data_5WWZ
# 
_entry.id   5WWZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5WWZ         
WWPDB D_1300002535 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5WWW unspecified 
PDB . 5WWZ unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5WWZ 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-05 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Yang, L.' 1 ? 
'Wang, C.' 2 ? 
'Li, F.'   3 ? 
'Gong, Q.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Biol. Chem.' 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            292 
_citation.language                  ? 
_citation.page_first                16221 
_citation.page_last                 16234 
_citation.title                     
'The human RNA-binding protein and E3 ligase MEX-3C binds the MEX-3-recognition element (MRE) motif with high affinity' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.M117.797746 
_citation.pdbx_database_id_PubMed   28808060 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yang, L.'  1 
primary 'Wang, C.'  2 
primary 'Li, F.'    3 
primary 'Zhang, J.' 4 
primary 'Nayab, A.' 5 
primary 'Wu, J.'    6 
primary 'Shi, Y.'   7 
primary 'Gong, Q.'  8 
# 
_cell.length_a           83.321 
_cell.length_b           83.321 
_cell.length_c           78.959 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           5WWZ 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 42 21 2' 
_symmetry.entry_id                         5WWZ 
_symmetry.Int_Tables_number                94 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'RNA-binding E3 ubiquitin-protein ligase MEX3C' 9772.222 3  2.3.2.27 ? 'KH2 domain, UNP residues 320-396' ? 
2 non-polymer syn 'SULFATE ION'                                   96.063   4  ?        ? ?                                  ? 
3 water       nat water                                           18.015   40 ?        ? ?                                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'RING finger and KH domain-containing protein 2,RING finger protein 194,RING-type E3 ubiquitin transferase MEX3C' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGHHHHHHMSPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEMH
IAMRTG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGHHHHHHMSPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEMH
IAMRTG
;
_entity_poly.pdbx_strand_id                 B,A,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  GLY n 
1 3  HIS n 
1 4  HIS n 
1 5  HIS n 
1 6  HIS n 
1 7  HIS n 
1 8  HIS n 
1 9  MET n 
1 10 SER n 
1 11 PRO n 
1 12 ASN n 
1 13 LEU n 
1 14 PRO n 
1 15 GLY n 
1 16 GLN n 
1 17 THR n 
1 18 THR n 
1 19 VAL n 
1 20 GLN n 
1 21 VAL n 
1 22 ARG n 
1 23 VAL n 
1 24 PRO n 
1 25 TYR n 
1 26 ARG n 
1 27 VAL n 
1 28 VAL n 
1 29 GLY n 
1 30 LEU n 
1 31 VAL n 
1 32 VAL n 
1 33 GLY n 
1 34 PRO n 
1 35 LYS n 
1 36 GLY n 
1 37 ALA n 
1 38 THR n 
1 39 ILE n 
1 40 LYS n 
1 41 ARG n 
1 42 ILE n 
1 43 GLN n 
1 44 GLN n 
1 45 GLN n 
1 46 THR n 
1 47 HIS n 
1 48 THR n 
1 49 TYR n 
1 50 ILE n 
1 51 VAL n 
1 52 THR n 
1 53 PRO n 
1 54 SER n 
1 55 ARG n 
1 56 ASP n 
1 57 LYS n 
1 58 GLU n 
1 59 PRO n 
1 60 VAL n 
1 61 PHE n 
1 62 GLU n 
1 63 VAL n 
1 64 THR n 
1 65 GLY n 
1 66 MET n 
1 67 PRO n 
1 68 GLU n 
1 69 ASN n 
1 70 VAL n 
1 71 ASP n 
1 72 ARG n 
1 73 ALA n 
1 74 ARG n 
1 75 GLU n 
1 76 GLU n 
1 77 ILE n 
1 78 GLU n 
1 79 MET n 
1 80 HIS n 
1 81 ILE n 
1 82 ALA n 
1 83 MET n 
1 84 ARG n 
1 85 THR n 
1 86 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   86 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'MEX3C, RKHD2, RNF194, BM-013' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MEX3C_HUMAN 
_struct_ref.pdbx_db_accession          Q5U5Q3 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   SPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEMHIAMRTG 
_struct_ref.pdbx_align_begin           320 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5WWZ B 10 ? 86 ? Q5U5Q3 320 ? 396 ? 320 396 
2 1 5WWZ A 10 ? 86 ? Q5U5Q3 320 ? 396 ? 320 396 
3 1 5WWZ C 10 ? 86 ? Q5U5Q3 320 ? 396 ? 320 396 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5WWZ MET B 1 ? UNP Q5U5Q3 ? ? 'expression tag' 311 1  
1 5WWZ GLY B 2 ? UNP Q5U5Q3 ? ? 'expression tag' 312 2  
1 5WWZ HIS B 3 ? UNP Q5U5Q3 ? ? 'expression tag' 313 3  
1 5WWZ HIS B 4 ? UNP Q5U5Q3 ? ? 'expression tag' 314 4  
1 5WWZ HIS B 5 ? UNP Q5U5Q3 ? ? 'expression tag' 315 5  
1 5WWZ HIS B 6 ? UNP Q5U5Q3 ? ? 'expression tag' 316 6  
1 5WWZ HIS B 7 ? UNP Q5U5Q3 ? ? 'expression tag' 317 7  
1 5WWZ HIS B 8 ? UNP Q5U5Q3 ? ? 'expression tag' 318 8  
1 5WWZ MET B 9 ? UNP Q5U5Q3 ? ? 'expression tag' 319 9  
2 5WWZ MET A 1 ? UNP Q5U5Q3 ? ? 'expression tag' 311 10 
2 5WWZ GLY A 2 ? UNP Q5U5Q3 ? ? 'expression tag' 312 11 
2 5WWZ HIS A 3 ? UNP Q5U5Q3 ? ? 'expression tag' 313 12 
2 5WWZ HIS A 4 ? UNP Q5U5Q3 ? ? 'expression tag' 314 13 
2 5WWZ HIS A 5 ? UNP Q5U5Q3 ? ? 'expression tag' 315 14 
2 5WWZ HIS A 6 ? UNP Q5U5Q3 ? ? 'expression tag' 316 15 
2 5WWZ HIS A 7 ? UNP Q5U5Q3 ? ? 'expression tag' 317 16 
2 5WWZ HIS A 8 ? UNP Q5U5Q3 ? ? 'expression tag' 318 17 
2 5WWZ MET A 9 ? UNP Q5U5Q3 ? ? 'expression tag' 319 18 
3 5WWZ MET C 1 ? UNP Q5U5Q3 ? ? 'expression tag' 311 19 
3 5WWZ GLY C 2 ? UNP Q5U5Q3 ? ? 'expression tag' 312 20 
3 5WWZ HIS C 3 ? UNP Q5U5Q3 ? ? 'expression tag' 313 21 
3 5WWZ HIS C 4 ? UNP Q5U5Q3 ? ? 'expression tag' 314 22 
3 5WWZ HIS C 5 ? UNP Q5U5Q3 ? ? 'expression tag' 315 23 
3 5WWZ HIS C 6 ? UNP Q5U5Q3 ? ? 'expression tag' 316 24 
3 5WWZ HIS C 7 ? UNP Q5U5Q3 ? ? 'expression tag' 317 25 
3 5WWZ HIS C 8 ? UNP Q5U5Q3 ? ? 'expression tag' 318 26 
3 5WWZ MET C 9 ? UNP Q5U5Q3 ? ? 'expression tag' 319 27 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5WWZ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.50 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50.83 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '1.6M Ammonium sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-12-12 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL18U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL18U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.entry_id                     5WWZ 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            2.500 
_reflns.number_obs                   10139 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.000 
_reflns.pdbx_Rmerge_I_obs            0.082 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.400 
_reflns.B_iso_Wilson_estimate        48.410 
_reflns.pdbx_redundancy              6.900 
_reflns.pdbx_Rrim_I_all              0.089 
_reflns.pdbx_Rpim_I_all              0.033 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_netI_over_av_sigmaI     ? 
_reflns.pdbx_number_measured_all     70047 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_chi_squared             0.483 
_reflns.Rmerge_F_all                 ? 
_reflns.Rmerge_F_obs                 ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.observed_criterion_I_max     ? 
_reflns.observed_criterion_I_min     ? 
_reflns.pdbx_d_res_high_opt          ? 
_reflns.pdbx_d_res_low_opt           ? 
_reflns.details                      ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1  2.500 2.590  ? ? ? ? 0.563 ? ? 0.439 6.900 ? ? ? 980  ? ? ? ? 100.000 0.609 0.230 0.888 
1 2  2.590 2.690  ? ? ? ? 0.467 ? ? 0.470 7.300 ? ? ? 985  ? ? ? ? 99.900  0.503 0.184 0.919 
1 3  2.690 2.820  ? ? ? ? 0.331 ? ? 0.448 7.200 ? ? ? 989  ? ? ? ? 100.000 0.357 0.131 0.965 
1 4  2.820 2.960  ? ? ? ? 0.242 ? ? 0.461 7.200 ? ? ? 995  ? ? ? ? 100.000 0.261 0.096 0.978 
1 5  2.960 3.150  ? ? ? ? 0.174 ? ? 0.469 6.900 ? ? ? 986  ? ? ? ? 100.000 0.189 0.071 0.988 
1 6  3.150 3.390  ? ? ? ? 0.106 ? ? 0.491 6.600 ? ? ? 1010 ? ? ? ? 100.000 0.115 0.044 0.993 
1 7  3.390 3.730  ? ? ? ? 0.083 ? ? 0.550 7.300 ? ? ? 1010 ? ? ? ? 100.000 0.089 0.032 0.996 
1 8  3.730 4.270  ? ? ? ? 0.058 ? ? 0.569 7.100 ? ? ? 1010 ? ? ? ? 99.800  0.063 0.023 0.998 
1 9  4.270 5.380  ? ? ? ? 0.048 ? ? 0.537 6.500 ? ? ? 1047 ? ? ? ? 100.000 0.053 0.020 0.998 
1 10 5.380 40.000 ? ? ? ? 0.039 ? ? 0.389 6.400 ? ? ? 1127 ? ? ? ? 99.900  0.042 0.016 0.999 
# 
_refine.entry_id                                 5WWZ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            2.50 
_refine.ls_d_res_low                             37.2620 
_refine.pdbx_ls_sigma_F                          1.380 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.9600 
_refine.ls_number_reflns_obs                     10107 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2284 
_refine.ls_R_factor_R_work                       0.2263 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2698 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.6300 
_refine.ls_number_reflns_R_free                  468 
_refine.ls_number_reflns_R_work                  9639 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               56.6324 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.3500 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      5WWW 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                136.360 
_refine.B_iso_min                                28.590 
_refine.pdbx_overall_phase_error                 27.3100 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        37.2620 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             40 
_refine_hist.number_atoms_total               1855 
_refine_hist.pdbx_number_residues_total       237 
_refine_hist.pdbx_B_iso_mean_ligand           64.07 
_refine_hist.pdbx_B_iso_mean_solvent          46.64 
_refine_hist.pdbx_number_atoms_protein        1795 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           1859 0.002  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          2552 0.430  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     293  0.042  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      338  0.003  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 1101 13.704 ? ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 1036 7.218 ? ? ? ? ? 
2 'X-RAY DIFFRACTION' 1 2 TORSIONAL B 1036 7.218 ? ? ? ? ? 
3 'X-RAY DIFFRACTION' 1 3 TORSIONAL C 1036 7.218 ? ? ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_obs 
2.4987 2.8601  3 100.0000 3139 . 0.2486 0.3416 . 147 0.0000 3286 . 'X-RAY DIFFRACTION' . 
2.8601 3.6030  3 100.0000 3195 . 0.2446 0.3294 . 128 0.0000 3323 . 'X-RAY DIFFRACTION' . 
3.6030 37.2664 3 100.0000 3305 . 0.2123 0.2366 . 193 0.0000 3498 . 'X-RAY DIFFRACTION' . 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 
;(chain A and (resid 4 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 43 or (resid 44 through 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 81))
;
1 2 
;(chain B and (resid 4 through 43 or (resid 44 through 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 and (name N or name CA or name C or name O or name CB ))))
;
1 3 
;(chain C and (resid 4 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 71 or (resid 72 through 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 81))
;
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 ? A 4  A 29 
;(chain A and (resid 4 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 43 or (resid 44 through 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 81))
;
? ? ? ? ? ? ? ? 
1 1 2 ? A 30 A 30 
;(chain A and (resid 4 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 43 or (resid 44 through 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 81))
;
? ? ? ? ? ? ? ? 
1 1 3 ? A 4  A 81 
;(chain A and (resid 4 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 43 or (resid 44 through 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 81))
;
? ? ? ? ? ? ? ? 
1 1 4 ? A 4  A 81 
;(chain A and (resid 4 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 43 or (resid 44 through 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 81))
;
? ? ? ? ? ? ? ? 
1 1 5 ? A 4  A 81 
;(chain A and (resid 4 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 43 or (resid 44 through 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 81))
;
? ? ? ? ? ? ? ? 
1 1 6 ? A 4  A 81 
;(chain A and (resid 4 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 43 or (resid 44 through 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 81))
;
? ? ? ? ? ? ? ? 
1 2 1 ? B 4  B 43 
;(chain B and (resid 4 through 43 or (resid 44 through 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 and (name N or name CA or name C or name O or name CB ))))
;
? ? ? ? ? ? ? ? 
1 2 2 ? B 44 B 45 
;(chain B and (resid 4 through 43 or (resid 44 through 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 and (name N or name CA or name C or name O or name CB ))))
;
? ? ? ? ? ? ? ? 
1 2 3 ? B 4  B 83 
;(chain B and (resid 4 through 43 or (resid 44 through 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 and (name N or name CA or name C or name O or name CB ))))
;
? ? ? ? ? ? ? ? 
1 2 4 ? B 4  B 83 
;(chain B and (resid 4 through 43 or (resid 44 through 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 and (name N or name CA or name C or name O or name CB ))))
;
? ? ? ? ? ? ? ? 
1 2 5 ? B 4  B 83 
;(chain B and (resid 4 through 43 or (resid 44 through 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 and (name N or name CA or name C or name O or name CB ))))
;
? ? ? ? ? ? ? ? 
1 2 6 ? B 4  B 83 
;(chain B and (resid 4 through 43 or (resid 44 through 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 and (name N or name CA or name C or name O or name CB ))))
;
? ? ? ? ? ? ? ? 
1 3 1 ? C 4  C 44 
;(chain C and (resid 4 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 71 or (resid 72 through 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 81))
;
? ? ? ? ? ? ? ? 
1 3 2 ? C 45 C 45 
;(chain C and (resid 4 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 71 or (resid 72 through 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 81))
;
? ? ? ? ? ? ? ? 
1 3 3 ? C 4  C 82 
;(chain C and (resid 4 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 71 or (resid 72 through 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 81))
;
? ? ? ? ? ? ? ? 
1 3 4 ? C 4  C 82 
;(chain C and (resid 4 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 71 or (resid 72 through 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 81))
;
? ? ? ? ? ? ? ? 
1 3 5 ? C 4  C 82 
;(chain C and (resid 4 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 71 or (resid 72 through 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 81))
;
? ? ? ? ? ? ? ? 
1 3 6 ? C 4  C 82 
;(chain C and (resid 4 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 71 or (resid 72 through 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 81))
;
? ? ? ? ? ? ? ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     5WWZ 
_struct.title                        'Crystal structure of the KH2 domain of human RNA-binding E3 ubiquitin-protein ligase MEX-3C' 
_struct.pdbx_descriptor              'RNA-binding E3 ubiquitin-protein ligase MEX3C (E.C.6.3.2.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5WWZ 
_struct_keywords.text            'KH2, MEX-3C, RNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 24 ? ARG A 26 ? PRO B 334 ARG B 336 5 ? 3  
HELX_P HELX_P2  AA2 VAL A 27 ? GLY A 33 ? VAL B 337 GLY B 343 1 ? 7  
HELX_P HELX_P3  AA3 GLY A 36 ? HIS A 47 ? GLY B 346 HIS B 357 1 ? 12 
HELX_P HELX_P4  AA4 MET A 66 ? HIS A 80 ? MET B 376 HIS B 390 1 ? 15 
HELX_P HELX_P5  AA5 PRO B 24 ? ARG B 26 ? PRO A 334 ARG A 336 5 ? 3  
HELX_P HELX_P6  AA6 VAL B 27 ? GLY B 33 ? VAL A 337 GLY A 343 1 ? 7  
HELX_P HELX_P7  AA7 GLY B 36 ? HIS B 47 ? GLY A 346 HIS A 357 1 ? 12 
HELX_P HELX_P8  AA8 MET B 66 ? ILE B 81 ? MET A 376 ILE A 391 1 ? 16 
HELX_P HELX_P9  AA9 PRO C 24 ? ARG C 26 ? PRO C 334 ARG C 336 5 ? 3  
HELX_P HELX_P10 AB1 VAL C 27 ? GLY C 33 ? VAL C 337 GLY C 343 1 ? 7  
HELX_P HELX_P11 AB2 GLY C 36 ? HIS C 47 ? GLY C 346 HIS C 357 1 ? 12 
HELX_P HELX_P12 AB3 MET C 66 ? HIS C 80 ? MET C 376 HIS C 390 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 3 ? 
AA4 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 17 ? ARG A 22 ? THR B 327 ARG B 332 
AA1 2 VAL A 60 ? GLY A 65 ? VAL B 370 GLY B 375 
AA1 3 TYR A 49 ? VAL A 51 ? TYR B 359 VAL B 361 
AA2 1 HIS B 7  ? PRO B 11 ? HIS A 317 PRO A 321 
AA2 2 HIS C 7  ? PRO C 11 ? HIS C 317 PRO C 321 
AA3 1 THR B 17 ? ARG B 22 ? THR A 327 ARG A 332 
AA3 2 VAL B 60 ? GLY B 65 ? VAL A 370 GLY A 375 
AA3 3 TYR B 49 ? VAL B 51 ? TYR A 359 VAL A 361 
AA4 1 THR C 17 ? ARG C 22 ? THR C 327 ARG C 332 
AA4 2 VAL C 60 ? GLY C 65 ? VAL C 370 GLY C 375 
AA4 3 TYR C 49 ? VAL C 51 ? TYR C 359 VAL C 361 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N THR A 17 ? N THR B 327 O GLY A 65 ? O GLY B 375 
AA1 2 3 O THR A 64 ? O THR B 374 N TYR A 49 ? N TYR B 359 
AA2 1 2 N SER B 10 ? N SER A 320 O HIS C 8  ? O HIS C 318 
AA3 1 2 N VAL B 21 ? N VAL A 331 O PHE B 61 ? O PHE A 371 
AA3 2 3 O THR B 64 ? O THR A 374 N TYR B 49 ? N TYR A 359 
AA4 1 2 N VAL C 21 ? N VAL C 331 O PHE C 61 ? O PHE C 371 
AA4 2 3 O THR C 64 ? O THR C 374 N TYR C 49 ? N TYR C 359 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B SO4 401 ? 9 'binding site for residue SO4 B 401' 
AC2 Software C SO4 401 ? 6 'binding site for residue SO4 C 401' 
AC3 Software C SO4 402 ? 5 'binding site for residue SO4 C 402' 
AC4 Software C SO4 403 ? 7 'binding site for residue SO4 C 403' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9 PRO B 24 ? PRO A 334 . ? 4_544 ? 
2  AC1 9 TYR B 25 ? TYR A 335 . ? 4_544 ? 
3  AC1 9 HOH I .  ? HOH A 402 . ? 4_544 ? 
4  AC1 9 TYR A 25 ? TYR B 335 . ? 1_555 ? 
5  AC1 9 HOH H .  ? HOH B 503 . ? 1_555 ? 
6  AC1 9 HOH H .  ? HOH B 508 . ? 1_555 ? 
7  AC1 9 HOH H .  ? HOH B 509 . ? 1_555 ? 
8  AC1 9 TYR C 25 ? TYR C 335 . ? 6_544 ? 
9  AC1 9 HOH J .  ? HOH C 506 . ? 6_544 ? 
10 AC2 6 HIS B 8  ? HIS A 318 . ? 1_555 ? 
11 AC2 6 SER B 10 ? SER A 320 . ? 1_555 ? 
12 AC2 6 GLN A 45 ? GLN B 355 . ? 1_555 ? 
13 AC2 6 ARG A 72 ? ARG B 382 . ? 1_555 ? 
14 AC2 6 HIS C 8  ? HIS C 318 . ? 1_555 ? 
15 AC2 6 SER C 10 ? SER C 320 . ? 1_555 ? 
16 AC3 5 ARG B 26 ? ARG A 336 . ? 7_555 ? 
17 AC3 5 HOH H .  ? HOH B 508 . ? 6_444 ? 
18 AC3 5 HOH H .  ? HOH B 509 . ? 6_444 ? 
19 AC3 5 ARG C 26 ? ARG C 336 . ? 1_555 ? 
20 AC3 5 HOH J .  ? HOH C 506 . ? 1_555 ? 
21 AC4 7 ARG B 22 ? ARG A 332 . ? 7_555 ? 
22 AC4 7 GLU B 58 ? GLU A 368 . ? 7_555 ? 
23 AC4 7 ARG A 22 ? ARG B 332 . ? 6_444 ? 
24 AC4 7 GLU A 58 ? GLU B 368 . ? 6_444 ? 
25 AC4 7 ARG C 22 ? ARG C 332 . ? 1_555 ? 
26 AC4 7 GLU C 58 ? GLU C 368 . ? 1_555 ? 
27 AC4 7 HOH J .  ? HOH C 504 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5WWZ 
_atom_sites.fract_transf_matrix[1][1]   0.012002 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012002 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012665 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . HIS A 1 4  ? 12.519  -16.287 -45.765 1.00 71.39  ? 314 HIS B N   1 
ATOM   2    C CA  . HIS A 1 4  ? 11.435  -16.500 -46.715 1.00 75.07  ? 314 HIS B CA  1 
ATOM   3    C C   . HIS A 1 4  ? 11.303  -15.282 -47.625 1.00 76.65  ? 314 HIS B C   1 
ATOM   4    O O   . HIS A 1 4  ? 11.417  -14.145 -47.170 1.00 91.43  ? 314 HIS B O   1 
ATOM   5    C CB  . HIS A 1 4  ? 10.120  -16.778 -45.977 1.00 75.30  ? 314 HIS B CB  1 
ATOM   6    C CG  . HIS A 1 4  ? 9.048   -17.372 -46.840 1.00 64.22  ? 314 HIS B CG  1 
ATOM   7    N ND1 . HIS A 1 4  ? 8.644   -16.807 -48.030 1.00 61.50  ? 314 HIS B ND1 1 
ATOM   8    C CD2 . HIS A 1 4  ? 8.301   -18.490 -46.683 1.00 59.14  ? 314 HIS B CD2 1 
ATOM   9    C CE1 . HIS A 1 4  ? 7.691   -17.548 -48.567 1.00 54.20  ? 314 HIS B CE1 1 
ATOM   10   N NE2 . HIS A 1 4  ? 7.465   -18.576 -47.770 1.00 62.87  ? 314 HIS B NE2 1 
ATOM   11   N N   . HIS A 1 5  ? 11.058  -15.529 -48.914 1.00 58.71  ? 315 HIS B N   1 
ATOM   12   C CA  . HIS A 1 5  ? 10.978  -14.460 -49.902 1.00 57.61  ? 315 HIS B CA  1 
ATOM   13   C C   . HIS A 1 5  ? 9.734   -13.595 -49.749 1.00 65.68  ? 315 HIS B C   1 
ATOM   14   O O   . HIS A 1 5  ? 9.668   -12.526 -50.363 1.00 65.55  ? 315 HIS B O   1 
ATOM   15   C CB  . HIS A 1 5  ? 11.020  -15.052 -51.312 1.00 65.31  ? 315 HIS B CB  1 
ATOM   16   C CG  . HIS A 1 5  ? 12.389  -15.467 -51.754 1.00 84.66  ? 315 HIS B CG  1 
ATOM   17   N ND1 . HIS A 1 5  ? 13.312  -14.575 -52.256 1.00 91.69  ? 315 HIS B ND1 1 
ATOM   18   C CD2 . HIS A 1 5  ? 12.993  -16.679 -51.764 1.00 90.66  ? 315 HIS B CD2 1 
ATOM   19   C CE1 . HIS A 1 5  ? 14.425  -15.220 -52.559 1.00 96.33  ? 315 HIS B CE1 1 
ATOM   20   N NE2 . HIS A 1 5  ? 14.258  -16.498 -52.269 1.00 93.27  ? 315 HIS B NE2 1 
ATOM   21   N N   . HIS A 1 6  ? 8.753   -14.022 -48.953 1.00 72.34  ? 316 HIS B N   1 
ATOM   22   C CA  . HIS A 1 6  ? 7.493   -13.303 -48.799 1.00 68.57  ? 316 HIS B CA  1 
ATOM   23   C C   . HIS A 1 6  ? 7.275   -12.823 -47.369 1.00 66.51  ? 316 HIS B C   1 
ATOM   24   O O   . HIS A 1 6  ? 6.137   -12.547 -46.977 1.00 75.69  ? 316 HIS B O   1 
ATOM   25   C CB  . HIS A 1 6  ? 6.320   -14.169 -49.262 1.00 66.07  ? 316 HIS B CB  1 
ATOM   26   C CG  . HIS A 1 6  ? 6.395   -14.564 -50.704 1.00 71.98  ? 316 HIS B CG  1 
ATOM   27   N ND1 . HIS A 1 6  ? 7.022   -15.714 -51.131 1.00 69.79  ? 316 HIS B ND1 1 
ATOM   28   C CD2 . HIS A 1 6  ? 5.928   -13.954 -51.819 1.00 73.68  ? 316 HIS B CD2 1 
ATOM   29   C CE1 . HIS A 1 6  ? 6.934   -15.799 -52.447 1.00 72.47  ? 316 HIS B CE1 1 
ATOM   30   N NE2 . HIS A 1 6  ? 6.275   -14.743 -52.889 1.00 75.90  ? 316 HIS B NE2 1 
ATOM   31   N N   . HIS A 1 7  ? 8.344   -12.716 -46.582 1.00 59.69  ? 317 HIS B N   1 
ATOM   32   C CA  . HIS A 1 7  ? 8.260   -12.231 -45.213 1.00 59.93  ? 317 HIS B CA  1 
ATOM   33   C C   . HIS A 1 7  ? 9.422   -11.284 -44.955 1.00 58.28  ? 317 HIS B C   1 
ATOM   34   O O   . HIS A 1 7  ? 10.403  -11.254 -45.702 1.00 64.53  ? 317 HIS B O   1 
ATOM   35   C CB  . HIS A 1 7  ? 8.273   -13.384 -44.201 1.00 53.32  ? 317 HIS B CB  1 
ATOM   36   C CG  . HIS A 1 7  ? 7.072   -14.274 -44.283 1.00 60.62  ? 317 HIS B CG  1 
ATOM   37   N ND1 . HIS A 1 7  ? 6.892   -15.188 -45.300 1.00 63.74  ? 317 HIS B ND1 1 
ATOM   38   C CD2 . HIS A 1 7  ? 5.990   -14.390 -43.478 1.00 60.39  ? 317 HIS B CD2 1 
ATOM   39   C CE1 . HIS A 1 7  ? 5.752   -15.828 -45.116 1.00 63.71  ? 317 HIS B CE1 1 
ATOM   40   N NE2 . HIS A 1 7  ? 5.185   -15.363 -44.018 1.00 62.44  ? 317 HIS B NE2 1 
ATOM   41   N N   . HIS A 1 8  ? 9.305   -10.503 -43.882 1.00 45.09  ? 318 HIS B N   1 
ATOM   42   C CA  . HIS A 1 8  ? 10.326  -9.520  -43.551 1.00 37.70  ? 318 HIS B CA  1 
ATOM   43   C C   . HIS A 1 8  ? 10.413  -9.359  -42.041 1.00 35.90  ? 318 HIS B C   1 
ATOM   44   O O   . HIS A 1 8  ? 9.463   -9.647  -41.306 1.00 43.68  ? 318 HIS B O   1 
ATOM   45   C CB  . HIS A 1 8  ? 10.034  -8.168  -44.214 1.00 43.58  ? 318 HIS B CB  1 
ATOM   46   C CG  . HIS A 1 8  ? 8.748   -7.543  -43.770 1.00 47.54  ? 318 HIS B CG  1 
ATOM   47   N ND1 . HIS A 1 8  ? 7.539   -7.819  -44.372 1.00 47.58  ? 318 HIS B ND1 1 
ATOM   48   C CD2 . HIS A 1 8  ? 8.482   -6.654  -42.784 1.00 46.22  ? 318 HIS B CD2 1 
ATOM   49   C CE1 . HIS A 1 8  ? 6.584   -7.129  -43.776 1.00 44.79  ? 318 HIS B CE1 1 
ATOM   50   N NE2 . HIS A 1 8  ? 7.130   -6.413  -42.809 1.00 46.75  ? 318 HIS B NE2 1 
ATOM   51   N N   . MET A 1 9  ? 11.574  -8.890  -41.588 1.00 40.24  ? 319 MET B N   1 
ATOM   52   C CA  . MET A 1 9  ? 11.827  -8.656  -40.173 1.00 46.68  ? 319 MET B CA  1 
ATOM   53   C C   . MET A 1 9  ? 11.425  -7.235  -39.800 1.00 50.61  ? 319 MET B C   1 
ATOM   54   O O   . MET A 1 9  ? 11.849  -6.273  -40.447 1.00 42.45  ? 319 MET B O   1 
ATOM   55   C CB  . MET A 1 9  ? 13.302  -8.890  -39.847 1.00 54.74  ? 319 MET B CB  1 
ATOM   56   C CG  . MET A 1 9  ? 13.708  -10.352 -39.808 1.00 74.43  ? 319 MET B CG  1 
ATOM   57   S SD  . MET A 1 9  ? 13.083  -11.208 -38.350 1.00 92.41  ? 319 MET B SD  1 
ATOM   58   C CE  . MET A 1 9  ? 14.352  -10.800 -37.155 1.00 99.10  ? 319 MET B CE  1 
ATOM   59   N N   . SER A 1 10 ? 10.612  -7.109  -38.753 1.00 52.97  ? 320 SER B N   1 
ATOM   60   C CA  . SER A 1 10 ? 10.164  -5.820  -38.260 1.00 48.50  ? 320 SER B CA  1 
ATOM   61   C C   . SER A 1 10 ? 10.507  -5.667  -36.784 1.00 52.60  ? 320 SER B C   1 
ATOM   62   O O   . SER A 1 10 ? 10.411  -6.636  -36.023 1.00 61.60  ? 320 SER B O   1 
ATOM   63   C CB  . SER A 1 10 ? 8.649   -5.647  -38.453 1.00 43.83  ? 320 SER B CB  1 
ATOM   64   O OG  . SER A 1 10 ? 8.312   -5.618  -39.829 1.00 61.80  ? 320 SER B OG  1 
ATOM   65   N N   . PRO A 1 11 ? 10.916  -4.476  -36.352 1.00 49.40  ? 321 PRO B N   1 
ATOM   66   C CA  . PRO A 1 11 ? 11.191  -4.273  -34.925 1.00 45.73  ? 321 PRO B CA  1 
ATOM   67   C C   . PRO A 1 11 ? 9.911   -4.343  -34.108 1.00 46.42  ? 321 PRO B C   1 
ATOM   68   O O   . PRO A 1 11 ? 8.845   -3.906  -34.546 1.00 36.00  ? 321 PRO B O   1 
ATOM   69   C CB  . PRO A 1 11 ? 11.814  -2.873  -34.878 1.00 52.08  ? 321 PRO B CB  1 
ATOM   70   C CG  . PRO A 1 11 ? 11.286  -2.188  -36.095 1.00 49.45  ? 321 PRO B CG  1 
ATOM   71   C CD  . PRO A 1 11 ? 11.159  -3.257  -37.144 1.00 41.32  ? 321 PRO B CD  1 
ATOM   72   N N   . ASN A 1 12 ? 10.030  -4.902  -32.908 1.00 43.97  ? 322 ASN B N   1 
ATOM   73   C CA  . ASN A 1 12 ? 8.886   -5.036  -32.022 1.00 35.14  ? 322 ASN B CA  1 
ATOM   74   C C   . ASN A 1 12 ? 8.450   -3.678  -31.482 1.00 51.18  ? 322 ASN B C   1 
