? 17  GLU B C   1 
ATOM   240  O  O   . GLU B 2 17  ? -13.838 -48.784 -15.512 1.00 25.44 ? 17  GLU B O   1 
ATOM   241  C  CB  . GLU B 2 17  ? -16.792 -47.378 -15.808 1.00 30.48 ? 17  GLU B CB  1 
ATOM   242  C  CG  . GLU B 2 17  ? -18.066 -47.612 -16.610 1.00 35.21 ? 17  GLU B CG  1 
ATOM   243  C  CD  . GLU B 2 17  ? -18.467 -46.387 -17.408 1.00 45.57 ? 17  GLU B CD  1 
ATOM   244  O  OE1 . GLU B 2 17  ? -18.770 -45.349 -16.787 1.00 50.09 ? 17  GLU B OE1 1 
ATOM   245  O  OE2 . GLU B 2 17  ? -18.475 -46.460 -18.656 1.00 58.66 ? 17  GLU B OE2 1 
ATOM   246  N  N   . VAL B 2 18  ? -14.522 -47.744 -13.622 1.00 23.26 ? 18  VAL B N   1 
ATOM   247  C  CA  . VAL B 2 18  ? -13.149 -47.546 -13.114 1.00 24.70 ? 18  VAL B CA  1 
ATOM   248  C  C   . VAL B 2 18  ? -12.426 -48.893 -13.040 1.00 24.72 ? 18  VAL B C   1 
ATOM   249  O  O   . VAL B 2 18  ? -11.306 -49.042 -13.557 1.00 24.06 ? 18  VAL B O   1 
ATOM   250  C  CB  . VAL B 2 18  ? -13.110 -46.832 -11.739 1.00 24.79 ? 18  VAL B CB  1 
ATOM   251  C  CG1 . VAL B 2 18  ? -11.696 -46.843 -11.150 1.00 24.77 ? 18  VAL B CG1 1 
ATOM   252  C  CG2 . VAL B 2 18  ? -13.609 -45.396 -11.873 1.00 25.48 ? 18  VAL B CG2 1 
ATOM   253  N  N   . ASN B 2 19  ? -13.075 -49.874 -12.417 1.00 23.52 ? 19  ASN B N   1 
ATOM   254  C  CA  . ASN B 2 19  ? -12.477 -51.201 -12.291 1.00 23.23 ? 19  ASN B CA  1 
ATOM   255  C  C   . ASN B 2 19  ? -12.191 -51.835 -13.648 1.00 24.35 ? 19  ASN B C   1 
ATOM   256  O  O   . ASN B 2 19  ? -11.088 -52.356 -13.858 1.00 24.27 ? 19  ASN B O   1 
ATOM   257  C  CB  . ASN B 2 19  ? -13.341 -52.131 -11.440 1.00 24.66 ? 19  ASN B CB  1 
ATOM   258  C  CG  . ASN B 2 19  ? -12.730 -53.513 -11.299 1.00 25.40 ? 19  ASN B CG  1 
ATOM   259  O  OD1 . ASN B 2 19  ? -11.787 -53.708 -10.532 1.00 27.03 ? 19  ASN B OD1 1 
ATOM   260  N  ND2 . ASN B 2 19  ? -13.258 -54.478 -12.051 1.00 26.27 ? 19  ASN B ND2 1 
ATOM   261  N  N   . ARG B 2 20  ? -13.167 -51.783 -14.564 1.00 23.86 ? 20  ARG B N   1 
ATOM   262  C  CA  A ARG B 2 20  ? -12.995 -52.403 -15.881 0.70 25.33 ? 20  ARG B CA  1 
ATOM   263  C  CA  B ARG B 2 20  ? -13.021 -52.376 -15.901 0.30 24.47 ? 20  ARG B CA  1 
ATOM   264  C  C   . ARG B 2 20  ? -11.829 -51.771 -16.644 1.00 24.58 ? 20  ARG B C   1 
ATOM   265  O  O   . ARG B 2 20  ? -10.979 -52.488 -17.201 1.00 24.10 ? 20  ARG B O   1 
ATOM   266  C  CB  A ARG B 2 20  ? -14.282 -52.342 -16.714 0.70 28.27 ? 20  ARG B CB  1 
ATOM   267  C  CB  B ARG B 2 20  ? -14.310 -52.180 -16.714 0.30 24.73 ? 20  ARG B CB  1 
ATOM   268  C  CG  A ARG B 2 20  ? -14.149 -53.047 -18.063 0.70 32.94 ? 20  ARG B CG  1 
ATOM   269  C  CG  B ARG B 2 20  ? -14.293 -52.800 -18.108 0.30 26.93 ? 20  ARG B CG  1 
ATOM   270  C  CD  A ARG B 2 20  ? -15.464 -53.132 -18.820 0.70 36.54 ? 20  ARG B CD  1 
ATOM   271  C  CD  B ARG B 2 20  ? -15.659 -52.699 -18.771 0.30 28.16 ? 20  ARG B CD  1 
ATOM   272  N  NE  A ARG B 2 20  ? -15.984 -51.824 -19.229 0.70 37.45 ? 20  ARG B NE  1 
ATOM   273  N  NE  B ARG B 2 20  ? -16.728 -52.880 -17.793 0.30 23.69 ? 20  ARG B NE  1 
ATOM   274  C  CZ  A ARG B 2 20  ? -15.588 -51.140 -20.303 0.70 41.32 ? 20  ARG B CZ  1 
ATOM   275  C  CZ  B ARG B 2 20  ? -17.567 -51.925 -17.409 0.30 4.51  ? 20  ARG B CZ  1 
ATOM   276  N  NH1 A ARG B 2 20  ? -14.637 -51.610 -21.103 0.70 42.32 ? 20  ARG B NH1 1 
ATOM   277  N  NH1 B ARG B 2 20  ? -17.501 -50.714 -17.935 0.30 11.79 ? 20  ARG B NH1 1 
ATOM   278  N  NH2 A ARG B 2 20  ? -16.147 -49.968 -20.573 0.70 45.34 ? 20  ARG B NH2 1 
ATOM   279  N  NH2 B ARG B 2 20  ? -18.489 -52.191 -16.498 0.30 12.93 ? 20  ARG B NH2 1 
ATOM   280  N  N   . TYR B 2 21  ? -11.777 -50.444 -16.661 1.00 22.89 ? 21  TYR B N   1 
ATOM   281  C  CA  . TYR B 2 21  ? -10.712 -49.752 -17.375 1.00 23.04 ? 21  TYR B CA  1 
ATOM   282  C  C   . TYR B 2 21  ? -9.346  -50.030 -16.752 1.00 24.34 ? 21  TYR B C   1 
ATOM   283  O  O   . TYR B 2 21  ? -8.381  -50.316 -17.472 1.00 25.13 ? 21  TYR B O   1 
ATOM   284  C  CB  . TYR B 2 21  ? -10.985 -48.252 -17.455 1.00 22.88 ? 21  TYR B CB  1 
ATOM   285  C  CG  . TYR B 2 21  ? -12.155 -47.864 -18.340 1.00 25.01 ? 21  TYR B CG  1 
ATOM   286  C  CD1 . TYR B 2 21  ? -12.320 -48.420 -19.614 1.00 27.10 ? 21  TYR B CD1 1 
ATOM   287  C  CD2 . TYR B 2 21  ? -13.071 -46.902 -17.915 1.00 25.73 ? 21  TYR B CD2 1 
ATOM   288  C  CE1 . TYR B 2 21  ? -13.389 -48.043 -20.425 1.00 32.76 ? 21  TYR B CE1 1 
ATOM   289  C  CE2 . TYR B 2 21  ? -14.135 -46.519 -18.719 1.00 27.76 ? 21  TYR B CE2 1 
ATOM   290  C  CZ  . TYR B 2 21  ? -14.292 -47.093 -19.965 1.00 31.84 ? 21  TYR B CZ  1 
ATOM   291  O  OH  . TYR B 2 21  ? -15.350 -46.693 -20.755 1.00 36.83 ? 21  TYR B OH  1 
ATOM   292  N  N   . GLY B 2 22  ? -9.269  -49.968 -15.423 1.00 22.77 ? 22  GLY B N   1 
ATOM   293  C  CA  . GLY B 2 22  ? -8.012  -50.243 -14.725 1.00 24.68 ? 22  GLY B CA  1 
ATOM   294  C  C   . GLY B 2 22  ? -7.501  -51.652 -14.990 1.00 26.10 ? 22  GLY B C   1 
ATOM   295  O  O   . GLY B 2 22  ? -6.305  -51.853 -15.231 1.00 25.10 ? 22  GLY B O   1 
ATOM   296  N  N   . GLN B 2 23  ? -8.411  -52.625 -14.963 1.00 24.17 ? 23  GLN B N   1 
ATOM   297  C  CA  . GLN B 2 23  ? -8.049  -54.033 -15.170 1.00 25.15 ? 23  GLN B CA  1 
ATOM   298  C  C   . GLN B 2 23  ? -7.529  -54.269 -16.587 1.00 24.14 ? 23  GLN B C   1 
ATOM   299  O  O   . GLN B 2 23  ? -6.702  -55.161 -16.811 1.00 29.79 ? 23  GLN B O   1 
ATOM   300  C  CB  . GLN B 2 23  ? -9.235  -54.959 -14.852 1.00 26.18 ? 23  GLN B CB  1 
ATOM   301  C  CG  . GLN B 2 23  ? -9.547  -55.061 -13.362 1.00 29.43 ? 23  GLN B CG  1 
ATOM   302  C  CD  . GLN B 2 23  ? -8.507  -55.843 -12.576 1.00 32.75 ? 23  GLN B CD  1 
ATOM   303  O  OE1 . GLN B 2 23  ? -7.986  -56.853 -13.042 1.00 37.36 ? 23  GLN B OE1 1 
ATOM   304  N  NE2 . GLN B 2 23  ? -8.209  -55.380 -11.368 1.00 36.45 ? 23  GLN B NE2 1 
ATOM   305  N  N   . ASN B 2 24  ? -8.001  -53.450 -17.527 1.00 22.66 ? 24  ASN B N   1 
ATOM   306  C  CA  A ASN B 2 24  ? -7.582  -53.533 -18.920 0.60 26.66 ? 24  ASN B CA  1 
ATOM   307  C  CA  B ASN B 2 24  ? -7.570  -53.540 -18.921 0.40 25.68 ? 24  ASN B CA  1 
ATOM   308  C  C   . ASN B 2 24  ? -6.401  -52.611 -19.251 1.00 26.01 ? 24  ASN B C   1 
ATOM   309  O  O   . ASN B 2 24  ? -5.955  -52.545 -20.400 1.00 27.12 ? 24  ASN B O   1 
ATOM   310  C  CB  A ASN B 2 24  ? -8.771  -53.220 -19.833 0.60 32.02 ? 24  ASN B CB  1 
ATOM   311  C  CB  B ASN B 2 24  ? -8.746  -53.267 -19.862 0.40 28.74 ? 24  ASN B CB  1 
ATOM   312  C  CG  A ASN B 2 24  ? -8.422  -53.330 -21.302 0.60 33.99 ? 24  ASN B CG  1 
ATOM   313  C  CG  B ASN B 2 24  ? -9.736  -54.412 -19.904 0.40 31.42 ? 24  ASN B CG  1 
ATOM   314  O  OD1 A ASN B 2 24  ? -7.985  -54.380 -21.773 0.60 39.95 ? 24  ASN B OD1 1 
ATOM   315  O  OD1 B ASN B 2 24  ? -9.363  -55.578 -19.769 0.40 32.99 ? 24  ASN B OD1 1 
ATOM   316  N  ND2 A ASN B 2 24  ? -8.599  -52.235 -22.033 0.60 42.38 ? 24  ASN B ND2 1 
ATOM   317  N  ND2 B ASN B 2 24  ? -11.009 -54.086 -20.093 0.40 32.32 ? 24  ASN B ND2 1 
ATOM   318  N  N   . GLY B 2 25  ? -5.896  -51.898 -18.246 1.00 22.49 ? 25  GLY B N   1 
ATOM   319  C  CA  . GLY B 2 25  ? -4.778  -50.963 -18.451 1.00 23.07 ? 25  GLY B CA  1 
ATOM   320  C  C   . GLY B 2 25  ? -5.138  -49.658 -19.150 1.00 22.69 ? 25  GLY B C   1 
ATOM   321  O  O   . GLY B 2 25  ? -4.255  -48.938 -19.630 1.00 22.51 ? 25  GLY B O   1 
ATOM   322  N  N   . ASP B 2 26  ? -6.435  -49.346 -19.222 1.00 22.42 ? 26  ASP B N   1 
ATOM   323  C  CA  . ASP B 2 26  ? -6.872  -48.100 -19.848 1.00 21.36 ? 26  ASP B CA  1 
ATOM   324  C  C   . ASP B 2 26  ? -6.967  -47.025 -18.779 1.00 23.22 ? 26  ASP B C   1 
ATOM   325  O  O   . ASP B 2 26  ? -8.063  -46.669 -18.312 1.00 22.01 ? 26  ASP B O   1 
ATOM   326  C  CB  . ASP B 2 26  ? -8.207  -48.283 -20.578 1.00 22.07 ? 26  ASP B CB  1 
ATOM   327  C  CG  . ASP B 2 26  ? -8.530  -47.120 -21.509 1.00 23.66 ? 26  ASP B CG  1 
ATOM   328  O  OD1 . ASP B 2 26  ? -7.883  -46.049 -21.414 1.00 23.61 ? 26  ASP B OD1 1 
ATOM   329  O  OD2 . ASP B 2 26  ? -9.440  -47.279 -22.343 1.00 25.25 ? 26  ASP B OD2 1 
ATOM   330  N  N   . PHE B 2 27  ? -5.807  -46.525 -18.360 1.00 21.62 ? 27  PHE B N   1 
ATOM   331  C  CA  . PHE B 2 27  ? -5.775  -45.558 -17.264 1.00 21.37 ? 27  PHE B CA  1 
ATOM   332  C  C   . PHE B 2 27  ? -6.308  -44.204 -17.692 1.00 22.60 ? 27  PHE B C   1 
ATOM   333  O  O   . PHE B 2 27  ? -6.832  -43.454 -16.861 1.00 23.90 ? 27  PHE B O   1 
ATOM   334  C  CB  . PHE B 2 27  ? -4.374  -45.487 -16.636 1.00 22.70 ? 27  PHE B CB  1 
ATOM   335  C  CG  . PHE B 2 27  ? -3.990  -46.761 -15.957 1.00 21.25 ? 27  PHE B CG  1 
ATOM   336  C  CD1 . PHE B 2 27  ? -4.526  -47.084 -14.707 1.00 21.03 ? 27  PHE B CD1 1 
ATOM   337  C  CD2 . PHE B 2 27  ? -3.159  -47.687 -16.596 1.00 22.34 ? 27  PHE B CD2 1 
ATOM   338  C  CE1 . PHE B 2 27  ? -4.214  -48.287 -14.088 1.00 22.94 ? 27  PHE B CE1 1 
ATOM   339  C  CE2 . PHE B 2 27  ? -2.843  -48.892 -15.975 1.00 21.58 ? 27  PHE B CE2 1 
ATOM   340  C  CZ  . PHE B 2 27  ? -3.374  -49.189 -14.723 1.00 22.72 ? 27  PHE B CZ  1 
ATOM   341  N  N   . THR B 2 28  ? -6.218  -43.918 -18.989 1.00 21.69 ? 28  THR B N   1 
ATOM   342  C  CA  . THR B 2 28  ? -6.788  -42.690 -19.548 1.00 23.90 ? 28  THR B CA  1 
ATOM   343  C  C   . THR B 2 28  ? -8.305  -42.673 -19.326 1.00 24.26 ? 28  THR B C   1 
ATOM   344  O  O   . THR B 2 28  ? -8.856  -41.699 -18.795 1.00 24.07 ? 28  THR B O   1 
ATOM   345  C  CB  . THR B 2 28  ? -6.442  -42.539 -21.041 1.00 25.19 ? 28  THR B CB  1 
ATOM   346  O  OG1 . THR B 2 28  ? -5.011  -42.523 -21.193 1.00 25.92 ? 28  THR B OG1 1 
ATOM   347  C  CG2 . THR B 2 28  ? -7.027  -41.239 -21.619 1.00 23.43 ? 28  THR B CG2 1 
ATOM   348  N  N   . ARG B 2 29  ? -8.980  -43.751 -19.711 1.00 23.82 ? 29  ARG B N   1 
ATOM   349  C  CA  . ARG B 2 29  ? -10.435 -43.806 -19.510 1.00 23.37 ? 29  ARG B CA  1 
ATOM   350  C  C   . ARG B 2 29  ? -10.809 -43.941 -18.040 1.00 24.00 ? 29  ARG B C   1 
ATOM   351  O  O   . ARG B 2 29  ? -11.785 -43.327 -17.590 1.00 25.92 ? 29  ARG B O   1 
ATOM   352  C  CB  . ARG B 2 29  ? -11.087 -44.895 -20.365 1.00 22.36 ? 29  ARG B CB  1 
ATOM   353  C  CG  . ARG B 2 29  ? -11.138 -44.530 -21.842 1.00 22.93 ? 29  ARG B CG  1 
ATOM   354  C  CD  . ARG B 2 29  ? -12.122 -45.438 -22.567 1.00 24.01 ? 29  ARG B CD  1 
ATOM   355  N  NE  . ARG B 2 29  ? -12.309 -45.102 -23.981 1.00 24.95 ? 29  ARG B NE  1 
ATOM   356  C  CZ  . ARG B 2 29  ? -11.595 -45.604 -24.986 1.00 25.79 ? 29  ARG B CZ  1 
ATOM   357  N  NH1 . ARG B 2 29  ? -10.591 -46.443 -24.749 1.00 24.84 ? 29  ARG B NH1 1 
ATOM   358  N  NH2 . ARG B 2 29  ? -11.878 -45.250 -26.239 1.00 25.01 ? 29  ARG B NH2 1 
ATOM   359  N  N   . ALA B 2 30  ? -10.027 -44.714 -17.279 1.00 22.82 ? 30  ALA B N   1 
ATOM   360  C  CA  . ALA B 2 30  ? -10.260 -44.810 -15.838 1.00 22.55 ? 30  ALA B CA  1 
ATOM   361  C  C   . ALA B 2 30  ? -10.178 -43.423 -15.176 1.00 24.91 ? 30  ALA B C   1 
ATOM   362  O  O   . ALA B 2 30  ? -10.986 -43.101 -14.303 1.00 24.96 ? 30  ALA B O   1 
ATOM   363  C  CB  . ALA B 2 30  ? -9.297  -45.791 -15.177 1.00 23.60 ? 30  ALA B CB  1 
ATOM   364  N  N   . LEU B 2 31  ? -9.217  -42.609 -15.610 1.00 23.75 ? 31  LEU B N   1 
ATOM   365  C  CA  . LEU B 2 31  ? -9.028  -41.259 -15.053 1.00 24.00 ? 31  LEU B CA  1 
ATOM   366  C  C   . LEU B 2 31  ? -10.234 -40.349 -15.329 1.00 25.14 ? 31  LEU B C   1 
ATOM   367  O  O   . LEU B 2 31  ? -10.693 -39.622 -14.439 1.00 26.36 ? 31  LEU B O   1 
ATOM   368  C  CB  . LEU B 2 31  ? -7.751  -40.630 -15.622 1.00 23.58 ? 31  LEU B CB  1 
ATOM   369  C  CG  . LEU B 2 31  ? -7.440  -39.181 -15.224 1.00 23.83 ? 31  LEU B CG  1 
ATOM   370  C  CD1 . LEU B 2 31  ? -7.363  -39.048 -13.708 1.00 24.34 ? 31  LEU B CD1 1 
ATOM   371  C  CD2 . LEU B 2 31  ? -6.137  -38.744 -15.874 1.00 27.04 ? 31  LEU B CD2 1 
ATOM   372  N  N   . LYS B 2 32  ? -10.734 -40.391 -16.560 1.00 24.04 ? 32  LYS B N   1 
ATOM   373  C  CA  . LYS B 2 32  ? -11.930 -39.625 -16.924 1.00 27.22 ? 32  LYS B CA  1 
ATOM   374  C  C   . LYS B 2 32  ? -13.116 -40.011 -16.025 1.00 27.92 ? 32  LYS B C   1 
ATOM   375  O  O   . LYS B 2 32  ? -13.849 -39.145 -15.534 1.00 27.96 ? 32  LYS B O   1 
ATOM   376  C  CB  . LYS B 2 32  ? -12.260 -39.829 -18.405 1.00 29.53 ? 32  LYS B CB  1 
ATOM   377  C  CG  . LYS B 2 32  ? -13.375 -38.933 -18.932 0.80 32.50 ? 32  LYS B CG  1 
ATOM   378  C  CD  . LYS B 2 32  ? -13.723 -39.261 -20.377 0.50 29.18 ? 32  LYS B CD  1 
ATOM   379  C  CE  . LYS B 2 32  ? -15.029 -38.605 -20.780 0.50 36.08 ? 32  LYS B CE  1 
ATOM   380  N  NZ  . LYS B 2 32  ? -15.365 -38.809 -22.218 0.80 45.57 ? 32  LYS B NZ  1 
ATOM   381  N  N   . THR B 2 33  ? -13.281 -41.311 -15.790 1.00 26.54 ? 33  THR B N   1 
ATOM   382  C  CA  . THR B 2 33  ? -14.355 -41.824 -14.939 1.00 25.96 ? 33  THR B CA  1 
ATOM   383  C  C   . THR B 2 33  ? -14.157 -41.438 -13.469 1.00 26.87 ? 33  THR B C   1 
ATOM   384  O  O   . THR B 2 33  ? -15.108 -41.015 -12.798 1.00 27.58 ? 33  THR B O   1 
ATOM   385  C  CB  . THR B 2 33  ? -14.490 -43.361 -15.082 1.00 26.98 ? 33  THR B CB  1 
ATOM   386  O  OG1 . THR B 2 33  ? -14.518 -43.706 -16.472 1.00 28.27 ? 33  THR B OG1 1 
ATOM   387  C  CG2 . THR B 2 33  ? -15.767 -43.864 -14.417 1.00 27.11 ? 33  THR B CG2 1 
ATOM   388  N  N   . VAL B 2 34  ? -12.925 -41.584 -12.973 1.00 25.59 ? 34  VAL B N   1 
ATOM   389  C  CA  . VAL B 2 34  ? -12.583 -41.231 -11.592 1.00 26.15 ? 34  VAL B CA  1 
ATOM   390  C  C   . VAL B 2 34  ? -12.860 -39.747 -11.331 1.00 26.45 ? 34  VAL B C   1 
ATOM   391  O  O   . VAL B 2 34  ? -13.361 -39.384 -10.260 1.00 28.03 ? 34  VAL B O   1 
ATOM   392  C  CB  . VAL B 2 34  ? -11.104 -41.574 -11.265 1.00 28.88 ? 34  VAL B CB  1 
ATOM   393  C  CG1 . VAL B 2 34  ? -10.595 -40.794 -10.063 1.00 34.64 ? 34  VAL B CG1 1 
ATOM   394  C  CG2 . VAL B 2 34  ? -10.957 -43.061 -11.006 1.00 31.79 ? 34  VAL B CG2 1 
ATOM   395  N  N   . ASN B 2 35  ? -12.549 -38.907 -12.316 1.00 25.11 ? 35  ASN B N   1 
ATOM   396  C  CA  . ASN B 2 35  ? -12.808 -37.469 -12.204 1.00 27.65 ? 35  ASN B CA  1 
ATOM   397  C  C   . ASN B 2 35  ? -14.307 -37.161 -12.083 1.00 30.34 ? 35  ASN B C   1 
ATOM   398  O  O   . ASN B 2 35  ? -14.694 -36.247 -11.351 1.00 33.98 ? 35  ASN B O   1 
ATOM   399  C  CB  . ASN B 2 35  ? -12.154 -36.707 -13.363 1.00 29.75 ? 35  ASN B CB  1 
ATOM   400  C  CG  . ASN B 2 35  ? -10.685 -36.398 -13.103 1.00 29.32 ? 35  ASN B CG  1 
ATOM   401  O  OD1 . ASN B 2 35  ? -10.259 -36.283 -11.954 1.00 33.14 ? 35  ASN B OD1 1 
ATOM   402  N  ND2 . ASN B 2 35  ? -9.904  -36.260 -14.173 1.00 33.24 ? 35  ASN B ND2 1 
ATOM   403  N  N   . LYS B 2 36  ? -15.144 -37.947 -12.761 1.00 29.87 ? 36  LYS B N   1 
ATOM   404  C  CA  . LYS B 2 36  ? -16.607 -37.828 -12.607 1.00 29.55 ? 36  LYS B CA  1 
ATOM   405  C  C   . LYS B 2 36  ? -17.050 -38.184 -11.191 1.00 32.39 ? 36  LYS B C   1 
ATOM   406  O  O   . LYS B 2 36  ? -17.927 -37.521 -10.621 1.00 34.80 ? 36  LYS B O   1 
ATOM   407  C  CB  . LYS B 2 36  ? -17.349 -38.709 -13.616 1.00 29.30 ? 36  LYS B CB  1 
ATOM   408  C  CG  . LYS B 2 36  ? -17.171 -38.309 -15.068 1.00 33.08 ? 36  LYS B CG  1 
ATOM   409  C  CD  . LYS B 2 36  ? -17.923 -39.267 -15.982 1.00 42.38 ? 36  LYS B CD  1 
ATOM   410  C  CE  . LYS B 2 36  ? -17.912 -38.779 -17.422 1.00 47.46 ? 36  LYS B CE  1 
ATOM   411  N  NZ  . LYS B 2 36  ? -18.446 -39.808 -18.359 1.00 55.78 ? 36  LYS B NZ  1 
ATOM   412  N  N   . ILE B 2 37  ? -16.444 -39.228 -10.618 1.00 29.04 ? 37  ILE B N   1 
ATOM   413  C  CA  . ILE B 2 37  ? -16.732 -39.622 -9.234  1.00 30.22 ? 37  ILE B CA  1 
ATOM   414  C  C   . ILE B 2 37  ? -16.325 -38.518 -8.252  1.00 32.84 ? 37  ILE B C   1 
ATOM   415  O  O   . ILE B 2 37  ? -17.043 -38.238 -7.285  1.00 34.77 ? 37  ILE B O   1 
ATOM   416  C  CB  . ILE B 2 37  ? -16.055 -40.963 -8.858  1.00 27.13 ? 37  ILE B CB  1 
ATOM   417  C  CG1 . ILE B 2 37  ? -16.646 -42.105 -9.696  1.00 26.40 ? 37  ILE B CG1 1 
ATOM   418  C  CG2 . ILE B 2 37  ? -16.207 -41.262 -7.369  1.00 27.93 ? 37  ILE B CG2 1 
ATOM   419  C  CD1 . ILE B 2 37  ? -15.907 -43.430 -9.582  1.00 28.68 ? 37  ILE B CD1 1 
ATOM   420  N  N   . LEU B 2 38  ? -15.179 -37.891 -8.515  1.00 30.05 ? 38  LEU B N   1 
ATOM   421  C  CA  . LEU B 2 38  ? -14.665 -36.828 -7.655  1.00 33.59 ? 38  LEU B CA  1 
ATOM   422  C  C   . LEU B 2 38  ? -15.486 -35.545 -7.732  1.00 34.24 ? 38  LEU B C   1 
ATOM   423  O  O   . LEU B 2 38  ? -15.467 -34.748 -6.798  1.00 39.84 ? 38  LEU B O   1 
ATOM   424  C  CB  . LEU B 2 38  ? -13.189 -36.541 -7.951  1.00 32.53 ? 38  LEU B CB  1 
ATOM   425  C  CG  . LEU B 2 38  ? -12.218 -37.595 -7.402  1.00 31.66 ? 38  LEU B CG  1 
ATOM   426  C  CD1 . LEU B 2 38  ? -10.842 -37.452 -8.041  1.00 32.30 ? 38  LEU B CD1 1 
ATOM   427  C  CD2 . LEU B 2 38  ? -12.121 -37.545 -5.883  1.00 33.52 ? 38  LEU B CD2 1 
ATOM   428  N  N   . GLN B 2 39  ? -16.195 -35.347 -8.840  1.00 34.79 ? 39  GLN B N   1 
ATOM   429  C  CA  . GLN B 2 39  ? -17.132 -34.222 -8.953  1.00 36.49 ? 39  GLN B CA  1 
ATOM   430  C  C   . GLN B 2 39  ? -18.323 -34.411 -8.016  1.00 42.29 ? 39  GLN B C   1 
ATOM   431  O  O   . GLN B 2 39  ? -18.887 -33.435 -7.511  1.00 46.84 ? 39  GLN B O   1 
ATOM   432  C  CB  . GLN B 2 39  ? -17.604 -34.042 -10.395 1.00 35.61 ? 39  GLN B CB  1 
ATOM   433  C  CG  . GLN B 2 39  ? -16.580 -33.381 -11.303 1.00 42.93 ? 39  GLN B CG  1 
ATOM   434  N  N   . ILE B 2 40  ? -18.680 -35.670 -7.775  1.00 39.48 ? 40  ILE B N   1 
ATOM   435  C  CA  . ILE B 2 40  ? -19.801 -36.031 -6.902  1.00 38.72 ? 40  ILE B CA  1 
ATOM   436  C  C   . ILE B 2 40  ? -19.359 -36.159 -5.440  1.00 41.36 ? 40  ILE B C   1 
ATOM   437  O  O   . ILE B 2 40  ? -20.019 -35.632 -4.537  1.00 47.17 ? 40  ILE B O   1 
ATOM   438  C  CB  . ILE B 2 40  ? -20.488 -37.326 -7.399  1.00 39.22 ? 40  ILE B CB  1 
ATOM   439  C  CG1 . ILE B 2 40  ? -21.019 -37.121 -8.825  1.00 40.60 ? 40  ILE B CG1 1 
ATOM   440  C  CG2 . ILE B 2 40  ? -21.606 -37.757 -6.453  1.00 43.24 ? 40  ILE B CG2 1 
ATOM   441  C  CD1 . ILE B 2 40  ? -21.366 -38.392 -9.574  1.00 43.36 ? 40  ILE B CD1 1 
ATOM   442  N  N   . ASN B 2 41  ? -18.243 -36.849 -5.214  1.00 38.72 ? 41  ASN B N   1 
ATOM   443  C  CA  . ASN B 2 41  ? -17.686 -37.039 -3.877  1.00 40.87 ? 41  ASN B CA  1 
ATOM   444  C  C   . ASN B 2 41  ? -16.251 -36.500 -3.828  1.00 46.08 ? 41  ASN B C   1 
ATOM   445  O  O   . ASN B 2 41  ? -15.295 -37.252 -4.022  1.00 42.41 ? 41  ASN B O   1 
ATOM   446  C  CB  . ASN B 2 41  ? -17.728 -38.527 -3.481  1.00 46.29 ? 41  ASN B CB  1 
ATOM   447  C  CG  . ASN B 2 41  ? -19.138 -39.113 -3.505  1.00 50.70 ? 41  ASN B CG  1 
ATOM   448  O  OD1 . ASN B 2 41  ? -19.358 -40.212 -4.022  1.00 52.75 ? 41  ASN B OD1 1 
ATOM   449  N  ND2 . ASN B 2 41  ? -20.096 -38.388 -2.941  1.00 51.54 ? 41  ASN B ND2 1 
ATOM   450  N  N   . LYS B 2 42  ? -16.106 -35.202 -3.549  1.00 48.45 ? 42  LYS B N   1 
ATOM   451  C  CA  . LYS B 2 42  ? -14.834 -34.486 -3.779  1.00 51.79 ? 42  LYS B CA  1 
ATOM   452  C  C   . LYS B 2 42  ? -13.607 -34.985 -2.996  1.00 44.88 ? 42  LYS B C   1 
ATOM   453  O  O   . LYS B 2 42  ? -12.470 -34.836 -3.458  1.00 55.23 ? 42  LYS B O   1 
ATOM   454  C  CB  . LYS B 2 42  ? -15.009 -32.962 -3.615  1.00 56.15 ? 42  LYS B CB  1 
ATOM   455  C  CG  . LYS B 2 42  ? -15.083 -32.463 -2.179  1.00 59.21 ? 42  LYS B CG  1 
ATOM   456  C  CD  . LYS B 2 42  ? -15.108 -30.942 -2.122  1.00 60.76 ? 42  LYS B CD  1 
ATOM   457  C  CE  . LYS B 2 42  ? -15.069 -30.445 -0.686  1.00 64.27 ? 42  LYS B CE  1 
ATOM   458  N  N   . ASP B 2 43  ? -13.836 -35.567 -1.825  1.00 43.98 ? 43  ASP B N   1 
ATOM   459  C  CA  . ASP B 2 43  ? -12.739 -36.034 -0.980  1.00 49.39 ? 43  ASP B CA  1 
ATOM   460  C  C   . ASP B 2 43  ? -12.773 -37.546 -0.763  1.00 41.28 ? 43  ASP B C   1 
ATOM   461  O  O   . ASP B 2 43  ? -12.315 -38.051 0.266   1.00 41.17 ? 43  ASP B O   1 
ATOM   462  C  CB  . ASP B 2 43  ? -12.735 -35.281 0.357   1.00 56.45 ? 43  ASP B CB  1 
ATOM   463  C  CG  . ASP B 2 43  ? -12.318 -33.821 0.210   1.00 65.41 ? 43  ASP B CG  1 
ATOM   464  O  OD1 . ASP B 2 43  ? -11.517 -33.499 -0.699  1.00 62.76 ? 43  ASP B OD1 1 
ATOM   465  O  OD2 . ASP B 2 43  ? -12.790 -32.994 1.019   1.00 71.21 ? 43  ASP B OD2 1 
ATOM   466  N  N   . ASP B 2 44  ? -13.312 -38.268 -1.742  1.00 37.28 ? 44  ASP B N   1 
ATOM   467  C  CA  . ASP B 2 44  ? -13.337 -39.726 -1.694  1.00 36.39 ? 44  ASP B CA  1 
ATOM   468  C  C   . ASP B 2 44  ? -11.895 -40.224 -1.792  1.00 34.66 ? 44  ASP B C   1 
ATOM   469  O  O   . ASP B 2 44  ? -11.224 -39.996 -2.795  1.00 35.13 ? 44  ASP B O   1 
ATOM   470  C  CB  . ASP B 2 44  ? -14.198 -40.286 -2.834  1.00 34.27 ? 44  ASP B CB  1 
ATOM   471  C  CG  . ASP B 2 44  ? -14.413 -41.785 -2.728  1.00 38.09 ? 44  ASP B CG  1 
ATOM   472  O  OD1 . ASP B 2 44  ? -13.446 -42.543 -2.925  1.00 35.21 ? 44  ASP B OD1 1 
ATOM   473  O  OD2 . ASP B 2 44  ? -15.558 -42.213 -2.458  1.00 40.52 ? 44  ASP B OD2 1 
ATOM   474  N  N   . VAL B 2 45  ? -11.430 -40.879 -0.731  1.00 31.22 ? 45  VAL B N   1 
ATOM   475  C  CA  . VAL B 2 45  ? -10.034 -41.298 -0.599  1.00 34.06 ? 45  VAL B CA  1 
ATOM   476  C  C   . VAL B 2 45  ? -9.669  -42.323 -1.676  1.00 33.27 ? 45  VAL B C   1 
ATOM   477  O  O   . VAL B 2 45  ? -8.611  -42.224 -2.308  1.00 31.09 ? 45  VAL B O   1 
ATOM   478  C  CB  . VAL B 2 45  ? -9.748  -41.860 0.816   1.00 35.85 ? 45  VAL B CB  1 
ATOM   479  C  CG1 . VAL B 2 45  ? -8.375  -42.514 0.886   1.00 36.49 ? 45  VAL B CG1 1 
ATOM   480  C  CG2 . VAL B 2 45  ? -9.861  -40.748 1.855   1.00 39.81 ? 45  VAL B CG2 1 
ATOM   481  N  N   . THR B 2 46  ? -10.562 -43.280 -1.896  1.00 31.45 ? 46  THR B N   1 
ATOM   482  C  CA  . THR B 2 46  ? -10.332 -44.331 -2.896  1.00 29.30 ? 46  THR B CA  1 
ATOM   483  C  C   . THR B 2 46  ? -10.239 -43.741 -4.302  1.00 29.13 ? 46  THR B C   1 
ATOM   484  O  O   . THR B 2 46  ? -9.367  -44.132 -5.093  1.00 29.86 ? 46  THR B O   1 
ATOM   485  C  CB  . THR B 2 46  ? -11.417 -45.422 -2.815  1.00 32.08 ? 46  THR B CB  1 
ATOM   486  O  OG1 . THR B 2 46  ? -11.497 -45.905 -1.468  1.00 32.92 ? 46  THR B OG1 1 
ATOM   487  C  CG2 . THR B 2 46  ? -11.088 -46.599 -3.734  1.00 30.78 ? 46  THR B CG2 1 
ATOM   488  N  N   . ALA B 2 47  ? -11.123 -42.791 -4.606  1.00 27.08 ? 47  ALA B N   1 
ATOM   489  C  CA  . ALA B 2 47  ? -11.086 -42.088 -5.884  1.00 28.19 ? 47  ALA B CA  1 
ATOM   490  C  C   . ALA B 2 47  ? -9.806  -41.262 -6.052  1.00 28.58 ? 47  ALA B C   1 
ATOM   491  O  O   . ALA B 2 47  ? -9.199  -41.270 -7.121  1.00 26.53 ? 47  ALA B O   1 
ATOM   492  C  CB  . ALA B 2 47  ? -12.323 -41.224 -6.063  1.00 30.84 ? 47  ALA B CB  1 
ATOM   493  N  N   . LEU B 2 48  ? -9.393  -40.554 -5.000  1.00 29.32 ? 48  LEU B N   1 
ATOM   494  C  CA  . LEU B 2 48  ? -8.137  -39.810 -5.056  1.00 28.08 ? 48  LEU B CA  1 
ATOM   495  C  C   . LEU B 2 48  ? -6.966  -40.768 -5.308  1.00 26.35 ? 48  LEU B C   1 
ATOM   496  O  O   . LEU B 2 48  ? -6.098  -40.478 -6.126  1.00 27.64 ? 48  LEU B O   1 
ATOM   497  C  CB  . LEU B 2 48  ? -7.912  -38.996 -3.778  1.00 29.16 ? 48  LEU B CB  1 
ATOM   498  C  CG  . LEU B 2 48  ? -8.835  -37.783 -3.596  1.00 31.20 ? 48  LEU B CG  1 
ATOM   499  C  CD1 . LEU B 2 48  ? -8.716  -37.232 -2.178  1.00 34.83 ? 48  LEU B CD1 1 
ATOM   500  C  CD2 . LEU B 2 48  ? -8.552  -36.704 -4.634  1.00 32.69 ? 48  LEU B CD2 1 
ATOM   501  N  N   . HIS B 2 49  ? -6.969  -41.906 -4.615  1.00 26.13 ? 49  HIS B N   1 
ATOM   502  C  CA  . HIS B 2 49  ? -5.932  -42.933 -4.785  1.00 25.32 ? 49  HIS B CA  1 
ATOM   503  C  C   . HIS B 2 49  ? -5.900  -43.427 -6.214  1.00 26.24 ? 49  HIS B C   1 
ATOM   504  O  O   . HIS B 2 49  ? -4.833  -43.454 -6.843  1.00 26.33 ? 49  HIS B O   1 
ATOM   505  C  CB  . HIS B 2 49  ? -6.168  -44.087 -3.812  1.00 27.12 ? 49  HIS B CB  1 
ATOM   506  C  CG  . HIS B 2 49  ? -4.972  -44.995 -3.621  1.00 27.38 ? 49  HIS B CG  1 
ATOM   507  N  ND1 . HIS B 2 49  ? -4.901  -45.888 -2.620  1.00 29.83 ? 49  HIS B ND1 1 
ATOM   508  C  CD2 . HIS B 2 49  ? -3.781  -45.121 -4.347  1.00 28.52 ? 49  HIS B CD2 1 
ATOM   509  C  CE1 . HIS B 2 49  ? -3.729  -46.561 -2.696  1.00 28.97 ? 49  HIS B CE1 1 
ATOM   510  N  NE2 . HIS B 2 49  ? -3.047  -46.090 -3.755  1.00 27.61 ? 49  HIS B NE2 1 
ATOM   511  N  N   . CYS B 2 50  ? -7.062  -43.802 -6.757  1.00 24.61 ? 50  CYS B N   1 
ATOM   512  C  CA  . CYS B 2 50  ? -7.136  -44.225 -8.164  1.00 23.28 ? 50  CYS B CA  1 
ATOM   513  C  C   . CYS B 2 50  ? -6.671  -43.140 -9.135  1.00 24.50 ? 50  CYS B C   1 
ATOM   514  O  O   . CYS B 2 50  ? -5.968  -43.437 -10.105 1.00 23.25 ? 50  CYS B O   1 
ATOM   515  C  CB  . CYS B 2 50  ? -8.548  -44.702 -8.536  1.00 24.68 ? 50  CYS B CB  1 
ATOM   516  S  SG  . CYS B 2 50  ? -9.006  -46.240 -7.723  1.00 28.08 ? 50  CYS B SG  1 
ATOM   517  N  N   . LYS B 2 51  ? -7.056  -41.886 -8.886  1.00 24.60 ? 51  LYS B N   1 
ATOM   518  C  CA  . LYS B 2 51  ? -6.627  -40.792 -9.763  1.00 25.80 ? 51  LYS B CA  1 
ATOM   519  C  C   . LYS B 2 51  ? -5.099  -40.699 -9.813  1.00 23.94 ? 51  LYS B C   1 
ATOM   520  O  O   . LYS B 2 51  ? -4.510  -40.574 -10.885 1.00 23.68 ? 51  LYS B O   1 
ATOM   521  C  CB  . LYS B 2 51  ? -7.225  -39.454 -9.314  1.00 25.06 ? 51  LYS B CB  1 
ATOM   522  C  CG  . LYS B 2 51  ? -6.735  -38.259 -10.112 1.00 25.88 ? 51  LYS B CG  1 
ATOM   523  C  CD  . LYS B 2 51  ? -7.583  -37.032 -9.805  1.00 28.87 ? 51  LYS B CD  1 
ATOM   524  C  CE  . LYS B 2 51  ? -7.148  -35.851 -10.650 1.00 30.92 ? 51  LYS B CE  1 
ATOM   525  N  NZ  . LYS B 2 51  ? -8.196  -34.790 -10.615 1.00 35.31 ? 51  LYS B NZ  1 
ATOM   526  N  N   . VAL B 2 52  ? -4.478  -40.767 -8.642  1.00 24.36 ? 52  VAL B N   1 
ATOM   527  C  CA  . VAL B 2 52  ? -3.018  -40.723 -8.526  1.00 24.97 ? 52  VAL B CA  1 
ATOM   528  C  C   . VAL B 2 52  ? -2.386  -41.865 -9.335  1.00 24.00 ? 52  VAL B C   1 
ATOM   529  O  O   . VAL B 2 52  ? -1.449  -41.637 -10.101 1.00 25.22 ? 52  VAL B O   1 
ATOM   530  C  CB  . VAL B 2 52  ? -2.584  -40.762 -7.046  1.00 26.00 ? 52  VAL B CB  1 
ATOM   531  C  CG1 . VAL B 2 52  ? -1.091  -41.039 -6.916  1.00 25.56 ? 52  VAL B CG1 1 
ATOM   532  C  CG2 . VAL B 2 52  ? -2.941  -39.445 -6.357  1.00 27.11 ? 52  VAL B CG2 1 
ATOM   533  N  N   . VAL B 2 53  ? -2.917  -43.079 -9.182  1.00 23.62 ? 53  VAL B N   1 
ATOM   534  C  CA  . VAL B 2 53  ? -2.438  -44.237 -9.960  1.00 23.32 ? 53  VAL B CA  1 
ATOM   535  C  C   . VAL B 2 53  ? -2.551  -43.998 -11.474 1.00 23.63 ? 53  VAL B C   1 
ATOM   536  O  O   . VAL B 2 53  ? -1.597  -44.250 -12.217 1.00 22.27 ? 53  VAL B O   1 
ATOM   537  C  CB  . VAL B 2 53  ? -3.144  -45.544 -9.534  1.00 23.25 ? 53  VAL B CB  1 
ATOM   538  C  CG1 . VAL B 2 53  ? -2.825  -46.694 -10.490 1.00 23.98 ? 53  VAL B CG1 1 
ATOM   539  C  CG2 . VAL B 2 53  ? -2.738  -45.917 -8.116  1.00 25.08 ? 53  VAL B CG2 1 
ATOM   540  N  N   . CYS B 2 54  ? -3.700  -43.500 -11.934 1.00 23.74 ? 54  CYS B N   1 
ATOM   541  C  CA  . CYS B 2 54  ? -3.878  -43.229 -13.366 1.00 24.17 ? 54  CYS B CA  1 
ATOM   542  C  C   . CYS B 2 54  ? -2.837  -42.231 -13.871 1.00 23.65 ? 54  CYS B C   1 
ATOM   543  O  O   . CYS B 2 54  ? -2.252  -42.416 -14.930 1.00 23.77 ? 54  CYS B O   1 
ATOM   544  C  CB  . CYS B 2 54  ? -5.269  -42.662 -13.657 1.00 24.43 ? 54  CYS B CB  1 
ATOM   545  S  SG  . CYS B 2 54  ? -6.637  -43.821 -13.418 1.00 25.58 ? 54  CYS B SG  1 
ATOM   546  N  N   . LEU B 2 55  ? -2.631  -41.162 -13.108 1.00 23.65 ? 55  LEU B N   1 
ATOM   547  C  CA  . LEU B 2 55  ? -1.700  -40.113 -13.506 1.00 23.17 ? 55  LEU B CA  1 
ATOM   548  C  C   . LEU B 2 55  ? -0.277  -40.668 -13.601 1.00 22.26 ? 55  LEU B C   1 
ATOM   549  O  O   . LEU B 2 55  ? 0.429   -40.409 -14.586 1.00 24.23 ? 55  LEU B O   1 
ATOM   550  C  CB  . LEU B 2 55  ? -1.790  -38.935 -12.529 1.00 25.38 ? 55  LEU B CB  1 
ATOM   551  C  CG  . LEU B 2 55  ? -3.097  -38.136 -12.675 1.00 25.28 ? 55  LEU B CG  1 
ATOM   552  C  CD1 . LEU B 2 55  ? -3.309  -37.234 -11.468 1.00 26.84 ? 55  LEU B CD1 1 
ATOM   553  C  CD2 . LEU B 2 55  ? -3.102  -37.339 -13.980 1.00 25.93 ? 55  LEU B CD2 1 
ATOM   554  N  N   . ILE B 2 56  ? 0.128   -41.460 -12.605 1.00 23.35 ? 56  ILE B N   1 
ATOM   555  C  CA  . ILE B 2 56  ? 1.469   -42.073 -12.617 1.00 21.85 ? 56  ILE B CA  1 
ATOM   556  C  C   . ILE B 2 56  ? 1.608   -42.987 -13.841 1.00 21.72 ? 56  ILE B C   1 
ATOM   557  O  O   . ILE B 2 56  ? 2.603   -42.936 -14.581 1.00 21.30 ? 56  ILE B O   1 
ATOM   558  C  CB  . ILE B 2 56  ? 1.765   -42.862 -11.324 1.00 23.03 ? 56  ILE B CB  1 
ATOM   559  C  CG1 . ILE B 2 56  ? 1.872   -41.895 -10.128 1.00 24.14 ? 56  ILE B CG1 1 
ATOM   560  C  CG2 . ILE B 2 56  ? 3.067   -43.652 -11.471 1.00 23.22 ? 56  ILE B CG2 1 
ATOM   561  C  CD1 . ILE B 2 56  ? 1.878   -42.573 -8.770  1.00 25.00 ? 56  ILE B CD1 1 
ATOM   562  N  N   . GLN B 2 57  ? 0.586   -43.800 -14.074 1.00 20.67 ? 57  GLN B N   1 
ATOM   563  C  CA  . GLN B 2 57  ? 0.604   -44.722 -15.214 1.00 21.11 ? 57  GLN B CA  1 
ATOM   564  C  C   . GLN B 2 57  ? 0.728   -44.007 -16.556 1.00 22.14 ? 57  GLN B C   1 
ATOM   565  O  O   . GLN B 2 57  ? 1.306   -44.551 -17.500 1.00 22.02 ? 57  GLN B O   1 
ATOM   566  C  CB  . GLN B 2 57  ? -0.652  -45.605 -15.192 1.00 20.92 ? 57  GLN B CB  1 
ATOM   567  C  CG  . GLN B 2 57  ? -0.618  -46.688 -14.115 1.00 23.75 ? 57  GLN B CG  1 
ATOM   568  C  CD  . GLN B 2 57  ? 0.338   -47.826 -14.439 1.00 22.85 ? 57  GLN B CD  1 
ATOM   569  O  OE1 . GLN B 2 57  ? 0.809   -47.957 -15.567 1.00 24.14 ? 57  GLN B OE1 1 
ATOM   570  N  NE2 . GLN B 2 57  ? 0.630   -48.652 -13.446 1.00 24.19 ? 57  GLN B NE2 1 
ATOM   571  N  N   . ASN B 2 58  ? 0.190   -42.789 -16.639 1.00 22.35 ? 58  ASN B N   1 
ATOM   572  C  CA  . ASN B 2 58  ? 0.288   -41.987 -17.864 1.00 22.95 ? 58  ASN B CA  1 
ATOM   573  C  C   . ASN B 2 58  ? 1.457   -40.995 -17.851 1.00 24.30 ? 58  ASN B C   1 
ATOM   574  O  O   . ASN B 2 58  ? 1.547   -40.130 -18.720 1.00 23.74 ? 58  ASN B O   1 
ATOM   575  C  CB  . ASN B 2 58  ? -1.044  -41.271 -18.156 1.00 23.92 ? 58  ASN B CB  1 
ATOM   576  C  CG  . ASN B 2 58  ? -2.094  -42.201 -18.741 1.00 25.20 ? 58  ASN B CG  1 
ATOM   577  O  OD1 . ASN B 2 58  ? -1.810  -43.354 -19.079 1.00 25.02 ? 58  ASN B OD1 1 
ATOM   578  N  ND2 . ASN B 2 58  ? -3.321  -41.699 -18.869 1.00 26.95 ? 58  ASN B ND2 1 
ATOM   579  N  N   . GLY B 2 59  ? 2.339   -41.126 -16.860 1.00 24.82 ? 59  GLY B N   1 
ATOM   580  C  CA  . GLY B 2 59  ? 3.563   -40.319 -16.788 1.00 25.67 ? 59  GLY B CA  1 
ATOM   581  C  C   . GLY B 2 59  ? 3.381   -38.892 -16.289 1.00 27.78 ? 59  GLY B C   1 
ATOM   582  O  O   . GLY B 2 59  ? 4.271   -38.063 -16.462 1.00 28.80 ? 59  GLY B O   1 
ATOM   583  N  N   . SER B 2 60  ? 2.234   -38.605 -15.674 1.00 25.78 ? 60  SER B N   1 
ATOM   584  C  CA  . SER B 2 60  ? 1.948   -37.273 -15.129 1.00 25.52 ? 60  SER B CA  1 
ATOM   585  C  C   . SER B 2 60  ? 2.325   -37.193 -13.653 1.00 25.76 ? 60  SER B C   1 
ATOM   586  O  O   . SER B 2 60  ? 1.458   -37.103 -12.780 1.00 27.45 ? 60  SER B O   1 
ATOM   587  C  CB  . SER B 2 60  ? 0.469   -36.925 -15.321 1.00 26.77 ? 60  SER B CB  1 
ATOM   588  O  OG  . SER B 2 60  ? 0.181   -36.771 -16.697 1.00 31.05 ? 60  SER B OG  1 
ATOM   589  N  N   . PHE B 2 61  ? 3.629   -37.220 -13.380 1.00 25.85 ? 61  PHE B N   1 
ATOM   590  C  CA  . PHE B 2 61  ? 4.115   -37.333 -12.010 1.00 25.78 ? 61  PHE B CA  1 
ATOM   591  C  C   . PHE B 2 61  ? 3.889   -36.063 -11.200 1.00 27.67 ? 61  PHE B C   1 
ATOM   592  O  O   . PHE B 2 61  ? 3.523   -36.144 -10.027 1.00 27.74 ? 61  PHE B O   1 
ATOM   593  C  CB  . PHE B 2 61  ? 5.597   -37.741 -11.988 1.00 26.84 ? 61  PHE B CB  1 
ATOM   594  C  CG  . PHE B 2 61  ? 5.907   -38.946 -12.836 1.00 24.92 ? 61  PHE B CG  1 
ATOM   595  C  CD1 . PHE B 2 61  ? 5.317   -40.182 -12.558 1.00 27.00 ? 61  PHE B CD1 1 
ATOM   596  C  CD2 . PHE B 2 61  ? 6.789   -38.850 -13.910 1.00 24.19 ? 61  PHE B CD2 1 
ATOM   597  C  CE1 . PHE B 2 61  ? 5.605   -41.297 -13.343 1.00 25.11 ? 61  PHE B CE1 1 
ATOM   598  C  CE2 . PHE B 2 61  ? 7.080   -39.959 -14.698 1.00 26.94 ? 61  PHE B CE2 1 
ATOM   599  C  CZ  . PHE B 2 61  ? 6.481   -41.186 -14.415 1.00 25.55 ? 61  PHE B CZ  1 
ATOM   600  N  N   . LYS B 2 62  ? 4.101   -34.901 -11.822 1.00 30.35 ? 62  LYS B N   1 
ATOM   601  C  CA  . LYS B 2 62  ? 3.838   -33.611 -11.150 1.00 33.15 ? 62  LYS B CA  1 
ATOM   602  C  C   . LYS B 2 62  ? 2.366   -33.487 -10.762 1.00 31.09 ? 62  LYS B C   1 
ATOM   603  O  O   . LYS B 2 62  ? 2.048   -33.140 -9.623  1.00 32.43 ? 62  LYS B O   1 
ATOM   604  C  CB  . LYS B 2 62  ? 4.263   -32.422 -12.022 1.00 36.21 ? 62  LYS B CB  1 
ATOM   605  C  CG  . LYS B 2 62  ? 5.764   -32.177 -12.060 1.00 44.04 ? 62  LYS B CG  1 
ATOM   606  C  CD  . LYS B 2 62  ? 6.118   -30.941 -12.878 1.00 51.39 ? 62  LYS B CD  1 
ATOM   607  C  CE  . LYS B 2 62  ? 7.622   -30.818 -13.074 1.00 56.65 ? 62  LYS B CE  1 
ATOM   608  N  N   . GLU B 2 63  ? 1.474   -33.799 -11.703 1.00 31.11 ? 63  GLU B N   1 
ATOM   609  C  CA  . GLU B 2 63  ? 0.037   -33.732 -11.444 1.00 30.05 ? 63  GLU B CA  1 
ATOM   610  C  C   . GLU B 2 63  ? -0.381  -34.705 -10.346 1.00 30.03 ? 63  GLU B C   1 
ATOM   611  O  O   . GLU B 2 63  ? -1.146  -34.334 -9.455  1.00 30.08 ? 63  GLU B O   1 
ATOM   612  C  CB  . GLU B 2 63  ? -0.776  -33.956 -12.729 1.00 32.39 ? 63  GLU B CB  1 
ATOM   613  C  CG  . GLU B 2 63  ? -2.268  -33.695 -12.562 1.00 39.07 ? 63  GLU B CG  1 
ATOM   614  C  CD  . GLU B 2 63  ? -3.063  -33.865 -13.845 1.00 44.15 ? 63  GLU B CD  1 
ATOM   615  O  OE1 . GLU B 2 63  ? -2.444  -34.020 -14.923 1.00 44.70 ? 63  GLU B OE1 1 
ATOM   616  O  OE2 . GLU B 2 63  ? -4.315  -33.843 -13.771 1.00 49.58 ? 63  GLU B OE2 1 
ATOM   617  N  N   . ALA B 2 64  ? 0.134   -35.939 -10.391 1.00 27.77 ? 64  ALA B N   1 
ATOM   618  C  CA  . ALA B 2 64  ? -0.144  -36.921 -9.336  1.00 28.62 ? 64  ALA B CA  1 
ATOM   619  C  C   . ALA B 2 64  ? 0.302   -36.427 -7.958  1.00 30.53 ? 64  ALA B C   1 
ATOM   620  O  O   . ALA B 2 64  ? -0.429  -36.542 -6.968  1.00 29.74 ? 64  ALA B O   1 
ATOM   621  C  CB  . ALA B 2 64  ? 0.522   -38.258 -9.657  1.00 28.47 ? 64  ALA B CB  1 
ATOM   622  N  N   . LEU B 2 65  ? 1.515   -35.887 -7.901  1.00 30.84 ? 65  LEU B N   1 
ATOM   623  C  CA  . LEU B 2 65  ? 2.064   -35.384 -6.649  1.00 32.87 ? 65  LEU B CA  1 
ATOM   624  C  C   . LEU B 2 65  ? 1.223   -34.223 -6.108  1.00 32.78 ? 65  LEU B C   1 
ATOM   625  O  O   . LEU B 2 65  ? 0.997   -34.123 -4.896  1.00 35.47 ? 65  LEU B O   1 
ATOM   626  C  CB  . LEU B 2 65  ? 3.527   -34.977 -6.836  1.00 34.04 ? 65  LEU B CB  1 
ATOM   627  C  CG  . LEU B 2 65  ? 4.319   -34.588 -5.590  1.00 35.48 ? 65  LEU B CG  1 
ATOM   628  C  CD1 . LEU B 2 65  ? 4.272   -35.692 -4.543  1.00 32.90 ? 65  LEU B CD1 1 
ATOM   629  C  CD2 . LEU B 2 65  ? 5.753   -34.254 -5.976  1.00 37.71 ? 65  LEU B CD2 1 
ATOM   630  N  N   . ASN B 2 66  ? 0.748   -33.378 -7.021  1.00 34.12 ? 66  ASN B N   1 
ATOM   631  C  CA  . ASN B 2 66  ? -0.122  -32.246 -6.690  1.00 36.47 ? 66  ASN B CA  1 
ATOM   632  C  C   . ASN B 2 66  ? -1.458  -32.691 -6.091  1.00 36.84 ? 66  ASN B C   1 
ATOM   633  O  O   . ASN B 2 66  ? -1.939  -32.085 -5.137  1.00 37.53 ? 66  ASN B O   1 
ATOM   634  C  CB  . ASN B 2 66  ? -0.352  -31.364 -7.921  1.00 40.05 ? 66  ASN B CB  1 
ATOM   635  C  CG  . ASN B 2 66  ? -1.148  -30.114 -7.601  1.00 45.59 ? 66  ASN B CG  1 
ATOM   636  O  OD1 . ASN B 2 66  ? -0.685  -29.243 -6.865  1.00 51.45 ? 66  ASN B OD1 1 
ATOM   637  N  ND2 . ASN B 2 66  ? -2.351  -30.018 -8.155  1.00 48.37 ? 66  ASN B ND2 1 
ATOM   638  N  N   . VAL B 2 67  ? -2.047  -33.758 -6.636  1.00 35.12 ? 67  VAL B N   1 
ATOM   639  C  CA  . VAL B 2 67  ? -3.245  -34.352 -6.042  1.00 33.68 ? 67  VAL B CA  1 
ATOM   640  C  C   . VAL B 2 67  ? -2.982  -34.740 -4.578  1.00 33.40 ? 67  VAL B C   1 
ATOM   641  O  O   . VAL B 2 67  ? -3.779  -34.422 -3.694  1.00 36.98 ? 67  VAL B O   1 
ATOM   642  C  CB  . VAL B 2 67  ? -3.764  -35.574 -6.851  1.00 32.46 ? 67  VAL B CB  1 
ATOM   643  C  CG1 . VAL B 2 67  ? -4.936  -36.238 -6.137  1.00 32.54 ? 67  VAL B CG1 1 
ATOM   644  C  CG2 . VAL B 2 67  ? -4.186  -35.153 -8.253  1.00 32.18 ? 67  VAL B CG2 1 
ATOM   645  N  N   . ILE B 2 68  ? -1.851  -35.398 -4.321  1.00 30.09 ? 68  ILE B N   1 
ATOM   646  C  CA  . ILE B 2 68  ? -1.531  -35.872 -2.975  1.00 33.02 ? 68  ILE B CA  1 
ATOM   647  C  C   . ILE B 2 68  ? -1.313  -34.684 -2.028  1.00 34.93 ? 68  ILE B C   1 
ATOM   648  O  O   . ILE B 2 68  ? -1.865  -34.651 -0.921  1.00 37.27 ? 68  ILE B O   1 
ATOM   649  C  CB  . ILE B 2 68  ? -0.296  -36.803 -2.964  1.00 31.28 ? 68  ILE B CB  1 
ATOM   650  C  CG1 . ILE B 2 68  ? -0.583  -38.086 -3.760  1.00 29.53 ? 68  ILE B CG1 1 
ATOM   651  C  CG2 . ILE B 2 68  ? 0.111   -37.159 -1.537  1.00 33.25 ? 68  ILE B CG2 1 
ATOM   652  C  CD1 . ILE B 2 68  ? 0.641   -38.944 -4.018  1.00 29.08 ? 68  ILE B CD1 1 
ATOM   653  N  N   . ASN B 2 69  ? -0.534  -33.709 -2.489  1.00 32.96 ? 69  ASN B N   1 
ATOM   654  C  CA  . ASN B 2 69  ? -0.100  -32.598 -1.636  1.00 37.44 ? 69  ASN B CA  1 
ATOM   655  C  C   . ASN B 2 69  ? -1.189  -31.561 -1.363  1.00 39.89 ? 69  ASN B C   1 
ATOM   656  O  O   . ASN B 2 69  ? -1.077  -30.782 -0.416  1.00 45.09 ? 69  ASN B O   1 
ATOM   657  C  CB  . ASN B 2 69  ? 1.171   -31.947 -2.198  1.00 37.76 ? 69  ASN B CB  1 
ATOM   658  C  CG  . ASN B 2 69  ? 2.424   -32.782 -1.952  1.00 36.90 ? 69  ASN B CG  1 
ATOM   659  O  OD1 . ASN B 2 69  ? 2.493   -33.583 -1.011  1.00 39.38 ? 69  ASN B OD1 1 
ATOM   660  N  ND2 . ASN B 2 69  ? 3.430   -32.588 -2.796  1.00 38.94 ? 69  ASN B ND2 1 
ATOM   661  N  N   . THR B 2 70  ? -2.239  -31.558 -2.184  1.00 37.35 ? 70  THR B N   1 
ATOM   662  C  CA  . THR B 2 70  ? -3.400  -30.687 -1.958  1.00 40.66 ? 70  THR B CA  1 
ATOM   663  C  C   . THR B 2 70  ? -4.545  -31.395 -1.216  1.00 43.51 ? 70  THR B C   1 
ATOM   664  O  O   . THR B 2 70  ? -5.602  -30.804 -0.999  1.00 45.34 ? 70  THR B O   1 