ATOM   75   O O   . ASN A 1 12 ? 9.205   -2.702  -31.484 1.00 48.63  ? 322 ASN B O   1 
ATOM   76   C CB  . ASN A 1 12 ? 9.210   -5.970  -30.856 1.00 49.60  ? 322 ASN B CB  1 
ATOM   77   C CG  . ASN A 1 12 ? 9.447   -7.399  -31.299 1.00 50.11  ? 322 ASN B CG  1 
ATOM   78   O OD1 . ASN A 1 12 ? 9.121   -7.776  -32.424 1.00 44.88  ? 322 ASN B OD1 1 
ATOM   79   N ND2 . ASN A 1 12 ? 10.011  -8.207  -30.408 1.00 42.29  ? 322 ASN B ND2 1 
ATOM   80   N N   . LEU A 1 13 ? 7.202   -3.628  -31.021 1.00 50.69  ? 323 LEU B N   1 
ATOM   81   C CA  . LEU A 1 13 ? 6.709   -2.446  -30.339 1.00 39.09  ? 323 LEU B CA  1 
ATOM   82   C C   . LEU A 1 13 ? 7.487   -2.253  -29.038 1.00 52.11  ? 323 LEU B C   1 
ATOM   83   O O   . LEU A 1 13 ? 8.037   -3.214  -28.489 1.00 50.65  ? 323 LEU B O   1 
ATOM   84   C CB  . LEU A 1 13 ? 5.214   -2.578  -30.052 1.00 49.88  ? 323 LEU B CB  1 
ATOM   85   C CG  . LEU A 1 13 ? 4.301   -2.738  -31.269 1.00 49.48  ? 323 LEU B CG  1 
ATOM   86   C CD1 . LEU A 1 13 ? 2.855   -2.924  -30.836 1.00 49.01  ? 323 LEU B CD1 1 
ATOM   87   C CD2 . LEU A 1 13 ? 4.435   -1.540  -32.196 1.00 48.16  ? 323 LEU B CD2 1 
ATOM   88   N N   . PRO A 1 14 ? 7.568   -1.022  -28.533 1.00 55.54  ? 324 PRO B N   1 
ATOM   89   C CA  . PRO A 1 14 ? 8.340   -0.780  -27.306 1.00 57.74  ? 324 PRO B CA  1 
ATOM   90   C C   . PRO A 1 14 ? 7.837   -1.619  -26.141 1.00 51.87  ? 324 PRO B C   1 
ATOM   91   O O   . PRO A 1 14 ? 6.644   -1.635  -25.830 1.00 56.46  ? 324 PRO B O   1 
ATOM   92   C CB  . PRO A 1 14 ? 8.133   0.718   -27.052 1.00 61.24  ? 324 PRO B CB  1 
ATOM   93   C CG  . PRO A 1 14 ? 7.839   1.288   -28.398 1.00 63.62  ? 324 PRO B CG  1 
ATOM   94   C CD  . PRO A 1 14 ? 7.059   0.230   -29.122 1.00 55.62  ? 324 PRO B CD  1 
ATOM   95   N N   . GLY A 1 15 ? 8.767   -2.326  -25.496 1.00 44.10  ? 325 GLY B N   1 
ATOM   96   C CA  . GLY A 1 15 ? 8.448   -3.182  -24.376 1.00 62.73  ? 325 GLY B CA  1 
ATOM   97   C C   . GLY A 1 15 ? 8.125   -4.620  -24.720 1.00 64.31  ? 325 GLY B C   1 
ATOM   98   O O   . GLY A 1 15 ? 8.001   -5.444  -23.805 1.00 68.30  ? 325 GLY B O   1 
ATOM   99   N N   . GLN A 1 16 ? 7.994   -4.955  -26.000 1.00 55.41  ? 326 GLN B N   1 
ATOM   100  C CA  . GLN A 1 16 ? 7.641   -6.304  -26.421 1.00 45.92  ? 326 GLN B CA  1 
ATOM   101  C C   . GLN A 1 16 ? 8.879   -7.095  -26.821 1.00 45.89  ? 326 GLN B C   1 
ATOM   102  O O   . GLN A 1 16 ? 9.818   -6.551  -27.409 1.00 47.87  ? 326 GLN B O   1 
ATOM   103  C CB  . GLN A 1 16 ? 6.648   -6.269  -27.585 1.00 41.91  ? 326 GLN B CB  1 
ATOM   104  C CG  . GLN A 1 16 ? 5.294   -5.681  -27.222 1.00 45.37  ? 326 GLN B CG  1 
ATOM   105  C CD  . GLN A 1 16 ? 4.294   -5.779  -28.356 1.00 57.42  ? 326 GLN B CD  1 
ATOM   106  O OE1 . GLN A 1 16 ? 4.595   -6.319  -29.421 1.00 52.36  ? 326 GLN B OE1 1 
ATOM   107  N NE2 . GLN A 1 16 ? 3.094   -5.255  -28.134 1.00 59.50  ? 326 GLN B NE2 1 
ATOM   108  N N   . THR A 1 17 ? 8.869   -8.385  -26.495 1.00 46.66  ? 327 THR B N   1 
ATOM   109  C CA  . THR A 1 17 ? 9.953   -9.300  -26.812 1.00 50.86  ? 327 THR B CA  1 
ATOM   110  C C   . THR A 1 17 ? 9.424   -10.455 -27.652 1.00 45.84  ? 327 THR B C   1 
ATOM   111  O O   . THR A 1 17 ? 8.216   -10.697 -27.725 1.00 34.30  ? 327 THR B O   1 
ATOM   112  C CB  . THR A 1 17 ? 10.619  -9.847  -25.541 1.00 61.85  ? 327 THR B CB  1 
ATOM   113  O OG1 . THR A 1 17 ? 9.652   -10.567 -24.766 1.00 61.29  ? 327 THR B OG1 1 
ATOM   114  C CG2 . THR A 1 17 ? 11.192  -8.713  -24.705 1.00 76.14  ? 327 THR B CG2 1 
ATOM   115  N N   . THR A 1 18 ? 10.348  -11.170 -28.290 1.00 39.27  ? 328 THR B N   1 
ATOM   116  C CA  . THR A 1 18 ? 10.026  -12.328 -29.115 1.00 34.26  ? 328 THR B CA  1 
ATOM   117  C C   . THR A 1 18 ? 10.818  -13.526 -28.613 1.00 41.75  ? 328 THR B C   1 
ATOM   118  O O   . THR A 1 18 ? 12.050  -13.470 -28.533 1.00 44.27  ? 328 THR B O   1 
ATOM   119  C CB  . THR A 1 18 ? 10.336  -12.061 -30.590 1.00 35.36  ? 328 THR B CB  1 
ATOM   120  O OG1 . THR A 1 18 ? 9.598   -10.918 -31.039 1.00 41.52  ? 328 THR B OG1 1 
ATOM   121  C CG2 . THR A 1 18 ? 9.961   -13.266 -31.441 1.00 29.52  ? 328 THR B CG2 1 
ATOM   122  N N   . VAL A 1 19 ? 10.112  -14.605 -28.272 1.00 38.10  ? 329 VAL B N   1 
ATOM   123  C CA  . VAL A 1 19 ? 10.736  -15.826 -27.780 1.00 32.16  ? 329 VAL B CA  1 
ATOM   124  C C   . VAL A 1 19 ? 10.339  -16.983 -28.688 1.00 36.26  ? 329 VAL B C   1 
ATOM   125  O O   . VAL A 1 19 ? 9.388   -16.899 -29.470 1.00 37.85  ? 329 VAL B O   1 
ATOM   126  C CB  . VAL A 1 19 ? 10.358  -16.140 -26.317 1.00 39.21  ? 329 VAL B CB  1 
ATOM   127  C CG1 . VAL A 1 19 ? 10.471  -14.893 -25.448 1.00 35.26  ? 329 VAL B CG1 1 
ATOM   128  C CG2 . VAL A 1 19 ? 8.970   -16.753 -26.245 1.00 33.10  ? 329 VAL B CG2 1 
ATOM   129  N N   . GLN A 1 20 ? 11.086  -18.076 -28.571 1.00 31.28  ? 330 GLN B N   1 
ATOM   130  C CA  . GLN A 1 20 ? 10.845  -19.287 -29.343 1.00 33.89  ? 330 GLN B CA  1 
ATOM   131  C C   . GLN A 1 20 ? 10.188  -20.334 -28.456 1.00 39.56  ? 330 GLN B C   1 
ATOM   132  O O   . GLN A 1 20 ? 10.644  -20.580 -27.335 1.00 33.69  ? 330 GLN B O   1 
ATOM   133  C CB  . GLN A 1 20 ? 12.151  -19.828 -29.926 1.00 42.07  ? 330 GLN B CB  1 
ATOM   134  C CG  . GLN A 1 20 ? 12.791  -18.917 -30.960 1.00 62.81  ? 330 GLN B CG  1 
ATOM   135  C CD  . GLN A 1 20 ? 14.104  -19.464 -31.484 1.00 81.60  ? 330 GLN B CD  1 
ATOM   136  O OE1 . GLN A 1 20 ? 14.178  -20.607 -31.936 1.00 78.86  ? 330 GLN B OE1 1 
ATOM   137  N NE2 . GLN A 1 20 ? 15.149  -18.646 -31.429 1.00 96.34  ? 330 GLN B NE2 1 
ATOM   138  N N   . VAL A 1 21 ? 9.113   -20.938 -28.955 1.00 41.66  ? 331 VAL B N   1 
ATOM   139  C CA  . VAL A 1 21 ? 8.369   -21.971 -28.243 1.00 39.50  ? 331 VAL B CA  1 
ATOM   140  C C   . VAL A 1 21 ? 8.410   -23.234 -29.092 1.00 38.91  ? 331 VAL B C   1 
ATOM   141  O O   . VAL A 1 21 ? 7.712   -23.329 -30.109 1.00 56.30  ? 331 VAL B O   1 
ATOM   142  C CB  . VAL A 1 21 ? 6.923   -21.547 -27.949 1.00 35.92  ? 331 VAL B CB  1 
ATOM   143  C CG1 . VAL A 1 21 ? 6.215   -22.613 -27.129 1.00 32.50  ? 331 VAL B CG1 1 
ATOM   144  C CG2 . VAL A 1 21 ? 6.900   -20.212 -27.223 1.00 31.72  ? 331 VAL B CG2 1 
ATOM   145  N N   . ARG A 1 22 ? 9.222   -24.204 -28.678 1.00 32.71  ? 332 ARG B N   1 
ATOM   146  C CA  . ARG A 1 22 ? 9.377   -25.450 -29.414 1.00 36.53  ? 332 ARG B CA  1 
ATOM   147  C C   . ARG A 1 22 ? 8.353   -26.475 -28.948 1.00 39.20  ? 332 ARG B C   1 
ATOM   148  O O   . ARG A 1 22 ? 8.109   -26.629 -27.748 1.00 51.69  ? 332 ARG B O   1 
ATOM   149  C CB  . ARG A 1 22 ? 10.784  -26.021 -29.226 1.00 46.88  ? 332 ARG B CB  1 
ATOM   150  C CG  . ARG A 1 22 ? 11.002  -27.369 -29.909 1.00 47.28  ? 332 ARG B CG  1 
ATOM   151  C CD  . ARG A 1 22 ? 12.477  -27.678 -30.102 1.00 46.42  ? 332 ARG B CD  1 
ATOM   152  N NE  . ARG A 1 22 ? 13.106  -26.893 -31.158 1.00 61.01  ? 332 ARG B NE  1 
ATOM   153  C CZ  . ARG A 1 22 ? 13.492  -27.394 -32.327 1.00 54.49  ? 332 ARG B CZ  1 
ATOM   154  N NH1 . ARG A 1 22 ? 13.319  -28.683 -32.586 1.00 34.04  ? 332 ARG B NH1 1 
ATOM   155  N NH2 . ARG A 1 22 ? 14.060  -26.610 -33.233 1.00 53.18  ? 332 ARG B NH2 1 
ATOM   156  N N   . VAL A 1 23 ? 7.751   -27.167 -29.909 1.00 43.33  ? 333 VAL B N   1 
ATOM   157  C CA  . VAL A 1 23 ? 6.817   -28.254 -29.622 1.00 54.78  ? 333 VAL B CA  1 
ATOM   158  C C   . VAL A 1 23 ? 7.264   -29.483 -30.403 1.00 48.11  ? 333 VAL B C   1 
ATOM   159  O O   . VAL A 1 23 ? 8.041   -29.376 -31.364 1.00 42.00  ? 333 VAL B O   1 
ATOM   160  C CB  . VAL A 1 23 ? 5.363   -27.869 -29.983 1.00 44.51  ? 333 VAL B CB  1 
ATOM   161  C CG1 . VAL A 1 23 ? 4.919   -26.662 -29.184 1.00 41.47  ? 333 VAL B CG1 1 
ATOM   162  C CG2 . VAL A 1 23 ? 5.237   -27.607 -31.477 1.00 37.87  ? 333 VAL B CG2 1 
ATOM   163  N N   . PRO A 1 24 ? 6.810   -30.670 -29.999 1.00 46.19  ? 334 PRO B N   1 
ATOM   164  C CA  . PRO A 1 24 ? 7.025   -31.853 -30.839 1.00 40.54  ? 334 PRO B CA  1 
ATOM   165  C C   . PRO A 1 24 ? 6.405   -31.649 -32.213 1.00 45.73  ? 334 PRO B C   1 
ATOM   166  O O   . PRO A 1 24 ? 5.383   -30.975 -32.364 1.00 45.74  ? 334 PRO B O   1 
ATOM   167  C CB  . PRO A 1 24 ? 6.325   -32.973 -30.063 1.00 38.73  ? 334 PRO B CB  1 
ATOM   168  C CG  . PRO A 1 24 ? 6.377   -32.521 -28.645 1.00 49.51  ? 334 PRO B CG  1 
ATOM   169  C CD  . PRO A 1 24 ? 6.229   -31.024 -28.692 1.00 51.56  ? 334 PRO B CD  1 
ATOM   170  N N   . TYR A 1 25 ? 7.047   -32.232 -33.228 1.00 41.58  ? 335 TYR B N   1 
ATOM   171  C CA  . TYR A 1 25 ? 6.616   -31.995 -34.602 1.00 41.97  ? 335 TYR B CA  1 
ATOM   172  C C   . TYR A 1 25 ? 5.197   -32.493 -34.847 1.00 39.87  ? 335 TYR B C   1 
ATOM   173  O O   . TYR A 1 25 ? 4.484   -31.941 -35.693 1.00 52.17  ? 335 TYR B O   1 
ATOM   174  C CB  . TYR A 1 25 ? 7.588   -32.663 -35.576 1.00 39.31  ? 335 TYR B CB  1 
ATOM   175  C CG  . TYR A 1 25 ? 7.263   -32.415 -37.031 1.00 35.27  ? 335 TYR B CG  1 
ATOM   176  C CD1 . TYR A 1 25 ? 7.483   -31.171 -37.608 1.00 34.05  ? 335 TYR B CD1 1 
ATOM   177  C CD2 . TYR A 1 25 ? 6.735   -33.423 -37.828 1.00 36.83  ? 335 TYR B CD2 1 
ATOM   178  C CE1 . TYR A 1 25 ? 7.187   -30.937 -38.938 1.00 34.44  ? 335 TYR B CE1 1 
ATOM   179  C CE2 . TYR A 1 25 ? 6.437   -33.200 -39.158 1.00 44.49  ? 335 TYR B CE2 1 
ATOM   180  C CZ  . TYR A 1 25 ? 6.664   -31.955 -39.708 1.00 44.61  ? 335 TYR B CZ  1 
ATOM   181  O OH  . TYR A 1 25 ? 6.369   -31.727 -41.032 1.00 45.11  ? 335 TYR B OH  1 
ATOM   182  N N   . ARG A 1 26 ? 4.766   -33.525 -34.118 1.00 37.65  ? 336 ARG B N   1 
ATOM   183  C CA  . ARG A 1 26 ? 3.432   -34.079 -34.323 1.00 50.01  ? 336 ARG B CA  1 
ATOM   184  C C   . ARG A 1 26 ? 2.318   -33.161 -33.832 1.00 60.65  ? 336 ARG B C   1 
ATOM   185  O O   . ARG A 1 26 ? 1.176   -33.305 -34.281 1.00 72.26  ? 336 ARG B O   1 
ATOM   186  C CB  . ARG A 1 26 ? 3.315   -35.447 -33.649 1.00 54.64  ? 336 ARG B CB  1 
ATOM   187  C CG  . ARG A 1 26 ? 2.135   -36.265 -34.155 1.00 77.84  ? 336 ARG B CG  1 
ATOM   188  C CD  . ARG A 1 26 ? 1.971   -37.568 -33.398 1.00 87.63  ? 336 ARG B CD  1 
ATOM   189  N NE  . ARG A 1 26 ? 3.146   -38.419 -33.541 1.00 95.01  ? 336 ARG B NE  1 
ATOM   190  C CZ  . ARG A 1 26 ? 3.272   -39.348 -34.484 1.00 105.48 ? 336 ARG B CZ  1 
ATOM   191  N NH1 . ARG A 1 26 ? 2.295   -39.540 -35.361 1.00 111.62 ? 336 ARG B NH1 1 
ATOM   192  N NH2 . ARG A 1 26 ? 4.372   -40.084 -34.553 1.00 104.52 ? 336 ARG B NH2 1 
ATOM   193  N N   . VAL A 1 27 ? 2.611   -32.211 -32.940 1.00 53.49  ? 337 VAL B N   1 
ATOM   194  C CA  . VAL A 1 27 ? 1.555   -31.427 -32.311 1.00 50.30  ? 337 VAL B CA  1 
ATOM   195  C C   . VAL A 1 27 ? 1.440   -30.024 -32.885 1.00 49.11  ? 337 VAL B C   1 
ATOM   196  O O   . VAL A 1 27 ? 0.650   -29.220 -32.369 1.00 47.85  ? 337 VAL B O   1 
ATOM   197  C CB  . VAL A 1 27 ? 1.746   -31.359 -30.782 1.00 54.08  ? 337 VAL B CB  1 
ATOM   198  C CG1 . VAL A 1 27 ? 1.897   -32.760 -30.200 1.00 53.00  ? 337 VAL B CG1 1 
ATOM   199  C CG2 . VAL A 1 27 ? 2.937   -30.486 -30.424 1.00 53.57  ? 337 VAL B CG2 1 
ATOM   200  N N   . VAL A 1 28 ? 2.211   -29.697 -33.926 1.00 45.24  ? 338 VAL B N   1 
ATOM   201  C CA  . VAL A 1 28 ? 2.075   -28.389 -34.560 1.00 38.21  ? 338 VAL B CA  1 
ATOM   202  C C   . VAL A 1 28 ? 0.659   -28.205 -35.093 1.00 47.91  ? 338 VAL B C   1 
ATOM   203  O O   . VAL A 1 28 ? 0.081   -27.115 -35.003 1.00 56.61  ? 338 VAL B O   1 
ATOM   204  C CB  . VAL A 1 28 ? 3.125   -28.219 -35.672 1.00 39.62  ? 338 VAL B CB  1 
ATOM   205  C CG1 . VAL A 1 28 ? 3.024   -26.833 -36.292 1.00 33.02  ? 338 VAL B CG1 1 
ATOM   206  C CG2 . VAL A 1 28 ? 4.519   -28.458 -35.125 1.00 43.37  ? 338 VAL B CG2 1 
ATOM   207  N N   . GLY A 1 29 ? 0.074   -29.272 -35.642 1.00 48.15  ? 339 GLY B N   1 
ATOM   208  C CA  . GLY A 1 29 ? -1.291  -29.188 -36.133 1.00 39.26  ? 339 GLY B CA  1 
ATOM   209  C C   . GLY A 1 29 ? -2.307  -28.993 -35.027 1.00 50.11  ? 339 GLY B C   1 
ATOM   210  O O   . GLY A 1 29 ? -3.340  -28.348 -35.235 1.00 56.75  ? 339 GLY B O   1 
ATOM   211  N N   . LEU A 1 30 ? -2.034  -29.543 -33.842 1.00 51.77  ? 340 LEU B N   1 
ATOM   212  C CA  . LEU A 1 30 ? -2.949  -29.370 -32.720 1.00 53.74  ? 340 LEU B CA  1 
ATOM   213  C C   . LEU A 1 30 ? -2.926  -27.934 -32.214 1.00 54.72  ? 340 LEU B C   1 
ATOM   214  O O   . LEU A 1 30 ? -3.963  -27.391 -31.816 1.00 66.27  ? 340 LEU B O   1 
ATOM   215  C CB  . LEU A 1 30 ? -2.596  -30.345 -31.597 1.00 58.08  ? 340 LEU B CB  1 
ATOM   216  N N   . VAL A 1 31 ? -1.749  -27.304 -32.219 1.00 46.13  ? 341 VAL B N   1 
ATOM   217  C CA  . VAL A 1 31 ? -1.644  -25.917 -31.781 1.00 38.85  ? 341 VAL B CA  1 
ATOM   218  C C   . VAL A 1 31 ? -2.280  -24.983 -32.804 1.00 45.11  ? 341 VAL B C   1 
ATOM   219  O O   . VAL A 1 31 ? -2.923  -23.991 -32.442 1.00 44.58  ? 341 VAL B O   1 
ATOM   220  C CB  . VAL A 1 31 ? -0.170  -25.554 -31.518 1.00 40.02  ? 341 VAL B CB  1 
ATOM   221  C CG1 . VAL A 1 31 ? -0.047  -24.108 -31.058 1.00 34.29  ? 341 VAL B CG1 1 
ATOM   222  C CG2 . VAL A 1 31 ? 0.434   -26.501 -30.490 1.00 35.33  ? 341 VAL B CG2 1 
ATOM   223  N N   . VAL A 1 32 ? -2.110  -25.279 -34.094 1.00 38.73  ? 342 VAL B N   1 
ATOM   224  C CA  . VAL A 1 32 ? -2.728  -24.454 -35.128 1.00 38.07  ? 342 VAL B CA  1 
ATOM   225  C C   . VAL A 1 32 ? -4.235  -24.675 -35.153 1.00 58.57  ? 342 VAL B C   1 
ATOM   226  O O   . VAL A 1 32 ? -5.021  -23.721 -35.135 1.00 65.32  ? 342 VAL B O   1 
ATOM   227  C CB  . VAL A 1 32 ? -2.091  -24.743 -36.499 1.00 46.72  ? 342 VAL B CB  1 
ATOM   228  C CG1 . VAL A 1 32 ? -2.828  -23.989 -37.595 1.00 39.11  ? 342 VAL B CG1 1 
ATOM   229  C CG2 . VAL A 1 32 ? -0.619  -24.368 -36.489 1.00 39.60  ? 342 VAL B CG2 1 
ATOM   230  N N   . GLY A 1 33 ? -4.661  -25.936 -35.189 1.00 53.39  ? 343 GLY B N   1 
ATOM   231  C CA  . GLY A 1 33 ? -6.064  -26.268 -35.195 1.00 52.81  ? 343 GLY B CA  1 
ATOM   232  C C   . GLY A 1 33 ? -6.679  -26.191 -36.578 1.00 65.28  ? 343 GLY B C   1 
ATOM   233  O O   . GLY A 1 33 ? -6.011  -25.870 -37.566 1.00 69.38  ? 343 GLY B O   1 
ATOM   234  N N   . PRO A 1 34 ? -7.975  -26.492 -36.671 1.00 66.71  ? 344 PRO B N   1 
ATOM   235  C CA  . PRO A 1 34 ? -8.668  -26.444 -37.970 1.00 70.55  ? 344 PRO B CA  1 
ATOM   236  C C   . PRO A 1 34 ? -8.739  -25.018 -38.498 1.00 77.26  ? 344 PRO B C   1 
ATOM   237  O O   . PRO A 1 34 ? -9.317  -24.135 -37.861 1.00 85.88  ? 344 PRO B O   1 
ATOM   238  C CB  . PRO A 1 34 ? -10.060 -27.003 -37.651 1.00 77.62  ? 344 PRO B CB  1 
ATOM   239  C CG  . PRO A 1 34 ? -10.235 -26.765 -36.186 1.00 76.74  ? 344 PRO B CG  1 
ATOM   240  C CD  . PRO A 1 34 ? -8.869  -26.921 -35.582 1.00 71.58  ? 344 PRO B CD  1 
ATOM   241  N N   . LYS A 1 35 ? -8.137  -24.800 -39.670 1.00 76.99  ? 345 LYS B N   1 
ATOM   242  C CA  . LYS A 1 35 ? -8.102  -23.493 -40.329 1.00 71.10  ? 345 LYS B CA  1 
ATOM   243  C C   . LYS A 1 35 ? -7.450  -22.422 -39.457 1.00 71.11  ? 345 LYS B C   1 
ATOM   244  O O   . LYS A 1 35 ? -7.759  -21.234 -39.580 1.00 71.18  ? 345 LYS B O   1 
ATOM   245  C CB  . LYS A 1 35 ? -9.505  -23.049 -40.758 1.00 60.95  ? 345 LYS B CB  1 
ATOM   246  N N   . GLY A 1 36 ? -6.545  -22.830 -38.569 1.00 66.78  ? 346 GLY B N   1 
ATOM   247  C CA  . GLY A 1 36 ? -5.843  -21.876 -37.733 1.00 59.11  ? 346 GLY B CA  1 
ATOM   248  C C   . GLY A 1 36 ? -6.657  -21.264 -36.618 1.00 56.24  ? 346 GLY B C   1 
ATOM   249  O O   . GLY A 1 36 ? -6.260  -20.231 -36.073 1.00 45.98  ? 346 GLY B O   1 
ATOM   250  N N   . ALA A 1 37 ? -7.790  -21.871 -36.257 1.00 57.59  ? 347 ALA B N   1 
ATOM   251  C CA  . ALA A 1 37 ? -8.651  -21.276 -35.240 1.00 53.71  ? 347 ALA B CA  1 
ATOM   252  C C   . ALA A 1 37 ? -8.020  -21.330 -33.856 1.00 60.22  ? 347 ALA B C   1 
ATOM   253  O O   . ALA A 1 37 ? -8.212  -20.409 -33.053 1.00 59.78  ? 347 ALA B O   1 
ATOM   254  C CB  . ALA A 1 37 ? -10.011 -21.974 -35.229 1.00 53.58  ? 347 ALA B CB  1 
ATOM   255  N N   . THR A 1 38 ? -7.270  -22.392 -33.555 1.00 70.90  ? 348 THR B N   1 
ATOM   256  C CA  . THR A 1 38 ? -6.679  -22.528 -32.228 1.00 56.13  ? 348 THR B CA  1 
ATOM   257  C C   . THR A 1 38 ? -5.555  -21.519 -32.019 1.00 50.01  ? 348 THR B C   1 
ATOM   258  O O   . THR A 1 38 ? -5.498  -20.844 -30.985 1.00 49.50  ? 348 THR B O   1 
ATOM   259  C CB  . THR A 1 38 ? -6.172  -23.955 -32.017 1.00 44.16  ? 348 THR B CB  1 
ATOM   260  O OG1 . THR A 1 38 ? -7.265  -24.873 -32.139 1.00 54.33  ? 348 THR B OG1 1 
ATOM   261  C CG2 . THR A 1 38 ? -5.558  -24.099 -30.634 1.00 43.21  ? 348 THR B CG2 1 
ATOM   262  N N   . ILE A 1 39 ? -4.650  -21.400 -32.994 1.00 55.44  ? 349 ILE B N   1 
ATOM   263  C CA  . ILE A 1 39 ? -3.539  -20.464 -32.847 1.00 37.92  ? 349 ILE B CA  1 
ATOM   264  C C   . ILE A 1 39 ? -4.040  -19.025 -32.905 1.00 52.25  ? 349 ILE B C   1 
ATOM   265  O O   . ILE A 1 39 ? -3.444  -18.128 -32.297 1.00 58.00  ? 349 ILE B O   1 
ATOM   266  C CB  . ILE A 1 39 ? -2.457  -20.743 -33.909 1.00 39.21  ? 349 ILE B CB  1 
ATOM   267  C CG1 . ILE A 1 39 ? -1.196  -19.927 -33.619 1.00 39.60  ? 349 ILE B CG1 1 
ATOM   268  C CG2 . ILE A 1 39 ? -2.978  -20.455 -35.311 1.00 42.61  ? 349 ILE B CG2 1 
ATOM   269  C CD1 . ILE A 1 39 ? -0.559  -20.252 -32.286 1.00 52.49  ? 349 ILE B CD1 1 
ATOM   270  N N   . LYS A 1 40 ? -5.140  -18.779 -33.622 1.00 46.97  ? 350 LYS B N   1 
ATOM   271  C CA  . LYS A 1 40 ? -5.730  -17.445 -33.637 1.00 44.78  ? 350 LYS B CA  1 
ATOM   272  C C   . LYS A 1 40 ? -6.363  -17.107 -32.293 1.00 49.65  ? 350 LYS B C   1 
ATOM   273  O O   . LYS A 1 40 ? -6.332  -15.947 -31.868 1.00 58.55  ? 350 LYS B O   1 
ATOM   274  C CB  . LYS A 1 40 ? -6.765  -17.336 -34.756 1.00 44.68  ? 350 LYS B CB  1 
ATOM   275  N N   . ARG A 1 41 ? -6.932  -18.106 -31.615 1.00 54.14  ? 351 ARG B N   1 
ATOM   276  C CA  . ARG A 1 41 ? -7.518  -17.884 -30.297 1.00 55.90  ? 351 ARG B CA  1 
ATOM   277  C C   . ARG A 1 41 ? -6.447  -17.584 -29.254 1.00 48.63  ? 351 ARG B C   1 
ATOM   278  O O   . ARG A 1 41 ? -6.662  -16.764 -28.354 1.00 45.23  ? 351 ARG B O   1 
ATOM   279  C CB  . ARG A 1 41 ? -8.330  -19.115 -29.890 1.00 48.26  ? 351 ARG B CB  1 
ATOM   280  C CG  . ARG A 1 41 ? -8.836  -19.102 -28.459 1.00 60.98  ? 351 ARG B CG  1 
ATOM   281  C CD  . ARG A 1 41 ? -9.805  -17.973 -28.180 1.00 75.65  ? 351 ARG B CD  1 
ATOM   282  N NE  . ARG A 1 41 ? -10.289 -18.045 -26.804 1.00 93.87  ? 351 ARG B NE  1 
ATOM   283  C CZ  . ARG A 1 41 ? -11.319 -18.784 -26.408 1.00 104.38 ? 351 ARG B CZ  1 
ATOM   284  N NH1 . ARG A 1 41 ? -11.984 -19.524 -27.284 1.00 105.06 ? 351 ARG B NH1 1 
ATOM   285  N NH2 . ARG A 1 41 ? -11.682 -18.787 -25.132 1.00 111.23 ? 351 ARG B NH2 1 
ATOM   286  N N   . ILE A 1 42 ? -5.284  -18.226 -29.369 1.00 41.82  ? 352 ILE B N   1 
ATOM   287  C CA  . ILE A 1 42 ? -4.196  -17.972 -28.430 1.00 44.98  ? 352 ILE B CA  1 
ATOM   288  C C   . ILE A 1 42 ? -3.683  -16.542 -28.567 1.00 49.41  ? 352 ILE B C   1 
ATOM   289  O O   . ILE A 1 42 ? -3.397  -15.872 -27.568 1.00 52.53  ? 352 ILE B O   1 
ATOM   290  C CB  . ILE A 1 42 ? -3.073  -19.005 -28.639 1.00 39.51  ? 352 ILE B CB  1 
ATOM   291  C CG1 . ILE A 1 42 ? -3.566  -20.407 -28.269 1.00 39.55  ? 352 ILE B CG1 1 
ATOM   292  C CG2 . ILE A 1 42 ? -1.841  -18.636 -27.829 1.00 37.10  ? 352 ILE B CG2 1 
ATOM   293  C CD1 . ILE A 1 42 ? -2.510  -21.483 -28.402 1.00 42.16  ? 352 ILE B CD1 1 
ATOM   294  N N   . GLN A 1 43 ? -3.570  -16.049 -29.803 1.00 38.74  ? 353 GLN B N   1 
ATOM   295  C CA  . GLN A 1 43 ? -3.091  -14.686 -30.019 1.00 43.82  ? 353 GLN B CA  1 
ATOM   296  C C   . GLN A 1 43 ? -4.071  -13.652 -29.477 1.00 49.10  ? 353 GLN B C   1 
ATOM   297  O O   . GLN A 1 43 ? -3.656  -12.649 -28.884 1.00 59.67  ? 353 GLN B O   1 
ATOM   298  C CB  . GLN A 1 43 ? -2.830  -14.456 -31.507 1.00 43.66  ? 353 GLN B CB  1 
ATOM   299  C CG  . GLN A 1 43 ? -1.733  -15.341 -32.079 1.00 51.40  ? 353 GLN B CG  1 
ATOM   300  C CD  . GLN A 1 43 ? -1.492  -15.099 -33.556 1.00 53.88  ? 353 GLN B CD  1 
ATOM   301  O OE1 . GLN A 1 43 ? -0.819  -14.143 -33.939 1.00 43.77  ? 353 GLN B OE1 1 
ATOM   302  N NE2 . GLN A 1 43 ? -2.042  -15.969 -34.395 1.00 58.46  ? 353 GLN B NE2 1 
ATOM   303  N N   . GLN A 1 44 ? -5.374  -13.874 -29.668 1.00 42.68  ? 354 GLN B N   1 
ATOM   304  C CA  . GLN A 1 44 ? -6.362  -12.907 -29.200 1.00 59.00  ? 354 GLN B CA  1 
ATOM   305  C C   . GLN A 1 44 ? -6.459  -12.899 -27.680 1.00 53.15  ? 354 GLN B C   1 
ATOM   306  O O   . GLN A 1 44 ? -6.571  -11.832 -27.065 1.00 56.91  ? 354 GLN B O   1 
ATOM   307  C CB  . GLN A 1 44 ? -7.727  -13.213 -29.817 1.00 68.55  ? 354 GLN B CB  1 
ATOM   308  C CG  . GLN A 1 44 ? -7.757  -13.164 -31.334 1.00 79.78  ? 354 GLN B CG  1 
ATOM   309  C CD  . GLN A 1 44 ? -8.992  -13.829 -31.910 1.00 86.52  ? 354 GLN B CD  1 
ATOM   310  O OE1 . GLN A 1 44 ? -9.842  -14.329 -31.173 1.00 86.19  ? 354 GLN B OE1 1 
ATOM   311  N NE2 . GLN A 1 44 ? -9.093  -13.844 -33.234 1.00 90.38  ? 354 GLN B NE2 1 
ATOM   312  N N   . GLN A 1 45 ? -6.421  -14.078 -27.057 1.00 46.20  ? 355 GLN B N   1 
ATOM   313  C CA  . GLN A 1 45 ? -6.596  -14.156 -25.610 1.00 65.14  ? 355 GLN B CA  1 
ATOM   314  C C   . GLN A 1 45 ? -5.363  -13.669 -24.857 1.00 60.02  ? 355 GLN B C   1 
ATOM   315  O O   . GLN A 1 45 ? -5.491  -13.107 -23.763 1.00 62.69  ? 355 GLN B O   1 
ATOM   316  C CB  . GLN A 1 45 ? -6.943  -15.589 -25.205 1.00 50.77  ? 355 GLN B CB  1 
ATOM   317  C CG  . GLN A 1 45 ? -7.289  -15.757 -23.735 1.00 64.99  ? 355 GLN B CG  1 
ATOM   318  C CD  . GLN A 1 45 ? -7.974  -17.078 -23.447 1.00 78.35  ? 355 GLN B CD  1 
ATOM   319  O OE1 . GLN A 1 45 ? -8.611  -17.665 -24.322 1.00 83.17  ? 355 GLN B OE1 1 
ATOM   320  N NE2 . GLN A 1 45 ? -7.846  -17.555 -22.214 1.00 85.05  ? 355 GLN B NE2 1 
ATOM   321  N N   . THR A 1 46 ? -4.173  -13.861 -25.421 1.00 45.25  ? 356 THR B N   1 
ATOM   322  C CA  . THR A 1 46 ? -2.932  -13.481 -24.760 1.00 44.34  ? 356 THR B CA  1 
ATOM   323  C C   . THR A 1 46 ? -2.341  -12.182 -25.290 1.00 46.91  ? 356 THR B C   1 
ATOM   324  O O   . THR A 1 46 ? -1.291  -11.754 -24.800 1.00 48.53  ? 356 THR B O   1 
ATOM   325  C CB  . THR A 1 46 ? -1.897  -14.604 -24.890 1.00 45.02  ? 356 THR B CB  1 
ATOM   326  O OG1 . THR A 1 46 ? -1.612  -14.838 -26.275 1.00 41.65  ? 356 THR B OG1 1 
ATOM   327  C CG2 . THR A 1 46 ? -2.421  -15.886 -24.260 1.00 41.72  ? 356 THR B CG2 1 
ATOM   328  N N   . HIS A 1 47 ? -2.989  -11.546 -26.269 1.00 41.90  ? 357 HIS B N   1 
ATOM   329  C CA  . HIS A 1 47 ? -2.522  -10.284 -26.847 1.00 48.56  ? 357 HIS B CA  1 
ATOM   330  C C   . HIS A 1 47 ? -1.093  -10.415 -27.374 1.00 51.01  ? 357 HIS B C   1 
ATOM   331  O O   . HIS A 1 47 ? -0.223  -9.586  -27.099 1.00 38.74  ? 357 HIS B O   1 
ATOM   332  C CB  . HIS A 1 47 ? -2.626  -9.142  -25.831 1.00 43.32  ? 357 HIS B CB  1 
ATOM   333  C CG  . HIS A 1 47 ? -4.002  -8.946  -25.276 1.00 82.81  ? 357 HIS B CG  1 
ATOM   334  N ND1 . HIS A 1 47 ? -4.349  -9.327  -23.998 1.00 82.88  ? 357 HIS B ND1 1 
ATOM   335  C CD2 . HIS A 1 47 ? -5.115  -8.403  -25.822 1.00 82.82  ? 357 HIS B CD2 1 
ATOM   336  C CE1 . HIS A 1 47 ? -5.618  -9.031  -23.782 1.00 86.74  ? 357 HIS B CE1 1 
ATOM   337  N NE2 . HIS A 1 47 ? -6.106  -8.469  -24.873 1.00 86.26  ? 357 HIS B NE2 1 
ATOM   338  N N   . THR A 1 48 ? -0.852  -11.475 -28.142 1.00 37.44  ? 358 THR B N   1 
ATOM   339  C CA  . THR A 1 48 ? 0.464   -11.747 -28.697 1.00 42.71  ? 358 THR B CA  1 
ATOM   340  C C   . THR A 1 48 ? 0.371   -11.912 -30.207 1.00 50.47  ? 358 THR B C   1 
ATOM   341  O O   . THR A 1 48 ? -0.704  -12.142 -30.767 1.00 45.30  ? 358 THR B O   1 
ATOM   342  C CB  . THR A 1 48 ? 1.092   -13.006 -28.079 1.00 41.08  ? 358 THR B CB  1 
ATOM   343  O OG1 . THR A 1 48 ? 0.234   -14.131 -28.303 1.00 40.81  ? 358 THR B OG1 1 
ATOM   344  C CG2 . THR A 1 48 ? 1.303   -12.821 -26.583 1.00 40.27  ? 358 THR B CG2 1 
ATOM   345  N N   . TYR A 1 49 ? 1.522   -11.781 -30.860 1.00 42.40  ? 359 TYR B N   1 
ATOM   346  C CA  . TYR A 1 49 ? 1.673   -12.025 -32.289 1.00 43.67  ? 359 TYR B CA  1 
ATOM   347  C C   . TYR A 1 49 ? 2.510   -13.284 -32.469 1.00 38.31  ? 359 TYR B C   1 
ATOM   348  O O   . TYR A 1 49 ? 3.677   -13.316 -32.065 1.00 41.72  ? 359 TYR B O   1 
ATOM   349  C CB  . TYR A 1 49 ? 2.322   -10.828 -32.982 1.00 35.65  ? 359 TYR B CB  1 
ATOM   350  C CG  . TYR A 1 49 ? 2.658   -11.065 -34.435 1.00 37.63  ? 359 TYR B CG  1 
ATOM   351  C CD1 . TYR A 1 49 ? 3.965   -11.313 -34.833 1.00 43.37  ? 359 TYR B CD1 1 
ATOM   352  C CD2 . TYR A 1 49 ? 1.669   -11.043 -35.410 1.00 40.03  ? 359 TYR B CD2 1 
ATOM   353  C CE1 . TYR A 1 49 ? 4.278   -11.530 -36.159 1.00 43.81  ? 359 TYR B CE1 1 
ATOM   354  C CE2 . TYR A 1 49 ? 1.973   -11.260 -36.741 1.00 37.41  ? 359 TYR B CE2 1 
ATOM   355  C CZ  . TYR A 1 49 ? 3.279   -11.503 -37.109 1.00 40.60  ? 359 TYR B CZ  1 
ATOM   356  O OH  . TYR A 1 49 ? 3.589   -11.720 -38.432 1.00 41.23  ? 359 TYR B OH  1 
ATOM   357  N N   . ILE A 1 50 ? 1.919   -14.316 -33.067 1.00 41.56  ? 360 ILE B N   1 
ATOM   358  C CA  . ILE A 1 50 ? 2.544   -15.631 -33.168 1.00 42.49  ? 360 ILE B CA  1 
ATOM   359  C C   . ILE A 1 50 ? 2.691   -16.010 -34.635 1.00 47.31  ? 360 ILE B C   1 
ATOM   360  O O   . ILE A 1 50 ? 1.719   -15.962 -35.397 1.00 30.91  ? 360 ILE B O   1 
ATOM   361  C CB  . ILE A 1 50 ? 1.739   -16.702 -32.410 1.00 43.60  ? 360 ILE B CB  1 
ATOM   362  C CG1 . ILE A 1 50 ? 1.653   -16.347 -30.924 1.00 36.83  ? 360 ILE B CG1 1 
ATOM   363  C CG2 . ILE A 1 50 ? 2.371   -18.072 -32.598 1.00 43.04  ? 360 ILE B CG2 1 
ATOM   364  C CD1 . ILE A 1 50 ? 0.834   -17.323 -30.112 1.00 40.58  ? 360 ILE B CD1 1 
ATOM   365  N N   . VAL A 1 51 ? 3.908   -16.388 -35.022 1.00 41.09  ? 361 VAL B N   1 
ATOM   366  C CA  . VAL A 1 51 ? 4.200   -16.893 -36.359 1.00 45.33  ? 361 VAL B CA  1 
ATOM   367  C C   . VAL A 1 51 ? 4.230   -18.414 -36.304 1.00 46.41  ? 361 VAL B C   1 
ATOM   368  O O   . VAL A 1 51 ? 4.953   -19.001 -35.489 1.00 40.51  ? 361 VAL B O   1 
ATOM   369  C CB  . VAL A 1 51 ? 5.531   -16.334 -36.890 1.00 47.55  ? 361 VAL B CB  1 
ATOM   370  C CG1 . VAL A 1 51 ? 5.867   -16.956 -38.236 1.00 28.59  ? 361 VAL B CG1 1 
ATOM   371  C CG2 . VAL A 1 51 ? 5.461   -14.821 -36.999 1.00 40.84  ? 361 VAL B CG2 1 
ATOM   372  N N   . THR A 1 52 ? 3.444   -19.050 -37.165 1.00 41.20  ? 362 THR B N   1 
ATOM   373  C CA  . THR A 1 52 ? 3.386   -20.507 -37.225 1.00 37.80  ? 362 THR B CA  1 
ATOM   374  C C   . THR A 1 52 ? 4.528   -21.043 -38.085 1.00 34.30  ? 362 THR B C   1 
ATOM   375  O O   . THR A 1 52 ? 4.782   -20.509 -39.170 1.00 35.32  ? 362 THR B O   1 
ATOM   376  C CB  . THR A 1 52 ? 2.040   -20.960 -37.792 1.00 40.74  ? 362 THR B CB  1 
ATOM   377  O OG1 . THR A 1 52 ? 1.002   -20.688 -36.842 1.00 35.55  ? 362 THR B OG1 1 
ATOM   378  C CG2 . THR A 1 52 ? 2.053   -22.449 -38.107 1.00 40.04  ? 362 THR B CG2 1 
ATOM   379  N N   . PRO A 1 53 ? 5.239   -22.075 -37.635 1.00 37.50  ? 363 PRO B N   1 
ATOM   380  C CA  . PRO A 1 53 ? 6.324   -22.638 -38.446 1.00 34.90  ? 363 PRO B CA  1 
ATOM   381  C C   . PRO A 1 53 ? 5.812   -23.265 -39.735 1.00 41.46  ? 363 PRO B C   1 
ATOM   382  O O   . PRO A 1 53 ? 4.646   -23.647 -39.861 1.00 45.32  ? 363 PRO B O   1 
ATOM   383  C CB  . PRO A 1 53 ? 6.947   -23.695 -37.525 1.00 34.78  ? 363 PRO B CB  1 
ATOM   384  C CG  . PRO A 1 53 ? 5.863   -24.037 -36.553 1.00 44.19  ? 363 PRO B CG  1 
ATOM   385  C CD  . PRO A 1 53 ? 5.107   -22.760 -36.338 1.00 41.98  ? 363 PRO B CD  1 
ATOM   386  N N   . SER A 1 54 ? 6.719   -23.365 -40.706 1.00 38.21  ? 364 SER B N   1 
ATOM   387  C CA  . SER A 1 54 ? 6.382   -23.872 -42.029 1.00 44.75  ? 364 SER B CA  1 
ATOM   388  C C   . SER A 1 54 ? 6.082   -25.372 -41.973 1.00 45.24  ? 364 SER B C   1 
ATOM   389  O O   . SER A 1 54 ? 6.079   -26.002 -40.911 1.00 59.06  ? 364 SER B O   1 
ATOM   390  C CB  . SER A 1 54 ? 7.513   -23.579 -43.011 1.00 39.54  ? 364 SER B CB  1 
ATOM   391  N N   . ARG A 1 55 ? 5.821   -25.947 -43.151 1.00 59.15  ? 365 ARG B N   1 
ATOM   392  C CA  . ARG A 1 55 ? 5.346   -27.326 -43.229 1.00 66.48  ? 365 ARG B CA  1 
ATOM   393  C C   . ARG A 1 55 ? 6.385   -28.310 -42.700 1.00 70.32  ? 365 ARG B C   1 
ATOM   394  O O   . ARG A 1 55 ? 6.093   -29.121 -41.814 1.00 73.12  ? 365 ARG B O   1 
ATOM   395  C CB  . ARG A 1 55 ? 4.970   -27.664 -44.672 1.00 63.26  ? 365 ARG B CB  1 
ATOM   396  N N   . ASP A 1 56 ? 7.606   -28.254 -43.231 1.00 45.04  ? 366 ASP B N   1 
ATOM   397  C CA  . ASP A 1 56 ? 8.652   -29.211 -42.885 1.00 41.70  ? 366 ASP B CA  1 
ATOM   398  C C   . ASP A 1 56 ? 9.850   -28.528 -42.232 1.00 40.95  ? 366 ASP B C   1 
ATOM   399  O O   . ASP A 1 56 ? 10.978  -29.018 -42.320 1.00 36.91  ? 366 ASP B O   1 
ATOM   400  C CB  . ASP A 1 56 ? 9.091   -30.001 -44.118 1.00 51.58  ? 366 ASP B CB  1 
ATOM   401  C CG  . ASP A 1 56 ? 7.957   -30.801 -44.735 1.00 57.43  ? 366 ASP B CG  1 
ATOM   402  O OD1 . ASP A 1 56 ? 7.647   -31.894 -44.216 1.00 49.23  ? 366 ASP B OD1 1 
ATOM   403  O OD2 . ASP A 1 56 ? 7.379   -30.339 -45.742 1.00 54.81  ? 366 ASP B OD2 1 
ATOM   404  N N   . LYS A 1 57 ? 9.619   -27.396 -41.574 1.00 32.85  ? 367 LYS B N   1 
ATOM   405  C CA  . LYS A 1 57 ? 10.660  -26.678 -40.858 1.00 42.16  ? 367 LYS B CA  1 
ATOM   406  C C   . LYS A 1 57 ? 10.618  -27.029 -39.372 1.00 36.02  ? 367 LYS B C   1 
ATOM   407  O O   . LYS A 1 57 ? 9.852   -27.889 -38.929 1.00 31.53  ? 367 LYS B O   1 
ATOM   408  C CB  . LYS A 1 57 ? 10.529  -25.170 -41.081 1.00 40.09  ? 367 LYS B CB  1 
ATOM   409  C CG  . LYS A 1 57 ? 11.349  -24.652 -42.253 1.00 50.08  ? 367 LYS B CG  1 
ATOM   410  C CD  . LYS A 1 57 ? 12.811  -25.065 -42.124 1.00 77.02  ? 367 LYS B CD  1 
ATOM   411  C CE  . LYS A 1 57 ? 13.454  -24.490 -40.867 1.00 79.32  ? 367 LYS B CE  1 
ATOM   412  N NZ  . LYS A 1 57 ? 14.773  -25.123 -40.581 1.00 71.73  ? 367 LYS B NZ  1 
ATOM   413  N N   . GLU A 1 58 ? 11.468  -26.357 -38.598 1.00 49.02  ? 368 GLU B N   1 
ATOM   414  C CA  . GLU A 1 58 ? 11.547  -26.617 -37.167 1.00 53.50  ? 368 GLU B CA  1 
ATOM   415  C C   . GLU A 1 58 ? 10.196  -26.354 -36.512 1.00 37.86  ? 368 GLU B C   1 
ATOM   416  O O   . GLU A 1 58 ? 9.581   -25.308 -36.765 1.00 38.40  ? 368 GLU B O   1 
ATOM   417  C CB  . GLU A 1 58 ? 12.600  -25.725 -36.510 1.00 63.57  ? 368 GLU B CB  1 
ATOM   418  C CG  . GLU A 1 58 ? 14.011  -25.874 -37.038 1.00 83.70  ? 368 GLU B CG  1 
ATOM   419  C CD  . GLU A 1 58 ? 14.981  -24.958 -36.317 1.00 91.08  ? 368 GLU B CD  1 
ATOM   420  O OE1 . GLU A 1 58 ? 14.520  -23.982 -35.689 1.00 88.18  ? 368 GLU B OE1 1 
ATOM   421  O OE2 . GLU A 1 58 ? 16.202  -25.215 -36.371 1.00 96.69  ? 368 GLU B OE2 1 
ATOM   422  N N   . PRO A 1 59 ? 9.700   -27.261 -35.673 1.00 34.91  ? 369 PRO B N   1 
ATOM   423  C CA  . PRO A 1 59 ? 8.392   -27.043 -35.017 1.00 32.88  ? 369 PRO B CA  1 
ATOM   424  C C   . PRO A 1 59 ? 8.506   -26.015 -33.896 1.00 38.06  ? 369 PRO B C   1 
ATOM   425  O O   . PRO A 1 59 ? 8.340   -26.303 -32.705 1.00 38.20  ? 369 PRO B O   1 
ATOM   426  C CB  . PRO A 1 59 ? 8.042   -28.443 -34.508 1.00 33.93  ? 369 PRO B CB  1 
ATOM   427  C CG  . PRO A 1 59 ? 9.364   -29.097 -34.275 1.00 33.60  ? 369 PRO B CG  1 
ATOM   428  C CD  . PRO A 1 59 ? 10.277  -28.578 -35.347 1.00 32.32  ? 369 PRO B CD  1 
ATOM   429  N N   . VAL A 1 60 ? 8.797   -24.774 -34.283 1.00 37.23  ? 370 VAL B N   1 
ATOM   430  C CA  . VAL A 1 60 ? 9.034   -23.683 -33.346 1.00 40.34  ? 370 VAL B CA  1 
ATOM   431  C C   . VAL A 1 60 ? 8.080   -22.541 -33.663 1.00 43.25  ? 370 VAL B C   1 
ATOM   432  O O   . VAL A 1 60 ? 8.037   -22.057 -34.799 1.00 28.72  ? 370 VAL B O   1 
ATOM   433  C CB  . VAL A 1 60 ? 10.496  -23.203 -33.393 1.00 40.74  ? 370 VAL B CB  1 
ATOM   434  C CG1 . VAL A 1 60 ? 10.686  -21.992 -32.490 1.00 28.72  ? 370 VAL B CG1 1 
ATOM   435  C CG2 . VAL A 1 60 ? 11.434  -24.329 -32.983 1.00 29.75  ? 370 VAL B CG2 1 
ATOM   436  N N   . PHE A 1 61 ? 7.318   -22.121 -32.658 1.00 41.80  ? 371 PHE B N   1 
ATOM   437  C CA  . PHE A 1 61 ? 6.464   -20.948 -32.761 1.00 38.64  ? 371 PHE B CA  1 
ATOM   438  C C   . PHE A 1 61 ? 7.199   -19.720 -32.240 1.00 40.71  ? 371 PHE B C   1 
ATOM   439  O O   . PHE A 1 61 ? 7.906   -19.785 -31.229 1.00 43.95  ? 371 PHE B O   1 
ATOM   440  C CB  . PHE A 1 61 ? 5.164   -21.149 -31.981 1.00 28.75  ? 371 PHE B CB  1 
ATOM   441  C CG  . PHE A 1 61 ? 4.245   -22.180 -32.577 1.00 34.91  ? 371 PHE B CG  1 
ATOM   442  C CD1 . PHE A 1 61 ? 3.187   -21.799 -33.387 1.00 29.70  ? 371 PHE B CD1 1 
ATOM   443  C CD2 . PHE A 1 61 ? 4.434   -23.529 -32.322 1.00 35.39  ? 371 PHE B CD2 1 
ATOM   444  C CE1 . PHE A 1 61 ? 2.336   -22.743 -33.932 1.00 33.53  ? 371 PHE B CE1 1 
ATOM   445  C CE2 . PHE A 1 61 ? 3.588   -24.478 -32.865 1.00 30.53  ? 371 PHE B CE2 1 
ATOM   446  C CZ  . PHE A 1 61 ? 2.537   -24.085 -33.671 1.00 38.45  ? 371 PHE B CZ  1 
ATOM   447  N N   . GLU A 1 62 ? 7.030   -18.602 -32.942 1.00 32.80  ? 372 GLU B N   1 
ATOM   448  C CA  . GLU A 1 62 ? 7.636   -17.331 -32.563 1.00 40.77  ? 372 GLU B CA  1 
ATOM   449  C C   . GLU A 1 62 ? 6.552   -16.449 -31.954 1.00 40.41  ? 372 GLU B C   1 
ATOM   450  O O   . GLU A 1 62 ? 5.639   -16.004 -32.656 1.00 47.00  ? 372 GLU B O   1 
ATOM   451  C CB  . GLU A 1 62 ? 8.273   -16.653 -33.776 1.00 41.15  ? 372 GLU B CB  1 
ATOM   452  C CG  . GLU A 1 62 ? 9.410   -17.442 -34.416 1.00 54.78  ? 372 GLU B CG  1 
ATOM   453  C CD  . GLU A 1 62 ? 10.249  -16.600 -35.367 1.00 70.51  ? 372 GLU B CD  1 
ATOM   454  O OE1 . GLU A 1 62 ? 11.436  -16.382 -35.052 1.00 80.62  ? 372 GLU B OE1 1 
ATOM   455  O OE2 . GLU A 1 62 ? 9.726   -16.126 -36.400 1.00 72.90  ? 372 GLU B OE2 1 
ATOM   456  N N   . VAL A 1 63 ? 6.659   -16.184 -30.653 1.00 43.91  ? 373 VAL B N   1 
ATOM   457  C CA  . VAL A 1 63 ? 5.652   -15.437 -29.908 1.00 42.31  ? 373 VAL B CA  1 
ATOM   458  C C   . VAL A 1 63 ? 6.209   -14.052 -29.605 1.00 42.74  ? 373 VAL B C   1 
ATOM   459  O O   . VAL A 1 63 ? 7.313   -13.928 -29.063 1.00 44.57  ? 373 VAL B O   1 
ATOM   460  C CB  . VAL A 1 63 ? 5.251   -16.171 -28.616 1.00 39.27  ? 373 VAL B CB  1 
ATOM   461  C CG1 . VAL A 1 63 ? 4.136   -15.426 -27.911 1.00 55.29  ? 373 VAL B CG1 1 
ATOM   462  C CG2 . VAL A 1 63 ? 4.826   -17.601 -28.925 1.00 41.15  ? 373 VAL B CG2 1 
ATOM   463  N N   . THR A 1 64 ? 5.449   -13.015 -29.957 1.00 30.54  ? 374 THR B N   1 
ATOM   464  C CA  . THR A 1 64 ? 5.860   -11.631 -29.763 1.00 47.34  ? 374 THR B CA  1 
ATOM   465  C C   . THR A 1 64 ? 4.818   -10.893 -28.932 1.00 50.09  ? 374 THR B C   1 
ATOM   466  O O   . THR A 1 64 ? 3.612   -11.032 -29.163 1.00 41.99  ? 374 THR B O   1 
ATOM   467  C CB  . THR A 1 64 ? 6.060   -10.909 -31.110 1.00 35.78  ? 374 THR B CB  1 
ATOM   468  O OG1 . THR A 1 64 ? 7.024   -11.615 -31.901 1.00 42.14  ? 374 THR B OG1 1 
ATOM   469  C CG2 . THR A 1 64 ? 6.552   -9.483  -30.891 1.00 31.73  ? 374 THR B CG2 1 
ATOM   470  N N   . GLY A 1 65 ? 5.290   -10.111 -27.971 1.00 50.13  ? 375 GLY B N   1 
ATOM   471  C CA  . GLY A 1 65 ? 4.409   -9.340  -27.119 1.00 52.09  ? 375 GLY B CA  1 
ATOM   472  C C   . GLY A 1 65 ? 5.120   -8.970  -25.831 1.00 52.93  ? 375 GLY B C   1 
ATOM   473  O O   . GLY A 1 65 ? 6.326   -9.161  -25.688 1.00 53.72  ? 375 GLY B O   1 
ATOM   474  N N   . MET A 1 66 ? 4.337   -8.432  -24.898 1.00 38.71  ? 376 MET B N   1 
ATOM   475  C CA  . MET A 1 66 ? 4.870   -8.118  -23.582 1.00 40.67  ? 376 MET B CA  1 
ATOM   476  C C   . MET A 1 66 ? 5.366   -9.396  -22.906 1.00 55.68  ? 376 MET B C   1 
ATOM   477  O O   . MET A 1 66 ? 4.813   -10.478 -23.130 1.00 55.63  ? 376 MET B O   1 
ATOM   478  C CB  . MET A 1 66 ? 3.808   -7.435  -22.720 1.00 47.51  ? 376 MET B CB  1 
ATOM   479  C CG  . MET A 1 66 ? 3.348   -6.085  -23.255 1.00 61.61  ? 376 MET B CG  1 
ATOM   480  S SD  . MET A 1 66 ? 4.704   -4.923  -23.518 1.00 69.30  ? 376 MET B SD  1 
ATOM   481  C CE  . MET A 1 66 ? 5.353   -4.766  -21.856 1.00 61.23  ? 376 MET B CE  1 
ATOM   482  N N   . PRO A 1 67 ? 6.422   -9.305  -22.088 1.00 56.31  ? 377 PRO B N   1 
ATOM   483  C CA  . PRO A 1 67 ? 6.978   -10.526 -21.475 1.00 50.82  ? 377 PRO B CA  1 
ATOM   484  C C   . PRO A 1 67 ? 5.960   -11.336 -20.691 1.00 43.44  ? 377 PRO B C   1 
ATOM   485  O O   . PRO A 1 67 ? 5.958   -12.570 -20.788 1.00 45.68  ? 377 PRO B O   1 
ATOM   486  C CB  . PRO A 1 67 ? 8.092   -9.981  -20.571 1.00 44.84  ? 377 PRO B CB  1 
ATOM   487  C CG  . PRO A 1 67 ? 8.486   -8.688  -21.201 1.00 44.62  ? 377 PRO B CG  1 
ATOM   488  C CD  . PRO A 1 67 ? 7.214   -8.108  -21.754 1.00 55.04  ? 377 PRO B CD  1 
ATOM   489  N N   . GLU A 1 68 ? 5.091   -10.681 -19.918 1.00 49.74  ? 378 GLU B N   1 
ATOM   490  C CA  . GLU A 1 68 ? 4.063   -11.417 -19.187 1.00 53.64  ? 378 GLU B CA  1 
ATOM   491  C C   . GLU A 1 68 ? 3.054   -12.047 -20.140 1.00 49.88  ? 378 GLU B C   1 
ATOM   492  O O   . GLU A 1 68 ? 2.584   -13.167 -19.905 1.00 44.96  ? 378 GLU B O   1 
ATOM   493  C CB  . GLU A 1 68 ? 3.363   -10.494 -18.191 1.00 49.61  ? 378 GLU B CB  1 
ATOM   494  N N   . ASN A 1 69 ? 2.715   -11.348 -21.226 1.00 43.22  ? 379 ASN B N   1 
ATOM   495  C CA  . ASN A 1 69 ? 1.777   -11.901 -22.197 1.00 58.12  ? 379 ASN B CA  1 
ATOM   496  C C   . ASN A 1 69 ? 2.421   -13.011 -23.015 1.00 62.22  ? 379 ASN B C   1 
ATOM   497  O O   . ASN A 1 69 ? 1.742   -13.966 -23.410 1.00 56.81  ? 379 ASN B O   1 
ATOM   498  C CB  . ASN A 1 69 ? 1.252   -10.798 -23.113 1.00 55.20  ? 379 ASN B CB  1 
ATOM   499  C CG  . ASN A 1 69 ? 0.293   -9.861  -22.406 1.00 59.73  ? 379 ASN B CG  1 
ATOM   500  O OD1 . ASN A 1 69 ? -0.439  -10.269 -21.504 1.00 63.14  ? 379 ASN B OD1 1 
ATOM   501  N ND2 . ASN A 1 69 ? 0.292   -8.597  -22.811 1.00 59.08  ? 379 ASN B ND2 1 
ATOM   502  N N   . VAL A 1 70 ? 3.723   -12.899 -23.281 1.00 52.92  ? 380 VAL B N   1 
ATOM   503  C CA  . VAL A 1 70 ? 4.422   -13.927 -24.042 1.00 38.16  ? 380 VAL B CA  1 
ATOM   504  C C   . VAL A 1 70 ? 4.508   -15.219 -23.239 1.00 43.49  ? 380 VAL B C   1 
ATOM   505  O O   . VAL A 1 70 ? 4.358   -16.318 -23.787 1.00 42.25  ? 380 VAL B O   1 
ATOM   506  C CB  . VAL A 1 70 ? 5.814   -13.410 -24.454 1.00 43.48  ? 380 VAL B CB  1 
ATOM   507  C CG1 . VAL A 1 70 ? 6.790   -14.554 -24.613 1.00 37.09  ? 380 VAL B CG1 1 
ATOM   508  C CG2 . VAL A 1 70 ? 5.718   -12.607 -25.743 1.00 37.23  ? 380 VAL B CG2 1 
ATOM   509  N N   . ASP A 1 71 ? 4.730   -15.110 -21.926 1.00 52.66  ? 381 ASP B N   1 
ATOM   510  C CA  . ASP A 1 71 ? 4.745   -16.296 -21.075 1.00 57.87  ? 381 ASP B CA  1 
ATOM   511  C C   . ASP A 1 71 ? 3.376   -16.964 -21.026 1.00 49.39  ? 381 ASP B C   1 
ATOM   512  O O   . ASP A 1 71 ? 3.280   -18.196 -20.976 1.00 46.47  ? 381 ASP B O   1 
ATOM   513  C CB  . ASP A 1 71 ? 5.213   -15.927 -19.667 1.00 67.96  ? 381 ASP B CB  1 
ATOM   514  C CG  . ASP A 1 71 ? 6.662   -15.482 -19.631 1.00 75.94  ? 381 ASP B CG  1 
ATOM   515  O OD1 . ASP A 1 71 ? 6.975   -14.531 -18.884 1.00 81.11  ? 381 ASP B OD1 1 
ATOM   516  O OD2 . ASP A 1 71 ? 7.481   -16.058 -20.378 1.00 80.99  ? 381 ASP B OD2 1 
ATOM   517  N N   . ARG A 1 72 ? 2.304   -16.167 -21.034 1.00 54.71  ? 382 ARG B N   1 
ATOM   518  C CA  . ARG A 1 72 ? 0.959   -16.734 -21.062 1.00 57.72  ? 382 ARG B CA  1 
ATOM   519  C C   . ARG A 1 72 ? 0.702   -17.491 -22.360 1.00 58.13  ? 382 ARG B C   1 
ATOM   520  O O   . ARG A 1 72 ? 0.061   -18.548 -22.355 1.00 57.16  ? 382 ARG B O   1 
ATOM   521  C CB  . ARG A 1 72 ? -0.079  -15.629 -20.870 1.00 51.65  ? 382 ARG B CB  1 
ATOM   522  N N   . ALA A 1 73 ? 1.191   -16.962 -23.482 1.00 52.80  ? 383 ALA B N   1 
ATOM   523  C CA  . ALA A 1 73 ? 1.011   -17.641 -24.762 1.00 51.38  ? 383 ALA B CA  1 
ATOM   524  C C   . ALA A 1 73 ? 1.821   -18.929 -24.829 1.00 46.77  ? 383 ALA B C   1 
ATOM   525  O O   . ALA A 1 73 ? 1.384   -19.911 -25.442 1.00 43.81  ? 383 ALA B O   1 
ATOM   526  C CB  . ALA A 1 73 ? 1.389   -16.707 -25.910 1.00 46.56  ? 383 ALA B CB  1 
ATOM   527  N N   . ARG A 1 74 ? 3.009   -18.941 -24.217 1.00 42.72  ? 384 ARG B N   1 
ATOM   528  C CA  . ARG A 1 74 ? 3.830   -20.149 -24.203 1.00 36.23  ? 384 ARG B CA  1 
ATOM   529  C C   . ARG A 1 74 ? 3.127   -21.302 -23.495 1.00 49.53  ? 384 ARG B C   1 
ATOM   530  O O   . ARG A 1 74 ? 3.194   -22.450 -23.951 1.00 42.95  ? 384 ARG B O   1 
ATOM   531  C CB  . ARG A 1 74 ? 5.172   -19.853 -23.535 1.00 36.79  ? 384 ARG B CB  1 
ATOM   532  C CG  . ARG A 1 74 ? 5.997   -21.090 -23.226 1.00 38.57  ? 384 ARG B CG  1 
ATOM   533  C CD  . ARG A 1 74 ? 7.247   -20.745 -22.435 1.00 38.77  ? 384 ARG B CD  1 
ATOM   534  N NE  . ARG A 1 74 ? 8.183   -19.942 -23.214 1.00 60.16  ? 384 ARG B NE  1 
ATOM   535  C CZ  . ARG A 1 74 ? 9.092   -20.447 -24.041 1.00 60.80  ? 384 ARG B CZ  1 
ATOM   536  N NH1 . ARG A 1 74 ? 9.189   -21.760 -24.200 1.00 76.04  ? 384 ARG B NH1 1 
ATOM   537  N NH2 . ARG A 1 74 ? 9.904   -19.641 -24.710 1.00 53.04  ? 384 ARG B NH2 1 
ATOM   538  N N   . GLU A 1 75 ? 2.445   -21.020 -22.382 1.00 50.73  ? 385 GLU B N   1 
ATOM   539  C CA  . GLU A 1 75 ? 1.761   -22.085 -21.652 1.00 57.50  ? 385 GLU B CA  1 
ATOM   540  C C   . GLU A 1 75 ? 0.608   -22.669 -22.459 1.00 41.61  ? 385 GLU B C   1 
ATOM   541  O O   . GLU A 1 75 ? 0.428   -23.892 -22.491 1.00 42.23  ? 385 GLU B O   1 
ATOM   542  C CB  . GLU A 1 75 ? 1.268   -21.575 -20.299 1.00 66.21  ? 385 GLU B CB  1 
ATOM   543  C CG  . GLU A 1 75 ? 2.151   -21.978 -19.119 1.00 82.30  ? 385 GLU B CG  1 
ATOM   544  C CD  . GLU A 1 75 ? 2.228   -23.486 -18.919 1.00 96.14  ? 385 GLU B CD  1 
ATOM   545  O OE1 . GLU A 1 75 ? 2.990   -24.156 -19.649 1.00 95.34  ? 385 GLU B OE1 1 
ATOM   546  O OE2 . GLU A 1 75 ? 1.523   -24.003 -18.026 1.00 103.73 ? 385 GLU B OE2 1 
ATOM   547  N N   . GLU A 1 76 ? -0.177  -21.818 -23.124 1.00 50.57  ? 386 GLU B N   1 
ATOM   548  C CA  . GLU A 1 76 ? -1.287  -22.322 -23.927 1.00 59.43  ? 386 GLU B CA  1 
ATOM   549  C C   . GLU A 1 76 ? -0.780  -23.206 -25.059 1.00 60.48  ? 386 GLU B C   1 
ATOM   550  O O   . GLU A 1 76 ? -1.430  -24.191 -25.429 1.00 66.41  ? 386 GLU B O   1 
ATOM   551  C CB  . GLU A 1 76 ? -2.111  -21.158 -24.477 1.00 60.87  ? 386 GLU B CB  1 
ATOM   552  C CG  . GLU A 1 76 ? -2.871  -20.380 -23.414 1.00 78.80  ? 386 GLU B CG  1 
ATOM   553  C CD  . GLU A 1 76 ? -3.741  -19.284 -24.000 1.00 92.92  ? 386 GLU B CD  1 
ATOM   554  O OE1 . GLU A 1 76 ? -3.814  -19.179 -25.242 1.00 94.49  ? 386 GLU B OE1 1 
ATOM   555  O OE2 . GLU A 1 76 ? -4.346  -18.522 -23.217 1.00 95.59  ? 386 GLU B OE2 1 
ATOM   556  N N   . ILE A 1 77 ? 0.377   -22.862 -25.626 1.00 37.50  ? 387 ILE B N   1 
ATOM   557  C CA  . ILE A 1 77 ? 0.973   -23.689 -26.669 1.00 41.74  ? 387 ILE B CA  1 
ATOM   558  C C   . ILE A 1 77 ? 1.441   -25.022 -26.091 1.00 44.70  ? 387 ILE B C   1 
ATOM   559  O O   . ILE A 1 77 ? 1.148   -26.091 -26.639 1.00 38.07  ? 387 ILE B O   1 
ATOM   560  C CB  . ILE A 1 77 ? 2.124   -22.933 -27.356 1.00 41.03  ? 387 ILE B CB  1 
ATOM   561  C CG1 . ILE A 1 77 ? 1.585   -21.736 -28.140 1.00 33.52  ? 387 ILE B CG1 1 
ATOM   562  C CG2 . ILE A 1 77 ? 2.893   -23.859 -28.279 1.00 40.35  ? 387 ILE B CG2 1 
ATOM   563  C CD1 . ILE A 1 77 ? 2.667   -20.865 -28.740 1.00 31.97  ? 387 ILE B CD1 1 
ATOM   564  N N   . GLU A 1 78 ? 2.170   -24.978 -24.970 1.00 37.82  ? 388 GLU B N   1 
ATOM   565  C CA  . GLU A 1 78 ? 2.689   -26.202 -24.365 1.00 49.86  ? 388 GLU B CA  1 
ATOM   566  C C   . GLU A 1 78 ? 1.600   -27.075 -23.758 1.00 54.12  ? 388 GLU B C   1 
ATOM   567  O O   . GLU A 1 78 ? 1.827   -28.274 -23.562 1.00 58.31  ? 388 GLU B O   1 
ATOM   568  C CB  . GLU A 1 78 ? 3.730   -25.872 -23.294 1.00 52.81  ? 388 GLU B CB  1 
ATOM   569  C CG  . GLU A 1 78 ? 5.051   -25.368 -23.844 1.00 54.94  ? 388 GLU B CG  1 
ATOM   570  C CD  . GLU A 1 78 ? 5.949   -24.799 -22.766 1.00 73.43  ? 388 GLU B CD  1 
ATOM   571  O OE1 . GLU A 1 78 ? 5.687   -25.056 -21.572 1.00 84.69  ? 388 GLU B OE1 1 
ATOM   572  O OE2 . GLU A 1 78 ? 6.927   -24.105 -23.113 1.00 78.55  ? 388 GLU B OE2 1 
ATOM   573  N N   . MET A 1 79 ? 0.426   -26.516 -23.462 1.00 48.94  ? 389 MET B N   1 
ATOM   574  C CA  . MET A 1 79 ? -0.664  -27.341 -22.958 1.00 48.51  ? 389 MET B CA  1 
ATOM   575  C C   . MET A 1 79 ? -1.239  -28.232 -24.049 1.00 49.89  ? 389 MET B C   1 
ATOM   576  O O   . MET A 1 79 ? -1.862  -29.253 -23.739 1.00 49.88  ? 389 MET B O   1 
ATOM   577  C CB  . MET A 1 79 ? -1.754  -26.462 -22.341 1.00 46.79  ? 389 MET B CB  1 
ATOM   578  C CG  . MET A 1 79 ? -1.378  -25.905 -20.973 1.00 55.92  ? 389 MET B CG  1 
ATOM   579  S SD  . MET A 1 79 ? -2.333  -24.456 -20.482 1.00 63.55  ? 389 MET B SD  1 
ATOM   580  C CE  . MET A 1 79 ? -3.869  -25.214 -19.963 1.00 57.69  ? 389 MET B CE  1 
ATOM   581  N N   . HIS A 1 80 ? -1.050  -27.859 -25.315 1.00 53.58  ? 390 HIS B N   1 
ATOM   582  C CA  . HIS A 1 80 ? -1.453  -28.679 -26.451 1.00 47.88  ? 390 HIS B CA  1 
ATOM   583  C C   . HIS A 1 80 ? -0.411  -29.756 -26.740 1.00 46.29  ? 390 HIS B C   1 
ATOM   584  O O   . HIS A 1 80 ? -0.175  -30.096 -27.903 1.00 71.47  ? 390 HIS B O   1 
ATOM   585  C CB  . HIS A 1 80 ? -1.647  -27.805 -27.692 1.00 54.73  ? 390 HIS B CB  1 
ATOM   586  C CG  . HIS A 1 80 ? -2.869  -26.942 -27.641 1.00 60.10  ? 390 HIS B CG  1 
ATOM   587  N ND1 . HIS A 1 80 ? -2.955  -25.827 -26.836 1.00 60.83  ? 390 HIS B ND1 1 
ATOM   588  C CD2 . HIS A 1 80 ? -4.049  -27.024 -28.299 1.00 64.62  ? 390 HIS B CD2 1 
ATOM   589  C CE1 . HIS A 1 80 ? -4.137  -25.260 -26.998 1.00 63.67  ? 390 HIS B CE1 1 
ATOM   590  N NE2 . HIS A 1 80 ? -4.821  -25.967 -27.880 1.00 65.27  ? 390 HIS B NE2 1 
ATOM   591  N N   . ILE A 1 81 ? 0.214   -30.302 -25.698 1.00 55.28  ? 391 ILE B N   1 
ATOM   592  C CA  . ILE A 1 81 ? 1.214   -31.355 -25.839 1.00 57.42  ? 391 ILE B CA  1 
ATOM   593  C C   . ILE A 1 81 ? 0.834   -32.505 -24.917 1.00 65.78  ? 391 ILE B C   1 
ATOM   594  O O   . ILE A 1 81 ? 0.777   -32.331 -23.693 1.00 68.20  ? 391 ILE B O   1 
ATOM   595  C CB  . ILE A 1 81 ? 2.632   -30.854 -25.512 1.00 52.32  ? 391 ILE B CB  1 
ATOM   596  C CG1 . ILE A 1 81 ? 3.013   -29.682 -26.417 1.00 50.75  ? 391 ILE B CG1 1 
ATOM   597  C CG2 . ILE A 1 81 ? 3.644   -31.983 -25.653 1.00 56.83  ? 391 ILE B CG2 1 
ATOM   598  C CD1 . ILE A 1 81 ? 4.375   -29.092 -26.111 1.00 44.30  ? 391 ILE B CD1 1 
ATOM   599  N N   . ALA A 1 82 ? 0.584   -33.674 -25.501 1.00 69.38  ? 392 ALA B N   1 
ATOM   600  C CA  . ALA A 1 82 ? 0.236   -34.855 -24.728 1.00 70.86  ? 392 ALA B CA  1 
ATOM   601  C C   . ALA A 1 82 ? 1.469   -35.439 -24.050 1.00 74.11  ? 392 ALA B C   1 
ATOM   602  O O   . ALA A 1 82 ? 2.590   -35.349 -24.561 1.00 74.61  ? 392 ALA B O   1 
ATOM   603  C CB  . ALA A 1 82 ? -0.416  -35.909 -25.622 1.00 69.16  ? 392 ALA B CB  1 
ATOM   604  N N   . MET A 1 83 ? 1.250   -36.047 -22.888 1.00 78.28  ? 393 MET B N   1 
ATOM   605  C CA  . MET A 1 83 ? 2.335   -36.641 -22.117 1.00 83.58  ? 393 MET B CA  1 
ATOM   606  C C   . MET A 1 83 ? 2.734   -38.002 -22.682 1.00 78.32  ? 393 MET B C   1 
ATOM   607  O O   . MET A 1 83 ? 3.910   -38.367 -22.678 1.00 77.12  ? 393 MET B O   1 
ATOM   608  C CB  . MET A 1 83 ? 1.930   -36.777 -20.648 1.00 99.89  ? 393 MET B CB  1 
ATOM   609  C CG  . MET A 1 83 ? 3.053   -37.229 -19.729 1.00 115.23 ? 393 MET B CG  1 
ATOM   610  S SD  . MET A 1 83 ? 2.526   -37.348 -18.009 1.00 117.04 ? 393 MET B SD  1 
ATOM   611  C CE  . MET A 1 83 ? 4.072   -37.767 -17.209 1.00 115.17 ? 393 MET B CE  1 
ATOM   612  N N   . HIS B 1 4  ? -10.283 -11.687 -6.096  1.00 94.67  ? 314 HIS A N   1 
ATOM   613  C CA  . HIS B 1 4  ? -8.962  -11.183 -5.744  1.00 93.60  ? 314 HIS A CA  1 
ATOM   614  C C   . HIS B 1 4  ? -8.612  -9.985  -6.623  1.00 76.56  ? 314 HIS A C   1 
ATOM   615  O O   . HIS B 1 4  ? -8.905  -9.979  -7.819  1.00 79.85  ? 314 HIS A O   1 
ATOM   616  C CB  . HIS B 1 4  ? -7.911  -12.287 -5.880  1.00 90.55  ? 314 HIS A CB  1 
ATOM   617  C CG  . HIS B 1 4  ? -6.615  -11.975 -5.198  1.00 64.90  ? 314 HIS A CG  1 
ATOM   618  N ND1 . HIS B 1 4  ? -5.650  -11.167 -5.759  1.00 64.49  ? 314 HIS A ND1 1 
ATOM   619  C CD2 . HIS B 1 4  ? -6.131  -12.356 -3.992  1.00 55.92  ? 314 HIS A CD2 1 
ATOM   620  C CE1 . HIS B 1 4  ? -4.624  -11.070 -4.932  1.00 50.13  ? 314 HIS A CE1 1 
ATOM   621  N NE2 . HIS B 1 4  ? -4.891  -11.781 -3.852  1.00 62.25  ? 314 HIS A NE2 1 
ATOM   622  N N   . HIS B 1 5  ? -7.985  -8.970  -6.022  1.00 58.88  ? 315 HIS A N   1 
ATOM   623  C CA  . HIS B 1 5  ? -7.679  -7.745  -6.751  1.00 69.21  ? 315 HIS A CA  1 
ATOM   624  C C   . HIS B 1 5  ? -6.577  -7.928  -7.787  1.00 68.79  ? 315 HIS A C   1 
ATOM   625  O O   . HIS B 1 5  ? -6.416  -7.066  -8.657  1.00 62.85  ? 315 HIS A O   1 
ATOM   626  C CB  . HIS B 1 5  ? -7.272  -6.640  -5.774  1.00 83.39  ? 315 HIS A CB  1 
ATOM   627  C CG  . HIS B 1 5  ? -8.423  -6.006  -5.058  1.00 99.31  ? 315 HIS A CG  1 
ATOM   628  N ND1 . HIS B 1 5  ? -9.198  -5.017  -5.625  1.00 106.48 ? 315 HIS A ND1 1 
ATOM   629  C CD2 . HIS B 1 5  ? -8.926  -6.214  -3.818  1.00 105.34 ? 315 HIS A CD2 1 
ATOM   630  C CE1 . HIS B 1 5  ? -10.131 -4.646  -4.766  1.00 111.09 ? 315 HIS A CE1 1 
ATOM   631  N NE2 . HIS B 1 5  ? -9.988  -5.356  -3.662  1.00 109.04 ? 315 HIS A NE2 1 
ATOM   632  N N   . HIS B 1 6  ? -5.819  -9.023  -7.721  1.00 64.82  ? 316 HIS A N   1 
ATOM   633  C CA  . HIS B 1 6  ? -4.698  -9.247  -8.628  1.00 66.24  ? 316 HIS A CA  1 
ATOM   634  C C   . HIS B 1 6  ? -4.872  -10.509 -9.465  1.00 62.81  ? 316 HIS A C   1 
ATOM   635  O O   . HIS B 1 6  ? -3.892  -11.020 -10.017 1.00 73.27  ? 316 HIS A O   1 
ATOM   636  C CB  . HIS B 1 6  ? -3.383  -9.299  -7.848  1.00 69.17  ? 316 HIS A CB  1 
ATOM   637  C CG  . HIS B 1 6  ? -3.075  -8.038  -7.103  1.00 77.92  ? 316 HIS A CG  1 
ATOM   638  N ND1 . HIS B 1 6  ? -3.489  -7.819  -5.807  1.00 79.26  ? 316 HIS A ND1 1 
ATOM   639  C CD2 . HIS B 1 6  ? -2.398  -6.926  -7.475  1.00 79.95  ? 316 HIS A CD2 1 
ATOM   640  C CE1 . HIS B 1 6  ? -3.077  -6.628  -5.411  1.00 80.77  ? 316 HIS A CE1 1 
ATOM   641  N NE2 . HIS B 1 6  ? -2.413  -6.065  -6.404  1.00 88.08  ? 316 HIS A NE2 1 
ATOM   642  N N   . HIS B 1 7  ? -6.095  -11.022 -9.574  1.00 59.60  ? 317 HIS A N   1 
ATOM   643  C CA  . HIS B 1 7  ? -6.362  -12.202 -10.382 1.00 58.98  ? 317 HIS A CA  1 
ATOM   644  C C   . HIS B 1 7  ? -7.664  -12.007 -11.143 1.00 60.12  ? 317 HIS A C   1 
ATOM   645  O O   . HIS B 1 7  ? -8.486  -11.152 -10.804 1.00 60.92  ? 317 HIS A O   1 
ATOM   646  C CB  . HIS B 1 7  ? -6.438  -13.472 -9.523  1.00 43.12  ? 317 HIS A CB  1 
ATOM   647  C CG  . HIS B 1 7  ? -5.141  -13.844 -8.875  1.00 53.55  ? 317 HIS A CG  1 
ATOM   648  N ND1 . HIS B 1 7  ? -4.624  -13.160 -7.796  1.00 55.33  ? 317 HIS A ND1 1 
ATOM   649  C CD2 . HIS B 1 7  ? -4.258  -14.833 -9.151  1.00 55.08  ? 317 HIS A CD2 1 
ATOM   650  C CE1 . HIS B 1 7  ? -3.477  -13.709 -7.437  1.00 63.36  ? 317 HIS A CE1 1 