ATOM   665  C  CB  . THR B 2 70  ? -3.930  -30.049 -3.268  1.00 41.74 ? 70  THR B CB  1 
ATOM   666  O  OG1 . THR B 2 70  ? -4.291  -31.073 -4.206  1.00 43.51 ? 70  THR B OG1 1 
ATOM   667  C  CG2 . THR B 2 70  ? -2.882  -29.131 -3.893  1.00 40.90 ? 70  THR B CG2 1 
ATOM   668  N  N   . HIS B 2 71  ? -4.326  -32.652 -0.822  1.00 41.11 ? 71  HIS B N   1 
ATOM   669  C  CA  . HIS B 2 71  ? -5.313  -33.422 -0.052  1.00 39.34 ? 71  HIS B CA  1 
ATOM   670  C  C   . HIS B 2 71  ? -4.707  -34.078 1.164   1.00 38.45 ? 71  HIS B C   1 
ATOM   671  O  O   . HIS B 2 71  ? -5.150  -35.147 1.595   1.00 40.07 ? 71  HIS B O   1 
ATOM   672  C  CB  . HIS B 2 71  ? -5.998  -34.469 -0.943  1.00 36.41 ? 71  HIS B CB  1 
ATOM   673  C  CG  . HIS B 2 71  ? -6.836  -33.873 -2.046  1.00 34.14 ? 71  HIS B CG  1 
ATOM   674  N  ND1 . HIS B 2 71  ? -6.311  -33.476 -3.223  1.00 38.27 ? 71  HIS B ND1 1 
ATOM   675  C  CD2 . HIS B 2 71  ? -8.201  -33.596 -2.112  1.00 39.23 ? 71  HIS B CD2 1 
ATOM   676  C  CE1 . HIS B 2 71  ? -7.286  -32.977 -4.006  1.00 38.92 ? 71  HIS B CE1 1 
ATOM   677  N  NE2 . HIS B 2 71  ? -8.443  -33.048 -3.325  1.00 39.16 ? 71  HIS B NE2 1 
ATOM   678  N  N   . THR B 2 72  ? -3.701  -33.428 1.745   1.00 43.96 ? 72  THR B N   1 
ATOM   679  C  CA  . THR B 2 72  ? -2.928  -34.001 2.850   1.00 48.63 ? 72  THR B CA  1 
ATOM   680  C  C   . THR B 2 72  ? -3.785  -34.469 4.033   1.00 49.72 ? 72  THR B C   1 
ATOM   681  O  O   . THR B 2 72  ? -3.622  -35.598 4.509   1.00 51.17 ? 72  THR B O   1 
ATOM   682  C  CB  . THR B 2 72  ? -1.827  -33.028 3.332   1.00 49.49 ? 72  THR B CB  1 
ATOM   683  O  OG1 . THR B 2 72  ? -1.067  -32.575 2.204   1.00 48.65 ? 72  THR B OG1 1 
ATOM   684  C  CG2 . THR B 2 72  ? -0.888  -33.712 4.325   1.00 49.98 ? 72  THR B CG2 1 
ATOM   685  N  N   . LYS B 2 73  ? -4.696  -33.611 4.492   1.00 52.32 ? 73  LYS B N   1 
ATOM   686  C  CA  . LYS B 2 73  ? -5.555  -33.928 5.638   1.00 56.98 ? 73  LYS B CA  1 
ATOM   687  C  C   . LYS B 2 73  ? -6.477  -35.113 5.345   1.00 56.94 ? 73  LYS B C   1 
ATOM   688  O  O   . LYS B 2 73  ? -6.544  -36.062 6.127   1.00 56.10 ? 73  LYS B O   1 
ATOM   689  C  CB  . LYS B 2 73  ? -6.368  -32.701 6.069   1.00 60.21 ? 73  LYS B CB  1 
ATOM   690  N  N   . VAL B 2 74  ? -7.165  -35.056 4.206   1.00 54.02 ? 74  VAL B N   1 
ATOM   691  C  CA  . VAL B 2 74  ? -8.058  -36.132 3.754   1.00 53.99 ? 74  VAL B CA  1 
ATOM   692  C  C   . VAL B 2 74  ? -7.325  -37.475 3.614   1.00 52.03 ? 74  VAL B C   1 
ATOM   693  O  O   . VAL B 2 74  ? -7.877  -38.534 3.927   1.00 52.07 ? 74  VAL B O   1 
ATOM   694  C  CB  . VAL B 2 74  ? -8.779  -35.731 2.442   1.00 52.22 ? 74  VAL B CB  1 
ATOM   695  C  CG1 . VAL B 2 74  ? -9.354  -36.939 1.714   1.00 52.83 ? 74  VAL B CG1 1 
ATOM   696  C  CG2 . VAL B 2 74  ? -9.875  -34.718 2.741   1.00 52.62 ? 74  VAL B CG2 1 
ATOM   697  N  N   . LEU B 2 75  ? -6.071  -37.418 3.174   1.00 50.09 ? 75  LEU B N   1 
ATOM   698  C  CA  . LEU B 2 75  ? -5.276  -38.623 2.962   1.00 51.36 ? 75  LEU B CA  1 
ATOM   699  C  C   . LEU B 2 75  ? -4.423  -39.034 4.173   1.00 59.30 ? 75  LEU B C   1 
ATOM   700  O  O   . LEU B 2 75  ? -3.519  -39.847 4.038   1.00 57.70 ? 75  LEU B O   1 
ATOM   701  C  CB  . LEU B 2 75  ? -4.403  -38.471 1.708   1.00 42.22 ? 75  LEU B CB  1 
ATOM   702  C  CG  . LEU B 2 75  ? -5.108  -38.190 0.373   1.00 38.44 ? 75  LEU B CG  1 
ATOM   703  C  CD1 . LEU B 2 75  ? -4.103  -37.724 -0.672  1.00 37.96 ? 75  LEU B CD1 1 
ATOM   704  C  CD2 . LEU B 2 75  ? -5.894  -39.400 -0.121  1.00 38.13 ? 75  LEU B CD2 1 
ATOM   705  N  N   . ALA B 2 76  ? -4.721  -38.490 5.353   1.00 69.44 ? 76  ALA B N   1 
ATOM   706  C  CA  . ALA B 2 76  ? -3.974  -38.831 6.572   1.00 71.84 ? 76  ALA B CA  1 
ATOM   707  C  C   . ALA B 2 76  ? -4.111  -40.310 6.944   1.00 71.44 ? 76  ALA B C   1 
ATOM   708  O  O   . ALA B 2 76  ? -5.225  -40.816 7.109   1.00 68.29 ? 76  ALA B O   1 
ATOM   709  C  CB  . ALA B 2 76  ? -4.404  -37.944 7.731   1.00 75.06 ? 76  ALA B CB  1 
ATOM   710  N  N   . ASN B 2 77  ? -2.967  -40.990 7.059   1.00 74.91 ? 77  ASN B N   1 
ATOM   711  C  CA  . ASN B 2 77  ? -2.886  -42.436 7.363   1.00 67.76 ? 77  ASN B CA  1 
ATOM   712  C  C   . ASN B 2 77  ? -3.490  -43.369 6.297   1.00 63.33 ? 77  ASN B C   1 
ATOM   713  O  O   . ASN B 2 77  ? -3.703  -44.559 6.544   1.00 61.31 ? 77  ASN B O   1 
ATOM   714  C  CB  . ASN B 2 77  ? -3.428  -42.746 8.767   1.00 69.73 ? 77  ASN B CB  1 
ATOM   715  C  CG  . ASN B 2 77  ? -2.592  -42.117 9.865   1.00 71.82 ? 77  ASN B CG  1 
ATOM   716  N  N   A ASN B 2 78  ? -3.813  -42.765 5.159   0.50 62.91 ? 78  ASN B N   1 
ATOM   717  N  N   B ASN B 2 78  ? -3.734  -42.842 5.098   0.50 58.93 ? 78  ASN B N   1 
ATOM   718  C  CA  A ASN B 2 78  ? -3.921  -43.417 3.871   0.50 61.04 ? 78  ASN B CA  1 
ATOM   719  C  CA  B ASN B 2 78  ? -4.496  -43.582 4.082   0.50 52.43 ? 78  ASN B CA  1 
ATOM   720  C  C   A ASN B 2 78  ? -3.124  -42.450 3.010   0.50 56.26 ? 78  ASN B C   1 
ATOM   721  C  C   B ASN B 2 78  ? -3.707  -44.314 2.979   0.50 48.63 ? 78  ASN B C   1 
ATOM   722  O  O   A ASN B 2 78  ? -3.530  -42.083 1.907   0.50 56.08 ? 78  ASN B O   1 
ATOM   723  O  O   B ASN B 2 78  ? -4.283  -44.739 1.976   0.50 42.84 ? 78  ASN B O   1 
ATOM   724  C  CB  A ASN B 2 78  ? -5.374  -43.475 3.406   0.50 62.65 ? 78  ASN B CB  1 
ATOM   725  C  CB  B ASN B 2 78  ? -5.609  -42.706 3.495   0.50 51.51 ? 78  ASN B CB  1 
ATOM   726  C  CG  A ASN B 2 78  ? -6.245  -44.321 4.313   0.50 65.66 ? 78  ASN B CG  1 
ATOM   727  C  CG  B ASN B 2 78  ? -6.746  -42.482 4.477   0.50 50.73 ? 78  ASN B CG  1 
ATOM   728  O  OD1 A ASN B 2 78  ? -7.403  -43.988 4.565   0.50 70.57 ? 78  ASN B OD1 1 
ATOM   729  O  OD1 B ASN B 2 78  ? -6.943  -43.272 5.400   0.50 50.94 ? 78  ASN B OD1 1 
ATOM   730  N  ND2 A ASN B 2 78  ? -5.692  -45.421 4.810   0.50 65.96 ? 78  ASN B ND2 1 
ATOM   731  N  ND2 B ASN B 2 78  ? -7.495  -41.404 4.286   0.50 48.27 ? 78  ASN B ND2 1 
ATOM   732  N  N   A SER B 2 79  ? -1.989  -42.026 3.563   0.50 45.62 ? 79  SER B N   1 
ATOM   733  N  N   B SER B 2 79  ? -2.398  -44.451 3.163   0.50 43.90 ? 79  SER B N   1 
ATOM   734  C  CA  A SER B 2 79  ? -1.232  -40.886 3.058   0.50 43.04 ? 79  SER B CA  1 
ATOM   735  C  CA  B SER B 2 79  ? -1.599  -45.350 2.330   0.50 39.38 ? 79  SER B CA  1 
ATOM   736  C  C   A SER B 2 79  ? -0.768  -41.047 1.628   0.50 40.24 ? 79  SER B C   1 
ATOM   737  C  C   B SER B 2 79  ? -1.077  -44.753 1.022   0.50 36.96 ? 79  SER B C   1 
ATOM   738  O  O   A SER B 2 79  ? -0.257  -40.101 1.031   0.50 40.69 ? 79  SER B O   1 
ATOM   739  O  O   B SER B 2 79  ? -0.816  -45.487 0.071   0.50 41.32 ? 79  SER B O   1 
ATOM   740  C  CB  A SER B 2 79  ? -0.032  -40.596 3.964   0.50 45.55 ? 79  SER B CB  1 
ATOM   741  C  CB  B SER B 2 79  ? -2.380  -46.635 2.042   0.50 43.04 ? 79  SER B CB  1 
ATOM   742  O  OG  A SER B 2 79  ? -0.451  -40.269 5.277   0.50 47.78 ? 79  SER B OG  1 
ATOM   743  O  OG  B SER B 2 79  ? -2.757  -47.277 3.248   0.50 42.25 ? 79  SER B OG  1 
ATOM   744  N  N   A LEU B 2 80  ? -0.949  -42.244 1.080   0.50 36.68 ? 80  LEU B N   1 
ATOM   745  N  N   B LEU B 2 80  ? -0.900  -43.438 0.971   0.50 31.90 ? 80  LEU B N   1 
ATOM   746  C  CA  A LEU B 2 80  ? -0.424  -42.549 -0.239  0.50 35.29 ? 80  LEU B CA  1 
ATOM   747  C  CA  B LEU B 2 80  ? -0.427  -42.795 -0.260  0.50 32.07 ? 80  LEU B CA  1 
ATOM   748  C  C   A LEU B 2 80  ? 1.084   -42.345 -0.259  0.50 30.67 ? 80  LEU B C   1 
ATOM   749  C  C   B LEU B 2 80  ? 1.050   -42.393 -0.250  0.50 30.10 ? 80  LEU B C   1 
ATOM   750  O  O   A LEU B 2 80  ? 1.614   -41.771 -1.211  0.50 29.31 ? 80  LEU B O   1 
ATOM   751  O  O   B LEU B 2 80  ? 1.515   -41.713 -1.166  0.50 30.14 ? 80  LEU B O   1 
ATOM   752  C  CB  A LEU B 2 80  ? -1.068  -41.640 -1.286  0.50 36.48 ? 80  LEU B CB  1 
ATOM   753  C  CB  B LEU B 2 80  ? -1.309  -41.603 -0.635  0.50 31.20 ? 80  LEU B CB  1 
ATOM   754  C  CG  A LEU B 2 80  ? -2.348  -42.148 -1.954  0.50 39.49 ? 80  LEU B CG  1 
ATOM   755  C  CG  B LEU B 2 80  ? -2.450  -41.999 -1.578  0.50 35.00 ? 80  LEU B CG  1 
ATOM   756  C  CD1 A LEU B 2 80  ? -3.323  -42.693 -0.925  0.50 38.07 ? 80  LEU B CD1 1 
ATOM   757  C  CD1 B LEU B 2 80  ? -3.460  -42.897 -0.882  0.50 35.11 ? 80  LEU B CD1 1 
ATOM   758  C  CD2 A LEU B 2 80  ? -2.991  -41.054 -2.791  0.50 41.65 ? 80  LEU B CD2 1 
ATOM   759  C  CD2 B LEU B 2 80  ? -3.124  -40.781 -2.179  0.50 36.40 ? 80  LEU B CD2 1 
ATOM   760  N  N   . SER B 2 81  ? 1.776   -42.815 0.782   1.00 30.48 ? 81  SER B N   1 
ATOM   761  C  CA  . SER B 2 81  ? 3.215   -42.555 0.891   1.00 32.11 ? 81  SER B CA  1 
ATOM   762  C  C   . SER B 2 81  ? 3.989   -43.205 -0.244  1.00 28.42 ? 81  SER B C   1 
ATOM   763  O  O   . SER B 2 81  ? 4.916   -42.596 -0.781  1.00 29.38 ? 81  SER B O   1 
ATOM   764  C  CB  . SER B 2 81  ? 3.778   -42.988 2.249   1.00 35.73 ? 81  SER B CB  1 
ATOM   765  O  OG  . SER B 2 81  ? 3.340   -42.102 3.270   1.00 37.79 ? 81  SER B OG  1 
ATOM   766  N  N   . PHE B 2 82  ? 3.590   -44.419 -0.630  1.00 28.07 ? 82  PHE B N   1 
ATOM   767  C  CA  . PHE B 2 82  ? 4.253   -45.098 -1.749  1.00 24.96 ? 82  PHE B CA  1 
ATOM   768  C  C   . PHE B 2 82  ? 4.168   -44.257 -3.020  1.00 25.16 ? 82  PHE B C   1 
ATOM   769  O  O   . PHE B 2 82  ? 5.186   -44.007 -3.674  1.00 24.59 ? 82  PHE B O   1 
ATOM   770  C  CB  . PHE B 2 82  ? 3.675   -46.501 -1.995  1.00 26.28 ? 82  PHE B CB  1 
ATOM   771  C  CG  . PHE B 2 82  ? 4.117   -47.111 -3.297  1.00 26.67 ? 82  PHE B CG  1 
ATOM   772  C  CD1 . PHE B 2 82  ? 5.416   -47.595 -3.454  1.00 25.87 ? 82  PHE B CD1 1 
ATOM   773  C  CD2 . PHE B 2 82  ? 3.237   -47.186 -4.382  1.00 26.91 ? 82  PHE B CD2 1 
ATOM   774  C  CE1 . PHE B 2 82  ? 5.830   -48.153 -4.659  1.00 28.99 ? 82  PHE B CE1 1 
ATOM   775  C  CE2 . PHE B 2 82  ? 3.647   -47.744 -5.586  1.00 27.09 ? 82  PHE B CE2 1 
ATOM   776  C  CZ  . PHE B 2 82  ? 4.941   -48.230 -5.728  1.00 28.61 ? 82  PHE B CZ  1 
ATOM   777  N  N   . GLU B 2 83  ? 2.957   -43.829 -3.379  1.00 25.34 ? 83  GLU B N   1 
ATOM   778  C  CA  . GLU B 2 83  ? 2.761   -43.035 -4.593  1.00 26.76 ? 83  GLU B CA  1 
ATOM   779  C  C   . GLU B 2 83  ? 3.455   -41.676 -4.519  1.00 25.16 ? 83  GLU B C   1 
ATOM   780  O  O   . GLU B 2 83  ? 4.047   -41.220 -5.502  1.00 24.92 ? 83  GLU B O   1 
ATOM   781  C  CB  . GLU B 2 83  ? 1.271   -42.879 -4.923  1.00 27.79 ? 83  GLU B CB  1 
ATOM   782  C  CG  . GLU B 2 83  ? 0.609   -44.171 -5.401  1.00 26.43 ? 83  GLU B CG  1 
ATOM   783  C  CD  . GLU B 2 83  ? 0.128   -45.066 -4.265  1.00 30.66 ? 83  GLU B CD  1 
ATOM   784  O  OE1 . GLU B 2 83  ? 0.359   -44.756 -3.068  1.00 30.99 ? 83  GLU B OE1 1 
ATOM   785  O  OE2 . GLU B 2 83  ? -0.498  -46.098 -4.570  1.00 33.19 ? 83  GLU B OE2 1 
ATOM   786  N  N   . LYS B 2 84  ? 3.389   -41.035 -3.356  1.00 28.29 ? 84  LYS B N   1 
ATOM   787  C  CA  . LYS B 2 84  ? 4.075   -39.755 -3.160  1.00 27.17 ? 84  LYS B CA  1 
ATOM   788  C  C   . LYS B 2 84  ? 5.581   -39.925 -3.370  1.00 25.78 ? 84  LYS B C   1 
ATOM   789  O  O   . LYS B 2 84  ? 6.186   -39.186 -4.160  1.00 26.61 ? 84  LYS B O   1 
ATOM   790  C  CB  . LYS B 2 84  ? 3.759   -39.177 -1.772  1.00 27.57 ? 84  LYS B CB  1 
ATOM   791  C  CG  . LYS B 2 84  ? 4.404   -37.824 -1.480  1.00 30.63 ? 84  LYS B CG  1 
ATOM   792  C  CD  . LYS B 2 84  ? 3.941   -37.308 -0.124  1.00 35.84 ? 84  LYS B CD  1 
ATOM   793  C  CE  . LYS B 2 84  ? 4.583   -35.973 0.222   1.00 38.90 ? 84  LYS B CE  1 
ATOM   794  N  NZ  . LYS B 2 84  ? 6.021   -36.152 0.538   1.00 43.01 ? 84  LYS B NZ  1 
ATOM   795  N  N   . ALA B 2 85  ? 6.169   -40.912 -2.693  1.00 25.95 ? 85  ALA B N   1 
ATOM   796  C  CA  . ALA B 2 85  ? 7.604   -41.204 -2.842  1.00 27.02 ? 85  ALA B CA  1 
ATOM   797  C  C   . ALA B 2 85  ? 7.945   -41.596 -4.272  1.00 26.97 ? 85  ALA B C   1 
ATOM   798  O  O   . ALA B 2 85  ? 8.987   -41.199 -4.793  1.00 24.94 ? 85  ALA B O   1 
ATOM   799  C  CB  . ALA B 2 85  ? 8.051   -42.293 -1.875  1.00 27.56 ? 85  ALA B CB  1 
ATOM   800  N  N   . TYR B 2 86  ? 7.063   -42.367 -4.911  1.00 25.75 ? 86  TYR B N   1 
ATOM   801  C  CA  . TYR B 2 86  ? 7.303   -42.772 -6.289  1.00 24.05 ? 86  TYR B CA  1 
ATOM   802  C  C   . TYR B 2 86  ? 7.392   -41.562 -7.231  1.00 24.59 ? 86  TYR B C   1 
ATOM   803  O  O   . TYR B 2 86  ? 8.297   -41.486 -8.080  1.00 24.07 ? 86  TYR B O   1 
ATOM   804  C  CB  . TYR B 2 86  ? 6.265   -43.814 -6.785  1.00 22.72 ? 86  TYR B CB  1 
ATOM   805  C  CG  . TYR B 2 86  ? 6.681   -44.356 -8.120  1.00 22.82 ? 86  TYR B CG  1 
ATOM   806  C  CD1 . TYR B 2 86  ? 7.713   -45.296 -8.217  1.00 25.32 ? 86  TYR B CD1 1 
ATOM   807  C  CD2 . TYR B 2 86  ? 6.099   -43.883 -9.297  1.00 23.41 ? 86  TYR B CD2 1 
ATOM   808  C  CE1 . TYR B 2 86  ? 8.141   -45.764 -9.448  1.00 25.30 ? 86  TYR B CE1 1 
ATOM   809  C  CE2 . TYR B 2 86  ? 6.515   -44.347 -10.537 1.00 25.22 ? 86  TYR B CE2 1 
ATOM   810  C  CZ  . TYR B 2 86  ? 7.536   -45.284 -10.603 1.00 23.57 ? 86  TYR B CZ  1 
ATOM   811  O  OH  . TYR B 2 86  ? 7.966   -45.735 -11.817 1.00 24.40 ? 86  TYR B OH  1 
ATOM   812  N  N   . CYS B 2 87  ? 6.460   -40.619 -7.076  1.00 25.05 ? 87  CYS B N   1 
ATOM   813  C  CA  . CYS B 2 87  ? 6.450   -39.406 -7.891  1.00 26.77 ? 87  CYS B CA  1 
ATOM   814  C  C   . CYS B 2 87  ? 7.708   -38.581 -7.658  1.00 25.83 ? 87  CYS B C   1 
ATOM   815  O  O   . CYS B 2 87  ? 8.330   -38.109 -8.609  1.00 26.86 ? 87  CYS B O   1 
ATOM   816  C  CB  . CYS B 2 87  ? 5.205   -38.559 -7.612  1.00 27.75 ? 87  CYS B CB  1 
ATOM   817  S  SG  . CYS B 2 87  ? 3.693   -39.290 -8.287  1.00 29.74 ? 87  CYS B SG  1 
ATOM   818  N  N   . GLU B 2 88  ? 8.085   -38.427 -6.393  1.00 27.22 ? 88  GLU B N   1 
ATOM   819  C  CA  . GLU B 2 88  ? 9.296   -37.664 -6.046  1.00 28.40 ? 88  GLU B CA  1 
ATOM   820  C  C   . GLU B 2 88  ? 10.521  -38.312 -6.685  1.00 28.53 ? 88  GLU B C   1 
ATOM   821  O  O   . GLU B 2 88  ? 11.355  -37.636 -7.291  1.00 31.87 ? 88  GLU B O   1 
ATOM   822  C  CB  . GLU B 2 88  ? 9.443   -37.558 -4.523  1.00 29.32 ? 88  GLU B CB  1 
ATOM   823  C  CG  . GLU B 2 88  ? 8.394   -36.655 -3.880  1.00 30.34 ? 88  GLU B CG  1 
ATOM   824  C  CD  . GLU B 2 88  ? 8.224   -36.887 -2.386  1.00 33.67 ? 88  GLU B CD  1 
ATOM   825  O  OE1 . GLU B 2 88  ? 8.657   -37.936 -1.869  1.00 35.01 ? 88  GLU B OE1 1 
ATOM   826  O  OE2 . GLU B 2 88  ? 7.634   -36.014 -1.717  1.00 39.67 ? 88  GLU B OE2 1 
ATOM   827  N  N   . TYR B 2 89  ? 10.600  -39.635 -6.575  1.00 27.88 ? 89  TYR B N   1 
ATOM   828  C  CA  . TYR B 2 89  ? 11.648  -40.419 -7.209  1.00 27.02 ? 89  TYR B CA  1 
ATOM   829  C  C   . TYR B 2 89  ? 11.722  -40.181 -8.725  1.00 29.27 ? 89  TYR B C   1 
ATOM   830  O  O   . TYR B 2 89  ? 12.806  -39.935 -9.264  1.00 30.38 ? 89  TYR B O   1 
ATOM   831  C  CB  . TYR B 2 89  ? 11.413  -41.894 -6.867  1.00 26.91 ? 89  TYR B CB  1 
ATOM   832  C  CG  . TYR B 2 89  ? 12.226  -42.922 -7.608  1.00 29.74 ? 89  TYR B CG  1 
ATOM   833  C  CD1 . TYR B 2 89  ? 13.543  -43.193 -7.238  1.00 29.82 ? 89  TYR B CD1 1 
ATOM   834  C  CD2 . TYR B 2 89  ? 11.652  -43.681 -8.632  1.00 31.06 ? 89  TYR B CD2 1 
ATOM   835  C  CE1 . TYR B 2 89  ? 14.281  -44.163 -7.889  1.00 31.32 ? 89  TYR B CE1 1 
ATOM   836  C  CE2 . TYR B 2 89  ? 12.384  -44.653 -9.296  1.00 32.30 ? 89  TYR B CE2 1 
ATOM   837  C  CZ  . TYR B 2 89  ? 13.696  -44.887 -8.920  1.00 31.09 ? 89  TYR B CZ  1 
ATOM   838  O  OH  . TYR B 2 89  ? 14.428  -45.847 -9.560  1.00 34.87 ? 89  TYR B OH  1 
ATOM   839  N  N   . ARG B 2 90  ? 10.578  -40.238 -9.409  1.00 28.02 ? 90  ARG B N   1 
ATOM   840  C  CA  . ARG B 2 90  ? 10.547  -40.021 -10.859 1.00 27.67 ? 90  ARG B CA  1 
ATOM   841  C  C   . ARG B 2 90  ? 10.832  -38.570 -11.249 1.00 29.20 ? 90  ARG B C   1 
ATOM   842  O  O   . ARG B 2 90  ? 11.238  -38.295 -12.380 1.00 31.18 ? 90  ARG B O   1 
ATOM   843  C  CB  . ARG B 2 90  ? 9.213   -40.490 -11.472 1.00 26.33 ? 90  ARG B CB  1 
ATOM   844  C  CG  . ARG B 2 90  ? 8.971   -41.993 -11.362 1.00 24.30 ? 90  ARG B CG  1 
ATOM   845  C  CD  . ARG B 2 90  ? 10.028  -42.811 -12.099 1.00 26.45 ? 90  ARG B CD  1 
ATOM   846  N  NE  . ARG B 2 90  ? 10.068  -42.492 -13.524 1.00 26.63 ? 90  ARG B NE  1 
ATOM   847  C  CZ  . ARG B 2 90  ? 9.312   -43.082 -14.448 1.00 28.52 ? 90  ARG B CZ  1 
ATOM   848  N  NH1 . ARG B 2 90  ? 8.448   -44.038 -14.107 1.00 26.58 ? 90  ARG B NH1 1 
ATOM   849  N  NH2 . ARG B 2 90  ? 9.421   -42.714 -15.717 1.00 27.57 ? 90  ARG B NH2 1 
ATOM   850  N  N   . LEU B 2 91  ? 10.618  -37.650 -10.314 1.00 30.94 ? 91  LEU B N   1 
ATOM   851  C  CA  . LEU B 2 91  ? 10.920  -36.235 -10.547 1.00 30.75 ? 91  LEU B CA  1 
ATOM   852  C  C   . LEU B 2 91  ? 12.345  -35.881 -10.109 1.00 37.44 ? 91  LEU B C   1 
ATOM   853  O  O   . LEU B 2 91  ? 12.702  -34.699 -10.026 1.00 39.44 ? 91  LEU B O   1 
ATOM   854  C  CB  . LEU B 2 91  ? 9.887   -35.343 -9.854  1.00 29.98 ? 91  LEU B CB  1 
ATOM   855  C  CG  . LEU B 2 91  ? 8.467   -35.402 -10.428 1.00 29.44 ? 91  LEU B CG  1 
ATOM   856  C  CD1 . LEU B 2 91  ? 7.478   -34.709 -9.504  1.00 34.07 ? 91  LEU B CD1 1 
ATOM   857  C  CD2 . LEU B 2 91  ? 8.418   -34.819 -11.834 1.00 32.61 ? 91  LEU B CD2 1 
ATOM   858  N  N   . ASN B 2 92  ? 13.145  -36.917 -9.850  1.00 35.12 ? 92  ASN B N   1 
ATOM   859  C  CA  . ASN B 2 92  ? 14.550  -36.795 -9.419  1.00 38.09 ? 92  ASN B CA  1 
ATOM   860  C  C   . ASN B 2 92  ? 14.734  -36.061 -8.080  1.00 39.68 ? 92  ASN B C   1 
ATOM   861  O  O   . ASN B 2 92  ? 15.795  -35.490 -7.816  1.00 44.87 ? 92  ASN B O   1 
ATOM   862  C  CB  . ASN B 2 92  ? 15.423  -36.181 -10.532 1.00 42.51 ? 92  ASN B CB  1 
ATOM   863  C  CG  . ASN B 2 92  ? 16.877  -36.613 -10.440 1.00 49.87 ? 92  ASN B CG  1 
ATOM   864  N  N   . ARG B 2 93  ? 13.696  -36.086 -7.242  1.00 36.01 ? 93  ARG B N   1 
ATOM   865  C  CA  . ARG B 2 93  ? 13.765  -35.544 -5.887  1.00 36.59 ? 93  ARG B CA  1 
ATOM   866  C  C   . ARG B 2 93  ? 14.025  -36.695 -4.917  1.00 36.26 ? 93  ARG B C   1 
ATOM   867  O  O   . ARG B 2 93  ? 13.148  -37.091 -4.144  1.00 35.54 ? 93  ARG B O   1 
ATOM   868  C  CB  . ARG B 2 93  ? 12.478  -34.789 -5.531  1.00 35.73 ? 93  ARG B CB  1 
ATOM   869  C  CG  . ARG B 2 93  ? 12.138  -33.686 -6.519  1.00 43.24 ? 93  ARG B CG  1 
ATOM   870  C  CD  . ARG B 2 93  ? 10.768  -33.080 -6.274  1.00 44.60 ? 93  ARG B CD  1 
ATOM   871  N  NE  . ARG B 2 93  ? 10.345  -32.303 -7.437  1.00 44.49 ? 93  ARG B NE  1 
ATOM   872  C  CZ  . ARG B 2 93  ? 9.152   -31.736 -7.583  1.00 43.45 ? 93  ARG B CZ  1 
ATOM   873  N  NH1 . ARG B 2 93  ? 8.231   -31.840 -6.629  1.00 47.27 ? 93  ARG B NH1 1 
ATOM   874  N  NH2 . ARG B 2 93  ? 8.881   -31.058 -8.691  1.00 47.32 ? 93  ARG B NH2 1 
ATOM   875  N  N   . ILE B 2 94  ? 15.250  -37.219 -4.967  1.00 34.62 ? 94  ILE B N   1 
ATOM   876  C  CA  . ILE B 2 94  ? 15.579  -38.492 -4.329  1.00 33.40 ? 94  ILE B CA  1 
ATOM   877  C  C   . ILE B 2 94  ? 15.585  -38.394 -2.803  1.00 36.12 ? 94  ILE B C   1 
ATOM   878  O  O   . ILE B 2 94  ? 15.101  -39.302 -2.114  1.00 33.18 ? 94  ILE B O   1 
ATOM   879  C  CB  . ILE B 2 94  ? 16.903  -39.095 -4.882  1.00 33.17 ? 94  ILE B CB  1 
ATOM   880  C  CG1 . ILE B 2 94  ? 16.932  -39.065 -6.424  1.00 35.64 ? 94  ILE B CG1 1 
ATOM   881  C  CG2 . ILE B 2 94  ? 17.114  -40.518 -4.376  1.00 34.85 ? 94  ILE B CG2 1 
ATOM   882  C  CD1 . ILE B 2 94  ? 15.816  -39.849 -7.113  1.00 34.45 ? 94  ILE B CD1 1 
ATOM   883  N  N   . GLU B 2 95  ? 16.119  -37.290 -2.281  1.00 39.22 ? 95  GLU B N   1 
ATOM   884  C  CA  . GLU B 2 95  ? 16.124  -37.053 -0.839  1.00 40.31 ? 95  GLU B CA  1 
ATOM   885  C  C   . GLU B 2 95  ? 14.699  -36.952 -0.292  1.00 34.85 ? 95  GLU B C   1 
ATOM   886  O  O   . GLU B 2 95  ? 14.388  -37.549 0.741   1.00 35.75 ? 95  GLU B O   1 
ATOM   887  C  CB  . GLU B 2 95  ? 16.940  -35.799 -0.489  1.00 45.43 ? 95  GLU B CB  1 
ATOM   888  C  CG  . GLU B 2 95  ? 17.760  -35.949 0.784   1.00 55.07 ? 95  GLU B CG  1 
ATOM   889  C  CD  . GLU B 2 95  ? 18.797  -37.059 0.685   1.00 57.73 ? 95  GLU B CD  1 
ATOM   890  O  OE1 . GLU B 2 95  ? 18.880  -37.885 1.620   1.00 64.07 ? 95  GLU B OE1 1 
ATOM   891  O  OE2 . GLU B 2 95  ? 19.523  -37.113 -0.334  1.00 64.19 ? 95  GLU B OE2 1 
ATOM   892  N  N   . ASN B 2 96  ? 13.842  -36.211 -0.995  1.00 36.51 ? 96  ASN B N   1 
ATOM   893  C  CA  . ASN B 2 96  ? 12.413  -36.140 -0.669  1.00 36.14 ? 96  ASN B CA  1 
ATOM   894  C  C   . ASN B 2 96  ? 11.773  -37.532 -0.664  1.00 34.73 ? 96  ASN B C   1 
ATOM   895  O  O   . ASN B 2 96  ? 11.039  -37.881 0.266   1.00 34.64 ? 96  ASN B O   1 
ATOM   896  C  CB  . ASN B 2 96  ? 11.659  -35.244 -1.659  1.00 40.14 ? 96  ASN B CB  1 
ATOM   897  C  CG  . ASN B 2 96  ? 11.904  -33.764 -1.432  1.00 50.03 ? 96  ASN B CG  1 
ATOM   898  O  OD1 . ASN B 2 96  ? 11.402  -32.929 -2.185  1.00 54.21 ? 96  ASN B OD1 1 
ATOM   899  N  ND2 . ASN B 2 96  ? 12.668  -33.427 -0.397  1.00 48.05 ? 96  ASN B ND2 1 
ATOM   900  N  N   . ALA B 2 97  ? 12.062  -38.322 -1.698  1.00 33.65 ? 97  ALA B N   1 
ATOM   901  C  CA  . ALA B 2 97  ? 11.520  -39.679 -1.790  1.00 30.81 ? 97  ALA B CA  1 
ATOM   902  C  C   . ALA B 2 97  ? 11.941  -40.518 -0.590  1.00 30.00 ? 97  ALA B C   1 
ATOM   903  O  O   . ALA B 2 97  ? 11.122  -41.219 -0.002  1.00 28.66 ? 97  ALA B O   1 
ATOM   904  C  CB  . ALA B 2 97  ? 11.931  -40.348 -3.102  1.00 31.35 ? 97  ALA B CB  1 
ATOM   905  N  N   . LEU B 2 98  ? 13.217  -40.421 -0.213  1.00 32.52 ? 98  LEU B N   1 
ATOM   906  C  CA  . LEU B 2 98  ? 13.725  -41.105 0.976   1.00 34.28 ? 98  LEU B CA  1 
ATOM   907  C  C   . LEU B 2 98  ? 12.946  -40.699 2.239   1.00 32.41 ? 98  LEU B C   1 
ATOM   908  O  O   . LEU B 2 98  ? 12.523  -41.561 3.021   1.00 32.64 ? 98  LEU B O   1 
ATOM   909  C  CB  . LEU B 2 98  ? 15.222  -40.815 1.155   1.00 34.58 ? 98  LEU B CB  1 
ATOM   910  C  CG  . LEU B 2 98  ? 15.876  -41.389 2.415   1.00 35.83 ? 98  LEU B CG  1 
ATOM   911  C  CD1 . LEU B 2 98  ? 15.997  -42.902 2.316   1.00 34.17 ? 98  LEU B CD1 1 
ATOM   912  C  CD2 . LEU B 2 98  ? 17.234  -40.746 2.656   1.00 37.22 ? 98  LEU B CD2 1 
ATOM   913  N  N   . LYS B 2 99  ? 12.755  -39.393 2.420   1.00 33.28 ? 99  LYS B N   1 
ATOM   914  C  CA  . LYS B 2 99  ? 12.059  -38.853 3.597   1.00 36.43 ? 99  LYS B CA  1 
ATOM   915  C  C   . LYS B 2 99  ? 10.619  -39.359 3.662   1.00 36.84 ? 99  LYS B C   1 
ATOM   916  O  O   . LYS B 2 99  ? 10.139  -39.769 4.725   1.00 34.72 ? 99  LYS B O   1 
ATOM   917  C  CB  . LYS B 2 99  ? 12.087  -37.321 3.589   1.00 38.91 ? 99  LYS B CB  1 
ATOM   918  C  CG  . LYS B 2 99  ? 11.496  -36.677 4.837   1.00 49.13 ? 99  LYS B CG  1 
ATOM   919  C  CD  . LYS B 2 99  ? 11.363  -35.168 4.693   1.00 58.25 ? 99  LYS B CD  1 
ATOM   920  C  CE  . LYS B 2 99  ? 10.803  -34.549 5.966   1.00 70.87 ? 99  LYS B CE  1 
ATOM   921  N  NZ  . LYS B 2 99  ? 10.613  -33.077 5.839   1.00 81.50 ? 99  LYS B NZ  1 
ATOM   922  N  N   . THR B 2 100 ? 9.945   -39.332 2.516   1.00 36.95 ? 100 THR B N   1 
ATOM   923  C  CA  . THR B 2 100 ? 8.573   -39.822 2.405   1.00 31.96 ? 100 THR B CA  1 
ATOM   924  C  C   . THR B 2 100 ? 8.473   -41.297 2.802   1.00 31.15 ? 100 THR B C   1 
ATOM   925  O  O   . THR B 2 100 ? 7.599   -41.677 3.585   1.00 35.52 ? 100 THR B O   1 
ATOM   926  C  CB  . THR B 2 100 ? 8.017   -39.575 0.986   1.00 30.86 ? 100 THR B CB  1 
ATOM   927  O  OG1 . THR B 2 100 ? 8.024   -38.167 0.718   1.00 32.35 ? 100 THR B OG1 1 
ATOM   928  C  CG2 . THR B 2 100 ? 6.585   -40.100 0.853   1.00 30.70 ? 100 THR B CG2 1 
ATOM   929  N  N   . ILE B 2 101 ? 9.380   -42.124 2.283   1.00 30.80 ? 101 ILE B N   1 
ATOM   930  C  CA  . ILE B 2 101 ? 9.419   -43.543 2.638   1.00 33.60 ? 101 ILE B CA  1 
ATOM   931  C  C   . ILE B 2 101 ? 9.635   -43.754 4.145   1.00 36.04 ? 101 ILE B C   1 
ATOM   932  O  O   . ILE B 2 101 ? 8.909   -44.520 4.785   1.00 35.55 ? 101 ILE B O   1 
ATOM   933  C  CB  . ILE B 2 101 ? 10.484  -44.308 1.814   1.00 32.31 ? 101 ILE B CB  1 
ATOM   934  C  CG1 . ILE B 2 101 ? 10.070  -44.360 0.330   1.00 30.00 ? 101 ILE B CG1 1 
ATOM   935  C  CG2 . ILE B 2 101 ? 10.699  -45.714 2.367   1.00 31.68 ? 101 ILE B CG2 1 
ATOM   936  C  CD1 . ILE B 2 101 ? 11.188  -44.742 -0.624  1.00 31.94 ? 101 ILE B CD1 1 
ATOM   937  N  N   . GLU B 2 102 ? 10.626  -43.067 4.706   1.00 38.38 ? 102 GLU B N   1 
ATOM   938  C  CA  . GLU B 2 102 ? 10.978  -43.246 6.115   1.00 39.88 ? 102 GLU B CA  1 
ATOM   939  C  C   . GLU B 2 102 ? 9.872   -42.821 7.077   1.00 39.67 ? 102 GLU B C   1 
ATOM   940  O  O   . GLU B 2 102 ? 9.738   -43.390 8.158   1.00 46.18 ? 102 GLU B O   1 
ATOM   941  C  CB  . GLU B 2 102 ? 12.278  -42.515 6.439   1.00 37.67 ? 102 GLU B CB  1 
ATOM   942  C  CG  . GLU B 2 102 ? 13.497  -43.189 5.842   1.00 41.06 ? 102 GLU B CG  1 
ATOM   943  C  CD  . GLU B 2 102 ? 14.765  -42.369 5.983   1.00 47.62 ? 102 GLU B CD  1 
ATOM   944  O  OE1 . GLU B 2 102 ? 14.685  -41.128 6.128   1.00 46.69 ? 102 GLU B OE1 1 
ATOM   945  O  OE2 . GLU B 2 102 ? 15.850  -42.977 5.932   1.00 51.12 ? 102 GLU B OE2 1 
ATOM   946  N  N   . SER B 2 103 ? 9.080   -41.830 6.677   1.00 39.23 ? 103 SER B N   1 
ATOM   947  C  CA  . SER B 2 103 ? 8.023   -41.308 7.539   1.00 41.85 ? 103 SER B CA  1 
ATOM   948  C  C   . SER B 2 103 ? 6.636   -41.913 7.268   1.00 44.74 ? 103 SER B C   1 
ATOM   949  O  O   . SER B 2 103 ? 5.636   -41.445 7.825   1.00 43.54 ? 103 SER B O   1 
ATOM   950  C  CB  . SER B 2 103 ? 7.980   -39.780 7.464   1.00 44.69 ? 103 SER B CB  1 
ATOM   951  O  OG  . SER B 2 103 ? 7.601   -39.340 6.174   1.00 52.80 ? 103 SER B OG  1 
ATOM   952  N  N   . ALA B 2 104 ? 6.580   -42.956 6.436   1.00 39.82 ? 104 ALA B N   1 
ATOM   953  C  CA  . ALA B 2 104 ? 5.316   -43.637 6.123   1.00 41.31 ? 104 ALA B CA  1 
ATOM   954  C  C   . ALA B 2 104 ? 4.691   -44.274 7.365   1.00 45.74 ? 104 ALA B C   1 
ATOM   955  O  O   . ALA B 2 104 ? 5.396   -44.860 8.194   1.00 45.99 ? 104 ALA B O   1 
ATOM   956  C  CB  . ALA B 2 104 ? 5.519   -44.685 5.033   1.00 39.02 ? 104 ALA B CB  1 
ATOM   957  N  N   . ASN B 2 105 ? 3.370   -44.152 7.485   1.00 47.75 ? 105 ASN B N   1 
ATOM   958  C  CA  . ASN B 2 105 ? 2.632   -44.697 8.627   1.00 50.33 ? 105 ASN B CA  1 
ATOM   959  C  C   . ASN B 2 105 ? 2.715   -46.219 8.714   1.00 53.02 ? 105 ASN B C   1 
ATOM   960  O  O   . ASN B 2 105 ? 2.822   -46.778 9.808   1.00 56.73 ? 105 ASN B O   1 
ATOM   961  C  CB  . ASN B 2 105 ? 1.169   -44.249 8.590   1.00 53.83 ? 105 ASN B CB  1 
ATOM   962  N  N   . GLN B 2 106 ? 2.678   -46.876 7.556   1.00 49.94 ? 106 GLN B N   1 
ATOM   963  C  CA  . GLN B 2 106 ? 2.713   -48.329 7.475   1.00 52.36 ? 106 GLN B CA  1 
ATOM   964  C  C   . GLN B 2 106 ? 3.700   -48.764 6.394   1.00 49.53 ? 106 GLN B C   1 
ATOM   965  O  O   . GLN B 2 106 ? 3.634   -48.293 5.260   1.00 51.63 ? 106 GLN B O   1 
ATOM   966  C  CB  . GLN B 2 106 ? 1.310   -48.870 7.170   1.00 60.23 ? 106 GLN B CB  1 
ATOM   967  C  CG  . GLN B 2 106 ? 1.142   -50.369 7.374   1.00 63.97 ? 106 GLN B CG  1 
ATOM   968  C  CD  . GLN B 2 106 ? -0.251  -50.850 7.011   1.00 65.16 ? 106 GLN B CD  1 
ATOM   969  N  N   . GLN B 2 107 ? 4.622   -49.651 6.755   1.00 43.90 ? 107 GLN B N   1 
ATOM   970  C  CA  . GLN B 2 107 ? 5.578   -50.192 5.794   1.00 43.28 ? 107 GLN B CA  1 
ATOM   971  C  C   . GLN B 2 107 ? 4.953   -51.350 5.027   1.00 44.25 ? 107 GLN B C   1 
ATOM   972  O  O   . GLN B 2 107 ? 4.152   -52.108 5.578   1.00 45.94 ? 107 GLN B O   1 
ATOM   973  C  CB  . GLN B 2 107 ? 6.884   -50.616 6.480   1.00 45.07 ? 107 GLN B CB  1 
ATOM   974  C  CG  . GLN B 2 107 ? 7.782   -49.454 6.898   1.00 47.17 ? 107 GLN B CG  1 
ATOM   975  C  CD  . GLN B 2 107 ? 8.158   -48.531 5.744   1.00 48.41 ? 107 GLN B CD  1 
ATOM   976  O  OE1 . GLN B 2 107 ? 8.382   -48.977 4.613   1.00 53.38 ? 107 GLN B OE1 1 
ATOM   977  N  NE2 . GLN B 2 107 ? 8.228   -47.233 6.028   1.00 42.88 ? 107 GLN B NE2 1 
ATOM   978  N  N   . THR B 2 108 ? 5.305   -51.460 3.747   1.00 39.76 ? 108 THR B N   1 
ATOM   979  C  CA  . THR B 2 108 ? 4.736   -52.460 2.845   1.00 37.38 ? 108 THR B CA  1 
ATOM   980  C  C   . THR B 2 108 ? 5.819   -52.962 1.895   1.00 36.58 ? 108 THR B C   1 
ATOM   981  O  O   . THR B 2 108 ? 6.887   -52.346 1.782   1.00 36.17 ? 108 THR B O   1 
ATOM   982  C  CB  . THR B 2 108 ? 3.625   -51.849 1.964   1.00 38.20 ? 108 THR B CB  1 
ATOM   983  O  OG1 . THR B 2 108 ? 4.189   -50.804 1.163   1.00 34.88 ? 108 THR B OG1 1 
ATOM   984  C  CG2 . THR B 2 108 ? 2.482   -51.277 2.807   1.00 40.45 ? 108 THR B CG2 1 
ATOM   985  N  N   . ASP B 2 109 ? 5.529   -54.065 1.202   1.00 34.89 ? 109 ASP B N   1 
ATOM   986  C  CA  . ASP B 2 109 ? 6.423   -54.610 0.179   1.00 35.42 ? 109 ASP B CA  1 
ATOM   987  C  C   . ASP B 2 109 ? 6.718   -53.622 -0.954  1.00 32.99 ? 109 ASP B C   1 
ATOM   988  O  O   . ASP B 2 109 ? 7.860   -53.541 -1.408  1.00 31.98 ? 109 ASP B O   1 
ATOM   989  C  CB  . ASP B 2 109 ? 5.866   -55.910 -0.412  1.00 41.08 ? 109 ASP B CB  1 
ATOM   990  C  CG  . ASP B 2 109 ? 5.957   -57.089 0.549   1.00 51.60 ? 109 ASP B CG  1 
ATOM   991  O  OD1 . ASP B 2 109 ? 6.789   -57.066 1.488   1.00 51.19 ? 109 ASP B OD1 1 
ATOM   992  O  OD2 . ASP B 2 109 ? 5.189   -58.055 0.354   1.00 61.04 ? 109 ASP B OD2 1 
ATOM   993  N  N   . LYS B 2 110 ? 5.706   -52.885 -1.421  1.00 30.91 ? 110 LYS B N   1 
ATOM   994  C  CA  . LYS B 2 110 ? 5.947   -51.908 -2.491  1.00 31.53 ? 110 LYS B CA  1 
ATOM   995  C  C   . LYS B 2 110 ? 6.829   -50.744 -2.016  1.00 29.52 ? 110 LYS B C   1 
ATOM   996  O  O   . LYS B 2 110 ? 7.676   -50.264 -2.769  1.00 28.33 ? 110 LYS B O   1 
ATOM   997  C  CB  . LYS B 2 110 ? 4.659   -51.423 -3.180  1.00 34.99 ? 110 LYS B CB  1 
ATOM   998  C  CG  . LYS B 2 110 ? 3.593   -50.813 -2.282  1.00 38.83 ? 110 LYS B CG  1 
ATOM   999  C  CD  . LYS B 2 110 ? 2.370   -50.386 -3.099  1.00 39.91 ? 110 LYS B CD  1 
ATOM   1000 C  CE  . LYS B 2 110 ? 1.594   -51.570 -3.656  1.00 43.80 ? 110 LYS B CE  1 
ATOM   1001 N  NZ  . LYS B 2 110 ? 0.432   -51.132 -4.490  1.00 44.13 ? 110 LYS B NZ  1 
ATOM   1002 N  N   . LEU B 2 111 ? 6.643   -50.317 -0.768  1.00 29.48 ? 111 LEU B N   1 
ATOM   1003 C  CA  . LEU B 2 111 ? 7.519   -49.298 -0.176  1.00 30.74 ? 111 LEU B CA  1 
ATOM   1004 C  C   . LEU B 2 111 ? 8.967   -49.781 -0.107  1.00 29.87 ? 111 LEU B C   1 
ATOM   1005 O  O   . LEU B 2 111 ? 9.890   -49.036 -0.450  1.00 30.05 ? 111 LEU B O   1 
ATOM   1006 C  CB  . LEU B 2 111 ? 7.026   -48.876 1.212   1.00 32.09 ? 111 LEU B CB  1 
ATOM   1007 C  CG  . LEU B 2 111 ? 5.999   -47.743 1.256   1.00 34.21 ? 111 LEU B CG  1 
ATOM   1008 C  CD1 . LEU B 2 111 ? 5.363   -47.666 2.638   1.00 41.65 ? 111 LEU B CD1 1 
ATOM   1009 C  CD2 . LEU B 2 111 ? 6.642   -46.411 0.884   1.00 31.78 ? 111 LEU B CD2 1 
ATOM   1010 N  N   . LYS B 2 112 ? 9.155   -51.029 0.320   1.00 29.26 ? 112 LYS B N   1 
ATOM   1011 C  CA  . LYS B 2 112 ? 10.488  -51.641 0.392   1.00 31.00 ? 112 LYS B CA  1 
ATOM   1012 C  C   . LYS B 2 112 ? 11.134  -51.766 -0.990  1.00 30.04 ? 112 LYS B C   1 
ATOM   1013 O  O   . LYS B 2 112 ? 12.334  -51.543 -1.141  1.00 27.78 ? 112 LYS B O   1 
ATOM   1014 C  CB  . LYS B 2 112 ? 10.418  -53.007 1.088   1.00 34.83 ? 112 LYS B CB  1 
ATOM   1015 C  CG  . LYS B 2 112 ? 11.774  -53.618 1.420   1.00 36.99 ? 112 LYS B CG  1 
ATOM   1016 C  CD  . LYS B 2 112 ? 11.647  -54.987 2.076   1.00 43.26 ? 112 LYS B CD  1 
ATOM   1017 C  CE  . LYS B 2 112 ? 11.100  -54.894 3.494   1.00 51.71 ? 112 LYS B CE  1 
ATOM   1018 N  NZ  . LYS B 2 112 ? 10.898  -56.246 4.091   1.00 59.36 ? 112 LYS B NZ  1 
ATOM   1019 N  N   . GLU B 2 113 ? 10.332  -52.113 -1.998  1.00 27.25 ? 113 GLU B N   1 
ATOM   1020 C  CA  . GLU B 2 113 ? 10.816  -52.183 -3.376  1.00 24.93 ? 113 GLU B CA  1 
ATOM   1021 C  C   . GLU B 2 113 ? 11.352  -50.820 -3.819  1.00 24.74 ? 113 GLU B C   1 
ATOM   1022 O  O   . GLU B 2 113 ? 12.462  -50.719 -4.359  1.00 25.03 ? 113 GLU B O   1 
ATOM   1023 C  CB  . GLU B 2 113 ? 9.692   -52.625 -4.320  1.00 26.53 ? 113 GLU B CB  1 
ATOM   1024 C  CG  . GLU B 2 113 ? 10.175  -52.969 -5.718  1.00 26.38 ? 113 GLU B CG  1 
ATOM   1025 C  CD  . GLU B 2 113 ? 10.494  -54.446 -5.883  1.00 32.28 ? 113 GLU B CD  1 
ATOM   1026 O  OE1 . GLU B 2 113 ? 9.563   -55.268 -5.759  1.00 35.92 ? 113 GLU B OE1 1 
ATOM   1027 O  OE2 . GLU B 2 113 ? 11.672  -54.787 -6.153  1.00 29.19 ? 113 GLU B OE2 1 
ATOM   1028 N  N   . LEU B 2 114 ? 10.562  -49.775 -3.591  1.00 23.79 ? 114 LEU B N   1 
ATOM   1029 C  CA  . LEU B 2 114 ? 10.980  -48.429 -3.957  1.00 24.95 ? 114 LEU B CA  1 
ATOM   1030 C  C   . LEU B 2 114 ? 12.206  -47.991 -3.150  1.00 25.20 ? 114 LEU B C   1 
ATOM   1031 O  O   . LEU B 2 114 ? 13.112  -47.335 -3.687  1.00 24.13 ? 114 LEU B O   1 
ATOM   1032 C  CB  . LEU B 2 114 ? 9.838   -47.429 -3.767  1.00 24.89 ? 114 LEU B CB  1 
ATOM   1033 C  CG  . LEU B 2 114 ? 10.142  -45.992 -4.212  1.00 23.35 ? 114 LEU B CG  1 
ATOM   1034 C  CD1 . LEU B 2 114 ? 10.624  -45.903 -5.661  1.00 24.86 ? 114 LEU B CD1 1 
ATOM   1035 C  CD2 . LEU B 2 114 ? 8.926   -45.099 -3.977  1.00 25.09 ? 114 LEU B CD2 1 
ATOM   1036 N  N   . TYR B 2 115 ? 12.213  -48.352 -1.869  1.00 24.37 ? 115 TYR B N   1 
ATOM   1037 C  CA  . TYR B 2 115 ? 13.335  -48.042 -0.966  1.00 25.22 ? 115 TYR B CA  1 
ATOM   1038 C  C   . TYR B 2 115 ? 14.651  -48.588 -1.529  1.00 25.62 ? 115 TYR B C   1 
ATOM   1039 O  O   . TYR B 2 115 ? 15.658  -47.873 -1.570  1.00 25.77 ? 115 TYR B O   1 
ATOM   1040 C  CB  . TYR B 2 115 ? 13.043  -48.576 0.439   1.00 25.29 ? 115 TYR B CB  1 
ATOM   1041 C  CG  . TYR B 2 115 ? 14.060  -48.175 1.498   1.00 26.58 ? 115 TYR B CG  1 
ATOM   1042 C  CD1 . TYR B 2 115 ? 14.288  -46.830 1.803   1.00 29.42 ? 115 TYR B CD1 1 
ATOM   1043 C  CD2 . TYR B 2 115 ? 14.761  -49.147 2.214   1.00 30.51 ? 115 TYR B CD2 1 
ATOM   1044 C  CE1 . TYR B 2 115 ? 15.214  -46.461 2.782   1.00 30.91 ? 115 TYR B CE1 1 
ATOM   1045 C  CE2 . TYR B 2 115 ? 15.688  -48.787 3.193   1.00 31.97 ? 115 TYR B CE2 1 
ATOM   1046 C  CZ  . TYR B 2 115 ? 15.908  -47.447 3.466   1.00 30.38 ? 115 TYR B CZ  1 
ATOM   1047 O  OH  . TYR B 2 115 ? 16.817  -47.082 4.440   1.00 34.16 ? 115 TYR B OH  1 
ATOM   1048 N  N   . GLY B 2 116 ? 14.637  -49.833 -2.001  1.00 25.16 ? 116 GLY B N   1 
ATOM   1049 C  CA  . GLY B 2 116 ? 15.800  -50.401 -2.677  1.00 25.64 ? 116 GLY B CA  1 
ATOM   1050 C  C   . GLY B 2 116 ? 16.278  -49.547 -3.840  1.00 25.96 ? 116 GLY B C   1 
ATOM   1051 O  O   . GLY B 2 116 ? 17.485  -49.322 -4.010  1.00 24.42 ? 116 GLY B O   1 
ATOM   1052 N  N   . GLN B 2 117 ? 15.331  -49.060 -4.643  1.00 23.31 ? 117 GLN B N   1 
ATOM   1053 C  CA  . GLN B 2 117 ? 15.668  -48.236 -5.803  1.00 22.99 ? 117 GLN B CA  1 
ATOM   1054 C  C   . GLN B 2 117 ? 16.207  -46.868 -5.396  1.00 21.64 ? 117 GLN B C   1 
ATOM   1055 O  O   . GLN B 2 117 ? 17.123  -46.349 -6.030  1.00 24.57 ? 117 GLN B O   1 
ATOM   1056 C  CB  . GLN B 2 117 ? 14.461  -48.062 -6.723  1.00 23.96 ? 117 GLN B CB  1 
ATOM   1057 C  CG  . GLN B 2 117 ? 14.013  -49.385 -7.308  1.00 24.70 ? 117 GLN B CG  1 
ATOM   1058 C  CD  . GLN B 2 117 ? 12.741  -49.291 -8.128  1.00 24.84 ? 117 GLN B CD  1 
ATOM   1059 O  OE1 . GLN B 2 117 ? 12.407  -48.251 -8.700  1.00 28.18 ? 117 GLN B OE1 1 
ATOM   1060 N  NE2 . GLN B 2 117 ? 12.033  -50.399 -8.195  1.00 22.21 ? 117 GLN B NE2 1 
ATOM   1061 N  N   . VAL B 2 118 ? 15.611  -46.292 -4.357  1.00 21.48 ? 118 VAL B N   1 
ATOM   1062 C  CA  . VAL B 2 118 ? 16.053  -45.003 -3.807  1.00 23.46 ? 118 VAL B CA  1 
ATOM   1063 C  C   . VAL B 2 118 ? 17.487  -45.118 -3.272  1.00 23.64 ? 118 VAL B C   1 
ATOM   1064 O  O   . VAL B 2 118 ? 18.336  -44.259 -3.560  1.00 25.16 ? 118 VAL B O   1 
ATOM   1065 C  CB  . VAL B 2 118 ? 15.070  -44.485 -2.724  1.00 24.75 ? 118 VAL B CB  1 
ATOM   1066 C  CG1 . VAL B 2 118 ? 15.687  -43.369 -1.877  1.00 27.25 ? 118 VAL B CG1 1 
ATOM   1067 C  CG2 . VAL B 2 118 ? 13.786  -43.976 -3.372  1.00 27.94 ? 118 VAL B CG2 1 
ATOM   1068 N  N   . LEU B 2 119 ? 17.764  -46.186 -2.531  1.00 23.85 ? 119 LEU B N   1 
ATOM   1069 C  CA  . LEU B 2 119 ? 19.120  -46.405 -1.994  1.00 24.08 ? 119 LEU B CA  1 
ATOM   1070 C  C   . LEU B 2 119 ? 20.142  -46.571 -3.109  1.00 25.45 ? 119 LEU B C   1 
ATOM   1071 O  O   . LEU B 2 119 ? 21.258  -46.072 -3.008  1.00 25.06 ? 119 LEU B O   1 
ATOM   1072 C  CB  . LEU B 2 119 ? 19.161  -47.626 -1.070  1.00 24.17 ? 119 LEU B CB  1 
ATOM   1073 C  CG  . LEU B 2 119 ? 18.375  -47.550 0.240   1.00 24.67 ? 119 LEU B CG  1 
ATOM   1074 C  CD1 . LEU B 2 119 ? 18.456  -48.898 0.938   1.00 29.71 ? 119 LEU B CD1 1 
ATOM   1075 C  CD2 . LEU B 2 119 ? 18.910  -46.429 1.135   1.00 28.98 ? 119 LEU B CD2 1 
ATOM   1076 N  N   . TYR B 2 120 ? 19.761  -47.273 -4.177  1.00 23.41 ? 120 TYR B N   1 
ATOM   1077 C  CA  . TYR B 2 120 ? 20.625  -47.395 -5.350  1.00 23.27 ? 120 TYR B CA  1 
ATOM   1078 C  C   . TYR B 2 120 ? 20.984  -46.028 -5.942  1.00 23.38 ? 120 TYR B C   1 
ATOM   1079 O  O   . TYR B 2 120 ? 22.158  -45.768 -6.233  1.00 24.65 ? 120 TYR B O   1 
ATOM   1080 C  CB  . TYR B 2 120 ? 19.955  -48.277 -6.412  1.00 23.61 ? 120 TYR B CB  1 
ATOM   1081 C  CG  . TYR B 2 120 ? 20.763  -48.490 -7.677  1.00 23.64 ? 120 TYR B CG  1 
ATOM   1082 C  CD1 . TYR B 2 120 ? 21.979  -49.184 -7.652  1.00 25.88 ? 120 TYR B CD1 1 
ATOM   1083 C  CD2 . TYR B 2 120 ? 20.291  -48.030 -8.907  1.00 24.84 ? 120 TYR B CD2 1 
ATOM   1084 C  CE1 . TYR B 2 120 ? 22.707  -49.393 -8.817  1.00 28.09 ? 120 TYR B CE1 1 
ATOM   1085 C  CE2 . TYR B 2 120 ? 21.008  -48.244 -10.081 1.00 27.37 ? 120 TYR B CE2 1 
ATOM   1086 C  CZ  . TYR B 2 120 ? 22.210  -48.925 -10.031 1.00 28.19 ? 120 TYR B CZ  1 
ATOM   1087 O  OH  . TYR B 2 120 ? 22.919  -49.137 -11.196 1.00 32.44 ? 120 TYR B OH  1 
ATOM   1088 N  N   . ARG B 2 121 ? 19.975  -45.167 -6.116  1.00 22.35 ? 121 ARG B N   1 
ATOM   1089 C  CA  . ARG B 2 121 ? 20.178  -43.817 -6.642  1.00 23.62 ? 121 ARG B CA  1 
ATOM   1090 C  C   . ARG B 2 121 ? 21.046  -42.963 -5.714  1.00 24.42 ? 121 ARG B C   1 