ATOM   651  N NE2 . HIS B 1 7  ? -3.232  -14.726 -8.244  1.00 58.97  ? 317 HIS A NE2 1 
ATOM   652  N N   . HIS B 1 8  ? -7.845  -12.821 -12.180 1.00 61.06  ? 318 HIS A N   1 
ATOM   653  C CA  . HIS B 1 8  ? -9.034  -12.741 -13.015 1.00 56.65  ? 318 HIS A CA  1 
ATOM   654  C C   . HIS B 1 8  ? -9.358  -14.125 -13.556 1.00 44.79  ? 318 HIS A C   1 
ATOM   655  O O   . HIS B 1 8  ? -8.494  -15.002 -13.638 1.00 50.34  ? 318 HIS A O   1 
ATOM   656  C CB  . HIS B 1 8  ? -8.853  -11.741 -14.164 1.00 65.37  ? 318 HIS A CB  1 
ATOM   657  C CG  . HIS B 1 8  ? -7.755  -12.104 -15.115 1.00 67.25  ? 318 HIS A CG  1 
ATOM   658  N ND1 . HIS B 1 8  ? -6.444  -11.729 -14.916 1.00 62.12  ? 318 HIS A ND1 1 
ATOM   659  C CD2 . HIS B 1 8  ? -7.773  -12.806 -16.272 1.00 60.73  ? 318 HIS A CD2 1 
ATOM   660  C CE1 . HIS B 1 8  ? -5.702  -12.185 -15.909 1.00 60.37  ? 318 HIS A CE1 1 
ATOM   661  N NE2 . HIS B 1 8  ? -6.484  -12.843 -16.745 1.00 61.54  ? 318 HIS A NE2 1 
ATOM   662  N N   . MET B 1 9  ? -10.623 -14.309 -13.923 1.00 43.73  ? 319 MET A N   1 
ATOM   663  C CA  . MET B 1 9  ? -11.099 -15.562 -14.489 1.00 47.86  ? 319 MET A CA  1 
ATOM   664  C C   . MET B 1 9  ? -10.939 -15.530 -16.003 1.00 47.53  ? 319 MET A C   1 
ATOM   665  O O   . MET B 1 9  ? -11.364 -14.573 -16.659 1.00 44.91  ? 319 MET A O   1 
ATOM   666  C CB  . MET B 1 9  ? -12.563 -15.801 -14.115 1.00 54.03  ? 319 MET A CB  1 
ATOM   667  C CG  . MET B 1 9  ? -12.774 -16.231 -12.673 1.00 79.76  ? 319 MET A CG  1 
ATOM   668  S SD  . MET B 1 9  ? -12.256 -17.931 -12.365 1.00 90.79  ? 319 MET A SD  1 
ATOM   669  C CE  . MET B 1 9  ? -13.727 -18.823 -12.859 1.00 96.63  ? 319 MET A CE  1 
ATOM   670  N N   . SER B 1 10 ? -10.324 -16.576 -16.555 1.00 41.53  ? 320 SER A N   1 
ATOM   671  C CA  . SER B 1 10 ? -10.139 -16.655 -17.992 1.00 56.32  ? 320 SER A CA  1 
ATOM   672  C C   . SER B 1 10 ? -10.770 -17.930 -18.535 1.00 57.26  ? 320 SER A C   1 
ATOM   673  O O   . SER B 1 10 ? -10.659 -18.991 -17.910 1.00 40.66  ? 320 SER A O   1 
ATOM   674  C CB  . SER B 1 10 ? -8.648  -16.628 -18.359 1.00 53.20  ? 320 SER A CB  1 
ATOM   675  O OG  . SER B 1 10 ? -8.056  -15.391 -18.005 1.00 64.06  ? 320 SER A OG  1 
ATOM   676  N N   . PRO B 1 11 ? -11.437 -17.862 -19.686 1.00 60.97  ? 321 PRO A N   1 
ATOM   677  C CA  . PRO B 1 11 ? -12.020 -19.077 -20.267 1.00 61.88  ? 321 PRO A CA  1 
ATOM   678  C C   . PRO B 1 11 ? -10.939 -20.019 -20.771 1.00 62.19  ? 321 PRO A C   1 
ATOM   679  O O   . PRO B 1 11 ? -9.914  -19.589 -21.304 1.00 50.18  ? 321 PRO A O   1 
ATOM   680  C CB  . PRO B 1 11 ? -12.879 -18.545 -21.422 1.00 51.32  ? 321 PRO A CB  1 
ATOM   681  C CG  . PRO B 1 11 ? -13.007 -17.064 -21.181 1.00 58.79  ? 321 PRO A CG  1 
ATOM   682  C CD  . PRO B 1 11 ? -11.751 -16.664 -20.479 1.00 58.44  ? 321 PRO A CD  1 
ATOM   683  N N   . ASN B 1 12 ? -11.173 -21.316 -20.590 1.00 56.85  ? 322 ASN A N   1 
ATOM   684  C CA  . ASN B 1 12 ? -10.224 -22.297 -21.085 1.00 54.13  ? 322 ASN A CA  1 
ATOM   685  C C   . ASN B 1 12 ? -10.307 -22.397 -22.606 1.00 53.60  ? 322 ASN A C   1 
ATOM   686  O O   . ASN B 1 12 ? -11.327 -22.081 -23.225 1.00 49.35  ? 322 ASN A O   1 
ATOM   687  C CB  . ASN B 1 12 ? -10.483 -23.668 -20.459 1.00 48.40  ? 322 ASN A CB  1 
ATOM   688  C CG  . ASN B 1 12 ? -10.214 -23.690 -18.969 1.00 55.03  ? 322 ASN A CG  1 
ATOM   689  O OD1 . ASN B 1 12 ? -9.582  -22.784 -18.426 1.00 55.90  ? 322 ASN A OD1 1 
ATOM   690  N ND2 . ASN B 1 12 ? -10.690 -24.733 -18.297 1.00 40.58  ? 322 ASN A ND2 1 
ATOM   691  N N   . LEU B 1 13 ? -9.208  -22.840 -23.207 1.00 58.21  ? 323 LEU A N   1 
ATOM   692  C CA  . LEU B 1 13 ? -9.208  -23.139 -24.627 1.00 61.68  ? 323 LEU A CA  1 
ATOM   693  C C   . LEU B 1 13 ? -10.065 -24.374 -24.904 1.00 66.13  ? 323 LEU A C   1 
ATOM   694  O O   . LEU B 1 13 ? -10.273 -25.204 -24.015 1.00 59.56  ? 323 LEU A O   1 
ATOM   695  C CB  . LEU B 1 13 ? -7.783  -23.361 -25.125 1.00 68.33  ? 323 LEU A CB  1 
ATOM   696  C CG  . LEU B 1 13 ? -6.856  -22.156 -24.950 1.00 69.57  ? 323 LEU A CG  1 
ATOM   697  C CD1 . LEU B 1 13 ? -5.447  -22.478 -25.418 1.00 78.93  ? 323 LEU A CD1 1 
ATOM   698  C CD2 . LEU B 1 13 ? -7.409  -20.949 -25.691 1.00 59.42  ? 323 LEU A CD2 1 
ATOM   699  N N   . PRO B 1 14 ? -10.597 -24.504 -26.120 1.00 72.21  ? 324 PRO A N   1 
ATOM   700  C CA  . PRO B 1 14 ? -11.394 -25.692 -26.449 1.00 67.29  ? 324 PRO A CA  1 
ATOM   701  C C   . PRO B 1 14 ? -10.576 -26.961 -26.253 1.00 60.76  ? 324 PRO A C   1 
ATOM   702  O O   . PRO B 1 14 ? -9.442  -27.069 -26.724 1.00 64.15  ? 324 PRO A O   1 
ATOM   703  C CB  . PRO B 1 14 ? -11.767 -25.473 -27.919 1.00 67.55  ? 324 PRO A CB  1 
ATOM   704  C CG  . PRO B 1 14 ? -11.726 -23.994 -28.094 1.00 71.03  ? 324 PRO A CG  1 
ATOM   705  C CD  . PRO B 1 14 ? -10.610 -23.513 -27.210 1.00 73.70  ? 324 PRO A CD  1 
ATOM   706  N N   . GLY B 1 15 ? -11.162 -27.922 -25.541 1.00 53.43  ? 325 GLY A N   1 
ATOM   707  C CA  . GLY B 1 15 ? -10.481 -29.151 -25.208 1.00 54.01  ? 325 GLY A CA  1 
ATOM   708  C C   . GLY B 1 15 ? -9.784  -29.146 -23.864 1.00 56.04  ? 325 GLY A C   1 
ATOM   709  O O   . GLY B 1 15 ? -9.284  -30.196 -23.442 1.00 51.88  ? 325 GLY A O   1 
ATOM   710  N N   . GLN B 1 16 ? -9.719  -28.003 -23.188 1.00 58.36  ? 326 GLN A N   1 
ATOM   711  C CA  . GLN B 1 16 ? -9.088  -27.896 -21.880 1.00 57.52  ? 326 GLN A CA  1 
ATOM   712  C C   . GLN B 1 16 ? -10.149 -27.936 -20.787 1.00 59.70  ? 326 GLN A C   1 
ATOM   713  O O   . GLN B 1 16 ? -11.227 -27.352 -20.932 1.00 60.51  ? 326 GLN A O   1 
ATOM   714  C CB  . GLN B 1 16 ? -8.284  -26.599 -21.772 1.00 62.65  ? 326 GLN A CB  1 
ATOM   715  C CG  . GLN B 1 16 ? -7.089  -26.519 -22.705 1.00 64.35  ? 326 GLN A CG  1 
ATOM   716  C CD  . GLN B 1 16 ? -6.269  -25.262 -22.489 1.00 59.85  ? 326 GLN A CD  1 
ATOM   717  O OE1 . GLN B 1 16 ? -6.579  -24.446 -21.621 1.00 55.76  ? 326 GLN A OE1 1 
ATOM   718  N NE2 . GLN B 1 16 ? -5.213  -25.100 -23.279 1.00 59.98  ? 326 GLN A NE2 1 
ATOM   719  N N   . THR B 1 17 ? -9.838  -28.625 -19.692 1.00 55.99  ? 327 THR A N   1 
ATOM   720  C CA  . THR B 1 17 ? -10.731 -28.720 -18.549 1.00 47.52  ? 327 THR A CA  1 
ATOM   721  C C   . THR B 1 17 ? -10.011 -28.248 -17.292 1.00 42.80  ? 327 THR A C   1 
ATOM   722  O O   . THR B 1 17 ? -8.781  -28.178 -17.245 1.00 48.22  ? 327 THR A O   1 
ATOM   723  C CB  . THR B 1 17 ? -11.242 -30.156 -18.354 1.00 50.75  ? 327 THR A CB  1 
ATOM   724  O OG1 . THR B 1 17 ? -12.196 -30.186 -17.284 1.00 61.26  ? 327 THR A OG1 1 
ATOM   725  C CG2 . THR B 1 17 ? -10.091 -31.093 -18.026 1.00 46.42  ? 327 THR A CG2 1 
ATOM   726  N N   . THR B 1 18 ? -10.795 -27.920 -16.266 1.00 42.44  ? 328 THR A N   1 
ATOM   727  C CA  . THR B 1 18 ? -10.264 -27.495 -14.975 1.00 43.60  ? 328 THR A CA  1 
ATOM   728  C C   . THR B 1 18 ? -10.877 -28.352 -13.879 1.00 45.56  ? 328 THR A C   1 
ATOM   729  O O   . THR B 1 18 ? -12.105 -28.408 -13.749 1.00 50.55  ? 328 THR A O   1 
ATOM   730  C CB  . THR B 1 18 ? -10.548 -26.013 -14.716 1.00 40.22  ? 328 THR A CB  1 
ATOM   731  O OG1 . THR B 1 18 ? -9.977  -25.224 -15.767 1.00 38.11  ? 328 THR A OG1 1 
ATOM   732  C CG2 . THR B 1 18 ? -9.951  -25.580 -13.384 1.00 36.81  ? 328 THR A CG2 1 
ATOM   733  N N   . VAL B 1 19 ? -10.031 -29.017 -13.094 1.00 50.43  ? 329 VAL A N   1 
ATOM   734  C CA  . VAL B 1 19 ? -10.491 -29.847 -11.990 1.00 54.83  ? 329 VAL A CA  1 
ATOM   735  C C   . VAL B 1 19 ? -9.831  -29.361 -10.705 1.00 42.79  ? 329 VAL A C   1 
ATOM   736  O O   . VAL B 1 19 ? -8.827  -28.645 -10.720 1.00 51.89  ? 329 VAL A O   1 
ATOM   737  C CB  . VAL B 1 19 ? -10.198 -31.346 -12.208 1.00 48.94  ? 329 VAL A CB  1 
ATOM   738  C CG1 . VAL B 1 19 ? -10.587 -31.774 -13.618 1.00 44.10  ? 329 VAL A CG1 1 
ATOM   739  C CG2 . VAL B 1 19 ? -8.739  -31.656 -11.908 1.00 50.59  ? 329 VAL A CG2 1 
ATOM   740  N N   . GLN B 1 20 ? -10.419 -29.761 -9.582  1.00 47.18  ? 330 GLN A N   1 
ATOM   741  C CA  . GLN B 1 20 ? -9.913  -29.432 -8.257  1.00 45.49  ? 330 GLN A CA  1 
ATOM   742  C C   . GLN B 1 20 ? -9.272  -30.671 -7.645  1.00 38.94  ? 330 GLN A C   1 
ATOM   743  O O   . GLN B 1 20 ? -9.874  -31.750 -7.648  1.00 41.03  ? 330 GLN A O   1 
ATOM   744  C CB  . GLN B 1 20 ? -11.037 -28.904 -7.364  1.00 47.45  ? 330 GLN A CB  1 
ATOM   745  C CG  . GLN B 1 20 ? -11.611 -27.575 -7.833  1.00 63.86  ? 330 GLN A CG  1 
ATOM   746  C CD  . GLN B 1 20 ? -12.747 -27.084 -6.957  1.00 88.16  ? 330 GLN A CD  1 
ATOM   747  O OE1 . GLN B 1 20 ? -12.524 -26.402 -5.957  1.00 97.34  ? 330 GLN A OE1 1 
ATOM   748  N NE2 . GLN B 1 20 ? -13.974 -27.431 -7.329  1.00 96.56  ? 330 GLN A NE2 1 
ATOM   749  N N   . VAL B 1 21 ? -8.058  -30.516 -7.123  1.00 38.47  ? 331 VAL A N   1 
ATOM   750  C CA  . VAL B 1 21 ? -7.316  -31.609 -6.498  1.00 48.68  ? 331 VAL A CA  1 
ATOM   751  C C   . VAL B 1 21 ? -7.051  -31.206 -5.053  1.00 44.23  ? 331 VAL A C   1 
ATOM   752  O O   . VAL B 1 21 ? -6.158  -30.395 -4.778  1.00 44.23  ? 331 VAL A O   1 
ATOM   753  C CB  . VAL B 1 21 ? -6.011  -31.921 -7.237  1.00 40.35  ? 331 VAL A CB  1 
ATOM   754  C CG1 . VAL B 1 21 ? -5.320  -33.121 -6.609  1.00 45.54  ? 331 VAL A CG1 1 
ATOM   755  C CG2 . VAL B 1 21 ? -6.282  -32.167 -8.714  1.00 49.06  ? 331 VAL A CG2 1 
ATOM   756  N N   . ARG B 1 22 ? -7.821  -31.767 -4.125  1.00 39.27  ? 332 ARG A N   1 
ATOM   757  C CA  . ARG B 1 22 ? -7.682  -31.448 -2.712  1.00 46.75  ? 332 ARG A CA  1 
ATOM   758  C C   . ARG B 1 22 ? -6.731  -32.418 -2.022  1.00 47.90  ? 332 ARG A C   1 
ATOM   759  O O   . ARG B 1 22 ? -6.776  -33.629 -2.258  1.00 56.05  ? 332 ARG A O   1 
ATOM   760  C CB  . ARG B 1 22 ? -9.043  -31.465 -2.015  1.00 49.48  ? 332 ARG A CB  1 
ATOM   761  C CG  . ARG B 1 22 ? -8.960  -31.191 -0.524  1.00 53.52  ? 332 ARG A CG  1 
ATOM   762  C CD  . ARG B 1 22 ? -10.277 -30.691 0.033   1.00 52.94  ? 332 ARG A CD  1 
ATOM   763  N NE  . ARG B 1 22 ? -10.117 -30.167 1.386   1.00 54.43  ? 332 ARG A NE  1 
ATOM   764  C CZ  . ARG B 1 22 ? -10.903 -29.242 1.927   1.00 61.41  ? 332 ARG A CZ  1 
ATOM   765  N NH1 . ARG B 1 22 ? -11.906 -28.730 1.227   1.00 67.29  ? 332 ARG A NH1 1 
ATOM   766  N NH2 . ARG B 1 22 ? -10.682 -28.825 3.166   1.00 64.60  ? 332 ARG A NH2 1 
ATOM   767  N N   . VAL B 1 23 ? -5.869  -31.873 -1.170  1.00 42.03  ? 333 VAL A N   1 
ATOM   768  C CA  . VAL B 1 23 ? -4.957  -32.672 -0.353  1.00 41.76  ? 333 VAL A CA  1 
ATOM   769  C C   . VAL B 1 23 ? -5.137  -32.249 1.099   1.00 46.18  ? 333 VAL A C   1 
ATOM   770  O O   . VAL B 1 23 ? -5.680  -31.169 1.381   1.00 50.19  ? 333 VAL A O   1 
ATOM   771  C CB  . VAL B 1 23 ? -3.486  -32.499 -0.801  1.00 39.27  ? 333 VAL A CB  1 
ATOM   772  C CG1 . VAL B 1 23 ? -3.313  -32.928 -2.249  1.00 39.40  ? 333 VAL A CG1 1 
ATOM   773  C CG2 . VAL B 1 23 ? -3.034  -31.059 -0.601  1.00 37.67  ? 333 VAL A CG2 1 
ATOM   774  N N   . PRO B 1 24 ? -4.716  -33.088 2.048   1.00 45.81  ? 334 PRO A N   1 
ATOM   775  C CA  . PRO B 1 24 ? -4.680  -32.640 3.445   1.00 49.18  ? 334 PRO A CA  1 
ATOM   776  C C   . PRO B 1 24 ? -3.791  -31.415 3.601   1.00 51.07  ? 334 PRO A C   1 
ATOM   777  O O   . PRO B 1 24 ? -2.779  -31.262 2.915   1.00 42.10  ? 334 PRO A O   1 
ATOM   778  C CB  . PRO B 1 24 ? -4.116  -33.852 4.201   1.00 44.43  ? 334 PRO A CB  1 
ATOM   779  C CG  . PRO B 1 24 ? -3.595  -34.785 3.149   1.00 49.10  ? 334 PRO A CG  1 
ATOM   780  C CD  . PRO B 1 24 ? -4.403  -34.520 1.923   1.00 46.31  ? 334 PRO A CD  1 
ATOM   781  N N   . TYR B 1 25 ? -4.191  -30.530 4.518   1.00 53.84  ? 335 TYR A N   1 
ATOM   782  C CA  . TYR B 1 25 ? -3.502  -29.251 4.666   1.00 54.62  ? 335 TYR A CA  1 
ATOM   783  C C   . TYR B 1 25 ? -2.054  -29.426 5.106   1.00 55.79  ? 335 TYR A C   1 
ATOM   784  O O   . TYR B 1 25 ? -1.208  -28.577 4.804   1.00 53.29  ? 335 TYR A O   1 
ATOM   785  C CB  . TYR B 1 25 ? -4.247  -28.360 5.660   1.00 41.00  ? 335 TYR A CB  1 
ATOM   786  C CG  . TYR B 1 25 ? -3.634  -26.986 5.805   1.00 40.66  ? 335 TYR A CG  1 
ATOM   787  C CD1 . TYR B 1 25 ? -2.912  -26.640 6.940   1.00 41.95  ? 335 TYR A CD1 1 
ATOM   788  C CD2 . TYR B 1 25 ? -3.758  -26.042 4.794   1.00 39.46  ? 335 TYR A CD2 1 
ATOM   789  C CE1 . TYR B 1 25 ? -2.345  -25.386 7.069   1.00 54.04  ? 335 TYR A CE1 1 
ATOM   790  C CE2 . TYR B 1 25 ? -3.195  -24.787 4.914   1.00 50.48  ? 335 TYR A CE2 1 
ATOM   791  C CZ  . TYR B 1 25 ? -2.490  -24.464 6.053   1.00 57.12  ? 335 TYR A CZ  1 
ATOM   792  O OH  . TYR B 1 25 ? -1.928  -23.213 6.174   1.00 59.73  ? 335 TYR A OH  1 
ATOM   793  N N   . ARG B 1 26 ? -1.750  -30.508 5.824   1.00 42.06  ? 336 ARG A N   1 
ATOM   794  C CA  . ARG B 1 26 ? -0.401  -30.711 6.336   1.00 51.62  ? 336 ARG A CA  1 
ATOM   795  C C   . ARG B 1 26 ? 0.607   -31.011 5.234   1.00 57.72  ? 336 ARG A C   1 
ATOM   796  O O   . ARG B 1 26 ? 1.807   -30.800 5.438   1.00 66.01  ? 336 ARG A O   1 
ATOM   797  C CB  . ARG B 1 26 ? -0.408  -31.849 7.358   1.00 55.91  ? 336 ARG A CB  1 
ATOM   798  C CG  . ARG B 1 26 ? 0.778   -31.858 8.306   1.00 58.29  ? 336 ARG A CG  1 
ATOM   799  C CD  . ARG B 1 26 ? 0.764   -33.101 9.180   1.00 61.17  ? 336 ARG A CD  1 
ATOM   800  N NE  . ARG B 1 26 ? -0.458  -33.205 9.974   1.00 65.87  ? 336 ARG A NE  1 
ATOM   801  C CZ  . ARG B 1 26 ? -0.592  -32.741 11.213  1.00 72.09  ? 336 ARG A CZ  1 
ATOM   802  N NH1 . ARG B 1 26 ? 0.424   -32.136 11.813  1.00 73.47  ? 336 ARG A NH1 1 
ATOM   803  N NH2 . ARG B 1 26 ? -1.744  -32.886 11.854  1.00 73.14  ? 336 ARG A NH2 1 
ATOM   804  N N   . VAL B 1 27 ? 0.152   -31.489 4.076   1.00 53.30  ? 337 VAL A N   1 
ATOM   805  C CA  . VAL B 1 27 ? 1.039   -31.962 3.022   1.00 50.37  ? 337 VAL A CA  1 
ATOM   806  C C   . VAL B 1 27 ? 1.087   -31.003 1.840   1.00 55.53  ? 337 VAL A C   1 
ATOM   807  O O   . VAL B 1 27 ? 1.686   -31.331 0.810   1.00 52.96  ? 337 VAL A O   1 
ATOM   808  C CB  . VAL B 1 27 ? 0.654   -33.376 2.560   1.00 54.16  ? 337 VAL A CB  1 
ATOM   809  C CG1 . VAL B 1 27 ? 0.562   -34.308 3.760   1.00 45.14  ? 337 VAL A CG1 1 
ATOM   810  C CG2 . VAL B 1 27 ? -0.647  -33.349 1.773   1.00 58.39  ? 337 VAL A CG2 1 
ATOM   811  N N   . VAL B 1 28 ? 0.449   -29.833 1.948   1.00 71.37  ? 338 VAL A N   1 
ATOM   812  C CA  . VAL B 1 28 ? 0.471   -28.861 0.855   1.00 54.89  ? 338 VAL A CA  1 
ATOM   813  C C   . VAL B 1 28 ? 1.903   -28.489 0.493   1.00 48.62  ? 338 VAL A C   1 
ATOM   814  O O   . VAL B 1 28 ? 2.227   -28.276 -0.682  1.00 47.29  ? 338 VAL A O   1 
ATOM   815  C CB  . VAL B 1 28 ? -0.357  -27.619 1.231   1.00 55.48  ? 338 VAL A CB  1 
ATOM   816  C CG1 . VAL B 1 28 ? -0.400  -26.629 0.075   1.00 36.21  ? 338 VAL A CG1 1 
ATOM   817  C CG2 . VAL B 1 28 ? -1.764  -28.017 1.638   1.00 61.10  ? 338 VAL A CG2 1 
ATOM   818  N N   . GLY B 1 29 ? 2.784   -28.412 1.492   1.00 57.85  ? 339 GLY A N   1 
ATOM   819  C CA  . GLY B 1 29 ? 4.175   -28.090 1.223   1.00 55.11  ? 339 GLY A CA  1 
ATOM   820  C C   . GLY B 1 29 ? 4.897   -29.155 0.422   1.00 54.98  ? 339 GLY A C   1 
ATOM   821  O O   . GLY B 1 29 ? 5.825   -28.845 -0.332  1.00 59.07  ? 339 GLY A O   1 
ATOM   822  N N   . LEU B 1 30 ? 4.490   -30.418 0.570   1.00 63.63  ? 340 LEU A N   1 
ATOM   823  C CA  . LEU B 1 30 ? 5.145   -31.494 -0.169  1.00 67.20  ? 340 LEU A CA  1 
ATOM   824  C C   . LEU B 1 30 ? 4.845   -31.412 -1.661  1.00 62.07  ? 340 LEU A C   1 
ATOM   825  O O   . LEU B 1 30 ? 5.723   -31.678 -2.491  1.00 60.73  ? 340 LEU A O   1 
ATOM   826  C CB  . LEU B 1 30 ? 4.715   -32.852 0.386   1.00 65.63  ? 340 LEU A CB  1 
ATOM   827  C CG  . LEU B 1 30 ? 5.097   -33.164 1.833   1.00 73.36  ? 340 LEU A CG  1 
ATOM   828  C CD1 . LEU B 1 30 ? 4.579   -34.536 2.234   1.00 75.33  ? 340 LEU A CD1 1 
ATOM   829  C CD2 . LEU B 1 30 ? 6.604   -33.081 2.019   1.00 83.10  ? 340 LEU A CD2 1 
ATOM   830  N N   . VAL B 1 31 ? 3.613   -31.048 -2.023  1.00 52.69  ? 341 VAL A N   1 
ATOM   831  C CA  . VAL B 1 31 ? 3.270   -30.916 -3.435  1.00 59.39  ? 341 VAL A CA  1 
ATOM   832  C C   . VAL B 1 31 ? 3.936   -29.682 -4.030  1.00 71.84  ? 341 VAL A C   1 
ATOM   833  O O   . VAL B 1 31 ? 4.394   -29.697 -5.179  1.00 76.33  ? 341 VAL A O   1 
ATOM   834  C CB  . VAL B 1 31 ? 1.741   -30.878 -3.611  1.00 58.86  ? 341 VAL A CB  1 
ATOM   835  C CG1 . VAL B 1 31 ? 1.375   -30.745 -5.084  1.00 45.87  ? 341 VAL A CG1 1 
ATOM   836  C CG2 . VAL B 1 31 ? 1.107   -32.123 -3.008  1.00 40.15  ? 341 VAL A CG2 1 
ATOM   837  N N   . VAL B 1 32 ? 4.008   -28.598 -3.256  1.00 67.85  ? 342 VAL A N   1 
ATOM   838  C CA  . VAL B 1 32 ? 4.662   -27.383 -3.731  1.00 60.15  ? 342 VAL A CA  1 
ATOM   839  C C   . VAL B 1 32 ? 6.171   -27.585 -3.803  1.00 68.93  ? 342 VAL A C   1 
ATOM   840  O O   . VAL B 1 32 ? 6.806   -27.291 -4.822  1.00 71.24  ? 342 VAL A O   1 
ATOM   841  C CB  . VAL B 1 32 ? 4.290   -26.192 -2.830  1.00 48.81  ? 342 VAL A CB  1 
ATOM   842  C CG1 . VAL B 1 32 ? 5.070   -24.953 -3.231  1.00 41.63  ? 342 VAL A CG1 1 
ATOM   843  C CG2 . VAL B 1 32 ? 2.794   -25.931 -2.892  1.00 40.41  ? 342 VAL A CG2 1 
ATOM   844  N N   . GLY B 1 33 ? 6.764   -28.100 -2.729  1.00 62.60  ? 343 GLY A N   1 
ATOM   845  C CA  . GLY B 1 33 ? 8.186   -28.339 -2.687  1.00 54.94  ? 343 GLY A CA  1 
ATOM   846  C C   . GLY B 1 33 ? 8.959   -27.090 -2.320  1.00 64.46  ? 343 GLY A C   1 
ATOM   847  O O   . GLY B 1 33 ? 8.384   -26.019 -2.097  1.00 57.28  ? 343 GLY A O   1 
ATOM   848  N N   . PRO B 1 34 ? 10.287  -27.203 -2.250  1.00 74.81  ? 344 PRO A N   1 
ATOM   849  C CA  . PRO B 1 34 ? 11.117  -26.042 -1.892  1.00 76.21  ? 344 PRO A CA  1 
ATOM   850  C C   . PRO B 1 34 ? 11.033  -24.966 -2.965  1.00 80.59  ? 344 PRO A C   1 
ATOM   851  O O   . PRO B 1 34 ? 11.410  -25.191 -4.117  1.00 83.79  ? 344 PRO A O   1 
ATOM   852  C CB  . PRO B 1 34 ? 12.529  -26.633 -1.790  1.00 77.52  ? 344 PRO A CB  1 
ATOM   853  C CG  . PRO B 1 34 ? 12.485  -27.861 -2.641  1.00 82.53  ? 344 PRO A CG  1 
ATOM   854  C CD  . PRO B 1 34 ? 11.095  -28.410 -2.492  1.00 77.36  ? 344 PRO A CD  1 
ATOM   855  N N   . LYS B 1 35 ? 10.529  -23.792 -2.576  1.00 74.24  ? 345 LYS A N   1 
ATOM   856  C CA  . LYS B 1 35 ? 10.369  -22.651 -3.478  1.00 77.04  ? 345 LYS A CA  1 
ATOM   857  C C   . LYS B 1 35 ? 9.491   -22.992 -4.681  1.00 75.67  ? 345 LYS A C   1 
ATOM   858  O O   . LYS B 1 35 ? 9.640   -22.407 -5.757  1.00 75.10  ? 345 LYS A O   1 
ATOM   859  C CB  . LYS B 1 35 ? 11.727  -22.113 -3.943  1.00 78.82  ? 345 LYS A CB  1 
ATOM   860  N N   . GLY B 1 36 ? 8.567   -23.935 -4.509  1.00 77.01  ? 346 GLY A N   1 
ATOM   861  C CA  . GLY B 1 36 ? 7.678   -24.315 -5.588  1.00 76.93  ? 346 GLY A CA  1 
ATOM   862  C C   . GLY B 1 36 ? 8.302   -25.162 -6.671  1.00 71.94  ? 346 GLY A C   1 
ATOM   863  O O   . GLY B 1 36 ? 7.742   -25.253 -7.767  1.00 71.16  ? 346 GLY A O   1 
ATOM   864  N N   . ALA B 1 37 ? 9.448   -25.790 -6.400  1.00 67.80  ? 347 ALA A N   1 
ATOM   865  C CA  . ALA B 1 37 ? 10.136  -26.554 -7.436  1.00 64.90  ? 347 ALA A CA  1 
ATOM   866  C C   . ALA B 1 37 ? 9.375   -27.823 -7.802  1.00 66.83  ? 347 ALA A C   1 
ATOM   867  O O   . ALA B 1 37 ? 9.374   -28.236 -8.967  1.00 79.91  ? 347 ALA A O   1 
ATOM   868  C CB  . ALA B 1 37 ? 11.555  -26.893 -6.981  1.00 58.29  ? 347 ALA A CB  1 
ATOM   869  N N   . THR B 1 38 ? 8.723   -28.457 -6.824  1.00 61.63  ? 348 THR A N   1 
ATOM   870  C CA  . THR B 1 38 ? 8.030   -29.713 -7.096  1.00 60.85  ? 348 THR A CA  1 
ATOM   871  C C   . THR B 1 38 ? 6.784   -29.489 -7.945  1.00 56.60  ? 348 THR A C   1 
ATOM   872  O O   . THR B 1 38 ? 6.565   -30.192 -8.939  1.00 55.17  ? 348 THR A O   1 
ATOM   873  C CB  . THR B 1 38 ? 7.669   -30.412 -5.784  1.00 62.33  ? 348 THR A CB  1 
ATOM   874  O OG1 . THR B 1 38 ? 8.864   -30.691 -5.044  1.00 68.15  ? 348 THR A OG1 1 
ATOM   875  C CG2 . THR B 1 38 ? 6.937   -31.718 -6.061  1.00 48.96  ? 348 THR A CG2 1 
ATOM   876  N N   . ILE B 1 39 ? 5.954   -28.512 -7.571  1.00 57.33  ? 349 ILE A N   1 
ATOM   877  C CA  . ILE B 1 39 ? 4.729   -28.260 -8.325  1.00 47.51  ? 349 ILE A CA  1 
ATOM   878  C C   . ILE B 1 39 ? 5.043   -27.668 -9.693  1.00 52.15  ? 349 ILE A C   1 
ATOM   879  O O   . ILE B 1 39 ? 4.288   -27.869 -10.653 1.00 51.09  ? 349 ILE A O   1 
ATOM   880  C CB  . ILE B 1 39 ? 3.774   -27.359 -7.517  1.00 40.77  ? 349 ILE A CB  1 
ATOM   881  C CG1 . ILE B 1 39 ? 2.409   -27.271 -8.204  1.00 48.72  ? 349 ILE A CG1 1 
ATOM   882  C CG2 . ILE B 1 39 ? 4.371   -25.975 -7.318  1.00 43.45  ? 349 ILE A CG2 1 
ATOM   883  C CD1 . ILE B 1 39 ? 1.705   -28.603 -8.337  1.00 55.66  ? 349 ILE A CD1 1 
ATOM   884  N N   . LYS B 1 40 ? 6.158   -26.944 -9.819  1.00 54.51  ? 350 LYS A N   1 
ATOM   885  C CA  . LYS B 1 40 ? 6.542   -26.421 -11.125 1.00 52.51  ? 350 LYS A CA  1 
ATOM   886  C C   . LYS B 1 40 ? 6.970   -27.546 -12.058 1.00 56.51  ? 350 LYS A C   1 
ATOM   887  O O   . LYS B 1 40 ? 6.724   -27.485 -13.268 1.00 50.12  ? 350 LYS A O   1 
ATOM   888  C CB  . LYS B 1 40 ? 7.663   -25.393 -10.975 1.00 54.07  ? 350 LYS A CB  1 
ATOM   889  N N   . ARG B 1 41 ? 7.616   -28.579 -11.518 1.00 51.25  ? 351 ARG A N   1 
ATOM   890  C CA  . ARG B 1 41 ? 8.000   -29.712 -12.351 1.00 63.59  ? 351 ARG A CA  1 
ATOM   891  C C   . ARG B 1 41 ? 6.786   -30.534 -12.770 1.00 61.10  ? 351 ARG A C   1 
ATOM   892  O O   . ARG B 1 41 ? 6.767   -31.089 -13.875 1.00 62.55  ? 351 ARG A O   1 
ATOM   893  C CB  . ARG B 1 41 ? 9.031   -30.569 -11.618 1.00 71.00  ? 351 ARG A CB  1 
ATOM   894  C CG  . ARG B 1 41 ? 9.424   -31.834 -12.347 1.00 78.10  ? 351 ARG A CG  1 
ATOM   895  C CD  . ARG B 1 41 ? 10.022  -31.485 -13.697 1.00 94.52  ? 351 ARG A CD  1 
ATOM   896  N NE  . ARG B 1 41 ? 10.545  -32.655 -14.388 1.00 110.44 ? 351 ARG A NE  1 
ATOM   897  C CZ  . ARG B 1 41 ? 11.782  -33.107 -14.226 1.00 123.17 ? 351 ARG A CZ  1 
ATOM   898  N NH1 . ARG B 1 41 ? 12.609  -32.473 -13.406 1.00 136.36 ? 351 ARG A NH1 1 
ATOM   899  N NH2 . ARG B 1 41 ? 12.194  -34.178 -14.886 1.00 121.36 ? 351 ARG A NH2 1 
ATOM   900  N N   . ILE B 1 42 ? 5.770   -30.626 -11.907 1.00 60.85  ? 352 ILE A N   1 
ATOM   901  C CA  . ILE B 1 42 ? 4.551   -31.348 -12.263 1.00 56.78  ? 352 ILE A CA  1 
ATOM   902  C C   . ILE B 1 42 ? 3.842   -30.661 -13.425 1.00 53.61  ? 352 ILE A C   1 
ATOM   903  O O   . ILE B 1 42 ? 3.308   -31.322 -14.325 1.00 49.58  ? 352 ILE A O   1 
ATOM   904  C CB  . ILE B 1 42 ? 3.632   -31.483 -11.035 1.00 52.56  ? 352 ILE A CB  1 
ATOM   905  C CG1 . ILE B 1 42 ? 4.285   -32.371 -9.975  1.00 48.55  ? 352 ILE A CG1 1 
ATOM   906  C CG2 . ILE B 1 42 ? 2.274   -32.045 -11.433 1.00 51.97  ? 352 ILE A CG2 1 
ATOM   907  C CD1 . ILE B 1 42 ? 3.427   -32.589 -8.749  1.00 49.04  ? 352 ILE A CD1 1 
ATOM   908  N N   . GLN B 1 43 ? 3.827   -29.325 -13.428 1.00 45.69  ? 353 GLN A N   1 
ATOM   909  C CA  . GLN B 1 43 ? 3.201   -28.598 -14.529 1.00 49.93  ? 353 GLN A CA  1 
ATOM   910  C C   . GLN B 1 43 ? 3.945   -28.830 -15.837 1.00 48.13  ? 353 GLN A C   1 
ATOM   911  O O   . GLN B 1 43 ? 3.323   -28.997 -16.892 1.00 48.51  ? 353 GLN A O   1 
ATOM   912  C CB  . GLN B 1 43 ? 3.147   -27.102 -14.217 1.00 47.94  ? 353 GLN A CB  1 
ATOM   913  C CG  . GLN B 1 43 ? 2.301   -26.729 -13.017 1.00 58.38  ? 353 GLN A CG  1 
ATOM   914  C CD  . GLN B 1 43 ? 2.288   -25.233 -12.765 1.00 69.50  ? 353 GLN A CD  1 
ATOM   915  O OE1 . GLN B 1 43 ? 1.566   -24.487 -13.426 1.00 52.22  ? 353 GLN A OE1 1 
ATOM   916  N NE2 . GLN B 1 43 ? 3.093   -24.787 -11.807 1.00 79.63  ? 353 GLN A NE2 1 
ATOM   917  N N   . GLN B 1 44 ? 5.278   -28.842 -15.785 1.00 50.73  ? 354 GLN A N   1 
ATOM   918  C CA  . GLN B 1 44 ? 6.068   -29.039 -16.996 1.00 59.18  ? 354 GLN A CA  1 
ATOM   919  C C   . GLN B 1 44 ? 5.963   -30.473 -17.502 1.00 56.33  ? 354 GLN A C   1 
ATOM   920  O O   . GLN B 1 44 ? 5.871   -30.703 -18.713 1.00 63.46  ? 354 GLN A O   1 
ATOM   921  C CB  . GLN B 1 44 ? 7.526   -28.665 -16.734 1.00 71.28  ? 354 GLN A CB  1 
ATOM   922  C CG  . GLN B 1 44 ? 7.736   -27.197 -16.399 1.00 84.86  ? 354 GLN A CG  1 
ATOM   923  C CD  . GLN B 1 44 ? 9.180   -26.875 -16.070 1.00 103.11 ? 354 GLN A CD  1 
ATOM   924  O OE1 . GLN B 1 44 ? 9.969   -27.763 -15.746 1.00 117.71 ? 354 GLN A OE1 1 
ATOM   925  N NE2 . GLN B 1 44 ? 9.535   -25.598 -16.154 1.00 98.38  ? 354 GLN A NE2 1 
ATOM   926  N N   . GLN B 1 45 ? 5.969   -31.449 -16.591 1.00 69.61  ? 355 GLN A N   1 
ATOM   927  C CA  . GLN B 1 45 ? 5.960   -32.846 -17.012 1.00 66.69  ? 355 GLN A CA  1 
ATOM   928  C C   . GLN B 1 45 ? 4.607   -33.260 -17.575 1.00 70.07  ? 355 GLN A C   1 
ATOM   929  O O   . GLN B 1 45 ? 4.545   -34.113 -18.468 1.00 60.60  ? 355 GLN A O   1 
ATOM   930  C CB  . GLN B 1 45 ? 6.344   -33.751 -15.841 1.00 59.66  ? 355 GLN A CB  1 
ATOM   931  N N   . THR B 1 46 ? 3.521   -32.676 -17.075 1.00 62.56  ? 356 THR A N   1 
ATOM   932  C CA  . THR B 1 46 ? 2.180   -33.015 -17.530 1.00 61.35  ? 356 THR A CA  1 
ATOM   933  C C   . THR B 1 46 ? 1.596   -31.980 -18.481 1.00 58.19  ? 356 THR A C   1 
ATOM   934  O O   . THR B 1 46 ? 0.472   -32.167 -18.956 1.00 51.39  ? 356 THR A O   1 
ATOM   935  C CB  . THR B 1 46 ? 1.241   -33.195 -16.332 1.00 59.96  ? 356 THR A CB  1 
ATOM   936  O OG1 . THR B 1 46 ? 1.165   -31.969 -15.593 1.00 47.32  ? 356 THR A OG1 1 
ATOM   937  C CG2 . THR B 1 46 ? 1.745   -34.307 -15.422 1.00 51.91  ? 356 THR A CG2 1 
ATOM   938  N N   . HIS B 1 47 ? 2.330   -30.904 -18.772 1.00 55.98  ? 357 HIS A N   1 
ATOM   939  C CA  . HIS B 1 47 ? 1.878   -29.855 -19.688 1.00 53.17  ? 357 HIS A CA  1 
ATOM   940  C C   . HIS B 1 47 ? 0.524   -29.292 -19.256 1.00 60.77  ? 357 HIS A C   1 
ATOM   941  O O   . HIS B 1 47 ? -0.410  -29.166 -20.051 1.00 54.01  ? 357 HIS A O   1 
ATOM   942  C CB  . HIS B 1 47 ? 1.828   -30.368 -21.129 1.00 54.11  ? 357 HIS A CB  1 
ATOM   943  C CG  . HIS B 1 47 ? 3.133   -30.910 -21.622 1.00 62.21  ? 357 HIS A CG  1 
ATOM   944  N ND1 . HIS B 1 47 ? 3.370   -32.259 -21.774 1.00 62.69  ? 357 HIS A ND1 1 
ATOM   945  C CD2 . HIS B 1 47 ? 4.275   -30.283 -21.992 1.00 60.03  ? 357 HIS A CD2 1 
ATOM   946  C CE1 . HIS B 1 47 ? 4.601   -32.439 -22.218 1.00 66.40  ? 357 HIS A CE1 1 
ATOM   947  N NE2 . HIS B 1 47 ? 5.171   -31.256 -22.359 1.00 71.43  ? 357 HIS A NE2 1 
ATOM   948  N N   . THR B 1 48 ? 0.424   -28.951 -17.976 1.00 45.56  ? 358 THR A N   1 
ATOM   949  C CA  . THR B 1 48 ? -0.800  -28.424 -17.397 1.00 52.29  ? 358 THR A CA  1 
ATOM   950  C C   . THR B 1 48 ? -0.524  -27.086 -16.725 1.00 47.15  ? 358 THR A C   1 
ATOM   951  O O   . THR B 1 48 ? 0.623   -26.732 -16.437 1.00 46.72  ? 358 THR A O   1 
ATOM   952  C CB  . THR B 1 48 ? -1.404  -29.396 -16.373 1.00 55.77  ? 358 THR A CB  1 
ATOM   953  O OG1 . THR B 1 48 ? -0.453  -29.651 -15.332 1.00 42.15  ? 358 THR A OG1 1 
ATOM   954  C CG2 . THR B 1 48 ? -1.789  -30.707 -17.040 1.00 61.45  ? 358 THR A CG2 1 
ATOM   955  N N   . TYR B 1 49 ? -1.599  -26.346 -16.478 1.00 40.40  ? 359 TYR A N   1 
ATOM   956  C CA  . TYR B 1 49 ? -1.547  -25.089 -15.746 1.00 45.10  ? 359 TYR A CA  1 
ATOM   957  C C   . TYR B 1 49 ? -2.178  -25.319 -14.381 1.00 40.64  ? 359 TYR A C   1 
ATOM   958  O O   . TYR B 1 49 ? -3.374  -25.616 -14.289 1.00 40.95  ? 359 TYR A O   1 
ATOM   959  C CB  . TYR B 1 49 ? -2.272  -23.982 -16.513 1.00 38.23  ? 359 TYR A CB  1 
ATOM   960  C CG  . TYR B 1 49 ? -2.405  -22.674 -15.765 1.00 48.96  ? 359 TYR A CG  1 
ATOM   961  C CD1 . TYR B 1 49 ? -3.615  -22.298 -15.195 1.00 40.72  ? 359 TYR A CD1 1 
ATOM   962  C CD2 . TYR B 1 49 ? -1.324  -21.812 -15.636 1.00 58.63  ? 359 TYR A CD2 1 
ATOM   963  C CE1 . TYR B 1 49 ? -3.744  -21.102 -14.516 1.00 44.01  ? 359 TYR A CE1 1 
ATOM   964  C CE2 . TYR B 1 49 ? -1.443  -20.613 -14.956 1.00 58.07  ? 359 TYR A CE2 1 
ATOM   965  C CZ  . TYR B 1 49 ? -2.655  -20.264 -14.398 1.00 54.80  ? 359 TYR A CZ  1 
ATOM   966  O OH  . TYR B 1 49 ? -2.780  -19.072 -13.721 1.00 53.80  ? 359 TYR A OH  1 
ATOM   967  N N   . ILE B 1 50 ? -1.374  -25.190 -13.330 1.00 38.92  ? 360 ILE A N   1 
ATOM   968  C CA  . ILE B 1 50 ? -1.786  -25.516 -11.971 1.00 46.96  ? 360 ILE A CA  1 
ATOM   969  C C   . ILE B 1 50 ? -1.652  -24.268 -11.113 1.00 34.76  ? 360 ILE A C   1 
ATOM   970  O O   . ILE B 1 50 ? -0.586  -23.642 -11.082 1.00 43.25  ? 360 ILE A O   1 
ATOM   971  C CB  . ILE B 1 50 ? -0.952  -26.670 -11.384 1.00 42.79  ? 360 ILE A CB  1 
ATOM   972  C CG1 . ILE B 1 50 ? -1.117  -27.935 -12.228 1.00 43.34  ? 360 ILE A CG1 1 
ATOM   973  C CG2 . ILE B 1 50 ? -1.347  -26.935 -9.937  1.00 36.24  ? 360 ILE A CG2 1 
ATOM   974  C CD1 . ILE B 1 50 ? -0.284  -29.104 -11.742 1.00 45.55  ? 360 ILE A CD1 1 
ATOM   975  N N   . VAL B 1 51 ? -2.727  -23.913 -10.418 1.00 42.99  ? 361 VAL A N   1 
ATOM   976  C CA  . VAL B 1 51 ? -2.720  -22.807 -9.471  1.00 38.45  ? 361 VAL A CA  1 
ATOM   977  C C   . VAL B 1 51 ? -2.535  -23.386 -8.077  1.00 33.41  ? 361 VAL A C   1 
ATOM   978  O O   . VAL B 1 51 ? -3.307  -24.251 -7.645  1.00 32.98  ? 361 VAL A O   1 
ATOM   979  C CB  . VAL B 1 51 ? -4.012  -21.980 -9.559  1.00 47.41  ? 361 VAL A CB  1 
ATOM   980  C CG1 . VAL B 1 51 ? -4.024  -20.900 -8.488  1.00 33.93  ? 361 VAL A CG1 1 
ATOM   981  C CG2 . VAL B 1 51 ? -4.156  -21.368 -10.944 1.00 49.26  ? 361 VAL A CG2 1 
ATOM   982  N N   . THR B 1 52 ? -1.514  -22.916 -7.379  1.00 41.58  ? 362 THR A N   1 
ATOM   983  C CA  . THR B 1 52 ? -1.264  -23.373 -6.020  1.00 41.96  ? 362 THR A CA  1 
ATOM   984  C C   . THR B 1 52 ? -2.119  -22.568 -5.047  1.00 43.14  ? 362 THR A C   1 
ATOM   985  O O   . THR B 1 52 ? -2.178  -21.339 -5.157  1.00 34.59  ? 362 THR A O   1 
ATOM   986  C CB  . THR B 1 52 ? 0.217   -23.225 -5.673  1.00 48.97  ? 362 THR A CB  1 
ATOM   987  O OG1 . THR B 1 52 ? 0.983   -24.180 -6.419  1.00 45.58  ? 362 THR A OG1 1 
ATOM   988  C CG2 . THR B 1 52 ? 0.455   -23.442 -4.185  1.00 47.62  ? 362 THR A CG2 1 
ATOM   989  N N   . PRO B 1 53 ? -2.798  -23.214 -4.102  1.00 43.91  ? 363 PRO A N   1 
ATOM   990  C CA  . PRO B 1 53 ? -3.595  -22.462 -3.128  1.00 34.17  ? 363 PRO A CA  1 
ATOM   991  C C   . PRO B 1 53 ? -2.709  -21.593 -2.251  1.00 38.66  ? 363 PRO A C   1 
ATOM   992  O O   . PRO B 1 53 ? -1.513  -21.842 -2.081  1.00 35.69  ? 363 PRO A O   1 
ATOM   993  C CB  . PRO B 1 53 ? -4.293  -23.556 -2.312  1.00 34.10  ? 363 PRO A CB  1 
ATOM   994  C CG  . PRO B 1 53 ? -3.433  -24.766 -2.489  1.00 42.48  ? 363 PRO A CG  1 
ATOM   995  C CD  . PRO B 1 53 ? -2.893  -24.668 -3.887  1.00 36.39  ? 363 PRO A CD  1 
ATOM   996  N N   . SER B 1 54 ? -3.320  -20.554 -1.689  1.00 54.60  ? 364 SER A N   1 
ATOM   997  C CA  . SER B 1 54 ? -2.583  -19.592 -0.884  1.00 60.57  ? 364 SER A CA  1 
ATOM   998  C C   . SER B 1 54 ? -2.124  -20.235 0.426   1.00 62.95  ? 364 SER A C   1 
ATOM   999  O O   . SER B 1 54 ? -2.323  -21.428 0.675   1.00 85.52  ? 364 SER A O   1 
ATOM   1000 C CB  . SER B 1 54 ? -3.438  -18.353 -0.624  1.00 57.32  ? 364 SER A CB  1 
ATOM   1001 O OG  . SER B 1 54 ? -3.720  -17.670 -1.833  1.00 46.10  ? 364 SER A OG  1 
ATOM   1002 N N   . ARG B 1 55 ? -1.494  -19.420 1.274   1.00 59.92  ? 365 ARG A N   1 
ATOM   1003 C CA  . ARG B 1 55 ? -0.845  -19.943 2.473   1.00 69.98  ? 365 ARG A CA  1 
ATOM   1004 C C   . ARG B 1 55 ? -1.852  -20.592 3.415   1.00 72.30  ? 365 ARG A C   1 
ATOM   1005 O O   . ARG B 1 55 ? -1.673  -21.740 3.838   1.00 71.22  ? 365 ARG A O   1 
ATOM   1006 C CB  . ARG B 1 55 ? -0.085  -18.823 3.184   1.00 72.42  ? 365 ARG A CB  1 
ATOM   1007 N N   . ASP B 1 56 ? -2.919  -19.873 3.758   1.00 62.96  ? 366 ASP A N   1 
ATOM   1008 C CA  . ASP B 1 56 ? -3.884  -20.339 4.747   1.00 58.01  ? 366 ASP A CA  1 
ATOM   1009 C C   . ASP B 1 56 ? -5.281  -20.513 4.157   1.00 56.36  ? 366 ASP A C   1 
ATOM   1010 O O   . ASP B 1 56 ? -6.280  -20.385 4.868   1.00 50.07  ? 366 ASP A O   1 
ATOM   1011 C CB  . ASP B 1 56 ? -3.919  -19.392 5.944   1.00 52.25  ? 366 ASP A CB  1 
ATOM   1012 C CG  . ASP B 1 56 ? -2.577  -19.293 6.641   1.00 58.94  ? 366 ASP A CG  1 
ATOM   1013 O OD1 . ASP B 1 56 ? -1.827  -18.336 6.352   1.00 61.84  ? 366 ASP A OD1 1 
ATOM   1014 O OD2 . ASP B 1 56 ? -2.264  -20.182 7.460   1.00 51.62  ? 366 ASP A OD2 1 
ATOM   1015 N N   . LYS B 1 57 ? -5.370  -20.799 2.862   1.00 57.23  ? 367 LYS A N   1 
ATOM   1016 C CA  . LYS B 1 57 ? -6.649  -21.055 2.222   1.00 39.87  ? 367 LYS A CA  1 
ATOM   1017 C C   . LYS B 1 57 ? -6.891  -22.562 2.145   1.00 41.69  ? 367 LYS A C   1 
ATOM   1018 O O   . LYS B 1 57 ? -6.080  -23.373 2.600   1.00 38.67  ? 367 LYS A O   1 
ATOM   1019 C CB  . LYS B 1 57 ? -6.693  -20.413 0.834   1.00 39.02  ? 367 LYS A CB  1 
ATOM   1020 N N   . GLU B 1 58 ? -8.026  -22.937 1.564   1.00 44.87  ? 368 GLU A N   1 
ATOM   1021 C CA  . GLU B 1 58 ? -8.366  -24.348 1.443   1.00 46.79  ? 368 GLU A CA  1 
ATOM   1022 C C   . GLU B 1 58 ? -7.333  -25.063 0.574   1.00 46.78  ? 368 GLU A C   1 
ATOM   1023 O O   . GLU B 1 58 ? -6.958  -24.548 -0.490  1.00 48.14  ? 368 GLU A O   1 
ATOM   1024 C CB  . GLU B 1 58 ? -9.774  -24.525 0.875   1.00 51.98  ? 368 GLU A CB  1 
ATOM   1025 C CG  . GLU B 1 58 ? -10.125 -23.618 -0.285  1.00 72.91  ? 368 GLU A CG  1 
ATOM   1026 C CD  . GLU B 1 58 ? -11.493 -23.931 -0.860  1.00 85.77  ? 368 GLU A CD  1 
ATOM   1027 O OE1 . GLU B 1 58 ? -12.164 -24.843 -0.332  1.00 90.53  ? 368 GLU A OE1 1 
ATOM   1028 O OE2 . GLU B 1 58 ? -11.897 -23.268 -1.837  1.00 95.81  ? 368 GLU A OE2 1 
ATOM   1029 N N   . PRO B 1 59 ? -6.849  -26.233 0.989   1.00 47.45  ? 369 PRO A N   1 
ATOM   1030 C CA  . PRO B 1 59 ? -5.788  -26.924 0.241   1.00 42.72  ? 369 PRO A CA  1 
ATOM   1031 C C   . PRO B 1 59 ? -6.268  -27.565 -1.050  1.00 45.31  ? 369 PRO A C   1 
ATOM   1032 O O   . PRO B 1 59 ? -6.295  -28.796 -1.159  1.00 42.65  ? 369 PRO A O   1 
ATOM   1033 C CB  . PRO B 1 59 ? -5.300  -27.993 1.231   1.00 39.92  ? 369 PRO A CB  1 
ATOM   1034 C CG  . PRO B 1 59 ? -5.951  -27.664 2.550   1.00 46.23  ? 369 PRO A CG  1 
ATOM   1035 C CD  . PRO B 1 59 ? -7.208  -26.946 2.222   1.00 44.64  ? 369 PRO A CD  1 
ATOM   1036 N N   . VAL B 1 60 ? -6.641  -26.752 -2.034  1.00 35.03  ? 370 VAL A N   1 
ATOM   1037 C CA  . VAL B 1 60 ? -7.187  -27.242 -3.294  1.00 34.99  ? 370 VAL A CA  1 
ATOM   1038 C C   . VAL B 1 60 ? -6.329  -26.710 -4.432  1.00 40.46  ? 370 VAL A C   1 
ATOM   1039 O O   . VAL B 1 60 ? -6.140  -25.493 -4.559  1.00 44.19  ? 370 VAL A O   1 
ATOM   1040 C CB  . VAL B 1 60 ? -8.655  -26.826 -3.477  1.00 40.82  ? 370 VAL A CB  1 
ATOM   1041 C CG1 . VAL B 1 60 ? -9.155  -27.240 -4.844  1.00 36.05  ? 370 VAL A CG1 1 
ATOM   1042 C CG2 . VAL B 1 60 ? -9.520  -27.432 -2.380  1.00 37.57  ? 370 VAL A CG2 1 
ATOM   1043 N N   . PHE B 1 61 ? -5.811  -27.620 -5.255  1.00 41.50  ? 371 PHE A N   1 
ATOM   1044 C CA  . PHE B 1 61 ? -5.101  -27.251 -6.469  1.00 45.10  ? 371 PHE A CA  1 
ATOM   1045 C C   . PHE B 1 61 ? -6.060  -27.272 -7.651  1.00 43.14  ? 371 PHE A C   1 
ATOM   1046 O O   . PHE B 1 61 ? -6.875  -28.188 -7.787  1.00 43.23  ? 371 PHE A O   1 
ATOM   1047 C CB  . PHE B 1 61 ? -3.938  -28.212 -6.731  1.00 47.75  ? 371 PHE A CB  1 
ATOM   1048 C CG  . PHE B 1 61 ? -2.820  -28.109 -5.730  1.00 46.46  ? 371 PHE A CG  1 
ATOM   1049 C CD1 . PHE B 1 61 ? -1.691  -27.354 -6.007  1.00 38.42  ? 371 PHE A CD1 1 
ATOM   1050 C CD2 . PHE B 1 61 ? -2.894  -28.772 -4.515  1.00 44.53  ? 371 PHE A CD2 1 
ATOM   1051 C CE1 . PHE B 1 61 ? -0.659  -27.260 -5.090  1.00 41.00  ? 371 PHE A CE1 1 
ATOM   1052 C CE2 . PHE B 1 61 ? -1.865  -28.683 -3.593  1.00 35.01  ? 371 PHE A CE2 1 
ATOM   1053 C CZ  . PHE B 1 61 ? -0.746  -27.925 -3.882  1.00 35.08  ? 371 PHE A CZ  1 
ATOM   1054 N N   . GLU B 1 62 ? -5.967  -26.254 -8.501  1.00 43.56  ? 372 GLU A N   1 
ATOM   1055 C CA  . GLU B 1 62 ? -6.771  -26.170 -9.717  1.00 42.08  ? 372 GLU A CA  1 
ATOM   1056 C C   . GLU B 1 62 ? -5.867  -26.451 -10.911 1.00 48.59  ? 372 GLU A C   1 
ATOM   1057 O O   . GLU B 1 62 ? -4.958  -25.669 -11.209 1.00 51.87  ? 372 GLU A O   1 
ATOM   1058 C CB  . GLU B 1 62 ? -7.457  -24.813 -9.839  1.00 37.04  ? 372 GLU A CB  1 
ATOM   1059 C CG  . GLU B 1 62 ? -8.465  -24.531 -8.739  1.00 65.59  ? 372 GLU A CG  1 
ATOM   1060 C CD  . GLU B 1 62 ? -9.358  -23.352 -9.065  1.00 94.75  ? 372 GLU A CD  1 
ATOM   1061 O OE1 . GLU B 1 62 ? -8.821  -22.240 -9.228  1.00 99.75  ? 372 GLU A OE1 1 
ATOM   1062 O OE2 . GLU B 1 62 ? -10.593 -23.532 -9.145  1.00 99.40  ? 372 GLU A OE2 1 
ATOM   1063 N N   . VAL B 1 63 ? -6.119  -27.569 -11.586 1.00 42.66  ? 373 VAL A N   1 
ATOM   1064 C CA  . VAL B 1 63 ? -5.302  -28.037 -12.699 1.00 39.02  ? 373 VAL A CA  1 
ATOM   1065 C C   . VAL B 1 63 ? -6.079  -27.821 -13.988 1.00 36.75  ? 373 VAL A C   1 
ATOM   1066 O O   . VAL B 1 63 ? -7.228  -28.262 -14.110 1.00 38.48  ? 373 VAL A O   1 
ATOM   1067 C CB  . VAL B 1 63 ? -4.921  -29.518 -12.532 1.00 42.52  ? 373 VAL A CB  1 
ATOM   1068 C CG1 . VAL B 1 63 ? -4.002  -29.959 -13.658 1.00 38.78  ? 373 VAL A CG1 1 
ATOM   1069 C CG2 . VAL B 1 63 ? -4.264  -29.745 -11.178 1.00 45.07  ? 373 VAL A CG2 1 
ATOM   1070 N N   . THR B 1 64 ? -5.450  -27.150 -14.948 1.00 42.95  ? 374 THR A N   1 
ATOM   1071 C CA  . THR B 1 64 ? -6.061  -26.837 -16.230 1.00 37.84  ? 374 THR A CA  1 
ATOM   1072 C C   . THR B 1 64 ? -5.190  -27.392 -17.347 1.00 39.44  ? 374 THR A C   1 
ATOM   1073 O O   . THR B 1 64 ? -3.961  -27.274 -17.305 1.00 46.82  ? 374 THR A O   1 
ATOM   1074 C CB  . THR B 1 64 ? -6.247  -25.324 -16.400 1.00 44.91  ? 374 THR A CB  1 
ATOM   1075 O OG1 . THR B 1 64 ? -7.039  -24.817 -15.319 1.00 47.61  ? 374 THR A OG1 1 
ATOM   1076 C CG2 . THR B 1 64 ? -6.941  -25.010 -17.717 1.00 41.72  ? 374 THR A CG2 1 
ATOM   1077 N N   . GLY B 1 65 ? -5.826  -28.005 -18.334 1.00 41.05  ? 375 GLY A N   1 
ATOM   1078 C CA  . GLY B 1 65 ? -5.103  -28.581 -19.448 1.00 45.64  ? 375 GLY A CA  1 
ATOM   1079 C C   . GLY B 1 65 ? -5.952  -29.624 -20.146 1.00 52.40  ? 375 GLY A C   1 
ATOM   1080 O O   . GLY B 1 65 ? -7.151  -29.747 -19.896 1.00 46.43  ? 375 GLY A O   1 
ATOM   1081 N N   . MET B 1 66 ? -5.298  -30.366 -21.036 1.00 54.26  ? 376 MET A N   1 
ATOM   1082 C CA  . MET B 1 66 ? -5.970  -31.457 -21.720 1.00 55.56  ? 376 MET A CA  1 
ATOM   1083 C C   . MET B 1 66 ? -6.456  -32.490 -20.703 1.00 50.69  ? 376 MET A C   1 
ATOM   1084 O O   . MET B 1 66 ? -5.810  -32.712 -19.674 1.00 55.54  ? 376 MET A O   1 
ATOM   1085 C CB  . MET B 1 66 ? -5.031  -32.114 -22.730 1.00 63.92  ? 376 MET A CB  1 
ATOM   1086 N N   . PRO B 1 67 ? -7.603  -33.126 -20.963 1.00 64.26  ? 377 PRO A N   1 
ATOM   1087 C CA  . PRO B 1 67 ? -8.151  -34.083 -19.984 1.00 59.19  ? 377 PRO A CA  1 
ATOM   1088 C C   . PRO B 1 67 ? -7.199  -35.211 -19.627 1.00 56.96  ? 377 PRO A C   1 
ATOM   1089 O O   . PRO B 1 67 ? -7.099  -35.580 -18.450 1.00 54.22  ? 377 PRO A O   1 
ATOM   1090 C CB  . PRO B 1 67 ? -9.412  -34.603 -20.685 1.00 57.84  ? 377 PRO A CB  1 
ATOM   1091 C CG  . PRO B 1 67 ? -9.799  -33.508 -21.625 1.00 61.25  ? 377 PRO A CG  1 
ATOM   1092 C CD  . PRO B 1 67 ? -8.506  -32.924 -22.108 1.00 61.83  ? 377 PRO A CD  1 
ATOM   1093 N N   . GLU B 1 68 ? -6.494  -35.772 -20.612 1.00 57.73  ? 378 GLU A N   1 
ATOM   1094 C CA  . GLU B 1 68 ? -5.526  -36.821 -20.310 1.00 70.76  ? 378 GLU A CA  1 
ATOM   1095 C C   . GLU B 1 68 ? -4.366  -36.272 -19.490 1.00 70.29  ? 378 GLU A C   1 
ATOM   1096 O O   . GLU B 1 68 ? -3.840  -36.959 -18.606 1.00 57.84  ? 378 GLU A O   1 
ATOM   1097 C CB  . GLU B 1 68 ? -5.019  -37.458 -21.604 1.00 63.86  ? 378 GLU A CB  1 
ATOM   1098 N N   . ASN B 1 69 ? -3.956  -35.033 -19.769 1.00 54.87  ? 379 ASN A N   1 
ATOM   1099 C CA  . ASN B 1 69 ? -2.867  -34.426 -19.015 1.00 52.84  ? 379 ASN A CA  1 
ATOM   1100 C C   . ASN B 1 69 ? -3.306  -34.026 -17.612 1.00 60.73  ? 379 ASN A C   1 
ATOM   1101 O O   . ASN B 1 69 ? -2.510  -34.103 -16.669 1.00 49.12  ? 379 ASN A O   1 
ATOM   1102 C CB  . ASN B 1 69 ? -2.329  -33.208 -19.764 1.00 59.55  ? 379 ASN A CB  1 
ATOM   1103 C CG  . ASN B 1 69 ? -1.547  -33.585 -21.006 1.00 65.74  ? 379 ASN A CG  1 
ATOM   1104 O OD1 . ASN B 1 69 ? -0.903  -34.633 -21.055 1.00 66.78  ? 379 ASN A OD1 1 
ATOM   1105 N ND2 . ASN B 1 69 ? -1.596  -32.727 -22.019 1.00 60.95  ? 379 ASN A ND2 1 
ATOM   1106 N N   . VAL B 1 70 ? -4.561  -33.599 -17.454 1.00 57.94  ? 380 VAL A N   1 
ATOM   1107 C CA  . VAL B 1 70 ? -5.047  -33.182 -16.142 1.00 51.05  ? 380 VAL A CA  1 
ATOM   1108 C C   . VAL B 1 70 ? -5.163  -34.374 -15.200 1.00 51.74  ? 380 VAL A C   1 
ATOM   1109 O O   . VAL B 1 70 ? -4.818  -34.279 -14.015 1.00 47.34  ? 380 VAL A O   1 
ATOM   1110 C CB  . VAL B 1 70 ? -6.386  -32.438 -16.292 1.00 50.34  ? 380 VAL A CB  1 
ATOM   1111 C CG1 . VAL B 1 70 ? -7.089  -32.326 -14.957 1.00 51.53  ? 380 VAL A CG1 1 
ATOM   1112 C CG2 . VAL B 1 70 ? -6.158  -31.057 -16.884 1.00 53.04  ? 380 VAL A CG2 1 
ATOM   1113 N N   . ASP B 1 71 ? -5.631  -35.519 -15.706 1.00 56.68  ? 381 ASP A N   1 
ATOM   1114 C CA  . ASP B 1 71 ? -5.686  -36.717 -14.874 1.00 64.53  ? 381 ASP A CA  1 
ATOM   1115 C C   . ASP B 1 71 ? -4.289  -37.174 -14.479 1.00 62.14  ? 381 ASP A C   1 
ATOM   1116 O O   . ASP B 1 71 ? -4.076  -37.652 -13.358 1.00 66.46  ? 381 ASP A O   1 
ATOM   1117 C CB  . ASP B 1 71 ? -6.439  -37.833 -15.597 1.00 82.46  ? 381 ASP A CB  1 
ATOM   1118 C CG  . ASP B 1 71 ? -7.911  -37.519 -15.779 1.00 102.46 ? 381 ASP A CG  1 
ATOM   1119 O OD1 . ASP B 1 71 ? -8.502  -36.895 -14.872 1.00 106.68 ? 381 ASP A OD1 1 
ATOM   1120 O OD2 . ASP B 1 71 ? -8.478  -37.899 -16.825 1.00 111.75 ? 381 ASP A OD2 1 
ATOM   1121 N N   . ARG B 1 72 ? -3.322  -37.039 -15.390 1.00 61.83  ? 382 ARG A N   1 
ATOM   1122 C CA  . ARG B 1 72 ? -1.940  -37.353 -15.047 1.00 61.94  ? 382 ARG A CA  1 
ATOM   1123 C C   . ARG B 1 72 ? -1.412  -36.396 -13.987 1.00 63.27  ? 382 ARG A C   1 
ATOM   1124 O O   . ARG B 1 72 ? -0.685  -36.807 -13.075 1.00 56.61  ? 382 ARG A O   1 
ATOM   1125 C CB  . ARG B 1 72 ? -1.065  -37.308 -16.300 1.00 56.90  ? 382 ARG A CB  1 
ATOM   1126 N N   . ALA B 1 73 ? -1.777  -35.114 -14.084 1.00 48.61  ? 383 ALA A N   1 
ATOM   1127 C CA  . ALA B 1 73 ? -1.334  -34.143 -13.087 1.00 45.94  ? 383 ALA A CA  1 
ATOM   1128 C C   . ALA B 1 73 ? -1.991  -34.400 -11.737 1.00 50.24  ? 383 ALA A C   1 
ATOM   1129 O O   . ALA B 1 73 ? -1.354  -34.230 -10.690 1.00 46.75  ? 383 ALA A O   1 
ATOM   1130 C CB  . ALA B 1 73 ? -1.628  -32.724 -13.569 1.00 52.54  ? 383 ALA A CB  1 
ATOM   1131 N N   . ARG B 1 74 ? -3.264  -34.805 -11.738 1.00 49.52  ? 384 ARG A N   1 
ATOM   1132 C CA  . ARG B 1 74 ? -3.916  -35.171 -10.485 1.00 51.83  ? 384 ARG A CA  1 
ATOM   1133 C C   . ARG B 1 74 ? -3.218  -36.361 -9.844  1.00 63.97  ? 384 ARG A C   1 
ATOM   1134 O O   . ARG B 1 74 ? -3.041  -36.407 -8.620  1.00 65.32  ? 384 ARG A O   1 
ATOM   1135 C CB  . ARG B 1 74 ? -5.393  -35.485 -10.729 1.00 50.64  ? 384 ARG A CB  1 
ATOM   1136 C CG  . ARG B 1 74 ? -6.083  -36.148 -9.544  1.00 54.68  ? 384 ARG A CG  1 
ATOM   1137 C CD  . ARG B 1 74 ? -7.507  -36.565 -9.875  1.00 67.24  ? 384 ARG A CD  1 
ATOM   1138 N NE  . ARG B 1 74 ? -8.380  -35.417 -10.099 1.00 78.42  ? 384 ARG A NE  1 
ATOM   1139 C CZ  . ARG B 1 74 ? -9.018  -34.767 -9.131  1.00 78.14  ? 384 ARG A CZ  1 
ATOM   1140 N NH1 . ARG B 1 74 ? -8.880  -35.150 -7.869  1.00 67.09  ? 384 ARG A NH1 1 
ATOM   1141 N NH2 . ARG B 1 74 ? -9.795  -33.732 -9.423  1.00 79.61  ? 384 ARG A NH2 1 
ATOM   1142 N N   . GLU B 1 75 ? -2.810  -37.333 -10.661 1.00 62.18  ? 385 GLU A N   1 
ATOM   1143 C CA  . GLU B 1 75 ? -2.104  -38.499 -10.146 1.00 64.47  ? 385 GLU A CA  1 
ATOM   1144 C C   . GLU B 1 75 ? -0.736  -38.111 -9.595  1.00 59.21  ? 385 GLU A C   1 
ATOM   1145 O O   . GLU B 1 75 ? -0.309  -38.628 -8.556  1.00 53.08  ? 385 GLU A O   1 
ATOM   1146 C CB  . GLU B 1 75 ? -1.979  -39.554 -11.244 1.00 72.32  ? 385 GLU A CB  1 
ATOM   1147 C CG  . GLU B 1 75 ? -1.595  -40.929 -10.744 1.00 82.84  ? 385 GLU A CG  1 
ATOM   1148 C CD  . GLU B 1 75 ? -1.690  -41.988 -11.826 1.00 114.28 ? 385 GLU A CD  1 
ATOM   1149 O OE1 . GLU B 1 75 ? -1.938  -41.625 -12.995 1.00 121.73 ? 385 GLU A OE1 1 
ATOM   1150 O OE2 . GLU B 1 75 ? -1.520  -43.183 -11.506 1.00 131.10 ? 385 GLU A OE2 1 
ATOM   1151 N N   . GLU B 1 76 ? -0.030  -37.207 -10.285 1.00 57.86  ? 386 GLU A N   1 
ATOM   1152 C CA  . GLU B 1 76 ? 1.281   -36.769 -9.813  1.00 61.48  ? 386 GLU A CA  1 
ATOM   1153 C C   . GLU B 1 76 ? 1.179   -36.068 -8.464  1.00 57.98  ? 386 GLU A C   1 
ATOM   1154 O O   . GLU B 1 76 ? 2.063   -36.212 -7.612  1.00 57.13  ? 386 GLU A O   1 
ATOM   1155 C CB  . GLU B 1 76 ? 1.923   -35.835 -10.841 1.00 69.06  ? 386 GLU A CB  1 
ATOM   1156 C CG  . GLU B 1 76 ? 2.325   -36.492 -12.153 1.00 73.68  ? 386 GLU A CG  1 
ATOM   1157 C CD  . GLU B 1 76 ? 3.732   -37.053 -12.123 1.00 80.16  ? 386 GLU A CD  1 
ATOM   1158 O OE1 . GLU B 1 76 ? 4.082   -37.747 -11.146 1.00 84.06  ? 386 GLU A OE1 1 
ATOM   1159 O OE2 . GLU B 1 76 ? 4.494   -36.791 -13.077 1.00 83.38  ? 386 GLU A OE2 1 
ATOM   1160 N N   . ILE B 1 77 ? 0.110   -35.297 -8.255  1.00 52.56  ? 387 ILE A N   1 
ATOM   1161 C CA  . ILE B 1 77 ? -0.085  -34.622 -6.976  1.00 57.50  ? 387 ILE A CA  1 
ATOM   1162 C C   . ILE B 1 77 ? -0.374  -35.637 -5.874  1.00 66.57  ? 387 ILE A C   1 
ATOM   1163 O O   . ILE B 1 77 ? 0.237   -35.602 -4.799  1.00 52.32  ? 387 ILE A O   1 
ATOM   1164 C CB  . ILE B 1 77 ? -1.207  -33.574 -7.089  1.00 46.45  ? 387 ILE A CB  1 
ATOM   1165 C CG1 . ILE B 1 77 ? -0.774  -32.428 -8.008  1.00 49.07  ? 387 ILE A CG1 1 
ATOM   1166 C CG2 . ILE B 1 77 ? -1.588  -33.046 -5.713  1.00 39.82  ? 387 ILE A CG2 1 
ATOM   1167 C CD1 . ILE B 1 77 ? -1.867  -31.416 -8.278  1.00 42.55  ? 387 ILE A CD1 1 
ATOM   1168 N N   . GLU B 1 78 ? -1.304  -36.561 -6.129  1.00 65.90  ? 388 GLU A N   1 
ATOM   1169 C CA  . GLU B 1 78 ? -1.679  -37.549 -5.123  1.00 63.00  ? 388 GLU A CA  1 
ATOM   1170 C C   . GLU B 1 78 ? -0.578  -38.567 -4.851  1.00 61.89  ? 388 GLU A C   1 
ATOM   1171 O O   . GLU B 1 78 ? -0.592  -39.205 -3.793  1.00 73.90  ? 388 GLU A O   1 
ATOM   1172 C CB  . GLU B 1 78 ? -2.949  -38.279 -5.564  1.00 77.90  ? 388 GLU A CB  1 
ATOM   1173 C CG  . GLU B 1 78 ? -4.210  -37.431 -5.516  1.00 86.70  ? 388 GLU A CG  1 
ATOM   1174 C CD  . GLU B 1 78 ? -5.377  -38.083 -6.233  1.00 94.40  ? 388 GLU A CD  1 
ATOM   1175 O OE1 . GLU B 1 78 ? -5.308  -39.301 -6.500  1.00 100.09 ? 388 GLU A OE1 1 
ATOM   1176 O OE2 . GLU B 1 78 ? -6.364  -37.377 -6.529  1.00 91.97  ? 388 GLU A OE2 1 
ATOM   1177 N N   . MET B 1 79 ? 0.369   -38.736 -5.776  1.00 57.85  ? 389 MET A N   1 
ATOM   1178 C CA  . MET B 1 79 ? 1.481   -39.653 -5.557  1.00 67.92  ? 389 MET A CA  1 
ATOM   1179 C C   . MET B 1 79 ? 2.509   -39.109 -4.572  1.00 82.80  ? 389 MET A C   1 
ATOM   1180 O O   . MET B 1 79 ? 3.224   -39.898 -3.944  1.00 98.38  ? 389 MET A O   1 
ATOM   1181 C CB  . MET B 1 79 ? 2.161   -39.982 -6.887  1.00 67.40  ? 389 MET A CB  1 
ATOM   1182 C CG  . MET B 1 79 ? 3.172   -41.115 -6.806  1.00 79.03  ? 389 MET A CG  1 
ATOM   1183 S SD  . MET B 1 79 ? 4.053   -41.376 -8.355  1.00 103.70 ? 389 MET A SD  1 
ATOM   1184 C CE  . MET B 1 79 ? 4.776   -39.757 -8.609  1.00 103.03 ? 389 MET A CE  1 
ATOM   1185 N N   . HIS B 1 80 ? 2.585   -37.789 -4.402  1.00 88.40  ? 390 HIS A N   1 
ATOM   1186 C CA  . HIS B 1 80 ? 3.540   -37.231 -3.452  1.00 94.86  ? 390 HIS A CA  1 
ATOM   1187 C C   . HIS B 1 80 ? 3.037   -37.342 -2.017  1.00 104.02 ? 390 HIS A C   1 
ATOM   1188 O O   . HIS B 1 80 ? 3.827   -37.593 -1.100  1.00 116.42 ? 390 HIS A O   1 
ATOM   1189 C CB  . HIS B 1 80 ? 3.836   -35.773 -3.806  1.00 88.90  ? 390 HIS A CB  1 
ATOM   1190 C CG  . HIS B 1 80 ? 4.696   -35.612 -5.018  1.00 103.54 ? 390 HIS A CG  1 
ATOM   1191 N ND1 . HIS B 1 80 ? 4.231   -35.841 -6.295  1.00 107.59 ? 390 HIS A ND1 1 
ATOM   1192 C CD2 . HIS B 1 80 ? 5.993   -35.245 -5.149  1.00 110.00 ? 390 HIS A CD2 1 
ATOM   1193 C CE1 . HIS B 1 80 ? 5.205   -35.625 -7.160  1.00 109.25 ? 390 HIS A CE1 1 
ATOM   1194 N NE2 . HIS B 1 80 ? 6.285   -35.262 -6.491  1.00 109.54 ? 390 HIS A NE2 1 
ATOM   1195 N N   . ILE B 1 81 ? 1.738   -37.162 -1.802  1.00 92.18  ? 391 ILE A N   1 
ATOM   1196 C CA  . ILE B 1 81 ? 1.156   -37.313 -0.474  1.00 88.70  ? 391 ILE A CA  1 
ATOM   1197 C C   . ILE B 1 81 ? -0.353  -37.509 -0.575  1.00 79.50  ? 391 ILE A C   1 
ATOM   1198 O O   . ILE B 1 81 ? -1.094  -36.559 -0.824  1.00 77.81  ? 391 ILE A O   1 
ATOM   1199 C CB  . ILE B 1 81 ? 1.488   -36.110 0.421   1.00 92.38  ? 391 ILE A CB  1 
ATOM   1200 N N   . HIS C 1 4  ? -15.285 -23.885 -11.757 1.00 92.93  ? 314 HIS C N   1 
ATOM   1201 C CA  . HIS C 1 4  ? -15.869 -24.112 -13.073 1.00 87.87  ? 314 HIS C CA  1 
ATOM   1202 C C   . HIS C 1 4  ? -14.922 -24.955 -13.922 1.00 85.84  ? 314 HIS C C   1 
ATOM   1203 O O   . HIS C 1 4  ? -13.713 -24.728 -13.927 1.00 88.92  ? 314 HIS C O   1 
ATOM   1204 C CB  . HIS C 1 4  ? -16.160 -22.769 -13.755 1.00 73.03  ? 314 HIS C CB  1 
ATOM   1205 C CG  . HIS C 1 4  ? -17.081 -22.861 -14.934 1.00 58.74  ? 314 HIS C CG  1 
ATOM   1206 N ND1 . HIS C 1 4  ? -17.290 -24.029 -15.636 1.00 61.24  ? 314 HIS C ND1 1 
ATOM   1207 C CD2 . HIS C 1 4  ? -17.844 -21.920 -15.538 1.00 57.56  ? 314 HIS C CD2 1 
ATOM   1208 C CE1 . HIS C 1 4  ? -18.144 -23.805 -16.618 1.00 56.86  ? 314 HIS C CE1 1 
ATOM   1209 N NE2 . HIS C 1 4  ? -18.495 -22.532 -16.581 1.00 58.15  ? 314 HIS C NE2 1 
ATOM   1210 N N   . HIS C 1 5  ? -15.480 -25.933 -14.639 1.00 76.54  ? 315 HIS C N   1 
ATOM   1211 C CA  . HIS C 1 5  ? -14.679 -26.827 -15.465 1.00 74.45  ? 315 HIS C CA  1 
ATOM   1212 C C   . HIS C 1 5  ? -14.151 -26.164 -16.731 1.00 77.44  ? 315 HIS C C   1 
ATOM   1213 O O   . HIS C 1 5  ? -13.258 -26.728 -17.373 1.00 81.87  ? 315 HIS C O   1 
ATOM   1214 C CB  . HIS C 1 5  ? -15.491 -28.069 -15.840 1.00 77.48  ? 315 HIS C CB  1 
ATOM   1215 C CG  . HIS C 1 5  ? -15.593 -29.080 -14.741 1.00 91.85  ? 315 HIS C CG  1 
ATOM   1216 N ND1 . HIS C 1 5  ? -16.383 -28.893 -13.627 1.00 93.79  ? 315 HIS C ND1 1 
ATOM   1217 C CD2 . HIS C 1 5  ? -15.003 -30.288 -14.584 1.00 97.66  ? 315 HIS C CD2 1 
ATOM   1218 C CE1 . HIS C 1 5  ? -16.277 -29.942 -12.832 1.00 96.57  ? 315 HIS C CE1 1 
ATOM   1219 N NE2 . HIS C 1 5  ? -15.445 -30.804 -13.390 1.00 100.04 ? 315 HIS C NE2 1 
ATOM   1220 N N   . HIS C 1 6  ? -14.670 -24.993 -17.109 1.00 69.41  ? 316 HIS C N   1 
ATOM   1221 C CA  . HIS C 1 6  ? -14.279 -24.352 -18.359 1.00 72.49  ? 316 HIS C CA  1 
ATOM   1222 C C   . HIS C 1 6  ? -13.615 -22.998 -18.137 1.00 66.93  ? 316 HIS C C   1 
ATOM   1223 O O   . HIS C 1 6  ? -13.502 -22.206 -19.078 1.00 76.83  ? 316 HIS C O   1 
ATOM   1224 C CB  . HIS C 1 6  ? -15.498 -24.194 -19.272 1.00 79.90  ? 316 HIS C CB  1 
ATOM   1225 C CG  . HIS C 1 6  ? -16.164 -25.488 -19.621 1.00 90.18  ? 316 HIS C CG  1 