ATOM   1091 O  O   . ARG B 2 121 ? 21.827  -42.129 -6.182  1.00 26.02 ? 121 ARG B O   1 
ATOM   1092 C  CB  . ARG B 2 121 ? 18.838  -43.120 -6.887  1.00 27.94 ? 121 ARG B CB  1 
ATOM   1093 C  CG  . ARG B 2 121 ? 18.052  -43.713 -8.049  1.00 39.15 ? 121 ARG B CG  1 
ATOM   1094 C  CD  . ARG B 2 121 ? 18.657  -43.335 -9.394  1.00 46.90 ? 121 ARG B CD  1 
ATOM   1095 N  NE  . ARG B 2 121 ? 18.405  -41.937 -9.732  1.00 55.15 ? 121 ARG B NE  1 
ATOM   1096 C  CZ  . ARG B 2 121 ? 17.310  -41.495 -10.348 1.00 57.26 ? 121 ARG B CZ  1 
ATOM   1097 N  NH1 . ARG B 2 121 ? 16.348  -42.339 -10.707 1.00 53.22 ? 121 ARG B NH1 1 
ATOM   1098 N  NH2 . ARG B 2 121 ? 17.180  -40.200 -10.604 1.00 59.54 ? 121 ARG B NH2 1 
ATOM   1099 N  N   . LEU B 2 122 ? 20.904  -43.188 -4.412  1.00 23.74 ? 122 LEU B N   1 
ATOM   1100 C  CA  . LEU B 2 122 ? 21.710  -42.473 -3.396  1.00 24.37 ? 122 LEU B CA  1 
ATOM   1101 C  C   . LEU B 2 122 ? 23.113  -43.062 -3.215  1.00 25.44 ? 122 LEU B C   1 
ATOM   1102 O  O   . LEU B 2 122 ? 23.909  -42.547 -2.424  1.00 26.67 ? 122 LEU B O   1 
ATOM   1103 C  CB  . LEU B 2 122 ? 20.977  -42.451 -2.052  1.00 25.00 ? 122 LEU B CB  1 
ATOM   1104 C  CG  . LEU B 2 122 ? 19.705  -41.598 -1.976  1.00 26.52 ? 122 LEU B CG  1 
ATOM   1105 C  CD1 . LEU B 2 122 ? 18.948  -41.838 -0.677  1.00 28.00 ? 122 LEU B CD1 1 
ATOM   1106 C  CD2 . LEU B 2 122 ? 20.016  -40.117 -2.163  1.00 29.85 ? 122 LEU B CD2 1 
ATOM   1107 N  N   . GLU B 2 123 ? 23.401  -44.139 -3.945  1.00 23.24 ? 123 GLU B N   1 
ATOM   1108 C  CA  . GLU B 2 123 ? 24.692  -44.852 -3.901  1.00 24.19 ? 123 GLU B CA  1 
ATOM   1109 C  C   . GLU B 2 123 ? 24.991  -45.445 -2.515  1.00 24.50 ? 123 GLU B C   1 
ATOM   1110 O  O   . GLU B 2 123 ? 26.153  -45.637 -2.126  1.00 25.39 ? 123 GLU B O   1 
ATOM   1111 C  CB  . GLU B 2 123 ? 25.838  -43.986 -4.464  1.00 25.36 ? 123 GLU B CB  1 
ATOM   1112 C  CG  . GLU B 2 123 ? 25.517  -43.458 -5.859  1.00 28.90 ? 123 GLU B CG  1 
ATOM   1113 C  CD  . GLU B 2 123 ? 26.643  -42.695 -6.536  1.00 36.04 ? 123 GLU B CD  1 
ATOM   1114 O  OE1 . GLU B 2 123 ? 27.830  -42.882 -6.200  1.00 34.49 ? 123 GLU B OE1 1 
ATOM   1115 O  OE2 . GLU B 2 123 ? 26.332  -41.909 -7.447  1.00 46.27 ? 123 GLU B OE2 1 
ATOM   1116 N  N   . ARG B 2 124 ? 23.918  -45.751 -1.787  1.00 24.20 ? 124 ARG B N   1 
ATOM   1117 C  CA  . ARG B 2 124 ? 24.011  -46.460 -0.518  1.00 24.27 ? 124 ARG B CA  1 
ATOM   1118 C  C   . ARG B 2 124 ? 23.922  -47.965 -0.775  1.00 24.89 ? 124 ARG B C   1 
ATOM   1119 O  O   . ARG B 2 124 ? 22.960  -48.635 -0.388  1.00 26.77 ? 124 ARG B O   1 
ATOM   1120 C  CB  . ARG B 2 124 ? 22.949  -45.938 0.453   1.00 22.90 ? 124 ARG B CB  1 
ATOM   1121 C  CG  . ARG B 2 124 ? 23.256  -44.503 0.898   1.00 26.50 ? 124 ARG B CG  1 
ATOM   1122 C  CD  . ARG B 2 124 ? 22.098  -43.779 1.575   1.00 25.56 ? 124 ARG B CD  1 
ATOM   1123 N  NE  . ARG B 2 124 ? 21.492  -44.555 2.652   1.00 25.86 ? 124 ARG B NE  1 
ATOM   1124 C  CZ  . ARG B 2 124 ? 20.501  -44.116 3.431   1.00 27.97 ? 124 ARG B CZ  1 
ATOM   1125 N  NH1 . ARG B 2 124 ? 20.009  -42.892 3.270   1.00 30.41 ? 124 ARG B NH1 1 
ATOM   1126 N  NH2 . ARG B 2 124 ? 19.991  -44.908 4.368   1.00 29.91 ? 124 ARG B NH2 1 
ATOM   1127 N  N   . TYR B 2 125 ? 24.962  -48.486 -1.421  1.00 23.90 ? 125 TYR B N   1 
ATOM   1128 C  CA  . TYR B 2 125 ? 24.928  -49.823 -2.013  1.00 24.85 ? 125 TYR B CA  1 
ATOM   1129 C  C   . TYR B 2 125 ? 24.867  -50.965 -0.999  1.00 26.65 ? 125 TYR B C   1 
ATOM   1130 O  O   . TYR B 2 125 ? 24.235  -51.995 -1.264  1.00 27.73 ? 125 TYR B O   1 
ATOM   1131 C  CB  . TYR B 2 125 ? 26.110  -50.026 -2.957  1.00 24.72 ? 125 TYR B CB  1 
ATOM   1132 C  CG  . TYR B 2 125 ? 26.190  -49.040 -4.100  1.00 26.46 ? 125 TYR B CG  1 
ATOM   1133 C  CD1 . TYR B 2 125 ? 25.069  -48.754 -4.895  1.00 25.49 ? 125 TYR B CD1 1 
ATOM   1134 C  CD2 . TYR B 2 125 ? 27.397  -48.421 -4.421  1.00 27.84 ? 125 TYR B CD2 1 
ATOM   1135 C  CE1 . TYR B 2 125 ? 25.151  -47.862 -5.953  1.00 25.20 ? 125 TYR B CE1 1 
ATOM   1136 C  CE2 . TYR B 2 125 ? 27.485  -47.528 -5.477  1.00 28.05 ? 125 TYR B CE2 1 
ATOM   1137 C  CZ  . TYR B 2 125 ? 26.366  -47.253 -6.238  1.00 27.01 ? 125 TYR B CZ  1 
ATOM   1138 O  OH  . TYR B 2 125 ? 26.470  -46.375 -7.284  1.00 30.11 ? 125 TYR B OH  1 
ATOM   1139 N  N   . ASP B 2 126 ? 25.519  -50.796 0.152   1.00 27.50 ? 126 ASP B N   1 
ATOM   1140 C  CA  . ASP B 2 126 ? 25.493  -51.843 1.164   1.00 28.88 ? 126 ASP B CA  1 
ATOM   1141 C  C   . ASP B 2 126 ? 24.082  -52.105 1.681   1.00 28.02 ? 126 ASP B C   1 
ATOM   1142 O  O   . ASP B 2 126 ? 23.629  -53.256 1.706   1.00 30.38 ? 126 ASP B O   1 
ATOM   1143 C  CB  . ASP B 2 126 ? 26.471  -51.537 2.303   1.00 28.61 ? 126 ASP B CB  1 
ATOM   1144 C  CG  . ASP B 2 126 ? 27.909  -51.634 1.848   1.00 30.28 ? 126 ASP B CG  1 
ATOM   1145 O  OD1 . ASP B 2 126 ? 28.358  -52.763 1.571   1.00 34.91 ? 126 ASP B OD1 1 
ATOM   1146 O  OD2 . ASP B 2 126 ? 28.574  -50.587 1.727   1.00 33.45 ? 126 ASP B OD2 1 
ATOM   1147 N  N   . GLU B 2 127 ? 23.384  -51.043 2.066   1.00 26.68 ? 127 GLU B N   1 
ATOM   1148 C  CA  . GLU B 2 127 ? 22.021  -51.194 2.559   1.00 28.77 ? 127 GLU B CA  1 
ATOM   1149 C  C   . GLU B 2 127 ? 21.101  -51.633 1.421   1.00 28.67 ? 127 GLU B C   1 
ATOM   1150 O  O   . GLU B 2 127 ? 20.194  -52.452 1.631   1.00 28.80 ? 127 GLU B O   1 
ATOM   1151 C  CB  . GLU B 2 127 ? 21.507  -49.913 3.202   1.00 27.60 ? 127 GLU B CB  1 
ATOM   1152 C  CG  . GLU B 2 127 ? 20.197  -50.134 3.954   1.00 30.18 ? 127 GLU B CG  1 
ATOM   1153 C  CD  . GLU B 2 127 ? 19.611  -48.874 4.554   1.00 31.12 ? 127 GLU B CD  1 
ATOM   1154 O  OE1 . GLU B 2 127 ? 20.265  -47.810 4.513   1.00 32.46 ? 127 GLU B OE1 1 
ATOM   1155 O  OE2 . GLU B 2 127 ? 18.480  -48.950 5.081   1.00 33.72 ? 127 GLU B OE2 1 
ATOM   1156 N  N   . CYS B 2 128 ? 21.355  -51.099 0.228   1.00 26.60 ? 128 CYS B N   1 
ATOM   1157 C  CA  . CYS B 2 128 ? 20.629  -51.509 -0.985  1.00 27.07 ? 128 CYS B CA  1 
ATOM   1158 C  C   . CYS B 2 128 ? 20.661  -53.031 -1.197  1.00 28.85 ? 128 CYS B C   1 
ATOM   1159 O  O   . CYS B 2 128 ? 19.606  -53.660 -1.397  1.00 28.98 ? 128 CYS B O   1 
ATOM   1160 C  CB  . CYS B 2 128 ? 21.203  -50.794 -2.208  1.00 27.28 ? 128 CYS B CB  1 
ATOM   1161 S  SG  . CYS B 2 128 ? 20.271  -51.080 -3.729  1.00 26.84 ? 128 CYS B SG  1 
ATOM   1162 N  N   . LEU B 2 129 ? 21.861  -53.619 -1.146  1.00 27.73 ? 129 LEU B N   1 
ATOM   1163 C  CA  . LEU B 2 129 ? 22.024  -55.075 -1.275  1.00 28.76 ? 129 LEU B CA  1 
ATOM   1164 C  C   . LEU B 2 129 ? 21.225  -55.844 -0.237  1.00 30.37 ? 129 LEU B C   1 
ATOM   1165 O  O   . LEU B 2 129 ? 20.640  -56.885 -0.558  1.00 31.22 ? 129 LEU B O   1 
ATOM   1166 C  CB  . LEU B 2 129 ? 23.495  -55.493 -1.173  1.00 30.05 ? 129 LEU B CB  1 
ATOM   1167 C  CG  . LEU B 2 129 ? 24.438  -55.165 -2.326  1.00 31.52 ? 129 LEU B CG  1 
ATOM   1168 C  CD1 . LEU B 2 129 ? 25.855  -55.567 -1.939  1.00 35.81 ? 129 LEU B CD1 1 
ATOM   1169 C  CD2 . LEU B 2 129 ? 24.018  -55.854 -3.621  1.00 32.38 ? 129 LEU B CD2 1 
ATOM   1170 N  N   . ALA B 2 130 ? 21.212  -55.339 1.001   1.00 29.02 ? 130 ALA B N   1 
ATOM   1171 C  CA  . ALA B 2 130 ? 20.475  -55.987 2.094   1.00 30.38 ? 130 ALA B CA  1 
ATOM   1172 C  C   . ALA B 2 130 ? 18.980  -55.983 1.795   1.00 31.07 ? 130 ALA B C   1 
ATOM   1173 O  O   . ALA B 2 130 ? 18.295  -56.989 2.008   1.00 30.91 ? 130 ALA B O   1 
ATOM   1174 C  CB  . ALA B 2 130 ? 20.747  -55.298 3.425   1.00 30.19 ? 130 ALA B CB  1 
ATOM   1175 N  N   . VAL B 2 131 ? 18.487  -54.844 1.310   1.00 29.22 ? 131 VAL B N   1 
ATOM   1176 C  CA  . VAL B 2 131 ? 17.076  -54.694 0.930   1.00 29.16 ? 131 VAL B CA  1 
ATOM   1177 C  C   . VAL B 2 131 ? 16.726  -55.679 -0.192  1.00 28.84 ? 131 VAL B C   1 
ATOM   1178 O  O   . VAL B 2 131 ? 15.729  -56.404 -0.089  1.00 30.94 ? 131 VAL B O   1 
ATOM   1179 C  CB  . VAL B 2 131 ? 16.742  -53.227 0.557   1.00 28.27 ? 131 VAL B CB  1 
ATOM   1180 C  CG1 . VAL B 2 131 ? 15.351  -53.104 -0.066  1.00 28.45 ? 131 VAL B CG1 1 
ATOM   1181 C  CG2 . VAL B 2 131 ? 16.841  -52.333 1.791   1.00 32.01 ? 131 VAL B CG2 1 
ATOM   1182 N  N   . TYR B 2 132 ? 17.553  -55.743 -1.235  1.00 27.02 ? 132 TYR B N   1 
ATOM   1183 C  CA  . TYR B 2 132 ? 17.287  -56.675 -2.348  1.00 29.14 ? 132 TYR B CA  1 
ATOM   1184 C  C   . TYR B 2 132 ? 17.392  -58.151 -1.990  1.00 32.13 ? 132 TYR B C   1 
ATOM   1185 O  O   . TYR B 2 132 ? 16.604  -58.954 -2.487  1.00 32.79 ? 132 TYR B O   1 
ATOM   1186 C  CB  . TYR B 2 132 ? 18.125  -56.353 -3.590  1.00 28.20 ? 132 TYR B CB  1 
ATOM   1187 C  CG  . TYR B 2 132 ? 17.488  -55.259 -4.391  1.00 28.26 ? 132 TYR B CG  1 
ATOM   1188 C  CD1 . TYR B 2 132 ? 16.337  -55.512 -5.140  1.00 30.44 ? 132 TYR B CD1 1 
ATOM   1189 C  CD2 . TYR B 2 132 ? 17.990  -53.961 -4.359  1.00 29.16 ? 132 TYR B CD2 1 
ATOM   1190 C  CE1 . TYR B 2 132 ? 15.722  -54.506 -5.851  1.00 27.19 ? 132 TYR B CE1 1 
ATOM   1191 C  CE2 . TYR B 2 132 ? 17.379  -52.944 -5.073  1.00 28.85 ? 132 TYR B CE2 1 
ATOM   1192 C  CZ  . TYR B 2 132 ? 16.245  -53.227 -5.816  1.00 26.80 ? 132 TYR B CZ  1 
ATOM   1193 O  OH  . TYR B 2 132 ? 15.613  -52.236 -6.522  1.00 26.32 ? 132 TYR B OH  1 
ATOM   1194 N  N   . ARG B 2 133 ? 18.345  -58.516 -1.131  1.00 31.06 ? 133 ARG B N   1 
ATOM   1195 C  CA  . ARG B 2 133 ? 18.427  -59.905 -0.664  1.00 32.99 ? 133 ARG B CA  1 
ATOM   1196 C  C   . ARG B 2 133 ? 17.146  -60.297 0.066   1.00 32.11 ? 133 ARG B C   1 
ATOM   1197 O  O   . ARG B 2 133 ? 16.622  -61.397 -0.133  1.00 36.65 ? 133 ARG B O   1 
ATOM   1198 C  CB  . ARG B 2 133 ? 19.656  -60.137 0.232   1.00 34.74 ? 133 ARG B CB  1 
ATOM   1199 C  CG  . ARG B 2 133 ? 20.958  -60.237 -0.550  1.00 41.90 ? 133 ARG B CG  1 
ATOM   1200 C  CD  . ARG B 2 133 ? 22.108  -60.773 0.292   1.00 48.07 ? 133 ARG B CD  1 
ATOM   1201 N  NE  . ARG B 2 133 ? 22.349  -59.966 1.478   1.00 55.96 ? 133 ARG B NE  1 
ATOM   1202 C  CZ  . ARG B 2 133 ? 22.213  -60.398 2.728   1.00 62.35 ? 133 ARG B CZ  1 
ATOM   1203 N  NH1 . ARG B 2 133 ? 21.843  -61.650 2.975   1.00 66.55 ? 133 ARG B NH1 1 
ATOM   1204 N  NH2 . ARG B 2 133 ? 22.457  -59.573 3.737   1.00 70.77 ? 133 ARG B NH2 1 
ATOM   1205 N  N   . ASP B 2 134 ? 16.655  -59.382 0.898   1.00 30.85 ? 134 ASP B N   1 
ATOM   1206 C  CA  . ASP B 2 134 ? 15.406  -59.539 1.648   1.00 35.29 ? 134 ASP B CA  1 
ATOM   1207 C  C   . ASP B 2 134 ? 14.207  -59.694 0.706   1.00 37.76 ? 134 ASP B C   1 
ATOM   1208 O  O   . ASP B 2 134 ? 13.397  -60.618 0.863   1.00 39.76 ? 134 ASP B O   1 
ATOM   1209 C  CB  . ASP B 2 134 ? 15.222  -58.329 2.575   1.00 38.95 ? 134 ASP B CB  1 
ATOM   1210 C  CG  . ASP B 2 134 ? 13.938  -58.385 3.396   1.00 50.28 ? 134 ASP B CG  1 
ATOM   1211 O  OD1 . ASP B 2 134 ? 13.404  -59.488 3.632   1.00 55.54 ? 134 ASP B OD1 1 
ATOM   1212 O  OD2 . ASP B 2 134 ? 13.468  -57.308 3.825   1.00 53.12 ? 134 ASP B OD2 1 
ATOM   1213 N  N   . LEU B 2 135 ? 14.101  -58.792 -0.268  1.00 34.39 ? 135 LEU B N   1 
ATOM   1214 C  CA  . LEU B 2 135 ? 13.022  -58.850 -1.269  1.00 34.07 ? 135 LEU B CA  1 
ATOM   1215 C  C   . LEU B 2 135 ? 13.005  -60.160 -2.064  1.00 39.74 ? 135 LEU B C   1 
ATOM   1216 O  O   . LEU B 2 135 ? 11.935  -60.723 -2.296  1.00 42.09 ? 135 LEU B O   1 
ATOM   1217 C  CB  . LEU B 2 135 ? 13.078  -57.647 -2.220  1.00 33.08 ? 135 LEU B CB  1 
ATOM   1218 C  CG  . LEU B 2 135 ? 12.684  -56.276 -1.651  1.00 31.99 ? 135 LEU B CG  1 
ATOM   1219 C  CD1 . LEU B 2 135 ? 13.150  -55.159 -2.579  1.00 31.18 ? 135 LEU B CD1 1 
ATOM   1220 C  CD2 . LEU B 2 135 ? 11.183  -56.173 -1.406  1.00 37.96 ? 135 LEU B CD2 1 
ATOM   1221 N  N   . VAL B 2 136 ? 14.180  -60.634 -2.481  1.00 35.92 ? 136 VAL B N   1 
ATOM   1222 C  CA  . VAL B 2 136 ? 14.285  -61.921 -3.177  1.00 37.72 ? 136 VAL B CA  1 
ATOM   1223 C  C   . VAL B 2 136 ? 13.857  -63.084 -2.268  1.00 42.99 ? 136 VAL B C   1 
ATOM   1224 O  O   . VAL B 2 136 ? 13.102  -63.963 -2.698  1.00 49.52 ? 136 VAL B O   1 
ATOM   1225 C  CB  . VAL B 2 136 ? 15.700  -62.149 -3.764  1.00 40.36 ? 136 VAL B CB  1 
ATOM   1226 C  CG1 . VAL B 2 136 ? 15.853  -63.562 -4.317  1.00 46.96 ? 136 VAL B CG1 1 
ATOM   1227 C  CG2 . VAL B 2 136 ? 15.994  -61.132 -4.857  1.00 38.18 ? 136 VAL B CG2 1 
ATOM   1228 N  N   . ARG B 2 137 ? 14.311  -63.070 -1.014  1.00 42.72 ? 137 ARG B N   1 
ATOM   1229 C  CA  . ARG B 2 137 ? 13.960  -64.117 -0.038  1.00 49.19 ? 137 ARG B CA  1 
ATOM   1230 C  C   . ARG B 2 137 ? 12.463  -64.246 0.259   1.00 49.84 ? 137 ARG B C   1 
ATOM   1231 O  O   . ARG B 2 137 ? 11.963  -65.354 0.458   1.00 50.00 ? 137 ARG B O   1 
ATOM   1232 C  CB  . ARG B 2 137 ? 14.709  -63.907 1.282   1.00 52.63 ? 137 ARG B CB  1 
ATOM   1233 C  CG  . ARG B 2 137 ? 15.889  -64.839 1.496   1.00 58.21 ? 137 ARG B CG  1 
ATOM   1234 C  CD  . ARG B 2 137 ? 16.453  -64.706 2.907   1.00 65.13 ? 137 ARG B CD  1 
ATOM   1235 N  NE  . ARG B 2 137 ? 17.202  -63.460 3.096   1.00 67.84 ? 137 ARG B NE  1 
ATOM   1236 C  CZ  . ARG B 2 137 ? 16.753  -62.393 3.754   1.00 58.32 ? 137 ARG B CZ  1 
ATOM   1237 N  NH1 . ARG B 2 137 ? 15.548  -62.399 4.308   1.00 68.16 ? 137 ARG B NH1 1 
ATOM   1238 N  NH2 . ARG B 2 137 ? 17.515  -61.313 3.860   1.00 54.64 ? 137 ARG B NH2 1 
ATOM   1239 N  N   . ASN B 2 138 ? 11.759  -63.119 0.293   1.00 48.85 ? 138 ASN B N   1 
ATOM   1240 C  CA  . ASN B 2 138 ? 10.365  -63.087 0.741   1.00 50.99 ? 138 ASN B CA  1 
ATOM   1241 C  C   . ASN B 2 138 ? 9.334   -62.782 -0.350  1.00 51.29 ? 138 ASN B C   1 
ATOM   1242 O  O   . ASN B 2 138 ? 8.168   -62.518 -0.043  1.00 57.69 ? 138 ASN B O   1 
ATOM   1243 C  CB  . ASN B 2 138 ? 10.211  -62.087 1.895   1.00 49.47 ? 138 ASN B CB  1 
ATOM   1244 C  CG  . ASN B 2 138 ? 10.984  -62.500 3.133   1.00 56.24 ? 138 ASN B CG  1 
ATOM   1245 O  OD1 . ASN B 2 138 ? 10.740  -63.560 3.709   1.00 61.06 ? 138 ASN B OD1 1 
ATOM   1246 N  ND2 . ASN B 2 138 ? 11.918  -61.657 3.553   1.00 55.50 ? 138 ASN B ND2 1 
ATOM   1247 N  N   . SER B 2 139 ? 9.755   -62.829 -1.613  1.00 46.66 ? 139 SER B N   1 
ATOM   1248 C  CA  . SER B 2 139 ? 8.888   -62.441 -2.731  1.00 52.96 ? 139 SER B CA  1 
ATOM   1249 C  C   . SER B 2 139 ? 7.759   -63.436 -2.979  1.00 60.22 ? 139 SER B C   1 
ATOM   1250 O  O   . SER B 2 139 ? 7.875   -64.618 -2.649  1.00 59.42 ? 139 SER B O   1 
ATOM   1251 C  CB  . SER B 2 139 ? 9.701   -62.266 -4.012  1.00 50.41 ? 139 SER B CB  1 
ATOM   1252 O  OG  . SER B 2 139 ? 10.181  -63.516 -4.472  1.00 56.25 ? 139 SER B OG  1 
ATOM   1253 N  N   . GLN B 2 140 ? 6.672   -62.940 -3.565  1.00 63.68 ? 140 GLN B N   1 
ATOM   1254 C  CA  . GLN B 2 140 ? 5.548   -63.780 -3.969  1.00 61.74 ? 140 GLN B CA  1 
ATOM   1255 C  C   . GLN B 2 140 ? 5.071   -63.393 -5.371  1.00 62.43 ? 140 GLN B C   1 
ATOM   1256 O  O   . GLN B 2 140 ? 3.877   -63.458 -5.672  1.00 70.17 ? 140 GLN B O   1 
ATOM   1257 C  CB  . GLN B 2 140 ? 4.406   -63.674 -2.950  1.00 59.30 ? 140 GLN B CB  1 
ATOM   1258 N  N   . ASP B 2 141 ? 6.014   -62.995 -6.225  1.00 49.50 ? 141 ASP B N   1 
ATOM   1259 C  CA  . ASP B 2 141 ? 5.692   -62.553 -7.584  1.00 42.27 ? 141 ASP B CA  1 
ATOM   1260 C  C   . ASP B 2 141 ? 6.611   -63.162 -8.646  1.00 42.81 ? 141 ASP B C   1 
ATOM   1261 O  O   . ASP B 2 141 ? 7.398   -64.062 -8.353  1.00 51.79 ? 141 ASP B O   1 
ATOM   1262 C  CB  . ASP B 2 141 ? 5.671   -61.019 -7.674  1.00 47.56 ? 141 ASP B CB  1 
ATOM   1263 C  CG  . ASP B 2 141 ? 7.003   -60.382 -7.306  1.00 49.34 ? 141 ASP B CG  1 
ATOM   1264 O  OD1 . ASP B 2 141 ? 8.064   -60.970 -7.598  1.00 44.70 ? 141 ASP B OD1 1 
ATOM   1265 O  OD2 . ASP B 2 141 ? 6.983   -59.275 -6.734  1.00 47.41 ? 141 ASP B OD2 1 
ATOM   1266 N  N   . ASP B 2 142 ? 6.501   -62.659 -9.875  1.00 42.32 ? 142 ASP B N   1 
ATOM   1267 C  CA  . ASP B 2 142 ? 7.259   -63.182 -11.005 1.00 49.04 ? 142 ASP B CA  1 
ATOM   1268 C  C   . ASP B 2 142 ? 8.429   -62.276 -11.368 1.00 50.98 ? 142 ASP B C   1 
ATOM   1269 O  O   . ASP B 2 142 ? 8.876   -62.261 -12.518 1.00 47.25 ? 142 ASP B O   1 
ATOM   1270 C  CB  . ASP B 2 142 ? 6.344   -63.358 -12.219 1.00 50.81 ? 142 ASP B CB  1 
ATOM   1271 N  N   . TYR B 2 143 ? 8.931   -61.527 -10.390 1.00 46.26 ? 143 TYR B N   1 
ATOM   1272 C  CA  . TYR B 2 143 ? 9.981   -60.553 -10.671 1.00 45.16 ? 143 TYR B CA  1 
ATOM   1273 C  C   . TYR B 2 143 ? 11.340  -60.883 -10.066 1.00 42.74 ? 143 TYR B C   1 
ATOM   1274 O  O   . TYR B 2 143 ? 12.218  -60.023 -10.047 1.00 36.33 ? 143 TYR B O   1 
ATOM   1275 C  CB  . TYR B 2 143 ? 9.541   -59.139 -10.259 1.00 42.81 ? 143 TYR B CB  1 
ATOM   1276 C  CG  . TYR B 2 143 ? 8.304   -58.658 -10.985 1.00 41.47 ? 143 TYR B CG  1 
ATOM   1277 C  CD1 . TYR B 2 143 ? 8.275   -58.584 -12.378 1.00 37.90 ? 143 TYR B CD1 1 
ATOM   1278 C  CD2 . TYR B 2 143 ? 7.163   -58.277 -10.278 1.00 46.69 ? 143 TYR B CD2 1 
ATOM   1279 C  CE1 . TYR B 2 143 ? 7.139   -58.151 -13.050 1.00 43.95 ? 143 TYR B CE1 1 
ATOM   1280 C  CE2 . TYR B 2 143 ? 6.024   -57.839 -10.939 1.00 45.20 ? 143 TYR B CE2 1 
ATOM   1281 C  CZ  . TYR B 2 143 ? 6.018   -57.778 -12.323 1.00 45.12 ? 143 TYR B CZ  1 
ATOM   1282 O  OH  . TYR B 2 143 ? 4.888   -57.342 -12.983 1.00 54.26 ? 143 TYR B OH  1 
ATOM   1283 N  N   . ASP B 2 144 ? 11.528  -62.114 -9.590  1.00 41.02 ? 144 ASP B N   1 
ATOM   1284 C  CA  . ASP B 2 144 ? 12.785  -62.456 -8.921  1.00 40.30 ? 144 ASP B CA  1 
ATOM   1285 C  C   . ASP B 2 144 ? 14.014  -62.403 -9.823  1.00 34.01 ? 144 ASP B C   1 
ATOM   1286 O  O   . ASP B 2 144 ? 15.088  -62.020 -9.359  1.00 35.14 ? 144 ASP B O   1 
ATOM   1287 C  CB  . ASP B 2 144 ? 12.698  -63.787 -8.161  1.00 46.24 ? 144 ASP B CB  1 
ATOM   1288 C  CG  . ASP B 2 144 ? 12.329  -63.597 -6.692  1.00 49.43 ? 144 ASP B CG  1 
ATOM   1289 O  OD1 . ASP B 2 144 ? 12.207  -62.432 -6.235  1.00 45.08 ? 144 ASP B OD1 1 
ATOM   1290 O  OD2 . ASP B 2 144 ? 12.156  -64.613 -5.986  1.00 51.33 ? 144 ASP B OD2 1 
ATOM   1291 N  N   . GLU B 2 145 ? 13.869  -62.753 -11.101 1.00 30.73 ? 145 GLU B N   1 
ATOM   1292 C  CA  . GLU B 2 145 ? 15.011  -62.654 -12.020 1.00 33.65 ? 145 GLU B CA  1 
ATOM   1293 C  C   . GLU B 2 145 ? 15.405  -61.192 -12.267 1.00 33.94 ? 145 GLU B C   1 
ATOM   1294 O  O   . GLU B 2 145 ? 16.592  -60.866 -12.377 1.00 30.06 ? 145 GLU B O   1 
ATOM   1295 C  CB  . GLU B 2 145 ? 14.762  -63.398 -13.336 1.00 33.87 ? 145 GLU B CB  1 
ATOM   1296 C  CG  . GLU B 2 145 ? 14.673  -64.917 -13.176 1.00 32.96 ? 145 GLU B CG  1 
ATOM   1297 C  CD  . GLU B 2 145 ? 15.797  -65.490 -12.323 1.00 30.66 ? 145 GLU B CD  1 
ATOM   1298 O  OE1 . GLU B 2 145 ? 16.975  -65.370 -12.724 1.00 32.90 ? 145 GLU B OE1 1 
ATOM   1299 O  OE2 . GLU B 2 145 ? 15.504  -66.047 -11.244 1.00 32.49 ? 145 GLU B OE2 1 
ATOM   1300 N  N   . GLU B 2 146 ? 14.403  -60.321 -12.344 1.00 31.10 ? 146 GLU B N   1 
ATOM   1301 C  CA  . GLU B 2 146 ? 14.656  -58.883 -12.447 1.00 31.90 ? 146 GLU B CA  1 
ATOM   1302 C  C   . GLU B 2 146 ? 15.334  -58.342 -11.193 1.00 28.34 ? 146 GLU B C   1 
ATOM   1303 O  O   . GLU B 2 146 ? 16.257  -57.531 -11.298 1.00 30.52 ? 146 GLU B O   1 
ATOM   1304 C  CB  . GLU B 2 146 ? 13.360  -58.118 -12.730 1.00 30.68 ? 146 GLU B CB  1 
ATOM   1305 C  CG  . GLU B 2 146 ? 12.841  -58.319 -14.142 1.00 33.46 ? 146 GLU B CG  1 
ATOM   1306 C  CD  . GLU B 2 146 ? 11.955  -59.551 -14.305 1.00 39.46 ? 146 GLU B CD  1 
ATOM   1307 O  OE1 . GLU B 2 146 ? 11.836  -60.377 -13.373 1.00 37.65 ? 146 GLU B OE1 1 
ATOM   1308 O  OE2 . GLU B 2 146 ? 11.372  -59.693 -15.395 1.00 47.04 ? 146 GLU B OE2 1 
ATOM   1309 N  N   . ARG B 2 147 ? 14.884  -58.795 -10.021 1.00 29.19 ? 147 ARG B N   1 
ATOM   1310 C  CA  . ARG B 2 147 ? 15.517  -58.424 -8.749  1.00 31.55 ? 147 ARG B CA  1 
ATOM   1311 C  C   . ARG B 2 147 ? 16.952  -58.905 -8.651  1.00 30.32 ? 147 ARG B C   1 
ATOM   1312 O  O   . ARG B 2 147 ? 17.801  -58.216 -8.099  1.00 30.75 ? 147 ARG B O   1 
ATOM   1313 C  CB  . ARG B 2 147 ? 14.734  -58.968 -7.562  1.00 35.32 ? 147 ARG B CB  1 
ATOM   1314 C  CG  . ARG B 2 147 ? 13.623  -58.053 -7.132  1.00 33.91 ? 147 ARG B CG  1 
ATOM   1315 C  CD  . ARG B 2 147 ? 12.903  -58.537 -5.898  1.00 32.02 ? 147 ARG B CD  1 
ATOM   1316 N  NE  . ARG B 2 147 ? 11.581  -57.933 -5.904  1.00 37.27 ? 147 ARG B NE  1 
ATOM   1317 C  CZ  . ARG B 2 147 ? 10.482  -58.548 -6.330  1.00 43.11 ? 147 ARG B CZ  1 
ATOM   1318 N  NH1 . ARG B 2 147 ? 10.536  -59.807 -6.754  1.00 39.47 ? 147 ARG B NH1 1 
ATOM   1319 N  NH2 . ARG B 2 147 ? 9.327   -57.904 -6.317  1.00 43.43 ? 147 ARG B NH2 1 
ATOM   1320 N  N   . LYS B 2 148 ? 17.219  -60.098 -9.173  1.00 31.07 ? 148 LYS B N   1 
ATOM   1321 C  CA  . LYS B 2 148 ? 18.577  -60.612 -9.176  1.00 28.64 ? 148 LYS B CA  1 
ATOM   1322 C  C   . LYS B 2 148 ? 19.462  -59.802 -10.093 1.00 28.69 ? 148 LYS B C   1 
ATOM   1323 O  O   . LYS B 2 148 ? 20.646  -59.623 -9.801  1.00 29.33 ? 148 LYS B O   1 
ATOM   1324 C  CB  . LYS B 2 148 ? 18.616  -62.074 -9.611  1.00 29.32 ? 148 LYS B CB  1 
ATOM   1325 C  CG  . LYS B 2 148 ? 18.056  -63.050 -8.601  1.00 32.39 ? 148 LYS B CG  1 
ATOM   1326 C  CD  . LYS B 2 148 ? 17.992  -64.409 -9.293  1.00 34.75 ? 148 LYS B CD  1 
ATOM   1327 C  CE  . LYS B 2 148 ? 17.372  -65.475 -8.431  1.00 36.07 ? 148 LYS B CE  1 
ATOM   1328 N  NZ  . LYS B 2 148 ? 17.327  -66.735 -9.228  1.00 32.16 ? 148 LYS B NZ  1 
ATOM   1329 N  N   . THR B 2 149 ? 18.894  -59.332 -11.207 1.00 25.39 ? 149 THR B N   1 
ATOM   1330 C  CA  . THR B 2 149 ? 19.598  -58.436 -12.112 1.00 26.32 ? 149 THR B CA  1 
ATOM   1331 C  C   . THR B 2 149 ? 19.921  -57.120 -11.392 1.00 27.02 ? 149 THR B C   1 
ATOM   1332 O  O   . THR B 2 149 ? 21.031  -56.606 -11.528 1.00 28.22 ? 149 THR B O   1 
ATOM   1333 C  CB  . THR B 2 149 ? 18.807  -58.182 -13.409 1.00 28.17 ? 149 THR B CB  1 
ATOM   1334 O  OG1 . THR B 2 149 ? 18.617  -59.426 -14.091 1.00 32.59 ? 149 THR B OG1 1 
ATOM   1335 C  CG2 . THR B 2 149 ? 19.558  -57.229 -14.336 1.00 31.02 ? 149 THR B CG2 1 
ATOM   1336 N  N   . ASN B 2 150 ? 18.959  -56.594 -10.632 1.00 25.65 ? 150 ASN B N   1 
ATOM   1337 C  CA  . ASN B 2 150 ? 19.201  -55.394 -9.807  1.00 25.31 ? 150 ASN B CA  1 
ATOM   1338 C  C   . ASN B 2 150 ? 20.315  -55.614 -8.787  1.00 26.62 ? 150 ASN B C   1 
ATOM   1339 O  O   . ASN B 2 150 ? 21.209  -54.776 -8.660  1.00 27.60 ? 150 ASN B O   1 
ATOM   1340 C  CB  . ASN B 2 150 ? 17.919  -54.910 -9.114  1.00 25.05 ? 150 ASN B CB  1 
ATOM   1341 C  CG  . ASN B 2 150 ? 16.962  -54.222 -10.082 1.00 24.59 ? 150 ASN B CG  1 
ATOM   1342 O  OD1 . ASN B 2 150 ? 17.128  -54.307 -11.300 1.00 25.05 ? 150 ASN B OD1 1 
ATOM   1343 N  ND2 . ASN B 2 150 ? 15.962  -53.540 -9.546  1.00 25.31 ? 150 ASN B ND2 1 
ATOM   1344 N  N   . LEU B 2 151 ? 20.260  -56.744 -8.083  1.00 26.30 ? 151 LEU B N   1 
ATOM   1345 C  CA  . LEU B 2 151 ? 21.331  -57.145 -7.157  1.00 29.02 ? 151 LEU B CA  1 
ATOM   1346 C  C   . LEU B 2 151 ? 22.691  -57.117 -7.841  1.00 29.30 ? 151 LEU B C   1 
ATOM   1347 O  O   . LEU B 2 151 ? 23.643  -56.525 -7.320  1.00 32.05 ? 151 LEU B O   1 
ATOM   1348 C  CB  . LEU B 2 151 ? 21.076  -58.550 -6.589  1.00 30.81 ? 151 LEU B CB  1 
ATOM   1349 C  CG  . LEU B 2 151 ? 20.329  -58.735 -5.275  1.00 34.42 ? 151 LEU B CG  1 
ATOM   1350 C  CD1 . LEU B 2 151 ? 20.206  -60.215 -4.951  1.00 33.63 ? 151 LEU B CD1 1 
ATOM   1351 C  CD2 . LEU B 2 151 ? 21.013  -58.003 -4.129  1.00 32.92 ? 151 LEU B CD2 1 
ATOM   1352 N  N   . SER B 2 152 ? 22.781  -57.744 -9.016  1.00 26.23 ? 152 SER B N   1 
ATOM   1353 C  CA  . SER B 2 152 ? 24.039  -57.777 -9.766  1.00 28.59 ? 152 SER B CA  1 
ATOM   1354 C  C   . SER B 2 152 ? 24.504  -56.391 -10.213 1.00 30.09 ? 152 SER B C   1 
ATOM   1355 O  O   . SER B 2 152 ? 25.701  -56.114 -10.226 1.00 30.35 ? 152 SER B O   1 
ATOM   1356 C  CB  . SER B 2 152 ? 23.938  -58.722 -10.963 1.00 30.74 ? 152 SER B CB  1 
ATOM   1357 O  OG  . SER B 2 152 ? 23.822  -60.052 -10.497 1.00 32.49 ? 152 SER B OG  1 
ATOM   1358 N  N   . ALA B 2 153 ? 23.555  -55.530 -10.575 1.00 28.82 ? 153 ALA B N   1 
ATOM   1359 C  CA  . ALA B 2 153 ? 23.869  -54.154 -10.955 1.00 28.39 ? 153 ALA B CA  1 
ATOM   1360 C  C   . ALA B 2 153 ? 24.461  -53.380 -9.774  1.00 28.84 ? 153 ALA B C   1 
ATOM   1361 O  O   . ALA B 2 153 ? 25.396  -52.583 -9.958  1.00 30.78 ? 153 ALA B O   1 
ATOM   1362 C  CB  . ALA B 2 153 ? 22.629  -53.447 -11.490 1.00 28.51 ? 153 ALA B CB  1 
ATOM   1363 N  N   . VAL B 2 154 ? 23.925  -53.622 -8.576  1.00 25.41 ? 154 VAL B N   1 
ATOM   1364 C  CA  . VAL B 2 154 ? 24.417  -52.953 -7.357  1.00 28.00 ? 154 VAL B CA  1 
ATOM   1365 C  C   . VAL B 2 154 ? 25.867  -53.366 -7.087  1.00 30.91 ? 154 VAL B C   1 
ATOM   1366 O  O   . VAL B 2 154 ? 26.718  -52.512 -6.847  1.00 30.01 ? 154 VAL B O   1 
ATOM   1367 C  CB  . VAL B 2 154 ? 23.533  -53.225 -6.115  1.00 27.99 ? 154 VAL B CB  1 
ATOM   1368 C  CG1 . VAL B 2 154 ? 24.129  -52.569 -4.869  1.00 30.26 ? 154 VAL B CG1 1 
ATOM   1369 C  CG2 . VAL B 2 154 ? 22.105  -52.729 -6.332  1.00 29.89 ? 154 VAL B CG2 1 
ATOM   1370 N  N   . VAL B 2 155 ? 26.150  -54.667 -7.158  1.00 30.27 ? 155 VAL B N   1 
ATOM   1371 C  CA  . VAL B 2 155 ? 27.520  -55.171 -6.960  1.00 29.61 ? 155 VAL B CA  1 
ATOM   1372 C  C   . VAL B 2 155 ? 28.481  -54.632 -8.019  1.00 31.22 ? 155 VAL B C   1 
ATOM   1373 O  O   . VAL B 2 155 ? 29.634  -54.305 -7.702  1.00 35.08 ? 155 VAL B O   1 
ATOM   1374 C  CB  . VAL B 2 155 ? 27.568  -56.719 -6.900  1.00 31.29 ? 155 VAL B CB  1 
ATOM   1375 C  CG1 . VAL B 2 155 ? 28.998  -57.218 -6.732  1.00 33.87 ? 155 VAL B CG1 1 
ATOM   1376 C  CG2 . VAL B 2 155 ? 26.712  -57.221 -5.755  1.00 30.63 ? 155 VAL B CG2 1 
ATOM   1377 N  N   . ALA B 2 156 ? 28.010  -54.526 -9.263  1.00 29.50 ? 156 ALA B N   1 
ATOM   1378 C  CA  . ALA B 2 156 ? 28.808  -53.936 -10.340 1.00 33.67 ? 156 ALA B CA  1 
ATOM   1379 C  C   . ALA B 2 156 ? 29.164  -52.484 -10.012 1.00 35.11 ? 156 ALA B C   1 
ATOM   1380 O  O   . ALA B 2 156 ? 30.297  -52.059 -10.226 1.00 35.91 ? 156 ALA B O   1 
ATOM   1381 C  CB  . ALA B 2 156 ? 28.079  -54.022 -11.673 1.00 34.90 ? 156 ALA B CB  1 
ATOM   1382 N  N   . ALA B 2 157 ? 28.197  -51.735 -9.485  1.00 33.42 ? 157 ALA B N   1 
ATOM   1383 C  CA  . ALA B 2 157 ? 28.431  -50.340 -9.098  1.00 33.14 ? 157 ALA B CA  1 
ATOM   1384 C  C   . ALA B 2 157 ? 29.465  -50.226 -7.975  1.00 36.57 ? 157 ALA B C   1 
ATOM   1385 O  O   . ALA B 2 157 ? 30.293  -49.311 -7.983  1.00 39.80 ? 157 ALA B O   1 
ATOM   1386 C  CB  . ALA B 2 157 ? 27.125  -49.661 -8.713  1.00 32.30 ? 157 ALA B CB  1 
ATOM   1387 N  N   . GLN B 2 158 ? 29.423  -51.160 -7.025  1.00 34.68 ? 158 GLN B N   1 
ATOM   1388 C  CA  . GLN B 2 158 ? 30.417  -51.223 -5.947  1.00 37.07 ? 158 GLN B CA  1 
ATOM   1389 C  C   . GLN B 2 158 ? 31.826  -51.549 -6.440  1.00 42.96 ? 158 GLN B C   1 
ATOM   1390 O  O   . GLN B 2 158 ? 32.800  -51.009 -5.914  1.00 42.65 ? 158 GLN B O   1 
ATOM   1391 C  CB  . GLN B 2 158 ? 30.043  -52.286 -4.918  1.00 31.99 ? 158 GLN B CB  1 
ATOM   1392 C  CG  . GLN B 2 158 ? 28.761  -52.036 -4.155  1.00 30.98 ? 158 GLN B CG  1 
ATOM   1393 C  CD  . GLN B 2 158 ? 28.527  -53.115 -3.129  1.00 31.79 ? 158 GLN B CD  1 
ATOM   1394 O  OE1 . GLN B 2 158 ? 28.420  -54.292 -3.474  1.00 38.97 ? 158 GLN B OE1 1 
ATOM   1395 N  NE2 . GLN B 2 158 ? 28.456  -52.730 -1.862  1.00 32.45 ? 158 GLN B NE2 1 
ATOM   1396 N  N   . SER B 2 159 ? 31.912  -52.452 -7.424  1.00 45.62 ? 159 SER B N   1 
ATOM   1397 C  CA  A SER B 2 159 ? 33.186  -52.936 -7.971  0.50 48.41 ? 159 SER B CA  1 
ATOM   1398 C  CA  B SER B 2 159 ? 33.196  -52.929 -7.940  0.50 48.95 ? 159 SER B CA  1 
ATOM   1399 C  C   . SER B 2 159 ? 34.000  -51.811 -8.594  1.00 48.36 ? 159 SER B C   1 
ATOM   1400 O  O   . SER B 2 159 ? 35.233  -51.856 -8.605  1.00 53.51 ? 159 SER B O   1 
ATOM   1401 C  CB  A SER B 2 159 ? 32.939  -54.019 -9.024  0.50 48.94 ? 159 SER B CB  1 
ATOM   1402 C  CB  B SER B 2 159 ? 32.988  -54.084 -8.921  0.50 49.92 ? 159 SER B CB  1 
ATOM   1403 O  OG  A SER B 2 159 ? 32.540  -53.445 -10.259 0.50 45.59 ? 159 SER B OG  1 
ATOM   1404 O  OG  B SER B 2 159 ? 32.422  -55.203 -8.262  0.50 52.34 ? 159 SER B OG  1 
ATOM   1405 N  N   . ASN B 2 160 ? 33.296  -50.817 -9.133  1.00 45.83 ? 160 ASN B N   1 
ATOM   1406 C  CA  . ASN B 2 160 ? 33.912  -49.618 -9.688  1.00 54.96 ? 160 ASN B CA  1 
ATOM   1407 C  C   . ASN B 2 160 ? 34.850  -48.936 -8.689  1.00 57.21 ? 160 ASN B C   1 
ATOM   1408 O  O   . ASN B 2 160 ? 35.849  -48.325 -9.077  1.00 65.06 ? 160 ASN B O   1 
ATOM   1409 C  CB  . ASN B 2 160 ? 32.822  -48.651 -10.173 1.00 56.56 ? 160 ASN B CB  1 
ATOM   1410 C  CG  . ASN B 2 160 ? 33.076  -47.210 -9.760  1.00 58.14 ? 160 ASN B CG  1 
ATOM   1411 O  OD1 . ASN B 2 160 ? 33.932  -46.523 -10.323 1.00 64.73 ? 160 ASN B OD1 1 
ATOM   1412 N  N   . TRP B 2 161 ? 34.528  -49.067 -7.404  1.00 54.00 ? 161 TRP B N   1 
ATOM   1413 C  CA  . TRP B 2 161 ? 35.259  -48.376 -6.346  1.00 50.67 ? 161 TRP B CA  1 
ATOM   1414 C  C   . TRP B 2 161 ? 36.454  -49.113 -5.801  1.00 57.87 ? 161 TRP B C   1 
ATOM   1415 O  O   . TRP B 2 161 ? 37.317  -48.506 -5.166  1.00 62.92 ? 161 TRP B O   1 
ATOM   1416 C  CB  . TRP B 2 161 ? 34.304  -47.937 -5.235  1.00 40.85 ? 161 TRP B CB  1 
ATOM   1417 C  CG  . TRP B 2 161 ? 33.322  -46.893 -5.716  1.00 38.34 ? 161 TRP B CG  1 
ATOM   1418 C  CD1 . TRP B 2 161 ? 31.929  -46.969 -5.729  1.00 38.07 ? 161 TRP B CD1 1 
ATOM   1419 C  CD2 . TRP B 2 161 ? 33.638  -45.589 -6.316  1.00 37.94 ? 161 TRP B CD2 1 
ATOM   1420 N  NE1 . TRP B 2 161 ? 31.380  -45.833 -6.264  1.00 37.08 ? 161 TRP B NE1 1 
ATOM   1421 C  CE2 . TRP B 2 161 ? 32.351  -44.963 -6.636  1.00 38.29 ? 161 TRP B CE2 1 
ATOM   1422 C  CE3 . TRP B 2 161 ? 34.816  -44.899 -6.599  1.00 34.43 ? 161 TRP B CE3 1 
ATOM   1423 C  CZ2 . TRP B 2 161 ? 32.270  -43.707 -7.217  1.00 38.99 ? 161 TRP B CZ2 1 
ATOM   1424 C  CZ3 . TRP B 2 161 ? 34.719  -43.633 -7.183  1.00 34.33 ? 161 TRP B CZ3 1 
ATOM   1425 C  CH2 . TRP B 2 161 ? 33.478  -43.053 -7.484  1.00 38.76 ? 161 TRP B CH2 1 
ATOM   1426 N  N   . GLU B 2 162 ? 36.528  -50.419 -6.050  1.00 60.78 ? 162 GLU B N   1 
ATOM   1427 C  CA  . GLU B 2 162 ? 37.691  -51.211 -5.637  1.00 58.77 ? 162 GLU B CA  1 
ATOM   1428 C  C   . GLU B 2 162 ? 38.515  -51.684 -6.830  1.00 45.59 ? 162 GLU B C   1 
ATOM   1429 O  O   . GLU B 2 162 ? 39.099  -50.869 -7.549  1.00 66.05 ? 162 GLU B O   1 
ATOM   1430 C  CB  . GLU B 2 162 ? 37.280  -52.391 -4.747  1.00 67.14 ? 162 GLU B CB  1 
ATOM   1431 C  CG  . GLU B 2 162 ? 36.260  -53.341 -5.357  1.00 71.00 ? 162 GLU B CG  1 
ATOM   1432 C  CD  . GLU B 2 162 ? 35.753  -54.371 -4.363  1.00 84.46 ? 162 GLU B CD  1 
ATOM   1433 O  OE1 . GLU B 2 162 ? 36.568  -54.904 -3.577  1.00 85.84 ? 162 GLU B OE1 1 
ATOM   1434 O  OE2 . GLU B 2 162 ? 34.534  -54.652 -4.371  1.00 94.47 ? 162 GLU B OE2 1 
HETATM 1435 C  C   . ACT C 3 .   ? -13.466 -43.539 1.192   1.00 48.08 ? 701 ACT A C   1 
HETATM 1436 O  O   . ACT C 3 .   ? -12.771 -44.019 0.274   1.00 42.51 ? 701 ACT A O   1 
HETATM 1437 O  OXT . ACT C 3 .   ? -14.206 -44.265 1.884   1.00 61.59 ? 701 ACT A OXT 1 
HETATM 1438 C  CH3 . ACT C 3 .   ? -13.421 -42.063 1.467   1.00 39.25 ? 701 ACT A CH3 1 
HETATM 1439 C  C1  . GOL D 4 .   ? 9.062   -52.587 -14.644 1.00 43.34 ? 702 GOL A C1  1 
HETATM 1440 O  O1  . GOL D 4 .   ? 9.349   -51.247 -15.077 1.00 36.39 ? 702 GOL A O1  1 
HETATM 1441 C  C2  . GOL D 4 .   ? 9.714   -53.634 -15.549 1.00 55.44 ? 702 GOL A C2  1 
HETATM 1442 O  O2  . GOL D 4 .   ? 11.122  -53.403 -15.640 1.00 60.26 ? 702 GOL A O2  1 
HETATM 1443 C  C3  . GOL D 4 .   ? 9.443   -55.042 -15.027 1.00 53.11 ? 702 GOL A C3  1 
HETATM 1444 O  O3  . GOL D 4 .   ? 9.595   -56.001 -16.080 1.00 67.50 ? 702 GOL A O3  1 
HETATM 1445 S  S   . SO4 E 5 .   ? 0.928   -44.143 4.762   1.00 45.74 ? 201 SO4 B S   1 
HETATM 1446 O  O1  . SO4 E 5 .   ? 1.001   -44.212 3.286   1.00 47.43 ? 201 SO4 B O1  1 
HETATM 1447 O  O2  . SO4 E 5 .   ? -0.452  -43.782 5.164   1.00 44.64 ? 201 SO4 B O2  1 
HETATM 1448 O  O3  . SO4 E 5 .   ? 1.299   -45.454 5.333   1.00 45.75 ? 201 SO4 B O3  1 
HETATM 1449 O  O4  . SO4 E 5 .   ? 1.853   -43.092 5.240   1.00 48.22 ? 201 SO4 B O4  1 
HETATM 1450 S  S   . SO4 F 5 .   ? 2.552   -33.478 -15.544 0.70 45.66 ? 202 SO4 B S   1 
HETATM 1451 O  O1  . SO4 F 5 .   ? 3.806   -33.994 -16.123 0.70 40.83 ? 202 SO4 B O1  1 
HETATM 1452 O  O2  . SO4 F 5 .   ? 1.438   -33.749 -16.487 0.70 51.63 ? 202 SO4 B O2  1 
HETATM 1453 O  O3  . SO4 F 5 .   ? 2.265   -34.130 -14.263 0.70 31.53 ? 202 SO4 B O3  1 
HETATM 1454 O  O4  . SO4 F 5 .   ? 2.680   -32.018 -15.331 0.70 53.52 ? 202 SO4 B O4  1 
HETATM 1455 NA NA  . NA  G 6 .   ? 13.270  -52.844 -7.448  1.00 36.55 ? 203 NA  B NA  1 
HETATM 1456 C  C   . ACT H 3 .   ? 4.023   -50.308 -16.737 0.60 44.97 ? 204 ACT B C   1 
HETATM 1457 O  O   . ACT H 3 .   ? 3.562   -49.138 -16.793 1.00 35.29 ? 204 ACT B O   1 
HETATM 1458 O  OXT . ACT H 3 .   ? 3.347   -51.267 -16.307 0.60 53.31 ? 204 ACT B OXT 1 
HETATM 1459 C  CH3 . ACT H 3 .   ? 5.427   -50.587 -17.198 1.00 42.20 ? 204 ACT B CH3 1 
HETATM 1460 C  C1  . GOL I 4 .   ? 11.596  -49.978 5.205   1.00 64.57 ? 205 GOL B C1  1 
HETATM 1461 O  O1  . GOL I 4 .   ? 11.585  -50.233 3.792   1.00 63.48 ? 205 GOL B O1  1 
HETATM 1462 C  C2  . GOL I 4 .   ? 12.502  -48.785 5.485   1.00 64.20 ? 205 GOL B C2  1 
HETATM 1463 O  O2  . GOL I 4 .   ? 11.882  -47.594 4.990   1.00 65.63 ? 205 GOL B O2  1 
HETATM 1464 C  C3  . GOL I 4 .   ? 12.732  -48.634 6.982   1.00 69.18 ? 205 GOL B C3  1 
HETATM 1465 O  O3  . GOL I 4 .   ? 13.230  -47.314 7.235   1.00 70.85 ? 205 GOL B O3  1 
HETATM 1466 C  C1  . GOL J 4 .   ? -6.509  -52.534 -10.832 0.80 41.23 ? 206 GOL B C1  1 
HETATM 1467 O  O1  . GOL J 4 .   ? -7.110  -52.201 -12.082 0.80 36.32 ? 206 GOL B O1  1 
HETATM 1468 C  C2  . GOL J 4 .   ? -5.033  -52.832 -11.031 0.80 45.09 ? 206 GOL B C2  1 
HETATM 1469 O  O2  . GOL J 4 .   ? -4.880  -54.147 -11.567 0.80 53.53 ? 206 GOL B O2  1 
HETATM 1470 C  C3  . GOL J 4 .   ? -4.459  -51.794 -11.983 0.80 43.94 ? 206 GOL B C3  1 
HETATM 1471 O  O3  . GOL J 4 .   ? -4.469  -50.538 -11.310 0.80 26.87 ? 206 GOL B O3  1 
HETATM 1472 C  C1  . GOL K 4 .   ? 14.187  -41.688 -15.512 1.00 56.29 ? 207 GOL B C1  1 
HETATM 1473 O  O1  . GOL K 4 .   ? 13.887  -41.874 -16.903 1.00 55.13 ? 207 GOL B O1  1 
HETATM 1474 C  C2  . GOL K 4 .   ? 15.190  -42.724 -15.012 1.00 57.44 ? 207 GOL B C2  1 
HETATM 1475 O  O2  . GOL K 4 .   ? 15.701  -43.467 -16.123 1.00 60.41 ? 207 GOL B O2  1 
HETATM 1476 C  C3  . GOL K 4 .   ? 14.543  -43.706 -14.039 1.00 50.63 ? 207 GOL B C3  1 
HETATM 1477 O  O3  . GOL K 4 .   ? 14.066  -43.070 -12.846 1.00 49.99 ? 207 GOL B O3  1 
HETATM 1478 C  C1  . GOL L 4 .   ? -17.383 -55.264 -12.504 1.00 44.59 ? 208 GOL B C1  1 
HETATM 1479 O  O1  . GOL L 4 .   ? -18.193 -54.185 -12.045 1.00 43.86 ? 208 GOL B O1  1 
HETATM 1480 C  C2  . GOL L 4 .   ? -16.682 -54.843 -13.787 1.00 45.65 ? 208 GOL B C2  1 
HETATM 1481 O  O2  . GOL L 4 .   ? -15.761 -53.789 -13.491 1.00 32.40 ? 208 GOL B O2  1 
HETATM 1482 C  C3  . GOL L 4 .   ? -15.939 -56.048 -14.352 1.00 45.95 ? 208 GOL B C3  1 
HETATM 1483 O  O3  . GOL L 4 .   ? -15.254 -55.643 -15.540 1.00 52.43 ? 208 GOL B O3  1 
HETATM 1484 O  O   . HOH M 7 .   ? -20.168 -46.628 -4.827  1.00 41.61 ? 801 HOH A O   1 
HETATM 1485 O  O   . HOH M 7 .   ? 2.545   -55.663 -7.951  1.00 50.99 ? 802 HOH A O   1 
HETATM 1486 O  O   . HOH M 7 .   ? -5.483  -53.456 -8.145  1.00 42.56 ? 803 HOH A O   1 
HETATM 1487 O  O   . HOH M 7 .   ? -9.581  -50.046 -0.917  1.00 37.66 ? 804 HOH A O   1 
HETATM 1488 O  O   . HOH M 7 .   ? -10.136 -56.436 -4.988  1.00 42.89 ? 805 HOH A O   1 
HETATM 1489 O  O   . HOH M 7 .   ? 2.485   -50.811 -13.689 1.00 32.05 ? 806 HOH A O   1 
HETATM 1490 O  O   . HOH M 7 .   ? -1.519  -51.324 -12.159 1.00 41.08 ? 807 HOH A O   1 
HETATM 1491 O  O   . HOH M 7 .   ? -13.236 -50.333 -2.274  1.00 40.12 ? 808 HOH A O   1 
HETATM 1492 O  O   . HOH M 7 .   ? -8.320  -52.934 -7.580  1.00 28.16 ? 809 HOH A O   1 
HETATM 1493 O  O   . HOH M 7 .   ? -2.931  -49.546 -4.057  1.00 45.34 ? 810 HOH A O   1 
HETATM 1494 O  O   . HOH M 7 .   ? 0.217   -54.453 -9.762  1.00 50.07 ? 811 HOH A O   1 
HETATM 1495 O  O   . HOH M 7 .   ? -25.652 -50.920 -2.415  1.00 48.81 ? 812 HOH A O   1 
HETATM 1496 O  O   . HOH M 7 .   ? -10.527 -54.480 -6.791  1.00 30.94 ? 813 HOH A O   1 
HETATM 1497 O  O   . HOH M 7 .   ? 16.514  -47.857 -13.819 1.00 57.32 ? 814 HOH A O   1 
HETATM 1498 O  O   . HOH M 7 .   ? 19.443  -49.686 -16.204 1.00 53.12 ? 815 HOH A O   1 
HETATM 1499 O  O   . HOH M 7 .   ? 25.363  -51.330 -14.433 1.00 76.43 ? 816 HOH A O   1 
HETATM 1500 O  O   . HOH M 7 .   ? 24.609  -49.911 -17.333 1.00 59.04 ? 817 HOH A O   1 
HETATM 1501 O  O   . HOH M 7 .   ? -4.032  -53.104 -4.336  1.00 57.24 ? 818 HOH A O   1 
HETATM 1502 O  O   . HOH M 7 .   ? -12.718 -52.779 -1.086  1.00 48.36 ? 819 HOH A O   1 
HETATM 1503 O  O   . HOH M 7 .   ? -18.324 -46.040 -0.634  1.00 71.19 ? 820 HOH A O   1 
HETATM 1504 O  O   . HOH M 7 .   ? -16.136 -47.864 0.675   1.00 58.64 ? 821 HOH A O   1 
HETATM 1505 O  O   . HOH M 7 .   ? 2.604   -54.723 -4.105  1.00 55.07 ? 822 HOH A O   1 
HETATM 1506 O  O   . HOH M 7 .   ? -10.818 -52.310 1.200   1.00 78.08 ? 823 HOH A O   1 
HETATM 1507 O  O   . HOH M 7 .   ? 21.449  -57.294 -17.951 1.00 61.92 ? 824 HOH A O   1 
HETATM 1508 O  O   . HOH M 7 .   ? 19.445  -47.255 -13.676 1.00 55.88 ? 825 HOH A O   1 
HETATM 1509 O  O   . HOH M 7 .   ? 27.080  -51.667 -17.490 1.00 62.38 ? 826 HOH A O   1 
HETATM 1510 O  O   . HOH M 7 .   ? -3.785  -51.131 -1.920  1.00 57.00 ? 827 HOH A O   1 
HETATM 1511 O  O   . HOH M 7 .   ? -7.034  -55.489 -6.739  1.00 56.14 ? 828 HOH A O   1 
HETATM 1512 O  O   . HOH M 7 .   ? 23.338  -56.199 -20.001 0.50 73.91 ? 829 HOH A O   1 
HETATM 1513 O  O   . HOH M 7 .   ? -24.889 -45.872 -3.860  1.00 59.90 ? 830 HOH A O   1 
HETATM 1514 O  O   . HOH M 7 .   ? 24.439  -47.091 -17.005 1.00 70.92 ? 831 HOH A O   1 
HETATM 1515 O  O   . HOH M 7 .   ? 27.022  -48.476 -16.476 1.00 75.02 ? 832 HOH A O   1 
HETATM 1516 O  O   . HOH M 7 .   ? 26.226  -52.410 -21.959 1.00 65.74 ? 833 HOH A O   1 
HETATM 1517 O  O   . HOH M 7 .   ? 29.763  -51.089 -18.283 1.00 70.88 ? 834 HOH A O   1 
HETATM 1518 O  O   . HOH M 7 .   ? 28.958  -48.203 -18.517 1.00 73.57 ? 835 HOH A O   1 
HETATM 1519 O  O   . HOH N 7 .   ? -0.457  -47.139 -1.646  1.00 46.64 ? 301 HOH B O   1 
HETATM 1520 O  O   . HOH N 7 .   ? 16.794  -46.346 -8.914  1.00 38.64 ? 302 HOH B O   1 
HETATM 1521 O  O   . HOH N 7 .   ? 14.231  -40.896 -11.591 1.00 48.10 ? 303 HOH B O   1 
HETATM 1522 O  O   . HOH N 7 .   ? -0.329  -48.325 -5.844  1.00 30.84 ? 304 HOH B O   1 
HETATM 1523 O  O   . HOH N 7 .   ? 5.480   -34.992 -14.441 1.00 38.04 ? 305 HOH B O   1 
HETATM 1524 O  O   . HOH N 7 .   ? -7.317  -44.607 -23.490 1.00 26.19 ? 306 HOH B O   1 
HETATM 1525 O  O   . HOH N 7 .   ? 14.580  -46.685 -12.016 1.00 47.68 ? 307 HOH B O   1 
HETATM 1526 O  O   . HOH N 7 .   ? 2.530   -48.974 0.341   1.00 43.25 ? 308 HOH B O   1 
HETATM 1527 O  O   . HOH N 7 .   ? 25.337  -50.608 -11.677 1.00 47.33 ? 309 HOH B O   1 
HETATM 1528 O  O   . HOH N 7 .   ? -16.105 -36.335 -0.748  1.00 52.78 ? 310 HOH B O   1 
HETATM 1529 O  O   . HOH N 7 .   ? 21.941  -48.534 -13.560 1.00 39.20 ? 311 HOH B O   1 
HETATM 1530 O  O   . HOH N 7 .   ? 9.054   -61.265 -14.945 1.00 51.69 ? 312 HOH B O   1 
HETATM 1531 O  O   . HOH N 7 .   ? 18.427  -42.401 5.619   1.00 49.90 ? 313 HOH B O   1 
HETATM 1532 O  O   . HOH N 7 .   ? -1.616  -49.300 -19.619 1.00 32.21 ? 314 HOH B O   1 
HETATM 1533 O  O   . HOH N 7 .   ? 31.870  -55.346 -5.657  1.00 65.00 ? 315 HOH B O   1 
HETATM 1534 O  O   . HOH N 7 .   ? 1.694   -47.401 3.554   1.00 51.06 ? 316 HOH B O   1 
HETATM 1535 O  O   . HOH N 7 .   ? 8.296   -64.941 -5.716  1.00 61.66 ? 317 HOH B O   1 
HETATM 1536 O  O   . HOH N 7 .   ? -14.270 -36.605 -16.268 1.00 34.34 ? 318 HOH B O   1 
HETATM 1537 O  O   . HOH N 7 .   ? -10.575 -49.676 -22.867 1.00 30.01 ? 319 HOH B O   1 
HETATM 1538 O  O   . HOH N 7 .   ? 27.086  -48.405 1.131   1.00 28.56 ? 320 HOH B O   1 
HETATM 1539 O  O   . HOH N 7 .   ? 19.094  -63.859 1.194   1.00 54.87 ? 321 HOH B O   1 
HETATM 1540 O  O   . HOH N 7 .   ? -9.277  -47.241 -0.629  1.00 38.39 ? 322 HOH B O   1 
HETATM 1541 O  O   . HOH N 7 .   ? 28.871  -45.122 -7.607  1.00 45.66 ? 323 HOH B O   1 
HETATM 1542 O  O   . HOH N 7 .   ? 6.778   -37.527 -17.400 1.00 35.15 ? 324 HOH B O   1 
HETATM 1543 O  O   . HOH N 7 .   ? -11.802 -51.743 -21.262 1.00 47.28 ? 325 HOH B O   1 
HETATM 1544 O  O   . HOH N 7 .   ? -0.661  -49.553 -2.538  1.00 49.13 ? 326 HOH B O   1 
HETATM 1545 O  O   . HOH N 7 .   ? 24.895  -55.547 2.511   1.00 39.67 ? 327 HOH B O   1 
HETATM 1546 O  O   . HOH N 7 .   ? -3.920  -53.201 -15.208 1.00 34.57 ? 328 HOH B O   1 
HETATM 1547 O  O   . HOH N 7 .   ? 0.221   -47.751 -18.235 1.00 25.65 ? 329 HOH B O   1 
HETATM 1548 O  O   . HOH N 7 .   ? 5.325   -40.329 4.332   1.00 38.76 ? 330 HOH B O   1 
HETATM 1549 O  O   . HOH N 7 .   ? 22.774  -46.834 3.950   1.00 28.81 ? 331 HOH B O   1 
HETATM 1550 O  O   . HOH N 7 .   ? -16.207 -44.113 -20.335 1.00 52.03 ? 332 HOH B O   1 
HETATM 1551 O  O   . HOH N 7 .   ? -11.295 -55.261 -17.617 1.00 41.23 ? 333 HOH B O   1 
HETATM 1552 O  O   . HOH N 7 .   ? -12.969 -56.011 -19.869 1.00 47.22 ? 334 HOH B O   1 
HETATM 1553 O  O   . HOH N 7 .   ? -14.577 -36.534 -23.565 1.00 68.86 ? 335 HOH B O   1 
HETATM 1554 O  O   . HOH N 7 .   ? -6.882  -45.936 -0.699  1.00 43.15 ? 336 HOH B O   1 
HETATM 1555 O  O   . HOH N 7 .   ? 4.562   -50.648 9.328   1.00 60.29 ? 337 HOH B O   1 
HETATM 1556 O  O   . HOH N 7 .   ? 18.983  -58.826 3.953   1.00 46.29 ? 338 HOH B O   1 
HETATM 1557 O  O   . HOH N 7 .   ? -17.249 -40.840 -0.759  1.00 52.33 ? 339 HOH B O   1 
HETATM 1558 O  O   . HOH N 7 .   ? -19.833 -36.339 -12.240 1.00 47.63 ? 340 HOH B O   1 
HETATM 1559 O  O   . HOH N 7 .   ? -4.498  -43.965 -23.508 1.00 26.47 ? 341 HOH B O   1 
HETATM 1560 O  O   . HOH N 7 .   ? -8.255  -58.534 -15.239 1.00 53.90 ? 342 HOH B O   1 
HETATM 1561 O  O   . HOH N 7 .   ? 6.193   -30.420 -7.893  1.00 57.42 ? 343 HOH B O   1 
HETATM 1562 O  O   . HOH N 7 .   ? -3.808  -35.495 -16.855 1.00 50.94 ? 344 HOH B O   1 
HETATM 1563 O  O   . HOH N 7 .   ? 1.667   -37.381 -19.167 0.50 31.18 ? 345 HOH B O   1 
HETATM 1564 O  O   . HOH N 7 .   ? 11.878  -40.383 -14.116 1.00 37.92 ? 346 HOH B O   1 
HETATM 1565 O  O   . HOH N 7 .   ? -8.491  -38.946 -19.063 1.00 30.48 ? 347 HOH B O   1 
HETATM 1566 O  O   . HOH N 7 .   ? -2.326  -37.744 -17.441 1.00 50.49 ? 348 HOH B O   1 
HETATM 1567 O  O   . HOH N 7 .   ? -9.275  -52.529 -10.195 1.00 29.49 ? 349 HOH B O   1 
HETATM 1568 O  O   . HOH N 7 .   ? -13.140 -33.999 -10.750 1.00 42.49 ? 350 HOH B O   1 
HETATM 1569 O  O   . HOH N 7 .   ? 6.382   -33.596 -2.380  1.00 47.07 ? 351 HOH B O   1 
HETATM 1570 O  O   . HOH N 7 .   ? 17.126  -51.353 5.609   1.00 40.78 ? 352 HOH B O   1 
HETATM 1571 O  O   . HOH N 7 .   ? 14.521  -66.083 -6.375  1.00 54.27 ? 353 HOH B O   1 
HETATM 1572 O  O   . HOH N 7 .   ? -3.799  -38.944 -19.170 1.00 41.57 ? 354 HOH B O   1 
HETATM 1573 O  O   . HOH N 7 .   ? 3.483   -31.259 -8.100  1.00 49.12 ? 355 HOH B O   1 
HETATM 1574 O  O   . HOH N 7 .   ? 1.112   -29.144 -4.701  1.00 62.86 ? 356 HOH B O   1 
HETATM 1575 O  O   . HOH N 7 .   ? -17.578 -42.779 -4.346  1.00 34.40 ? 357 HOH B O   1 
HETATM 1576 O  O   . HOH N 7 .   ? 23.447  -45.295 -8.705  1.00 44.47 ? 358 HOH B O   1 
HETATM 1577 O  O   . HOH N 7 .   ? 26.253  -60.491 -9.106  1.00 32.12 ? 359 HOH B O   1 
HETATM 1578 O  O   . HOH N 7 .   ? 29.454  -41.007 -7.580  1.00 52.73 ? 360 HOH B O   1 
HETATM 1579 O  O   . HOH N 7 .   ? 10.836  -40.624 -17.028 1.00 39.66 ? 361 HOH B O   1 
HETATM 1580 O  O   . HOH N 7 .   ? 27.602  -58.229 -10.325 1.00 37.06 ? 362 HOH B O   1 
HETATM 1581 O  O   . HOH N 7 .   ? -7.237  -32.678 2.644   1.00 55.19 ? 363 HOH B O   1 
HETATM 1582 O  O   . HOH N 7 .   ? 7.823   -56.049 -3.637  1.00 55.99 ? 364 HOH B O   1 
HETATM 1583 O  O   . HOH N 7 .   ? 12.946  -66.983 -10.383 1.00 53.45 ? 365 HOH B O   1 
HETATM 1584 O  O   . HOH N 7 .   ? -8.299  -32.843 -12.713 1.00 58.06 ? 366 HOH B O   1 
HETATM 1585 O  O   . HOH N 7 .   ? -0.563  -49.072 3.666   1.00 58.53 ? 367 HOH B O   1 
HETATM 1586 O  O   . HOH N 7 .   ? 17.849  -65.181 -15.454 1.00 39.86 ? 368 HOH B O   1 
HETATM 1587 O  O   . HOH N 7 .   ? -3.154  -32.273 -9.744  1.00 48.43 ? 369 HOH B O   1 
HETATM 1588 O  O   . HOH N 7 .   ? 13.921  -62.609 6.670   1.00 65.10 ? 370 HOH B O   1 
HETATM 1589 O  O   . HOH N 7 .   ? -16.042 -41.384 -18.446 1.00 61.86 ? 371 HOH B O   1 
HETATM 1590 O  O   . HOH N 7 .   ? 11.490  -63.370 -12.975 1.00 46.16 ? 372 HOH B O   1 
HETATM 1591 O  O   . HOH N 7 .   ? -21.085 -49.466 -15.336 1.00 53.34 ? 373 HOH B O   1 
HETATM 1592 O  O   . HOH N 7 .   ? 1.435   -30.253 -13.421 1.00 61.95 ? 374 HOH B O   1 
HETATM 1593 O  O   . HOH N 7 .   ? 10.261  -37.323 -14.915 1.00 54.80 ? 375 HOH B O   1 
HETATM 1594 O  O   . HOH N 7 .   ? -3.681  -45.375 -19.972 1.00 25.02 ? 376 HOH B O   1 
HETATM 1595 O  O   . HOH N 7 .   ? 3.307   -30.974 -5.199  1.00 48.34 ? 377 HOH B O   1 
HETATM 1596 O  O   . HOH N 7 .   ? -5.559  -32.884 -11.334 1.00 56.66 ? 378 HOH B O   1 
HETATM 1597 O  O   . HOH N 7 .   ? 9.222   -35.762 1.817   1.00 53.46 ? 379 HOH B O   1 
HETATM 1598 O  O   . HOH N 7 .   ? -1.456  -37.527 4.692   1.00 62.47 ? 380 HOH B O   1 
HETATM 1599 O  O   . HOH N 7 .   ? 23.649  -40.960 0.000   0.50 29.46 ? 381 HOH B O   1 
HETATM 1600 O  O   . HOH N 7 .   ? 1.879   -46.285 0.840   1.00 36.97 ? 382 HOH B O   1 
HETATM 1601 O  O   . HOH N 7 .   ? 2.405   -39.472 2.052   1.00 52.40 ? 383 HOH B O   1 
HETATM 1602 O  O   . HOH N 7 .   ? -3.025  -30.268 1.702   1.00 53.49 ? 384 HOH B O   1 
HETATM 1603 O  O   . HOH N 7 .   ? -0.387  -37.410 2.169   1.00 57.92 ? 385 HOH B O   1 
HETATM 1604 O  O   . HOH N 7 .   ? -9.427  -57.557 -17.616 1.00 56.10 ? 386 HOH B O   1 
HETATM 1605 O  O   . HOH N 7 .   ? 29.859  -47.101 -9.858  1.00 58.24 ? 387 HOH B O   1 
HETATM 1606 O  O   . HOH N 7 .   ? -23.196 -39.078 -13.016 1.00 70.08 ? 388 HOH B O   1 
HETATM 1607 O  O   . HOH N 7 .   ? 0.002   -45.481 -20.001 0.50 25.48 ? 389 HOH B O   1 
HETATM 1608 O  O   . HOH N 7 .   ? 9.530   -59.634 -0.996  1.00 58.57 ? 390 HOH B O   1 
HETATM 1609 O  O   . HOH N 7 .   ? 15.121  -54.905 4.219   1.00 58.78 ? 391 HOH B O   1 
HETATM 1610 O  O   . HOH N 7 .   ? 23.424  -42.356 -8.648  1.00 49.08 ? 392 HOH B O   1 
HETATM 1611 O  O   . HOH N 7 .   ? -6.575  -57.209 -9.732  1.00 58.41 ? 393 HOH B O   1 
HETATM 1612 O  O   . HOH N 7 .   ? -1.120  -46.142 6.878   1.00 54.14 ? 394 HOH B O   1 
HETATM 1613 O  O   . HOH N 7 .   ? 33.876  -51.235 -3.165  1.00 50.42 ? 395 HOH B O   1 
HETATM 1614 O  O   . HOH N 7 .   ? 0.415   -50.773 -16.397 1.00 47.72 ? 396 HOH B O   1 
HETATM 1615 O  O   . HOH N 7 .   ? 3.083   -55.499 2.128   1.00 48.85 ? 397 HOH B O   1 
HETATM 1616 O  O   . HOH N 7 .   ? 16.561  -60.267 -16.097 1.00 67.60 ? 398 HOH B O   1 
HETATM 1617 O  O   . HOH N 7 .   ? 24.733  -48.417 2.564   1.00 32.46 ? 399 HOH B O   1 
HETATM 1618 O  O   . HOH N 7 .   ? 7.096   -64.041 2.317   1.00 65.07 ? 400 HOH B O   1 
HETATM 1619 O  O   . HOH N 7 .   ? -22.276 -33.764 -5.239  1.00 77.24 ? 401 HOH B O   1 
HETATM 1620 O  O   . HOH N 7 .   ? -7.045  -35.088 -14.102 1.00 39.92 ? 402 HOH B O   1 
HETATM 1621 O  O   . HOH N 7 .   ? -25.190 -42.915 -6.987  1.00 44.68 ? 403 HOH B O   1 
HETATM 1622 O  O   . HOH N 7 .   ? 12.043  -32.733 -12.239 1.00 61.84 ? 404 HOH B O   1 
HETATM 1623 O  O   . HOH N 7 .   ? 6.682   -33.278 1.252   1.00 59.45 ? 405 HOH B O   1 
HETATM 1624 O  O   . HOH N 7 .   ? 0.852   -34.747 1.291   1.00 60.89 ? 406 HOH B O   1 
HETATM 1625 O  O   . HOH N 7 .   ? -21.111 -40.931 -17.422 1.00 59.96 ? 407 HOH B O   1 
HETATM 1626 O  O   . HOH N 7 .   ? -8.226  -34.190 -7.633  1.00 42.51 ? 408 HOH B O   1 
HETATM 1627 O  O   . HOH N 7 .   ? -4.725  -56.156 -14.718 1.00 58.76 ? 409 HOH B O   1 
HETATM 1628 O  O   . HOH N 7 .   ? 2.939   -54.120 -1.071  1.00 42.55 ? 410 HOH B O   1 
HETATM 1629 O  O   . HOH N 7 .   ? 4.045   -60.995 -10.596 1.00 47.88 ? 411 HOH B O   1 
HETATM 1630 O  O   . HOH N 7 .   ? 25.893  -38.874 -7.231  1.00 68.50 ? 412 HOH B O   1 
HETATM 1631 O  O   . HOH N 7 .   ? -10.684 -33.580 -9.250  1.00 62.06 ? 413 HOH B O   1 
HETATM 1632 O  O   . HOH N 7 .   ? 15.062  -34.247 -3.052  1.00 47.15 ? 414 HOH B O   1 
HETATM 1633 O  O   . HOH N 7 .   ? -13.035 -48.345 -0.345  1.00 45.37 ? 415 HOH B O   1 
HETATM 1634 O  O   . HOH N 7 .   ? 5.324   -37.528 3.233   1.00 53.44 ? 416 HOH B O   1 
HETATM 1635 O  O   . HOH N 7 .   ? -4.543  -27.826 -7.850  1.00 64.31 ? 417 HOH B O   1 
HETATM 1636 O  O   . HOH N 7 .   ? 14.712  -32.550 -8.973  1.00 69.82 ? 418 HOH B O   1 
HETATM 1637 O  O   . HOH N 7 .   ? 21.430  -40.432 1.935   1.00 40.17 ? 419 HOH B O   1 
HETATM 1638 O  O   . HOH N 7 .   ? -5.044  -30.749 3.232   1.00 54.29 ? 420 HOH B O   1 
HETATM 1639 O  O   . HOH N 7 .   ? 2.770   -56.663 -10.728 1.00 61.30 ? 421 HOH B O   1 
HETATM 1640 O  O   . HOH N 7 .   ? -18.589 -37.629 -20.654 1.00 69.58 ? 422 HOH B O   1 
HETATM 1641 O  O   . HOH N 7 .   ? 8.502   -32.753 -3.596  1.00 46.45 ? 423 HOH B O   1 
HETATM 1642 O  O   . HOH N 7 .   ? -11.677 -35.484 -16.699 1.00 43.62 ? 424 HOH B O   1 
HETATM 1643 O  O   . HOH N 7 .   ? -26.695 -46.224 -13.344 1.00 61.45 ? 425 HOH B O   1 
HETATM 1644 O  O   . HOH N 7 .   ? -21.978 -41.975 -3.544  1.00 62.46 ? 426 HOH B O   1 
HETATM 1645 O  O   . HOH N 7 .   ? 24.980  -46.753 -10.638 1.00 70.94 ? 427 HOH B O   1 
HETATM 1646 O  O   . HOH N 7 .   ? 17.738  -35.107 -3.976  1.00 52.82 ? 428 HOH B O   1 
HETATM 1647 O  O   . HOH N 7 .   ? -1.741  -30.334 -11.298 1.00 60.64 ? 429 HOH B O   1 
HETATM 1648 O  O   . HOH N 7 .   ? -9.780  -30.745 -0.495  1.00 66.20 ? 430 HOH B O   1 
HETATM 1649 O  O   . HOH N 7 .   ? 14.107  -52.166 4.532   1.00 55.26 ? 431 HOH B O   1 
HETATM 1650 O  O   . HOH N 7 .   ? -9.573  -36.985 -17.341 1.00 39.58 ? 432 HOH B O   1 
HETATM 1651 O  O   . HOH N 7 .   ? 23.796  -39.759 -5.060  1.00 48.62 ? 433 HOH B O   1 
HETATM 1652 O  O   . HOH N 7 .   ? -10.783 -33.086 -14.388 1.00 73.40 ? 434 HOH B O   1 
HETATM 1653 O  O   . HOH N 7 .   ? -10.714 -33.711 -6.191  1.00 58.16 ? 435 HOH B O   1 
HETATM 1654 O  O   . HOH N 7 .   ? -14.768 -47.583 -24.055 1.00 50.63 ? 436 HOH B O   1 
HETATM 1655 O  O   . HOH N 7 .   ? 31.612  -53.456 -0.579  0.50 31.86 ? 437 HOH B O   1 
HETATM 1656 O  O   . HOH N 7 .   ? -5.421  -47.838 0.781   1.00 71.52 ? 438 HOH B O   1 
HETATM 1657 O  O   . HOH N 7 .   ? -3.247  -54.222 -18.015 1.00 59.49 ? 439 HOH B O   1 
HETATM 1658 O  O   . HOH N 7 .   ? -15.485 -34.825 -14.519 1.00 46.53 ? 440 HOH B O   1 
HETATM 1659 O  O   . HOH N 7 .   ? 16.381  -42.064 9.339   1.00 71.78 ? 441 HOH B O   1 
HETATM 1660 O  O   . HOH N 7 .   ? -15.623 -56.353 -19.080 1.00 59.96 ? 442 HOH B O   1 
HETATM 1661 O  O   . HOH N 7 .   ? 2.902   -39.228 6.915   1.00 65.78 ? 443 HOH B O   1 
HETATM 1662 O  O   . HOH N 7 .   ? -8.840  -56.882 -8.110  1.00 53.99 ? 444 HOH B O   1 
HETATM 1663 O  O   . HOH N 7 .   ? 30.323  -57.233 -10.457 1.00 46.87 ? 445 HOH B O   1 
HETATM 1664 O  O   . HOH N 7 .   ? -16.026 -38.801 0.658   1.00 70.95 ? 446 HOH B O   1 
HETATM 1665 O  O   . HOH N 7 .   ? 2.336   -62.885 -8.963  1.00 69.65 ? 447 HOH B O   1 
HETATM 1666 O  O   . HOH N 7 .   ? 18.379  -42.388 -13.843 1.00 67.92 ? 448 HOH B O   1 
HETATM 1667 O  O   . HOH N 7 .   ? -7.372  -35.286 -16.710 1.00 52.66 ? 449 HOH B O   1 
HETATM 1668 O  O   . HOH N 7 .   ? 0.876   -29.584 -10.588 1.00 65.25 ? 450 HOH B O   1 
HETATM 1669 O  O   . HOH N 7 .   ? -13.090 -49.976 -24.289 1.00 32.32 ? 451 HOH B O   1 
HETATM 1670 O  O   . HOH N 7 .   ? -6.343  -32.146 -7.360  1.00 53.56 ? 452 HOH B O   1 
HETATM 1671 O  O   . HOH N 7 .   ? 11.006  -29.183 -1.063  1.00 79.86 ? 453 HOH B O   1 
HETATM 1672 O  O   . HOH N 7 .   ? 7.761   -58.511 -2.617  1.00 67.07 ? 454 HOH B O   1 
HETATM 1673 O  O   . HOH N 7 .   ? 16.198  -56.399 6.584   1.00 73.40 ? 455 HOH B O   1 
HETATM 1674 O  O   . HOH N 7 .   ? 17.709  -54.308 5.202   1.00 54.99 ? 456 HOH B O   1 
HETATM 1675 O  O   . HOH N 7 .   ? -3.422  -46.342 -22.596 1.00 26.11 ? 457 HOH B O   1 
HETATM 1676 O  O   . HOH N 7 .   ? -19.313 -44.650 -3.088  1.00 50.04 ? 458 HOH B O   1 
HETATM 1677 O  O   . HOH N 7 .   ? 18.491  -45.758 -11.263 1.00 55.36 ? 459 HOH B O   1 
HETATM 1678 O  O   . HOH N 7 .   ? 23.539  -59.459 -14.533 1.00 58.94 ? 460 HOH B O   1 
HETATM 1679 O  O   . HOH N 7 .   ? 18.745  -58.844 -18.173 1.00 59.40 ? 461 HOH B O   1 
HETATM 1680 O  O   . HOH N 7 .   ? -13.535 -32.926 -13.522 1.00 60.40 ? 462 HOH B O   1 
HETATM 1681 O  O   . HOH N 7 .   ? -20.064 -41.361 -0.068  1.00 62.80 ? 463 HOH B O   1 
HETATM 1682 O  O   . HOH N 7 .   ? 21.346  -44.712 -10.608 1.00 55.43 ? 464 HOH B O   1 
HETATM 1683 O  O   . HOH N 7 .   ? -1.317  -52.085 -14.819 1.00 45.65 ? 465 HOH B O   1 
HETATM 1684 O  O   . HOH N 7 .   ? -9.751  -47.009 2.220   1.00 60.63 ? 466 HOH B O   1 
HETATM 1685 O  O   . HOH N 7 .   ? 38.190  -50.185 -1.368  1.00 60.67 ? 467 HOH B O   1 
HETATM 1686 O  O   . HOH N 7 .   ? -15.949 -36.349 -18.413 1.00 56.90 ? 468 HOH B O   1 
HETATM 1687 O  O   . HOH N 7 .   ? 12.210  -63.894 -15.841 1.00 65.23 ? 469 HOH B O   1 
HETATM 1688 O  O   . HOH N 7 .   ? 27.338  -58.815 -13.184 1.00 52.91 ? 470 HOH B O   1 
HETATM 1689 O  O   . HOH N 7 .   ? 0.021   -50.267 0.050   1.00 58.56 ? 471 HOH B O   1 
HETATM 1690 O  O   . HOH N 7 .   ? -2.422  -55.253 -8.112  1.00 68.68 ? 472 HOH B O   1 
HETATM 1691 O  O   . HOH N 7 .   ? -7.252  -30.505 -10.899 1.00 69.00 ? 473 HOH B O   1 
HETATM 1692 O  O   . HOH N 7 .   ? -18.193 -34.510 -13.860 1.00 57.17 ? 474 HOH B O   1 
HETATM 1693 O  O   . HOH N 7 .   ? 0.531   -52.959 -0.212  1.00 50.58 ? 475 HOH B O   1 
HETATM 1694 O  O   . HOH N 7 .   ? 15.473  -67.773 -0.954  1.00 63.80 ? 476 HOH B O   1 
HETATM 1695 O  O   . HOH N 7 .   ? -0.994  -51.882 -18.584 1.00 49.06 ? 477 HOH B O   1 
HETATM 1696 O  O   . HOH N 7 .   ? 8.102   -35.585 -15.615 1.00 54.16 ? 478 HOH B O   1 
HETATM 1697 O  O   . HOH N 7 .   ? 9.561   -38.517 -18.106 1.00 43.52 ? 479 HOH B O   1 
HETATM 1698 O  O   . HOH N 7 .   ? -6.096  -37.807 -19.830 1.00 37.33 ? 480 HOH B O   1 
HETATM 1699 O  O   . HOH N 7 .   ? 10.713  -66.840 -12.468 1.00 67.16 ? 481 HOH B O   1 
HETATM 1700 O  O   . HOH N 7 .   ? -23.749 -34.254 -7.729  1.00 75.56 ? 482 HOH B O   1 
HETATM 1701 O  O   . HOH N 7 .   ? -24.839 -36.108 -5.655  1.00 76.41 ? 483 HOH B O   1 
HETATM 1702 O  O   . HOH N 7 .   ? -25.044 -39.500 -7.091  1.00 62.72 ? 484 HOH B O   1 
HETATM 1703 O  O   . HOH N 7 .   ? 30.714  -41.707 -10.162 1.00 72.87 ? 485 HOH B O   1 
HETATM 1704 O  O   . HOH N 7 .   ? 29.493  -57.058 -13.629 1.00 57.07 ? 486 HOH B O   1 
HETATM 1705 O  O   . HOH N 7 .   ? -5.708  -35.275 -18.886 1.00 54.44 ? 487 HOH B O   1 
HETATM 1706 O  O   . HOH N 7 .   ? -3.799  -35.479 -21.413 1.00 65.12 ? 488 HOH B O   1 
HETATM 1707 O  O   . HOH N 7 .   ? 9.090   -69.985 -9.882  1.00 72.48 ? 489 HOH B O   1 
HETATM 1708 O  O   . HOH N 7 .   ? 22.285  -45.078 -16.575 1.00 70.85 ? 490 HOH B O   1 
HETATM 1709 O  O   . HOH N 7 .   ? 10.609  -26.377 0.792   1.00 70.20 ? 491 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . PRO A 80  ? 1.2427 0.9471 1.0307 0.0772  0.0791  -0.0695 588 PRO A N   
2    C  CA  . PRO A 80  ? 0.9474 1.0274 0.9340 0.1084  0.0097  -0.0308 588 PRO A CA  
3    C  C   . PRO A 80  ? 0.7754 0.9117 0.7243 -0.0271 0.0989  -0.1269 588 PRO A C   
4    O  O   . PRO A 80  ? 0.8562 0.9284 0.7844 -0.1277 0.1182  -0.0693 588 PRO A O   
5    C  CB  . PRO A 80  ? 0.8614 0.8611 0.9421 0.1035  0.1011  0.0278  588 PRO A CB  
6    C  CG  . PRO A 80  ? 1.1186 0.9438 1.1441 0.2101  0.0709  0.0628  588 PRO A CG  
7    C  CD  . PRO A 80  ? 1.1267 1.0561 1.1168 0.1184  0.0809  -0.0449 588 PRO A CD  
8    N  N   . LEU A 81  ? 0.6332 0.8311 0.5555 0.0847  0.2074  -0.1241 589 LEU A N   
9    C  CA  . LEU A 81  ? 0.5110 0.6955 0.5012 -0.0408 -0.0126 -0.0428 589 LEU A CA  
10   C  C   . LEU A 81  ? 0.3748 0.3963 0.4706 -0.0082 -0.0745 -0.0712 589 LEU A C   
11   O  O   . LEU A 81  ? 0.3929 0.4474 0.5071 0.0848  -0.0699 -0.0660 589 LEU A O   
12   C  CB  . LEU A 81  ? 0.6435 0.5422 0.5590 -0.0173 -0.0269 -0.0906 589 LEU A CB  
13   C  CG  . LEU A 81  ? 0.6688 0.6828 0.6230 -0.0506 -0.0415 -0.0008 589 LEU A CG  
14   C  CD1 . LEU A 81  ? 0.6967 0.8022 0.7873 -0.0628 0.0456  -0.0299 589 LEU A CD1 
15   C  CD2 . LEU A 81  ? 0.5700 0.7194 0.7025 -0.0203 -0.0011 -0.1050 589 LEU A CD2 
16   N  N   . PHE A 82  ? 0.3808 0.4016 0.4349 -0.0043 -0.0237 -0.0417 590 PHE A N   
17   C  CA  . PHE A 82  ? 0.3293 0.3673 0.3997 -0.0227 -0.0354 -0.0090 590 PHE A CA  
18   C  C   . PHE A 82  ? 0.3348 0.3839 0.3746 -0.0009 -0.0181 0.0066  590 PHE A C   
19   O  O   . PHE A 82  ? 0.3606 0.4001 0.4690 0.0168  -0.0248 0.0423  590 PHE A O   
20   C  CB  . PHE A 82  ? 0.3386 0.3718 0.3762 -0.0099 -0.0120 -0.0276 590 PHE A CB  
21   C  CG  . PHE A 82  ? 0.3692 0.3593 0.3787 -0.0076 -0.0128 -0.0057 590 PHE A CG  
22   C  CD1 . PHE A 82  ? 0.3485 0.3603 0.3610 -0.0232 -0.0068 -0.0426 590 PHE A CD1 
23   C  CD2 . PHE A 82  ? 0.3161 0.3207 0.3705 -0.0530 -0.0353 -0.0245 590 PHE A CD2 
24   C  CE1 . PHE A 82  ? 0.2931 0.3470 0.3597 -0.0374 -0.0240 -0.0042 590 PHE A CE1 
25   C  CE2 . PHE A 82  ? 0.3229 0.2787 0.3713 -0.0572 -0.0295 -0.0493 590 PHE A CE2 
26   C  CZ  . PHE A 82  ? 0.3242 0.2755 0.3993 -0.0440 -0.0541 -0.0377 590 PHE A CZ  
27   N  N   . PHE A 83  ? 0.2913 0.3227 0.3709 0.0078  -0.0365 -0.0143 591 PHE A N   
28   C  CA  . PHE A 83  ? 0.2875 0.3341 0.3725 0.0046  -0.0344 -0.0408 591 PHE A CA  
29   C  C   . PHE A 83  ? 0.3055 0.3263 0.3380 -0.0033 0.0041  0.0028  591 PHE A C   
30   O  O   . PHE A 83  ? 0.2679 0.3489 0.3461 0.0238  -0.0437 -0.0149 591 PHE A O   
31   C  CB  . PHE A 83  ? 0.3166 0.3348 0.3850 -0.0072 -0.0309 -0.0606 591 PHE A CB  
32   C  CG  . PHE A 83  ? 0.3924 0.3874 0.3898 0.0156  0.0111  -0.0532 591 PHE A CG  
33   C  CD1 . PHE A 83  ? 0.4608 0.4904 0.4346 0.0305  -0.0678 -0.0553 591 PHE A CD1 
34   C  CD2 . PHE A 83  ? 0.3540 0.4210 0.4345 0.0005  -0.0638 -0.0667 591 PHE A CD2 
35   C  CE1 . PHE A 83  ? 0.4786 0.4854 0.4246 0.0172  -0.0708 -0.0569 591 PHE A CE1 
36   C  CE2 . PHE A 83  ? 0.3797 0.5171 0.4396 0.0371  -0.0479 -0.0871 591 PHE A CE2 
37   C  CZ  . PHE A 83  ? 0.4736 0.4837 0.4499 0.0206  -0.0660 -0.0567 591 PHE A CZ  
38   N  N   . ASP A 84  ? 0.3015 0.3237 0.3178 -0.0085 -0.0277 -0.0387 592 ASP A N   
39   C  CA  . ASP A 84  ? 0.2884 0.3110 0.3263 -0.0005 -0.0090 -0.0017 592 ASP A CA  
40   C  C   . ASP A 84  ? 0.3072 0.2965 0.3065 -0.0038 -0.0260 0.0104  592 ASP A C   
41   O  O   . ASP A 84  ? 0.3091 0.3384 0.3387 -0.0143 -0.0570 -0.0204 592 ASP A O   
42   C  CB  . ASP A 84  ? 0.3103 0.3017 0.3086 0.0073  -0.0173 -0.0234 592 ASP A CB  
43   C  CG  . ASP A 84  ? 0.2419 0.2852 0.2832 -0.0357 -0.0256 -0.0053 592 ASP A CG  
44   O  OD1 . ASP A 84  ? 0.2550 0.2965 0.2972 -0.0067 -0.0087 -0.0057 592 ASP A OD1 
45   O  OD2 . ASP A 84  ? 0.2728 0.3173 0.3174 -0.0088 -0.0188 -0.0052 592 ASP A OD2 
46   N  N   . LEU A 85  ? 0.2601 0.2950 0.2784 0.0068  -0.0397 -0.0028 593 LEU A N   
47   C  CA  . LEU A 85  ? 0.3010 0.3035 0.2840 -0.0204 -0.0384 -0.0183 593 LEU A CA  
48   C  C   . LEU A 85  ? 0.3124 0.2875 0.3310 -0.0075 -0.0337 -0.0193 593 LEU A C   
49   O  O   . LEU A 85  ? 0.3112 0.2889 0.3896 -0.0188 -0.0544 -0.0367 593 LEU A O   
50   C  CB  . LEU A 85  ? 0.3170 0.3347 0.3123 0.0054  -0.0695 -0.0285 593 LEU A CB  
51   C  CG  . LEU A 85  ? 0.3600 0.3392 0.3541 0.0149  -0.0427 -0.0434 593 LEU A CG  
52   C  CD1 . LEU A 85  ? 0.3858 0.3485 0.4145 -0.0084 -0.1248 -0.0347 593 LEU A CD1 
53   C  CD2 . LEU A 85  ? 0.4124 0.3572 0.3729 0.0061  -0.0768 -0.0409 593 LEU A CD2 
54   N  N   . ALA A 86  ? 0.2894 0.2867 0.2796 0.0027  -0.0420 -0.0213 594 ALA A N   
55   C  CA  . ALA A 86  ? 0.2892 0.2931 0.2931 -0.0101 -0.0282 -0.0267 594 ALA A CA  
56   C  C   . ALA A 86  ? 0.2749 0.2875 0.2925 -0.0217 -0.0212 -0.0265 594 ALA A C   
57   O  O   . ALA A 86  ? 0.2711 0.3120 0.3261 -0.0355 -0.0229 -0.0536 594 ALA A O   
58   C  CB  . ALA A 86  ? 0.3090 0.3079 0.3032 -0.0201 -0.0281 -0.0493 594 ALA A CB  
59   N  N   . LEU A 87  ? 0.2534 0.2885 0.2932 -0.0084 -0.0465 -0.0188 595 LEU A N   
60   C  CA  . LEU A 87  ? 0.2638 0.2916 0.2917 -0.0130 -0.0524 -0.0023 595 LEU A CA  
61   C  C   . LEU A 87  ? 0.2745 0.2759 0.3509 -0.0087 -0.0244 -0.0153 595 LEU A C   
62   O  O   . LEU A 87  ? 0.2663 0.3144 0.3348 -0.0156 -0.0560 -0.0008 595 LEU A O   
63   C  CB  . LEU A 87  ? 0.2850 0.3110 0.3145 -0.0355 -0.0345 0.0155  595 LEU A CB  
64   C  CG  . LEU A 87  ? 0.3057 0.3532 0.3027 -0.0056 -0.0399 -0.0145 595 LEU A CG  
65   C  CD1 . LEU A 87  ? 0.2992 0.3154 0.3780 0.0006  -0.0890 -0.0049 595 LEU A CD1 
66   C  CD2 . LEU A 87  ? 0.2910 0.3824 0.3315 -0.0206 -0.0366 0.0249  595 LEU A CD2 
67   N  N   . ASN A 88  ? 0.2430 0.2863 0.3393 -0.0007 -0.0376 -0.0211 596 ASN A N   
68   C  CA  . ASN A 88  ? 0.3209 0.2936 0.3442 -0.0345 -0.0081 -0.0165 596 ASN A CA  
69   C  C   . ASN A 88  ? 0.3197 0.3301 0.3469 -0.0155 -0.0112 -0.0187 596 ASN A C   
70   O  O   . ASN A 88  ? 0.3294 0.4123 0.4274 -0.0365 -0.0882 -0.0503 596 ASN A O   
71   C  CB  . ASN A 88  ? 0.3055 0.3056 0.3763 -0.0290 -0.0348 -0.0269 596 ASN A CB  
72   C  CG  . ASN A 88  ? 0.4200 0.3669 0.3910 0.0140  -0.0046 -0.0084 596 ASN A CG  
73   O  OD1 . ASN A 88  ? 0.4263 0.5120 0.4084 0.0362  -0.0569 -0.0181 596 ASN A OD1 
74   N  ND2 . ASN A 88  ? 0.3869 0.4878 0.4758 -0.0088 -0.1055 -0.0940 596 ASN A ND2 
75   N  N   . HIS A 89  ? 0.3023 0.3048 0.3159 0.0100  -0.0265 -0.0124 597 HIS A N   
76   C  CA  . HIS A 89  ? 0.3200 0.3619 0.3263 0.0048  -0.0188 -0.0173 597 HIS A CA  
77   C  C   . HIS A 89  ? 0.2725 0.3273 0.3027 -0.0269 -0.0401 -0.0055 597 HIS A C   
78   O  O   . HIS A 89  ? 0.3009 0.3765 0.3132 -0.0101 -0.0311 -0.0104 597 HIS A O   
79   C  CB  . HIS A 89  ? 0.3331 0.3776 0.3538 -0.0162 -0.0425 0.0061  597 HIS A CB  
80   C  CG  . HIS A 89  ? 0.4184 0.4286 0.4988 0.0311  -0.0536 0.0394  597 HIS A CG  
81   N  ND1 . HIS A 89  ? 0.4980 0.4868 0.6640 -0.0015 -0.1050 -0.0298 597 HIS A ND1 
82   C  CD2 . HIS A 89  ? 0.4141 0.4513 0.4819 -0.0151 -0.0297 -0.0139 597 HIS A CD2 
83   C  CE1 . HIS A 89  ? 0.4616 0.5751 0.7335 -0.0019 -0.0711 0.0069  597 HIS A CE1 
84   N  NE2 . HIS A 89  ? 0.4818 0.4457 0.5372 0.0137  -0.0382 0.0072  597 HIS A NE2 
85   N  N   . VAL A 90  ? 0.2598 0.3015 0.3279 -0.0231 -0.0594 -0.0062 598 VAL A N   
86   C  CA  . VAL A 90  ? 0.2611 0.3185 0.3762 -0.0110 -0.0191 -0.0006 598 VAL A CA  
87   C  C   . VAL A 90  ? 0.2920 0.3151 0.3243 -0.0337 -0.0206 0.0047  598 VAL A C   
88   O  O   . VAL A 90  ? 0.2482 0.3562 0.3370 -0.0114 -0.0059 -0.0053 598 VAL A O   
89   C  CB  . VAL A 90  ? 0.2591 0.2942 0.3702 -0.0051 -0.0462 0.0003  598 VAL A CB  
90   C  CG1 . VAL A 90  ? 0.2649 0.3115 0.3979 0.0013  -0.0453 0.0210  598 VAL A CG1 
91   C  CG2 . VAL A 90  ? 0.2859 0.3010 0.3329 -0.0351 -0.0468 -0.0247 598 VAL A CG2 
92   N  N   . ALA A 91  ? 0.2604 0.3018 0.3341 -0.0235 -0.0151 -0.0431 599 ALA A N   
93   C  CA  . ALA A 91  ? 0.2476 0.2853 0.3502 -0.0212 0.0266  -0.0108 599 ALA A CA  
94   C  C   . ALA A 91  ? 0.2759 0.3451 0.3068 0.0145  0.0000  -0.0366 599 ALA A C   
95   O  O   . ALA A 91  ? 0.2331 0.3601 0.3196 -0.0181 -0.0147 -0.0421 599 ALA A O   
96   C  CB  . ALA A 91  ? 0.2203 0.2794 0.3621 -0.0170 0.0076  -0.0101 599 ALA A CB  
97   N  N   . PHE A 92  ? 0.2583 0.3098 0.3411 0.0225  -0.0012 -0.0379 600 PHE A N   
98   C  CA  . PHE A 92  ? 0.2715 0.3667 0.3038 0.0113  0.0013  -0.0278 600 PHE A CA  
99   C  C   . PHE A 92  ? 0.2638 0.3244 0.3331 0.0034  -0.0244 -0.0183 600 PHE A C   
100  O  O   . PHE A 92  ? 0.2652 0.3336 0.3413 -0.0004 0.0101  -0.0167 600 PHE A O   
101  C  CB  . PHE A 92  ? 0.2833 0.3406 0.3203 0.0117  -0.0258 -0.0355 600 PHE A CB  
102  C  CG  . PHE A 92  ? 0.2867 0.3120 0.3103 0.0050  0.0052  -0.0340 600 PHE A CG  
103  C  CD1 . PHE A 92  ? 0.2578 0.3008 0.3147 0.0340  0.0125  -0.0245 600 PHE A CD1 
104  C  CD2 . PHE A 92  ? 0.2758 0.3266 0.2876 0.0038  0.0103  -0.0344 600 PHE A CD2 
105  C  CE1 . PHE A 92  ? 0.3174 0.3211 0.3047 0.0007  0.0000  -0.0112 600 PHE A CE1 
106  C  CE2 . PHE A 92  ? 0.2722 0.2836 0.3384 0.0129  0.0182  -0.0166 600 PHE A CE2 
107  C  CZ  . PHE A 92  ? 0.2804 0.2901 0.3533 -0.0001 0.0186  -0.0316 600 PHE A CZ  
108  N  N   . PRO A 93  ? 0.3045 0.3449 0.3396 -0.0091 -0.0093 -0.0266 601 PRO A N   
109  C  CA  . PRO A 93  ? 0.3496 0.3671 0.3560 -0.0152 -0.0039 -0.0065 601 PRO A CA  
110  C  C   . PRO A 93  ? 0.3349 0.3319 0.3450 0.0150  -0.0042 -0.0291 601 PRO A C   
111  O  O   . PRO A 93  ? 0.2777 0.3763 0.3497 0.0020  0.0037  -0.0254 601 PRO A O   
112  C  CB  . PRO A 93  ? 0.3940 0.3682 0.3924 0.0137  0.0072  -0.0207 601 PRO A CB  
113  C  CG  . PRO A 93  ? 0.3422 0.3954 0.3259 -0.0016 0.0327  -0.0171 601 PRO A CG  
114  C  CD  . PRO A 93  ? 0.3316 0.3511 0.3325 0.0129  0.0277  -0.0476 601 PRO A CD  
115  N  N   . PRO A 94  ? 0.3642 0.3639 0.3829 0.0029  -0.0080 0.0002  602 PRO A N   
116  C  CA  . PRO A 94  ? 0.3636 0.4069 0.4046 -0.0043 -0.0295 -0.0002 602 PRO A CA  
117  C  C   . PRO A 94  ? 0.3713 0.3759 0.3700 -0.0060 -0.0157 -0.0037 602 PRO A C   
118  O  O   . PRO A 94  ? 0.3740 0.3888 0.3881 0.0003  0.0155  -0.0072 602 PRO A O   
119  C  CB  . PRO A 94  ? 0.3905 0.4599 0.3908 -0.0005 -0.0204 0.0068  602 PRO A CB  
120  C  CG  . PRO A 94  ? 0.3863 0.4441 0.4338 -0.0244 -0.0219 0.0362  602 PRO A CG  
121  C  CD  . PRO A 94  ? 0.4173 0.4040 0.3571 0.0040  -0.0097 0.0115  602 PRO A CD  
122  N  N   . LEU A 95  ? 0.3137 0.3720 0.3538 -0.0035 0.0098  0.0076  603 LEU A N   
123  C  CA  . LEU A 95  ? 0.3302 0.3310 0.3598 -0.0080 0.0237  0.0289  603 LEU A CA  
124  C  C   . LEU A 95  ? 0.3333 0.3478 0.3875 -0.0084 0.0414  0.0001  603 LEU A C   
125  O  O   . LEU A 95  ? 0.3186 0.4045 0.3696 0.0035  0.0321  -0.0206 603 LEU A O   
126  C  CB  . LEU A 95  ? 0.3087 0.3571 0.3365 -0.0045 0.0274  -0.0083 603 LEU A CB  
127  C  CG  . LEU A 95  ? 0.3035 0.3261 0.3254 0.0064  0.0270  -0.0111 603 LEU A CG  
128  C  CD1 . LEU A 95  ? 0.2925 0.3468 0.3385 -0.0060 0.0031  0.0257  603 LEU A CD1 
129  C  CD2 . LEU A 95  ? 0.3134 0.3313 0.3685 0.0155  0.0580  -0.0332 603 LEU A CD2 
130  N  N   . GLU A 96  ? 0.3047 0.3473 0.3355 0.0066  0.0599  -0.0134 604 GLU A N   
131  C  CA  . GLU A 96  ? 0.3441 0.3533 0.3968 -0.0272 0.0631  0.0150  604 GLU A CA  
132  C  C   . GLU A 96  ? 0.3729 0.3902 0.4282 0.0301  0.0143  -0.0252 604 GLU A C   
133  O  O   . GLU A 96  ? 0.3363 0.4006 0.3974 0.0277  0.0679  -0.0378 604 GLU A O   
134  C  CB  . GLU A 96  ? 0.3303 0.3647 0.4264 -0.0090 0.0327  0.0202  604 GLU A CB  
135  C  CG  . GLU A 96  ? 0.4423 0.4256 0.3966 0.0001  0.0400  0.0201  604 GLU A CG  
136  C  CD  . GLU A 96  ? 0.4361 0.5051 0.4963 -0.0535 0.0034  0.0025  604 GLU A CD  
137  O  OE1 . GLU A 96  ? 0.5428 0.6642 0.5631 -0.0328 -0.0175 0.1094  604 GLU A OE1 
138  O  OE2 . GLU A 96  ? 0.3940 0.4657 0.4965 -0.0157 -0.0104 0.0051  604 GLU A OE2 
139  N  N   . ASP A 97  ? 0.3922 0.3830 0.3876 0.0220  0.0285  -0.0196 605 ASP A N   
140  C  CA  . ASP A 97  ? 0.4098 0.4343 0.4136 0.0295  0.0576  -0.0106 605 ASP A CA  
141  C  C   . ASP A 97  ? 0.4011 0.3911 0.4027 0.0060  0.0488  -0.0355 605 ASP A C   
142  O  O   . ASP A 97  ? 0.3873 0.4807 0.4427 0.0058  0.0566  -0.0173 605 ASP A O   
143  C  CB  . ASP A 97  ? 0.4475 0.4842 0.4606 -0.0347 0.0449  -0.0146 605 ASP A CB  
144  C  CG  . ASP A 97  ? 0.5358 0.5630 0.5472 0.0048  0.0064  0.0227  605 ASP A CG  
145  O  OD1 . ASP A 97  ? 0.5640 0.5396 0.5711 0.0331  0.1032  -0.0173 605 ASP A OD1 
146  O  OD2 . ASP A 97  ? 0.6124 0.6437 0.5789 -0.0364 -0.0476 0.0223  605 ASP A OD2 
147  N  N   . LYS A 98  ? 0.3816 0.3703 0.3916 0.0153  0.0398  -0.0271 606 LYS A N   
148  C  CA  . LYS A 98  ? 0.3459 0.3615 0.3363 0.0367  0.0519  -0.0697 606 LYS A CA  
149  C  C   . LYS A 98  ? 0.3574 0.3453 0.4093 -0.0024 0.0254  -0.0498 606 LYS A C   
150  O  O   . LYS A 98  ? 0.4025 0.3652 0.4423 0.0430  0.0321  -0.0377 606 LYS A O   
151  C  CB  . LYS A 98  ? 0.3717 0.3580 0.3992 -0.0061 0.0244  -0.0480 606 LYS A CB  
152  C  CG  . LYS A 98  ? 0.3909 0.3605 0.4079 -0.0185 0.0042  -0.0422 606 LYS A CG  
153  C  CD  . LYS A 98  ? 0.4632 0.4673 0.4034 0.0314  0.0648  -0.0537 606 LYS A CD  
154  C  CE  . LYS A 98  ? 0.4491 0.4970 0.5385 0.0107  0.0259  -0.0753 606 LYS A CE  
155  N  NZ  . LYS A 98  ? 0.4997 0.5008 0.5427 0.0253  0.0683  -0.0817 606 LYS A NZ  
156  N  N   . LEU A 99  ? 0.2992 0.3569 0.3540 0.0012  0.0694  -0.0414 607 LEU A N   
157  C  CA  . LEU A 99  ? 0.3248 0.3436 0.3799 0.0014  0.0568  -0.0532 607 LEU A CA  
158  C  C   . LEU A 99  ? 0.3257 0.4199 0.3959 0.0079  0.0492  -0.0152 607 LEU A C   
159  O  O   . LEU A 99  ? 0.2963 0.4071 0.4559 0.0256  0.0556  -0.0492 607 LEU A O   
160  C  CB  . LEU A 99  ? 0.3608 0.3504 0.3683 0.0162  0.0508  -0.0621 607 LEU A CB  
161  C  CG  . LEU A 99  ? 0.3473 0.3606 0.3779 0.0468  0.0491  -0.0238 607 LEU A CG  
162  C  CD1 . LEU A 99  ? 0.4560 0.3827 0.4430 0.0668  0.0992  -0.0667 607 LEU A CD1 
163  C  CD2 . LEU A 99  ? 0.3870 0.3670 0.4209 0.0204  0.0634  0.0293  607 LEU A CD2 
164  N  N   . ALA A 100 ? 0.3303 0.4237 0.3936 -0.0059 0.0777  -0.0107 608 ALA A N   
165  C  CA  . ALA A 100 ? 0.3504 0.4180 0.4215 -0.0345 0.0783  0.0128  608 ALA A CA  
166  C  C   . ALA A 100 ? 0.4325 0.4628 0.5501 0.0060  0.0963  -0.0244 608 ALA A C   
167  O  O   . ALA A 100 ? 0.4298 0.5120 0.5484 0.0142  0.1263  -0.0737 608 ALA A O   
168  C  CB  . ALA A 100 ? 0.3957 0.4109 0.4262 0.0056  0.0874  0.0040  608 ALA A CB  
169  N  N   . ALA A 101 ? 0.3717 0.4746 0.5329 0.0157  0.1248  0.0175  609 ALA A N   
170  C  CA  . ALA A 101 ? 0.4931 0.5480 0.5822 0.0761  0.0951  -0.0422 609 ALA A CA  
171  C  C   . ALA A 101 ? 0.6770 0.6951 0.6132 0.0418  0.0113  -0.0230 609 ALA A C   
172  O  O   . ALA A 101 ? 0.6573 0.7374 0.8380 0.0121  0.0997  -0.0183 609 ALA A O   
173  C  CB  . ALA A 101 ? 0.5406 0.5440 0.5624 0.0785  0.0548  -0.0388 609 ALA A CB  
174  N  N   . ALA A 102 ? 0.6221 0.7306 0.7353 0.0798  0.0601  -0.0237 610 ALA A N   
175  C  CA  . ALA A 102 ? 0.8536 0.8085 0.7628 0.0592  -0.0311 0.0231  610 ALA A CA  
176  C  C   . ALA A 102 ? 0.8968 0.8363 0.9350 -0.0665 -0.0336 -0.0146 610 ALA A C   
177  O  O   . ALA A 102 ? 0.9957 0.7856 1.0606 -0.0960 -0.0142 -0.0271 610 ALA A O   
178  C  CB  . ALA A 102 ? 0.7493 0.8009 0.6548 0.0505  0.0933  0.0265  610 ALA A CB  
179  N  N   . VAL B 9   ? 0.8101 0.9091 0.7456 -0.0023 0.1339  -0.0648 9   VAL B N   
180  C  CA  . VAL B 9   ? 0.8450 0.8587 0.7604 0.0490  0.0029  -0.0660 9   VAL B CA  
181  C  C   . VAL B 9   ? 0.6849 0.6661 0.7399 0.0558  -0.0080 0.0315  9   VAL B C   
182  O  O   . VAL B 9   ? 0.8917 0.7166 0.8634 0.0482  -0.0617 -0.0487 9   VAL B O   
183  C  CB  . VAL B 9   ? 0.8723 1.0560 0.8239 -0.0206 -0.0031 -0.0985 9   VAL B CB  
184  N  N   . SER B 10  ? 0.3334 0.7022 0.6137 0.0458  -0.0061 -0.0105 10  SER B N   
185  C  CA  . SER B 10  ? 0.4580 0.5404 0.5876 0.0399  0.0092  -0.0315 10  SER B CA  
186  C  C   . SER B 10  ? 0.4640 0.5209 0.5003 0.0257  0.0069  -0.0313 10  SER B C   
187  O  O   . SER B 10  ? 0.3968 0.4497 0.5872 0.0320  0.0141  -0.0479 10  SER B O   
188  C  CB  . SER B 10  ? 0.4895 0.5167 0.7120 0.0176  0.0137  -0.0527 10  SER B CB  
189  O  OG  . SER B 10  ? 0.3401 0.5201 0.7325 -0.0215 0.0174  -0.0959 10  SER B OG  
190  N  N   . VAL B 11  ? 0.4022 0.3952 0.5206 0.0787  0.0096  -0.0403 11  VAL B N   
191  C  CA  . VAL B 11  ? 0.4068 0.4009 0.4873 0.0517  -0.0098 -0.0244 11  VAL B CA  
192  C  C   . VAL B 11  ? 0.3836 0.3908 0.5018 0.0257  0.0382  -0.0090 11  VAL B C   
193  O  O   . VAL B 11  ? 0.3478 0.3719 0.4467 0.0117  0.0238  0.0135  11  VAL B O   
194  C  CB  . VAL B 11  ? 0.4359 0.4234 0.4770 0.0307  -0.0123 -0.0026 11  VAL B CB  
195  C  CG1 . VAL B 11  ? 0.4222 0.3773 0.5180 0.0313  -0.0070 -0.0303 11  VAL B CG1 
196  C  CG2 . VAL B 11  ? 0.3653 0.4112 0.5572 0.0303  0.0299  -0.0447 11  VAL B CG2 
197  N  N   . PRO B 12  ? 0.4120 0.3975 0.5509 0.0233  0.0820  -0.0043 12  PRO B N   
198  C  CA  . PRO B 12  ? 0.3672 0.3901 0.4658 0.0149  0.0824  0.0033  12  PRO B CA  
199  C  C   . PRO B 12  ? 0.3901 0.3792 0.4383 0.0123  0.0139  0.0221  12  PRO B C   
200  O  O   . PRO B 12  ? 0.3632 0.4082 0.4610 0.0110  0.0337  -0.0366 12  PRO B O   
201  C  CB  . PRO B 12  ? 0.4444 0.3853 0.4993 -0.0486 0.0822  -0.0010 12  PRO B CB  
202  C  CG  . PRO B 12  ? 0.4641 0.4628 0.5605 0.0102  0.1289  0.0138  12  PRO B CG  
203  C  CD  . PRO B 12  ? 0.4241 0.4607 0.5361 0.0066  0.0861  0.0157  12  PRO B CD  
204  N  N   . ALA B 13  ? 0.3351 0.4022 0.4417 -0.0152 0.0185  0.0266  13  ALA B N   
205  C  CA  . ALA B 13  ? 0.3815 0.4157 0.4348 0.0051  0.0166  0.0109  13  ALA B CA  
206  C  C   . ALA B 13  ? 0.3798 0.4094 0.4436 -0.0227 -0.0061 -0.0306 13  ALA B C   
207  O  O   . ALA B 13  ? 0.3530 0.3940 0.4765 -0.0136 -0.0032 -0.0283 13  ALA B O   
208  C  CB  . ALA B 13  ? 0.3914 0.4455 0.5733 0.0255  -0.0327 -0.0050 13  ALA B CB  
209  N  N   . LEU B 14  ? 0.3404 0.3855 0.5007 0.0060  0.0245  -0.0255 14  LEU B N   
210  C  CA  . LEU B 14  ? 0.3345 0.3306 0.4562 0.0195  -0.0157 -0.0035 14  LEU B CA  
211  C  C   . LEU B 14  ? 0.3327 0.3135 0.3467 0.0147  -0.0017 -0.0117 14  LEU B C   
212  O  O   . LEU B 14  ? 0.3187 0.3139 0.3852 0.0086  0.0080  -0.0159 14  LEU B O   
213  C  CB  . LEU B 14  ? 0.3276 0.3321 0.4357 0.0184  -0.0175 -0.0005 14  LEU B CB  
214  C  CG  . LEU B 14  ? 0.3376 0.3734 0.3877 0.0407  -0.0311 -0.0198 14  LEU B CG  
215  C  CD1 . LEU B 14  ? 0.3718 0.3461 0.5073 0.0519  -0.0172 -0.0374 14  LEU B CD1 
216  C  CD2 . LEU B 14  ? 0.3690 0.4248 0.4053 0.0673  -0.0186 0.0249  14  LEU B CD2 
217  N  N   . TRP B 15  ? 0.2873 0.2957 0.3552 0.0127  -0.0069 -0.0047 15  TRP B N   
218  C  CA  . TRP B 15  ? 0.3158 0.3052 0.3466 0.0210  -0.0097 0.0028  15  TRP B CA  
219  C  C   . TRP B 15  ? 0.3270 0.3289 0.3937 0.0027  -0.0094 -0.0357 15  TRP B C   
220  O  O   . TRP B 15  ? 0.2995 0.3193 0.3938 -0.0107 -0.0223 -0.0244 15  TRP B O   
221  C  CB  . TRP B 15  ? 0.3053 0.3625 0.3281 -0.0032 0.0134  -0.0308 15  TRP B CB  
222  C  CG  . TRP B 15  ? 0.3368 0.3432 0.4062 -0.0051 0.0396  -0.0504 15  TRP B CG  
223  C  CD1 . TRP B 15  ? 0.3182 0.3935 0.4428 0.0178  0.0310  -0.0747 15  TRP B CD1 
224  C  CD2 . TRP B 15  ? 0.3340 0.3584 0.3857 0.0041  0.0114  -0.0271 15  TRP B CD2 
225  N  NE1 . TRP B 15  ? 0.3563 0.3925 0.4539 -0.0016 0.0177  -0.0626 15  TRP B NE1 
226  C  CE2 . TRP B 15  ? 0.3586 0.3791 0.4042 0.0173  0.0116  -0.0380 15  TRP B CE2 
227  C  CE3 . TRP B 15  ? 0.3189 0.3472 0.4438 -0.0044 0.0202  -0.0236 15  TRP B CE3 
228  C  CZ2 . TRP B 15  ? 0.3634 0.3823 0.3903 -0.0063 0.0317  -0.0213 15  TRP B CZ2 
229  C  CZ3 . TRP B 15  ? 0.3100 0.3811 0.3862 0.0323  -0.0280 -0.0432 15  TRP B CZ3 
230  C  CH2 . TRP B 15  ? 0.3547 0.3557 0.4263 0.0179  -0.0036 -0.0454 15  TRP B CH2 
231  N  N   . SER B 16  ? 0.2925 0.3119 0.3749 0.0053  0.0218  -0.0326 16  SER B N   
232  C  CA  . SER B 16  ? 0.3261 0.3454 0.3606 -0.0332 0.0031  -0.0526 16  SER B CA  
233  C  C   . SER B 16  ? 0.2995 0.3420 0.3782 0.0034  -0.0048 -0.0155 16  SER B C   
234  O  O   . SER B 16  ? 0.3185 0.3196 0.3872 -0.0180 0.0286  -0.0421 16  SER B O   
235  C  CB  . SER B 16  ? 0.3510 0.3944 0.4810 -0.0881 -0.0098 -0.0654 16  SER B CB  
236  O  OG  . SER B 16  ? 0.4115 0.4526 0.5735 -0.0876 -0.0095 -0.1081 16  SER B OG  
237  N  N   . GLU B 17  ? 0.2672 0.3302 0.3641 -0.0137 -0.0153 -0.0182 17  GLU B N   
238  C  CA  . GLU B 17  ? 0.2969 0.3434 0.3644 -0.0032 -0.0177 -0.0028 17  GLU B CA  
239  C  C   . GLU B 17  ? 0.2993 0.3497 0.3147 -0.0023 -0.0200 -0.0264 17  GLU B C   
240  O  O   . GLU B 17  ? 0.2703 0.3401 0.3561 -0.0162 -0.0008 0.0075  17  GLU B O   