ATOM   1226 N ND1 . HIS C 1 6  ? -17.177 -26.031 -18.860 1.00 93.12  ? 316 HIS C ND1 1 
ATOM   1227 C CD2 . HIS C 1 6  ? -15.966 -26.345 -20.650 1.00 96.17  ? 316 HIS C CD2 1 
ATOM   1228 C CE1 . HIS C 1 6  ? -17.573 -27.168 -19.404 1.00 96.74  ? 316 HIS C CE1 1 
ATOM   1229 N NE2 . HIS C 1 6  ? -16.854 -27.381 -20.491 1.00 97.18  ? 316 HIS C NE2 1 
ATOM   1230 N N   . HIS C 1 7  ? -13.173 -22.714 -16.915 1.00 63.76  ? 317 HIS C N   1 
ATOM   1231 C CA  . HIS C 1 7  ? -12.473 -21.475 -16.611 1.00 48.02  ? 317 HIS C CA  1 
ATOM   1232 C C   . HIS C 1 7  ? -11.351 -21.762 -15.625 1.00 52.45  ? 317 HIS C C   1 
ATOM   1233 O O   . HIS C 1 7  ? -11.316 -22.813 -14.981 1.00 53.32  ? 317 HIS C O   1 
ATOM   1234 C CB  . HIS C 1 7  ? -13.417 -20.402 -16.050 1.00 45.43  ? 317 HIS C CB  1 
ATOM   1235 C CG  . HIS C 1 7  ? -14.434 -19.912 -17.034 1.00 53.86  ? 317 HIS C CG  1 
ATOM   1236 N ND1 . HIS C 1 7  ? -15.534 -20.656 -17.404 1.00 56.48  ? 317 HIS C ND1 1 
ATOM   1237 C CD2 . HIS C 1 7  ? -14.516 -18.751 -17.726 1.00 55.09  ? 317 HIS C CD2 1 
ATOM   1238 C CE1 . HIS C 1 7  ? -16.249 -19.975 -18.281 1.00 46.05  ? 317 HIS C CE1 1 
ATOM   1239 N NE2 . HIS C 1 7  ? -15.653 -18.815 -18.494 1.00 52.67  ? 317 HIS C NE2 1 
ATOM   1240 N N   . HIS C 1 8  ? -10.426 -20.810 -15.515 1.00 48.35  ? 318 HIS C N   1 
ATOM   1241 C CA  . HIS C 1 8  ? -9.296  -20.948 -14.609 1.00 57.57  ? 318 HIS C CA  1 
ATOM   1242 C C   . HIS C 1 8  ? -8.897  -19.569 -14.106 1.00 57.63  ? 318 HIS C C   1 
ATOM   1243 O O   . HIS C 1 8  ? -9.170  -18.550 -14.746 1.00 57.43  ? 318 HIS C O   1 
ATOM   1244 C CB  . HIS C 1 8  ? -8.108  -21.642 -15.287 1.00 55.74  ? 318 HIS C CB  1 
ATOM   1245 C CG  . HIS C 1 8  ? -7.552  -20.888 -16.455 1.00 59.54  ? 318 HIS C CG  1 
ATOM   1246 N ND1 . HIS C 1 8  ? -8.045  -21.029 -17.735 1.00 58.56  ? 318 HIS C ND1 1 
ATOM   1247 C CD2 . HIS C 1 8  ? -6.543  -19.990 -16.537 1.00 57.90  ? 318 HIS C CD2 1 
ATOM   1248 C CE1 . HIS C 1 8  ? -7.365  -20.247 -18.554 1.00 50.40  ? 318 HIS C CE1 1 
ATOM   1249 N NE2 . HIS C 1 8  ? -6.447  -19.606 -17.853 1.00 57.00  ? 318 HIS C NE2 1 
ATOM   1250 N N   . MET C 1 9  ? -8.243  -19.551 -12.947 1.00 60.60  ? 319 MET C N   1 
ATOM   1251 C CA  . MET C 1 9  ? -7.771  -18.312 -12.345 1.00 52.68  ? 319 MET C CA  1 
ATOM   1252 C C   . MET C 1 9  ? -6.365  -18.001 -12.838 1.00 49.98  ? 319 MET C C   1 
ATOM   1253 O O   . MET C 1 9  ? -5.471  -18.850 -12.766 1.00 56.58  ? 319 MET C O   1 
ATOM   1254 C CB  . MET C 1 9  ? -7.787  -18.409 -10.819 1.00 46.20  ? 319 MET C CB  1 
ATOM   1255 C CG  . MET C 1 9  ? -9.171  -18.307 -10.201 1.00 73.69  ? 319 MET C CG  1 
ATOM   1256 S SD  . MET C 1 9  ? -9.830  -16.630 -10.270 1.00 87.62  ? 319 MET C SD  1 
ATOM   1257 C CE  . MET C 1 9  ? -9.091  -15.916 -8.805  1.00 97.21  ? 319 MET C CE  1 
ATOM   1258 N N   . SER C 1 10 ? -6.175  -16.781 -13.338 1.00 50.37  ? 320 SER C N   1 
ATOM   1259 C CA  . SER C 1 10 ? -4.884  -16.327 -13.817 1.00 54.51  ? 320 SER C CA  1 
ATOM   1260 C C   . SER C 1 10 ? -4.479  -15.042 -13.109 1.00 62.80  ? 320 SER C C   1 
ATOM   1261 O O   . SER C 1 10 ? -5.326  -14.174 -12.869 1.00 62.57  ? 320 SER C O   1 
ATOM   1262 C CB  . SER C 1 10 ? -4.909  -16.087 -15.333 1.00 56.86  ? 320 SER C CB  1 
ATOM   1263 O OG  . SER C 1 10 ? -5.126  -17.296 -16.039 1.00 80.33  ? 320 SER C OG  1 
ATOM   1264 N N   . PRO C 1 11 ? -3.204  -14.891 -12.757 1.00 61.58  ? 321 PRO C N   1 
ATOM   1265 C CA  . PRO C 1 11 ? -2.761  -13.637 -12.138 1.00 56.89  ? 321 PRO C CA  1 
ATOM   1266 C C   . PRO C 1 11 ? -2.805  -12.491 -13.137 1.00 53.03  ? 321 PRO C C   1 
ATOM   1267 O O   . PRO C 1 11 ? -2.522  -12.666 -14.324 1.00 57.23  ? 321 PRO C O   1 
ATOM   1268 C CB  . PRO C 1 11 ? -1.326  -13.946 -11.696 1.00 57.74  ? 321 PRO C CB  1 
ATOM   1269 C CG  . PRO C 1 11 ? -0.883  -15.044 -12.604 1.00 44.71  ? 321 PRO C CG  1 
ATOM   1270 C CD  . PRO C 1 11 ? -2.110  -15.870 -12.877 1.00 44.83  ? 321 PRO C CD  1 
ATOM   1271 N N   . ASN C 1 12 ? -3.164  -11.311 -12.641 1.00 52.37  ? 322 ASN C N   1 
ATOM   1272 C CA  . ASN C 1 12 ? -3.228  -10.132 -13.488 1.00 46.40  ? 322 ASN C CA  1 
ATOM   1273 C C   . ASN C 1 12 ? -1.826  -9.684  -13.888 1.00 52.95  ? 322 ASN C C   1 
ATOM   1274 O O   . ASN C 1 12 ? -0.825  -10.034 -13.255 1.00 53.57  ? 322 ASN C O   1 
ATOM   1275 C CB  . ASN C 1 12 ? -3.959  -8.992  -12.778 1.00 51.38  ? 322 ASN C CB  1 
ATOM   1276 C CG  . ASN C 1 12 ? -5.425  -9.296  -12.544 1.00 50.69  ? 322 ASN C CG  1 
ATOM   1277 O OD1 . ASN C 1 12 ? -5.979  -10.225 -13.131 1.00 46.84  ? 322 ASN C OD1 1 
ATOM   1278 N ND2 . ASN C 1 12 ? -6.064  -8.506  -11.690 1.00 39.24  ? 322 ASN C ND2 1 
ATOM   1279 N N   . LEU C 1 13 ? -1.763  -8.905  -14.964 1.00 63.97  ? 323 LEU C N   1 
ATOM   1280 C CA  . LEU C 1 13 ? -0.499  -8.319  -15.373 1.00 67.39  ? 323 LEU C CA  1 
ATOM   1281 C C   . LEU C 1 13 ? -0.019  -7.335  -14.305 1.00 62.38  ? 323 LEU C C   1 
ATOM   1282 O O   . LEU C 1 13 ? -0.829  -6.775  -13.558 1.00 58.05  ? 323 LEU C O   1 
ATOM   1283 C CB  . LEU C 1 13 ? -0.655  -7.608  -16.716 1.00 65.54  ? 323 LEU C CB  1 
ATOM   1284 C CG  . LEU C 1 13 ? -1.108  -8.481  -17.889 1.00 67.71  ? 323 LEU C CG  1 
ATOM   1285 C CD1 . LEU C 1 13 ? -1.279  -7.647  -19.151 1.00 71.77  ? 323 LEU C CD1 1 
ATOM   1286 C CD2 . LEU C 1 13 ? -0.139  -9.627  -18.123 1.00 66.35  ? 323 LEU C CD2 1 
ATOM   1287 N N   . PRO C 1 14 ? 1.292   -7.118  -14.199 1.00 80.04  ? 324 PRO C N   1 
ATOM   1288 C CA  . PRO C 1 14 ? 1.808   -6.189  -13.184 1.00 82.38  ? 324 PRO C CA  1 
ATOM   1289 C C   . PRO C 1 14 ? 1.251   -4.785  -13.369 1.00 67.18  ? 324 PRO C C   1 
ATOM   1290 O O   . PRO C 1 14 ? 1.300   -4.215  -14.461 1.00 70.45  ? 324 PRO C O   1 
ATOM   1291 C CB  . PRO C 1 14 ? 3.325   -6.233  -13.401 1.00 90.35  ? 324 PRO C CB  1 
ATOM   1292 C CG  . PRO C 1 14 ? 3.503   -6.774  -14.786 1.00 93.42  ? 324 PRO C CG  1 
ATOM   1293 C CD  . PRO C 1 14 ? 2.376   -7.730  -14.985 1.00 90.03  ? 324 PRO C CD  1 
ATOM   1294 N N   . GLY C 1 15 ? 0.717   -4.230  -12.282 1.00 56.48  ? 325 GLY C N   1 
ATOM   1295 C CA  . GLY C 1 15 ? 0.119   -2.915  -12.297 1.00 62.58  ? 325 GLY C CA  1 
ATOM   1296 C C   . GLY C 1 15 ? -1.365  -2.888  -12.590 1.00 62.22  ? 325 GLY C C   1 
ATOM   1297 O O   . GLY C 1 15 ? -1.990  -1.830  -12.441 1.00 60.42  ? 325 GLY C O   1 
ATOM   1298 N N   . GLN C 1 16 ? -1.949  -4.010  -12.998 1.00 61.18  ? 326 GLN C N   1 
ATOM   1299 C CA  . GLN C 1 16 ? -3.371  -4.091  -13.294 1.00 51.15  ? 326 GLN C CA  1 
ATOM   1300 C C   . GLN C 1 16 ? -4.107  -4.695  -12.106 1.00 56.81  ? 326 GLN C C   1 
ATOM   1301 O O   . GLN C 1 16 ? -3.597  -5.601  -11.440 1.00 66.57  ? 326 GLN C O   1 
ATOM   1302 C CB  . GLN C 1 16 ? -3.630  -4.919  -14.554 1.00 44.19  ? 326 GLN C CB  1 
ATOM   1303 C CG  . GLN C 1 16 ? -3.085  -4.287  -15.825 1.00 58.14  ? 326 GLN C CG  1 
ATOM   1304 C CD  . GLN C 1 16 ? -3.468  -5.058  -17.072 1.00 61.99  ? 326 GLN C CD  1 
ATOM   1305 O OE1 . GLN C 1 16 ? -4.174  -6.064  -17.001 1.00 64.42  ? 326 GLN C OE1 1 
ATOM   1306 N NE2 . GLN C 1 16 ? -3.006  -4.587  -18.224 1.00 71.81  ? 326 GLN C NE2 1 
ATOM   1307 N N   . THR C 1 17 ? -5.308  -4.190  -11.848 1.00 52.15  ? 327 THR C N   1 
ATOM   1308 C CA  . THR C 1 17 ? -6.130  -4.656  -10.746 1.00 49.07  ? 327 THR C CA  1 
ATOM   1309 C C   . THR C 1 17 ? -7.465  -5.165  -11.270 1.00 45.22  ? 327 THR C C   1 
ATOM   1310 O O   . THR C 1 17 ? -7.862  -4.888  -12.405 1.00 45.08  ? 327 THR C O   1 
ATOM   1311 C CB  . THR C 1 17 ? -6.369  -3.543  -9.716  1.00 50.37  ? 327 THR C CB  1 
ATOM   1312 O OG1 . THR C 1 17 ? -7.183  -4.044  -8.649  1.00 62.16  ? 327 THR C OG1 1 
ATOM   1313 C CG2 . THR C 1 17 ? -7.070  -2.360  -10.367 1.00 53.75  ? 327 THR C CG2 1 
ATOM   1314 N N   . THR C 1 18 ? -8.155  -5.919  -10.420 1.00 39.48  ? 328 THR C N   1 
ATOM   1315 C CA  . THR C 1 18 ? -9.472  -6.459  -10.728 1.00 37.20  ? 328 THR C CA  1 
ATOM   1316 C C   . THR C 1 18 ? -10.435 -5.999  -9.645  1.00 51.29  ? 328 THR C C   1 
ATOM   1317 O O   . THR C 1 18 ? -10.209 -6.256  -8.458  1.00 45.01  ? 328 THR C O   1 
ATOM   1318 C CB  . THR C 1 18 ? -9.445  -7.986  -10.811 1.00 47.57  ? 328 THR C CB  1 
ATOM   1319 O OG1 . THR C 1 18 ? -8.506  -8.397  -11.813 1.00 49.20  ? 328 THR C OG1 1 
ATOM   1320 C CG2 . THR C 1 18 ? -10.825 -8.526  -11.163 1.00 36.43  ? 328 THR C CG2 1 
ATOM   1321 N N   . VAL C 1 19 ? -11.501 -5.320  -10.056 1.00 45.22  ? 329 VAL C N   1 
ATOM   1322 C CA  . VAL C 1 19 ? -12.505 -4.811  -9.136  1.00 38.53  ? 329 VAL C CA  1 
ATOM   1323 C C   . VAL C 1 19 ? -13.856 -5.396  -9.521  1.00 47.66  ? 329 VAL C C   1 
ATOM   1324 O O   . VAL C 1 19 ? -14.053 -5.906  -10.627 1.00 50.73  ? 329 VAL C O   1 
ATOM   1325 C CB  . VAL C 1 19 ? -12.563 -3.268  -9.123  1.00 41.93  ? 329 VAL C CB  1 
ATOM   1326 C CG1 . VAL C 1 19 ? -11.163 -2.681  -9.014  1.00 39.69  ? 329 VAL C CG1 1 
ATOM   1327 C CG2 . VAL C 1 19 ? -13.274 -2.750  -10.364 1.00 41.93  ? 329 VAL C CG2 1 
ATOM   1328 N N   . GLN C 1 20 ? -14.793 -5.314  -8.585  1.00 52.27  ? 330 GLN C N   1 
ATOM   1329 C CA  . GLN C 1 20 ? -16.146 -5.809  -8.788  1.00 51.23  ? 330 GLN C CA  1 
ATOM   1330 C C   . GLN C 1 20 ? -17.082 -4.634  -9.026  1.00 48.67  ? 330 GLN C C   1 
ATOM   1331 O O   . GLN C 1 20 ? -17.057 -3.653  -8.276  1.00 48.00  ? 330 GLN C O   1 
ATOM   1332 C CB  . GLN C 1 20 ? -16.617 -6.620  -7.580  1.00 37.71  ? 330 GLN C CB  1 
ATOM   1333 C CG  . GLN C 1 20 ? -15.848 -7.909  -7.353  1.00 50.02  ? 330 GLN C CG  1 
ATOM   1334 C CD  . GLN C 1 20 ? -16.328 -8.658  -6.126  1.00 77.36  ? 330 GLN C CD  1 
ATOM   1335 O OE1 . GLN C 1 20 ? -17.427 -8.416  -5.628  1.00 84.69  ? 330 GLN C OE1 1 
ATOM   1336 N NE2 . GLN C 1 20 ? -15.504 -9.574  -5.631  1.00 92.88  ? 330 GLN C NE2 1 
ATOM   1337 N N   . VAL C 1 21 ? -17.890 -4.729  -10.077 1.00 48.87  ? 331 VAL C N   1 
ATOM   1338 C CA  . VAL C 1 21 ? -18.877 -3.711  -10.412 1.00 51.07  ? 331 VAL C CA  1 
ATOM   1339 C C   . VAL C 1 21 ? -20.228 -4.410  -10.367 1.00 48.61  ? 331 VAL C C   1 
ATOM   1340 O O   . VAL C 1 21 ? -20.602 -5.124  -11.305 1.00 40.45  ? 331 VAL C O   1 
ATOM   1341 C CB  . VAL C 1 21 ? -18.621 -3.072  -11.782 1.00 45.90  ? 331 VAL C CB  1 
ATOM   1342 C CG1 . VAL C 1 21 ? -19.625 -1.957  -12.042 1.00 38.88  ? 331 VAL C CG1 1 
ATOM   1343 C CG2 . VAL C 1 21 ? -17.198 -2.543  -11.864 1.00 38.20  ? 331 VAL C CG2 1 
ATOM   1344 N N   . ARG C 1 22 ? -20.965 -4.209  -9.280  1.00 38.05  ? 332 ARG C N   1 
ATOM   1345 C CA  . ARG C 1 22 ? -22.254 -4.854  -9.103  1.00 39.52  ? 332 ARG C CA  1 
ATOM   1346 C C   . ARG C 1 22 ? -23.369 -3.965  -9.634  1.00 43.54  ? 332 ARG C C   1 
ATOM   1347 O O   . ARG C 1 22 ? -23.374 -2.750  -9.415  1.00 45.98  ? 332 ARG C O   1 
ATOM   1348 C CB  . ARG C 1 22 ? -22.494 -5.195  -7.632  1.00 45.31  ? 332 ARG C CB  1 
ATOM   1349 C CG  . ARG C 1 22 ? -23.844 -5.837  -7.365  1.00 48.47  ? 332 ARG C CG  1 
ATOM   1350 C CD  . ARG C 1 22 ? -23.826 -6.639  -6.079  1.00 39.21  ? 332 ARG C CD  1 
ATOM   1351 N NE  . ARG C 1 22 ? -25.009 -7.485  -5.959  1.00 39.01  ? 332 ARG C NE  1 
ATOM   1352 C CZ  . ARG C 1 22 ? -25.046 -8.624  -5.275  1.00 46.42  ? 332 ARG C CZ  1 
ATOM   1353 N NH1 . ARG C 1 22 ? -23.958 -9.062  -4.656  1.00 39.71  ? 332 ARG C NH1 1 
ATOM   1354 N NH2 . ARG C 1 22 ? -26.167 -9.331  -5.220  1.00 46.93  ? 332 ARG C NH2 1 
ATOM   1355 N N   . VAL C 1 23 ? -24.307 -4.583  -10.340 1.00 42.02  ? 333 VAL C N   1 
ATOM   1356 C CA  . VAL C 1 23 ? -25.487 -3.889  -10.853 1.00 49.32  ? 333 VAL C CA  1 
ATOM   1357 C C   . VAL C 1 23 ? -26.715 -4.649  -10.375 1.00 38.00  ? 333 VAL C C   1 
ATOM   1358 O O   . VAL C 1 23 ? -26.618 -5.819  -9.973  1.00 38.99  ? 333 VAL C O   1 
ATOM   1359 C CB  . VAL C 1 23 ? -25.462 -3.784  -12.396 1.00 49.55  ? 333 VAL C CB  1 
ATOM   1360 C CG1 . VAL C 1 23 ? -24.232 -3.020  -12.857 1.00 38.29  ? 333 VAL C CG1 1 
ATOM   1361 C CG2 . VAL C 1 23 ? -25.506 -5.170  -13.023 1.00 36.60  ? 333 VAL C CG2 1 
ATOM   1362 N N   . PRO C 1 24 ? -27.883 -4.008  -10.381 1.00 43.88  ? 334 PRO C N   1 
ATOM   1363 C CA  . PRO C 1 24 ? -29.117 -4.753  -10.110 1.00 38.65  ? 334 PRO C CA  1 
ATOM   1364 C C   . PRO C 1 24 ? -29.282 -5.897  -11.100 1.00 43.67  ? 334 PRO C C   1 
ATOM   1365 O O   . PRO C 1 24 ? -28.888 -5.795  -12.263 1.00 54.11  ? 334 PRO C O   1 
ATOM   1366 C CB  . PRO C 1 24 ? -30.213 -3.694  -10.272 1.00 46.07  ? 334 PRO C CB  1 
ATOM   1367 C CG  . PRO C 1 24 ? -29.529 -2.409  -9.958  1.00 52.21  ? 334 PRO C CG  1 
ATOM   1368 C CD  . PRO C 1 24 ? -28.127 -2.557  -10.483 1.00 45.51  ? 334 PRO C CD  1 
ATOM   1369 N N   . TYR C 1 25 ? -29.854 -7.004  -10.620 1.00 44.31  ? 335 TYR C N   1 
ATOM   1370 C CA  . TYR C 1 25 ? -29.962 -8.200  -11.452 1.00 50.22  ? 335 TYR C CA  1 
ATOM   1371 C C   . TYR C 1 25 ? -30.838 -7.964  -12.676 1.00 49.49  ? 335 TYR C C   1 
ATOM   1372 O O   . TYR C 1 25 ? -30.657 -8.627  -13.704 1.00 60.38  ? 335 TYR C O   1 
ATOM   1373 C CB  . TYR C 1 25 ? -30.496 -9.373  -10.629 1.00 52.02  ? 335 TYR C CB  1 
ATOM   1374 C CG  . TYR C 1 25 ? -30.609 -10.658 -11.418 1.00 44.21  ? 335 TYR C CG  1 
ATOM   1375 C CD1 . TYR C 1 25 ? -29.476 -11.367 -11.803 1.00 34.98  ? 335 TYR C CD1 1 
ATOM   1376 C CD2 . TYR C 1 25 ? -31.853 -11.166 -11.776 1.00 41.31  ? 335 TYR C CD2 1 
ATOM   1377 C CE1 . TYR C 1 25 ? -29.580 -12.541 -12.530 1.00 47.01  ? 335 TYR C CE1 1 
ATOM   1378 C CE2 . TYR C 1 25 ? -31.966 -12.337 -12.498 1.00 45.94  ? 335 TYR C CE2 1 
ATOM   1379 C CZ  . TYR C 1 25 ? -30.828 -13.022 -12.872 1.00 45.93  ? 335 TYR C CZ  1 
ATOM   1380 O OH  . TYR C 1 25 ? -30.939 -14.191 -13.592 1.00 49.70  ? 335 TYR C OH  1 
ATOM   1381 N N   . ARG C 1 26 ? -31.789 -7.032  -12.586 1.00 40.68  ? 336 ARG C N   1 
ATOM   1382 C CA  . ARG C 1 26 ? -32.714 -6.771  -13.683 1.00 44.33  ? 336 ARG C CA  1 
ATOM   1383 C C   . ARG C 1 26 ? -32.035 -6.123  -14.885 1.00 56.19  ? 336 ARG C C   1 
ATOM   1384 O O   . ARG C 1 26 ? -32.561 -6.218  -16.000 1.00 67.06  ? 336 ARG C O   1 
ATOM   1385 C CB  . ARG C 1 26 ? -33.844 -5.865  -13.187 1.00 47.70  ? 336 ARG C CB  1 
ATOM   1386 C CG  . ARG C 1 26 ? -35.115 -5.883  -14.024 1.00 48.77  ? 336 ARG C CG  1 
ATOM   1387 C CD  . ARG C 1 26 ? -36.099 -4.823  -13.536 1.00 44.89  ? 336 ARG C CD  1 
ATOM   1388 N NE  . ARG C 1 26 ? -36.454 -4.998  -12.130 1.00 42.83  ? 336 ARG C NE  1 
ATOM   1389 C CZ  . ARG C 1 26 ? -37.504 -5.689  -11.695 1.00 44.99  ? 336 ARG C CZ  1 
ATOM   1390 N NH1 . ARG C 1 26 ? -37.738 -5.786  -10.394 1.00 40.90  ? 336 ARG C NH1 1 
ATOM   1391 N NH2 . ARG C 1 26 ? -38.319 -6.282  -12.558 1.00 43.55  ? 336 ARG C NH2 1 
ATOM   1392 N N   . VAL C 1 27 ? -30.887 -5.476  -14.691 1.00 55.75  ? 337 VAL C N   1 
ATOM   1393 C CA  . VAL C 1 27 ? -30.254 -4.675  -15.731 1.00 54.00  ? 337 VAL C CA  1 
ATOM   1394 C C   . VAL C 1 27 ? -29.013 -5.350  -16.300 1.00 57.53  ? 337 VAL C C   1 
ATOM   1395 O O   . VAL C 1 27 ? -28.288 -4.731  -17.086 1.00 79.03  ? 337 VAL C O   1 
ATOM   1396 C CB  . VAL C 1 27 ? -29.925 -3.258  -15.229 1.00 56.14  ? 337 VAL C CB  1 
ATOM   1397 C CG1 . VAL C 1 27 ? -31.168 -2.615  -14.634 1.00 63.60  ? 337 VAL C CG1 1 
ATOM   1398 C CG2 . VAL C 1 27 ? -28.780 -3.291  -14.223 1.00 56.93  ? 337 VAL C CG2 1 
ATOM   1399 N N   . VAL C 1 28 ? -28.728 -6.595  -15.902 1.00 39.93  ? 338 VAL C N   1 
ATOM   1400 C CA  . VAL C 1 28 ? -27.554 -7.293  -16.426 1.00 48.66  ? 338 VAL C CA  1 
ATOM   1401 C C   . VAL C 1 28 ? -27.605 -7.372  -17.947 1.00 53.45  ? 338 VAL C C   1 
ATOM   1402 O O   . VAL C 1 28 ? -26.578 -7.242  -18.623 1.00 45.16  ? 338 VAL C O   1 
ATOM   1403 C CB  . VAL C 1 28 ? -27.441 -8.690  -15.793 1.00 46.71  ? 338 VAL C CB  1 
ATOM   1404 C CG1 . VAL C 1 28 ? -26.187 -9.401  -16.283 1.00 43.88  ? 338 VAL C CG1 1 
ATOM   1405 C CG2 . VAL C 1 28 ? -27.432 -8.593  -14.277 1.00 46.82  ? 338 VAL C CG2 1 
ATOM   1406 N N   . GLY C 1 29 ? -28.799 -7.569  -18.511 1.00 54.43  ? 339 GLY C N   1 
ATOM   1407 C CA  . GLY C 1 29 ? -28.923 -7.625  -19.959 1.00 44.44  ? 339 GLY C CA  1 
ATOM   1408 C C   . GLY C 1 29 ? -28.630 -6.304  -20.640 1.00 51.35  ? 339 GLY C C   1 
ATOM   1409 O O   . GLY C 1 29 ? -28.143 -6.281  -21.774 1.00 56.51  ? 339 GLY C O   1 
ATOM   1410 N N   . LEU C 1 30 ? -28.923 -5.188  -19.967 1.00 62.49  ? 340 LEU C N   1 
ATOM   1411 C CA  . LEU C 1 30 ? -28.670 -3.877  -20.558 1.00 60.26  ? 340 LEU C CA  1 
ATOM   1412 C C   . LEU C 1 30 ? -27.176 -3.584  -20.648 1.00 61.24  ? 340 LEU C C   1 
ATOM   1413 O O   . LEU C 1 30 ? -26.714 -2.982  -21.625 1.00 67.14  ? 340 LEU C O   1 
ATOM   1414 C CB  . LEU C 1 30 ? -29.381 -2.791  -19.752 1.00 58.86  ? 340 LEU C CB  1 
ATOM   1415 N N   . VAL C 1 31 ? -26.407 -3.996  -19.639 1.00 57.25  ? 341 VAL C N   1 
ATOM   1416 C CA  . VAL C 1 31 ? -24.966 -3.772  -19.668 1.00 56.53  ? 341 VAL C CA  1 
ATOM   1417 C C   . VAL C 1 31 ? -24.307 -4.679  -20.700 1.00 61.90  ? 341 VAL C C   1 
ATOM   1418 O O   . VAL C 1 31 ? -23.360 -4.277  -21.387 1.00 61.90  ? 341 VAL C O   1 
ATOM   1419 C CB  . VAL C 1 31 ? -24.366 -3.974  -18.265 1.00 48.35  ? 341 VAL C CB  1 
ATOM   1420 C CG1 . VAL C 1 31 ? -22.863 -3.734  -18.288 1.00 38.76  ? 341 VAL C CG1 1 
ATOM   1421 C CG2 . VAL C 1 31 ? -25.044 -3.052  -17.264 1.00 45.70  ? 341 VAL C CG2 1 
ATOM   1422 N N   . VAL C 1 32 ? -24.801 -5.910  -20.835 1.00 59.96  ? 342 VAL C N   1 
ATOM   1423 C CA  . VAL C 1 32 ? -24.248 -6.828  -21.826 1.00 59.69  ? 342 VAL C CA  1 
ATOM   1424 C C   . VAL C 1 32 ? -24.607 -6.367  -23.234 1.00 65.13  ? 342 VAL C C   1 
ATOM   1425 O O   . VAL C 1 32 ? -23.745 -6.285  -24.117 1.00 62.25  ? 342 VAL C O   1 
ATOM   1426 C CB  . VAL C 1 32 ? -24.731 -8.264  -21.556 1.00 50.98  ? 342 VAL C CB  1 
ATOM   1427 C CG1 . VAL C 1 32 ? -24.272 -9.198  -22.663 1.00 47.13  ? 342 VAL C CG1 1 
ATOM   1428 C CG2 . VAL C 1 32 ? -24.220 -8.745  -20.206 1.00 47.21  ? 342 VAL C CG2 1 
ATOM   1429 N N   . GLY C 1 33 ? -25.880 -6.051  -23.463 1.00 61.72  ? 343 GLY C N   1 
ATOM   1430 C CA  . GLY C 1 33 ? -26.321 -5.569  -24.751 1.00 47.26  ? 343 GLY C CA  1 
ATOM   1431 C C   . GLY C 1 33 ? -26.616 -6.681  -25.735 1.00 54.42  ? 343 GLY C C   1 
ATOM   1432 O O   . GLY C 1 33 ? -26.497 -7.870  -25.421 1.00 47.18  ? 343 GLY C O   1 
ATOM   1433 N N   . PRO C 1 34 ? -27.017 -6.310  -26.953 1.00 62.26  ? 344 PRO C N   1 
ATOM   1434 C CA  . PRO C 1 34 ? -27.345 -7.319  -27.975 1.00 59.78  ? 344 PRO C CA  1 
ATOM   1435 C C   . PRO C 1 34 ? -26.114 -8.118  -28.377 1.00 66.24  ? 344 PRO C C   1 
ATOM   1436 O O   . PRO C 1 34 ? -25.144 -7.567  -28.902 1.00 78.85  ? 344 PRO C O   1 
ATOM   1437 C CB  . PRO C 1 34 ? -27.886 -6.480  -29.140 1.00 65.78  ? 344 PRO C CB  1 
ATOM   1438 C CG  . PRO C 1 34 ? -27.300 -5.118  -28.931 1.00 74.96  ? 344 PRO C CG  1 
ATOM   1439 C CD  . PRO C 1 34 ? -27.220 -4.936  -27.444 1.00 70.80  ? 344 PRO C CD  1 
ATOM   1440 N N   . LYS C 1 35 ? -26.161 -9.429  -28.122 1.00 64.90  ? 345 LYS C N   1 
ATOM   1441 C CA  . LYS C 1 35 ? -25.065 -10.347 -28.438 1.00 72.80  ? 345 LYS C CA  1 
ATOM   1442 C C   . LYS C 1 35 ? -23.760 -9.920  -27.771 1.00 74.65  ? 345 LYS C C   1 
ATOM   1443 O O   . LYS C 1 35 ? -22.670 -10.194 -28.280 1.00 72.23  ? 345 LYS C O   1 
ATOM   1444 C CB  . LYS C 1 35 ? -24.873 -10.486 -29.952 1.00 75.11  ? 345 LYS C CB  1 
ATOM   1445 N N   . GLY C 1 36 ? -23.864 -9.240  -26.632 1.00 69.13  ? 346 GLY C N   1 
ATOM   1446 C CA  . GLY C 1 36 ? -22.685 -8.786  -25.926 1.00 57.70  ? 346 GLY C CA  1 
ATOM   1447 C C   . GLY C 1 36 ? -21.991 -7.607  -26.563 1.00 58.48  ? 346 GLY C C   1 
ATOM   1448 O O   . GLY C 1 36 ? -20.831 -7.336  -26.241 1.00 58.17  ? 346 GLY C O   1 
ATOM   1449 N N   . ALA C 1 37 ? -22.672 -6.889  -27.460 1.00 62.06  ? 347 ALA C N   1 
ATOM   1450 C CA  . ALA C 1 37 ? -22.035 -5.780  -28.164 1.00 68.94  ? 347 ALA C CA  1 
ATOM   1451 C C   . ALA C 1 37 ? -21.766 -4.601  -27.239 1.00 70.04  ? 347 ALA C C   1 
ATOM   1452 O O   . ALA C 1 37 ? -20.763 -3.899  -27.410 1.00 71.89  ? 347 ALA C O   1 
ATOM   1453 C CB  . ALA C 1 37 ? -22.898 -5.338  -29.345 1.00 53.11  ? 347 ALA C CB  1 
ATOM   1454 N N   . THR C 1 38 ? -22.642 -4.366  -26.261 1.00 65.62  ? 348 THR C N   1 
ATOM   1455 C CA  . THR C 1 38 ? -22.469 -3.219  -25.375 1.00 65.33  ? 348 THR C CA  1 
ATOM   1456 C C   . THR C 1 38 ? -21.271 -3.414  -24.453 1.00 54.66  ? 348 THR C C   1 
ATOM   1457 O O   . THR C 1 38 ? -20.434 -2.516  -24.310 1.00 45.78  ? 348 THR C O   1 
ATOM   1458 C CB  . THR C 1 38 ? -23.742 -2.986  -24.560 1.00 63.63  ? 348 THR C CB  1 
ATOM   1459 O OG1 . THR C 1 38 ? -24.838 -2.719  -25.444 1.00 68.32  ? 348 THR C OG1 1 
ATOM   1460 C CG2 . THR C 1 38 ? -23.560 -1.811  -23.612 1.00 45.87  ? 348 THR C CG2 1 
ATOM   1461 N N   . ILE C 1 39 ? -21.170 -4.586  -23.823 1.00 43.59  ? 349 ILE C N   1 
ATOM   1462 C CA  . ILE C 1 39 ? -20.057 -4.833  -22.913 1.00 54.57  ? 349 ILE C CA  1 
ATOM   1463 C C   . ILE C 1 39 ? -18.747 -4.968  -23.682 1.00 54.02  ? 349 ILE C C   1 
ATOM   1464 O O   . ILE C 1 39 ? -17.677 -4.637  -23.159 1.00 57.44  ? 349 ILE C O   1 
ATOM   1465 C CB  . ILE C 1 39 ? -20.343 -6.074  -22.043 1.00 55.96  ? 349 ILE C CB  1 
ATOM   1466 C CG1 . ILE C 1 39 ? -19.296 -6.207  -20.935 1.00 52.02  ? 349 ILE C CG1 1 
ATOM   1467 C CG2 . ILE C 1 39 ? -20.402 -7.337  -22.893 1.00 44.28  ? 349 ILE C CG2 1 
ATOM   1468 C CD1 . ILE C 1 39 ? -19.271 -5.033  -19.980 1.00 45.87  ? 349 ILE C CD1 1 
ATOM   1469 N N   . LYS C 1 40 ? -18.803 -5.433  -24.933 1.00 51.37  ? 350 LYS C N   1 
ATOM   1470 C CA  . LYS C 1 40 ? -17.588 -5.516  -25.738 1.00 54.28  ? 350 LYS C CA  1 
ATOM   1471 C C   . LYS C 1 40 ? -17.086 -4.130  -26.123 1.00 57.70  ? 350 LYS C C   1 
ATOM   1472 O O   . LYS C 1 40 ? -15.873 -3.898  -26.189 1.00 47.78  ? 350 LYS C O   1 
ATOM   1473 C CB  . LYS C 1 40 ? -17.838 -6.362  -26.985 1.00 51.12  ? 350 LYS C CB  1 
ATOM   1474 N N   . ARG C 1 41 ? -18.004 -3.194  -26.378 1.00 55.70  ? 351 ARG C N   1 
ATOM   1475 C CA  . ARG C 1 41 ? -17.596 -1.829  -26.692 1.00 52.90  ? 351 ARG C CA  1 
ATOM   1476 C C   . ARG C 1 41 ? -17.022 -1.127  -25.468 1.00 52.42  ? 351 ARG C C   1 
ATOM   1477 O O   . ARG C 1 41 ? -16.090 -0.325  -25.596 1.00 53.16  ? 351 ARG C O   1 
ATOM   1478 C CB  . ARG C 1 41 ? -18.780 -1.049  -27.263 1.00 51.88  ? 351 ARG C CB  1 
ATOM   1479 C CG  . ARG C 1 41 ? -18.510 0.426   -27.509 1.00 64.24  ? 351 ARG C CG  1 
ATOM   1480 C CD  . ARG C 1 41 ? -19.638 1.048   -28.312 1.00 87.73  ? 351 ARG C CD  1 
ATOM   1481 N NE  . ARG C 1 41 ? -20.943 0.709   -27.754 1.00 99.80  ? 351 ARG C NE  1 
ATOM   1482 C CZ  . ARG C 1 41 ? -22.102 0.963   -28.352 1.00 105.77 ? 351 ARG C CZ  1 
ATOM   1483 N NH1 . ARG C 1 41 ? -22.124 1.560   -29.536 1.00 117.13 ? 351 ARG C NH1 1 
ATOM   1484 N NH2 . ARG C 1 41 ? -23.240 0.616   -27.767 1.00 95.27  ? 351 ARG C NH2 1 
ATOM   1485 N N   . ILE C 1 42 ? -17.556 -1.421  -24.280 1.00 47.86  ? 352 ILE C N   1 
ATOM   1486 C CA  . ILE C 1 42 ? -17.011 -0.842  -23.056 1.00 49.99  ? 352 ILE C CA  1 
ATOM   1487 C C   . ILE C 1 42 ? -15.584 -1.327  -22.838 1.00 50.28  ? 352 ILE C C   1 
ATOM   1488 O O   . ILE C 1 42 ? -14.705 -0.560  -22.423 1.00 45.01  ? 352 ILE C O   1 
ATOM   1489 C CB  . ILE C 1 42 ? -17.918 -1.178  -21.857 1.00 50.20  ? 352 ILE C CB  1 
ATOM   1490 C CG1 . ILE C 1 42 ? -19.279 -0.495  -22.013 1.00 50.45  ? 352 ILE C CG1 1 
ATOM   1491 C CG2 . ILE C 1 42 ? -17.258 -0.769  -20.547 1.00 42.84  ? 352 ILE C CG2 1 
ATOM   1492 C CD1 . ILE C 1 42 ? -20.224 -0.739  -20.858 1.00 51.36  ? 352 ILE C CD1 1 
ATOM   1493 N N   . GLN C 1 43 ? -15.328 -2.606  -23.123 1.00 44.03  ? 353 GLN C N   1 
ATOM   1494 C CA  . GLN C 1 43 ? -13.976 -3.138  -22.996 1.00 45.70  ? 353 GLN C CA  1 
ATOM   1495 C C   . GLN C 1 43 ? -13.033 -2.486  -23.998 1.00 45.51  ? 353 GLN C C   1 
ATOM   1496 O O   . GLN C 1 43 ? -11.883 -2.176  -23.667 1.00 57.88  ? 353 GLN C O   1 
ATOM   1497 C CB  . GLN C 1 43 ? -13.989 -4.655  -23.181 1.00 43.00  ? 353 GLN C CB  1 
ATOM   1498 C CG  . GLN C 1 43 ? -14.781 -5.406  -22.124 1.00 47.38  ? 353 GLN C CG  1 
ATOM   1499 C CD  . GLN C 1 43 ? -14.784 -6.904  -22.353 1.00 56.51  ? 353 GLN C CD  1 
ATOM   1500 O OE1 . GLN C 1 43 ? -13.819 -7.596  -22.028 1.00 53.68  ? 353 GLN C OE1 1 
ATOM   1501 N NE2 . GLN C 1 43 ? -15.874 -7.414  -22.917 1.00 58.42  ? 353 GLN C NE2 1 
ATOM   1502 N N   . GLN C 1 44 ? -13.501 -2.271  -25.230 1.00 47.46  ? 354 GLN C N   1 
ATOM   1503 C CA  . GLN C 1 44 ? -12.650 -1.660  -26.247 1.00 49.70  ? 354 GLN C CA  1 
ATOM   1504 C C   . GLN C 1 44 ? -12.408 -0.184  -25.956 1.00 50.53  ? 354 GLN C C   1 
ATOM   1505 O O   . GLN C 1 44 ? -11.290 0.313   -26.135 1.00 51.78  ? 354 GLN C O   1 
ATOM   1506 C CB  . GLN C 1 44 ? -13.275 -1.840  -27.630 1.00 52.51  ? 354 GLN C CB  1 
ATOM   1507 N N   . GLN C 1 45 ? -13.440 0.536   -25.508 1.00 50.49  ? 355 GLN C N   1 
ATOM   1508 C CA  . GLN C 1 45 ? -13.291 1.970   -25.283 1.00 51.86  ? 355 GLN C CA  1 
ATOM   1509 C C   . GLN C 1 45 ? -12.462 2.270   -24.041 1.00 50.45  ? 355 GLN C C   1 
ATOM   1510 O O   . GLN C 1 45 ? -11.757 3.285   -24.002 1.00 51.82  ? 355 GLN C O   1 
ATOM   1511 C CB  . GLN C 1 45 ? -14.663 2.636   -25.177 1.00 52.61  ? 355 GLN C CB  1 
ATOM   1512 C CG  . GLN C 1 45 ? -15.407 2.744   -26.498 1.00 65.01  ? 355 GLN C CG  1 
ATOM   1513 C CD  . GLN C 1 45 ? -16.710 3.510   -26.374 1.00 69.64  ? 355 GLN C CD  1 