241  C  CB  . GLU B 17  ? 0.3642 0.3748 0.4190 0.0576  -0.0558 -0.0174 17  GLU B CB  
242  C  CG  . GLU B 17  ? 0.3819 0.4710 0.4850 0.0314  -0.0662 -0.0359 17  GLU B CG  
243  C  CD  . GLU B 17  ? 0.5953 0.5273 0.6086 0.1097  -0.0946 -0.0016 17  GLU B CD  
244  O  OE1 . GLU B 17  ? 0.6409 0.5968 0.6652 0.1577  0.0276  -0.0329 17  GLU B OE1 
245  O  OE2 . GLU B 17  ? 0.8035 0.7972 0.6279 0.1339  -0.0481 -0.0019 17  GLU B OE2 
246  N  N   . VAL B 18  ? 0.2627 0.2972 0.3237 0.0142  0.0005  -0.0246 18  VAL B N   
247  C  CA  . VAL B 18  ? 0.2815 0.3132 0.3436 0.0150  -0.0348 -0.0127 18  VAL B CA  
248  C  C   . VAL B 18  ? 0.3037 0.2987 0.3368 0.0012  0.0045  -0.0054 18  VAL B C   
249  O  O   . VAL B 18  ? 0.2842 0.2990 0.3309 0.0060  -0.0085 -0.0407 18  VAL B O   
250  C  CB  . VAL B 18  ? 0.2903 0.3085 0.3431 0.0229  -0.0405 -0.0049 18  VAL B CB  
251  C  CG1 . VAL B 18  ? 0.2879 0.3177 0.3354 0.0285  -0.0317 -0.0211 18  VAL B CG1 
252  C  CG2 . VAL B 18  ? 0.2812 0.3055 0.3811 0.0353  0.0042  -0.0474 18  VAL B CG2 
253  N  N   . ASN B 19  ? 0.3031 0.2760 0.3143 0.0119  0.0029  -0.0103 19  ASN B N   
254  C  CA  . ASN B 19  ? 0.2802 0.2863 0.3161 0.0160  0.0120  -0.0010 19  ASN B CA  
255  C  C   . ASN B 19  ? 0.3017 0.3092 0.3143 0.0066  -0.0089 -0.0116 19  ASN B C   
256  O  O   . ASN B 19  ? 0.2832 0.3170 0.3217 0.0029  0.0080  -0.0028 19  ASN B O   
257  C  CB  . ASN B 19  ? 0.3196 0.2887 0.3286 -0.0019 -0.0019 0.0215  19  ASN B CB  
258  C  CG  . ASN B 19  ? 0.3324 0.3057 0.3269 0.0167  0.0094  0.0009  19  ASN B CG  
259  O  OD1 . ASN B 19  ? 0.3073 0.3520 0.3675 0.0113  0.0097  -0.0011 19  ASN B OD1 
260  N  ND2 . ASN B 19  ? 0.3016 0.3440 0.3525 -0.0255 0.0159  -0.0096 19  ASN B ND2 
261  N  N   . ARG B 20  ? 0.2988 0.3093 0.2984 -0.0045 -0.0063 0.0043  20  ARG B N   
262  C  CA  A ARG B 20  ? 0.3130 0.3387 0.3106 -0.0089 0.0125  -0.0097 20  ARG B CA  
263  C  CA  B ARG B 20  ? 0.2997 0.3229 0.3069 -0.0019 0.0017  -0.0050 20  ARG B CA  
264  C  C   . ARG B 20  ? 0.2928 0.3048 0.3360 0.0005  0.0042  -0.0088 20  ARG B C   
265  O  O   . ARG B 20  ? 0.3021 0.2932 0.3204 -0.0129 -0.0043 -0.0433 20  ARG B O   
266  C  CB  A ARG B 20  ? 0.3319 0.3821 0.3598 -0.0081 -0.0281 -0.0139 20  ARG B CB  
267  C  CB  B ARG B 20  ? 0.2944 0.3260 0.3193 0.0024  -0.0034 -0.0160 20  ARG B CB  
268  C  CG  A ARG B 20  ? 0.4201 0.4272 0.4043 -0.0079 -0.0206 -0.0414 20  ARG B CG  
269  C  CG  B ARG B 20  ? 0.3255 0.3675 0.3302 -0.0008 -0.0025 -0.0249 20  ARG B CG  
270  C  CD  A ARG B 20  ? 0.4386 0.4523 0.4974 0.1028  -0.0750 -0.0412 20  ARG B CD  
271  C  CD  B ARG B 20  ? 0.3021 0.4216 0.3461 0.0245  0.0239  -0.0276 20  ARG B CD  
272  N  NE  A ARG B 20  ? 0.5077 0.4226 0.4923 -0.0005 -0.1497 0.0557  20  ARG B NE  
273  N  NE  B ARG B 20  ? 0.1565 0.1459 0.5974 0.0728  0.0905  -0.1102 20  ARG B NE  
274  C  CZ  A ARG B 20  ? 0.5435 0.5186 0.5075 -0.0214 -0.0040 0.0050  20  ARG B CZ  
275  C  CZ  B ARG B 20  ? 0.0554 0.0538 0.0622 0.0165  0.0206  0.0186  20  ARG B CZ  
276  N  NH1 A ARG B 20  ? 0.5263 0.5222 0.5592 0.0409  -0.0654 -0.0449 20  ARG B NH1 
277  N  NH1 B ARG B 20  ? 0.1541 0.0827 0.2112 0.0136  0.0092  0.0853  20  ARG B NH1 
278  N  NH2 A ARG B 20  ? 0.5952 0.5339 0.5936 0.0100  0.0406  0.0321  20  ARG B NH2 
279  N  NH2 B ARG B 20  ? 0.0784 0.3485 0.0643 -0.0501 0.0245  0.0175  20  ARG B NH2 
280  N  N   . TYR B 21  ? 0.2610 0.2914 0.3173 -0.0133 0.0074  -0.0006 21  TYR B N   
281  C  CA  . TYR B 21  ? 0.2725 0.2890 0.3136 -0.0058 0.0110  0.0076  21  TYR B CA  
282  C  C   . TYR B 21  ? 0.2973 0.3194 0.3081 -0.0066 -0.0189 -0.0198 21  TYR B C   
283  O  O   . TYR B 21  ? 0.2964 0.3089 0.3494 0.0170  -0.0101 -0.0205 21  TYR B O   
284  C  CB  . TYR B 21  ? 0.2745 0.2821 0.3126 -0.0013 -0.0025 -0.0021 21  TYR B CB  
285  C  CG  . TYR B 21  ? 0.2954 0.3216 0.3330 0.0077  -0.0115 0.0061  21  TYR B CG  
286  C  CD1 . TYR B 21  ? 0.3356 0.3535 0.3405 -0.0090 -0.0287 0.0078  21  TYR B CD1 
287  C  CD2 . TYR B 21  ? 0.2764 0.3245 0.3767 0.0083  -0.0006 0.0360  21  TYR B CD2 
288  C  CE1 . TYR B 21  ? 0.3858 0.3887 0.4700 0.0310  -0.0671 0.0142  21  TYR B CE1 
289  C  CE2 . TYR B 21  ? 0.2913 0.4086 0.3546 -0.0042 -0.0183 0.0454  21  TYR B CE2 
290  C  CZ  . TYR B 21  ? 0.3495 0.4450 0.4150 0.0098  -0.0293 -0.0201 21  TYR B CZ  
291  O  OH  . TYR B 21  ? 0.3893 0.4876 0.5223 0.0109  -0.0833 0.0442  21  TYR B OH  
292  N  N   . GLY B 22  ? 0.2727 0.2801 0.3121 0.0071  -0.0074 -0.0009 22  GLY B N   
293  C  CA  . GLY B 22  ? 0.3083 0.3027 0.3266 0.0330  -0.0376 -0.0058 22  GLY B CA  
294  C  C   . GLY B 22  ? 0.3008 0.3138 0.3771 0.0067  0.0209  -0.0324 22  GLY B C   
295  O  O   . GLY B 22  ? 0.2822 0.3060 0.3655 0.0286  0.0034  -0.0155 22  GLY B O   
296  N  N   . GLN B 23  ? 0.2945 0.2821 0.3415 0.0185  0.0102  -0.0168 23  GLN B N   
297  C  CA  . GLN B 23  ? 0.3205 0.2821 0.3529 0.0019  0.0287  -0.0233 23  GLN B CA  
298  C  C   . GLN B 23  ? 0.3029 0.2874 0.3267 -0.0068 0.0086  0.0079  23  GLN B C   
299  O  O   . GLN B 23  ? 0.3630 0.3414 0.4275 0.0414  0.0423  -0.0326 23  GLN B O   
300  C  CB  . GLN B 23  ? 0.3185 0.3070 0.3692 0.0021  0.0333  -0.0029 23  GLN B CB  
301  C  CG  . GLN B 23  ? 0.3684 0.3618 0.3880 0.0120  0.0500  0.0316  23  GLN B CG  
302  C  CD  . GLN B 23  ? 0.3990 0.4139 0.4314 0.0030  0.0029  0.0202  23  GLN B CD  
303  O  OE1 . GLN B 23  ? 0.4359 0.4540 0.5297 0.0565  0.0829  0.0294  23  GLN B OE1 
304  N  NE2 . GLN B 23  ? 0.4161 0.5129 0.4557 0.0075  -0.0273 -0.0035 23  GLN B NE2 
305  N  N   . ASN B 24  ? 0.2533 0.2912 0.3164 -0.0113 0.0112  0.0026  24  ASN B N   
306  C  CA  A ASN B 24  ? 0.3472 0.3403 0.3252 -0.0180 0.0176  -0.0167 24  ASN B CA  
307  C  CA  B ASN B 24  ? 0.3317 0.3286 0.3153 -0.0084 0.0072  -0.0173 24  ASN B CA  
308  C  C   . ASN B 24  ? 0.3168 0.3422 0.3293 -0.0099 0.0110  -0.0373 24  ASN B C   
309  O  O   . ASN B 24  ? 0.3201 0.3660 0.3440 -0.0177 0.0263  -0.0161 24  ASN B O   
310  C  CB  A ASN B 24  ? 0.3617 0.4459 0.4090 -0.0110 -0.0220 -0.0181 24  ASN B CB  
311  C  CB  B ASN B 24  ? 0.3520 0.3975 0.3423 -0.0004 -0.0175 -0.0308 24  ASN B CB  
312  C  CG  A ASN B 24  ? 0.3909 0.4501 0.4503 -0.0018 0.0450  -0.0195 24  ASN B CG  
313  C  CG  B ASN B 24  ? 0.3898 0.3973 0.4065 -0.0148 -0.0263 -0.0404 24  ASN B CG  
314  O  OD1 A ASN B 24  ? 0.5040 0.4434 0.5703 -0.0199 -0.0160 -0.0908 24  ASN B OD1 
315  O  OD1 B ASN B 24  ? 0.3763 0.3889 0.4884 -0.0449 -0.0934 -0.0556 24  ASN B OD1 
316  N  ND2 A ASN B 24  ? 0.4949 0.4981 0.6173 0.0428  0.0459  0.0411  24  ASN B ND2 
317  N  ND2 B ASN B 24  ? 0.3886 0.4084 0.4309 0.0211  0.0273  -0.0594 24  ASN B ND2 
318  N  N   . GLY B 25  ? 0.2668 0.2829 0.3047 0.0075  -0.0085 0.0004  25  GLY B N   
319  C  CA  . GLY B 25  ? 0.2723 0.2892 0.3150 0.0072  0.0142  0.0032  25  GLY B CA  
320  C  C   . GLY B 25  ? 0.2699 0.2992 0.2928 0.0017  -0.0127 -0.0019 25  GLY B C   
321  O  O   . GLY B 25  ? 0.2593 0.2904 0.3056 0.0223  -0.0004 -0.0027 25  GLY B O   
322  N  N   . ASP B 26  ? 0.2689 0.2778 0.3050 0.0123  -0.0184 -0.0077 26  ASP B N   
323  C  CA  . ASP B 26  ? 0.2436 0.2976 0.2704 0.0022  -0.0367 -0.0021 26  ASP B CA  
324  C  C   . ASP B 26  ? 0.2601 0.2923 0.3298 -0.0025 -0.0146 -0.0234 26  ASP B C   
325  O  O   . ASP B 26  ? 0.2448 0.2931 0.2982 0.0037  -0.0158 -0.0142 26  ASP B O   
326  C  CB  . ASP B 26  ? 0.2440 0.2990 0.2954 -0.0075 -0.0399 0.0076  26  ASP B CB  
327  C  CG  . ASP B 26  ? 0.2934 0.2936 0.3117 0.0019  -0.0169 0.0118  26  ASP B CG  
328  O  OD1 . ASP B 26  ? 0.2541 0.3058 0.3372 0.0162  -0.0312 0.0080  26  ASP B OD1 
329  O  OD2 . ASP B 26  ? 0.3030 0.3281 0.3282 0.0046  -0.0357 0.0291  26  ASP B OD2 
330  N  N   . PHE B 27  ? 0.2545 0.2632 0.3035 0.0058  -0.0251 -0.0075 27  PHE B N   
331  C  CA  . PHE B 27  ? 0.2430 0.2823 0.2866 -0.0001 -0.0357 -0.0153 27  PHE B CA  
332  C  C   . PHE B 27  ? 0.2763 0.2807 0.3014 -0.0070 -0.0227 -0.0070 27  PHE B C   
333  O  O   . PHE B 27  ? 0.2806 0.2950 0.3325 0.0219  -0.0172 -0.0206 27  PHE B O   
334  C  CB  . PHE B 27  ? 0.2427 0.2926 0.3271 0.0204  -0.0438 0.0032  27  PHE B CB  
335  C  CG  . PHE B 27  ? 0.2549 0.2731 0.2793 0.0036  -0.0076 0.0013  27  PHE B CG  
336  C  CD1 . PHE B 27  ? 0.2330 0.2859 0.2798 0.0043  -0.0109 -0.0132 27  PHE B CD1 
337  C  CD2 . PHE B 27  ? 0.2680 0.2711 0.3094 0.0157  -0.0030 0.0000  27  PHE B CD2 
338  C  CE1 . PHE B 27  ? 0.2594 0.2752 0.3367 -0.0019 -0.0341 -0.0203 27  PHE B CE1 
339  C  CE2 . PHE B 27  ? 0.2497 0.2821 0.2882 -0.0152 -0.0418 0.0119  27  PHE B CE2 
340  C  CZ  . PHE B 27  ? 0.2600 0.3090 0.2940 -0.0068 -0.0123 -0.0375 27  PHE B CZ  
341  N  N   . THR B 28  ? 0.2321 0.2790 0.3128 -0.0105 -0.0100 -0.0019 28  THR B N   
342  C  CA  . THR B 28  ? 0.2806 0.2882 0.3393 0.0016  -0.0095 0.0133  28  THR B CA  
343  C  C   . THR B 28  ? 0.2832 0.2952 0.3433 0.0032  -0.0008 -0.0040 28  THR B C   
344  O  O   . THR B 28  ? 0.2660 0.3195 0.3290 -0.0064 0.0021  -0.0267 28  THR B O   
345  C  CB  . THR B 28  ? 0.2969 0.3036 0.3564 0.0224  0.0172  0.0357  28  THR B CB  
346  O  OG1 . THR B 28  ? 0.2859 0.3286 0.3703 -0.0059 -0.0040 0.0357  28  THR B OG1 
347  C  CG2 . THR B 28  ? 0.2584 0.3009 0.3307 -0.0049 -0.0244 0.0300  28  THR B CG2 
348  N  N   . ARG B 29  ? 0.2635 0.3058 0.3357 0.0009  0.0017  0.0000  29  ARG B N   
349  C  CA  . ARG B 29  ? 0.2647 0.2959 0.3274 -0.0041 -0.0205 -0.0231 29  ARG B CA  
350  C  C   . ARG B 29  ? 0.2957 0.2848 0.3312 0.0118  -0.0145 -0.0080 29  ARG B C   
351  O  O   . ARG B 29  ? 0.2681 0.3423 0.3745 0.0331  -0.0188 -0.0163 29  ARG B O   
352  C  CB  . ARG B 29  ? 0.2357 0.3029 0.3106 0.0094  -0.0237 -0.0260 29  ARG B CB  
353  C  CG  . ARG B 29  ? 0.2538 0.3059 0.3114 0.0047  -0.0436 -0.0159 29  ARG B CG  
354  C  CD  . ARG B 29  ? 0.2856 0.3039 0.3227 -0.0260 -0.0352 -0.0096 29  ARG B CD  
355  N  NE  . ARG B 29  ? 0.2554 0.3767 0.3159 0.0011  -0.0321 -0.0224 29  ARG B NE  
356  C  CZ  . ARG B 29  ? 0.3058 0.3586 0.3154 0.0114  0.0042  0.0092  29  ARG B CZ  
357  N  NH1 . ARG B 29  ? 0.2929 0.3220 0.3289 -0.0068 -0.0094 0.0018  29  ARG B NH1 
358  N  NH2 . ARG B 29  ? 0.2733 0.3433 0.3337 0.0023  -0.0051 0.0189  29  ARG B NH2 
359  N  N   . ALA B 30  ? 0.2673 0.2802 0.3195 0.0090  -0.0197 -0.0214 30  ALA B N   
360  C  CA  . ALA B 30  ? 0.2653 0.2885 0.3027 0.0025  -0.0260 -0.0218 30  ALA B CA  
361  C  C   . ALA B 30  ? 0.3055 0.2929 0.3479 -0.0064 0.0024  -0.0237 30  ALA B C   
362  O  O   . ALA B 30  ? 0.2863 0.3296 0.3324 0.0205  -0.0083 -0.0544 30  ALA B O   
363  C  CB  . ALA B 30  ? 0.2698 0.2852 0.3415 0.0035  -0.0095 -0.0061 30  ALA B CB  
364  N  N   . LEU B 31  ? 0.2891 0.2667 0.3464 0.0083  -0.0222 -0.0014 31  LEU B N   
365  C  CA  . LEU B 31  ? 0.2832 0.2660 0.3625 -0.0021 -0.0101 -0.0097 31  LEU B CA  
366  C  C   . LEU B 31  ? 0.3062 0.3160 0.3330 0.0246  -0.0023 -0.0281 31  LEU B C   
367  O  O   . LEU B 31  ? 0.3168 0.3012 0.3832 0.0349  0.0336  -0.0388 31  LEU B O   
368  C  CB  . LEU B 31  ? 0.2772 0.2655 0.3532 -0.0143 -0.0162 -0.0129 31  LEU B CB  
369  C  CG  . LEU B 31  ? 0.3059 0.2759 0.3234 -0.0280 0.0198  -0.0214 31  LEU B CG  
370  C  CD1 . LEU B 31  ? 0.3027 0.3003 0.3216 0.0054  0.0206  -0.0390 31  LEU B CD1 
371  C  CD2 . LEU B 31  ? 0.2964 0.3154 0.4157 -0.0364 0.0425  -0.0402 31  LEU B CD2 
372  N  N   . LYS B 32  ? 0.2941 0.2800 0.3393 0.0222  -0.0139 0.0021  32  LYS B N   
373  C  CA  . LYS B 32  ? 0.3146 0.3322 0.3875 0.0418  -0.0326 0.0147  32  LYS B CA  
374  C  C   . LYS B 32  ? 0.3427 0.3229 0.3950 0.0150  -0.0048 -0.0181 32  LYS B C   
375  O  O   . LYS B 32  ? 0.3154 0.3297 0.4171 0.0003  0.0025  -0.0471 32  LYS B O   
376  C  CB  . LYS B 32  ? 0.3868 0.3594 0.3756 0.0560  -0.0172 0.0190  32  LYS B CB  
377  C  CG  . LYS B 32  ? 0.3596 0.4351 0.4401 0.0493  -0.0513 0.0353  32  LYS B CG  
378  C  CD  . LYS B 32  ? 0.2405 0.3950 0.4731 0.1850  -0.1538 0.0585  32  LYS B CD  
379  C  CE  . LYS B 32  ? 0.3344 0.4418 0.5944 0.1981  -0.2538 0.1067  32  LYS B CE  
380  N  NZ  . LYS B 32  ? 0.5848 0.6150 0.5314 0.1229  -0.1678 0.0645  32  LYS B NZ  
381  N  N   . THR B 33  ? 0.3078 0.3244 0.3761 0.0114  0.0012  -0.0087 33  THR B N   
382  C  CA  . THR B 33  ? 0.3272 0.3171 0.3420 0.0228  -0.0018 0.0174  33  THR B CA  
383  C  C   . THR B 33  ? 0.3061 0.3497 0.3649 0.0223  -0.0007 -0.0283 33  THR B C   
384  O  O   . THR B 33  ? 0.2972 0.3307 0.4199 0.0362  0.0200  -0.0180 33  THR B O   
385  C  CB  . THR B 33  ? 0.3358 0.3300 0.3592 -0.0286 -0.0008 -0.0074 33  THR B CB  
386  O  OG1 . THR B 33  ? 0.3456 0.3497 0.3786 0.0086  -0.0151 -0.0273 33  THR B OG1 
387  C  CG2 . THR B 33  ? 0.3106 0.3279 0.3913 -0.0212 -0.0170 0.0089  33  THR B CG2 
388  N  N   . VAL B 34  ? 0.3048 0.3088 0.3584 0.0528  -0.0099 -0.0175 34  VAL B N   
389  C  CA  . VAL B 34  ? 0.3149 0.3193 0.3592 0.0583  0.0094  -0.0364 34  VAL B CA  
390  C  C   . VAL B 34  ? 0.3120 0.3145 0.3781 0.0355  0.0132  -0.0168 34  VAL B C   
391  O  O   . VAL B 34  ? 0.3579 0.3315 0.3754 0.0628  -0.0086 -0.0498 34  VAL B O   
392  C  CB  . VAL B 34  ? 0.3436 0.3727 0.3809 0.0931  -0.0315 -0.0079 34  VAL B CB  
393  C  CG1 . VAL B 34  ? 0.4181 0.4410 0.4570 0.0458  -0.0394 -0.0414 34  VAL B CG1 
394  C  CG2 . VAL B 34  ? 0.4030 0.3685 0.4361 0.0379  0.0019  -0.0057 34  VAL B CG2 
395  N  N   . ASN B 35  ? 0.2704 0.2985 0.3851 0.0492  -0.0407 -0.0071 35  ASN B N   
396  C  CA  . ASN B 35  ? 0.3379 0.3034 0.4092 0.0468  0.0056  -0.0176 35  ASN B CA  
397  C  C   . ASN B 35  ? 0.3372 0.3788 0.4367 0.0354  -0.0011 -0.0465 35  ASN B C   
398  O  O   . ASN B 35  ? 0.4035 0.3712 0.5163 0.0751  0.0192  -0.0604 35  ASN B O   
399  C  CB  . ASN B 35  ? 0.3736 0.3378 0.4190 0.0196  0.0234  -0.0228 35  ASN B CB  
400  C  CG  . ASN B 35  ? 0.3753 0.3344 0.4040 0.0335  0.0096  -0.0203 35  ASN B CG  
401  O  OD1 . ASN B 35  ? 0.3955 0.4115 0.4520 0.0102  -0.0210 -0.0298 35  ASN B OD1 
402  N  ND2 . ASN B 35  ? 0.4490 0.3487 0.4653 0.0003  0.0630  -0.0118 35  ASN B ND2 
403  N  N   . LYS B 36  ? 0.3305 0.3424 0.4620 0.0489  -0.0113 -0.0452 36  LYS B N   
404  C  CA  . LYS B 36  ? 0.3349 0.3436 0.4441 0.0354  0.0147  -0.0408 36  LYS B CA  
405  C  C   . LYS B 36  ? 0.3931 0.3916 0.4458 0.0563  -0.0080 -0.0047 36  LYS B C   
406  O  O   . LYS B 36  ? 0.4366 0.4104 0.4749 0.0956  0.0032  -0.0309 36  LYS B O   
407  C  CB  . LYS B 36  ? 0.3003 0.3986 0.4143 0.0720  -0.0384 -0.0241 36  LYS B CB  
408  C  CG  . LYS B 36  ? 0.4171 0.3940 0.4458 0.0246  0.0150  0.0057  36  LYS B CG  
409  C  CD  . LYS B 36  ? 0.5233 0.5245 0.5623 -0.0272 -0.0454 -0.0435 36  LYS B CD  
410  C  CE  . LYS B 36  ? 0.6257 0.5941 0.5833 -0.0416 -0.0715 -0.0235 36  LYS B CE  
411  N  NZ  . LYS B 36  ? 0.7509 0.7002 0.6681 -0.0910 -0.0830 -0.0956 36  LYS B NZ  
412  N  N   . ILE B 37  ? 0.3248 0.3587 0.4199 0.0525  0.0123  -0.0239 37  ILE B N   
413  C  CA  . ILE B 37  ? 0.3797 0.3638 0.4044 0.0305  0.0189  -0.0291 37  ILE B CA  
414  C  C   . ILE B 37  ? 0.4129 0.3814 0.4534 -0.0213 0.0190  -0.0338 37  ILE B C   
415  O  O   . ILE B 37  ? 0.4393 0.3864 0.4951 0.0411  0.0411  -0.0280 37  ILE B O   
416  C  CB  . ILE B 37  ? 0.3126 0.3482 0.3700 0.0006  0.0139  -0.0341 37  ILE B CB  
417  C  CG1 . ILE B 37  ? 0.3102 0.3188 0.3740 0.0236  0.0232  -0.0473 37  ILE B CG1 
418  C  CG2 . ILE B 37  ? 0.3193 0.3576 0.3842 0.0316  0.0085  -0.0067 37  ILE B CG2 
419  C  CD1 . ILE B 37  ? 0.3442 0.3287 0.4166 0.0355  -0.0071 -0.0217 37  ILE B CD1 
420  N  N   . LEU B 38  ? 0.3488 0.3233 0.4696 0.0519  0.0356  -0.0322 38  LEU B N   
421  C  CA  . LEU B 38  ? 0.3978 0.3955 0.4828 0.0225  0.0006  -0.0461 38  LEU B CA  
422  C  C   . LEU B 38  ? 0.3932 0.4271 0.4807 0.0480  0.0072  -0.0305 38  LEU B C   
423  O  O   . LEU B 38  ? 0.5129 0.4336 0.5672 0.0890  0.0556  -0.0888 38  LEU B O   
424  C  CB  . LEU B 38  ? 0.3936 0.3729 0.4693 0.0074  0.0110  -0.0672 38  LEU B CB  
425  C  CG  . LEU B 38  ? 0.3752 0.4011 0.4264 0.0091  0.0120  -0.0498 38  LEU B CG  
426  C  CD1 . LEU B 38  ? 0.3588 0.3875 0.4808 0.0136  0.0183  -0.0497 38  LEU B CD1 
427  C  CD2 . LEU B 38  ? 0.4198 0.4199 0.4336 0.0654  0.0203  -0.0622 38  LEU B CD2 
428  N  N   . GLN B 39  ? 0.4138 0.4081 0.4996 0.0598  0.0060  -0.0277 39  GLN B N   
429  C  CA  . GLN B 39  ? 0.4569 0.4174 0.5120 0.0863  0.0096  -0.0127 39  GLN B CA  
430  C  C   . GLN B 39  ? 0.5096 0.4856 0.6115 0.0542  0.0741  -0.0231 39  GLN B C   
431  O  O   . GLN B 39  ? 0.5663 0.5008 0.7124 0.1152  0.0619  -0.0573 39  GLN B O   
432  C  CB  . GLN B 39  ? 0.4315 0.4102 0.5111 0.0663  0.0053  -0.0284 39  GLN B CB  
433  C  CG  . GLN B 39  ? 0.5066 0.5053 0.6193 0.0743  0.0619  0.0506  39  GLN B CG  
434  N  N   . ILE B 40  ? 0.4560 0.4494 0.5946 0.0841  0.0655  -0.0626 40  ILE B N   
435  C  CA  . ILE B 40  ? 0.4813 0.4710 0.5187 0.0587  0.0442  -0.0601 40  ILE B CA  
436  C  C   . ILE B 40  ? 0.5391 0.4900 0.5423 0.0913  0.0251  -0.0017 40  ILE B C   
437  O  O   . ILE B 40  ? 0.5616 0.5587 0.6719 0.1549  0.0699  -0.0462 40  ILE B O   
438  C  CB  . ILE B 40  ? 0.4782 0.4549 0.5570 0.0416  0.0336  -0.0180 40  ILE B CB  
439  C  CG1 . ILE B 40  ? 0.4513 0.5135 0.5776 0.0829  0.0046  -0.0384 40  ILE B CG1 
440  C  CG2 . ILE B 40  ? 0.4709 0.5180 0.6537 0.0925  0.1139  -0.0630 40  ILE B CG2 
441  C  CD1 . ILE B 40  ? 0.4617 0.4661 0.7197 0.1189  0.0367  -0.0640 40  ILE B CD1 
442  N  N   . ASN B 41  ? 0.4497 0.4777 0.5439 0.0639  0.0718  -0.1103 41  ASN B N   
443  C  CA  . ASN B 41  ? 0.5153 0.5211 0.5161 0.0597  0.0797  -0.0967 41  ASN B CA  
444  C  C   . ASN B 41  ? 0.5781 0.5283 0.6442 0.0149  0.0288  -0.1230 41  ASN B C   
445  O  O   . ASN B 41  ? 0.6036 0.5013 0.5065 0.0172  0.0452  -0.1580 41  ASN B O   
446  C  CB  . ASN B 41  ? 0.5837 0.5624 0.6125 0.0526  0.0969  -0.0386 41  ASN B CB  
447  C  CG  . ASN B 41  ? 0.6111 0.6405 0.6745 0.0339  0.0407  -0.0774 41  ASN B CG  
448  O  OD1 . ASN B 41  ? 0.6276 0.5878 0.7887 0.0367  -0.0050 -0.0221 41  ASN B OD1 
449  N  ND2 . ASN B 41  ? 0.5507 0.6928 0.7148 0.0420  0.0978  -0.0078 41  ASN B ND2 
450  N  N   . LYS B 42  ? 0.6843 0.5072 0.6492 0.0720  0.1097  -0.1859 42  LYS B N   
451  C  CA  . LYS B 42  ? 0.6446 0.6174 0.7057 0.0362  -0.0230 -0.1545 42  LYS B CA  
452  C  C   . LYS B 42  ? 0.6896 0.4260 0.5894 0.0345  0.0243  -0.1190 42  LYS B C   
453  O  O   . LYS B 42  ? 0.7068 0.5858 0.8058 0.0146  0.0589  -0.1860 42  LYS B O   
454  C  CB  . LYS B 42  ? 0.7930 0.5998 0.7406 0.0420  0.0222  -0.0896 42  LYS B CB  
455  C  CG  . LYS B 42  ? 0.8168 0.7008 0.7320 0.0248  0.0352  -0.0780 42  LYS B CG  
456  C  CD  . LYS B 42  ? 0.8246 0.6935 0.7903 0.0461  0.0324  -0.0946 42  LYS B CD  
457  C  CE  . LYS B 42  ? 0.9458 0.6935 0.8025 0.0352  -0.0198 -0.0944 42  LYS B CE  
458  N  N   . ASP B 43  ? 0.6955 0.3946 0.5806 0.0398  -0.0127 -0.1105 43  ASP B N   
459  C  CA  . ASP B 43  ? 0.6504 0.5728 0.6532 0.0425  -0.0094 -0.0399 43  ASP B CA  
460  C  C   . ASP B 43  ? 0.5178 0.5560 0.4946 0.0293  -0.0055 -0.0750 43  ASP B C   
461  O  O   . ASP B 43  ? 0.6084 0.4977 0.4582 0.1174  -0.0087 -0.1810 43  ASP B O   
462  C  CB  . ASP B 43  ? 0.7716 0.6891 0.6839 0.0580  -0.0321 -0.0879 43  ASP B CB  
463  C  CG  . ASP B 43  ? 0.8867 0.7494 0.8492 -0.0167 0.0341  -0.0527 43  ASP B CG  
464  O  OD1 . ASP B 43  ? 0.7251 0.7236 0.9358 0.0222  0.0480  -0.0841 43  ASP B OD1 
465  O  OD2 . ASP B 43  ? 0.9734 0.7976 0.9346 0.0287  -0.0045 -0.1357 43  ASP B OD2 
466  N  N   . ASP B 44  ? 0.4396 0.4880 0.4885 0.0353  0.0688  -0.0884 44  ASP B N   
467  C  CA  . ASP B 44  ? 0.4443 0.4786 0.4596 0.0390  0.0327  -0.0664 44  ASP B CA  
468  C  C   . ASP B 44  ? 0.4392 0.4339 0.4435 0.0167  0.0008  -0.0255 44  ASP B C   
469  O  O   . ASP B 44  ? 0.4396 0.4301 0.4650 0.0347  0.0626  -0.1015 44  ASP B O   
470  C  CB  . ASP B 44  ? 0.3796 0.4524 0.4700 0.0155  0.0627  -0.0734 44  ASP B CB  
471  C  CG  . ASP B 44  ? 0.4430 0.4525 0.5515 0.0220  0.0341  -0.0713 44  ASP B CG  
472  O  OD1 . ASP B 44  ? 0.4076 0.4425 0.4876 -0.0039 0.0552  -0.0953 44  ASP B OD1 
473  O  OD2 . ASP B 44  ? 0.4581 0.5193 0.5621 0.0336  0.1330  -0.1020 44  ASP B OD2 
474  N  N   . VAL B 45  ? 0.4285 0.3749 0.3827 0.0366  -0.0140 -0.0979 45  VAL B N   
475  C  CA  . VAL B 45  ? 0.4251 0.4425 0.4263 0.0249  0.0050  -0.0706 45  VAL B CA  
476  C  C   . VAL B 45  ? 0.4172 0.3900 0.4568 -0.0014 0.0371  -0.0625 45  VAL B C   
477  O  O   . VAL B 45  ? 0.4077 0.3737 0.3996 0.0228  0.0240  -0.0415 45  VAL B O   
478  C  CB  . VAL B 45  ? 0.4623 0.4637 0.4360 0.0085  -0.0044 -0.0422 45  VAL B CB  
479  C  CG1 . VAL B 45  ? 0.4769 0.4718 0.4378 0.0251  -0.0003 -0.0617 45  VAL B CG1 
480  C  CG2 . VAL B 45  ? 0.5025 0.5168 0.4930 -0.0244 0.0188  -0.0925 45  VAL B CG2 
481  N  N   . THR B 46  ? 0.3853 0.3853 0.4242 0.0213  0.0252  -0.0935 46  THR B N   
482  C  CA  . THR B 46  ? 0.3824 0.3694 0.3612 0.0302  0.0172  -0.0641 46  THR B CA  
483  C  C   . THR B 46  ? 0.3636 0.3416 0.4014 0.0187  0.0168  -0.0390 46  THR B C   
484  O  O   . THR B 46  ? 0.3497 0.3851 0.3998 0.0353  0.0327  -0.0205 46  THR B O   
485  C  CB  . THR B 46  ? 0.4461 0.3753 0.3975 0.0101  0.0390  -0.0370 46  THR B CB  
486  O  OG1 . THR B 46  ? 0.4159 0.4528 0.3819 0.0123  0.0506  -0.0442 46  THR B OG1 
487  C  CG2 . THR B 46  ? 0.4157 0.3465 0.4072 -0.0063 0.0261  -0.0394 46  THR B CG2 
488  N  N   . ALA B 47  ? 0.3242 0.3564 0.3480 0.0226  0.0221  -0.0656 47  ALA B N   
489  C  CA  . ALA B 47  ? 0.3467 0.3294 0.3949 0.0035  0.0254  -0.0276 47  ALA B CA  
490  C  C   . ALA B 47  ? 0.3440 0.3751 0.3665 -0.0066 0.0185  -0.0560 47  ALA B C   
491  O  O   . ALA B 47  ? 0.3380 0.3228 0.3472 -0.0058 0.0039  -0.0526 47  ALA B O   
492  C  CB  . ALA B 47  ? 0.3496 0.3647 0.4576 0.0188  -0.0089 -0.0683 47  ALA B CB  
493  N  N   . LEU B 48  ? 0.3260 0.3811 0.4067 0.0040  0.0210  -0.0855 48  LEU B N   
494  C  CA  . LEU B 48  ? 0.3195 0.3533 0.3939 0.0187  0.0085  -0.0756 48  LEU B CA  
495  C  C   . LEU B 48  ? 0.3451 0.3225 0.3333 0.0198  0.0229  -0.0619 48  LEU B C   
496  O  O   . LEU B 48  ? 0.3299 0.3508 0.3693 -0.0268 0.0279  -0.0925 48  LEU B O   
497  C  CB  . LEU B 48  ? 0.3515 0.3632 0.3930 0.0013  0.0176  -0.0805 48  LEU B CB  
498  C  CG  . LEU B 48  ? 0.3973 0.3917 0.3963 0.0417  0.0155  -0.0442 48  LEU B CG  
499  C  CD1 . LEU B 48  ? 0.4450 0.4527 0.4254 0.0059  0.0032  -0.0966 48  LEU B CD1 
500  C  CD2 . LEU B 48  ? 0.4212 0.3813 0.4394 0.0366  0.0180  -0.0265 48  LEU B CD2 
501  N  N   . HIS B 49  ? 0.3329 0.3174 0.3423 0.0160  -0.0044 -0.0616 49  HIS B N   
502  C  CA  . HIS B 49  ? 0.3154 0.3185 0.3281 0.0117  -0.0044 -0.0372 49  HIS B CA  
503  C  C   . HIS B 49  ? 0.3015 0.3731 0.3221 0.0098  -0.0109 -0.0346 49  HIS B C   
504  O  O   . HIS B 49  ? 0.3227 0.3474 0.3303 0.0000  0.0066  -0.0466 49  HIS B O   
505  C  CB  . HIS B 49  ? 0.3421 0.3433 0.3447 0.0169  -0.0084 -0.0170 49  HIS B CB  
506  C  CG  . HIS B 49  ? 0.3391 0.3473 0.3537 0.0185  -0.0135 -0.0310 49  HIS B CG  
507  N  ND1 . HIS B 49  ? 0.3791 0.3809 0.3733 0.0239  0.0032  -0.0184 49  HIS B ND1 
508  C  CD2 . HIS B 49  ? 0.3389 0.3605 0.3843 0.0054  -0.0030 -0.0116 49  HIS B CD2 
509  C  CE1 . HIS B 49  ? 0.3340 0.4103 0.3562 -0.0078 0.0088  -0.0289 49  HIS B CE1 
510  N  NE2 . HIS B 49  ? 0.3373 0.3585 0.3530 -0.0063 -0.0165 -0.0116 49  HIS B NE2 
511  N  N   . CYS B 50  ? 0.2828 0.3494 0.3026 0.0169  0.0026  -0.0356 50  CYS B N   
512  C  CA  . CYS B 50  ? 0.2593 0.3188 0.3063 0.0082  -0.0238 -0.0255 50  CYS B CA  
513  C  C   . CYS B 50  ? 0.2868 0.3104 0.3337 0.0093  -0.0014 -0.0270 50  CYS B C   
514  O  O   . CYS B 50  ? 0.2937 0.2821 0.3072 0.0037  -0.0132 -0.0449 50  CYS B O   
515  C  CB  . CYS B 50  ? 0.2526 0.3439 0.3410 0.0293  -0.0478 -0.0320 50  CYS B CB  
516  S  SG  . CYS B 50  ? 0.2954 0.3675 0.4038 -0.0007 0.0316  -0.0451 50  CYS B SG  
517  N  N   . LYS B 51  ? 0.2721 0.3026 0.3598 0.0008  -0.0098 -0.0293 51  LYS B N   
518  C  CA  . LYS B 51  ? 0.2939 0.3005 0.3856 0.0187  0.0143  -0.0280 51  LYS B CA  
519  C  C   . LYS B 51  ? 0.2998 0.2869 0.3227 0.0103  0.0144  -0.0181 51  LYS B C   
520  O  O   . LYS B 51  ? 0.2891 0.3016 0.3088 -0.0182 0.0049  -0.0239 51  LYS B O   
521  C  CB  . LYS B 51  ? 0.2800 0.2897 0.3825 0.0187  0.0063  -0.0218 51  LYS B CB  
522  C  CG  . LYS B 51  ? 0.3160 0.3031 0.3639 0.0271  0.0017  -0.0185 51  LYS B CG  
523  C  CD  . LYS B 51  ? 0.3463 0.3209 0.4297 0.0633  -0.0003 -0.0062 51  LYS B CD  
524  C  CE  . LYS B 51  ? 0.3673 0.3414 0.4659 0.0207  0.0092  -0.0028 51  LYS B CE  
525  N  NZ  . LYS B 51  ? 0.4157 0.3528 0.5728 0.0522  -0.0606 -0.0383 51  LYS B NZ  
526  N  N   . VAL B 52  ? 0.2857 0.2940 0.3457 0.0168  -0.0120 -0.0678 52  VAL B N   
527  C  CA  . VAL B 52  ? 0.2833 0.3126 0.3528 0.0213  -0.0158 -0.0658 52  VAL B CA  
528  C  C   . VAL B 52  ? 0.2973 0.2967 0.3179 0.0040  0.0068  -0.0372 52  VAL B C   
529  O  O   . VAL B 52  ? 0.3011 0.3364 0.3207 0.0023  0.0103  -0.0516 52  VAL B O   
530  C  CB  . VAL B 52  ? 0.3185 0.3148 0.3545 0.0496  -0.0061 -0.0521 52  VAL B CB  
531  C  CG1 . VAL B 52  ? 0.3039 0.3131 0.3540 0.0039  -0.0495 -0.0827 52  VAL B CG1 
532  C  CG2 . VAL B 52  ? 0.3209 0.3224 0.3867 0.0591  0.0321  -0.0567 52  VAL B CG2 
533  N  N   . VAL B 53  ? 0.2884 0.2902 0.3187 0.0114  -0.0070 -0.0483 53  VAL B N   
534  C  CA  . VAL B 53  ? 0.2936 0.2826 0.3095 0.0179  -0.0065 -0.0283 53  VAL B CA  
535  C  C   . VAL B 53  ? 0.2753 0.3085 0.3141 0.0091  0.0000  -0.0114 53  VAL B C   
536  O  O   . VAL B 53  ? 0.2789 0.2763 0.2909 0.0025  -0.0021 -0.0274 53  VAL B O   
537  C  CB  . VAL B 53  ? 0.2875 0.2898 0.3059 0.0115  -0.0019 -0.0235 53  VAL B CB  
538  C  CG1 . VAL B 53  ? 0.2780 0.3070 0.3260 0.0029  0.0038  -0.0445 53  VAL B CG1 
539  C  CG2 . VAL B 53  ? 0.3362 0.2874 0.3290 0.0282  -0.0432 -0.0126 53  VAL B CG2 
540  N  N   . CYS B 54  ? 0.2941 0.2794 0.3285 0.0307  -0.0081 -0.0109 54  CYS B N   
541  C  CA  . CYS B 54  ? 0.2902 0.2976 0.3305 0.0119  -0.0060 0.0085  54  CYS B CA  
542  C  C   . CYS B 54  ? 0.2691 0.3028 0.3264 0.0099  0.0024  -0.0199 54  CYS B C   
543  O  O   . CYS B 54  ? 0.3021 0.2938 0.3070 0.0189  -0.0084 -0.0122 54  CYS B O   
544  C  CB  . CYS B 54  ? 0.2731 0.3011 0.3538 0.0114  -0.0246 -0.0274 54  CYS B CB  
545  S  SG  . CYS B 54  ? 0.2858 0.3131 0.3728 0.0033  -0.0178 -0.0188 54  CYS B SG  
546  N  N   . LEU B 55  ? 0.2731 0.2992 0.3261 -0.0038 -0.0255 -0.0165 55  LEU B N   
547  C  CA  . LEU B 55  ? 0.2673 0.2948 0.3180 -0.0018 -0.0119 -0.0429 55  LEU B CA  
548  C  C   . LEU B 55  ? 0.2716 0.2771 0.2969 0.0037  -0.0091 -0.0283 55  LEU B C   
549  O  O   . LEU B 55  ? 0.2952 0.3146 0.3109 0.0129  -0.0023 -0.0362 55  LEU B O   
550  C  CB  . LEU B 55  ? 0.2955 0.2886 0.3801 0.0316  -0.0204 -0.0610 55  LEU B CB  
551  C  CG  . LEU B 55  ? 0.3075 0.3170 0.3359 0.0387  -0.0057 -0.0274 55  LEU B CG  
552  C  CD1 . LEU B 55  ? 0.3099 0.3336 0.3762 -0.0015 -0.0339 -0.0783 55  LEU B CD1 
553  C  CD2 . LEU B 55  ? 0.3067 0.3380 0.3402 0.0215  -0.0325 -0.0198 55  LEU B CD2 
554  N  N   . ILE B 56  ? 0.2857 0.2929 0.3086 0.0283  -0.0143 -0.0371 56  ILE B N   
555  C  CA  . ILE B 56  ? 0.2674 0.2751 0.2875 0.0118  -0.0379 -0.0272 56  ILE B CA  
556  C  C   . ILE B 56  ? 0.2638 0.2767 0.2848 -0.0198 -0.0009 -0.0221 56  ILE B C   
557  O  O   . ILE B 56  ? 0.2278 0.2677 0.3138 -0.0266 -0.0142 -0.0146 56  ILE B O   
558  C  CB  . ILE B 56  ? 0.2849 0.3000 0.2898 0.0116  -0.0177 -0.0155 56  ILE B CB  
559  C  CG1 . ILE B 56  ? 0.3018 0.3171 0.2983 -0.0172 -0.0197 -0.0325 56  ILE B CG1 
560  C  CG2 . ILE B 56  ? 0.2783 0.3131 0.2908 0.0093  -0.0040 -0.0418 56  ILE B CG2 
561  C  CD1 . ILE B 56  ? 0.3178 0.3159 0.3162 -0.0174 -0.0007 -0.0244 56  ILE B CD1 
562  N  N   . GLN B 57  ? 0.2408 0.2467 0.2978 0.0091  -0.0498 -0.0184 57  GLN B N   
563  C  CA  . GLN B 57  ? 0.2350 0.2884 0.2784 -0.0214 -0.0128 -0.0226 57  GLN B CA  
564  C  C   . GLN B 57  ? 0.2388 0.2879 0.3142 -0.0139 0.0119  -0.0029 57  GLN B C   
565  O  O   . GLN B 57  ? 0.2485 0.3063 0.2816 0.0000  -0.0058 -0.0089 57  GLN B O   
566  C  CB  . GLN B 57  ? 0.2451 0.2658 0.2839 -0.0258 -0.0043 -0.0113 57  GLN B CB  
567  C  CG  . GLN B 57  ? 0.2965 0.2813 0.3245 0.0163  0.0061  0.0150  57  GLN B CG  
568  C  CD  . GLN B 57  ? 0.2749 0.2797 0.3135 -0.0025 -0.0005 -0.0045 57  GLN B CD  
569  O  OE1 . GLN B 57  ? 0.2786 0.3170 0.3216 0.0258  -0.0052 -0.0009 57  GLN B OE1 
570  N  NE2 . GLN B 57  ? 0.2882 0.3101 0.3207 0.0271  0.0019  0.0117  57  GLN B NE2 
571  N  N   . ASN B 58  ? 0.2365 0.2804 0.3322 -0.0247 -0.0366 -0.0103 58  ASN B N   
572  C  CA  . ASN B 58  ? 0.2746 0.2724 0.3250 -0.0005 -0.0171 -0.0079 58  ASN B CA  
573  C  C   . ASN B 58  ? 0.3048 0.3112 0.3072 -0.0289 0.0034  0.0014  58  ASN B C   
574  O  O   . ASN B 58  ? 0.2875 0.2871 0.3274 -0.0320 -0.0246 -0.0013 58  ASN B O   
575  C  CB  . ASN B 58  ? 0.2753 0.3189 0.3145 -0.0019 -0.0304 0.0082  58  ASN B CB  
576  C  CG  . ASN B 58  ? 0.3071 0.3120 0.3381 0.0001  -0.0267 -0.0191 58  ASN B CG  
577  O  OD1 . ASN B 58  ? 0.2704 0.3216 0.3583 0.0160  -0.0246 -0.0239 58  ASN B OD1 
578  N  ND2 . ASN B 58  ? 0.2844 0.3685 0.3709 -0.0044 -0.0331 -0.0070 58  ASN B ND2 
579  N  N   . GLY B 59  ? 0.2821 0.2902 0.3705 -0.0142 -0.0264 -0.0327 59  GLY B N   
580  C  CA  . GLY B 59  ? 0.2950 0.2992 0.3809 -0.0273 -0.0069 -0.0190 59  GLY B CA  
581  C  C   . GLY B 59  ? 0.3379 0.3189 0.3985 -0.0130 0.0231  -0.0310 59  GLY B C   
582  O  O   . GLY B 59  ? 0.3406 0.3309 0.4226 -0.0350 -0.0005 -0.0245 59  GLY B O   
583  N  N   . SER B 60  ? 0.3127 0.3249 0.3419 0.0231  -0.0193 -0.0324 60  SER B N   
584  C  CA  . SER B 60  ? 0.3103 0.3154 0.3437 0.0249  -0.0314 -0.0257 60  SER B CA  
585  C  C   . SER B 60  ? 0.3176 0.3219 0.3389 0.0112  -0.0134 -0.0363 60  SER B C   
586  O  O   . SER B 60  ? 0.3197 0.3466 0.3766 -0.0160 -0.0099 -0.0670 60  SER B O   
587  C  CB  . SER B 60  ? 0.3129 0.3298 0.3742 0.0391  -0.0112 -0.0291 60  SER B CB  
588  O  OG  . SER B 60  ? 0.3899 0.3932 0.3964 0.0347  -0.0152 0.0044  60  SER B OG  
589  N  N   . PHE B 61  ? 0.3277 0.2999 0.3545 0.0023  -0.0385 -0.0480 61  PHE B N   
590  C  CA  . PHE B 61  ? 0.3201 0.3074 0.3519 0.0180  -0.0244 -0.0218 61  PHE B CA  
591  C  C   . PHE B 61  ? 0.3390 0.3439 0.3682 0.0024  -0.0009 -0.0468 61  PHE B C   
592  O  O   . PHE B 61  ? 0.3633 0.3400 0.3507 -0.0277 -0.0400 -0.0352 61  PHE B O   
593  C  CB  . PHE B 61  ? 0.3067 0.3048 0.4082 0.0127  -0.0232 -0.0347 61  PHE B CB  
594  C  CG  . PHE B 61  ? 0.2963 0.3234 0.3269 -0.0014 -0.0184 -0.0220 61  PHE B CG  
595  C  CD1 . PHE B 61  ? 0.3106 0.3061 0.4091 0.0159  -0.0376 -0.0211 61  PHE B CD1 
596  C  CD2 . PHE B 61  ? 0.2683 0.3203 0.3304 -0.0327 -0.0324 -0.0121 61  PHE B CD2 
597  C  CE1 . PHE B 61  ? 0.2679 0.3327 0.3534 -0.0240 -0.0387 -0.0392 61  PHE B CE1 
598  C  CE2 . PHE B 61  ? 0.2982 0.3084 0.4171 -0.0157 0.0090  -0.0112 61  PHE B CE2 
599  C  CZ  . PHE B 61  ? 0.2991 0.3143 0.3573 -0.0210 -0.0158 0.0300  61  PHE B CZ  
600  N  N   . LYS B 62  ? 0.3786 0.3432 0.4310 0.0247  -0.0434 -0.0121 62  LYS B N   
601  C  CA  . LYS B 62  ? 0.4074 0.3734 0.4786 0.0051  -0.0074 -0.0428 62  LYS B CA  
602  C  C   . LYS B 62  ? 0.4115 0.3564 0.4134 0.0141  -0.0159 -0.0159 62  LYS B C   
603  O  O   . LYS B 62  ? 0.4590 0.3472 0.4258 -0.0245 -0.0358 -0.0407 62  LYS B O   
604  C  CB  . LYS B 62  ? 0.4795 0.4042 0.4920 -0.0137 0.0103  -0.0226 62  LYS B CB  
605  C  CG  . LYS B 62  ? 0.4937 0.5494 0.6302 -0.0414 -0.0217 0.0347  62  LYS B CG  
606  C  CD  . LYS B 62  ? 0.6249 0.5596 0.7678 -0.1108 -0.0218 0.0654  62  LYS B CD  
607  C  CE  . LYS B 62  ? 0.6562 0.6874 0.8087 -0.0696 0.0979  -0.0188 62  LYS B CE  
608  N  N   . GLU B 63  ? 0.3942 0.3160 0.4717 0.0061  -0.0253 -0.0451 63  GLU B N   
609  C  CA  . GLU B 63  ? 0.4014 0.3269 0.4132 0.0172  -0.0087 -0.0558 63  GLU B CA  
610  C  C   . GLU B 63  ? 0.3815 0.3473 0.4122 0.0232  -0.0339 -0.0399 63  GLU B C   
611  O  O   . GLU B 63  ? 0.3648 0.3297 0.4482 -0.0012 -0.0264 -0.0654 63  GLU B O   
612  C  CB  . GLU B 63  ? 0.4338 0.3442 0.4525 0.0142  -0.0418 -0.0801 63  GLU B CB  
613  C  CG  . GLU B 63  ? 0.4602 0.4637 0.5602 0.0250  -0.0239 -0.0513 63  GLU B CG  
614  C  CD  . GLU B 63  ? 0.5787 0.5530 0.5455 -0.0145 -0.0405 -0.0280 63  GLU B CD  
615  O  OE1 . GLU B 63  ? 0.6336 0.4923 0.5723 0.0701  -0.0127 -0.0592 63  GLU B OE1 
616  O  OE2 . GLU B 63  ? 0.5712 0.5237 0.7888 0.0057  -0.0986 -0.0575 63  GLU B OE2 
617  N  N   . ALA B 64  ? 0.3342 0.3322 0.3885 0.0143  -0.0658 -0.0443 64  ALA B N   
618  C  CA  . ALA B 64  ? 0.3493 0.3445 0.3934 0.0294  0.0015  -0.0306 64  ALA B CA  
619  C  C   . ALA B 64  ? 0.3764 0.3603 0.4230 -0.0170 0.0194  -0.0588 64  ALA B C   
620  O  O   . ALA B 64  ? 0.3633 0.3765 0.3902 -0.0017 -0.0117 -0.0652 64  ALA B O   
621  C  CB  . ALA B 64  ? 0.3377 0.3358 0.4081 0.0234  -0.0090 -0.0365 64  ALA B CB  
622  N  N   . LEU B 65  ? 0.3658 0.3311 0.4749 0.0022  -0.0421 -0.0481 65  LEU B N   
623  C  CA  . LEU B 65  ? 0.4081 0.4347 0.4060 0.0077  0.0127  -0.0565 65  LEU B CA  
624  C  C   . LEU B 65  ? 0.4127 0.3950 0.4375 -0.0073 -0.0221 -0.0571 65  LEU B C   
625  O  O   . LEU B 65  ? 0.4060 0.4648 0.4768 -0.0157 0.0379  -0.0797 65  LEU B O   
626  C  CB  . LEU B 65  ? 0.4221 0.4318 0.4392 -0.0314 -0.0069 -0.0702 65  LEU B CB  
627  C  CG  . LEU B 65  ? 0.4305 0.4811 0.4362 -0.0401 -0.0228 -0.0264 65  LEU B CG  
628  C  CD1 . LEU B 65  ? 0.4104 0.4224 0.4171 -0.0505 -0.0389 -0.0590 65  LEU B CD1 
629  C  CD2 . LEU B 65  ? 0.4262 0.4827 0.5236 -0.0482 0.0069  -0.0660 65  LEU B CD2 
630  N  N   . ASN B 66  ? 0.4237 0.3603 0.5121 -0.0084 -0.0499 -0.0435 66  ASN B N   
631  C  CA  . ASN B 66  ? 0.4556 0.4329 0.4970 0.0150  0.0054  -0.0701 66  ASN B CA  
632  C  C   . ASN B 66  ? 0.4752 0.4279 0.4964 -0.0029 -0.0016 -0.0646 66  ASN B C   
633  O  O   . ASN B 66  ? 0.5349 0.3556 0.5354 0.0074  -0.0317 -0.1119 66  ASN B O   
634  C  CB  . ASN B 66  ? 0.5066 0.4861 0.5287 -0.0018 -0.0604 -0.0515 66  ASN B CB  
635  C  CG  . ASN B 66  ? 0.5931 0.5196 0.6193 0.0380  -0.0278 -0.0365 66  ASN B CG  
636  O  OD1 . ASN B 66  ? 0.7146 0.5305 0.7097 0.0308  0.0351  -0.1200 66  ASN B OD1 
637  N  ND2 . ASN B 66  ? 0.5983 0.6079 0.6314 0.1009  -0.0137 -0.0390 66  ASN B ND2 
638  N  N   . VAL B 67  ? 0.4008 0.4192 0.5144 0.0076  -0.0186 -0.0589 67  VAL B N   
639  C  CA  . VAL B 67  ? 0.4526 0.3602 0.4669 -0.0085 -0.0083 -0.0524 67  VAL B CA  
640  C  C   . VAL B 67  ? 0.4141 0.3818 0.4731 0.0051  -0.0292 -0.0729 67  VAL B C   
641  O  O   . VAL B 67  ? 0.4377 0.4171 0.5501 0.0057  0.0100  -0.1218 67  VAL B O   
642  C  CB  . VAL B 67  ? 0.4308 0.3754 0.4268 -0.0057 -0.0040 -0.0507 67  VAL B CB  
643  C  CG1 . VAL B 67  ? 0.4240 0.3201 0.4923 -0.0087 0.0071  -0.1074 67  VAL B CG1 
644  C  CG2 . VAL B 67  ? 0.3984 0.3875 0.4367 0.0175  -0.0452 -0.1016 67  VAL B CG2 
645  N  N   . ILE B 68  ? 0.4090 0.3093 0.4248 -0.0037 -0.0229 -0.1224 68  ILE B N   
646  C  CA  . ILE B 68  ? 0.4542 0.3637 0.4365 0.0029  -0.0289 -0.0838 68  ILE B CA  
647  C  C   . ILE B 68  ? 0.4757 0.4152 0.4361 -0.0409 -0.0121 -0.1031 68  ILE B C   
648  O  O   . ILE B 68  ? 0.4930 0.4691 0.4538 0.0138  -0.0162 -0.1387 68  ILE B O   
649  C  CB  . ILE B 68  ? 0.4326 0.3648 0.3911 -0.0105 -0.0171 -0.0773 68  ILE B CB  
650  C  CG1 . ILE B 68  ? 0.3662 0.3492 0.4065 0.0027  -0.0060 -0.0868 68  ILE B CG1 
651  C  CG2 . ILE B 68  ? 0.4485 0.4005 0.4143 -0.0087 -0.0511 -0.0640 68  ILE B CG2 
652  C  CD1 . ILE B 68  ? 0.3773 0.3375 0.3897 0.0064  -0.0534 -0.0991 68  ILE B CD1 
653  N  N   . ASN B 69  ? 0.4600 0.3811 0.4110 -0.0114 -0.0303 -0.0755 69  ASN B N   
654  C  CA  . ASN B 69  ? 0.5014 0.4020 0.5191 -0.0333 -0.0019 -0.1220 69  ASN B CA  
655  C  C   . ASN B 69  ? 0.5040 0.4817 0.5296 0.0157  -0.0225 -0.0869 69  ASN B C   
656  O  O   . ASN B 69  ? 0.6002 0.5579 0.5549 -0.0418 0.0019  -0.1329 69  ASN B O   
657  C  CB  . ASN B 69  ? 0.5132 0.3994 0.5218 -0.0372 -0.0060 -0.1244 69  ASN B CB  
658  C  CG  . ASN B 69  ? 0.5078 0.4209 0.4732 -0.0435 -0.0040 -0.1100 69  ASN B CG  
659  O  OD1 . ASN B 69  ? 0.5208 0.4525 0.5228 0.0344  -0.0608 -0.0940 69  ASN B OD1 
660  N  ND2 . ASN B 69  ? 0.5159 0.4372 0.5262 -0.1130 0.0056  -0.1669 69  ASN B ND2 
661  N  N   . THR B 70  ? 0.5043 0.3864 0.5282 -0.0241 -0.0329 -0.1447 70  THR B N   
662  C  CA  . THR B 70  ? 0.5528 0.4680 0.5240 0.0383  0.0004  -0.0758 70  THR B CA  
663  C  C   . THR B 70  ? 0.5189 0.5110 0.6233 0.0256  -0.0125 -0.0510 70  THR B C   
664  O  O   . THR B 70  ? 0.5769 0.4722 0.6737 0.0525  -0.0238 -0.1811 70  THR B O   
665  C  CB  . THR B 70  ? 0.5675 0.4738 0.5446 0.0019  -0.0203 -0.0477 70  THR B CB  
666  O  OG1 . THR B 70  ? 0.5887 0.4516 0.6125 0.0519  -0.0055 -0.0890 70  THR B OG1 
667  C  CG2 . THR B 70  ? 0.5625 0.4450 0.5462 0.0386  0.0054  -0.0375 70  THR B CG2 
668  N  N   . HIS B 71  ? 0.5627 0.4793 0.5197 -0.0200 -0.0058 -0.0783 71  HIS B N   
669  C  CA  . HIS B 71  ? 0.5000 0.4815 0.5131 -0.0042 0.0115  -0.1185 71  HIS B CA  
670  C  C   . HIS B 71  ? 0.4750 0.4954 0.4905 0.0237  0.0653  -0.1154 71  HIS B C   
671  O  O   . HIS B 71  ? 0.5090 0.5178 0.4954 -0.0084 0.0481  -0.1223 71  HIS B O   
672  C  CB  . HIS B 71  ? 0.4580 0.4241 0.5010 0.0065  -0.0062 -0.0717 71  HIS B CB  
673  C  CG  . HIS B 71  ? 0.4674 0.3560 0.4735 -0.0063 -0.0088 -0.0932 71  HIS B CG  
674  N  ND1 . HIS B 71  ? 0.4989 0.4412 0.5138 0.0434  0.0168  -0.0546 71  HIS B ND1 
675  C  CD2 . HIS B 71  ? 0.4914 0.4680 0.5308 0.0416  0.0029  -0.0473 71  HIS B CD2 
676  C  CE1 . HIS B 71  ? 0.4668 0.4611 0.5507 -0.0341 -0.0291 -0.0694 71  HIS B CE1 
677  N  NE2 . HIS B 71  ? 0.5087 0.4808 0.4982 0.0708  0.0158  -0.0836 71  HIS B NE2 
678  N  N   . THR B 72  ? 0.5144 0.5954 0.5604 -0.0068 0.0130  -0.1152 72  THR B N   
679  C  CA  . THR B 72  ? 0.5790 0.6456 0.6231 -0.0299 -0.0144 -0.0324 72  THR B CA  
680  C  C   . THR B 72  ? 0.6186 0.6453 0.6252 -0.0409 -0.0060 -0.0587 72  THR B C   
681  O  O   . THR B 72  ? 0.7201 0.6797 0.5442 -0.0527 -0.1220 -0.0575 72  THR B O   
682  C  CB  . THR B 72  ? 0.6344 0.6202 0.6258 -0.0542 -0.0277 -0.0285 72  THR B CB  
683  O  OG1 . THR B 72  ? 0.5657 0.6293 0.6535 -0.1253 -0.0183 -0.1091 72  THR B OG1 
684  C  CG2 . THR B 72  ? 0.6108 0.6408 0.6471 -0.0541 -0.0446 -0.0179 72  THR B CG2 
685  N  N   . LYS B 73  ? 0.6136 0.6778 0.6965 -0.0289 -0.0032 -0.1032 73  LYS B N   
686  C  CA  . LYS B 73  ? 0.7234 0.7051 0.7365 -0.0389 0.0058  -0.0004 73  LYS B CA  
687  C  C   . LYS B 73  ? 0.7575 0.7217 0.6843 -0.0606 -0.0136 -0.0217 73  LYS B C   
688  O  O   . LYS B 73  ? 0.7654 0.7545 0.6117 -0.1863 -0.0665 -0.0533 73  LYS B O   
689  C  CB  . LYS B 73  ? 0.7814 0.7630 0.7433 -0.0036 0.0131  -0.0683 73  LYS B CB  
690  N  N   . VAL B 74  ? 0.6665 0.7117 0.6739 -0.0427 0.0271  -0.0396 74  VAL B N   
691  C  CA  . VAL B 74  ? 0.7194 0.7010 0.6307 -0.0237 -0.0052 -0.0484 74  VAL B CA  
692  C  C   . VAL B 74  ? 0.6950 0.6803 0.6016 -0.0603 -0.0030 -0.0628 74  VAL B C   
693  O  O   . VAL B 74  ? 0.7691 0.6829 0.5264 -0.1010 0.0375  -0.1058 74  VAL B O   
694  C  CB  . VAL B 74  ? 0.6256 0.6427 0.7158 0.0064  -0.0389 -0.0466 74  VAL B CB  
695  C  CG1 . VAL B 74  ? 0.6358 0.6985 0.6727 -0.0112 0.0203  -0.0928 74  VAL B CG1 
696  C  CG2 . VAL B 74  ? 0.6623 0.6495 0.6874 0.0030  0.0126  -0.1060 74  VAL B CG2 
697  N  N   . LEU B 75  ? 0.6454 0.6876 0.5701 0.0037  -0.0477 -0.1389 75  LEU B N   
698  C  CA  . LEU B 75  ? 0.6735 0.6504 0.6275 -0.0113 0.0115  -0.0538 75  LEU B CA  
699  C  C   . LEU B 75  ? 0.7431 0.7601 0.7497 0.0586  -0.0323 0.0299  75  LEU B C   
700  O  O   . LEU B 75  ? 0.6225 0.7858 0.7839 0.0345  -0.0547 0.1115  75  LEU B O   
701  C  CB  . LEU B 75  ? 0.5354 0.5038 0.5648 0.0140  -0.0581 -0.0606 75  LEU B CB  
702  C  CG  . LEU B 75  ? 0.4919 0.4540 0.5145 -0.0116 0.0136  -0.0292 75  LEU B CG  
703  C  CD1 . LEU B 75  ? 0.4690 0.4272 0.5458 0.0006  0.0288  -0.0271 75  LEU B CD1 
704  C  CD2 . LEU B 75  ? 0.4495 0.4629 0.5361 0.0249  0.0274  -0.0919 75  LEU B CD2 
705  N  N   . ALA B 76  ? 0.9938 0.8763 0.7684 -0.0285 -0.0405 -0.0280 76  ALA B N   
706  C  CA  . ALA B 76  ? 0.9668 0.8935 0.8691 -0.0246 -0.1133 -0.0210 76  ALA B CA  
707  C  C   . ALA B 76  ? 0.8797 0.9235 0.9110 0.0011  -0.0905 0.0214  76  ALA B C   
708  O  O   . ALA B 76  ? 0.8846 1.0103 0.6996 -0.0765 -0.1534 -0.0382 76  ALA B O   
709  C  CB  . ALA B 76  ? 1.0582 0.9460 0.8478 -0.0146 -0.1079 -0.0218 76  ALA B CB  
710  N  N   . ASN B 77  ? 0.9188 0.9349 0.9925 0.0164  -0.1241 0.0134  77  ASN B N   
711  C  CA  . ASN B 77  ? 0.8511 0.8908 0.8325 -0.0337 -0.0413 -0.0194 77  ASN B CA  
712  C  C   . ASN B 77  ? 0.8386 0.7984 0.7690 0.0022  0.0055  0.0126  77  ASN B C   
713  O  O   . ASN B 77  ? 0.8942 0.8035 0.6318 0.0040  -0.0191 0.0086  77  ASN B O   
714  C  CB  . ASN B 77  ? 0.8919 0.9241 0.8331 -0.0760 -0.0386 -0.0073 77  ASN B CB  
715  C  CG  . ASN B 77  ? 0.8937 1.0721 0.7629 -0.0618 -0.1212 0.1073  77  ASN B CG  
716  N  N   A ASN B 78  ? 0.7722 0.8299 0.7882 -0.0266 -0.0616 0.0011  78  ASN B N   
717  N  N   B ASN B 78  ? 0.6935 0.7772 0.7684 -0.0339 -0.0511 -0.0130 78  ASN B N   
718  C  CA  A ASN B 78  ? 0.7627 0.7828 0.7735 -0.0237 0.0155  0.0052  78  ASN B CA  
719  C  CA  B ASN B 78  ? 0.6649 0.6717 0.6553 0.0194  0.0257  -0.0141 78  ASN B CA  
720  C  C   A ASN B 78  ? 0.6661 0.7896 0.6815 -0.0449 -0.0659 -0.0110 78  ASN B C   
721  C  C   B ASN B 78  ? 0.5774 0.6580 0.6123 -0.0248 -0.0356 -0.0426 78  ASN B C   
722  O  O   A ASN B 78  ? 0.5494 0.8607 0.7206 -0.0634 -0.1994 -0.0950 78  ASN B O   
723  O  O   B ASN B 78  ? 0.4614 0.6242 0.5418 -0.0381 0.0765  -0.0681 78  ASN B O   
724  C  CB  A ASN B 78  ? 0.7993 0.8026 0.7783 0.0003  -0.0247 0.0076  78  ASN B CB  
725  C  CB  B ASN B 78  ? 0.6679 0.6663 0.6226 0.0193  0.0081  -0.0334 78  ASN B CB  
726  C  CG  A ASN B 78  ? 0.8488 0.8324 0.8133 0.0016  0.0124  0.0198  78  ASN B CG  
727  C  CG  B ASN B 78  ? 0.6366 0.6236 0.6672 0.0276  0.0177  0.0294  78  ASN B CG  
728  O  OD1 A ASN B 78  ? 0.8366 0.9441 0.9004 0.0119  -0.0001 0.0280  78  ASN B OD1 
729  O  OD1 B ASN B 78  ? 0.6962 0.6549 0.5840 0.0032  0.0813  -0.0320 78  ASN B OD1 
730  N  ND2 A ASN B 78  ? 0.9338 0.8140 0.7583 0.0183  0.0240  0.0054  78  ASN B ND2 
731  N  ND2 B ASN B 78  ? 0.5542 0.6408 0.6387 0.0323  0.0676  -0.0019 78  ASN B ND2 
732  N  N   A SER B 79  ? 0.6455 0.5709 0.5168 -0.0095 -0.0325 0.0054  79  SER B N   
733  N  N   B SER B 79  ? 0.5754 0.5385 0.5541 0.0362  -0.0041 -0.0341 79  SER B N   
734  C  CA  A SER B 79  ? 0.5284 0.5866 0.5202 -0.0030 0.0150  -0.0408 79  SER B CA  
735  C  CA  B SER B 79  ? 0.4807 0.5188 0.4967 -0.0169 -0.0109 -0.0240 79  SER B CA  
736  C  C   A SER B 79  ? 0.5192 0.5038 0.5057 0.0027  -0.0081 -0.0293 79  SER B C   
737  C  C   B SER B 79  ? 0.4510 0.4563 0.4968 -0.0330 -0.0695 -0.0006 79  SER B C   
738  O  O   A SER B 79  ? 0.5733 0.5132 0.4594 -0.0272 -0.0150 -0.0618 79  SER B O   
739  O  O   B SER B 79  ? 0.5184 0.5008 0.5508 -0.0155 -0.0213 -0.0122 79  SER B O   
740  C  CB  A SER B 79  ? 0.5664 0.6059 0.5582 -0.0244 -0.0067 -0.0504 79  SER B CB  
741  C  CB  B SER B 79  ? 0.5272 0.5193 0.5885 -0.0423 0.0102  0.0068  79  SER B CB  
742  O  OG  A SER B 79  ? 0.6958 0.5320 0.5876 -0.1496 -0.0085 -0.1572 79  SER B OG  
743  O  OG  B SER B 79  ? 0.5091 0.4862 0.6097 -0.0898 0.0829  -0.0489 79  SER B OG  
744  N  N   A LEU B 80  ? 0.4448 0.4848 0.4638 -0.0646 0.0246  0.0061  80  LEU B N   
745  N  N   B LEU B 80  ? 0.3804 0.4445 0.3869 0.0063  -0.0448 -0.0267 80  LEU B N   
746  C  CA  A LEU B 80  ? 0.3983 0.4957 0.4465 -0.0428 -0.0301 -0.0344 80  LEU B CA  
747  C  CA  B LEU B 80  ? 0.3736 0.4433 0.4016 -0.0098 -0.0193 -0.0375 80  LEU B CA  
748  C  C   A LEU B 80  ? 0.3964 0.3834 0.3855 -0.0148 -0.0060 -0.0389 80  LEU B C   
749  C  C   B LEU B 80  ? 0.3817 0.3813 0.3805 -0.0073 -0.0047 -0.0455 80  LEU B C   
750  O  O   A LEU B 80  ? 0.3255 0.4006 0.3873 -0.0317 -0.0121 -0.0639 80  LEU B O   
751  O  O   B LEU B 80  ? 0.3461 0.4084 0.3907 -0.0373 -0.0102 -0.0548 80  LEU B O   
752  C  CB  A LEU B 80  ? 0.4473 0.4790 0.4595 -0.0373 -0.0042 -0.0155 80  LEU B CB  
753  C  CB  B LEU B 80  ? 0.4290 0.3819 0.3743 0.0003  0.0095  -0.0883 80  LEU B CB  
754  C  CG  A LEU B 80  ? 0.4306 0.5547 0.5151 -0.0429 -0.0215 0.0220  80  LEU B CG  
755  C  CG  B LEU B 80  ? 0.4028 0.4929 0.4339 -0.0150 -0.0209 -0.0188 80  LEU B CG  
756  C  CD1 A LEU B 80  ? 0.3581 0.6352 0.4532 0.0340  0.0302  -0.0625 80  LEU B CD1 
757  C  CD1 B LEU B 80  ? 0.3797 0.5346 0.4197 0.0037  0.0493  -0.0665 80  LEU B CD1 
758  C  CD2 A LEU B 80  ? 0.5180 0.5024 0.5621 -0.0205 -0.0514 -0.0118 80  LEU B CD2 
759  C  CD2 B LEU B 80  ? 0.4170 0.4585 0.5071 0.0155  0.0125  -0.0503 80  LEU B CD2 
760  N  N   . SER B 81  ? 0.3624 0.4127 0.3828 0.0041  -0.0163 -0.0741 81  SER B N   
761  C  CA  . SER B 81  ? 0.3646 0.4701 0.3851 0.0020  -0.0048 -0.0674 81  SER B CA  
762  C  C   . SER B 81  ? 0.3656 0.3735 0.3406 -0.0108 -0.0236 -0.0388 81  SER B C   
763  O  O   . SER B 81  ? 0.3678 0.4090 0.3396 -0.0476 -0.0411 -0.0650 81  SER B O   
764  C  CB  . SER B 81  ? 0.4084 0.5279 0.4210 0.0373  -0.0511 -0.0585 81  SER B CB  
765  O  OG  . SER B 81  ? 0.4591 0.5657 0.4109 -0.0408 -0.0667 -0.1127 81  SER B OG  
766  N  N   . PHE B 82  ? 0.3222 0.3894 0.3546 0.0044  -0.0131 -0.0642 82  PHE B N   
767  C  CA  . PHE B 82  ? 0.2976 0.3222 0.3284 -0.0226 -0.0343 -0.0586 82  PHE B CA  
768  C  C   . PHE B 82  ? 0.3102 0.3101 0.3357 -0.0146 -0.0046 -0.0512 82  PHE B C   
769  O  O   . PHE B 82  ? 0.2768 0.3246 0.3329 -0.0370 -0.0347 -0.0593 82  PHE B O   
770  C  CB  . PHE B 82  ? 0.3296 0.3176 0.3512 -0.0224 -0.0103 -0.0439 82  PHE B CB  
771  C  CG  . PHE B 82  ? 0.3356 0.3383 0.3394 0.0065  -0.0266 -0.0426 82  PHE B CG  
772  C  CD1 . PHE B 82  ? 0.2884 0.3616 0.3329 -0.0286 -0.0469 -0.0105 82  PHE B CD1 
773  C  CD2 . PHE B 82  ? 0.3325 0.3694 0.3203 -0.0380 -0.0213 -0.0221 82  PHE B CD2 
774  C  CE1 . PHE B 82  ? 0.3563 0.3940 0.3511 -0.0173 -0.0388 -0.0405 82  PHE B CE1 
775  C  CE2 . PHE B 82  ? 0.3376 0.3469 0.3447 0.0128  -0.0548 -0.0456 82  PHE B CE2 
776  C  CZ  . PHE B 82  ? 0.3179 0.3920 0.3772 -0.0121 -0.0322 -0.0535 82  PHE B CZ  
777  N  N   . GLU B 83  ? 0.3031 0.3192 0.3401 -0.0060 0.0041  -0.0513 83  GLU B N   
778  C  CA  . GLU B 83  ? 0.3160 0.3190 0.3816 -0.0180 -0.0399 -0.0295 83  GLU B CA  
779  C  C   . GLU B 83  ? 0.3140 0.3093 0.3325 -0.0093 -0.0285 -0.0021 83  GLU B C   
780  O  O   . GLU B 83  ? 0.3104 0.3079 0.3286 -0.0176 -0.0078 -0.0387 83  GLU B O   
781  C  CB  . GLU B 83  ? 0.3037 0.3240 0.4279 -0.0107 -0.0193 -0.0542 83  GLU B CB  
782  C  CG  . GLU B 83  ? 0.3119 0.3356 0.3564 -0.0187 -0.0036 -0.0542 83  GLU B CG  
783  C  CD  . GLU B 83  ? 0.3825 0.3814 0.4010 -0.0270 0.0306  -0.0284 83  GLU B CD  
784  O  OE1 . GLU B 83  ? 0.3262 0.4445 0.4066 -0.0382 0.0080  -0.0040 83  GLU B OE1 
785  O  OE2 . GLU B 83  ? 0.3635 0.4197 0.4776 -0.0371 -0.0057 -0.0527 83  GLU B OE2 
786  N  N   . LYS B 84  ? 0.3628 0.3245 0.3876 -0.0055 -0.0133 -0.0481 84  LYS B N   
787  C  CA  . LYS B 84  ? 0.3316 0.3525 0.3481 -0.0250 -0.0231 -0.0662 84  LYS B CA  
788  C  C   . LYS B 84  ? 0.3395 0.3199 0.3199 -0.0215 -0.0097 -0.0494 84  LYS B C   
789  O  O   . LYS B 84  ? 0.3327 0.3455 0.3329 -0.0552 -0.0183 -0.0556 84  LYS B O   
790  C  CB  . LYS B 84  ? 0.3384 0.3468 0.3623 -0.0131 0.0120  -0.0655 84  LYS B CB  
791  C  CG  . LYS B 84  ? 0.3758 0.3723 0.4155 -0.0338 -0.0177 -0.0797 84  LYS B CG  
792  C  CD  . LYS B 84  ? 0.4623 0.4477 0.4517 -0.0044 -0.0065 -0.1401 84  LYS B CD  
793  C  CE  . LYS B 84  ? 0.4511 0.4804 0.5462 -0.0695 -0.0149 -0.0706 84  LYS B CE  
794  N  NZ  . LYS B 84  ? 0.5137 0.5138 0.6066 -0.0166 -0.1164 -0.1281 84  LYS B NZ  
795  N  N   . ALA B 85  ? 0.3329 0.3538 0.2990 -0.0168 -0.0445 -0.0659 85  ALA B N   
796  C  CA  . ALA B 85  ? 0.3285 0.3665 0.3316 -0.0239 -0.0219 -0.0306 85  ALA B CA  
797  C  C   . ALA B 85  ? 0.3202 0.3558 0.3486 -0.0386 -0.0118 -0.0440 85  ALA B C   
798  O  O   . ALA B 85  ? 0.2934 0.3240 0.3301 -0.0509 -0.0430 -0.0674 85  ALA B O   
799  C  CB  . ALA B 85  ? 0.3296 0.3808 0.3367 -0.0119 -0.0821 -0.0531 85  ALA B CB  
800  N  N   . TYR B 86  ? 0.2956 0.3418 0.3410 -0.0088 -0.0233 -0.0534 86  TYR B N   
801  C  CA  . TYR B 86  ? 0.2629 0.3269 0.3239 -0.0359 -0.0506 -0.0344 86  TYR B CA  
802  C  C   . TYR B 86  ? 0.2725 0.3184 0.3433 -0.0397 -0.0173 -0.0357 86  TYR B C   
803  O  O   . TYR B 86  ? 0.3012 0.3212 0.2920 -0.0216 -0.0284 -0.0317 86  TYR B O   
804  C  CB  . TYR B 86  ? 0.2412 0.3131 0.3089 -0.0324 -0.0206 -0.0467 86  TYR B CB  
805  C  CG  . TYR B 86  ? 0.2671 0.3012 0.2985 -0.0194 -0.0267 -0.0264 86  TYR B CG  
806  C  CD1 . TYR B 86  ? 0.2757 0.3446 0.3417 0.0082  -0.0290 -0.0460 86  TYR B CD1 
807  C  CD2 . TYR B 86  ? 0.2881 0.3105 0.2908 -0.0259 -0.0198 -0.0043 86  TYR B CD2 
808  C  CE1 . TYR B 86  ? 0.3400 0.3220 0.2992 -0.0039 -0.0318 -0.0131 86  TYR B CE1 
809  C  CE2 . TYR B 86  ? 0.3110 0.3129 0.3343 0.0117  -0.0018 -0.0401 86  TYR B CE2 
810  C  CZ  . TYR B 86  ? 0.2827 0.2968 0.3160 -0.0088 -0.0353 -0.0288 86  TYR B CZ  
811  O  OH  . TYR B 86  ? 0.2953 0.3186 0.3130 -0.0026 -0.0441 -0.0267 86  TYR B OH  
812  N  N   . CYS B 87  ? 0.3021 0.2973 0.3524 -0.0326 -0.0406 -0.0449 87  CYS B N   
813  C  CA  . CYS B 87  ? 0.3120 0.3344 0.3708 -0.0358 -0.0305 -0.0127 87  CYS B CA  
814  C  C   . CYS B 87  ? 0.2993 0.3404 0.3417 -0.0323 -0.0256 -0.0243 87  CYS B C   
815  O  O   . CYS B 87  ? 0.3198 0.3421 0.3586 -0.0491 -0.0338 -0.0292 87  CYS B O   
816  C  CB  . CYS B 87  ? 0.3277 0.3043 0.4220 -0.0237 -0.0428 -0.0606 87  CYS B CB  
817  S  SG  . CYS B 87  ? 0.3336 0.3671 0.4293 -0.0314 -0.0611 -0.0250 87  CYS B SG  
818  N  N   . GLU B 88  ? 0.3218 0.3375 0.3748 -0.0084 -0.0649 -0.0429 88  GLU B N   
819  C  CA  . GLU B 88  ? 0.3441 0.3573 0.3775 -0.0496 -0.0402 -0.0358 88  GLU B CA  
820  C  C   . GLU B 88  ? 0.3559 0.3553 0.3727 -0.0333 -0.0372 -0.0156 88  GLU B C   
821  O  O   . GLU B 88  ? 0.4206 0.3730 0.4173 -0.0534 -0.0102 0.0085  88  GLU B O   
822  C  CB  . GLU B 88  ? 0.3599 0.3766 0.3772 -0.0154 -0.0258 -0.0658 88  GLU B CB  
823  C  CG  . GLU B 88  ? 0.3631 0.3798 0.4098 -0.0153 -0.0108 -0.0811 88  GLU B CG  
824  C  CD  . GLU B 88  ? 0.4028 0.4530 0.4233 -0.0216 -0.0454 -0.0415 88  GLU B CD  
825  O  OE1 . GLU B 88  ? 0.4192 0.4108 0.5001 -0.0220 -0.0241 -0.0788 88  GLU B OE1 
826  O  OE2 . GLU B 88  ? 0.4901 0.5095 0.5075 -0.0194 -0.0792 -0.1551 88  GLU B OE2 
827  N  N   . TYR B 89  ? 0.3365 0.3555 0.3672 -0.0114 -0.0575 -0.0335 89  TYR B N   
828  C  CA  . TYR B 89  ? 0.3158 0.3397 0.3709 -0.0367 -0.0440 -0.0221 89  TYR B CA  
829  C  C   . TYR B 89  ? 0.3452 0.3878 0.3791 -0.0278 -0.0315 -0.0095 89  TYR B C   
830  O  O   . TYR B 89  ? 0.3467 0.3797 0.4277 -0.0402 -0.0130 -0.0267 89  TYR B O   
831  C  CB  . TYR B 89  ? 0.3099 0.3398 0.3726 -0.0260 -0.0404 -0.0181 89  TYR B CB  
832  C  CG  . TYR B 89  ? 0.3647 0.3781 0.3871 -0.0016 -0.0222 -0.0264 89  TYR B CG  
833  C  CD1 . TYR B 89  ? 0.3508 0.3749 0.4072 -0.0203 -0.0245 -0.0459 89  TYR B CD1 
834  C  CD2 . TYR B 89  ? 0.3914 0.3968 0.3917 0.0044  -0.0286 -0.0442 89  TYR B CD2 
835  C  CE1 . TYR B 89  ? 0.3491 0.4116 0.4293 -0.0262 0.0190  -0.0404 89  TYR B CE1 
836  C  CE2 . TYR B 89  ? 0.4070 0.4028 0.4175 0.0332  -0.0198 -0.0280 89  TYR B CE2 
837  C  CZ  . TYR B 89  ? 0.3720 0.4290 0.3800 -0.0270 0.0107  -0.0254 89  TYR B CZ  
838  O  OH  . TYR B 89  ? 0.4650 0.4111 0.4486 0.0000  -0.0058 -0.0378 89  TYR B OH  
839  N  N   . ARG B 90  ? 0.3288 0.3534 0.3823 -0.0204 -0.0300 0.0023  90  ARG B N   
840  C  CA  . ARG B 90  ? 0.3152 0.3639 0.3720 -0.0582 -0.0330 -0.0155 90  ARG B CA  
841  C  C   . ARG B 90  ? 0.3510 0.3736 0.3845 -0.0481 -0.0179 0.0056  90  ARG B C   
842  O  O   . ARG B 90  ? 0.3772 0.4019 0.4055 -0.0919 -0.0049 0.0349  90  ARG B O   
843  C  CB  . ARG B 90  ? 0.3085 0.3361 0.3556 -0.0313 -0.0425 -0.0184 90  ARG B CB  
844  C  CG  . ARG B 90  ? 0.2740 0.3282 0.3209 -0.0059 -0.0355 -0.0114 90  ARG B CG  
845  C  CD  . ARG B 90  ? 0.3164 0.3611 0.3273 0.0052  -0.0207 -0.0276 90  ARG B CD  
846  N  NE  . ARG B 90  ? 0.2978 0.3690 0.3450 -0.0067 -0.0077 -0.0043 90  ARG B NE  
847  C  CZ  . ARG B 90  ? 0.3598 0.3792 0.3447 -0.0190 -0.0211 -0.0094 90  ARG B CZ  
848  N  NH1 . ARG B 90  ? 0.3077 0.3177 0.3843 0.0334  -0.0406 0.0090  90  ARG B NH1 
849  N  NH2 . ARG B 90  ? 0.3395 0.3664 0.3417 0.0441  0.0000  -0.0005 90  ARG B NH2 
850  N  N   . LEU B 91  ? 0.3724 0.3647 0.4383 -0.0212 -0.0430 -0.0134 91  LEU B N   
851  C  CA  . LEU B 91  ? 0.3796 0.3751 0.4134 -0.0383 -0.0092 0.0212  91  LEU B CA  
852  C  C   . LEU B 91  ? 0.4197 0.4521 0.5506 -0.0426 -0.0691 -0.0070 91  LEU B C   
853  O  O   . LEU B 91  ? 0.4418 0.4598 0.5969 -0.0668 -0.0809 -0.0150 91  LEU B O   
854  C  CB  . LEU B 91  ? 0.3825 0.3177 0.4388 -0.0581 -0.0595 -0.0270 91  LEU B CB  
855  C  CG  . LEU B 91  ? 0.3685 0.3453 0.4044 -0.0562 -0.0376 -0.0225 91  LEU B CG  
856  C  CD1 . LEU B 91  ? 0.4243 0.3601 0.5100 0.0007  -0.0087 -0.0272 91  LEU B CD1 
857  C  CD2 . LEU B 91  ? 0.4067 0.4010 0.4314 -0.0657 -0.0415 0.0106  91  LEU B CD2 
858  N  N   . ASN B 92  ? 0.4057 0.4407 0.4878 -0.0430 -0.0241 0.0204  92  ASN B N   
859  C  CA  . ASN B 92  ? 0.4216 0.5279 0.4975 -0.0466 -0.0232 0.0046  92  ASN B CA  
860  C  C   . ASN B 92  ? 0.4554 0.5606 0.4914 -0.0740 -0.0146 0.0070  92  ASN B C   
861  O  O   . ASN B 92  ? 0.5164 0.5944 0.5940 -0.1340 -0.0536 -0.0358 92  ASN B O   
862  C  CB  . ASN B 92  ? 0.4766 0.5473 0.5910 -0.0875 0.0158  0.0363  92  ASN B CB  
863  C  CG  . ASN B 92  ? 0.5579 0.6450 0.6916 0.0076  0.0290  -0.0316 92  ASN B CG  
864  N  N   . ARG B 93  ? 0.4264 0.4624 0.4791 -0.0674 -0.0413 -0.0142 93  ARG B N   
865  C  CA  . ARG B 93  ? 0.4470 0.4591 0.4840 -0.0463 -0.0345 -0.0333 93  ARG B CA  
866  C  C   . ARG B 93  ? 0.4505 0.4363 0.4909 -0.0316 -0.0005 -0.0452 93  ARG B C   
867  O  O   . ARG B 93  ? 0.4467 0.4523 0.4513 -0.0604 -0.0204 -0.0880 93  ARG B O   
868  C  CB  . ARG B 93  ? 0.4027 0.4300 0.5246 -0.0802 -0.0682 -0.0487 93  ARG B CB  
869  C  CG  . ARG B 93  ? 0.5361 0.4804 0.6261 -0.0462 -0.0660 0.0073  93  ARG B CG  
870  C  CD  . ARG B 93  ? 0.5230 0.5349 0.6364 -0.0688 -0.0841 -0.0432 93  ARG B CD  
871  N  NE  . ARG B 93  ? 0.5150 0.5155 0.6598 -0.0777 -0.0722 -0.0284 93  ARG B NE  
872  C  CZ  . ARG B 93  ? 0.5929 0.4402 0.6175 -0.0024 0.0028  -0.0443 93  ARG B CZ  
873  N  NH1 . ARG B 93  ? 0.5381 0.5319 0.7257 -0.0525 0.0355  -0.0289 93  ARG B NH1 
874  N  NH2 . ARG B 93  ? 0.6726 0.5050 0.6204 -0.0570 -0.0613 -0.0446 93  ARG B NH2 
875  N  N   . ILE B 94  ? 0.4115 0.4057 0.4981 -0.0781 -0.0497 -0.0330 94  ILE B N   
876  C  CA  . ILE B 94  ? 0.3881 0.4407 0.4402 -0.0354 -0.0940 -0.0439 94  ILE B CA  
877  C  C   . ILE B 94  ? 0.4796 0.4470 0.4458 -0.0640 -0.0204 -0.0279 94  ILE B C   
878  O  O   . ILE B 94  ? 0.3893 0.4689 0.4021 -0.1101 -0.0919 -0.0513 94  ILE B O   
879  C  CB  . ILE B 94  ? 0.3912 0.4326 0.4364 -0.0787 -0.0577 -0.0504 94  ILE B CB  
880  C  CG1 . ILE B 94  ? 0.3895 0.5236 0.4408 -0.0929 -0.0564 -0.0320 94  ILE B CG1 
881  C  CG2 . ILE B 94  ? 0.3953 0.4603 0.4685 -0.0177 -0.0678 -0.0345 94  ILE B CG2 
882  C  CD1 . ILE B 94  ? 0.3997 0.4527 0.4563 -0.0471 -0.0651 -0.0659 94  ILE B CD1 
883  N  N   . GLU B 95  ? 0.5017 0.4943 0.4939 -0.0837 -0.0259 -0.0781 95  GLU B N   
884  C  CA  . GLU B 95  ? 0.4893 0.5459 0.4962 -0.0945 0.0045  -0.0839 95  GLU B CA  
885  C  C   . GLU B 95  ? 0.4479 0.4308 0.4452 -0.0888 -0.0591 -0.0824 95  GLU B C   
886  O  O   . GLU B 95  ? 0.4100 0.4978 0.4503 -0.1178 -0.0568 -0.0963 95  GLU B O   
887  C  CB  . GLU B 95  ? 0.5991 0.5114 0.6155 -0.0804 -0.0492 -0.1159 95  GLU B CB  
888  C  CG  . GLU B 95  ? 0.7290 0.6573 0.7060 -0.0178 -0.1103 -0.0751 95  GLU B CG  
889  C  CD  . GLU B 95  ? 0.7002 0.7219 0.7712 -0.0134 -0.0085 -0.0395 95  GLU B CD  
890  O  OE1 . GLU B 95  ? 0.9161 0.7010 0.8171 -0.1349 -0.1551 0.0059  95  GLU B OE1 
891  O  OE2 . GLU B 95  ? 0.9359 0.7077 0.7953 -0.1540 0.0834  -0.2923 95  GLU B OE2 
892  N  N   . ASN B 96  ? 0.4817 0.3780 0.5274 -0.0712 -0.0581 -0.0929 96  ASN B N   
893  C  CA  . ASN B 96  ? 0.4826 0.4283 0.4621 -0.0706 -0.0400 -0.0833 96  ASN B CA  
894  C  C   . ASN B 96  ? 0.4557 0.4198 0.4440 -0.0571 -0.0186 -0.0570 96  ASN B C   
895  O  O   . ASN B 96  ? 0.3889 0.4560 0.4711 -0.1078 -0.0384 -0.1252 96  ASN B O   
896  C  CB  . ASN B 96  ? 0.5255 0.4980 0.5014 -0.0409 -0.0737 -0.0611 96  ASN B CB  
897  C  CG  . ASN B 96  ? 0.7513 0.5234 0.6262 -0.0568 -0.0634 -0.0503 96  ASN B CG  
898  O  OD1 . ASN B 96  ? 0.7622 0.5596 0.7377 0.0213  -0.0843 -0.0369 96  ASN B OD1 
899  N  ND2 . ASN B 96  ? 0.6775 0.4337 0.7143 -0.0919 -0.0462 -0.1288 96  ASN B ND2 
900  N  N   . ALA B 97  ? 0.3826 0.4265 0.4693 -0.0533 -0.0679 -0.0907 97  ALA B N   
901  C  CA  . ALA B 97  ? 0.3752 0.3902 0.4051 -0.0185 -0.0254 -0.0646 97  ALA B CA  
902  C  C   . ALA B 97  ? 0.3631 0.4079 0.3686 -0.0477 -0.0111 -0.0596 97  ALA B C   
903  O  O   . ALA B 97  ? 0.3418 0.3916 0.3555 -0.0502 -0.0260 -0.0905 97  ALA B O   
904  C  CB  . ALA B 97  ? 0.3365 0.4201 0.4343 -0.0623 -0.0498 -0.1370 97  ALA B CB  
905  N  N   . LEU B 98  ? 0.3797 0.4512 0.4044 -0.0700 -0.0465 -0.0621 98  LEU B N   
906  C  CA  . LEU B 98  ? 0.3791 0.4873 0.4359 -0.0243 -0.0429 -0.0413 98  LEU B CA  
907  C  C   . LEU B 98  ? 0.3765 0.4379 0.4169 -0.0348 -0.0569 -0.0244 98  LEU B C   
908  O  O   . LEU B 98  ? 0.3782 0.4873 0.3745 -0.0659 -0.1117 -0.0278 98  LEU B O   
909  C  CB  . LEU B 98  ? 0.3819 0.4956 0.4364 -0.0195 -0.0552 -0.0375 98  LEU B CB  
910  C  CG  . LEU B 98  ? 0.4066 0.4813 0.4733 -0.0036 -0.0726 -0.0224 98  LEU B CG  
911  C  CD1 . LEU B 98  ? 0.3908 0.4572 0.4500 -0.0673 -0.0966 -0.0070 98  LEU B CD1 
912  C  CD2 . LEU B 98  ? 0.4313 0.5117 0.4711 -0.0571 -0.0164 -0.0726 98  LEU B CD2 
913  N  N   . LYS B 99  ? 0.3562 0.4585 0.4497 -0.0028 -0.0736 -0.0874 99  LYS B N   
914  C  CA  . LYS B 99  ? 0.4164 0.5248 0.4428 -0.0283 0.0074  -0.0287 99  LYS B CA  
915  C  C   . LYS B 99  ? 0.4235 0.5253 0.4507 -0.0368 -0.0275 -0.0307 99  LYS B C   
916  O  O   . LYS B 99  ? 0.4145 0.5067 0.3980 -0.0568 -0.0591 -0.0800 99  LYS B O   
917  C  CB  . LYS B 99  ? 0.4332 0.5214 0.5238 -0.0172 -0.0518 -0.0629 99  LYS B CB  
918  C  CG  . LYS B 99  ? 0.5670 0.6674 0.6322 0.0063  0.0432  -0.1053 99  LYS B CG  
919  C  CD  . LYS B 99  ? 0.7430 0.6934 0.7767 0.0276  0.0518  -0.0098 99  LYS B CD  
920  C  CE  . LYS B 99  ? 0.9328 0.9041 0.8558 0.0543  0.0630  -0.1402 99  LYS B CE  
921  N  NZ  . LYS B 99  ? 1.0793 0.9060 1.1110 0.0608  -0.0169 -0.1332 99  LYS B NZ  
922  N  N   . THR B 100 ? 0.4180 0.5187 0.4669 -0.0219 -0.0466 -0.0856 100 THR B N   
923  C  CA  . THR B 100 ? 0.3855 0.4577 0.3709 0.0062  -0.0369 -0.0669 100 THR B CA  
924  C  C   . THR B 100 ? 0.3688 0.4642 0.3502 0.0064  -0.0447 -0.0617 100 THR B C   
925  O  O   . THR B 100 ? 0.4032 0.5192 0.4271 -0.0196 -0.0009 -0.0779 100 THR B O   
926  C  CB  . THR B 100 ? 0.3591 0.4297 0.3834 -0.0081 -0.0281 -0.0153 100 THR B CB  
927  O  OG1 . THR B 100 ? 0.3794 0.4237 0.4259 -0.0410 -0.0177 -0.0690 100 THR B OG1 
928  C  CG2 . THR B 100 ? 0.3446 0.4582 0.3637 0.0043  -0.0367 -0.0816 100 THR B CG2 
929  N  N   . ILE B 101 ? 0.3463 0.4357 0.3884 -0.0117 -0.0566 -0.0830 101 ILE B N   
930  C  CA  . ILE B 101 ? 0.3925 0.4669 0.4171 0.0054  -0.0260 -0.0155 101 ILE B CA  
931  C  C   . ILE B 101 ? 0.4429 0.5188 0.4074 -0.0131 -0.0047 -0.0407 101 ILE B C   
932  O  O   . ILE B 101 ? 0.3977 0.5275 0.4255 0.0136  -0.0126 -0.0376 101 ILE B O   
933  C  CB  . ILE B 101 ? 0.4407 0.4193 0.3675 0.0040  -0.0217 -0.0233 101 ILE B CB  
934  C  CG1 . ILE B 101 ? 0.3863 0.3915 0.3618 -0.0036 -0.0057 -0.0829 101 ILE B CG1 
935  C  CG2 . ILE B 101 ? 0.4163 0.4514 0.3357 0.0236  -0.0286 0.0078  101 ILE B CG2 
936  C  CD1 . ILE B 101 ? 0.3710 0.4550 0.3874 0.0292  -0.0045 -0.0606 101 ILE B CD1 
937  N  N   . GLU B 102 ? 0.4749 0.5330 0.4500 -0.0092 -0.0063 -0.0861 102 GLU B N   
938  C  CA  . GLU B 102 ? 0.4628 0.5742 0.4780 0.0069  -0.0439 -0.0793 102 GLU B CA  
939  C  C   . GLU B 102 ? 0.4782 0.5507 0.4783 -0.0160 -0.0229 -0.0507 102 GLU B C   
940  O  O   . GLU B 102 ? 0.6240 0.5902 0.5402 -0.0087 0.0226  0.0000  102 GLU B O   
941  C  CB  . GLU B 102 ? 0.4842 0.5579 0.3892 -0.0078 -0.0762 -0.0546 102 GLU B CB  
942  C  CG  . GLU B 102 ? 0.5035 0.5979 0.4585 0.0158  -0.0645 -0.0488 102 GLU B CG  
943  C  CD  . GLU B 102 ? 0.5840 0.6198 0.6054 -0.0355 -0.0904 -0.0683 102 GLU B CD  
944  O  OE1 . GLU B 102 ? 0.5383 0.6425 0.5930 -0.0932 -0.0962 -0.1165 102 GLU B OE1 
945  O  OE2 . GLU B 102 ? 0.5598 0.8342 0.5483 0.0211  -0.1492 -0.0675 102 GLU B OE2 
946  N  N   . SER B 103 ? 0.4574 0.5508 0.4822 -0.0136 -0.0829 -0.1388 103 SER B N   
947  C  CA  . SER B 103 ? 0.5254 0.5676 0.4968 -0.0220 0.0048  -0.1086 103 SER B CA  
948  C  C   . SER B 103 ? 0.5201 0.5967 0.5831 0.0098  -0.0203 -0.1026 103 SER B C   
949  O  O   . SER B 103 ? 0.5425 0.7193 0.3925 -0.0190 -0.0036 -0.1250 103 SER B O   
950  C  CB  . SER B 103 ? 0.5644 0.5871 0.5466 0.0778  0.0755  -0.0463 103 SER B CB  
951  O  OG  . SER B 103 ? 0.6884 0.7621 0.5557 0.0197  -0.0051 -0.0792 103 SER B OG  
952  N  N   . ALA B 104 ? 0.4885 0.5620 0.4624 -0.0177 -0.0198 -0.0455 104 ALA B N   
953  C  CA  . ALA B 104 ? 0.5272 0.5213 0.5209 -0.0376 0.0003  -0.0621 104 ALA B CA  
954  C  C   . ALA B 104 ? 0.5775 0.6233 0.5369 0.0192  0.0050  -0.0057 104 ALA B C   
955  O  O   . ALA B 104 ? 0.5570 0.7080 0.4822 0.0122  -0.0585 -0.0662 104 ALA B O   
956  C  CB  . ALA B 104 ? 0.4737 0.5667 0.4420 0.0055  -0.0460 -0.0442 104 ALA B CB  
957  N  N   . ASN B 105 ? 0.5478 0.7143 0.5522 -0.0384 -0.0417 -0.0361 105 ASN B N   
958  C  CA  . ASN B 105 ? 0.6399 0.6699 0.6026 -0.0500 -0.0292 0.0220  105 ASN B CA  
959  C  C   . ASN B 105 ? 0.6705 0.6800 0.6640 -0.0347 -0.0081 -0.0035 105 ASN B C   
960  O  O   . ASN B 105 ? 0.7215 0.7782 0.6557 -0.0243 0.0270  0.0244  105 ASN B O   
961  C  CB  . ASN B 105 ? 0.6468 0.7230 0.6754 -0.0356 0.0199  -0.0023 105 ASN B CB  
962  N  N   . GLN B 106 ? 0.5745 0.6800 0.6430 -0.0407 0.0503  -0.0036 106 GLN B N   
963  C  CA  . GLN B 106 ? 0.6292 0.6809 0.6791 0.0366  0.0339  0.0016  106 GLN B CA  
964  C  C   . GLN B 106 ? 0.5947 0.6648 0.6224 0.0235  -0.0043 0.0423  106 GLN B C   
965  O  O   . GLN B 106 ? 0.6152 0.7331 0.6132 -0.0029 -0.0431 0.0465  106 GLN B O   
966  C  CB  . GLN B 106 ? 0.7273 0.7721 0.7889 -0.0737 0.0011  -0.0351 106 GLN B CB  
967  C  CG  . GLN B 106 ? 0.7905 0.7796 0.8605 -0.0821 0.0103  -0.0259 106 GLN B CG  
968  C  CD  . GLN B 106 ? 0.7975 0.7801 0.8981 -0.1206 0.0348  -0.0270 106 GLN B CD  
969  N  N   . GLN B 107 ? 0.5169 0.6055 0.5454 -0.0051 0.0147  0.0026  107 GLN B N   
970  C  CA  . GLN B 107 ? 0.5684 0.6029 0.4730 0.0043  -0.0179 -0.0103 107 GLN B CA  
971  C  C   . GLN B 107 ? 0.5818 0.5872 0.5123 -0.0478 0.0109  0.0229  107 GLN B C   
972  O  O   . GLN B 107 ? 0.6354 0.7191 0.3909 -0.0552 0.0505  0.0690  107 GLN B O   
973  C  CB  . GLN B 107 ? 0.5527 0.6119 0.5477 -0.0151 -0.0086 0.0172  107 GLN B CB  
974  C  CG  . GLN B 107 ? 0.6287 0.6391 0.5245 -0.0365 -0.0480 0.0154  107 GLN B CG  
975  C  CD  . GLN B 107 ? 0.6341 0.5830 0.6220 -0.0504 0.0338  -0.0007 107 GLN B CD  
976  O  OE1 . GLN B 107 ? 0.6858 0.7383 0.6041 -0.0148 0.0529  -0.0167 107 GLN B OE1 
977  N  NE2 . GLN B 107 ? 0.5067 0.6090 0.5135 0.0219  0.0282  -0.1011 107 GLN B NE2 
978  N  N   . THR B 108 ? 0.4643 0.5358 0.5106 -0.0247 0.0178  0.0004  108 THR B N   
979  C  CA  . THR B 108 ? 0.4272 0.5157 0.4770 -0.0139 0.0063  0.0280  108 THR B CA  
980  C  C   . THR B 108 ? 0.4394 0.4808 0.4695 -0.0236 -0.0138 -0.0094 108 THR B C   
981  O  O   . THR B 108 ? 0.4247 0.5146 0.4349 -0.0370 -0.0155 0.0457  108 THR B O   
982  C  CB  . THR B 108 ? 0.4742 0.4922 0.4848 -0.0173 -0.0089 0.0463  108 THR B CB  
983  O  OG1 . THR B 108 ? 0.3953 0.4793 0.4507 -0.0461 -0.0246 0.0098  108 THR B OG1 
984  C  CG2 . THR B 108 ? 0.4557 0.5736 0.5073 -0.0599 0.0152  0.0128  108 THR B CG2 
985  N  N   . ASP B 109 ? 0.4397 0.4471 0.4388 -0.0492 0.0009  0.0200  109 ASP B N   
986  C  CA  . ASP B 109 ? 0.4097 0.4640 0.4721 -0.0006 -0.0129 0.0287  109 ASP B CA  
987  C  C   . ASP B 109 ? 0.3928 0.4344 0.4261 -0.0006 -0.0097 -0.0014 109 ASP B C   
988  O  O   . ASP B 109 ? 0.3605 0.4145 0.4401 -0.0218 -0.0416 -0.0286 109 ASP B O   
989  C  CB  . ASP B 109 ? 0.4765 0.4879 0.5964 -0.0572 0.0062  0.0042  109 ASP B CB  
990  C  CG  . ASP B 109 ? 0.6894 0.6077 0.6635 -0.0223 -0.0305 0.0822  109 ASP B CG  
991  O  OD1 . ASP B 109 ? 0.6735 0.5749 0.6963 0.0438  -0.0456 0.1318  109 ASP B OD1 
992  O  OD2 . ASP B 109 ? 0.8235 0.6507 0.8447 -0.0974 -0.0046 0.0293  109 ASP B OD2 
993  N  N   . LYS B 110 ? 0.3229 0.4059 0.4454 -0.0595 -0.0173 0.0013  110 LYS B N   
994  C  CA  . LYS B 110 ? 0.3608 0.4007 0.4364 -0.0432 -0.0474 0.0015  110 LYS B CA  
995  C  C   . LYS B 110 ? 0.3587 0.3727 0.3900 -0.0228 -0.0242 -0.0110 110 LYS B C   
996  O  O   . LYS B 110 ? 0.3278 0.3808 0.3675 -0.0598 -0.0634 -0.0169 110 LYS B O   
997  C  CB  . LYS B 110 ? 0.3940 0.4726 0.4629 0.0156  -0.0521 -0.0166 110 LYS B CB  
998  C  CG  . LYS B 110 ? 0.4385 0.5382 0.4987 0.0329  -0.0052 0.0014  110 LYS B CG  
999  C  CD  . LYS B 110 ? 0.4572 0.5321 0.5271 0.0017  -0.0389 0.0113  110 LYS B CD  
1000 C  CE  . LYS B 110 ? 0.4894 0.6128 0.5618 0.0030  -0.0686 -0.0359 110 LYS B CE  
1001 N  NZ  . LYS B 110 ? 0.4362 0.6618 0.5785 -0.0374 -0.0297 0.0520  110 LYS B NZ  
1002 N  N   . LEU B 111 ? 0.3299 0.3902 0.3999 -0.0117 -0.0343 -0.0278 111 LEU B N   
1003 C  CA  . LEU B 111 ? 0.3609 0.3981 0.4089 -0.0186 -0.0208 -0.0405 111 LEU B CA  
1004 C  C   . LEU B 111 ? 0.3668 0.3752 0.3928 -0.0112 -0.0241 -0.0108 111 LEU B C   
1005 O  O   . LEU B 111 ? 0.3633 0.3871 0.3911 -0.0257 -0.0342 -0.0014 111 LEU B O   
1006 C  CB  . LEU B 111 ? 0.4311 0.4084 0.3797 -0.0124 -0.0021 0.0006  111 LEU B CB  
1007 C  CG  . LEU B 111 ? 0.4582 0.4280 0.4134 -0.0177 0.0023  -0.0397 111 LEU B CG  
1008 C  CD1 . LEU B 111 ? 0.5272 0.5894 0.4658 0.0141  0.0624  -0.0007 111 LEU B CD1 
1009 C  CD2 . LEU B 111 ? 0.4606 0.4258 0.3210 -0.0210 0.0630  -0.0588 111 LEU B CD2 
1010 N  N   . LYS B 112 ? 0.3453 0.3781 0.3882 -0.0247 -0.0608 -0.0024 112 LYS B N   
1011 C  CA  . LYS B 112 ? 0.3681 0.4155 0.3939 0.0117  -0.0172 -0.0118 112 LYS B CA  
1012 C  C   . LYS B 112 ? 0.3478 0.4147 0.3786 -0.0209 -0.0379 -0.0124 112 LYS B C   
1013 O  O   . LYS B 112 ? 0.3332 0.3871 0.3350 -0.0249 -0.0572 -0.0206 112 LYS B O   
1014 C  CB  . LYS B 112 ? 0.4191 0.4263 0.4777 -0.0040 -0.0553 0.0233  112 LYS B CB  
1015 C  CG  . LYS B 112 ? 0.4311 0.4851 0.4890 0.0219  -0.0455 0.0171  112 LYS B CG  
1016 C  CD  . LYS B 112 ? 0.5469 0.5225 0.5743 -0.0079 -0.0224 0.0562  112 LYS B CD  
1017 C  CE  . LYS B 112 ? 0.6786 0.6856 0.6005 -0.0135 0.0080  0.0713  112 LYS B CE  
1018 N  NZ  . LYS B 112 ? 0.8126 0.7454 0.6974 -0.0737 -0.0478 0.1554  112 LYS B NZ  
1019 N  N   . GLU B 113 ? 0.3199 0.3688 0.3465 -0.0357 -0.0208 0.0060  113 GLU B N   
1020 C  CA  . GLU B 113 ? 0.2919 0.3368 0.3183 -0.0255 -0.0547 0.0074  113 GLU B CA  
1021 C  C   . GLU B 113 ? 0.3045 0.3308 0.3047 -0.0161 -0.0246 -0.0214 113 GLU B C   
1022 O  O   . GLU B 113 ? 0.2924 0.3512 0.3074 -0.0262 -0.0206 -0.0126 113 GLU B O   
1023 C  CB  . GLU B 113 ? 0.2905 0.3798 0.3377 -0.0375 -0.0391 -0.0487 113 GLU B CB  
1024 C  CG  . GLU B 113 ? 0.2919 0.3800 0.3303 -0.0212 -0.0459 0.0047  113 GLU B CG  
1025 C  CD  . GLU B 113 ? 0.3839 0.4014 0.4412 0.0095  -0.0004 -0.0423 113 GLU B CD  
1026 O  OE1 . GLU B 113 ? 0.4366 0.4373 0.4909 -0.0447 0.0087  -0.0044 113 GLU B OE1 
1027 O  OE2 . GLU B 113 ? 0.3413 0.3866 0.3811 -0.0084 -0.0532 -0.0227 113 GLU B OE2 
1028 N  N   . LEU B 114 ? 0.2604 0.3154 0.3280 -0.0277 -0.0640 -0.0111 114 LEU B N   
1029 C  CA  . LEU B 114 ? 0.2947 0.3044 0.3489 -0.0106 -0.0585 -0.0082 114 LEU B CA  
1030 C  C   . LEU B 114 ? 0.2796 0.3664 0.3113 -0.0386 -0.0312 0.0069  114 LEU B C   
1031 O  O   . LEU B 114 ? 0.2622 0.3442 0.3103 -0.0569 -0.0530 -0.0213 114 LEU B O   
1032 C  CB  . LEU B 114 ? 0.2862 0.3171 0.3422 -0.0052 -0.0320 -0.0247 114 LEU B CB  
1033 C  CG  . LEU B 114 ? 0.2617 0.3184 0.3071 -0.0095 -0.0317 -0.0156 114 LEU B CG  
1034 C  CD1 . LEU B 114 ? 0.2657 0.3583 0.3205 -0.0158 -0.0224 -0.0015 114 LEU B CD1 
1035 C  CD2 . LEU B 114 ? 0.2783 0.3277 0.3470 0.0054  -0.0228 -0.0175 114 LEU B CD2 
1036 N  N   . TYR B 115 ? 0.2658 0.3455 0.3145 -0.0445 -0.0739 -0.0002 115 TYR B N   
1037 C  CA  . TYR B 115 ? 0.2774 0.3800 0.3007 -0.0602 -0.0633 -0.0192 115 TYR B CA  
1038 C  C   . TYR B 115 ? 0.3144 0.3269 0.3321 -0.0391 -0.0487 -0.0140 115 TYR B C   
1039 O  O   . TYR B 115 ? 0.2988 0.3510 0.3293 -0.0592 -0.0351 -0.0189 115 TYR B O   
1040 C  CB  . TYR B 115 ? 0.2982 0.3616 0.3011 -0.0333 -0.0543 -0.0170 115 TYR B CB  
1041 C  CG  . TYR B 115 ? 0.3090 0.3907 0.3100 -0.0348 -0.0647 -0.0174 115 TYR B CG  
1042 C  CD1 . TYR B 115 ? 0.3569 0.4128 0.3478 -0.0322 -0.0494 -0.0402 115 TYR B CD1 
1043 C  CD2 . TYR B 115 ? 0.3430 0.4350 0.3812 -0.0105 -0.0638 0.0042  115 TYR B CD2 
1044 C  CE1 . TYR B 115 ? 0.3692 0.4464 0.3587 -0.0266 -0.0700 -0.0160 115 TYR B CE1 
1045 C  CE2 . TYR B 115 ? 0.4269 0.4389 0.3488 -0.0558 -0.0635 -0.0224 115 TYR B CE2 
1046 C  CZ  . TYR B 115 ? 0.3673 0.4213 0.3655 -0.0249 -0.0619 -0.0251 115 TYR B CZ  
1047 O  OH  . TYR B 115 ? 0.4332 0.4816 0.3830 -0.0803 -0.0949 -0.0380 115 TYR B OH  
1048 N  N   . GLY B 116 ? 0.3087 0.3314 0.3157 -0.0241 -0.0344 -0.0188 116 GLY B N   
1049 C  CA  . GLY B 116 ? 0.3046 0.3632 0.3061 -0.0191 -0.0260 0.0005  116 GLY B CA  
1050 C  C   . GLY B 116 ? 0.2928 0.3516 0.3417 -0.0121 -0.0413 0.0221  116 GLY B C   
1051 O  O   . GLY B 116 ? 0.2609 0.3296 0.3372 -0.0122 -0.0615 -0.0350 116 GLY B O   
1052 N  N   . GLN B 117 ? 0.2684 0.3055 0.3116 -0.0375 -0.0571 -0.0143 117 GLN B N   
1053 C  CA  . GLN B 117 ? 0.2727 0.2881 0.3126 -0.0509 -0.0437 -0.0121 117 GLN B CA  
1054 C  C   . GLN B 117 ? 0.2608 0.2722 0.2890 -0.0099 -0.0369 -0.0326 117 GLN B C   
1055 O  O   . GLN B 117 ? 0.3004 0.3153 0.3176 -0.0437 -0.0340 -0.0032 117 GLN B O   
1056 C  CB  . GLN B 117 ? 0.2867 0.2953 0.3281 -0.0099 -0.0510 -0.0336 117 GLN B CB  
1057 C  CG  . GLN B 117 ? 0.2606 0.3222 0.3557 -0.0396 -0.0829 -0.0360 117 GLN B CG  
1058 C  CD  . GLN B 117 ? 0.2816 0.3202 0.3418 -0.0370 -0.0838 -0.0070 117 GLN B CD  
1059 O  OE1 . GLN B 117 ? 0.3292 0.3570 0.3843 -0.0160 -0.0648 -0.0005 117 GLN B OE1 
1060 N  NE2 . GLN B 117 ? 0.2447 0.3152 0.2837 -0.0294 -0.0744 -0.0109 117 GLN B NE2 
1061 N  N   . VAL B 118 ? 0.2589 0.2706 0.2862 -0.0114 -0.0464 -0.0403 118 VAL B N   
1062 C  CA  . VAL B 118 ? 0.2730 0.2795 0.3385 -0.0250 -0.0435 -0.0599 118 VAL B CA  
1063 C  C   . VAL B 118 ? 0.2819 0.3062 0.3098 -0.0152 -0.0353 -0.0073 118 VAL B C   
1064 O  O   . VAL B 118 ? 0.2590 0.3450 0.3516 -0.0442 -0.0495 -0.0282 118 VAL B O   
1065 C  CB  . VAL B 118 ? 0.2861 0.3330 0.3212 -0.0136 -0.0334 -0.0612 118 VAL B CB  
1066 C  CG1 . VAL B 118 ? 0.3488 0.3356 0.3510 -0.0485 -0.0297 -0.0574 118 VAL B CG1 
1067 C  CG2 . VAL B 118 ? 0.3396 0.3862 0.3356 0.0057  -0.0813 -0.0675 118 VAL B CG2 
1068 N  N   . LEU B 119 ? 0.2793 0.3043 0.3223 -0.0103 -0.0590 -0.0238 119 LEU B N   
1069 C  CA  . LEU B 119 ? 0.2670 0.3397 0.3083 -0.0083 -0.0401 -0.0062 119 LEU B CA  
1070 C  C   . LEU B 119 ? 0.3132 0.3475 0.3062 -0.0282 -0.0247 -0.0384 119 LEU B C   
1071 O  O   . LEU B 119 ? 0.3302 0.3211 0.3006 -0.0484 -0.0542 -0.0468 119 LEU B O   
1072 C  CB  . LEU B 119 ? 0.2972 0.3223 0.2986 -0.0382 -0.0389 -0.0107 119 LEU B CB  
1073 C  CG  . LEU B 119 ? 0.3213 0.3080 0.3078 -0.0341 -0.0250 -0.0277 119 LEU B CG  
1074 C  CD1 . LEU B 119 ? 0.4041 0.3394 0.3851 -0.0411 -0.0393 0.0096  119 LEU B CD1 
1075 C  CD2 . LEU B 119 ? 0.3638 0.3869 0.3501 -0.0740 -0.0477 -0.0623 119 LEU B CD2 
1076 N  N   . TYR B 120 ? 0.2804 0.3207 0.2883 -0.0156 -0.0439 -0.0247 120 TYR B N   
1077 C  CA  . TYR B 120 ? 0.2937 0.3074 0.2831 -0.0394 -0.0321 -0.0216 120 TYR B CA  
1078 C  C   . TYR B 120 ? 0.2955 0.2958 0.2967 -0.0132 -0.0255 -0.0333 120 TYR B C   
1079 O  O   . TYR B 120 ? 0.3040 0.3364 0.2962 -0.0527 -0.0378 -0.0260 120 TYR B O   
1080 C  CB  . TYR B 120 ? 0.2970 0.3224 0.2777 -0.0462 -0.0165 -0.0315 120 TYR B CB  
1081 C  CG  . TYR B 120 ? 0.2992 0.2916 0.3071 -0.0302 -0.0039 -0.0382 120 TYR B CG  
1082 C  CD1 . TYR B 120 ? 0.3161 0.3271 0.3399 -0.0142 -0.0326 -0.0610 120 TYR B CD1 
1083 C  CD2 . TYR B 120 ? 0.3069 0.3186 0.3183 -0.0474 -0.0228 -0.0298 120 TYR B CD2 
1084 C  CE1 . TYR B 120 ? 0.3383 0.3724 0.3563 -0.0386 -0.0074 -0.0254 120 TYR B CE1 
1085 C  CE2 . TYR B 120 ? 0.3389 0.3436 0.3571 -0.0405 0.0016  -0.0357 120 TYR B CE2 
1086 C  CZ  . TYR B 120 ? 0.3496 0.3443 0.3769 -0.0331 -0.0066 -0.0087 120 TYR B CZ  
1087 O  OH  . TYR B 120 ? 0.3957 0.4567 0.3801 -0.0855 -0.0123 -0.0666 120 TYR B OH  
1088 N  N   . ARG B 121 ? 0.2841 0.2860 0.2789 -0.0354 -0.0888 -0.0384 121 ARG B N   
1089 C  CA  . ARG B 121 ? 0.3183 0.3048 0.2744 -0.0388 -0.0607 -0.0170 121 ARG B CA  
1090 C  C   . ARG B 121 ? 0.3124 0.3167 0.2987 -0.0518 -0.0484 -0.0249 121 ARG B C   
1091 O  O   . ARG B 121 ? 0.3150 0.3133 0.3604 -0.0716 -0.0568 -0.0265 121 ARG B O   
1092 C  CB  . ARG B 121 ? 0.3281 0.3725 0.3610 0.0057  -0.0144 -0.0303 121 ARG B CB  
1093 C  CG  . ARG B 121 ? 0.5139 0.5153 0.4583 -0.1012 -0.0728 -0.0438 121 ARG B CG  
1094 C  CD  . ARG B 121 ? 0.6095 0.6447 0.5275 0.0110  0.0062  0.0339  121 ARG B CD  
1095 N  NE  . ARG B 121 ? 0.7615 0.6874 0.6463 0.0418  0.0523  0.1152  121 ARG B NE  
1096 C  CZ  . ARG B 121 ? 0.7163 0.7482 0.7110 0.0078  0.0102  0.0688  121 ARG B CZ  
1097 N  NH1 . ARG B 121 ? 0.7096 0.7080 0.6043 -0.0261 0.0507  0.1328  121 ARG B NH1 
1098 N  NH2 . ARG B 121 ? 0.7895 0.7945 0.6781 0.0641  0.1490  0.1697  121 ARG B NH2 
1099 N  N   . LEU B 122 ? 0.2738 0.3357 0.2925 -0.0419 -0.0509 -0.0395 122 LEU B N   
1100 C  CA  . LEU B 122 ? 0.2915 0.3245 0.3097 -0.0559 -0.0479 -0.0464 122 LEU B CA  
1101 C  C   . LEU B 122 ? 0.3159 0.3254 0.3252 -0.0191 -0.0266 -0.0375 122 LEU B C   
1102 O  O   . LEU B 122 ? 0.3120 0.3361 0.3650 -0.0479 -0.0281 -0.0590 122 LEU B O   
1103 C  CB  . LEU B 122 ? 0.3072 0.3334 0.3089 -0.0165 -0.0463 -0.0574 122 LEU B CB  
1104 C  CG  . LEU B 122 ? 0.2974 0.3627 0.3474 -0.0070 -0.0495 -0.0298 122 LEU B CG  
1105 C  CD1 . LEU B 122 ? 0.3393 0.4113 0.3131 -0.0469 -0.0606 -0.0728 122 LEU B CD1 
1106 C  CD2 . LEU B 122 ? 0.3592 0.3499 0.4247 0.0135  -0.0721 -0.0399 122 LEU B CD2 
1107 N  N   . GLU B 123 ? 0.2876 0.3051 0.2902 -0.0307 -0.0319 -0.0240 123 GLU B N   
1108 C  CA  . GLU B 123 ? 0.2886 0.3187 0.3116 -0.0300 -0.0085 -0.0042 123 GLU B CA  
1109 C  C   . GLU B 123 ? 0.2944 0.3132 0.3231 -0.0066 -0.0098 -0.0076 123 GLU B C   
1110 O  O   . GLU B 123 ? 0.2990 0.3181 0.3475 -0.0378 -0.0535 -0.0071 123 GLU B O   
1111 C  CB  . GLU B 123 ? 0.3232 0.3138 0.3266 -0.0613 -0.0015 -0.0306 123 GLU B CB  
1112 C  CG  . GLU B 123 ? 0.3665 0.3597 0.3716 -0.0176 -0.0421 0.0098  123 GLU B CG  
1113 C  CD  . GLU B 123 ? 0.4166 0.4879 0.4647 -0.0322 0.0152  0.0547  123 GLU B CD  
1114 O  OE1 . GLU B 123 ? 0.4126 0.4926 0.4052 -0.1063 -0.0112 0.0099  123 GLU B OE1 
1115 O  OE2 . GLU B 123 ? 0.5648 0.5829 0.6103 -0.0261 -0.0272 0.1481  123 GLU B OE2 
1116 N  N   . ARG B 124 ? 0.2920 0.3384 0.2889 -0.0582 -0.0327 -0.0179 124 ARG B N   
1117 C  CA  . ARG B 124 ? 0.2845 0.3143 0.3231 -0.0347 -0.0371 -0.0050 124 ARG B CA  
1118 C  C   . ARG B 124 ? 0.3195 0.3305 0.2955 -0.0235 -0.0320 -0.0315 124 ARG B C   
1119 O  O   . ARG B 124 ? 0.3180 0.3669 0.3321 -0.0370 -0.0430 -0.0024 124 ARG B O   
1120 C  CB  . ARG B 124 ? 0.2750 0.3209 0.2740 -0.0191 -0.0975 -0.0539 124 ARG B CB  
1121 C  CG  . ARG B 124 ? 0.3428 0.3188 0.3452 -0.0341 -0.0431 -0.0735 124 ARG B CG  