ATOM   1514 O OE1 . GLN C 1 45 ? -17.155 3.827   -25.270 1.00 73.83  ? 355 GLN C OE1 1 
ATOM   1515 N NE2 . GLN C 1 45 ? -17.329 3.813   -27.509 1.00 69.36  ? 355 GLN C NE2 1 
ATOM   1516 N N   . THR C 1 46 ? -12.529 1.415   -23.023 1.00 48.42  ? 356 THR C N   1 
ATOM   1517 C CA  . THR C 1 46 ? -11.804 1.635   -21.779 1.00 54.36  ? 356 THR C CA  1 
ATOM   1518 C C   . THR C 1 46 ? -10.549 0.782   -21.657 1.00 51.28  ? 356 THR C C   1 
ATOM   1519 O O   . THR C 1 46 ? -9.837  0.899   -20.655 1.00 45.06  ? 356 THR C O   1 
ATOM   1520 C CB  . THR C 1 46 ? -12.718 1.372   -20.576 1.00 53.64  ? 356 THR C CB  1 
ATOM   1521 O OG1 . THR C 1 46 ? -13.162 0.009   -20.598 1.00 47.53  ? 356 THR C OG1 1 
ATOM   1522 C CG2 . THR C 1 46 ? -13.925 2.298   -20.613 1.00 46.59  ? 356 THR C CG2 1 
ATOM   1523 N N   . HIS C 1 47 ? -10.260 -0.063  -22.650 1.00 54.50  ? 357 HIS C N   1 
ATOM   1524 C CA  . HIS C 1 47 ? -9.067  -0.913  -22.653 1.00 65.73  ? 357 HIS C CA  1 
ATOM   1525 C C   . HIS C 1 47 ? -8.998  -1.772  -21.390 1.00 58.51  ? 357 HIS C C   1 
ATOM   1526 O O   . HIS C 1 47 ? -7.973  -1.840  -20.708 1.00 42.91  ? 357 HIS C O   1 
ATOM   1527 C CB  . HIS C 1 47 ? -7.797  -0.073  -22.822 1.00 74.62  ? 357 HIS C CB  1 
ATOM   1528 C CG  . HIS C 1 47 ? -6.584  -0.872  -23.184 1.00 76.60  ? 357 HIS C CG  1 
ATOM   1529 N ND1 . HIS C 1 47 ? -5.308  -0.354  -23.126 1.00 73.40  ? 357 HIS C ND1 1 
ATOM   1530 C CD2 . HIS C 1 47 ? -6.453  -2.149  -23.613 1.00 71.66  ? 357 HIS C CD2 1 
ATOM   1531 C CE1 . HIS C 1 47 ? -4.443  -1.279  -23.501 1.00 68.28  ? 357 HIS C CE1 1 
ATOM   1532 N NE2 . HIS C 1 47 ? -5.112  -2.377  -23.802 1.00 74.09  ? 357 HIS C NE2 1 
ATOM   1533 N N   . THR C 1 48 ? -10.112 -2.428  -21.073 1.00 48.76  ? 358 THR C N   1 
ATOM   1534 C CA  . THR C 1 48 ? -10.214 -3.269  -19.891 1.00 50.50  ? 358 THR C CA  1 
ATOM   1535 C C   . THR C 1 48 ? -10.678 -4.666  -20.281 1.00 57.44  ? 358 THR C C   1 
ATOM   1536 O O   . THR C 1 48 ? -11.213 -4.887  -21.371 1.00 56.06  ? 358 THR C O   1 
ATOM   1537 C CB  . THR C 1 48 ? -11.179 -2.678  -18.850 1.00 43.98  ? 358 THR C CB  1 
ATOM   1538 O OG1 . THR C 1 48 ? -12.476 -2.508  -19.437 1.00 45.72  ? 358 THR C OG1 1 
ATOM   1539 C CG2 . THR C 1 48 ? -10.671 -1.337  -18.349 1.00 41.17  ? 358 THR C CG2 1 
ATOM   1540 N N   . TYR C 1 49 ? -10.464 -5.608  -19.367 1.00 50.22  ? 359 TYR C N   1 
ATOM   1541 C CA  . TYR C 1 49 ? -10.932 -6.981  -19.503 1.00 46.90  ? 359 TYR C CA  1 
ATOM   1542 C C   . TYR C 1 49 ? -12.062 -7.202  -18.506 1.00 49.99  ? 359 TYR C C   1 
ATOM   1543 O O   . TYR C 1 49 ? -11.846 -7.129  -17.292 1.00 51.52  ? 359 TYR C O   1 
ATOM   1544 C CB  . TYR C 1 49 ? -9.789  -7.968  -19.264 1.00 41.95  ? 359 TYR C CB  1 
ATOM   1545 C CG  . TYR C 1 49 ? -10.208 -9.420  -19.219 1.00 46.92  ? 359 TYR C CG  1 
ATOM   1546 C CD1 . TYR C 1 49 ? -10.502 -10.117 -20.384 1.00 43.25  ? 359 TYR C CD1 1 
ATOM   1547 C CD2 . TYR C 1 49 ? -10.297 -10.098 -18.010 1.00 55.83  ? 359 TYR C CD2 1 
ATOM   1548 C CE1 . TYR C 1 49 ? -10.882 -11.447 -20.344 1.00 45.31  ? 359 TYR C CE1 1 
ATOM   1549 C CE2 . TYR C 1 49 ? -10.674 -11.426 -17.960 1.00 50.86  ? 359 TYR C CE2 1 
ATOM   1550 C CZ  . TYR C 1 49 ? -10.966 -12.095 -19.130 1.00 51.12  ? 359 TYR C CZ  1 
ATOM   1551 O OH  . TYR C 1 49 ? -11.342 -13.418 -19.082 1.00 50.15  ? 359 TYR C OH  1 
ATOM   1552 N N   . ILE C 1 50 ? -13.262 -7.468  -19.018 1.00 39.46  ? 360 ILE C N   1 
ATOM   1553 C CA  . ILE C 1 50 ? -14.469 -7.558  -18.205 1.00 42.83  ? 360 ILE C CA  1 
ATOM   1554 C C   . ILE C 1 50 ? -15.073 -8.945  -18.374 1.00 51.94  ? 360 ILE C C   1 
ATOM   1555 O O   . ILE C 1 50 ? -15.297 -9.398  -19.503 1.00 37.92  ? 360 ILE C O   1 
ATOM   1556 C CB  . ILE C 1 50 ? -15.491 -6.470  -18.581 1.00 44.18  ? 360 ILE C CB  1 
ATOM   1557 C CG1 . ILE C 1 50 ? -14.893 -5.079  -18.360 1.00 53.44  ? 360 ILE C CG1 1 
ATOM   1558 C CG2 . ILE C 1 50 ? -16.768 -6.636  -17.772 1.00 47.22  ? 360 ILE C CG2 1 
ATOM   1559 C CD1 . ILE C 1 50 ? -15.818 -3.948  -18.757 1.00 63.12  ? 360 ILE C CD1 1 
ATOM   1560 N N   . VAL C 1 51 ? -15.334 -9.612  -17.253 1.00 48.66  ? 361 VAL C N   1 
ATOM   1561 C CA  . VAL C 1 51 ? -16.007 -10.906 -17.236 1.00 46.71  ? 361 VAL C CA  1 
ATOM   1562 C C   . VAL C 1 51 ? -17.480 -10.681 -16.927 1.00 38.80  ? 361 VAL C C   1 
ATOM   1563 O O   . VAL C 1 51 ? -17.823 -10.052 -15.918 1.00 40.28  ? 361 VAL C O   1 
ATOM   1564 C CB  . VAL C 1 51 ? -15.366 -11.854 -16.208 1.00 56.02  ? 361 VAL C CB  1 
ATOM   1565 C CG1 . VAL C 1 51 ? -16.147 -13.159 -16.130 1.00 58.27  ? 361 VAL C CG1 1 
ATOM   1566 C CG2 . VAL C 1 51 ? -13.912 -12.118 -16.565 1.00 52.73  ? 361 VAL C CG2 1 
ATOM   1567 N N   . THR C 1 52 ? -18.347 -11.191 -17.791 1.00 38.15  ? 362 THR C N   1 
ATOM   1568 C CA  . THR C 1 52 ? -19.785 -11.060 -17.589 1.00 42.83  ? 362 THR C CA  1 
ATOM   1569 C C   . THR C 1 52 ? -20.272 -12.153 -16.642 1.00 37.98  ? 362 THR C C   1 
ATOM   1570 O O   . THR C 1 52 ? -19.889 -13.316 -16.801 1.00 36.36  ? 362 THR C O   1 
ATOM   1571 C CB  . THR C 1 52 ? -20.521 -11.152 -18.927 1.00 48.91  ? 362 THR C CB  1 
ATOM   1572 O OG1 . THR C 1 52 ? -20.253 -9.978  -19.703 1.00 74.43  ? 362 THR C OG1 1 
ATOM   1573 C CG2 . THR C 1 52 ? -22.024 -11.287 -18.721 1.00 36.66  ? 362 THR C CG2 1 
ATOM   1574 N N   . PRO C 1 53 ? -21.095 -11.822 -15.646 1.00 36.89  ? 363 PRO C N   1 
ATOM   1575 C CA  . PRO C 1 53 ? -21.597 -12.856 -14.735 1.00 41.99  ? 363 PRO C CA  1 
ATOM   1576 C C   . PRO C 1 53 ? -22.485 -13.854 -15.463 1.00 44.13  ? 363 PRO C C   1 
ATOM   1577 O O   . PRO C 1 53 ? -23.064 -13.568 -16.513 1.00 44.84  ? 363 PRO C O   1 
ATOM   1578 C CB  . PRO C 1 53 ? -22.388 -12.059 -13.689 1.00 43.00  ? 363 PRO C CB  1 
ATOM   1579 C CG  . PRO C 1 53 ? -22.746 -10.783 -14.380 1.00 50.02  ? 363 PRO C CG  1 
ATOM   1580 C CD  . PRO C 1 53 ? -21.587 -10.482 -15.285 1.00 48.70  ? 363 PRO C CD  1 
ATOM   1581 N N   . SER C 1 54 ? -22.585 -15.048 -14.882 1.00 45.14  ? 364 SER C N   1 
ATOM   1582 C CA  . SER C 1 54 ? -23.345 -16.127 -15.495 1.00 50.56  ? 364 SER C CA  1 
ATOM   1583 C C   . SER C 1 54 ? -24.842 -15.822 -15.443 1.00 56.29  ? 364 SER C C   1 
ATOM   1584 O O   . SER C 1 54 ? -25.281 -14.764 -14.981 1.00 60.95  ? 364 SER C O   1 
ATOM   1585 C CB  . SER C 1 54 ? -23.028 -17.456 -14.811 1.00 63.94  ? 364 SER C CB  1 
ATOM   1586 O OG  . SER C 1 54 ? -21.688 -17.848 -15.053 1.00 70.41  ? 364 SER C OG  1 
ATOM   1587 N N   . ARG C 1 55 ? -25.637 -16.778 -15.930 1.00 63.24  ? 365 ARG C N   1 
ATOM   1588 C CA  . ARG C 1 55 ? -27.068 -16.548 -16.104 1.00 62.17  ? 365 ARG C CA  1 
ATOM   1589 C C   . ARG C 1 55 ? -27.761 -16.288 -14.771 1.00 62.33  ? 365 ARG C C   1 
ATOM   1590 O O   . ARG C 1 55 ? -28.463 -15.283 -14.608 1.00 74.86  ? 365 ARG C O   1 
ATOM   1591 C CB  . ARG C 1 55 ? -27.703 -17.741 -16.819 1.00 56.77  ? 365 ARG C CB  1 
ATOM   1592 N N   . ASP C 1 56 ? -27.576 -17.184 -13.801 1.00 39.70  ? 366 ASP C N   1 
ATOM   1593 C CA  . ASP C 1 56 ? -28.289 -17.109 -12.532 1.00 51.45  ? 366 ASP C CA  1 
ATOM   1594 C C   . ASP C 1 56 ? -27.341 -16.933 -11.347 1.00 47.89  ? 366 ASP C C   1 
ATOM   1595 O O   . ASP C 1 56 ? -27.665 -17.324 -10.223 1.00 50.17  ? 366 ASP C O   1 
ATOM   1596 C CB  . ASP C 1 56 ? -29.161 -18.349 -12.339 1.00 51.29  ? 366 ASP C CB  1 
ATOM   1597 C CG  . ASP C 1 56 ? -30.198 -18.509 -13.437 1.00 51.11  ? 366 ASP C CG  1 
ATOM   1598 O OD1 . ASP C 1 56 ? -29.938 -19.271 -14.393 1.00 53.83  ? 366 ASP C OD1 1 
ATOM   1599 O OD2 . ASP C 1 56 ? -31.263 -17.861 -13.356 1.00 52.32  ? 366 ASP C OD2 1 
ATOM   1600 N N   . LYS C 1 57 ? -26.174 -16.339 -11.578 1.00 38.21  ? 367 LYS C N   1 
ATOM   1601 C CA  . LYS C 1 57 ? -25.220 -16.056 -10.518 1.00 36.64  ? 367 LYS C CA  1 
ATOM   1602 C C   . LYS C 1 57 ? -25.385 -14.609 -10.054 1.00 35.96  ? 367 LYS C C   1 
ATOM   1603 O O   . LYS C 1 57 ? -26.246 -13.871 -10.537 1.00 36.15  ? 367 LYS C O   1 
ATOM   1604 C CB  . LYS C 1 57 ? -23.793 -16.339 -10.994 1.00 53.98  ? 367 LYS C CB  1 
ATOM   1605 N N   . GLU C 1 58 ? -24.548 -14.200 -9.104  1.00 50.54  ? 368 GLU C N   1 
ATOM   1606 C CA  . GLU C 1 58 ? -24.626 -12.842 -8.578  1.00 44.71  ? 368 GLU C CA  1 
ATOM   1607 C C   . GLU C 1 58 ? -24.361 -11.832 -9.693  1.00 35.31  ? 368 GLU C C   1 
ATOM   1608 O O   . GLU C 1 58 ? -23.411 -12.007 -10.468 1.00 35.03  ? 368 GLU C O   1 
ATOM   1609 C CB  . GLU C 1 58 ? -23.633 -12.648 -7.432  1.00 42.17  ? 368 GLU C CB  1 
ATOM   1610 C CG  . GLU C 1 58 ? -22.250 -13.237 -7.663  1.00 67.85  ? 368 GLU C CG  1 
ATOM   1611 C CD  . GLU C 1 58 ? -21.300 -12.901 -6.531  1.00 80.10  ? 368 GLU C CD  1 
ATOM   1612 O OE1 . GLU C 1 58 ? -20.120 -13.311 -6.585  1.00 78.13  ? 368 GLU C OE1 1 
ATOM   1613 O OE2 . GLU C 1 58 ? -21.743 -12.226 -5.579  1.00 80.22  ? 368 GLU C OE2 1 
ATOM   1614 N N   . PRO C 1 59 ? -25.169 -10.770 -9.814  1.00 51.54  ? 369 PRO C N   1 
ATOM   1615 C CA  . PRO C 1 59 ? -24.984 -9.825  -10.925 1.00 39.45  ? 369 PRO C CA  1 
ATOM   1616 C C   . PRO C 1 59 ? -23.777 -8.917  -10.751 1.00 35.04  ? 369 PRO C C   1 
ATOM   1617 O O   . PRO C 1 59 ? -23.933 -7.709  -10.554 1.00 41.70  ? 369 PRO C O   1 
ATOM   1618 C CB  . PRO C 1 59 ? -26.289 -9.023  -10.915 1.00 45.72  ? 369 PRO C CB  1 
ATOM   1619 C CG  . PRO C 1 59 ? -26.722 -9.051  -9.496  1.00 42.96  ? 369 PRO C CG  1 
ATOM   1620 C CD  . PRO C 1 59 ? -26.317 -10.403 -8.964  1.00 42.38  ? 369 PRO C CD  1 
ATOM   1621 N N   . VAL C 1 60 ? -22.572 -9.478  -10.828 1.00 34.87  ? 370 VAL C N   1 
ATOM   1622 C CA  . VAL C 1 60 ? -21.337 -8.736  -10.600 1.00 44.80  ? 370 VAL C CA  1 
ATOM   1623 C C   . VAL C 1 60 ? -20.443 -8.868  -11.824 1.00 48.74  ? 370 VAL C C   1 
ATOM   1624 O O   . VAL C 1 60 ? -20.141 -9.985  -12.262 1.00 47.24  ? 370 VAL C O   1 
ATOM   1625 C CB  . VAL C 1 60 ? -20.601 -9.228  -9.339  1.00 39.18  ? 370 VAL C CB  1 
ATOM   1626 C CG1 . VAL C 1 60 ? -19.262 -8.522  -9.195  1.00 41.76  ? 370 VAL C CG1 1 
ATOM   1627 C CG2 . VAL C 1 60 ? -21.459 -9.012  -8.102  1.00 42.10  ? 370 VAL C CG2 1 
ATOM   1628 N N   . PHE C 1 61 ? -20.017 -7.730  -12.370 1.00 52.20  ? 371 PHE C N   1 
ATOM   1629 C CA  . PHE C 1 61 ? -19.028 -7.713  -13.436 1.00 39.13  ? 371 PHE C CA  1 
ATOM   1630 C C   . PHE C 1 61 ? -17.641 -7.573  -12.826 1.00 41.06  ? 371 PHE C C   1 
ATOM   1631 O O   . PHE C 1 61 ? -17.433 -6.782  -11.902 1.00 41.15  ? 371 PHE C O   1 
ATOM   1632 C CB  . PHE C 1 61 ? -19.282 -6.560  -14.411 1.00 35.34  ? 371 PHE C CB  1 
ATOM   1633 C CG  . PHE C 1 61 ? -20.526 -6.720  -15.241 1.00 48.23  ? 371 PHE C CG  1 
ATOM   1634 C CD1 . PHE C 1 61 ? -21.765 -6.361  -14.736 1.00 48.64  ? 371 PHE C CD1 1 
ATOM   1635 C CD2 . PHE C 1 61 ? -20.453 -7.219  -16.533 1.00 35.67  ? 371 PHE C CD2 1 
ATOM   1636 C CE1 . PHE C 1 61 ? -22.909 -6.504  -15.499 1.00 49.60  ? 371 PHE C CE1 1 
ATOM   1637 C CE2 . PHE C 1 61 ? -21.594 -7.364  -17.300 1.00 41.13  ? 371 PHE C CE2 1 
ATOM   1638 C CZ  . PHE C 1 61 ? -22.823 -7.006  -16.783 1.00 43.63  ? 371 PHE C CZ  1 
ATOM   1639 N N   . GLU C 1 62 ? -16.693 -8.347  -13.345 1.00 49.61  ? 372 GLU C N   1 
ATOM   1640 C CA  . GLU C 1 62 ? -15.307 -8.296  -12.894 1.00 52.21  ? 372 GLU C CA  1 
ATOM   1641 C C   . GLU C 1 62 ? -14.487 -7.581  -13.960 1.00 49.85  ? 372 GLU C C   1 
ATOM   1642 O O   . GLU C 1 62 ? -14.313 -8.096  -15.070 1.00 45.76  ? 372 GLU C O   1 
ATOM   1643 C CB  . GLU C 1 62 ? -14.771 -9.697  -12.616 1.00 44.54  ? 372 GLU C CB  1 
ATOM   1644 C CG  . GLU C 1 62 ? -15.496 -10.417 -11.490 1.00 57.48  ? 372 GLU C CG  1 
ATOM   1645 C CD  . GLU C 1 62 ? -14.755 -11.651 -11.022 1.00 88.43  ? 372 GLU C CD  1 
ATOM   1646 O OE1 . GLU C 1 62 ? -14.568 -12.566 -11.847 1.00 101.92 ? 372 GLU C OE1 1 
ATOM   1647 O OE2 . GLU C 1 62 ? -14.382 -11.721 -9.831  1.00 100.34 ? 372 GLU C OE2 1 
ATOM   1648 N N   . VAL C 1 63 ? -13.987 -6.398  -13.616 1.00 48.50  ? 373 VAL C N   1 
ATOM   1649 C CA  . VAL C 1 63 ? -13.263 -5.532  -14.538 1.00 49.71  ? 373 VAL C CA  1 
ATOM   1650 C C   . VAL C 1 63 ? -11.789 -5.574  -14.173 1.00 51.32  ? 373 VAL C C   1 
ATOM   1651 O O   . VAL C 1 63 ? -11.422 -5.340  -13.015 1.00 52.55  ? 373 VAL C O   1 
ATOM   1652 C CB  . VAL C 1 63 ? -13.800 -4.092  -14.492 1.00 39.83  ? 373 VAL C CB  1 
ATOM   1653 C CG1 . VAL C 1 63 ? -13.090 -3.226  -15.519 1.00 38.43  ? 373 VAL C CG1 1 
ATOM   1654 C CG2 . VAL C 1 63 ? -15.304 -4.085  -14.727 1.00 38.71  ? 373 VAL C CG2 1 
ATOM   1655 N N   . THR C 1 64 ? -10.948 -5.861  -15.161 1.00 52.98  ? 374 THR C N   1 
ATOM   1656 C CA  . THR C 1 64 ? -9.512  -5.978  -14.965 1.00 54.11  ? 374 THR C CA  1 
ATOM   1657 C C   . THR C 1 64 ? -8.796  -5.004  -15.889 1.00 50.16  ? 374 THR C C   1 
ATOM   1658 O O   . THR C 1 64 ? -9.146  -4.878  -17.066 1.00 42.86  ? 374 THR C O   1 
ATOM   1659 C CB  . THR C 1 64 ? -9.035  -7.412  -15.234 1.00 48.43  ? 374 THR C CB  1 
ATOM   1660 O OG1 . THR C 1 64 ? -9.741  -8.317  -14.377 1.00 39.92  ? 374 THR C OG1 1 
ATOM   1661 C CG2 . THR C 1 64 ? -7.540  -7.542  -14.983 1.00 37.45  ? 374 THR C CG2 1 
ATOM   1662 N N   . GLY C 1 65 ? -7.805  -4.314  -15.346 1.00 38.20  ? 375 GLY C N   1 
ATOM   1663 C CA  . GLY C 1 65 ? -7.043  -3.358  -16.118 1.00 39.12  ? 375 GLY C CA  1 
ATOM   1664 C C   . GLY C 1 65 ? -6.362  -2.362  -15.200 1.00 39.64  ? 375 GLY C C   1 
ATOM   1665 O O   . GLY C 1 65 ? -6.327  -2.532  -13.981 1.00 47.81  ? 375 GLY C O   1 
ATOM   1666 N N   . MET C 1 66 ? -5.817  -1.321  -15.821 1.00 40.72  ? 376 MET C N   1 
ATOM   1667 C CA  . MET C 1 66 ? -5.209  -0.238  -15.067 1.00 44.82  ? 376 MET C CA  1 
ATOM   1668 C C   . MET C 1 66 ? -6.254  0.426   -14.171 1.00 47.89  ? 376 MET C C   1 
ATOM   1669 O O   . MET C 1 66 ? -7.438  0.476   -14.519 1.00 44.32  ? 376 MET C O   1 
ATOM   1670 C CB  . MET C 1 66 ? -4.590  0.787   -16.014 1.00 50.36  ? 376 MET C CB  1 
ATOM   1671 C CG  . MET C 1 66 ? -3.478  0.225   -16.886 1.00 66.07  ? 376 MET C CG  1 
ATOM   1672 S SD  . MET C 1 66 ? -2.147  -0.505  -15.914 1.00 73.59  ? 376 MET C SD  1 
ATOM   1673 C CE  . MET C 1 66 ? -1.615  0.912   -14.956 1.00 83.22  ? 376 MET C CE  1 
ATOM   1674 N N   . PRO C 1 67 ? -5.845  0.925   -12.998 1.00 60.88  ? 377 PRO C N   1 
ATOM   1675 C CA  . PRO C 1 67 ? -6.828  1.523   -12.075 1.00 63.58  ? 377 PRO C CA  1 
ATOM   1676 C C   . PRO C 1 67 ? -7.648  2.640   -12.697 1.00 54.47  ? 377 PRO C C   1 
ATOM   1677 O O   . PRO C 1 67 ? -8.855  2.732   -12.445 1.00 52.61  ? 377 PRO C O   1 
ATOM   1678 C CB  . PRO C 1 67 ? -5.951  2.032   -10.923 1.00 71.62  ? 377 PRO C CB  1 
ATOM   1679 C CG  . PRO C 1 67 ? -4.736  1.164   -10.964 1.00 76.22  ? 377 PRO C CG  1 
ATOM   1680 C CD  . PRO C 1 67 ? -4.490  0.892   -12.421 1.00 69.76  ? 377 PRO C CD  1 
ATOM   1681 N N   . GLU C 1 68 ? -7.023  3.510   -13.491 1.00 53.23  ? 378 GLU C N   1 
ATOM   1682 C CA  . GLU C 1 68 ? -7.781  4.561   -14.161 1.00 60.68  ? 378 GLU C CA  1 
ATOM   1683 C C   . GLU C 1 68 ? -8.721  3.985   -15.213 1.00 62.39  ? 378 GLU C C   1 
ATOM   1684 O O   . GLU C 1 68 ? -9.831  4.494   -15.407 1.00 47.18  ? 378 GLU C O   1 
ATOM   1685 C CB  . GLU C 1 68 ? -6.831  5.576   -14.792 1.00 57.91  ? 378 GLU C CB  1 
ATOM   1686 N N   . ASN C 1 69 ? -8.296  2.921   -15.901 1.00 60.09  ? 379 ASN C N   1 
ATOM   1687 C CA  . ASN C 1 69 ? -9.128  2.343   -16.953 1.00 45.90  ? 379 ASN C CA  1 
ATOM   1688 C C   . ASN C 1 69 ? -10.321 1.583   -16.384 1.00 48.82  ? 379 ASN C C   1 
ATOM   1689 O O   . ASN C 1 69 ? -11.406 1.596   -16.978 1.00 51.33  ? 379 ASN C O   1 
ATOM   1690 C CB  . ASN C 1 69 ? -8.283  1.432   -17.842 1.00 48.62  ? 379 ASN C CB  1 
ATOM   1691 C CG  . ASN C 1 69 ? -7.320  2.207   -18.720 1.00 58.30  ? 379 ASN C CG  1 
ATOM   1692 O OD1 . ASN C 1 69 ? -7.609  3.329   -19.137 1.00 61.25  ? 379 ASN C OD1 1 
ATOM   1693 N ND2 . ASN C 1 69 ? -6.167  1.613   -19.004 1.00 61.69  ? 379 ASN C ND2 1 
ATOM   1694 N N   . VAL C 1 70 ? -10.149 0.914   -15.241 1.00 51.82  ? 380 VAL C N   1 
ATOM   1695 C CA  . VAL C 1 70 ? -11.273 0.191   -14.651 1.00 45.32  ? 380 VAL C CA  1 
ATOM   1696 C C   . VAL C 1 70 ? -12.320 1.172   -14.136 1.00 47.29  ? 380 VAL C C   1 
ATOM   1697 O O   . VAL C 1 70 ? -13.525 0.901   -14.196 1.00 43.90  ? 380 VAL C O   1 
ATOM   1698 C CB  . VAL C 1 70 ? -10.797 -0.786  -13.556 1.00 43.35  ? 380 VAL C CB  1 
ATOM   1699 C CG1 . VAL C 1 70 ? -9.860  -1.830  -14.150 1.00 39.14  ? 380 VAL C CG1 1 
ATOM   1700 C CG2 . VAL C 1 70 ? -10.131 -0.057  -12.407 1.00 40.92  ? 380 VAL C CG2 1 
ATOM   1701 N N   . ASP C 1 71 ? -11.880 2.322   -13.614 1.00 51.44  ? 381 ASP C N   1 
ATOM   1702 C CA  . ASP C 1 71 ? -12.828 3.349   -13.196 1.00 53.85  ? 381 ASP C CA  1 
ATOM   1703 C C   . ASP C 1 71 ? -13.624 3.867   -14.387 1.00 49.82  ? 381 ASP C C   1 
ATOM   1704 O O   . ASP C 1 71 ? -14.820 4.159   -14.265 1.00 51.97  ? 381 ASP C O   1 
ATOM   1705 C CB  . ASP C 1 71 ? -12.092 4.498   -12.508 1.00 69.17  ? 381 ASP C CB  1 
ATOM   1706 C CG  . ASP C 1 71 ? -11.458 4.084   -11.195 1.00 68.59  ? 381 ASP C CG  1 
ATOM   1707 O OD1 . ASP C 1 71 ? -12.056 3.254   -10.479 1.00 66.93  ? 381 ASP C OD1 1 
ATOM   1708 O OD2 . ASP C 1 71 ? -10.362 4.594   -10.879 1.00 64.98  ? 381 ASP C OD2 1 
ATOM   1709 N N   . ARG C 1 72 ? -12.976 3.990   -15.548 1.00 46.40  ? 382 ARG C N   1 
ATOM   1710 C CA  . ARG C 1 72 ? -13.698 4.370   -16.759 1.00 50.36  ? 382 ARG C CA  1 
ATOM   1711 C C   . ARG C 1 72 ? -14.697 3.293   -17.159 1.00 53.23  ? 382 ARG C C   1 
ATOM   1712 O O   . ARG C 1 72 ? -15.811 3.602   -17.598 1.00 56.14  ? 382 ARG C O   1 
ATOM   1713 C CB  . ARG C 1 72 ? -12.714 4.636   -17.898 1.00 54.11  ? 382 ARG C CB  1 
ATOM   1714 C CG  . ARG C 1 72 ? -11.814 5.843   -17.685 1.00 57.07  ? 382 ARG C CG  1 
ATOM   1715 C CD  . ARG C 1 72 ? -10.754 5.924   -18.771 1.00 65.92  ? 382 ARG C CD  1 
ATOM   1716 N NE  . ARG C 1 72 ? -11.342 6.042   -20.102 1.00 75.61  ? 382 ARG C NE  1 
ATOM   1717 C CZ  . ARG C 1 72 ? -10.677 5.830   -21.234 1.00 69.00  ? 382 ARG C CZ  1 
ATOM   1718 N NH1 . ARG C 1 72 ? -9.399  5.478   -21.198 1.00 65.06  ? 382 ARG C NH1 1 
ATOM   1719 N NH2 . ARG C 1 72 ? -11.292 5.961   -22.401 1.00 66.99  ? 382 ARG C NH2 1 
ATOM   1720 N N   . ALA C 1 73 ? -14.316 2.020   -17.016 1.00 43.86  ? 383 ALA C N   1 
ATOM   1721 C CA  . ALA C 1 73 ? -15.240 0.938   -17.334 1.00 42.81  ? 383 ALA C CA  1 
ATOM   1722 C C   . ALA C 1 73 ? -16.382 0.880   -16.328 1.00 52.79  ? 383 ALA C C   1 
ATOM   1723 O O   . ALA C 1 73 ? -17.529 0.606   -16.698 1.00 42.01  ? 383 ALA C O   1 
ATOM   1724 C CB  . ALA C 1 73 ? -14.495 -0.395  -17.384 1.00 43.67  ? 383 ALA C CB  1 
ATOM   1725 N N   . ARG C 1 74 ? -16.088 1.140   -15.051 1.00 42.19  ? 384 ARG C N   1 
ATOM   1726 C CA  . ARG C 1 74 ? -17.146 1.195   -14.048 1.00 42.27  ? 384 ARG C CA  1 
ATOM   1727 C C   . ARG C 1 74 ? -18.132 2.314   -14.357 1.00 55.07  ? 384 ARG C C   1 
ATOM   1728 O O   . ARG C 1 74 ? -19.345 2.153   -14.178 1.00 52.59  ? 384 ARG C O   1 
ATOM   1729 C CB  . ARG C 1 74 ? -16.546 1.376   -12.653 1.00 45.03  ? 384 ARG C CB  1 
ATOM   1730 C CG  . ARG C 1 74 ? -17.571 1.707   -11.578 1.00 43.49  ? 384 ARG C CG  1 
ATOM   1731 C CD  . ARG C 1 74 ? -16.914 2.005   -10.240 1.00 44.44  ? 384 ARG C CD  1 
ATOM   1732 N NE  . ARG C 1 74 ? -16.266 0.825   -9.675  1.00 60.18  ? 384 ARG C NE  1 
ATOM   1733 C CZ  . ARG C 1 74 ? -16.889 -0.088  -8.938  1.00 57.37  ? 384 ARG C CZ  1 
ATOM   1734 N NH1 . ARG C 1 74 ? -18.183 0.038   -8.675  1.00 55.16  ? 384 ARG C NH1 1 
ATOM   1735 N NH2 . ARG C 1 74 ? -16.220 -1.130  -8.464  1.00 60.10  ? 384 ARG C NH2 1 
ATOM   1736 N N   . GLU C 1 75 ? -17.627 3.458   -14.824 1.00 51.64  ? 385 GLU C N   1 
ATOM   1737 C CA  . GLU C 1 75 ? -18.505 4.575   -15.153 1.00 56.19  ? 385 GLU C CA  1 
ATOM   1738 C C   . GLU C 1 75 ? -19.414 4.240   -16.329 1.00 57.50  ? 385 GLU C C   1 
ATOM   1739 O O   . GLU C 1 75 ? -20.614 4.534   -16.293 1.00 48.70  ? 385 GLU C O   1 
ATOM   1740 C CB  . GLU C 1 75 ? -17.667 5.814   -15.465 1.00 56.06  ? 385 GLU C CB  1 
ATOM   1741 C CG  . GLU C 1 75 ? -18.446 7.118   -15.491 1.00 74.87  ? 385 GLU C CG  1 
ATOM   1742 C CD  . GLU C 1 75 ? -18.136 7.998   -14.297 1.00 96.22  ? 385 GLU C CD  1 
ATOM   1743 O OE1 . GLU C 1 75 ? -17.467 7.515   -13.359 1.00 102.05 ? 385 GLU C OE1 1 
ATOM   1744 O OE2 . GLU C 1 75 ? -18.557 9.174   -14.299 1.00 100.53 ? 385 GLU C OE2 1 
ATOM   1745 N N   . GLU C 1 76 ? -18.863 3.623   -17.378 1.00 52.73  ? 386 GLU C N   1 
ATOM   1746 C CA  . GLU C 1 76 ? -19.673 3.259   -18.537 1.00 48.20  ? 386 GLU C CA  1 
ATOM   1747 C C   . GLU C 1 76 ? -20.702 2.187   -18.196 1.00 51.79  ? 386 GLU C C   1 
ATOM   1748 O O   . GLU C 1 76 ? -21.818 2.205   -18.728 1.00 58.85  ? 386 GLU C O   1 
ATOM   1749 C CB  . GLU C 1 76 ? -18.778 2.807   -19.690 1.00 51.58  ? 386 GLU C CB  1 
ATOM   1750 C CG  . GLU C 1 76 ? -17.948 3.931   -20.288 1.00 56.05  ? 386 GLU C CG  1 
ATOM   1751 C CD  . GLU C 1 76 ? -17.149 3.492   -21.497 1.00 78.47  ? 386 GLU C CD  1 
ATOM   1752 O OE1 . GLU C 1 76 ? -17.300 2.328   -21.922 1.00 85.99  ? 386 GLU C OE1 1 
ATOM   1753 O OE2 . GLU C 1 76 ? -16.372 4.314   -22.026 1.00 91.44  ? 386 GLU C OE2 1 
ATOM   1754 N N   . ILE C 1 77 ? -20.350 1.244   -17.319 1.00 44.15  ? 387 ILE C N   1 
ATOM   1755 C CA  . ILE C 1 77 ? -21.306 0.212   -16.923 1.00 43.86  ? 387 ILE C CA  1 
ATOM   1756 C C   . ILE C 1 77 ? -22.465 0.835   -16.162 1.00 63.11  ? 387 ILE C C   1 
ATOM   1757 O O   . ILE C 1 77 ? -23.638 0.570   -16.449 1.00 71.55  ? 387 ILE C O   1 
ATOM   1758 C CB  . ILE C 1 77 ? -20.611 -0.879  -16.088 1.00 40.31  ? 387 ILE C CB  1 
ATOM   1759 C CG1 . ILE C 1 77 ? -19.643 -1.684  -16.955 1.00 49.02  ? 387 ILE C CG1 1 
ATOM   1760 C CG2 . ILE C 1 77 ? -21.638 -1.782  -15.421 1.00 45.68  ? 387 ILE C CG2 1 
ATOM   1761 C CD1 . ILE C 1 77 ? -18.826 -2.690  -16.178 1.00 39.67  ? 387 ILE C CD1 1 
ATOM   1762 N N   . GLU C 1 78 ? -22.151 1.674   -15.177 1.00 65.43  ? 388 GLU C N   1 
ATOM   1763 C CA  . GLU C 1 78 ? -23.196 2.338   -14.418 1.00 66.07  ? 388 GLU C CA  1 
ATOM   1764 C C   . GLU C 1 78 ? -23.921 3.384   -15.256 1.00 70.93  ? 388 GLU C C   1 
ATOM   1765 O O   . GLU C 1 78 ? -25.037 3.780   -14.901 1.00 64.67  ? 388 GLU C O   1 
ATOM   1766 C CB  . GLU C 1 78 ? -22.600 2.944   -13.147 1.00 64.60  ? 388 GLU C CB  1 
ATOM   1767 C CG  . GLU C 1 78 ? -22.205 1.881   -12.124 1.00 66.08  ? 388 GLU C CG  1 
ATOM   1768 C CD  . GLU C 1 78 ? -21.363 2.427   -10.991 1.00 78.21  ? 388 GLU C CD  1 
ATOM   1769 O OE1 . GLU C 1 78 ? -20.724 1.624   -10.278 1.00 77.48  ? 388 GLU C OE1 1 
ATOM   1770 O OE2 . GLU C 1 78 ? -21.331 3.663   -10.824 1.00 86.90  ? 388 GLU C OE2 1 
ATOM   1771 N N   . MET C 1 79 ? -23.313 3.837   -16.359 1.00 71.12  ? 389 MET C N   1 
ATOM   1772 C CA  . MET C 1 79 ? -24.001 4.763   -17.253 1.00 74.50  ? 389 MET C CA  1 
ATOM   1773 C C   . MET C 1 79 ? -25.079 4.061   -18.070 1.00 77.72  ? 389 MET C C   1 
ATOM   1774 O O   . MET C 1 79 ? -26.056 4.698   -18.476 1.00 77.19  ? 389 MET C O   1 
ATOM   1775 C CB  . MET C 1 79 ? -22.995 5.443   -18.182 1.00 77.79  ? 389 MET C CB  1 
ATOM   1776 N N   . HIS C 1 80 ? -24.925 2.761   -18.324 1.00 82.04  ? 390 HIS C N   1 
ATOM   1777 C CA  . HIS C 1 80 ? -25.987 2.001   -18.974 1.00 80.27  ? 390 HIS C CA  1 
ATOM   1778 C C   . HIS C 1 80 ? -27.063 1.561   -17.994 1.00 81.00  ? 390 HIS C C   1 
ATOM   1779 O O   . HIS C 1 80 ? -28.056 0.958   -18.415 1.00 87.80  ? 390 HIS C O   1 
ATOM   1780 C CB  . HIS C 1 80 ? -25.418 0.786   -19.714 1.00 77.97  ? 390 HIS C CB  1 
ATOM   1781 C CG  . HIS C 1 80 ? -24.753 1.127   -21.011 1.00 89.04  ? 390 HIS C CG  1 
ATOM   1782 N ND1 . HIS C 1 80 ? -23.522 1.741   -21.084 1.00 94.26  ? 390 HIS C ND1 1 
ATOM   1783 C CD2 . HIS C 1 80 ? -25.162 0.951   -22.290 1.00 92.27  ? 390 HIS C CD2 1 
ATOM   1784 C CE1 . HIS C 1 80 ? -23.195 1.919   -22.352 1.00 97.41  ? 390 HIS C CE1 1 
ATOM   1785 N NE2 . HIS C 1 80 ? -24.174 1.449   -23.104 1.00 95.92  ? 390 HIS C NE2 1 
ATOM   1786 N N   . ILE C 1 81 ? -26.887 1.850   -16.710 1.00 69.95  ? 391 ILE C N   1 
ATOM   1787 C CA  . ILE C 1 81 ? -27.907 1.602   -15.706 1.00 66.86  ? 391 ILE C CA  1 
ATOM   1788 C C   . ILE C 1 81 ? -28.688 2.881   -15.407 1.00 88.62  ? 391 ILE C C   1 
ATOM   1789 O O   . ILE C 1 81 ? -29.389 2.965   -14.399 1.00 107.08 ? 391 ILE C O   1 
ATOM   1790 C CB  . ILE C 1 81 ? -27.310 1.001   -14.425 1.00 52.93  ? 391 ILE C CB  1 
ATOM   1791 N N   . ALA C 1 82 ? -28.560 3.883   -16.270 1.00 82.57  ? 392 ALA C N   1 
ATOM   1792 C CA  . ALA C 1 82 ? -29.224 5.164   -16.115 1.00 88.13  ? 392 ALA C CA  1 
ATOM   1793 C C   . ALA C 1 82 ? -29.458 5.777   -17.491 1.00 101.54 ? 392 ALA C C   1 
ATOM   1794 O O   . ALA C 1 82 ? -29.239 5.130   -18.516 1.00 103.64 ? 392 ALA C O   1 
ATOM   1795 C CB  . ALA C 1 82 ? -28.392 6.093   -15.249 1.00 78.09  ? 392 ALA C CB  1 
HETATM 1796 S S   . SO4 D 2 .  ? 10.616  -34.233 -32.830 1.00 48.63  ? 401 SO4 B S   1 
HETATM 1797 O O1  . SO4 D 2 .  ? 11.074  -34.739 -34.120 1.00 57.90  ? 401 SO4 B O1  1 
HETATM 1798 O O2  . SO4 D 2 .  ? 10.128  -32.868 -32.989 1.00 44.85  ? 401 SO4 B O2  1 
HETATM 1799 O O3  . SO4 D 2 .  ? 11.724  -34.247 -31.881 1.00 40.42  ? 401 SO4 B O3  1 
HETATM 1800 O O4  . SO4 D 2 .  ? 9.537   -35.080 -32.332 1.00 41.83  ? 401 SO4 B O4  1 
HETATM 1801 S S   . SO4 E 2 .  ? -4.837  -15.511 -19.529 1.00 95.20  ? 401 SO4 C S   1 