1122 C  CD  . ARG B 124 ? 0.2869 0.3294 0.3549 -0.0521 -0.0333 -0.0256 124 ARG B CD  
1123 N  NE  . ARG B 124 ? 0.2917 0.3724 0.3183 -0.0660 -0.0656 -0.0203 124 ARG B NE  
1124 C  CZ  . ARG B 124 ? 0.3617 0.3806 0.3205 -0.0171 -0.0373 -0.0246 124 ARG B CZ  
1125 N  NH1 . ARG B 124 ? 0.3585 0.3917 0.4051 -0.0228 -0.0555 -0.0324 124 ARG B NH1 
1126 N  NH2 . ARG B 124 ? 0.3506 0.4353 0.3502 -0.0646 -0.0427 -0.0098 124 ARG B NH2 
1127 N  N   . TYR B 125 ? 0.2872 0.3009 0.3198 -0.0293 -0.0449 -0.0223 125 TYR B N   
1128 C  CA  . TYR B 125 ? 0.3272 0.3089 0.3080 -0.0236 -0.0323 -0.0201 125 TYR B CA  
1129 C  C   . TYR B 125 ? 0.3562 0.3283 0.3281 -0.0296 -0.0258 -0.0042 125 TYR B C   
1130 O  O   . TYR B 125 ? 0.3108 0.3565 0.3864 -0.0351 -0.0585 -0.0257 125 TYR B O   
1131 C  CB  . TYR B 125 ? 0.2964 0.3351 0.3076 -0.0247 -0.0517 -0.0131 125 TYR B CB  
1132 C  CG  . TYR B 125 ? 0.3297 0.3525 0.3230 -0.0224 -0.0259 -0.0051 125 TYR B CG  
1133 C  CD1 . TYR B 125 ? 0.3134 0.3145 0.3403 -0.0459 -0.0442 -0.0164 125 TYR B CD1 
1134 C  CD2 . TYR B 125 ? 0.3439 0.3603 0.3532 -0.0477 -0.0160 -0.0247 125 TYR B CD2 
1135 C  CE1 . TYR B 125 ? 0.3283 0.3155 0.3136 -0.0204 -0.0282 -0.0351 125 TYR B CE1 
1136 C  CE2 . TYR B 125 ? 0.3386 0.3507 0.3763 -0.0436 -0.0348 -0.0181 125 TYR B CE2 
1137 C  CZ  . TYR B 125 ? 0.3424 0.3260 0.3579 -0.0236 -0.0198 -0.0322 125 TYR B CZ  
1138 O  OH  . TYR B 125 ? 0.4021 0.3740 0.3679 -0.0556 -0.0286 -0.0216 125 TYR B OH  
1139 N  N   . ASP B 126 ? 0.3121 0.3814 0.3512 -0.0714 -0.0279 0.0096  126 ASP B N   
1140 C  CA  . ASP B 126 ? 0.3491 0.4055 0.3426 -0.0439 -0.0604 0.0146  126 ASP B CA  
1141 C  C   . ASP B 126 ? 0.3489 0.3830 0.3325 -0.0232 -0.0538 -0.0028 126 ASP B C   
1142 O  O   . ASP B 126 ? 0.3678 0.4085 0.3779 -0.0610 -0.1105 0.0247  126 ASP B O   
1143 C  CB  . ASP B 126 ? 0.3552 0.4033 0.3286 -0.0465 -0.0628 0.0300  126 ASP B CB  
1144 C  CG  . ASP B 126 ? 0.3404 0.4203 0.3899 -0.0006 -0.0858 0.0160  126 ASP B CG  
1145 O  OD1 . ASP B 126 ? 0.3549 0.4294 0.5421 -0.0282 -0.0806 -0.0047 126 ASP B OD1 
1146 O  OD2 . ASP B 126 ? 0.4085 0.4452 0.4171 -0.0446 -0.0708 0.0202  126 ASP B OD2 
1147 N  N   . GLU B 127 ? 0.3026 0.3897 0.3212 -0.0428 -0.0867 -0.0175 127 GLU B N   
1148 C  CA  . GLU B 127 ? 0.3242 0.4240 0.3448 -0.0318 -0.0520 -0.0106 127 GLU B CA  
1149 C  C   . GLU B 127 ? 0.3439 0.4115 0.3337 -0.0426 -0.0619 0.0234  127 GLU B C   
1150 O  O   . GLU B 127 ? 0.3627 0.4008 0.3306 -0.0653 -0.0491 -0.0091 127 GLU B O   
1151 C  CB  . GLU B 127 ? 0.3266 0.4039 0.3179 -0.0588 -0.0509 -0.0229 127 GLU B CB  
1152 C  CG  . GLU B 127 ? 0.3535 0.4343 0.3589 -0.0762 -0.0168 -0.0036 127 GLU B CG  
1153 C  CD  . GLU B 127 ? 0.3861 0.4125 0.3837 -0.0333 -0.0160 0.0344  127 GLU B CD  
1154 O  OE1 . GLU B 127 ? 0.3593 0.4570 0.4169 -0.0767 -0.0475 -0.0005 127 GLU B OE1 
1155 O  OE2 . GLU B 127 ? 0.4013 0.5110 0.3687 -0.0978 0.0024  -0.0243 127 GLU B OE2 
1156 N  N   . CYS B 128 ? 0.3208 0.3732 0.3165 -0.0650 -0.0457 -0.0019 128 CYS B N   
1157 C  CA  . CYS B 128 ? 0.3464 0.3680 0.3141 -0.0391 -0.0657 0.0199  128 CYS B CA  
1158 C  C   . CYS B 128 ? 0.3445 0.3734 0.3783 -0.0259 -0.0463 0.0159  128 CYS B C   
1159 O  O   . CYS B 128 ? 0.3505 0.3679 0.3827 -0.0507 -0.0748 0.0331  128 CYS B O   
1160 C  CB  . CYS B 128 ? 0.3415 0.4043 0.2906 -0.0325 -0.0439 -0.0013 128 CYS B CB  
1161 S  SG  . CYS B 128 ? 0.3066 0.3713 0.3417 -0.0467 -0.0655 -0.0108 128 CYS B SG  
1162 N  N   . LEU B 129 ? 0.3305 0.3621 0.3610 -0.0275 -0.0588 -0.0121 129 LEU B N   
1163 C  CA  . LEU B 129 ? 0.3397 0.3659 0.3870 0.0100  -0.0375 0.0315  129 LEU B CA  
1164 C  C   . LEU B 129 ? 0.3832 0.3944 0.3762 -0.0088 -0.0242 0.0217  129 LEU B C   
1165 O  O   . LEU B 129 ? 0.3664 0.4007 0.4191 -0.0201 -0.0505 0.0124  129 LEU B O   
1166 C  CB  . LEU B 129 ? 0.3355 0.4056 0.4006 0.0111  -0.0334 0.0211  129 LEU B CB  
1167 C  CG  . LEU B 129 ? 0.3924 0.4179 0.3872 -0.0107 -0.0267 0.0128  129 LEU B CG  
1168 C  CD1 . LEU B 129 ? 0.3905 0.4853 0.4846 0.0013  -0.0258 0.0419  129 LEU B CD1 
1169 C  CD2 . LEU B 129 ? 0.4321 0.3874 0.4105 -0.0084 -0.0416 -0.0069 129 LEU B CD2 
1170 N  N   . ALA B 130 ? 0.3281 0.3911 0.3835 -0.0287 -0.0190 0.0065  130 ALA B N   
1171 C  CA  . ALA B 130 ? 0.3483 0.4233 0.3826 -0.0598 -0.0203 0.0088  130 ALA B CA  
1172 C  C   . ALA B 130 ? 0.3679 0.3797 0.4328 -0.0254 -0.0824 0.0272  130 ALA B C   
1173 O  O   . ALA B 130 ? 0.3634 0.4178 0.3931 -0.0609 -0.0951 0.0284  130 ALA B O   
1174 C  CB  . ALA B 130 ? 0.3531 0.4249 0.3691 -0.0476 -0.0433 0.0202  130 ALA B CB  
1175 N  N   . VAL B 131 ? 0.3250 0.3848 0.4004 -0.0246 -0.0831 0.0234  131 VAL B N   
1176 C  CA  . VAL B 131 ? 0.3242 0.3823 0.4014 -0.0176 -0.0695 0.0114  131 VAL B CA  
1177 C  C   . VAL B 131 ? 0.3440 0.3850 0.3668 -0.0083 -0.0276 0.0108  131 VAL B C   
1178 O  O   . VAL B 131 ? 0.3682 0.4131 0.3940 -0.0543 -0.0757 0.0208  131 VAL B O   
1179 C  CB  . VAL B 131 ? 0.3023 0.3849 0.3867 0.0064  -0.0536 0.0008  131 VAL B CB  
1180 C  CG1 . VAL B 131 ? 0.3182 0.3798 0.3826 -0.0098 -0.0670 0.0283  131 VAL B CG1 
1181 C  CG2 . VAL B 131 ? 0.4089 0.4096 0.3975 -0.0128 -0.0491 -0.0033 131 VAL B CG2 
1182 N  N   . TYR B 132 ? 0.3129 0.3434 0.3703 -0.0269 -0.0419 0.0028  132 TYR B N   
1183 C  CA  . TYR B 132 ? 0.3826 0.3531 0.3714 -0.0395 -0.0430 0.0030  132 TYR B CA  
1184 C  C   . TYR B 132 ? 0.4086 0.3788 0.4332 -0.0255 -0.1018 0.0395  132 TYR B C   
1185 O  O   . TYR B 132 ? 0.4088 0.3630 0.4741 -0.0348 -0.1393 0.0590  132 TYR B O   
1186 C  CB  . TYR B 132 ? 0.3665 0.3380 0.3668 -0.0245 -0.0506 -0.0048 132 TYR B CB  
1187 C  CG  . TYR B 132 ? 0.3408 0.3465 0.3863 -0.0066 -0.0438 -0.0003 132 TYR B CG  
1188 C  CD1 . TYR B 132 ? 0.3805 0.3804 0.3956 -0.0158 -0.0761 -0.0005 132 TYR B CD1 
1189 C  CD2 . TYR B 132 ? 0.3514 0.3539 0.4025 -0.0282 -0.0426 0.0031  132 TYR B CD2 
1190 C  CE1 . TYR B 132 ? 0.3213 0.3410 0.3705 -0.0535 -0.0821 -0.0179 132 TYR B CE1 
1191 C  CE2 . TYR B 132 ? 0.3580 0.3578 0.3804 -0.0243 -0.0463 -0.0003 132 TYR B CE2 
1192 C  CZ  . TYR B 132 ? 0.3467 0.3087 0.3629 -0.0144 -0.0291 -0.0008 132 TYR B CZ  
1193 O  OH  . TYR B 132 ? 0.2924 0.3437 0.3636 -0.0495 -0.0868 0.0014  132 TYR B OH  
1194 N  N   . ARG B 133 ? 0.3387 0.4095 0.4317 -0.0499 -0.0886 0.0549  133 ARG B N   
1195 C  CA  . ARG B 133 ? 0.4048 0.4059 0.4427 -0.0260 -0.0827 0.0492  133 ARG B CA  
1196 C  C   . ARG B 133 ? 0.3984 0.4145 0.4070 0.0152  -0.0700 0.0360  133 ARG B C   
1197 O  O   . ARG B 133 ? 0.4793 0.4441 0.4691 -0.0712 -0.1061 0.0796  133 ARG B O   
1198 C  CB  . ARG B 133 ? 0.4070 0.4849 0.4278 0.0106  -0.0713 0.0903  133 ARG B CB  
1199 C  CG  . ARG B 133 ? 0.4899 0.5516 0.5505 0.0261  0.0290  0.0864  133 ARG B CG  
1200 C  CD  . ARG B 133 ? 0.4577 0.6831 0.6853 -0.0130 -0.0570 0.0246  133 ARG B CD  
1201 N  NE  . ARG B 133 ? 0.5999 0.8384 0.6880 0.0340  0.0061  -0.0452 133 ARG B NE  
1202 C  CZ  . ARG B 133 ? 0.8179 0.7989 0.7519 -0.0219 -0.0155 0.0486  133 ARG B CZ  
1203 N  NH1 . ARG B 133 ? 0.8721 0.7690 0.8873 -0.1228 -0.0666 -0.1423 133 ARG B NH1 
1204 N  NH2 . ARG B 133 ? 0.9017 0.9709 0.8161 -0.0367 -0.2530 -0.0001 133 ARG B NH2 
1205 N  N   . ASP B 134 ? 0.3850 0.4168 0.3702 0.0258  -0.0812 0.0320  134 ASP B N   
1206 C  CA  . ASP B 134 ? 0.4292 0.4544 0.4570 -0.0301 -0.0398 0.0785  134 ASP B CA  
1207 C  C   . ASP B 134 ? 0.4692 0.4867 0.4787 -0.0579 -0.0556 0.0657  134 ASP B C   
1208 O  O   . ASP B 134 ? 0.4232 0.5177 0.5698 -0.0714 -0.1541 0.0806  134 ASP B O   
1209 C  CB  . ASP B 134 ? 0.4707 0.5110 0.4979 -0.0365 -0.0419 0.0061  134 ASP B CB  
1210 C  CG  . ASP B 134 ? 0.5998 0.6237 0.6868 -0.0180 0.0904  0.0554  134 ASP B CG  
1211 O  OD1 . ASP B 134 ? 0.6624 0.6452 0.8024 -0.0967 0.0280  0.0347  134 ASP B OD1 
1212 O  OD2 . ASP B 134 ? 0.7269 0.6686 0.6227 0.0122  0.0407  -0.0122 134 ASP B OD2 
1213 N  N   . LEU B 135 ? 0.4030 0.4651 0.4385 -0.0268 -0.0993 0.0451  135 LEU B N   
1214 C  CA  . LEU B 135 ? 0.4005 0.4468 0.4469 -0.1005 -0.0946 0.0148  135 LEU B CA  
1215 C  C   . LEU B 135 ? 0.4751 0.4531 0.5814 -0.0149 -0.0463 -0.0170 135 LEU B C   
1216 O  O   . LEU B 135 ? 0.4757 0.4576 0.6655 -0.0364 -0.0923 -0.0016 135 LEU B O   
1217 C  CB  . LEU B 135 ? 0.3900 0.3949 0.4716 -0.0240 -0.0714 0.0090  135 LEU B CB  
1218 C  CG  . LEU B 135 ? 0.4013 0.4030 0.4110 -0.0498 -0.0048 -0.0025 135 LEU B CG  
1219 C  CD1 . LEU B 135 ? 0.4076 0.3881 0.3888 -0.0101 -0.0795 0.0371  135 LEU B CD1 
1220 C  CD2 . LEU B 135 ? 0.4242 0.4959 0.5219 0.0118  0.0237  0.0130  135 LEU B CD2 
1221 N  N   . VAL B 136 ? 0.4135 0.4512 0.4998 -0.0036 -0.1236 0.0001  136 VAL B N   
1222 C  CA  . VAL B 136 ? 0.4922 0.4922 0.4488 -0.0199 -0.0932 -0.0140 136 VAL B CA  
1223 C  C   . VAL B 136 ? 0.5777 0.4976 0.5579 -0.0566 -0.0865 0.0096  136 VAL B C   
1224 O  O   . VAL B 136 ? 0.5746 0.4983 0.8085 -0.0879 -0.1370 -0.0040 136 VAL B O   
1225 C  CB  . VAL B 136 ? 0.4935 0.5190 0.5209 -0.0215 -0.0812 0.0016  136 VAL B CB  
1226 C  CG1 . VAL B 136 ? 0.6148 0.5323 0.6370 -0.0112 -0.1780 -0.0439 136 VAL B CG1 
1227 C  CG2 . VAL B 136 ? 0.4828 0.5112 0.4565 0.0460  -0.1534 0.0034  136 VAL B CG2 
1228 N  N   . ARG B 137 ? 0.5032 0.5422 0.5775 -0.0737 -0.1069 0.0410  137 ARG B N   
1229 C  CA  . ARG B 137 ? 0.6210 0.6251 0.6228 -0.0971 -0.0443 0.0750  137 ARG B CA  
1230 C  C   . ARG B 137 ? 0.5859 0.6134 0.6941 -0.0322 -0.0754 0.0400  137 ARG B C   
1231 O  O   . ARG B 137 ? 0.5351 0.6487 0.7159 -0.0580 -0.1195 0.0668  137 ARG B O   
1232 C  CB  . ARG B 137 ? 0.6869 0.6723 0.6404 -0.0504 -0.0944 0.0976  137 ARG B CB  
1233 C  CG  . ARG B 137 ? 0.7125 0.7527 0.7463 0.0163  -0.0478 0.0129  137 ARG B CG  
1234 C  CD  . ARG B 137 ? 0.8385 0.8733 0.7628 0.0155  -0.1140 0.0687  137 ARG B CD  
1235 N  NE  . ARG B 137 ? 0.9952 0.8248 0.7574 0.0612  -0.1201 -0.0195 137 ARG B NE  
1236 C  CZ  . ARG B 137 ? 0.7809 0.7681 0.6666 -0.0260 -0.0870 0.0408  137 ARG B CZ  
1237 N  NH1 . ARG B 137 ? 0.8041 0.9669 0.8188 0.0496  -0.0146 0.1324  137 ARG B NH1 
1238 N  NH2 . ARG B 137 ? 0.7148 0.8240 0.5371 -0.0663 -0.2970 0.1904  137 ARG B NH2 
1239 N  N   . ASN B 138 ? 0.6021 0.5604 0.6935 -0.0720 -0.0625 0.0425  138 ASN B N   
1240 C  CA  . ASN B 138 ? 0.6410 0.6416 0.6548 -0.0445 -0.0068 0.0280  138 ASN B CA  
1241 C  C   . ASN B 138 ? 0.6428 0.6445 0.6613 -0.0744 -0.0185 -0.0023 138 ASN B C   
1242 O  O   . ASN B 138 ? 0.6356 0.7364 0.8197 -0.0497 -0.0073 0.0027  138 ASN B O   
1243 C  CB  . ASN B 138 ? 0.6017 0.6257 0.6521 -0.0982 -0.0200 0.0231  138 ASN B CB  
1244 C  CG  . ASN B 138 ? 0.7203 0.7041 0.7124 -0.0659 -0.0716 0.0589  138 ASN B CG  
1245 O  OD1 . ASN B 138 ? 0.6884 0.7398 0.8917 -0.1151 -0.1250 0.1284  138 ASN B OD1 
1246 N  ND2 . ASN B 138 ? 0.7234 0.6719 0.7133 -0.0842 -0.0273 0.0916  138 ASN B ND2 
1247 N  N   . SER B 139 ? 0.5605 0.5546 0.6575 -0.1404 -0.0313 -0.0305 139 SER B N   
1248 C  CA  . SER B 139 ? 0.6173 0.7160 0.6790 -0.0244 -0.0261 0.0052  139 SER B CA  
1249 C  C   . SER B 139 ? 0.7196 0.7220 0.8463 -0.0567 -0.0647 -0.0270 139 SER B C   
1250 O  O   . SER B 139 ? 0.6346 0.6932 0.9298 -0.0917 -0.0798 -0.0671 139 SER B O   
1251 C  CB  . SER B 139 ? 0.5047 0.7307 0.6797 -0.0199 -0.0492 -0.0453 139 SER B CB  
1252 O  OG  . SER B 139 ? 0.6503 0.6887 0.7979 -0.0442 -0.0496 -0.0514 139 SER B OG  
1253 N  N   . GLN B 140 ? 0.7525 0.8111 0.8557 -0.0629 -0.1080 0.0038  140 GLN B N   
1254 C  CA  . GLN B 140 ? 0.6947 0.8765 0.7744 -0.0700 -0.0346 0.0140  140 GLN B CA  
1255 C  C   . GLN B 140 ? 0.7458 0.9027 0.7233 -0.1341 0.0223  0.0366  140 GLN B C   
1256 O  O   . GLN B 140 ? 0.7395 0.9677 0.9587 -0.1261 0.0034  0.0583  140 GLN B O   
1257 C  CB  . GLN B 140 ? 0.6420 0.7889 0.8219 -0.1730 -0.0239 -0.0336 140 GLN B CB  
1258 N  N   . ASP B 141 ? 0.5324 0.7113 0.6369 -0.1114 -0.1170 0.0135  141 ASP B N   
1259 C  CA  . ASP B 141 ? 0.4659 0.5684 0.5717 -0.1083 -0.0805 -0.0917 141 ASP B CA  
1260 C  C   . ASP B 141 ? 0.4435 0.5414 0.6415 -0.0965 -0.0468 -0.0372 141 ASP B C   
1261 O  O   . ASP B 141 ? 0.5229 0.5888 0.8558 -0.0523 -0.1398 -0.0503 141 ASP B O   
1262 C  CB  . ASP B 141 ? 0.5335 0.5835 0.6899 -0.0770 -0.0983 0.0016  141 ASP B CB  
1263 C  CG  . ASP B 141 ? 0.5264 0.5863 0.7617 -0.0439 -0.0946 -0.0781 141 ASP B CG  
1264 O  OD1 . ASP B 141 ? 0.3997 0.5605 0.7381 -0.1379 -0.1350 -0.0561 141 ASP B OD1 
1265 O  OD2 . ASP B 141 ? 0.4159 0.6303 0.7552 -0.0554 -0.1454 -0.1114 141 ASP B OD2 
1266 N  N   . ASP B 142 ? 0.4448 0.5675 0.5953 -0.1868 -0.0432 -0.0903 142 ASP B N   
1267 C  CA  . ASP B 142 ? 0.6079 0.6267 0.6287 -0.1016 0.0223  -0.0793 142 ASP B CA  
1268 C  C   . ASP B 142 ? 0.5854 0.6826 0.6689 -0.0936 0.0192  -0.0625 142 ASP B C   
1269 O  O   . ASP B 142 ? 0.5454 0.5556 0.6940 -0.1543 0.0238  -0.1213 142 ASP B O   
1270 C  CB  . ASP B 142 ? 0.5318 0.7060 0.6927 -0.0802 -0.0282 -0.0110 142 ASP B CB  
1271 N  N   . TYR B 143 ? 0.5199 0.5372 0.7004 -0.0561 0.0051  -0.0170 143 TYR B N   
1272 C  CA  . TYR B 143 ? 0.4969 0.5013 0.7174 -0.0457 -0.0610 -0.0328 143 TYR B CA  
1273 C  C   . TYR B 143 ? 0.4556 0.4724 0.6958 -0.0525 0.0042  0.0361  143 TYR B C   
1274 O  O   . TYR B 143 ? 0.3771 0.4058 0.5974 -0.0125 -0.0385 -0.0657 143 TYR B O   
1275 C  CB  . TYR B 143 ? 0.4160 0.5123 0.6980 -0.0489 -0.0642 -0.0654 143 TYR B CB  
1276 C  CG  . TYR B 143 ? 0.5206 0.4714 0.5836 0.0026  -0.0499 0.0046  143 TYR B CG  
1277 C  CD1 . TYR B 143 ? 0.4473 0.4445 0.5481 -0.0375 -0.0271 -0.0644 143 TYR B CD1 
1278 C  CD2 . TYR B 143 ? 0.5569 0.5497 0.6673 -0.0090 0.0000  -0.0201 143 TYR B CD2 
1279 C  CE1 . TYR B 143 ? 0.5485 0.4392 0.6822 0.0442  -0.0697 -0.0475 143 TYR B CE1 
1280 C  CE2 . TYR B 143 ? 0.5838 0.5174 0.6160 -0.0173 -0.0361 0.0037  143 TYR B CE2 
1281 C  CZ  . TYR B 143 ? 0.5694 0.5290 0.6157 -0.0478 -0.0015 0.0139  143 TYR B CZ  
1282 O  OH  . TYR B 143 ? 0.5998 0.5633 0.8983 -0.0581 -0.1273 -0.0552 143 TYR B OH  
1283 N  N   . ASP B 144 ? 0.4754 0.4422 0.6409 -0.0693 -0.0461 -0.0056 144 ASP B N   
1284 C  CA  . ASP B 144 ? 0.4882 0.4624 0.5806 0.0313  0.0295  0.0272  144 ASP B CA  
1285 C  C   . ASP B 144 ? 0.4365 0.3960 0.4594 0.0289  -0.0428 -0.0049 144 ASP B C   
1286 O  O   . ASP B 144 ? 0.4583 0.3484 0.5283 -0.0472 -0.0274 -0.0536 144 ASP B O   
1287 C  CB  . ASP B 144 ? 0.6027 0.5267 0.6275 0.0180  0.0425  0.0709  144 ASP B CB  
1288 C  CG  . ASP B 144 ? 0.6750 0.6095 0.5937 -0.0432 -0.0764 -0.0204 144 ASP B CG  
1289 O  OD1 . ASP B 144 ? 0.4844 0.5837 0.6446 0.0113  -0.1663 -0.0029 144 ASP B OD1 
1290 O  OD2 . ASP B 144 ? 0.6500 0.5747 0.7253 -0.0225 -0.0536 -0.0018 144 ASP B OD2 
1291 N  N   . GLU B 145 ? 0.3893 0.3350 0.4431 -0.0245 -0.0360 0.0124  145 GLU B N   
1292 C  CA  . GLU B 145 ? 0.4404 0.3696 0.4686 -0.0287 0.0057  0.0061  145 GLU B CA  
1293 C  C   . GLU B 145 ? 0.3986 0.3625 0.5284 0.0003  -0.0066 0.0022  145 GLU B C   
1294 O  O   . GLU B 145 ? 0.3658 0.3230 0.4530 0.0135  -0.0819 -0.0291 145 GLU B O   
1295 C  CB  . GLU B 145 ? 0.4135 0.4106 0.4626 -0.0101 -0.0656 0.0215  145 GLU B CB  
1296 C  CG  . GLU B 145 ? 0.3717 0.3926 0.4878 -0.0406 -0.0799 -0.0246 145 GLU B CG  
1297 C  CD  . GLU B 145 ? 0.4133 0.3156 0.4360 0.0329  -0.0013 0.0033  145 GLU B CD  
1298 O  OE1 . GLU B 145 ? 0.3886 0.3728 0.4885 -0.0138 -0.0218 -0.0132 145 GLU B OE1 
1299 O  OE2 . GLU B 145 ? 0.4148 0.3959 0.4238 -0.0105 0.0159  -0.0064 145 GLU B OE2 
1300 N  N   . GLU B 146 ? 0.3664 0.3408 0.4742 -0.0084 -0.0384 -0.0388 146 GLU B N   
1301 C  CA  . GLU B 146 ? 0.3857 0.3498 0.4762 0.0195  -0.0866 0.0016  146 GLU B CA  
1302 C  C   . GLU B 146 ? 0.3424 0.3156 0.4187 0.0296  -0.0244 0.0077  146 GLU B C   
1303 O  O   . GLU B 146 ? 0.3731 0.3177 0.4685 -0.0279 -0.0698 -0.0233 146 GLU B O   
1304 C  CB  . GLU B 146 ? 0.3758 0.3349 0.4551 0.0203  -0.0593 -0.0143 146 GLU B CB  
1305 C  CG  . GLU B 146 ? 0.4085 0.4073 0.4552 0.0255  -0.1020 0.0045  146 GLU B CG  
1306 C  CD  . GLU B 146 ? 0.4901 0.4907 0.5184 -0.0608 -0.0472 0.0111  146 GLU B CD  
1307 O  OE1 . GLU B 146 ? 0.3930 0.4833 0.5540 -0.0206 -0.0850 0.0065  146 GLU B OE1 
1308 O  OE2 . GLU B 146 ? 0.5562 0.6238 0.6071 -0.1157 -0.1307 -0.0557 146 GLU B OE2 
1309 N  N   . ARG B 147 ? 0.3661 0.3358 0.4070 0.0052  -0.0340 0.0043  147 ARG B N   
1310 C  CA  . ARG B 147 ? 0.4102 0.3645 0.4238 0.0120  -0.0150 -0.0382 147 ARG B CA  
1311 C  C   . ARG B 147 ? 0.3903 0.3399 0.4218 0.0021  -0.0172 -0.0589 147 ARG B C   
1312 O  O   . ARG B 147 ? 0.4261 0.3234 0.4186 -0.0195 -0.0198 -0.0664 147 ARG B O   
1313 C  CB  . ARG B 147 ? 0.4946 0.3853 0.4618 0.0010  0.0252  -0.0262 147 ARG B CB  
1314 C  CG  . ARG B 147 ? 0.4098 0.4192 0.4595 -0.0102 -0.0185 -0.0156 147 ARG B CG  
1315 C  CD  . ARG B 147 ? 0.3845 0.3865 0.4455 -0.0533 -0.0235 -0.0693 147 ARG B CD  
1316 N  NE  . ARG B 147 ? 0.4321 0.4167 0.5670 0.0251  -0.0893 -0.0574 147 ARG B NE  
1317 C  CZ  . ARG B 147 ? 0.4631 0.5289 0.6459 -0.0231 -0.0812 -0.1061 147 ARG B CZ  
1318 N  NH1 . ARG B 147 ? 0.4271 0.5039 0.5686 0.0131  -0.1031 -0.0417 147 ARG B NH1 
1319 N  NH2 . ARG B 147 ? 0.4295 0.5238 0.6968 -0.0279 -0.1585 -0.0915 147 ARG B NH2 
1320 N  N   . LYS B 148 ? 0.3979 0.3328 0.4495 0.0055  -0.0415 -0.0846 148 LYS B N   
1321 C  CA  . LYS B 148 ? 0.3749 0.3073 0.4059 -0.0101 -0.0307 -0.0590 148 LYS B CA  
1322 C  C   . LYS B 148 ? 0.3620 0.3195 0.4084 0.0116  -0.0539 -0.0163 148 LYS B C   
1323 O  O   . LYS B 148 ? 0.3441 0.3259 0.4443 0.0196  -0.0873 -0.0365 148 LYS B O   
1324 C  CB  . LYS B 148 ? 0.3941 0.2952 0.4247 0.0174  -0.0669 -0.0583 148 LYS B CB  
1325 C  CG  . LYS B 148 ? 0.4435 0.3699 0.4170 -0.0090 -0.0466 -0.0422 148 LYS B CG  
1326 C  CD  . LYS B 148 ? 0.4556 0.3359 0.5286 -0.0207 -0.0062 -0.0434 148 LYS B CD  
1327 C  CE  . LYS B 148 ? 0.5151 0.3995 0.4557 -0.0223 0.0126  -0.0335 148 LYS B CE  
1328 N  NZ  . LYS B 148 ? 0.4239 0.3677 0.4303 -0.0292 0.0140  -0.0266 148 LYS B NZ  
1329 N  N   . THR B 149 ? 0.3369 0.2894 0.3384 -0.0290 -0.0526 -0.0707 149 THR B N   
1330 C  CA  . THR B 149 ? 0.3566 0.3110 0.3323 -0.0159 -0.0405 -0.0523 149 THR B CA  
1331 C  C   . THR B 149 ? 0.3638 0.3012 0.3615 -0.0122 -0.0194 -0.0581 149 THR B C   
1332 O  O   . THR B 149 ? 0.3410 0.3357 0.3955 -0.0014 -0.0286 -0.0701 149 THR B O   
1333 C  CB  . THR B 149 ? 0.3648 0.3463 0.3592 -0.0034 -0.0481 -0.0195 149 THR B CB  
1334 O  OG1 . THR B 149 ? 0.4078 0.3954 0.4348 0.0025  -0.0979 -0.0842 149 THR B OG1 
1335 C  CG2 . THR B 149 ? 0.3521 0.4233 0.4032 -0.0329 -0.0391 -0.0095 149 THR B CG2 
1336 N  N   . ASN B 150 ? 0.3281 0.3107 0.3357 -0.0166 -0.0414 -0.0647 150 ASN B N   
1337 C  CA  . ASN B 150 ? 0.3028 0.3130 0.3459 -0.0162 -0.0536 -0.0654 150 ASN B CA  
1338 C  C   . ASN B 150 ? 0.3142 0.3419 0.3551 -0.0061 -0.0411 0.0068  150 ASN B C   
1339 O  O   . ASN B 150 ? 0.3479 0.3371 0.3636 -0.0189 -0.0751 -0.0397 150 ASN B O   
1340 C  CB  . ASN B 150 ? 0.3218 0.2827 0.3472 -0.0058 -0.0441 -0.0349 150 ASN B CB  
1341 C  CG  . ASN B 150 ? 0.2870 0.3271 0.3201 -0.0056 -0.0187 -0.0159 150 ASN B CG  
1342 O  OD1 . ASN B 150 ? 0.3037 0.3334 0.3144 -0.0124 -0.0597 -0.0152 150 ASN B OD1 
1343 N  ND2 . ASN B 150 ? 0.3021 0.3150 0.3445 -0.0032 -0.0355 -0.0549 150 ASN B ND2 
1344 N  N   . LEU B 151 ? 0.3386 0.3083 0.3523 -0.0047 -0.0473 -0.0104 151 LEU B N   
1345 C  CA  . LEU B 151 ? 0.3825 0.3452 0.3749 0.0028  -0.0568 0.0161  151 LEU B CA  
1346 C  C   . LEU B 151 ? 0.3800 0.3699 0.3633 0.0217  -0.0589 -0.0241 151 LEU B C   
1347 O  O   . LEU B 151 ? 0.4257 0.3515 0.4403 -0.0005 -0.1055 -0.0563 151 LEU B O   
1348 C  CB  . LEU B 151 ? 0.4161 0.3454 0.4088 -0.0633 -0.0529 0.0051  151 LEU B CB  
1349 C  CG  . LEU B 151 ? 0.4965 0.3969 0.4143 -0.0406 -0.0290 -0.0214 151 LEU B CG  
1350 C  CD1 . LEU B 151 ? 0.4540 0.3914 0.4323 -0.0736 -0.0311 -0.0077 151 LEU B CD1 
1351 C  CD2 . LEU B 151 ? 0.3782 0.4428 0.4296 -0.0260 -0.0716 -0.0008 151 LEU B CD2 
1352 N  N   . SER B 152 ? 0.3475 0.3074 0.3417 -0.0015 -0.0897 -0.0190 152 SER B N   
1353 C  CA  . SER B 152 ? 0.3862 0.3417 0.3583 0.0145  -0.0428 0.0023  152 SER B CA  
1354 C  C   . SER B 152 ? 0.3730 0.3306 0.4395 0.0093  -0.0332 -0.0159 152 SER B C   
1355 O  O   . SER B 152 ? 0.3758 0.3367 0.4405 0.0051  -0.0570 -0.0411 152 SER B O   
1356 C  CB  . SER B 152 ? 0.4076 0.3609 0.3995 -0.0028 -0.0282 -0.0320 152 SER B CB  
1357 O  OG  . SER B 152 ? 0.4081 0.3488 0.4773 -0.0140 -0.0601 -0.0507 152 SER B OG  
1358 N  N   . ALA B 153 ? 0.3519 0.3276 0.4153 -0.0134 -0.0947 -0.0266 153 ALA B N   
1359 C  CA  . ALA B 153 ? 0.3596 0.3495 0.3695 -0.0015 -0.0551 0.0061  153 ALA B CA  
1360 C  C   . ALA B 153 ? 0.3670 0.3601 0.3684 -0.0021 -0.0283 -0.0194 153 ALA B C   
1361 O  O   . ALA B 153 ? 0.3806 0.3836 0.4052 -0.0345 -0.0553 -0.0768 153 ALA B O   
1362 C  CB  . ALA B 153 ? 0.3403 0.3494 0.3933 0.0022  -0.0579 -0.0128 153 ALA B CB  
1363 N  N   . VAL B 154 ? 0.3254 0.3037 0.3361 0.0137  -0.0692 -0.0093 154 VAL B N   
1364 C  CA  . VAL B 154 ? 0.3641 0.3373 0.3621 0.0001  -0.0519 -0.0408 154 VAL B CA  
1365 C  C   . VAL B 154 ? 0.3573 0.3392 0.4778 -0.0099 -0.0605 -0.0421 154 VAL B C   
1366 O  O   . VAL B 154 ? 0.3645 0.3475 0.4282 -0.0113 -0.0991 -0.0766 154 VAL B O   
1367 C  CB  . VAL B 154 ? 0.3579 0.3573 0.3480 -0.0063 -0.0474 -0.0485 154 VAL B CB  
1368 C  CG1 . VAL B 154 ? 0.4259 0.3515 0.3722 -0.0347 -0.0294 -0.0776 154 VAL B CG1 
1369 C  CG2 . VAL B 154 ? 0.3665 0.3569 0.4120 -0.0036 -0.0363 -0.0818 154 VAL B CG2 
1370 N  N   . VAL B 155 ? 0.3832 0.3310 0.4356 0.0043  -0.0922 -0.0565 155 VAL B N   
1371 C  CA  . VAL B 155 ? 0.3625 0.3352 0.4271 0.0083  -0.0188 -0.0812 155 VAL B CA  
1372 C  C   . VAL B 155 ? 0.3958 0.3512 0.4390 0.0081  -0.0275 -0.0564 155 VAL B C   
1373 O  O   . VAL B 155 ? 0.4009 0.4252 0.5066 -0.0274 -0.0740 -0.1121 155 VAL B O   
1374 C  CB  . VAL B 155 ? 0.3794 0.3554 0.4542 0.0227  -0.0530 0.0189  155 VAL B CB  
1375 C  CG1 . VAL B 155 ? 0.3983 0.3495 0.5390 0.0561  -0.0654 -0.0540 155 VAL B CG1 
1376 C  CG2 . VAL B 155 ? 0.4076 0.3540 0.4020 -0.0301 -0.0562 -0.0320 155 VAL B CG2 
1377 N  N   . ALA B 156 ? 0.3993 0.2960 0.4253 -0.0239 -0.0306 -0.0671 156 ALA B N   
1378 C  CA  . ALA B 156 ? 0.4422 0.3859 0.4508 -0.0206 0.0071  -0.0560 156 ALA B CA  
1379 C  C   . ALA B 156 ? 0.4301 0.3990 0.5048 -0.0370 -0.0075 -0.0628 156 ALA B C   
1380 O  O   . ALA B 156 ? 0.4428 0.4239 0.4975 -0.0785 -0.0159 -0.1043 156 ALA B O   
1381 C  CB  . ALA B 156 ? 0.4402 0.4387 0.4470 -0.0637 0.0083  -0.0896 156 ALA B CB  
1382 N  N   . ALA B 157 ? 0.4330 0.3885 0.4482 -0.0416 -0.0518 -0.1033 157 ALA B N   
1383 C  CA  . ALA B 157 ? 0.4205 0.3633 0.4753 -0.0300 -0.0038 -0.0701 157 ALA B CA  
1384 C  C   . ALA B 157 ? 0.4669 0.4463 0.4760 -0.0371 -0.0184 -0.0301 157 ALA B C   
1385 O  O   . ALA B 157 ? 0.5026 0.4443 0.5653 -0.0653 0.0658  -0.1008 157 ALA B O   
1386 C  CB  . ALA B 157 ? 0.4129 0.3561 0.4581 -0.0397 0.0010  -0.0722 157 ALA B CB  
1387 N  N   . GLN B 158 ? 0.4462 0.3895 0.4820 -0.0361 -0.0419 -0.0527 158 GLN B N   
1388 C  CA  . GLN B 158 ? 0.4685 0.5008 0.4389 -0.0396 -0.0173 -0.0148 158 GLN B CA  
1389 C  C   . GLN B 158 ? 0.4804 0.5677 0.5840 -0.0311 0.0068  -0.0888 158 GLN B C   
1390 O  O   . GLN B 158 ? 0.5077 0.5591 0.5535 -0.1109 0.0102  -0.0382 158 GLN B O   
1391 C  CB  . GLN B 158 ? 0.4055 0.3946 0.4151 -0.0251 -0.0070 -0.0660 158 GLN B CB  
1392 C  CG  . GLN B 158 ? 0.3702 0.3828 0.4241 -0.0591 -0.0167 -0.0221 158 GLN B CG  
1393 C  CD  . GLN B 158 ? 0.3558 0.4329 0.4191 -0.0282 -0.0022 0.0002  158 GLN B CD  
1394 O  OE1 . GLN B 158 ? 0.4567 0.4518 0.5721 -0.0138 -0.0702 -0.0435 158 GLN B OE1 
1395 N  NE2 . GLN B 158 ? 0.3585 0.4435 0.4308 -0.0643 -0.0821 -0.0502 158 GLN B NE2 
1396 N  N   . SER B 159 ? 0.5287 0.6314 0.5732 -0.0445 -0.0732 -0.1312 159 SER B N   
1397 C  CA  A SER B 159 ? 0.5990 0.6226 0.6178 -0.0150 0.0095  -0.0720 159 SER B CA  
1398 C  CA  B SER B 159 ? 0.5961 0.6295 0.6340 -0.0186 0.0141  -0.0675 159 SER B CA  
1399 C  C   . SER B 159 ? 0.6190 0.6080 0.6101 0.0032  0.0108  -0.0707 159 SER B C   
1400 O  O   . SER B 159 ? 0.6028 0.7507 0.6796 -0.0171 0.0055  -0.1778 159 SER B O   
1401 C  CB  A SER B 159 ? 0.6363 0.6159 0.6072 0.0051  -0.0301 -0.0560 159 SER B CB  
1402 C  CB  B SER B 159 ? 0.6436 0.5964 0.6566 -0.0248 0.0058  -0.0480 159 SER B CB  
1403 O  OG  A SER B 159 ? 0.5877 0.5912 0.5531 0.0243  0.0249  -0.0949 159 SER B OG  
1404 O  OG  B SER B 159 ? 0.6276 0.6117 0.7494 -0.0712 -0.0071 -0.0358 159 SER B OG  
1405 N  N   . ASN B 160 ? 0.6135 0.6456 0.4819 -0.0103 -0.1036 -0.0983 160 ASN B N   
1406 C  CA  . ASN B 160 ? 0.7038 0.7316 0.6526 -0.0349 0.0072  -0.0033 160 ASN B CA  
1407 C  C   . ASN B 160 ? 0.7016 0.7918 0.6800 -0.0513 0.0291  -0.0354 160 ASN B C   
1408 O  O   . ASN B 160 ? 0.7993 0.9048 0.7676 -0.0650 0.2056  -0.0301 160 ASN B O   
1409 C  CB  . ASN B 160 ? 0.6617 0.7040 0.7833 -0.0532 0.0597  0.0486  160 ASN B CB  
1410 C  CG  . ASN B 160 ? 0.7753 0.7591 0.6746 -0.1119 0.1359  0.0191  160 ASN B CG  
1411 O  OD1 . ASN B 160 ? 0.8231 0.8152 0.8209 -0.1330 0.1426  0.1142  160 ASN B OD1 
1412 N  N   . TRP B 161 ? 0.6457 0.7252 0.6806 -0.0017 0.0208  -0.0602 161 TRP B N   
1413 C  CA  . TRP B 161 ? 0.6309 0.6733 0.6210 0.0096  0.0296  -0.0526 161 TRP B CA  
1414 C  C   . TRP B 161 ? 0.6814 0.7418 0.7755 0.0543  -0.0264 -0.0819 161 TRP B C   
1415 O  O   . TRP B 161 ? 0.6213 0.8544 0.9149 0.0326  0.0426  -0.2230 161 TRP B O   
1416 C  CB  . TRP B 161 ? 0.4806 0.5372 0.5342 -0.0511 -0.0922 -0.1022 161 TRP B CB  
1417 C  CG  . TRP B 161 ? 0.4856 0.5092 0.4617 -0.0663 -0.0146 -0.0452 161 TRP B CG  
1418 C  CD1 . TRP B 161 ? 0.4793 0.4879 0.4791 -0.0244 -0.0567 -0.0866 161 TRP B CD1 
1419 C  CD2 . TRP B 161 ? 0.4873 0.4852 0.4690 -0.0530 0.0296  -0.0741 161 TRP B CD2 
1420 N  NE1 . TRP B 161 ? 0.5252 0.4666 0.4169 -0.0929 -0.0883 -0.0838 161 TRP B NE1 
1421 C  CE2 . TRP B 161 ? 0.5195 0.4948 0.4403 -0.0382 0.0097  -0.0505 161 TRP B CE2 
1422 C  CE3 . TRP B 161 ? 0.4835 0.4619 0.3627 -0.0542 0.0306  -0.0684 161 TRP B CE3 
1423 C  CZ2 . TRP B 161 ? 0.5823 0.4963 0.4025 -0.0656 0.0221  -0.0504 161 TRP B CZ2 
1424 C  CZ3 . TRP B 161 ? 0.4686 0.4331 0.4026 -0.0573 0.0249  -0.0828 161 TRP B CZ3 
1425 C  CH2 . TRP B 161 ? 0.4851 0.5442 0.4433 -0.0195 -0.0047 -0.0718 161 TRP B CH2 
1426 N  N   . GLU B 162 ? 0.7655 0.7435 0.8001 0.0017  -0.0751 -0.0914 162 GLU B N   
1427 C  CA  . GLU B 162 ? 0.7628 0.7494 0.7204 0.0240  0.0317  -0.0490 162 GLU B CA  
1428 C  C   . GLU B 162 ? 0.5993 0.5577 0.5750 -0.1369 0.1682  0.2440  162 GLU B C   
1429 O  O   . GLU B 162 ? 0.9069 0.7134 0.8889 -0.1839 0.1936  0.2156  162 GLU B O   
1430 C  CB  . GLU B 162 ? 0.8419 0.7979 0.9110 -0.0583 0.0143  0.0325  162 GLU B CB  
1431 C  CG  . GLU B 162 ? 0.8896 0.8518 0.9560 -0.0509 -0.0687 0.0263  162 GLU B CG  
1432 C  CD  . GLU B 162 ? 1.1252 1.0328 1.0511 -0.0250 0.0289  0.1469  162 GLU B CD  
1433 O  OE1 . GLU B 162 ? 1.1008 1.1182 1.0424 0.0601  0.0447  0.1044  162 GLU B OE1 
1434 O  OE2 . GLU B 162 ? 1.1434 1.1949 1.2510 -0.0593 -0.0314 0.1071  162 GLU B OE2 
1435 C  C   . ACT C .   ? 0.6310 0.5911 0.6046 -0.0242 0.1123  -0.0570 701 ACT A C   
1436 O  O   . ACT C .   ? 0.4211 0.5901 0.6039 -0.0332 -0.0322 -0.1456 701 ACT A O   
1437 O  OXT . ACT C .   ? 0.9411 0.7156 0.6833 -0.0933 0.1428  0.0651  701 ACT A OXT 
1438 C  CH3 . ACT C .   ? 0.4561 0.5994 0.4356 -0.0316 0.1222  -0.0594 701 ACT A CH3 
1439 C  C1  . GOL D .   ? 0.5479 0.5679 0.5306 -0.0322 -0.0358 0.0195  702 GOL A C1  
1440 O  O1  . GOL D .   ? 0.4567 0.4999 0.4260 0.0334  -0.1235 -0.0331 702 GOL A O1  
1441 C  C2  . GOL D .   ? 0.7137 0.6621 0.7307 0.0303  -0.0089 -0.0644 702 GOL A C2  
1442 O  O2  . GOL D .   ? 0.6582 0.8505 0.7809 0.1051  -0.0212 -0.0264 702 GOL A O2  
1443 C  C3  . GOL D .   ? 0.6800 0.6953 0.6426 0.0111  -0.0567 0.0076  702 GOL A C3  
1444 O  O3  . GOL D .   ? 0.9379 0.8648 0.7617 -0.1042 0.0070  -0.1040 702 GOL A O3  
1445 S  S   . SO4 E .   ? 0.5264 0.6537 0.5575 -0.0062 0.0084  -0.0479 201 SO4 B S   
1446 O  O1  . SO4 E .   ? 0.4830 0.7558 0.5633 -0.0422 0.0116  -0.0153 201 SO4 B O1  
1447 O  O2  . SO4 E .   ? 0.5431 0.7042 0.4485 -0.0410 0.0293  -0.1047 201 SO4 B O2  
1448 O  O3  . SO4 E .   ? 0.5534 0.6326 0.5521 -0.0326 0.0046  -0.0372 201 SO4 B O3  
1449 O  O4  . SO4 E .   ? 0.5489 0.6573 0.6257 -0.0537 0.0358  -0.0704 201 SO4 B O4  
1450 S  S   . SO4 F .   ? 0.6038 0.5433 0.5875 -0.0150 -0.0154 -0.0191 202 SO4 B S   
1451 O  O1  . SO4 F .   ? 0.5253 0.3728 0.6532 -0.0343 -0.0123 0.0776  202 SO4 B O1  
1452 O  O2  . SO4 F .   ? 0.6877 0.5968 0.6770 -0.0400 -0.0825 0.0002  202 SO4 B O2  
1453 O  O3  . SO4 F .   ? 0.4246 0.2797 0.4934 0.0143  -0.0579 -0.0928 202 SO4 B O3  
1454 O  O4  . SO4 F .   ? 0.7803 0.5826 0.6705 -0.0141 -0.0146 -0.0867 202 SO4 B O4  
1455 NA NA  . NA  G .   ? 0.4201 0.4647 0.5040 -0.0615 -0.0814 -0.0314 203 NA  B NA  
1456 C  C   . ACT H .   ? 0.5461 0.4999 0.6624 0.0170  -0.0154 0.0456  204 ACT B C   
1457 O  O   . ACT H .   ? 0.3996 0.4473 0.4938 -0.0400 -0.0495 0.0361  204 ACT B O   
1458 O  OXT . ACT H .   ? 0.7201 0.5589 0.7462 -0.0769 0.0127  0.0538  204 ACT B OXT 
1459 C  CH3 . ACT H .   ? 0.5849 0.5343 0.4839 0.0864  -0.0643 -0.0680 204 ACT B CH3 
1460 C  C1  . GOL I .   ? 0.8268 0.8330 0.7933 -0.0239 0.0635  -0.0437 205 GOL B C1  
1461 O  O1  . GOL I .   ? 0.7372 0.9743 0.7003 -0.1650 0.1630  0.0728  205 GOL B O1  
1462 C  C2  . GOL I .   ? 0.8073 0.8132 0.8186 0.0193  -0.0008 -0.0400 205 GOL B C2  
1463 O  O2  . GOL I .   ? 0.7745 0.8557 0.8632 0.0557  0.0567  0.0181  205 GOL B O2  
1464 C  C3  . GOL I .   ? 0.9007 0.8875 0.8401 -0.0244 0.0157  -0.1108 205 GOL B C3  
1465 O  O3  . GOL I .   ? 0.9313 0.8574 0.9032 -0.0133 0.1087  -0.1542 205 GOL B O3  
1466 C  C1  . GOL J .   ? 0.5118 0.5442 0.5103 0.0211  -0.0127 -0.0010 206 GOL B C1  
1467 O  O1  . GOL J .   ? 0.4745 0.4760 0.4293 -0.0383 0.0476  0.0018  206 GOL B O1  
1468 C  C2  . GOL J .   ? 0.5136 0.6094 0.5902 -0.0471 0.0874  -0.0058 206 GOL B C2  
1469 O  O2  . GOL J .   ? 0.6128 0.5855 0.8354 0.0508  0.0186  -0.0017 206 GOL B O2  
1470 C  C3  . GOL J .   ? 0.6969 0.4289 0.5435 -0.0770 0.0176  -0.0634 206 GOL B C3  
1471 O  O3  . GOL J .   ? 0.3219 0.3683 0.3305 0.0464  0.0378  0.0002  206 GOL B O3  
1472 C  C1  . GOL K .   ? 0.6010 0.8141 0.7233 0.0015  0.0190  0.0016  207 GOL B C1  
1473 O  O1  . GOL K .   ? 0.6394 0.7214 0.7338 -0.1711 0.1346  -0.1327 207 GOL B O1  
1474 C  C2  . GOL K .   ? 0.7656 0.7013 0.7152 0.0254  0.0704  0.0497  207 GOL B C2  
1475 O  O2  . GOL K .   ? 0.8979 0.6562 0.7411 -0.0643 0.0229  -0.0494 207 GOL B O2  
1476 C  C3  . GOL K .   ? 0.5078 0.6939 0.7217 -0.0374 0.0421  -0.0463 207 GOL B C3  
1477 O  O3  . GOL K .   ? 0.5211 0.7352 0.6429 -0.0594 -0.0067 -0.0379 207 GOL B O3  
1478 C  C1  . GOL L .   ? 0.5209 0.5101 0.6629 0.0339  0.0809  0.0092  208 GOL B C1  
1479 O  O1  . GOL L .   ? 0.4490 0.5674 0.6500 -0.0131 0.1366  -0.0529 208 GOL B O1  
1480 C  C2  . GOL L .   ? 0.5316 0.5721 0.6307 -0.0382 0.0622  -0.0802 208 GOL B C2  
1481 O  O2  . GOL L .   ? 0.3774 0.4268 0.4266 0.0504  0.0128  -0.0171 208 GOL B O2  
1482 C  C3  . GOL L .   ? 0.6136 0.6222 0.5098 0.0165  0.1460  -0.0467 208 GOL B C3  
1483 O  O3  . GOL L .   ? 0.6327 0.7644 0.5948 -0.1043 0.2064  -0.0697 208 GOL B O3  
1484 O  O   . HOH M .   ? 0.4485 0.4703 0.6622 0.0386  0.1697  -0.0937 801 HOH A O   
1485 O  O   . HOH M .   ? 0.7348 0.5242 0.6784 -0.0447 -0.3195 0.0692  802 HOH A O   
1486 O  O   . HOH M .   ? 0.5099 0.5322 0.5750 0.0755  -0.0554 -0.0644 803 HOH A O   
1487 O  O   . HOH M .   ? 0.4476 0.5543 0.4290 -0.0008 0.0293  -0.0885 804 HOH A O   
1488 O  O   . HOH M .   ? 0.4864 0.5495 0.5935 0.0291  -0.0105 -0.0378 805 HOH A O   
1489 O  O   . HOH M .   ? 0.3866 0.3647 0.4662 0.0725  -0.1176 -0.0781 806 HOH A O   
1490 O  O   . HOH M .   ? 0.6043 0.5144 0.4420 -0.0475 0.0011  0.0010  807 HOH A O   
1491 O  O   . HOH M .   ? 0.4459 0.5425 0.5358 -0.0295 0.0730  -0.0760 808 HOH A O   
1492 O  O   . HOH M .   ? 0.2992 0.3891 0.3817 0.0161  -0.0254 -0.0688 809 HOH A O   
1493 O  O   . HOH M .   ? 0.4769 0.6812 0.5646 -0.0511 -0.0599 -0.0632 810 HOH A O   
1494 O  O   . HOH M .   ? 0.5494 0.4984 0.8545 0.0382  -0.0352 -0.1391 811 HOH A O   
1495 O  O   . HOH M .   ? 0.5337 0.5208 0.7998 0.0532  0.1201  -0.1211 812 HOH A O   
1496 O  O   . HOH M .   ? 0.3590 0.3951 0.4213 0.0591  -0.0139 -0.0799 813 HOH A O   
1497 O  O   . HOH M .   ? 0.9652 0.6124 0.6003 -0.0868 -0.1291 0.0235  814 HOH A O   
1498 O  O   . HOH M .   ? 0.6207 0.6906 0.7067 -0.0470 0.1434  0.0152  815 HOH A O   
1499 O  O   . HOH M .   ? 0.8335 1.0855 0.9848 -0.0226 0.0610  -0.1016 816 HOH A O   
1500 O  O   . HOH M .   ? 0.5807 0.6830 0.9793 -0.1039 0.0473  -0.0135 817 HOH A O   
1501 O  O   . HOH M .   ? 0.6726 0.7571 0.7449 0.1745  -0.0455 -0.0010 818 HOH A O   
1502 O  O   . HOH M .   ? 0.5607 0.6386 0.6379 -0.0460 0.0636  -0.0164 819 HOH A O   
1503 O  O   . HOH M .   ? 0.8078 1.1349 0.7619 0.0938  0.2998  -0.0927 820 HOH A O   
1504 O  O   . HOH M .   ? 0.9816 0.6188 0.6273 0.0311  0.1062  -0.0157 821 HOH A O   
1505 O  O   . HOH M .   ? 0.6119 0.7383 0.7419 -0.0146 0.0052  -0.1461 822 HOH A O   
1506 O  O   . HOH M .   ? 1.2599 1.0948 0.6119 0.1201  0.2268  -0.0092 823 HOH A O   
1507 O  O   . HOH M .   ? 0.8073 0.6729 0.8723 -0.0874 -0.2234 -0.1739 824 HOH A O   
1508 O  O   . HOH M .   ? 0.8420 0.5385 0.7427 -0.0403 -0.1466 0.1472  825 HOH A O   
1509 O  O   . HOH M .   ? 0.7146 0.8316 0.8237 -0.0433 -0.2422 -0.0818 826 HOH A O   
1510 O  O   . HOH M .   ? 0.4519 0.9979 0.7159 -0.0312 -0.1983 0.1252  827 HOH A O   
1511 O  O   . HOH M .   ? 0.5029 0.7232 0.9067 0.0943  -0.0535 0.0241  828 HOH A O   
1512 O  O   . HOH M .   ? 1.2306 0.9770 0.6005 0.3211  0.0002  0.0434  829 HOH A O   
1513 O  O   . HOH M .   ? 0.4966 0.9143 0.8648 0.1220  0.2195  -0.0633 830 HOH A O   
1514 O  O   . HOH M .   ? 0.9538 0.8922 0.8486 -0.2567 -0.0707 -0.0764 831 HOH A O   
1515 O  O   . HOH M .   ? 1.1969 0.7460 0.9073 0.0207  0.0258  -0.1685 832 HOH A O   
1516 O  O   . HOH M .   ? 1.0609 0.7939 0.6428 -0.1716 0.1667  0.1612  833 HOH A O   
1517 O  O   . HOH M .   ? 0.9955 1.0620 0.6356 -0.0986 0.0070  -0.1316 834 HOH A O   
1518 O  O   . HOH M .   ? 0.9796 0.9055 0.9103 0.0294  0.1272  -0.0185 835 HOH A O   
1519 O  O   . HOH N .   ? 0.4845 0.6876 0.5998 0.0524  -0.0083 0.0411  301 HOH B O   
1520 O  O   . HOH N .   ? 0.4800 0.5268 0.4611 -0.0134 -0.0128 -0.0097 302 HOH B O   
1521 O  O   . HOH N .   ? 0.4983 0.7285 0.6007 0.0191  -0.0551 -0.0524 303 HOH B O   
1522 O  O   . HOH N .   ? 0.3643 0.4130 0.3945 -0.0209 -0.0070 -0.0869 304 HOH B O   
1523 O  O   . HOH N .   ? 0.4584 0.4524 0.5345 -0.1229 -0.0640 -0.0059 305 HOH B O   
1524 O  O   . HOH N .   ? 0.3087 0.3431 0.3433 -0.0209 -0.0093 -0.0118 306 HOH B O   
1525 O  O   . HOH N .   ? 0.5507 0.7342 0.5267 -0.1768 -0.1897 -0.0805 307 HOH B O   
1526 O  O   . HOH N .   ? 0.4731 0.5757 0.5943 -0.0325 0.0449  0.0938  308 HOH B O   
1527 O  O   . HOH N .   ? 0.5416 0.5929 0.6635 -0.0726 -0.0688 0.0085  309 HOH B O   
1528 O  O   . HOH N .   ? 0.6661 0.6477 0.6913 0.1993  -0.0434 -0.2114 310 HOH B O   
1529 O  O   . HOH N .   ? 0.5005 0.5517 0.4370 -0.0414 -0.0371 -0.0621 311 HOH B O   
1530 O  O   . HOH N .   ? 0.5479 0.6220 0.7939 -0.0446 -0.0779 -0.1727 312 HOH B O   
1531 O  O   . HOH N .   ? 0.4662 0.9259 0.5039 0.1811  -0.0492 -0.0877 313 HOH B O   
1532 O  O   . HOH N .   ? 0.3451 0.4443 0.4341 0.0239  0.0159  -0.0258 314 HOH B O   
1533 O  O   . HOH N .   ? 0.6388 0.6905 1.1401 0.0127  -0.0642 -0.0843 315 HOH B O   
1534 O  O   . HOH N .   ? 0.5030 0.8160 0.6208 -0.0479 0.0410  -0.0452 316 HOH B O   
1535 O  O   . HOH N .   ? 0.7455 0.8168 0.7803 -0.0886 -0.0898 0.0572  317 HOH B O   
1536 O  O   . HOH N .   ? 0.4101 0.3560 0.5386 0.0874  -0.0375 0.0161  318 HOH B O   
1537 O  O   . HOH N .   ? 0.3456 0.3589 0.4355 0.0020  0.0017  0.0024  319 HOH B O   
1538 O  O   . HOH N .   ? 0.3116 0.4135 0.3598 -0.0896 -0.1217 -0.0155 320 HOH B O   
1539 O  O   . HOH N .   ? 0.6818 0.7988 0.6041 -0.0354 -0.0365 -0.0440 321 HOH B O   
1540 O  O   . HOH N .   ? 0.4864 0.5337 0.4383 0.0194  -0.0121 -0.0438 322 HOH B O   
1541 O  O   . HOH N .   ? 0.5698 0.5741 0.5909 -0.1181 0.0144  0.0874  323 HOH B O   
1542 O  O   . HOH N .   ? 0.3787 0.4469 0.5099 -0.0570 0.0487  -0.0016 324 HOH B O   
1543 O  O   . HOH N .   ? 0.7512 0.5268 0.5183 0.1421  0.0948  0.0662  325 HOH B O   
1544 O  O   . HOH N .   ? 0.5246 0.6306 0.7114 -0.0793 -0.0938 -0.0261 326 HOH B O   
1545 O  O   . HOH N .   ? 0.4544 0.4792 0.5734 -0.0953 -0.2160 0.0494  327 HOH B O   
1546 O  O   . HOH N .   ? 0.3553 0.4228 0.5354 0.0506  -0.0174 -0.0035 328 HOH B O   
1547 O  O   . HOH N .   ? 0.2913 0.3223 0.3610 0.0135  -0.0170 -0.0151 329 HOH B O   
1548 O  O   . HOH N .   ? 0.5005 0.5417 0.4303 -0.0620 -0.0020 -0.1355 330 HOH B O   
1549 O  O   . HOH N .   ? 0.3101 0.4115 0.3730 -0.0946 -0.0622 -0.0263 331 HOH B O   
1550 O  O   . HOH N .   ? 0.6571 0.5827 0.7369 0.0404  -0.0931 0.0290  332 HOH B O   
1551 O  O   . HOH N .   ? 0.4947 0.4957 0.5760 0.0148  -0.0476 -0.0408 333 HOH B O   
1552 O  O   . HOH N .   ? 0.6280 0.6280 0.5380 0.0524  -0.0364 -0.0094 334 HOH B O   
1553 O  O   . HOH N .   ? 0.8789 0.9514 0.7858 0.0557  0.0330  -0.0713 335 HOH B O   
1554 O  O   . HOH N .   ? 0.4871 0.5764 0.5759 0.0013  0.1510  -0.0764 336 HOH B O   
1555 O  O   . HOH N .   ? 0.9117 0.7584 0.6204 0.1651  0.0919  0.0680  337 HOH B O   
1556 O  O   . HOH N .   ? 0.5300 0.6773 0.5513 -0.1434 -0.1139 0.1874  338 HOH B O   
1557 O  O   . HOH N .   ? 0.7363 0.6073 0.6444 0.1949  0.1802  -0.0968 339 HOH B O   
1558 O  O   . HOH N .   ? 0.4684 0.5941 0.7469 0.1868  -0.0331 -0.0525 340 HOH B O   
1559 O  O   . HOH N .   ? 0.2851 0.3660 0.3546 -0.0044 -0.0047 0.0131  341 HOH B O   
1560 O  O   . HOH N .   ? 0.7316 0.5271 0.7891 0.0771  0.1031  -0.0011 342 HOH B O   
1561 O  O   . HOH N .   ? 0.7055 0.6592 0.8168 -0.0871 0.0490  0.0072  343 HOH B O   
1562 O  O   . HOH N .   ? 0.7094 0.6649 0.5609 -0.0313 -0.0942 0.1357  344 HOH B O   
1563 O  O   . HOH N .   ? 0.4769 0.3119 0.3957 0.0201  -0.0444 0.1094  345 HOH B O   
1564 O  O   . HOH N .   ? 0.4728 0.4532 0.5147 -0.1114 0.0044  -0.0116 346 HOH B O   
1565 O  O   . HOH N .   ? 0.4143 0.3186 0.4249 0.0217  -0.0344 0.0029  347 HOH B O   
1566 O  O   . HOH N .   ? 0.5896 0.7316 0.5970 0.0669  -0.0127 -0.0307 348 HOH B O   
1567 O  O   . HOH N .   ? 0.2951 0.4226 0.4026 -0.0127 0.0100  -0.0056 349 HOH B O   
1568 O  O   . HOH N .   ? 0.6378 0.3709 0.6055 0.0222  0.0618  -0.1148 350 HOH B O   
1569 O  O   . HOH N .   ? 0.7292 0.5623 0.4969 0.0638  -0.1222 -0.1546 351 HOH B O   
1570 O  O   . HOH N .   ? 0.4453 0.6473 0.4565 -0.1103 -0.0167 0.0730  352 HOH B O   
1571 O  O   . HOH N .   ? 0.5857 0.7771 0.6989 -0.1187 -0.1161 0.0866  353 HOH B O   
1572 O  O   . HOH N .   ? 0.5310 0.4214 0.6270 0.0889  -0.0201 -0.0225 354 HOH B O   
1573 O  O   . HOH N .   ? 0.7012 0.4998 0.6652 -0.0472 -0.0874 -0.0786 355 HOH B O   
1574 O  O   . HOH N .   ? 0.7044 0.7365 0.9475 -0.0408 0.0558  -0.0616 356 HOH B O   
1575 O  O   . HOH N .   ? 0.3649 0.4407 0.5015 0.0545  0.0709  -0.0941 357 HOH B O   
1576 O  O   . HOH N .   ? 0.5261 0.5573 0.6060 -0.1364 0.0568  -0.0096 358 HOH B O   
1577 O  O   . HOH N .   ? 0.4216 0.3625 0.4362 0.0070  -0.0789 -0.0025 359 HOH B O   
1578 O  O   . HOH N .   ? 0.7053 0.6514 0.6468 -0.1431 0.1437  0.0178  360 HOH B O   
1579 O  O   . HOH N .   ? 0.4677 0.5446 0.4946 -0.1009 0.0192  0.0489  361 HOH B O   
1580 O  O   . HOH N .   ? 0.4223 0.4409 0.5447 -0.0139 -0.0572 -0.0356 362 HOH B O   
1581 O  O   . HOH N .   ? 0.7262 0.6931 0.6776 0.0699  0.1383  -0.2415 363 HOH B O   
1582 O  O   . HOH N .   ? 0.7184 0.7109 0.6978 -0.1209 -0.0880 0.0682  364 HOH B O   
1583 O  O   . HOH N .   ? 0.5420 0.7253 0.7635 0.0175  0.0542  0.0216  365 HOH B O   
1584 O  O   . HOH N .   ? 0.7375 0.6738 0.7947 0.1133  0.1197  0.1785  366 HOH B O   
1585 O  O   . HOH N .   ? 0.5325 0.8823 0.8090 -0.0115 0.0622  -0.1092 367 HOH B O   
1586 O  O   . HOH N .   ? 0.4601 0.4643 0.5899 0.0089  -0.0099 0.0053  368 HOH B O   
1587 O  O   . HOH N .   ? 0.5949 0.5844 0.6609 0.0078  0.0289  -0.0896 369 HOH B O   
1588 O  O   . HOH N .   ? 0.7535 0.7925 0.9275 -0.0331 0.0510  0.0226  370 HOH B O   
1589 O  O   . HOH N .   ? 0.6629 0.8328 0.8547 0.1254  -0.0957 -0.0177 371 HOH B O   
1590 O  O   . HOH N .   ? 0.3380 0.6263 0.7895 -0.0491 -0.0952 -0.0508 372 HOH B O   
1591 O  O   . HOH N .   ? 0.5778 0.6418 0.8070 0.0206  -0.0865 -0.0656 373 HOH B O   
1592 O  O   . HOH N .   ? 0.7231 0.6711 0.9596 0.1492  -0.0781 0.0385  374 HOH B O   
1593 O  O   . HOH N .   ? 0.6865 0.6996 0.6957 -0.0062 0.0163  0.1251  375 HOH B O   
1594 O  O   . HOH N .   ? 0.3019 0.3276 0.3209 -0.0025 0.0231  0.0049  376 HOH B O   
1595 O  O   . HOH N .   ? 0.6253 0.4593 0.7520 -0.0813 -0.0465 -0.0864 377 HOH B O   
1596 O  O   . HOH N .   ? 0.6896 0.6437 0.8196 -0.0440 -0.0606 0.1124  378 HOH B O   
1597 O  O   . HOH N .   ? 0.8104 0.5489 0.6716 -0.0707 -0.1311 -0.2837 379 HOH B O   
1598 O  O   . HOH N .   ? 0.8431 0.9410 0.5894 0.0784  -0.2070 -0.2216 380 HOH B O   
1599 O  O   . HOH N .   ? 0.3404 0.3638 0.4150 -0.0269 -0.1354 -0.0823 381 HOH B O   
1600 O  O   . HOH N .   ? 0.4377 0.5056 0.4614 -0.0401 0.0457  -0.0869 382 HOH B O   
1601 O  O   . HOH N .   ? 0.7867 0.6100 0.5940 0.0063  0.0403  -0.2181 383 HOH B O   
1602 O  O   . HOH N .   ? 0.6837 0.6167 0.7320 -0.0575 0.0288  -0.2371 384 HOH B O   
1603 O  O   . HOH N .   ? 0.8481 0.7639 0.5886 0.0050  -0.0022 -0.2181 385 HOH B O   
1604 O  O   . HOH N .   ? 0.6995 0.6249 0.8068 0.0378  -0.0693 -0.1106 386 HOH B O   
1605 O  O   . HOH N .   ? 0.8018 0.6661 0.7448 -0.1257 0.0312  0.0843  387 HOH B O   
1606 O  O   . HOH N .   ? 0.8884 1.0290 0.7453 0.1169  -0.0110 0.0575  388 HOH B O   
1607 O  O   . HOH N .   ? 0.2293 0.3525 0.3864 0.0001  -0.0203 -0.0001 389 HOH B O   
1608 O  O   . HOH N .   ? 0.5482 0.6742 1.0027 -0.1085 0.0009  0.0105  390 HOH B O   
1609 O  O   . HOH N .   ? 0.8653 0.8301 0.5377 -0.2066 -0.0012 -0.0418 391 HOH B O   
1610 O  O   . HOH N .   ? 0.6604 0.6515 0.5528 -0.1000 0.0449  0.0148  392 HOH B O   
1611 O  O   . HOH N .   ? 0.5640 0.7574 0.8977 0.0206  -0.1186 0.0900  393 HOH B O   
1612 O  O   . HOH N .   ? 0.6012 0.8272 0.6287 0.0486  0.1096  0.0047  394 HOH B O   
1613 O  O   . HOH N .   ? 0.4774 0.6091 0.8290 -0.0392 -0.0443 -0.0014 395 HOH B O   
1614 O  O   . HOH N .   ? 0.7328 0.4600 0.6203 0.0485  -0.0561 0.0064  396 HOH B O   
1615 O  O   . HOH N .   ? 0.5441 0.5861 0.7257 0.0030  -0.0019 0.0229  397 HOH B O   
1616 O  O   . HOH N .   ? 0.9881 0.6932 0.8869 0.0931  -0.0806 -0.0255 398 HOH B O   
1617 O  O   . HOH N .   ? 0.3556 0.4479 0.4298 -0.0304 -0.1018 -0.0411 399 HOH B O   
1618 O  O   . HOH N .   ? 0.7858 0.7910 0.8954 -0.0331 0.2563  0.1530  400 HOH B O   
1619 O  O   . HOH N .   ? 0.9741 0.9483 1.0123 0.2685  0.1662  -0.0354 401 HOH B O   
1620 O  O   . HOH N .   ? 0.4744 0.4391 0.6031 -0.0185 -0.0180 -0.0179 402 HOH B O   
1621 O  O   . HOH N .   ? 0.3346 0.6622 0.7007 0.0681  0.1012  -0.0854 403 HOH B O   
1622 O  O   . HOH N .   ? 0.7346 0.7598 0.8550 -0.1646 -0.0019 0.0966  404 HOH B O   
1623 O  O   . HOH N .   ? 0.9495 0.5965 0.7126 -0.1320 -0.1406 -0.2383 405 HOH B O   
1624 O  O   . HOH N .   ? 1.1612 0.6021 0.5502 0.0692  -0.0388 -0.2233 406 HOH B O   
1625 O  O   . HOH N .   ? 0.7757 0.7267 0.7757 -0.0021 -0.0496 0.0658  407 HOH B O   
1626 O  O   . HOH N .   ? 0.5970 0.4059 0.6122 0.0515  0.0318  -0.1214 408 HOH B O   
1627 O  O   . HOH N .   ? 0.7136 0.6575 0.8615 0.1433  0.0860  -0.0152 409 HOH B O   
1628 O  O   . HOH N .   ? 0.5173 0.5046 0.5947 -0.0618 -0.1436 0.0435  410 HOH B O   
1629 O  O   . HOH N .   ? 0.5391 0.6182 0.6617 -0.1165 -0.0897 -0.0517 411 HOH B O   
1630 O  O   . HOH N .   ? 1.2469 0.7506 0.6051 0.0113  -0.1261 0.0274  412 HOH B O   
1631 O  O   . HOH N .   ? 0.8136 0.6382 0.9060 -0.0787 0.0022  -0.0495 413 HOH B O   
1632 O  O   . HOH N .   ? 0.6342 0.5876 0.5696 -0.0897 -0.1204 -0.1312 414 HOH B O   
1633 O  O   . HOH N .   ? 0.6237 0.5822 0.5176 -0.0695 0.0093  -0.0949 415 HOH B O   
1634 O  O   . HOH N .   ? 0.6553 0.6586 0.7163 -0.0686 0.0000  -0.2248 416 HOH B O   
1635 O  O   . HOH N .   ? 0.8550 0.7917 0.7966 -0.0169 0.0009  0.0206  417 HOH B O   
1636 O  O   . HOH N .   ? 0.9041 0.8259 0.9226 -0.0031 -0.0187 0.0468  418 HOH B O   
1637 O  O   . HOH N .   ? 0.5115 0.4714 0.5432 -0.0596 -0.0837 -0.1726 419 HOH B O   
1638 O  O   . HOH N .   ? 0.8624 0.5578 0.6424 0.0466  -0.0275 -0.2838 420 HOH B O   
1639 O  O   . HOH N .   ? 0.7806 0.5914 0.9567 -0.1735 -0.1464 -0.0569 421 HOH B O   
1640 O  O   . HOH N .   ? 0.6974 0.9502 0.9961 0.0542  -0.0729 0.0232  422 HOH B O   
1641 O  O   . HOH N .   ? 0.6402 0.4493 0.6753 -0.2402 -0.0683 -0.1056 423 HOH B O   
1642 O  O   . HOH N .   ? 0.4825 0.5090 0.6658 -0.0355 -0.0084 0.0399  424 HOH B O   
1643 O  O   . HOH N .   ? 0.6194 0.8011 0.9142 0.0335  0.0095  -0.1793 425 HOH B O   
1644 O  O   . HOH N .   ? 0.8052 0.8855 0.6822 -0.0525 0.1824  -0.0407 426 HOH B O   
1645 O  O   . HOH N .   ? 0.6491 0.9368 1.1094 -0.1886 0.0020  0.3545  427 HOH B O   
1646 O  O   . HOH N .   ? 0.5935 0.6553 0.7579 -0.3075 -0.1292 -0.0297 428 HOH B O   
1647 O  O   . HOH N .   ? 0.8273 0.6268 0.8499 0.1331  0.0896  -0.0319 429 HOH B O   
1648 O  O   . HOH N .   ? 0.9620 0.6932 0.8599 0.0441  0.0389  -0.1735 430 HOH B O   
1649 O  O   . HOH N .   ? 0.7941 0.7373 0.5681 -0.0763 0.0152  0.0787  431 HOH B O   
1650 O  O   . HOH N .   ? 0.5438 0.3933 0.5666 0.0177  -0.0715 0.0103  432 HOH B O   
1651 O  O   . HOH N .   ? 0.5666 0.6002 0.6805 -0.1669 -0.1057 0.0784  433 HOH B O   
1652 O  O   . HOH N .   ? 1.1781 0.3894 1.2213 0.0461  0.1389  0.0755  434 HOH B O   
1653 O  O   . HOH N .   ? 0.7833 0.4987 0.9276 0.0006  -0.0661 -0.1649 435 HOH B O   
1654 O  O   . HOH N .   ? 0.5299 0.6883 0.7055 -0.0177 -0.0278 -0.0285 436 HOH B O   
1655 O  O   . HOH N .   ? 0.3657 0.3412 0.5036 -0.0733 -0.0715 -0.0058 437 HOH B O   
1656 O  O   . HOH N .   ? 0.7769 0.9680 0.9723 -0.1436 -0.1217 -0.0339 438 HOH B O   
1657 O  O   . HOH N .   ? 0.6926 0.7142 0.8534 0.2684  0.0219  0.0418  439 HOH B O   
1658 O  O   . HOH N .   ? 0.5655 0.5220 0.6801 0.0953  0.0001  0.0386  440 HOH B O   
1659 O  O   . HOH N .   ? 1.0452 0.9427 0.7393 0.0757  0.0309  0.0555  441 HOH B O   
1660 O  O   . HOH N .   ? 0.7468 0.7474 0.7839 -0.0698 -0.2424 0.0505  442 HOH B O   
1661 O  O   . HOH N .   ? 0.9095 0.8484 0.7413 0.0203  0.0513  -0.0353 443 HOH B O   
1662 O  O   . HOH N .   ? 0.7991 0.7100 0.5422 0.1505  -0.0988 -0.0541 444 HOH B O   
1663 O  O   . HOH N .   ? 0.5624 0.5083 0.7101 0.0000  -0.1381 -0.1398 445 HOH B O   
1664 O  O   . HOH N .   ? 0.6085 1.1006 0.9867 -0.0296 0.2327  -0.2107 446 HOH B O   
1665 O  O   . HOH N .   ? 0.7175 0.9483 0.9805 -0.0423 -0.2044 -0.0362 447 HOH B O   
1666 O  O   . HOH N .   ? 0.8947 0.8470 0.8385 -0.0375 0.0787  0.1636  448 HOH B O   
1667 O  O   . HOH N .   ? 0.6928 0.4906 0.8173 0.0027  -0.0173 0.0361  449 HOH B O   
1668 O  O   . HOH N .   ? 0.8560 0.7101 0.9129 0.1974  -0.0035 0.1206  450 HOH B O   
1669 O  O   . HOH N .   ? 0.2859 0.5320 0.4099 -0.0603 -0.0081 0.0388  451 HOH B O   
1670 O  O   . HOH N .   ? 0.6612 0.5329 0.8406 0.0534  0.0003  -0.1770 452 HOH B O   
1671 O  O   . HOH N .   ? 1.1328 0.9439 0.9575 -0.0206 0.0031  -0.0558 453 HOH B O   
1672 O  O   . HOH N .   ? 0.9252 0.8408 0.7821 -0.0588 -0.0802 -0.1896 454 HOH B O   
1673 O  O   . HOH N .   ? 0.9117 1.1452 0.7318 -0.0968 -0.0821 -0.0019 455 HOH B O   
1674 O  O   . HOH N .   ? 0.7403 0.7466 0.6024 0.0047  -0.0154 0.0436  456 HOH B O   
1675 O  O   . HOH N .   ? 0.2812 0.3204 0.3904 0.0132  -0.0006 0.0206  457 HOH B O   
1676 O  O   . HOH N .   ? 0.4496 0.7065 0.7450 0.0825  0.1274  -0.0019 458 HOH B O   
1677 O  O   . HOH N .   ? 0.6287 0.6920 0.7826 0.1534  -0.0184 0.2838  459 HOH B O   
1678 O  O   . HOH N .   ? 1.0937 0.5377 0.6081 0.0077  -0.0062 -0.1108 460 HOH B O   
1679 O  O   . HOH N .   ? 0.5524 0.8612 0.8433 0.0087  0.0352  -0.0624 461 HOH B O   
1680 O  O   . HOH N .   ? 0.7703 0.6156 0.9090 0.0360  0.0631  -0.1110 462 HOH B O   
1681 O  O   . HOH N .   ? 0.8122 0.8908 0.6828 0.1305  -0.0429 -0.0823 463 HOH B O   
1682 O  O   . HOH N .   ? 0.7922 0.5927 0.7210 -0.0203 0.1402  0.0712  464 HOH B O   
1683 O  O   . HOH N .   ? 0.6023 0.4903 0.6417 0.0069  -0.0889 -0.0169 465 HOH B O   
1684 O  O   . HOH N .   ? 0.9079 0.8606 0.5350 -0.1276 0.0770  -0.1761 466 HOH B O   
1685 O  O   . HOH N .   ? 0.5309 0.9567 0.8174 0.1193  -0.1822 -0.4495 467 HOH B O   
1686 O  O   . HOH N .   ? 0.7238 0.6586 0.7793 0.1060  -0.0807 0.0573  468 HOH B O   
1687 O  O   . HOH N .   ? 0.6423 0.9897 0.8462 0.0117  -0.2533 -0.1353 469 HOH B O   
1688 O  O   . HOH N .   ? 0.5108 0.7616 0.7380 0.0169  0.0147  0.0394  470 HOH B O   
1689 O  O   . HOH N .   ? 0.6262 0.8983 0.7005 -0.1710 -0.1732 0.0794  471 HOH B O   
1690 O  O   . HOH N .   ? 0.9132 0.6184 1.0776 0.0161  -0.0575 0.0019  472 HOH B O   
1691 O  O   . HOH N .   ? 0.7266 1.1331 0.7618 -0.1366 0.0895  0.1763  473 HOH B O   
1692 O  O   . HOH N .   ? 0.6887 0.6227 0.8605 0.1225  0.0148  0.0550  474 HOH B O   
1693 O  O   . HOH N .   ? 0.5747 0.7566 0.5901 -0.1347 -0.0312 0.0060  475 HOH B O   
1694 O  O   . HOH N .   ? 0.8676 0.6687 0.8876 0.1682  0.2344  -0.1785 476 HOH B O   
1695 O  O   . HOH N .   ? 0.5011 0.5462 0.8166 0.0454  0.0111  0.0507  477 HOH B O   
1696 O  O   . HOH N .   ? 0.6603 0.7012 0.6963 -0.0392 -0.0116 0.0629  478 HOH B O   
1697 O  O   . HOH N .   ? 0.5268 0.4469 0.6799 -0.0632 -0.0988 -0.0001 479 HOH B O   
1698 O  O   . HOH N .   ? 0.4274 0.4173 0.5733 -0.0077 -0.0640 0.0258  480 HOH B O   
1699 O  O   . HOH N .   ? 0.6786 0.9060 0.9669 0.0774  -0.0489 0.0202  481 HOH B O   
1700 O  O   . HOH N .   ? 0.6847 1.0005 1.1854 0.3687  0.0419  0.1027  482 HOH B O   
1701 O  O   . HOH N .   ? 0.8392 1.1030 0.9608 0.4183  0.0716  -0.0739 483 HOH B O   
1702 O  O   . HOH N .   ? 0.5639 0.8600 0.9590 0.0845  0.1179  0.0086  484 HOH B O   
1703 O  O   . HOH N .   ? 0.7626 1.0494 0.9566 -0.2228 0.0007  0.0054  485 HOH B O   
1704 O  O   . HOH N .   ? 0.7711 0.6189 0.7784 0.0521  -0.0837 -0.0609 486 HOH B O   
1705 O  O   . HOH N .   ? 0.6577 0.5988 0.8118 -0.0335 -0.1286 -0.1310 487 HOH B O   
1706 O  O   . HOH N .   ? 0.8286 0.6219 1.0236 -0.0044 0.1536  -0.2018 488 HOH B O   
1707 O  O   . HOH N .   ? 0.8391 1.0754 0.8391 -0.0447 0.0261  0.0660  489 HOH B O   
1708 O  O   . HOH N .   ? 0.9726 0.9048 0.8143 -0.0093 0.0551  0.1090  490 HOH B O   
1709 O  O   . HOH N .   ? 0.9040 0.9117 0.8515 -0.0679 -0.0060 0.0005  491 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   509 ?   ?   ?   A . n 
A 1 2   LEU 2   510 ?   ?   ?   A . n 
A 1 3   PRO 3   511 ?   ?   ?   A . n 
A 1 4   ASP 4   512 ?   ?   ?   A . n 
A 1 5   VAL 5   513 ?   ?   ?   A . n 
A 1 6   GLN 6   514 ?   ?   ?   A . n 
A 1 7   GLU 7   515 ?   ?   ?   A . n 
A 1 8   LEU 8   516 ?   ?   ?   A . n 
A 1 9   ILE 9   517 ?   ?   ?   A . n 
A 1 10  THR 10  518 ?   ?   ?   A . n 
A 1 11  GLN 11  519 ?   ?   ?   A . n 
A 1 12  VAL 12  520 ?   ?   ?   A . n 
A 1 13  ARG 13  521 ?   ?   ?   A . n 
A 1 14  SER 14  522 ?   ?   ?   A . n 
A 1 15  GLU 15  523 ?   ?   ?   A . n 
A 1 16  LYS 16  524 ?   ?   ?   A . n 
A 1 17  CYS 17  525 ?   ?   ?   A . n 
A 1 18  SER 18  526 ?   ?   ?   A . n 
A 1 19  LEU 19  527 ?   ?   ?   A . n 
A 1 20  GLN 20  528 ?   ?   ?   A . n 
A 1 21  ALA 21  529 ?   ?   ?   A . n 
A 1 22  ALA 22  530 ?   ?   ?   A . n 
A 1 23  ALA 23  531 ?   ?   ?   A . n 
A 1 24  ILE 24  532 ?   ?   ?   A . n 
A 1 25  LEU 25  533 ?   ?   ?   A . n 
A 1 26  ASP 26  534 ?   ?   ?   A . n 
A 1 27  ALA 27  535 ?   ?   ?   A . n 
A 1 28  ASN 28  536 ?   ?   ?   A . n 
A 1 29  ASP 29  537 ?   ?   ?   A . n 
A 1 30  ALA 30  538 ?   ?   ?   A . n 
A 1 31  HIS 31  539 ?   ?   ?   A . n 
A 1 32  GLN 32  540 ?   ?   ?   A . n 
A 1 33  THR 33  541 ?   ?   ?   A . n 
A 1 34  GLU 34  542 ?   ?   ?   A . n 
A 1 35  THR 35  543 ?   ?   ?   A . n 
A 1 36  SER 36  544 ?   ?   ?   A . n 
A 1 37  SER 37  545 ?   ?   ?   A . n 
A 1 38  SER 38  546 ?   ?   ?   A . n 
A 1 39  GLN 39  547 ?   ?   ?   A . n 
A 1 40  VAL 40  548 ?   ?   ?   A . n 
A 1 41  LYS 41  549 ?   ?   ?   A . n 
A 1 42  ASP 42  550 ?   ?   ?   A . n 
A 1 43  ASN 43  551 ?   ?   ?   A . n 
A 1 44  LYS 44  552 ?   ?   ?   A . n 
A 1 45  PRO 45  553 ?   ?   ?   A . n 
A 1 46  LEU 46  554 ?   ?   ?   A . n 
A 1 47  VAL 47  555 ?   ?   ?   A . n 
A 1 48  GLU 48  556 ?   ?   ?   A . n 
A 1 49  ARG 49  557 ?   ?   ?   A . n 
A 1 50  PHE 50  558 ?   ?   ?   A . n 
A 1 51  GLU 51  559 ?   ?   ?   A . n 
A 1 52  THR 52  560 ?   ?   ?   A . n 
A 1 53  PHE 53  561 ?   ?   ?   A . n 
A 1 54  CYS 54  562 ?   ?   ?   A . n 
A 1 55  LEU 55  563 ?   ?   ?   A . n 
A 1 56  ASP 56  564 ?   ?   ?   A . n 
A 1 57  PRO 57  565 ?   ?   ?   A . n 
A 1 58  SER 58  566 ?   ?   ?   A . n 
A 1 59  LEU 59  567 ?   ?   ?   A . n 
A 1 60  VAL 60  568 ?   ?   ?   A . n 
A 1 61  THR 61  569 ?   ?   ?   A . n 
A 1 62  LYS 62  570 ?   ?   ?   A . n 
A 1 63  GLN 63  571 ?   ?   ?   A . n 
A 1 64  ALA 64  572 ?   ?   ?   A . n 
A 1 65  ASN 65  573 ?   ?   ?   A . n 
A 1 66  LEU 66  574 ?   ?   ?   A . n 
A 1 67  VAL 67  575 ?   ?   ?   A . n 
A 1 68  HIS 68  576 ?   ?   ?   A . n 
A 1 69  PHE 69  577 ?   ?   ?   A . n 
A 1 70  PRO 70  578 ?   ?   ?   A . n 
A 1 71  PRO 71  579 ?   ?   ?   A . n 
A 1 72  GLY 72  580 ?   ?   ?   A . n 
A 1 73  PHE 73  581 ?   ?   ?   A . n 
A 1 74  GLN 74  582 ?   ?   ?   A . n 
A 1 75  PRO 75  583 ?   ?   ?   A . n 
A 1 76  ILE 76  584 ?   ?   ?   A . n 
A 1 77  PRO 77  585 ?   ?   ?   A . n 
A 1 78  CYS 78  586 ?   ?   ?   A . n 
A 1 79  LYS 79  587 ?   ?   ?   A . n 
A 1 80  PRO 80  588 588 PRO PRO A . n 
A 1 81  LEU 81  589 589 LEU LEU A . n 
A 1 82  PHE 82  590 590 PHE PHE A . n 
A 1 83  PHE 83  591 591 PHE PHE A . n 
A 1 84  ASP 84  592 592 ASP ASP A . n 
A 1 85  LEU 85  593 593 LEU LEU A . n 
A 1 86  ALA 86  594 594 ALA ALA A . n 
A 1 87  LEU 87  595 595 LEU LEU A . n 
A 1 88  ASN 88  596 596 ASN ASN A . n 
A 1 89  HIS 89  597 597 HIS HIS A . n 
A 1 90  VAL 90  598 598 VAL VAL A . n 
A 1 91  ALA 91  599 599 ALA ALA A . n 
A 1 92  PHE 92  600 600 PHE PHE A . n 
A 1 93  PRO 93  601 601 PRO PRO A . n 
A 1 94  PRO 94  602 602 PRO PRO A . n 
A 1 95  LEU 95  603 603 LEU LEU A . n 
A 1 96  GLU 96  604 604 GLU GLU A . n 
A 1 97  ASP 97  605 605 ASP ASP A . n 
A 1 98  LYS 98  606 606 LYS LYS A . n 
A 1 99  LEU 99  607 607 LEU LEU A . n 
A 1 100 ALA 100 608 608 ALA ALA A . n 
A 1 101 ALA 101 609 609 ALA ALA A . n 
A 1 102 ALA 102 610 610 ALA ALA A . n 
A 1 103 THR 103 611 ?   ?   ?   A . n 
A 1 104 LYS 104 612 ?   ?   ?   A . n 
A 1 105 SER 105 613 ?   ?   ?   A . n 
A 1 106 GLY 106 614 ?   ?   ?   A . n 
B 2 1   MET 1   1   ?   ?   ?   B . n 
B 2 2   ALA 2   2   ?   ?   ?   B . n 
B 2 3   SER 3   3   ?   ?   ?   B . n 
B 2 4   GLY 4   4   ?   ?   ?   B . n 
B 2 5   GLY 5   5   ?   ?   ?   B . n 
B 2 6   SER 6   6   ?   ?   ?   B . n 
B 2 7   GLY 7   7   ?   ?   ?   B . n 
B 2 8   GLY 8   8   ?   ?   ?   B . n 
B 2 9   VAL 9   9   9   VAL VAL B . n 
B 2 10  SER 10  10  10  SER SER B . n 
B 2 11  VAL 11  11  11  VAL VAL B . n 
B 2 12  PRO 12  12  12  PRO PRO B . n 
B 2 13  ALA 13  13  13  ALA ALA B . n 
B 2 14  LEU 14  14  14  LEU LEU B . n 
B 2 15  TRP 15  15  15  TRP TRP B . n 
B 2 16  SER 16  16  16  SER SER B . n 
B 2 17  GLU 17  17  17  GLU GLU B . n 
B 2 18  VAL 18  18  18  VAL VAL B . n 
B 2 19  ASN 19  19  19  ASN ASN B . n 
B 2 20  ARG 20  20  20  ARG ARG B . n 
B 2 21  TYR 21  21  21  TYR TYR B . n 
B 2 22  GLY 22  22  22  GLY GLY B . n 
B 2 23  GLN 23  23  23  GLN GLN B . n 
B 2 24  ASN 24  24  24  ASN ASN B . n 
B 2 25  GLY 25  25  25  GLY GLY B . n 
B 2 26  ASP 26  26  26  ASP ASP B . n 
B 2 27  PHE 27  27  27  PHE PHE B . n 
B 2 28  THR 28  28  28  THR THR B . n 
B 2 29  ARG 29  29  29  ARG ARG B . n 
B 2 30  ALA 30  30  30  ALA ALA B . n 
B 2 31  LEU 31  31  31  LEU LEU B . n 
B 2 32  LYS 32  32  32  LYS LYS B . n 
B 2 33  THR 33  33  33  THR THR B . n 
B 2 34  VAL 34  34  34  VAL VAL B . n 
B 2 35  ASN 35  35  35  ASN ASN B . n 
B 2 36  LYS 36  36  36  LYS LYS B . n 
B 2 37  ILE 37  37  37  ILE ILE B . n 
B 2 38  LEU 38  38  38  LEU LEU B . n 
B 2 39  GLN 39  39  39  GLN GLN B . n 
B 2 40  ILE 40  40  40  ILE ILE B . n 
B 2 41  ASN 41  41  41  ASN ASN B . n 
B 2 42  LYS 42  42  42  LYS LYS B . n 
B 2 43  ASP 43  43  43  ASP ASP B . n 
B 2 44  ASP 44  44  44  ASP ASP B . n 
B 2 45  VAL 45  45  45  VAL VAL B . n 
B 2 46  THR 46  46  46  THR THR B . n 
B 2 47  ALA 47  47  47  ALA ALA B . n 
B 2 48  LEU 48  48  48  LEU LEU B . n 
B 2 49  HIS 49  49  49  HIS HIS B . n 
B 2 50  CYS 50  50  50  CYS CYS B . n 
B 2 51  LYS 51  51  51  LYS LYS B . n 
B 2 52  VAL 52  52  52  VAL VAL B . n 
B 2 53  VAL 53  53  53  VAL VAL B . n 
B 2 54  CYS 54  54  54  CYS CYS B . n 
B 2 55  LEU 55  55  55  LEU LEU B . n 
B 2 56  ILE 56  56  56  ILE ILE B . n 
B 2 57  GLN 57  57  57  GLN GLN B . n 
B 2 58  ASN 58  58  58  ASN ASN B . n 
B 2 59  GLY 59  59  59  GLY GLY B . n 
B 2 60  SER 60  60  60  SER SER B . n 
B 2 61  PHE 61  61  61  PHE PHE B . n 
B 2 62  LYS 62  62  62  LYS LYS B . n 
B 2 63  GLU 63  63  63  GLU GLU B . n 
B 2 64  ALA 64  64  64  ALA ALA B . n 
B 2 65  LEU 65  65  65  LEU LEU B . n 
B 2 66  ASN 66  66  66  ASN ASN B . n 
B 2 67  VAL 67  67  67  VAL VAL B . n 
B 2 68  ILE 68  68  68  ILE ILE B . n 
B 2 69  ASN 69  69  69  ASN ASN B . n 
B 2 70  THR 70  70  70  THR THR B . n 
B 2 71  HIS 71  71  71  HIS HIS B . n 
B 2 72  THR 72  72  72  THR THR B . n 
B 2 73  LYS 73  73  73  LYS LYS B . n 
B 2 74  VAL 74  74  74  VAL VAL B . n 
B 2 75  LEU 75  75  75  LEU LEU B . n 
B 2 76  ALA 76  76  76  ALA ALA B . n 
B 2 77  ASN 77  77  77  ASN ASN B . n 
B 2 78  ASN 78  78  78  ASN ASN B . n 
B 2 79  SER 79  79  79  SER SER B . n 
B 2 80  LEU 80  80  80  LEU LEU B . n 
B 2 81  SER 81  81  81  SER SER B . n 
B 2 82  PHE 82  82  82  PHE PHE B . n 
B 2 83  GLU 83  83  83  GLU GLU B . n 
B 2 84  LYS 84  84  84  LYS LYS B . n 
B 2 85  ALA 85  85  85  ALA ALA B . n 
B 2 86  TYR 86  86  86  TYR TYR B . n 
B 2 87  CYS 87  87  87  CYS CYS B . n 
B 2 88  GLU 88  88  88  GLU GLU B . n 
B 2 89  TYR 89  89  89  TYR TYR B . n 
B 2 90  ARG 90  90  90  ARG ARG B . n 
B 2 91  LEU 91  91  91  LEU LEU B . n 
B 2 92  ASN 92  92  92  ASN ASN B . n 
B 2 93  ARG 93  93  93  ARG ARG B . n 
B 2 94  ILE 94  94  94  ILE ILE B . n 
B 2 95  GLU 95  95  95  GLU GLU B . n 
B 2 96  ASN 96  96  96  ASN ASN B . n 
B 2 97  ALA 97  97  97  ALA ALA B . n 
B 2 98  LEU 98  98  98  LEU LEU B . n 
B 2 99  LYS 99  99  99  LYS LYS B . n 
B 2 100 THR 100 100 100 THR THR B . n 
B 2 101 ILE 101 101 101 ILE ILE B . n 
B 2 102 GLU 102 102 102 GLU GLU B . n 
B 2 103 SER 103 103 103 SER SER B . n 
B 2 104 ALA 104 104 104 ALA ALA B . n 
B 2 105 ASN 105 105 105 ASN ASN B . n 
B 2 106 GLN 106 106 106 GLN GLN B . n 
B 2 107 GLN 107 107 107 GLN GLN B . n 
B 2 108 THR 108 108 108 THR THR B . n 
B 2 109 ASP 109 109 109 ASP ASP B . n 
B 2 110 LYS 110 110 110 LYS LYS B . n 
B 2 111 LEU 111 111 111 LEU LEU B . n 
B 2 112 LYS 112 112 112 LYS LYS B . n 
B 2 113 GLU 113 113 113 GLU GLU B . n 
B 2 114 LEU 114 114 114 LEU LEU B . n 
B 2 115 TYR 115 115 115 TYR TYR B . n 
B 2 116 GLY 116 116 116 GLY GLY B . n 
B 2 117 GLN 117 117 117 GLN GLN B . n 
B 2 118 VAL 118 118 118 VAL VAL B . n 
B 2 119 LEU 119 119 119 LEU LEU B . n 
B 2 120 TYR 120 120 120 TYR TYR B . n 
B 2 121 ARG 121 121 121 ARG ARG B . n 
B 2 122 LEU 122 122 122 LEU LEU B . n 
B 2 123 GLU 123 123 123 GLU GLU B . n 
B 2 124 ARG 124 124 124 ARG ARG B . n 
B 2 125 TYR 125 125 125 TYR TYR B . n 
B 2 126 ASP 126 126 126 ASP ASP B . n 
B 2 127 GLU 127 127 127 GLU GLU B . n 
B 2 128 CYS 128 128 128 CYS CYS B . n 
B 2 129 LEU 129 129 129 LEU LEU B . n 
B 2 130 ALA 130 130 130 ALA ALA B . n 
B 2 131 VAL 131 131 131 VAL VAL B . n 
B 2 132 TYR 132 132 132 TYR TYR B . n 
B 2 133 ARG 133 133 133 ARG ARG B . n 
B 2 134 ASP 134 134 134 ASP ASP B . n 
B 2 135 LEU 135 135 135 LEU LEU B . n 
B 2 136 VAL 136 136 136 VAL VAL B . n 
B 2 137 ARG 137 137 137 ARG ARG B . n 
B 2 138 ASN 138 138 138 ASN ASN B . n 
B 2 139 SER 139 139 139 SER SER B . n 
B 2 140 GLN 140 140 140 GLN GLN B . n 
B 2 141 ASP 141 141 141 ASP ASP B . n 
B 2 142 ASP 142 142 142 ASP ASP B . n 
B 2 143 TYR 143 143 143 TYR TYR B . n 
B 2 144 ASP 144 144 144 ASP ASP B . n 
B 2 145 GLU 145 145 145 GLU GLU B . n 
B 2 146 GLU 146 146 146 GLU GLU B . n 
B 2 147 ARG 147 147 147 ARG ARG B . n 
B 2 148 LYS 148 148 148 LYS LYS B . n 
B 2 149 THR 149 149 149 THR THR B . n 
B 2 150 ASN 150 150 150 ASN ASN B . n 
B 2 151 LEU 151 151 151 LEU LEU B . n 
B 2 152 SER 152 152 152 SER SER B . n 
B 2 153 ALA 153 153 153 ALA ALA B . n 
B 2 154 VAL 154 154 154 VAL VAL B . n 
B 2 155 VAL 155 155 155 VAL VAL B . n 
B 2 156 ALA 156 156 156 ALA ALA B . n 
B 2 157 ALA 157 157 157 ALA ALA B . n 
B 2 158 GLN 158 158 158 GLN GLN B . n 
B 2 159 SER 159 159 159 SER SER B . n 
B 2 160 ASN 160 160 160 ASN ASN B . n 
B 2 161 TRP 161 161 161 TRP TRP B . n 
B 2 162 GLU 162 162 162 GLU GLU B . n 
B 2 163 LYS 163 163 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ACT 1   701 701 ACT ACT A . 
D 4 GOL 1   702 702 GOL GOL A . 
E 5 SO4 1   201 201 SO4 SO4 B . 
F 5 SO4 1   202 202 SO4 SO4 B . 
G 6 NA  1   203 203 NA  NA  B . 
H 3 ACT 1   204 204 ACT ACT B . 
I 4 GOL 1   205 205 GOL GOL B . 
J 4 GOL 1   206 206 GOL GOL B . 
K 4 GOL 1   207 207 GOL GOL B . 
L 4 GOL 1   208 208 GOL GOL B . 
M 7 HOH 1   801 801 HOH HOH A . 
M 7 HOH 2   802 802 HOH HOH A . 
M 7 HOH 3   803 803 HOH HOH A . 
M 7 HOH 4   804 804 HOH HOH A . 
M 7 HOH 5   805 805 HOH HOH A . 
M 7 HOH 6   806 806 HOH HOH A . 
M 7 HOH 7   807 807 HOH HOH A . 
M 7 HOH 8   808 808 HOH HOH A . 
M 7 HOH 9   809 809 HOH HOH A . 
M 7 HOH 10  810 810 HOH HOH A . 
M 7 HOH 11  811 811 HOH HOH A . 
M 7 HOH 12  812 812 HOH HOH A . 
M 7 HOH 13  813 813 HOH HOH A . 
M 7 HOH 14  814 814 HOH HOH A . 
M 7 HOH 15  815 815 HOH HOH A . 
M 7 HOH 16  816 816 HOH HOH A . 
M 7 HOH 17  817 817 HOH HOH A . 
M 7 HOH 18  818 818 HOH HOH A . 
M 7 HOH 19  819 819 HOH HOH A . 
M 7 HOH 20  820 820 HOH HOH A . 
M 7 HOH 21  821 821 HOH HOH A . 
M 7 HOH 22  822 822 HOH HOH A . 
M 7 HOH 23  823 823 HOH HOH A . 
M 7 HOH 24  824 824 HOH HOH A . 
M 7 HOH 25  825 825 HOH HOH A . 
M 7 HOH 26  826 826 HOH HOH A . 
M 7 HOH 27  827 827 HOH HOH A . 
M 7 HOH 28  828 828 HOH HOH A . 
M 7 HOH 29  829 829 HOH HOH A . 
M 7 HOH 30  830 830 HOH HOH A . 
M 7 HOH 31  831 831 HOH HOH A . 
M 7 HOH 32  832 832 HOH HOH A . 
M 7 HOH 33  833 833 HOH HOH A . 
M 7 HOH 34  834 834 HOH HOH A . 
M 7 HOH 35  835 835 HOH HOH A . 
N 7 HOH 1   301 301 HOH HOH B . 
N 7 HOH 2   302 302 HOH HOH B . 
N 7 HOH 3   303 303 HOH HOH B . 
N 7 HOH 4   304 304 HOH HOH B . 
N 7 HOH 5   305 305 HOH HOH B . 
N 7 HOH 6   306 306 HOH HOH B . 
N 7 HOH 7   307 307 HOH HOH B . 
N 7 HOH 8   308 308 HOH HOH B . 
N 7 HOH 9   309 309 HOH HOH B . 
N 7 HOH 10  310 310 HOH HOH B . 
N 7 HOH 11  311 311 HOH HOH B . 
N 7 HOH 12  312 312 HOH HOH B . 
N 7 HOH 13  313 313 HOH HOH B . 
N 7 HOH 14  314 314 HOH HOH B . 
N 7 HOH 15  315 315 HOH HOH B . 
N 7 HOH 16  316 316 HOH HOH B . 
N 7 HOH 17  317 317 HOH HOH B . 
N 7 HOH 18  318 318 HOH HOH B . 
N 7 HOH 19  319 319 HOH HOH B . 
N 7 HOH 20  320 320 HOH HOH B . 
N 7 HOH 21  321 321 HOH HOH B . 
N 7 HOH 22  322 322 HOH HOH B . 
N 7 HOH 23  323 323 HOH HOH B . 
N 7 HOH 24  324 324 HOH HOH B . 
N 7 HOH 25  325 325 HOH HOH B . 
N 7 HOH 26  326 326 HOH HOH B . 
N 7 HOH 27  327 327 HOH HOH B . 
N 7 HOH 28  328 328 HOH HOH B . 
N 7 HOH 29  329 329 HOH HOH B . 
N 7 HOH 30  330 330 HOH HOH B . 
N 7 HOH 31  331 331 HOH HOH B . 
N 7 HOH 32  332 332 HOH HOH B . 
N 7 HOH 33  333 333 HOH HOH B . 
N 7 HOH 34  334 334 HOH HOH B . 
N 7 HOH 35  335 335 HOH HOH B . 
N 7 HOH 36  336 336 HOH HOH B . 
N 7 HOH 37  337 337 HOH HOH B . 
N 7 HOH 38  338 338 HOH HOH B . 
N 7 HOH 39  339 339 HOH HOH B . 
N 7 HOH 40  340 340 HOH HOH B . 
N 7 HOH 41  341 341 HOH HOH B . 
N 7 HOH 42  342 342 HOH HOH B . 
N 7 HOH 43  343 343 HOH HOH B . 
N 7 HOH 44  344 344 HOH HOH B . 
N 7 HOH 45  345 345 HOH HOH B . 
N 7 HOH 46  346 346 HOH HOH B . 
N 7 HOH 47  347 347 HOH HOH B . 
N 7 HOH 48  348 348 HOH HOH B . 
N 7 HOH 49  349 349 HOH HOH B . 
N 7 HOH 50  350 350 HOH HOH B . 
N 7 HOH 51  351 351 HOH HOH B . 
N 7 HOH 52  352 352 HOH HOH B . 
N 7 HOH 53  353 353 HOH HOH B . 
N 7 HOH 54  354 354 HOH HOH B . 
N 7 HOH 55  355 355 HOH HOH B . 
N 7 HOH 56  356 356 HOH HOH B . 
N 7 HOH 57  357 357 HOH HOH B . 
N 7 HOH 58  358 358 HOH HOH B . 
N 7 HOH 59  359 359 HOH HOH B . 
N 7 HOH 60  360 360 HOH HOH B . 
N 7 HOH 61  361 361 HOH HOH B . 
N 7 HOH 62  362 362 HOH HOH B . 
N 7 HOH 63  363 363 HOH HOH B . 
N 7 HOH 64  364 364 HOH HOH B . 
N 7 HOH 65  365 365 HOH HOH B . 
N 7 HOH 66  366 366 HOH HOH B . 
N 7 HOH 67  367 367 HOH HOH B . 
N 7 HOH 68  368 368 HOH HOH B . 
N 7 HOH 69  369 369 HOH HOH B . 
N 7 HOH 70  370 370 HOH HOH B . 
N 7 HOH 71  371 371 HOH HOH B . 
N 7 HOH 72  372 372 HOH HOH B . 
N 7 HOH 73  373 373 HOH HOH B . 
N 7 HOH 74  374 374 HOH HOH B . 
N 7 HOH 75  375 375 HOH HOH B . 
N 7 HOH 76  376 376 HOH HOH B . 
N 7 HOH 77  377 377 HOH HOH B . 
N 7 HOH 78  378 378 HOH HOH B . 
N 7 HOH 79  379 379 HOH HOH B . 
N 7 HOH 80  380 380 HOH HOH B . 
N 7 HOH 81  381 381 HOH HOH B . 
N 7 HOH 82  382 382 HOH HOH B . 
N 7 HOH 83  383 383 HOH HOH B . 
N 7 HOH 84  384 384 HOH HOH B . 
N 7 HOH 85  385 385 HOH HOH B . 
N 7 HOH 86  386 386 HOH HOH B . 
N 7 HOH 87  387 387 HOH HOH B . 
N 7 HOH 88  388 388 HOH HOH B . 
N 7 HOH 89  389 389 HOH HOH B . 
N 7 HOH 90  390 390 HOH HOH B . 
N 7 HOH 91  391 391 HOH HOH B . 
N 7 HOH 92  392 392 HOH HOH B . 
N 7 HOH 93  393 393 HOH HOH B . 
N 7 HOH 94  394 394 HOH HOH B . 
N 7 HOH 95  395 395 HOH HOH B . 
N 7 HOH 96  396 396 HOH HOH B . 
N 7 HOH 97  397 397 HOH HOH B . 
N 7 HOH 98  398 398 HOH HOH B . 
N 7 HOH 99  399 399 HOH HOH B . 
N 7 HOH 100 400 400 HOH HOH B . 
N 7 HOH 101 401 401 HOH HOH B . 
N 7 HOH 102 402 402 HOH HOH B . 
N 7 HOH 103 403 403 HOH HOH B . 
N 7 HOH 104 404 404 HOH HOH B . 
N 7 HOH 105 405 405 HOH HOH B . 
N 7 HOH 106 406 406 HOH HOH B . 
N 7 HOH 107 407 407 HOH HOH B . 
N 7 HOH 108 408 408 HOH HOH B . 
N 7 HOH 109 409 409 HOH HOH B . 
N 7 HOH 110 410 410 HOH HOH B . 
N 7 HOH 111 411 411 HOH HOH B . 
N 7 HOH 112 412 412 HOH HOH B . 
N 7 HOH 113 413 413 HOH HOH B . 
N 7 HOH 114 414 414 HOH HOH B . 
N 7 HOH 115 415 415 HOH HOH B . 
N 7 HOH 116 416 416 HOH HOH B . 
N 7 HOH 117 417 417 HOH HOH B . 
N 7 HOH 118 418 418 HOH HOH B . 
N 7 HOH 119 419 419 HOH HOH B . 
N 7 HOH 120 420 420 HOH HOH B . 
N 7 HOH 121 421 421 HOH HOH B . 
N 7 HOH 122 422 422 HOH HOH B . 
N 7 HOH 123 423 423 HOH HOH B . 
N 7 HOH 124 424 424 HOH HOH B . 
N 7 HOH 125 425 425 HOH HOH B . 
N 7 HOH 126 426 426 HOH HOH B . 
N 7 HOH 127 427 427 HOH HOH B . 
N 7 HOH 128 428 428 HOH HOH B . 
N 7 HOH 129 429 429 HOH HOH B . 
N 7 HOH 130 430 430 HOH HOH B . 
N 7 HOH 131 431 431 HOH HOH B . 
N 7 HOH 132 432 432 HOH HOH B . 
N 7 HOH 133 433 433 HOH HOH B . 
N 7 HOH 134 434 434 HOH HOH B . 
N 7 HOH 135 435 435 HOH HOH B . 
N 7 HOH 136 436 436 HOH HOH B . 
N 7 HOH 137 437 437 HOH HOH B . 
N 7 HOH 138 438 438 HOH HOH B . 
N 7 HOH 139 439 439 HOH HOH B . 
N 7 HOH 140 440 440 HOH HOH B . 
N 7 HOH 141 441 441 HOH HOH B . 
N 7 HOH 142 442 442 HOH HOH B . 
N 7 HOH 143 443 443 HOH HOH B . 
N 7 HOH 144 444 444 HOH HOH B . 
N 7 HOH 145 445 445 HOH HOH B . 
N 7 HOH 146 446 446 HOH HOH B . 
N 7 HOH 147 447 447 HOH HOH B . 
N 7 HOH 148 448 448 HOH HOH B . 
N 7 HOH 149 449 449 HOH HOH B . 
N 7 HOH 150 450 450 HOH HOH B . 
N 7 HOH 151 451 451 HOH HOH B . 
N 7 HOH 152 452 452 HOH HOH B . 
N 7 HOH 153 453 453 HOH HOH B . 
N 7 HOH 154 454 454 HOH HOH B . 
N 7 HOH 155 455 455 HOH HOH B . 
N 7 HOH 156 456 456 HOH HOH B . 
N 7 HOH 157 457 457 HOH HOH B . 
N 7 HOH 158 458 458 HOH HOH B . 
N 7 HOH 159 459 459 HOH HOH B . 
N 7 HOH 160 460 460 HOH HOH B . 
N 7 HOH 161 461 461 HOH HOH B . 
N 7 HOH 162 462 462 HOH HOH B . 
N 7 HOH 163 463 463 HOH HOH B . 
N 7 HOH 164 464 464 HOH HOH B . 
N 7 HOH 165 465 465 HOH HOH B . 
N 7 HOH 166 466 466 HOH HOH B . 
N 7 HOH 167 467 467 HOH HOH B . 
N 7 HOH 168 468 468 HOH HOH B . 
N 7 HOH 169 469 469 HOH HOH B . 
N 7 HOH 170 470 470 HOH HOH B . 
N 7 HOH 171 471 471 HOH HOH B . 
N 7 HOH 172 472 472 HOH HOH B . 
N 7 HOH 173 473 473 HOH HOH B . 
N 7 HOH 174 474 474 HOH HOH B . 
N 7 HOH 175 475 475 HOH HOH B . 
N 7 HOH 176 476 476 HOH HOH B . 
N 7 HOH 177 477 477 HOH HOH B . 
N 7 HOH 178 478 478 HOH HOH B . 
N 7 HOH 179 479 479 HOH HOH B . 
N 7 HOH 180 480 480 HOH HOH B . 
N 7 HOH 181 481 481 HOH HOH B . 
N 7 HOH 182 482 482 HOH HOH B . 
N 7 HOH 183 483 483 HOH HOH B . 
N 7 HOH 184 484 484 HOH HOH B . 
N 7 HOH 185 485 485 HOH HOH B . 
N 7 HOH 186 486 486 HOH HOH B . 
N 7 HOH 187 487 487 HOH HOH B . 
N 7 HOH 188 488 488 HOH HOH B . 
N 7 HOH 189 489 489 HOH HOH B . 
N 7 HOH 190 490 490 HOH HOH B . 
N 7 HOH 191 491 491 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4420 ? 
1 MORE         -68  ? 
1 'SSA (A^2)'  9440 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 829 ? M HOH . 
2 1 B HOH 381 ? N HOH . 
3 1 B HOH 389 ? N HOH . 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   OE2 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   B 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   GLU 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    113 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    B 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    GLU 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     113 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   NA 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   G 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   NA 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    B 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    NA 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     203 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   OH 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   B 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   TYR 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    132 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    B 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    TYR 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     132 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 120.5 
_pdbx_struct_conn_angle.value_esd             ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-06-21 
2 'Structure model' 1 1 2017-07-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 2 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation 
2 2 'Structure model' software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume' 
2 2 'Structure model' '_citation.page_first'     
3 2 'Structure model' '_citation.page_last'      
4 2 'Structure model' '_software.name'           
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC   ? ? ? 5.6.0117 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? SHELX    ? ? ? .        4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER B 79 ? A -59.74 -8.35 
2 1 SER B 79 ? B 86.35  26.30 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 833 ? 6.86 . 
2 1 O ? A HOH 834 ? 7.26 . 
3 1 O ? A HOH 835 ? 7.54 . 
4 1 O ? B HOH 488 ? 6.30 . 
5 1 O ? B HOH 489 ? 6.35 . 
6 1 O ? B HOH 490 ? 6.77 . 
7 1 O ? B HOH 491 ? 7.24 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B VAL 9   ? CG1 ? B VAL 9   CG1 
2  1 Y 1 B VAL 9   ? CG2 ? B VAL 9   CG2 
3  1 Y 1 B GLN 39  ? CD  ? B GLN 39  CD  
4  1 Y 1 B GLN 39  ? OE1 ? B GLN 39  OE1 
5  1 Y 1 B GLN 39  ? NE2 ? B GLN 39  NE2 
6  1 Y 1 B LYS 42  ? NZ  ? B LYS 42  NZ  
7  1 Y 1 B LYS 62  ? NZ  ? B LYS 62  NZ  
8  1 Y 1 B LYS 73  ? CG  ? B LYS 73  CG  
9  1 Y 1 B LYS 73  ? CD  ? B LYS 73  CD  
10 1 Y 1 B LYS 73  ? CE  ? B LYS 73  CE  
11 1 Y 1 B LYS 73  ? NZ  ? B LYS 73  NZ  
12 1 Y 1 B ASN 77  ? OD1 ? B ASN 77  OD1 
13 1 Y 1 B ASN 77  ? ND2 ? B ASN 77  ND2 
14 1 Y 1 B ASN 92  ? OD1 ? B ASN 92  OD1 
15 1 Y 1 B ASN 92  ? ND2 ? B ASN 92  ND2 
16 1 Y 1 B ASN 105 ? CG  ? B ASN 105 CG  
17 1 Y 1 B ASN 105 ? OD1 ? B ASN 105 OD1 
18 1 Y 1 B ASN 105 ? ND2 ? B ASN 105 ND2 
19 1 Y 1 B GLN 106 ? OE1 ? B GLN 106 OE1 
20 1 Y 1 B GLN 106 ? NE2 ? B GLN 106 NE2 
21 1 Y 1 B GLN 140 ? CG  ? B GLN 140 CG  
22 1 Y 1 B GLN 140 ? CD  ? B GLN 140 CD  
23 1 Y 1 B GLN 140 ? OE1 ? B GLN 140 OE1 
24 1 Y 1 B GLN 140 ? NE2 ? B GLN 140 NE2 
25 1 Y 1 B ASP 142 ? CG  ? B ASP 142 CG  
26 1 Y 1 B ASP 142 ? OD1 ? B ASP 142 OD1 
27 1 Y 1 B ASP 142 ? OD2 ? B ASP 142 OD2 
28 1 Y 1 B ASN 160 ? ND2 ? B ASN 160 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 509 ? A ASP 1   
2  1 Y 1 A LEU 510 ? A LEU 2   
3  1 Y 1 A PRO 511 ? A PRO 3   
4  1 Y 1 A ASP 512 ? A ASP 4   
5  1 Y 1 A VAL 513 ? A VAL 5   
6  1 Y 1 A GLN 514 ? A GLN 6   
7  1 Y 1 A GLU 515 ? A GLU 7   
8  1 Y 1 A LEU 516 ? A LEU 8   
9  1 Y 1 A ILE 517 ? A ILE 9   
10 1 Y 1 A THR 518 ? A THR 10  
11 1 Y 1 A GLN 519 ? A GLN 11  
12 1 Y 1 A VAL 520 ? A VAL 12  
13 1 Y 1 A ARG 521 ? A ARG 13  
14 1 Y 1 A SER 522 ? A SER 14  
15 1 Y 1 A GLU 523 ? A GLU 15  
16 1 Y 1 A LYS 524 ? A LYS 16  
17 1 Y 1 A CYS 525 ? A CYS 17  
18 1 Y 1 A SER 526 ? A SER 18  
19 1 Y 1 A LEU 527 ? A LEU 19  
20 1 Y 1 A GLN 528 ? A GLN 20  
21 1 Y 1 A ALA 529 ? A ALA 21  
22 1 Y 1 A ALA 530 ? A ALA 22  
23 1 Y 1 A ALA 531 ? A ALA 23  
24 1 Y 1 A ILE 532 ? A ILE 24  
25 1 Y 1 A LEU 533 ? A LEU 25  
26 1 Y 1 A ASP 534 ? A ASP 26  
27 1 Y 1 A ALA 535 ? A ALA 27  
28 1 Y 1 A ASN 536 ? A ASN 28  
29 1 Y 1 A ASP 537 ? A ASP 29  
30 1 Y 1 A ALA 538 ? A ALA 30  
31 1 Y 1 A HIS 539 ? A HIS 31  
32 1 Y 1 A GLN 540 ? A GLN 32  
33 1 Y 1 A THR 541 ? A THR 33  
34 1 Y 1 A GLU 542 ? A GLU 34  
35 1 Y 1 A THR 543 ? A THR 35  
36 1 Y 1 A SER 544 ? A SER 36  
37 1 Y 1 A SER 545 ? A SER 37  
38 1 Y 1 A SER 546 ? A SER 38  
39 1 Y 1 A GLN 547 ? A GLN 39  
40 1 Y 1 A VAL 548 ? A VAL 40  
41 1 Y 1 A LYS 549 ? A LYS 41  
42 1 Y 1 A ASP 550 ? A ASP 42  
43 1 Y 1 A ASN 551 ? A ASN 43  
44 1 Y 1 A LYS 552 ? A LYS 44  
45 1 Y 1 A PRO 553 ? A PRO 45  
46 1 Y 1 A LEU 554 ? A LEU 46  
47 1 Y 1 A VAL 555 ? A VAL 47  
48 1 Y 1 A GLU 556 ? A GLU 48  
49 1 Y 1 A ARG 557 ? A ARG 49  
50 1 Y 1 A PHE 558 ? A PHE 50  
51 1 Y 1 A GLU 559 ? A GLU 51  
52 1 Y 1 A THR 560 ? A THR 52  
53 1 Y 1 A PHE 561 ? A PHE 53  
54 1 Y 1 A CYS 562 ? A CYS 54  
55 1 Y 1 A LEU 563 ? A LEU 55  
56 1 Y 1 A ASP 564 ? A ASP 56  
57 1 Y 1 A PRO 565 ? A PRO 57  
58 1 Y 1 A SER 566 ? A SER 58  
59 1 Y 1 A LEU 567 ? A LEU 59  
60 1 Y 1 A VAL 568 ? A VAL 60  
61 1 Y 1 A THR 569 ? A THR 61  
62 1 Y 1 A LYS 570 ? A LYS 62  
63 1 Y 1 A GLN 571 ? A GLN 63  
64 1 Y 1 A ALA 572 ? A ALA 64  
65 1 Y 1 A ASN 573 ? A ASN 65  
66 1 Y 1 A LEU 574 ? A LEU 66  
67 1 Y 1 A VAL 575 ? A VAL 67  
68 1 Y 1 A HIS 576 ? A HIS 68  
69 1 Y 1 A PHE 577 ? A PHE 69  
70 1 Y 1 A PRO 578 ? A PRO 70  
71 1 Y 1 A PRO 579 ? A PRO 71  
72 1 Y 1 A GLY 580 ? A GLY 72  
73 1 Y 1 A PHE 581 ? A PHE 73  
74 1 Y 1 A GLN 582 ? A GLN 74  
75 1 Y 1 A PRO 583 ? A PRO 75  
76 1 Y 1 A ILE 584 ? A ILE 76  
77 1 Y 1 A PRO 585 ? A PRO 77  
78 1 Y 1 A CYS 586 ? A CYS 78  
79 1 Y 1 A LYS 587 ? A LYS 79  
80 1 Y 1 A THR 611 ? A THR 103 
81 1 Y 1 A LYS 612 ? A LYS 104 
82 1 Y 1 A SER 613 ? A SER 105 
83 1 Y 1 A GLY 614 ? A GLY 106 
84 1 Y 1 B MET 1   ? B MET 1   
85 1 Y 1 B ALA 2   ? B ALA 2   
86 1 Y 1 B SER 3   ? B SER 3   
87 1 Y 1 B GLY 4   ? B GLY 4   
88 1 Y 1 B GLY 5   ? B GLY 5   
89 1 Y 1 B SER 6   ? B SER 6   
90 1 Y 1 B GLY 7   ? B GLY 7   
91 1 Y 1 B GLY 8   ? B GLY 8   
92 1 Y 1 B LYS 163 ? B LYS 163 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ACETATE ION' ACT 
4 GLYCEROL      GOL 
5 'SULFATE ION' SO4 
6 'SODIUM ION'  NA  
7 water         HOH 
#