HETATM 1802 O O1  . SO4 E 2 .  ? -3.443  -15.464 -19.962 1.00 114.56 ? 401 SO4 C O1  1 
HETATM 1803 O O2  . SO4 E 2 .  ? -5.688  -14.934 -20.565 1.00 103.04 ? 401 SO4 C O2  1 
HETATM 1804 O O3  . SO4 E 2 .  ? -5.228  -16.899 -19.295 1.00 85.01  ? 401 SO4 C O3  1 
HETATM 1805 O O4  . SO4 E 2 .  ? -4.988  -14.747 -18.294 1.00 66.57  ? 401 SO4 C O4  1 
HETATM 1806 S S   . SO4 F 2 .  ? -35.155 -3.473  -8.895  1.00 59.13  ? 402 SO4 C S   1 
HETATM 1807 O O1  . SO4 F 2 .  ? -34.238 -3.602  -10.024 1.00 42.86  ? 402 SO4 C O1  1 
HETATM 1808 O O2  . SO4 F 2 .  ? -36.182 -2.486  -9.214  1.00 71.55  ? 402 SO4 C O2  1 
HETATM 1809 O O3  . SO4 F 2 .  ? -35.787 -4.762  -8.629  1.00 63.84  ? 402 SO4 C O3  1 
HETATM 1810 O O4  . SO4 F 2 .  ? -34.414 -3.043  -7.714  1.00 69.24  ? 402 SO4 C O4  1 
HETATM 1811 S S   . SO4 G 2 .  ? -26.075 -12.391 -3.908  1.00 50.02  ? 403 SO4 C S   1 
HETATM 1812 O O1  . SO4 G 2 .  ? -25.767 -13.567 -4.718  1.00 53.46  ? 403 SO4 C O1  1 
HETATM 1813 O O2  . SO4 G 2 .  ? -27.141 -11.626 -4.548  1.00 51.68  ? 403 SO4 C O2  1 
HETATM 1814 O O3  . SO4 G 2 .  ? -26.507 -12.809 -2.579  1.00 55.26  ? 403 SO4 C O3  1 
HETATM 1815 O O4  . SO4 G 2 .  ? -24.882 -11.559 -3.788  1.00 66.35  ? 403 SO4 C O4  1 
HETATM 1816 O O   . HOH H 3 .  ? 5.896   -6.290  -31.533 1.00 32.54  ? 501 HOH B O   1 
HETATM 1817 O O   . HOH H 3 .  ? 9.390   -14.373 -21.125 1.00 58.10  ? 502 HOH B O   1 
HETATM 1818 O O   . HOH H 3 .  ? 10.734  -30.635 -31.656 1.00 36.80  ? 503 HOH B O   1 
HETATM 1819 O O   . HOH H 3 .  ? 13.486  -8.506  -43.415 1.00 43.24  ? 504 HOH B O   1 
HETATM 1820 O O   . HOH H 3 .  ? 6.770   -13.558 -33.726 1.00 37.69  ? 505 HOH B O   1 
HETATM 1821 O O   . HOH H 3 .  ? 2.025   -17.747 -39.025 1.00 42.90  ? 506 HOH B O   1 
HETATM 1822 O O   . HOH H 3 .  ? 0.198   -18.167 -36.401 1.00 37.82  ? 507 HOH B O   1 
HETATM 1823 O O   . HOH H 3 .  ? 8.824   -35.493 -29.688 1.00 50.42  ? 508 HOH B O   1 
HETATM 1824 O O   . HOH H 3 .  ? 6.881   -35.184 -33.125 1.00 39.86  ? 509 HOH B O   1 
HETATM 1825 O O   . HOH H 3 .  ? 4.553   -28.467 -39.573 1.00 49.44  ? 510 HOH B O   1 
HETATM 1826 O O   . HOH H 3 .  ? 1.569   -7.995  -25.463 1.00 35.63  ? 511 HOH B O   1 
HETATM 1827 O O   . HOH H 3 .  ? -4.279  -27.672 -24.627 1.00 46.43  ? 512 HOH B O   1 
HETATM 1828 O O   . HOH I 3 .  ? -3.361  -17.777 2.609   1.00 58.40  ? 401 HOH A O   1 
HETATM 1829 O O   . HOH I 3 .  ? -8.413  -30.862 3.100   1.00 57.51  ? 402 HOH A O   1 
HETATM 1830 O O   . HOH I 3 .  ? -6.174  -23.957 -13.062 1.00 39.25  ? 403 HOH A O   1 
HETATM 1831 O O   . HOH I 3 .  ? -2.650  -29.793 -21.230 1.00 39.61  ? 404 HOH A O   1 
HETATM 1832 O O   . HOH I 3 .  ? -8.010  -22.216 -11.844 1.00 45.95  ? 405 HOH A O   1 
HETATM 1833 O O   . HOH I 3 .  ? 1.476   -23.566 -9.092  1.00 38.00  ? 406 HOH A O   1 
HETATM 1834 O O   . HOH I 3 .  ? -7.775  -22.331 -2.238  1.00 47.82  ? 407 HOH A O   1 
HETATM 1835 O O   . HOH I 3 .  ? 1.302   -27.105 4.324   1.00 55.54  ? 408 HOH A O   1 
HETATM 1836 O O   . HOH I 3 .  ? 3.689   -22.124 -10.370 1.00 39.49  ? 409 HOH A O   1 
HETATM 1837 O O   . HOH J 3 .  ? -6.072  -0.760  -19.053 1.00 43.67  ? 501 HOH C O   1 
HETATM 1838 O O   . HOH J 3 .  ? -21.547 -9.179  -4.751  1.00 51.54  ? 502 HOH C O   1 
HETATM 1839 O O   . HOH J 3 .  ? -11.894 -9.551  -14.625 1.00 35.61  ? 503 HOH C O   1 
HETATM 1840 O O   . HOH J 3 .  ? -23.971 -15.321 -4.804  1.00 49.34  ? 504 HOH C O   1 
HETATM 1841 O O   . HOH J 3 .  ? -4.224  -8.541  -16.359 1.00 37.26  ? 505 HOH C O   1 
HETATM 1842 O O   . HOH J 3 .  ? -31.910 -3.864  -7.126  1.00 29.01  ? 506 HOH C O   1 
HETATM 1843 O O   . HOH J 3 .  ? -17.603 -12.874 -19.800 1.00 49.04  ? 507 HOH C O   1 
HETATM 1844 O O   . HOH J 3 .  ? -21.555 -13.995 -10.759 1.00 49.27  ? 508 HOH C O   1 
HETATM 1845 O O   . HOH J 3 .  ? -15.862 3.485   -29.891 1.00 64.61  ? 509 HOH C O   1 
HETATM 1846 O O   . HOH J 3 .  ? -12.312 -11.804 -13.383 1.00 46.65  ? 510 HOH C O   1 
HETATM 1847 O O   . HOH J 3 .  ? -4.134  -21.349 -18.687 1.00 55.72  ? 511 HOH C O   1 
HETATM 1848 O O   . HOH J 3 .  ? -14.681 -10.477 -22.255 1.00 47.90  ? 512 HOH C O   1 
HETATM 1849 O O   . HOH J 3 .  ? -13.893 -14.707 -9.572  1.00 56.35  ? 513 HOH C O   1 
HETATM 1850 O O   . HOH J 3 .  ? -9.411  -3.703  -24.642 1.00 41.30  ? 514 HOH C O   1 
HETATM 1851 O O   . HOH J 3 .  ? -16.735 -10.194 -24.077 1.00 46.29  ? 515 HOH C O   1 
HETATM 1852 O O   . HOH J 3 .  ? -23.167 -16.504 -7.285  1.00 55.06  ? 516 HOH C O   1 
HETATM 1853 O O   . HOH J 3 .  ? -16.496 -17.096 -21.428 1.00 55.75  ? 517 HOH C O   1 
HETATM 1854 O O   . HOH J 3 .  ? -16.116 -15.433 -19.741 1.00 52.67  ? 518 HOH C O   1 
HETATM 1855 O O   . HOH J 3 .  ? -14.069 -16.691 -8.303  1.00 66.09  ? 519 HOH C O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . HIS A 4  ? 0.9952 0.8817 0.8356 -0.0133 0.1347  -0.0084 314 HIS B N   
2    C CA  . HIS A 4  ? 1.0630 0.9458 0.8434 -0.0166 0.1241  -0.0004 314 HIS B CA  
3    C C   . HIS A 4  ? 1.1074 0.9632 0.8417 -0.0110 0.1346  0.0136  314 HIS B C   
4    O O   . HIS A 4  ? 1.2896 1.1440 1.0402 -0.0004 0.1379  0.0228  314 HIS B O   
5    C CB  . HIS A 4  ? 1.0514 0.9715 0.8382 -0.0112 0.0914  0.0070  314 HIS B CB  
6    C CG  . HIS A 4  ? 0.9241 0.8503 0.6658 -0.0188 0.0748  0.0097  314 HIS B CG  
7    N ND1 . HIS A 4  ? 0.9151 0.8221 0.5995 -0.0186 0.0732  0.0196  314 HIS B ND1 
8    C CD2 . HIS A 4  ? 0.8514 0.7992 0.5963 -0.0279 0.0577  0.0030  314 HIS B CD2 
9    C CE1 . HIS A 4  ? 0.8280 0.7479 0.4834 -0.0276 0.0516  0.0180  314 HIS B CE1 
10   N NE2 . HIS A 4  ? 0.9161 0.8618 0.6107 -0.0345 0.0434  0.0071  314 HIS B NE2 
11   N N   . HIS A 5  ? 0.9103 0.7392 0.5810 -0.0183 0.1404  0.0153  315 HIS B N   
12   C CA  . HIS A 5  ? 0.9276 0.7205 0.5409 -0.0125 0.1522  0.0299  315 HIS B CA  
13   C C   . HIS A 5  ? 1.0284 0.8419 0.6253 0.0034  0.1226  0.0515  315 HIS B C   
14   O O   . HIS A 5  ? 1.0499 0.8340 0.6066 0.0133  0.1316  0.0674  315 HIS B O   
15   C CB  . HIS A 5  ? 1.0635 0.8162 0.6017 -0.0249 0.1638  0.0253  315 HIS B CB  
16   C CG  . HIS A 5  ? 1.3199 1.0337 0.8631 -0.0369 0.2076  0.0087  315 HIS B CG  
17   N ND1 . HIS A 5  ? 1.4274 1.0975 0.9589 -0.0353 0.2466  0.0120  315 HIS B ND1 
18   C CD2 . HIS A 5  ? 1.3900 1.1010 0.9538 -0.0502 0.2220  -0.0110 315 HIS B CD2 
19   C CE1 . HIS A 5  ? 1.4884 1.1338 1.0378 -0.0473 0.2834  -0.0054 315 HIS B CE1 
20   N NE2 . HIS A 5  ? 1.4352 1.1045 1.0040 -0.0554 0.2688  -0.0191 315 HIS B NE2 
21   N N   . HIS A 6  ? 1.0864 0.9472 0.7151 0.0071  0.0907  0.0532  316 HIS B N   
22   C CA  . HIS A 6  ? 1.0319 0.9178 0.6555 0.0230  0.0631  0.0734  316 HIS B CA  
23   C C   . HIS A 6  ? 0.9751 0.8911 0.6610 0.0347  0.0582  0.0768  316 HIS B C   
24   O O   . HIS A 6  ? 1.0763 1.0234 0.7760 0.0463  0.0356  0.0896  316 HIS B O   
25   C CB  . HIS A 6  ? 0.9977 0.9120 0.6005 0.0166  0.0297  0.0739  316 HIS B CB  
26   C CG  . HIS A 6  ? 1.1093 0.9888 0.6368 0.0051  0.0298  0.0711  316 HIS B CG  
27   N ND1 . HIS A 6  ? 1.0940 0.9540 0.6037 -0.0154 0.0434  0.0499  316 HIS B ND1 
28   C CD2 . HIS A 6  ? 1.1619 1.0168 0.6210 0.0120  0.0185  0.0870  316 HIS B CD2 
29   C CE1 . HIS A 6  ? 1.1670 0.9897 0.5970 -0.0225 0.0420  0.0512  316 HIS B CE1 
30   N NE2 . HIS A 6  ? 1.2231 1.0419 0.6187 -0.0059 0.0251  0.0741  316 HIS B NE2 
31   N N   . HIS A 7  ? 0.8791 0.7855 0.6034 0.0318  0.0789  0.0650  317 HIS B N   
32   C CA  . HIS A 7  ? 0.8602 0.7849 0.6322 0.0413  0.0754  0.0659  317 HIS B CA  
33   C C   . HIS A 7  ? 0.8443 0.7388 0.6312 0.0425  0.1012  0.0619  317 HIS B C   
34   O O   . HIS A 7  ? 0.9374 0.8027 0.7117 0.0337  0.1240  0.0550  317 HIS B O   
35   C CB  . HIS A 7  ? 0.7544 0.7062 0.5654 0.0337  0.0644  0.0513  317 HIS B CB  
36   C CG  . HIS A 7  ? 0.8379 0.8210 0.6445 0.0309  0.0415  0.0540  317 HIS B CG  
37   N ND1 . HIS A 7  ? 0.8875 0.8699 0.6646 0.0179  0.0357  0.0482  317 HIS B ND1 
38   C CD2 . HIS A 7  ? 0.8169 0.8310 0.6468 0.0378  0.0250  0.0603  317 HIS B CD2 
39   C CE1 . HIS A 7  ? 0.8731 0.8882 0.6594 0.0157  0.0139  0.0502  317 HIS B CE1 
40   N NE2 . HIS A 7  ? 0.8385 0.8743 0.6597 0.0281  0.0086  0.0581  317 HIS B NE2 
41   N N   . HIS A 8  ? 0.6663 0.5659 0.4810 0.0523  0.0996  0.0650  318 HIS B N   
42   C CA  . HIS A 8  ? 0.5761 0.4481 0.4083 0.0517  0.1213  0.0597  318 HIS B CA  
43   C C   . HIS A 8  ? 0.5364 0.4208 0.4070 0.0544  0.1120  0.0513  318 HIS B C   
44   O O   . HIS A 8  ? 0.6262 0.5331 0.5003 0.0620  0.0941  0.0563  318 HIS B O   
45   C CB  . HIS A 8  ? 0.6717 0.5135 0.4707 0.0634  0.1365  0.0780  318 HIS B CB  
46   C CG  . HIS A 8  ? 0.7194 0.5749 0.5120 0.0819  0.1217  0.0962  318 HIS B CG  
47   N ND1 . HIS A 8  ? 0.7213 0.5973 0.4891 0.0916  0.1020  0.1127  318 HIS B ND1 
48   C CD2 . HIS A 8  ? 0.6980 0.5491 0.5089 0.0925  0.1246  0.0999  318 HIS B CD2 
49   C CE1 . HIS A 8  ? 0.6787 0.5659 0.4573 0.1089  0.0949  0.1269  318 HIS B CE1 
50   N NE2 . HIS A 8  ? 0.7021 0.5712 0.5030 0.1099  0.1105  0.1195  318 HIS B NE2 
51   N N   . MET A 9  ? 0.5876 0.4549 0.4863 0.0472  0.1251  0.0378  319 MET B N   
52   C CA  . MET A 9  ? 0.6584 0.5293 0.5859 0.0477  0.1148  0.0274  319 MET B CA  
53   C C   . MET A 9  ? 0.7202 0.5678 0.6351 0.0577  0.1247  0.0365  319 MET B C   
54   O O   . MET A 9  ? 0.6286 0.4483 0.5361 0.0568  0.1470  0.0403  319 MET B O   
55   C CB  . MET A 9  ? 0.7474 0.6150 0.7175 0.0338  0.1186  0.0064  319 MET B CB  
56   C CG  . MET A 9  ? 0.9822 0.8729 0.9731 0.0271  0.1059  -0.0039 319 MET B CG  
57   S SD  . MET A 9  ? 1.2024 1.1138 1.1949 0.0335  0.0746  -0.0064 319 MET B SD  
58   C CE  . MET A 9  ? 1.2761 1.1797 1.3096 0.0278  0.0636  -0.0252 319 MET B CE  
59   N N   . SER A 10 ? 0.7492 0.6034 0.6600 0.0672  0.1119  0.0401  320 SER B N   
60   C CA  . SER A 10 ? 0.7049 0.5342 0.6037 0.0777  0.1231  0.0477  320 SER B CA  
61   C C   . SER A 10 ? 0.7567 0.5755 0.6663 0.0737  0.1144  0.0317  320 SER B C   
62   O O   . SER A 10 ? 0.8631 0.6999 0.7776 0.0715  0.0951  0.0242  320 SER B O   
63   C CB  . SER A 10 ? 0.6488 0.4897 0.5266 0.0964  0.1208  0.0704  320 SER B CB  
64   O OG  . SER A 10 ? 0.8810 0.7261 0.7408 0.1014  0.1251  0.0864  320 SER B OG  
65   N N   . PRO A 11 ? 0.7279 0.5129 0.6362 0.0720  0.1282  0.0256  321 PRO B N   
66   C CA  . PRO A 11 ? 0.6871 0.4556 0.5946 0.0674  0.1176  0.0092  321 PRO B CA  
67   C C   . PRO A 11 ? 0.7053 0.4724 0.5859 0.0826  0.1145  0.0199  321 PRO B C   
68   O O   . PRO A 11 ? 0.5772 0.3449 0.4456 0.0983  0.1283  0.0400  321 PRO B O   
69   C CB  . PRO A 11 ? 0.7803 0.5090 0.6896 0.0611  0.1380  0.0014  321 PRO B CB  
70   C CG  . PRO A 11 ? 0.7543 0.4734 0.6513 0.0723  0.1633  0.0231  321 PRO B CG  
71   C CD  . PRO A 11 ? 0.6378 0.3923 0.5399 0.0733  0.1551  0.0329  321 PRO B CD  
72   N N   . ASN A 12 ? 0.6782 0.4420 0.5505 0.0787  0.0969  0.0069  322 ASN B N   
73   C CA  . ASN A 12 ? 0.5779 0.3343 0.4231 0.0914  0.0986  0.0149  322 ASN B CA  
74   C C   . ASN A 12 ? 0.8031 0.5168 0.6249 0.0993  0.1209  0.0170  322 ASN B C   
75   O O   . ASN A 12 ? 0.7806 0.4647 0.6024 0.0911  0.1296  0.0063  322 ASN B O   
76   C CB  . ASN A 12 ? 0.7668 0.5196 0.5981 0.0851  0.0760  0.0007  322 ASN B CB  
77   C CG  . ASN A 12 ? 0.7534 0.5450 0.6056 0.0807  0.0575  0.0012  322 ASN B CG  
78   O OD1 . ASN A 12 ? 0.6706 0.4925 0.5421 0.0827  0.0626  0.0129  322 ASN B OD1 
79   N ND2 . ASN A 12 ? 0.6588 0.4454 0.5027 0.0750  0.0357  -0.0113 322 ASN B ND2 
80   N N   . LEU A 13 ? 0.8040 0.5131 0.6088 0.1151  0.1333  0.0304  323 LEU B N   
81   C CA  . LEU A 13 ? 0.6807 0.3442 0.4603 0.1242  0.1578  0.0316  323 LEU B CA  
82   C C   . LEU A 13 ? 0.8718 0.4909 0.6172 0.1105  0.1489  0.0065  323 LEU B C   
83   O O   . LEU A 13 ? 0.8526 0.4807 0.5912 0.1002  0.1228  -0.0062 323 LEU B O   
84   C CB  . LEU A 13 ? 0.8159 0.4871 0.5922 0.1440  0.1743  0.0503  323 LEU B CB  
85   C CG  . LEU A 13 ? 0.7837 0.5012 0.5952 0.1589  0.1779  0.0756  323 LEU B CG  
86   C CD1 . LEU A 13 ? 0.7707 0.5003 0.5910 0.1766  0.1928  0.0912  323 LEU B CD1 
87   C CD2 . LEU A 13 ? 0.7693 0.4730 0.5876 0.1667  0.1935  0.0868  323 LEU B CD2 
88   N N   . PRO A 14 ? 0.9403 0.5084 0.6614 0.1102  0.1688  -0.0012 324 PRO B N   
89   C CA  . PRO A 14 ? 0.9966 0.5182 0.6791 0.0947  0.1566  -0.0276 324 PRO B CA  
90   C C   . PRO A 14 ? 0.9408 0.4487 0.5814 0.0985  0.1469  -0.0308 324 PRO B C   
91   O O   . PRO A 14 ? 1.0076 0.5061 0.6315 0.1150  0.1709  -0.0161 324 PRO B O   
92   C CB  . PRO A 14 ? 1.0671 0.5328 0.7268 0.0977  0.1890  -0.0307 324 PRO B CB  
93   C CG  . PRO A 14 ? 1.0766 0.5649 0.7757 0.1087  0.2100  -0.0098 324 PRO B CG  
94   C CD  . PRO A 14 ? 0.9464 0.4938 0.6732 0.1228  0.2016  0.0130  324 PRO B CD  
95   N N   . GLY A 15 ? 0.8482 0.3538 0.4735 0.0839  0.1122  -0.0495 325 GLY B N   
96   C CA  . GLY A 15 ? 1.1071 0.5925 0.6839 0.0866  0.1001  -0.0528 325 GLY B CA  
97   C C   . GLY A 15 ? 1.1031 0.6374 0.7029 0.0927  0.0865  -0.0392 325 GLY B C   
98   O O   . GLY A 15 ? 1.1735 0.6892 0.7325 0.0940  0.0745  -0.0420 325 GLY B O   
99   N N   . GLN A 16 ? 0.9524 0.5428 0.6103 0.0959  0.0886  -0.0250 326 GLN B N   
100  C CA  . GLN A 16 ? 0.8094 0.4450 0.4905 0.0999  0.0783  -0.0133 326 GLN B CA  
101  C C   . GLN A 16 ? 0.7893 0.4546 0.4997 0.0873  0.0450  -0.0239 326 GLN B C   
102  O O   . GLN A 16 ? 0.8013 0.4756 0.5420 0.0775  0.0378  -0.0331 326 GLN B O   
103  C CB  . GLN A 16 ? 0.7309 0.4082 0.4531 0.1110  0.0993  0.0084  326 GLN B CB  
104  C CG  . GLN A 16 ? 0.7857 0.4444 0.4938 0.1269  0.1322  0.0222  326 GLN B CG  
105  C CD  . GLN A 16 ? 0.9064 0.6140 0.6612 0.1386  0.1445  0.0443  326 GLN B CD  
106  O OE1 . GLN A 16 ? 0.8168 0.5676 0.6048 0.1336  0.1285  0.0485  326 GLN B OE1 
107  N NE2 . GLN A 16 ? 0.9346 0.6342 0.6921 0.1545  0.1728  0.0582  326 GLN B NE2 
108  N N   . THR A 17 ? 0.7969 0.4752 0.5007 0.0881  0.0283  -0.0223 327 THR B N   
109  C CA  . THR A 17 ? 0.8308 0.5370 0.5646 0.0796  -0.0011 -0.0301 327 THR B CA  
110  C C   . THR A 17 ? 0.7431 0.4922 0.5064 0.0833  0.0032  -0.0163 327 THR B C   
111  O O   . THR A 17 ? 0.5977 0.3527 0.3528 0.0914  0.0230  -0.0024 327 THR B O   
112  C CB  . THR A 17 ? 0.9942 0.6683 0.6876 0.0773  -0.0304 -0.0426 327 THR B CB  
113  O OG1 . THR A 17 ? 1.0105 0.6618 0.6566 0.0872  -0.0208 -0.0326 327 THR B OG1 
114  C CG2 . THR A 17 ? 1.2010 0.8306 0.8615 0.0705  -0.0394 -0.0598 327 THR B CG2 
115  N N   . THR A 18 ? 0.6374 0.4162 0.4386 0.0762  -0.0146 -0.0214 328 THR B N   
116  C CA  . THR A 18 ? 0.5533 0.3682 0.3802 0.0767  -0.0122 -0.0122 328 THR B CA  
117  C C   . THR A 18 ? 0.6480 0.4622 0.4760 0.0752  -0.0366 -0.0189 328 THR B C   
118  O O   . THR A 18 ? 0.6720 0.4878 0.5222 0.0699  -0.0571 -0.0311 328 THR B O   
119  C CB  . THR A 18 ? 0.5416 0.3894 0.4125 0.0708  -0.0033 -0.0101 328 THR B CB  
120  O OG1 . THR A 18 ? 0.6224 0.4667 0.4885 0.0752  0.0177  -0.0013 328 THR B OG1 
121  C CG2 . THR A 18 ? 0.4512 0.3305 0.3401 0.0694  -0.0008 -0.0027 328 THR B CG2 
122  N N   . VAL A 19 ? 0.6092 0.4210 0.4173 0.0802  -0.0335 -0.0105 329 VAL B N   
123  C CA  . VAL A 19 ? 0.5374 0.3432 0.3413 0.0819  -0.0536 -0.0133 329 VAL B CA  
124  C C   . VAL A 19 ? 0.5707 0.4061 0.4011 0.0794  -0.0427 -0.0061 329 VAL B C   
125  O O   . VAL A 19 ? 0.5801 0.4366 0.4214 0.0767  -0.0223 0.0014  329 VAL B O   
126  C CB  . VAL A 19 ? 0.6633 0.4223 0.4043 0.0902  -0.0596 -0.0109 329 VAL B CB  
127  C CG1 . VAL A 19 ? 0.6381 0.3608 0.3406 0.0910  -0.0642 -0.0185 329 VAL B CG1 
128  C CG2 . VAL A 19 ? 0.5941 0.3490 0.3147 0.0937  -0.0326 0.0021  329 VAL B CG2 
129  N N   . GLN A 20 ? 0.5038 0.3395 0.3451 0.0805  -0.0581 -0.0090 330 GLN B N   
130  C CA  . GLN A 20 ? 0.5231 0.3788 0.3857 0.0770  -0.0480 -0.0048 330 GLN B CA  
131  C C   . GLN A 20 ? 0.6170 0.4452 0.4409 0.0831  -0.0443 0.0029  330 GLN B C   
132  O O   . GLN A 20 ? 0.5650 0.3593 0.3558 0.0920  -0.0614 0.0029  330 GLN B O   
133  C CB  . GLN A 20 ? 0.6065 0.4788 0.5134 0.0748  -0.0608 -0.0127 330 GLN B CB  
134  C CG  . GLN A 20 ? 0.8469 0.7444 0.7953 0.0668  -0.0563 -0.0202 330 GLN B CG  
135  C CD  . GLN A 20 ? 1.0634 0.9755 1.0616 0.0650  -0.0638 -0.0286 330 GLN B CD  
136  O OE1 . GLN A 20 ? 1.0227 0.9401 1.0337 0.0646  -0.0570 -0.0272 330 GLN B OE1 
137  N NE2 . GLN A 20 ? 1.2373 1.1551 1.2680 0.0631  -0.0756 -0.0381 330 GLN B NE2 
138  N N   . VAL A 21 ? 0.6388 0.4792 0.4651 0.0777  -0.0225 0.0092  331 VAL B N   
139  C CA  . VAL A 21 ? 0.6303 0.4449 0.4256 0.0805  -0.0111 0.0164  331 VAL B CA  
140  C C   . VAL A 21 ? 0.6079 0.4396 0.4311 0.0725  -0.0040 0.0152  331 VAL B C   
141  O O   . VAL A 21 ? 0.8093 0.6718 0.6579 0.0610  0.0102  0.0144  331 VAL B O   
142  C CB  . VAL A 21 ? 0.5921 0.4033 0.3696 0.0792  0.0127  0.0237  331 VAL B CB  
143  C CG1 . VAL A 21 ? 0.5704 0.3487 0.3159 0.0812  0.0289  0.0305  331 VAL B CG1 
144  C CG2 . VAL A 21 ? 0.5545 0.3459 0.3048 0.0866  0.0099  0.0236  331 VAL B CG2 
145  N N   . ARG A 22 ? 0.5387 0.3484 0.3556 0.0790  -0.0148 0.0149  332 ARG B N   
146  C CA  . ARG A 22 ? 0.5766 0.3940 0.4173 0.0725  -0.0058 0.0128  332 ARG B CA  
147  C C   . ARG A 22 ? 0.6277 0.4202 0.4415 0.0697  0.0151  0.0195  332 ARG B C   
148  O O   . ARG A 22 ? 0.8140 0.5663 0.5836 0.0799  0.0160  0.0274  332 ARG B O   
149  C CB  . ARG A 22 ? 0.7069 0.5125 0.5619 0.0831  -0.0253 0.0104  332 ARG B CB  
150  C CG  . ARG A 22 ? 0.7049 0.5098 0.5818 0.0786  -0.0121 0.0084  332 ARG B CG  
151  C CD  . ARG A 22 ? 0.6805 0.4890 0.5943 0.0882  -0.0285 0.0042  332 ARG B CD  
152  N NE  . ARG A 22 ? 0.8379 0.6830 0.7970 0.0801  -0.0292 -0.0061 332 ARG B NE  
153  C CZ  . ARG A 22 ? 0.7387 0.5988 0.7328 0.0712  -0.0131 -0.0136 332 ARG B CZ  
154  N NH1 . ARG A 22 ? 0.4863 0.3295 0.4776 0.0688  0.0035  -0.0133 332 ARG B NH1 
155  N NH2 . ARG A 22 ? 0.7021 0.5883 0.7301 0.0643  -0.0105 -0.0220 332 ARG B NH2 
156  N N   . VAL A 23 ? 0.6652 0.4782 0.5030 0.0545  0.0331  0.0156  333 VAL B N   
157  C CA  . VAL A 23 ? 0.8220 0.6142 0.6453 0.0475  0.0559  0.0192  333 VAL B CA  
158  C C   . VAL A 23 ? 0.7313 0.5221 0.5747 0.0392  0.0629  0.0125  333 VAL B C   
159  O O   . VAL A 23 ? 0.6367 0.4504 0.5087 0.0356  0.0545  0.0043  333 VAL B O   
160  C CB  . VAL A 23 ? 0.6783 0.4983 0.5147 0.0331  0.0735  0.0191  333 VAL B CB  
161  C CG1 . VAL A 23 ? 0.6474 0.4635 0.4645 0.0432  0.0719  0.0261  333 VAL B CG1 
162  C CG2 . VAL A 23 ? 0.5650 0.4334 0.4407 0.0177  0.0696  0.0098  333 VAL B CG2 
163  N N   . PRO A 24 ? 0.7233 0.4816 0.5502 0.0360  0.0820  0.0156  334 PRO B N   
164  C CA  . PRO A 24 ? 0.6464 0.4015 0.4924 0.0241  0.0948  0.0073  334 PRO B CA  
165  C C   . PRO A 24 ? 0.6867 0.4867 0.5640 0.0005  0.1003  -0.0055 334 PRO B C   
166  O O   . PRO A 24 ? 0.6750 0.5036 0.5594 -0.0090 0.1018  -0.0055 334 PRO B O   
167  C CB  . PRO A 24 ? 0.6471 0.3580 0.4663 0.0221  0.1192  0.0136  334 PRO B CB  
168  C CG  . PRO A 24 ? 0.8096 0.4857 0.5859 0.0427  0.1120  0.0279  334 PRO B CG  
169  C CD  . PRO A 24 ? 0.8207 0.5335 0.6047 0.0446  0.0950  0.0271  334 PRO B CD  
170  N N   . TYR A 25 ? 0.6272 0.4312 0.5217 -0.0078 0.1030  -0.0162 335 TYR B N   
171  C CA  . TYR A 25 ? 0.6139 0.4542 0.5266 -0.0292 0.1041  -0.0289 335 TYR B CA  
172  C C   . TYR A 25 ? 0.5827 0.4338 0.4986 -0.0518 0.1178  -0.0342 335 TYR B C   
173  O O   . TYR A 25 ? 0.7214 0.6108 0.6502 -0.0667 0.1105  -0.0402 335 TYR B O   
174  C CB  . TYR A 25 ? 0.5807 0.4106 0.5024 -0.0343 0.1105  -0.0403 335 TYR B CB  
175  C CG  . TYR A 25 ? 0.5187 0.3761 0.4453 -0.0558 0.1109  -0.0539 335 TYR B CG  
176  C CD1 . TYR A 25 ? 0.4918 0.3792 0.4228 -0.0530 0.0959  -0.0530 335 TYR B CD1 
177  C CD2 . TYR A 25 ? 0.5434 0.3917 0.4644 -0.0795 0.1261  -0.0678 335 TYR B CD2 
178  C CE1 . TYR A 25 ? 0.4928 0.3984 0.4175 -0.0709 0.0950  -0.0635 335 TYR B CE1 
179  C CE2 . TYR A 25 ? 0.6358 0.5040 0.5506 -0.0995 0.1227  -0.0806 335 TYR B CE2 
180  C CZ  . TYR A 25 ? 0.6284 0.5242 0.5425 -0.0940 0.1066  -0.0773 335 TYR B CZ  
181  O OH  . TYR A 25 ? 0.6359 0.5447 0.5335 -0.1122 0.1022  -0.0882 335 TYR B OH  
182  N N   . ARG A 26 ? 0.5690 0.3865 0.4751 -0.0545 0.1370  -0.0318 336 ARG B N   
183  C CA  . ARG A 26 ? 0.7180 0.5459 0.6363 -0.0787 0.1527  -0.0388 336 ARG B CA  
184  C C   . ARG A 26 ? 0.8381 0.6970 0.7694 -0.0784 0.1494  -0.0308 336 ARG B C   
185  O O   . ARG A 26 ? 0.9666 0.8547 0.9243 -0.0998 0.1547  -0.0382 336 ARG B O   
186  C CB  . ARG A 26 ? 0.7984 0.5751 0.7027 -0.0819 0.1798  -0.0380 336 ARG B CB  
187  C CG  . ARG A 26 ? 1.0827 0.8679 1.0069 -0.1136 0.1986  -0.0518 336 ARG B CG  
188  C CD  . ARG A 26 ? 1.2308 0.9593 1.1397 -0.1166 0.2305  -0.0496 336 ARG B CD  
189  N NE  . ARG A 26 ? 1.3460 1.0299 1.2342 -0.1067 0.2369  -0.0510 336 ARG B NE  
190  C CZ  . ARG A 26 ? 1.4807 1.1527 1.3745 -0.1274 0.2492  -0.0684 336 ARG B CZ  
191  N NH1 . ARG A 26 ? 1.5413 1.2432 1.4566 -0.1608 0.2520  -0.0869 336 ARG B NH1 
192  N NH2 . ARG A 26 ? 1.4876 1.1171 1.3664 -0.1146 0.2581  -0.0679 336 ARG B NH2 
193  N N   . VAL A 27 ? 0.7539 0.6079 0.6706 -0.0552 0.1405  -0.0168 337 VAL B N   
194  C CA  . VAL A 27 ? 0.7042 0.5765 0.6303 -0.0526 0.1452  -0.0083 337 VAL B CA  
195  C C   . VAL A 27 ? 0.6677 0.5870 0.6112 -0.0480 0.1235  -0.0065 337 VAL B C   
196  O O   . VAL A 27 ? 0.6435 0.5780 0.5968 -0.0420 0.1272  0.0018  337 VAL B O   
197  C CB  . VAL A 27 ? 0.7812 0.6045 0.6692 -0.0313 0.1566  0.0060  337 VAL B CB  
198  C CG1 . VAL A 27 ? 0.7937 0.5626 0.6575 -0.0330 0.1789  0.0072  337 VAL B CG1 
199  C CG2 . VAL A 27 ? 0.7868 0.5996 0.6492 -0.0081 0.1329  0.0124  337 VAL B CG2 
200  N N   . VAL A 28 ? 0.6115 0.5496 0.5576 -0.0496 0.1045  -0.0132 338 VAL B N   
201  C CA  . VAL A 28 ? 0.5049 0.4829 0.4639 -0.0456 0.0861  -0.0105 338 VAL B CA  
202  C C   . VAL A 28 ? 0.6020 0.6237 0.5947 -0.0608 0.0855  -0.0119 338 VAL B C   
203  O O   . VAL A 28 ? 0.6980 0.7471 0.7059 -0.0520 0.0789  -0.0030 338 VAL B O   
204  C CB  . VAL A 28 ? 0.5232 0.5066 0.4756 -0.0475 0.0719  -0.0183 338 VAL B CB  
205  C CG1 . VAL A 28 ? 0.4266 0.4428 0.3853 -0.0416 0.0557  -0.0134 338 VAL B CG1 
206  C CG2 . VAL A 28 ? 0.5893 0.5355 0.5232 -0.0324 0.0722  -0.0173 338 VAL B CG2 
207  N N   . GLY A 29 ? 0.5974 0.6264 0.6057 -0.0838 0.0919  -0.0235 339 GLY B N   
208  C CA  . GLY A 29 ? 0.4558 0.5310 0.5050 -0.1001 0.0875  -0.0264 339 GLY B CA  
209  C C   . GLY A 29 ? 0.5826 0.6625 0.6587 -0.0944 0.1067  -0.0163 339 GLY B C   
210  O O   . GLY A 29 ? 0.6380 0.7630 0.7553 -0.0961 0.1003  -0.0120 339 GLY B O   
211  N N   . LEU A 30 ? 0.6278 0.6590 0.6803 -0.0863 0.1316  -0.0116 340 LEU B N   
212  C CA  . LEU A 30 ? 0.6500 0.6738 0.7181 -0.0801 0.1568  -0.0019 340 LEU B CA  
213  C C   . LEU A 30 ? 0.6623 0.6932 0.7237 -0.0562 0.1511  0.0119  340 LEU B C   
214  O O   . LEU A 30 ? 0.7900 0.8425 0.8854 -0.0532 0.1645  0.0189  340 LEU B O   
215  C CB  . LEU A 30 ? 0.7396 0.6981 0.7691 -0.0764 0.1852  0.0007  340 LEU B CB  
216  N N   . VAL A 31 ? 0.5730 0.5851 0.5947 -0.0397 0.1336  0.0152  341 VAL B N   
217  C CA  . VAL A 31 ? 0.4833 0.4976 0.4952 -0.0189 0.1283  0.0261  341 VAL B CA  
218  C C   . VAL A 31 ? 0.5291 0.6017 0.5830 -0.0206 0.1106  0.0281  341 VAL B C   
219  O O   . VAL A 31 ? 0.5117 0.5988 0.5834 -0.0083 0.1167  0.0381  341 VAL B O   
220  C CB  . VAL A 31 ? 0.5261 0.5049 0.4897 -0.0038 0.1135  0.0268  341 VAL B CB  
221  C CG1 . VAL A 31 ? 0.4582 0.4348 0.4097 0.0149  0.1090  0.0356  341 VAL B CG1 
222  C CG2 . VAL A 31 ? 0.4998 0.4211 0.4216 0.0007  0.1262  0.0270  341 VAL B CG2 
223  N N   . VAL A 32 ? 0.4343 0.5369 0.5005 -0.0348 0.0891  0.0193  342 VAL B N   
224  C CA  . VAL A 32 ? 0.3977 0.5523 0.4964 -0.0357 0.0685  0.0226  342 VAL B CA  
225  C C   . VAL A 32 ? 0.6232 0.8204 0.7817 -0.0464 0.0750  0.0238  342 VAL B C   
226  O O   . VAL A 32 ? 0.6861 0.9159 0.8798 -0.0349 0.0726  0.0349  342 VAL B O   
227  C CB  . VAL A 32 ? 0.5091 0.6744 0.5917 -0.0484 0.0445  0.0124  342 VAL B CB  
228  C CG1 . VAL A 32 ? 0.3874 0.6026 0.4961 -0.0498 0.0204  0.0169  342 VAL B CG1 
229  C CG2 . VAL A 32 ? 0.4463 0.5752 0.4832 -0.0363 0.0409  0.0122  342 VAL B CG2 
230  N N   . GLY A 33 ? 0.5516 0.7492 0.7277 -0.0685 0.0847  0.0121  343 GLY B N   
231  C CA  . GLY A 33 ? 0.5083 0.7477 0.7503 -0.0826 0.0924  0.0103  343 GLY B CA  
232  C C   . GLY A 33 ? 0.6337 0.9328 0.9137 -0.0976 0.0577  0.0041  343 GLY B C   
233  O O   . GLY A 33 ? 0.6959 0.9981 0.9420 -0.0968 0.0299  0.0018  343 GLY B O   
234  N N   . PRO A 34 ? 0.6124 0.9587 0.9637 -0.1122 0.0587  0.0009  344 PRO B N   
235  C CA  . PRO A 34 ? 0.6275 1.0346 1.0184 -0.1275 0.0196  -0.0054 344 PRO B CA  
236  C C   . PRO A 34 ? 0.7011 1.1393 1.0949 -0.1029 -0.0077 0.0117  344 PRO B C   
237  O O   . PRO A 34 ? 0.7914 1.2472 1.2244 -0.0819 0.0048  0.0278  344 PRO B O   
238  C CB  . PRO A 34 ? 0.6731 1.1238 1.1524 -0.1454 0.0325  -0.0108 344 PRO B CB  
239  C CG  . PRO A 34 ? 0.6684 1.0886 1.1589 -0.1280 0.0791  0.0012  344 PRO B CG  
240  C CD  . PRO A 34 ? 0.6585 1.0029 1.0583 -0.1164 0.0966  0.0025  344 PRO B CD  
241  N N   . LYS A 35 ? 0.7128 1.1517 1.0609 -0.1052 -0.0416 0.0085  345 LYS B N   
242  C CA  . LYS A 35 ? 0.6346 1.0943 0.9726 -0.0827 -0.0687 0.0251  345 LYS B CA  
243  C C   . LYS A 35 ? 0.6556 1.0799 0.9664 -0.0520 -0.0452 0.0419  345 LYS B C   
244  O O   . LYS A 35 ? 0.6448 1.0891 0.9706 -0.0292 -0.0547 0.0594  345 LYS B O   
245  C CB  . LYS A 35 ? 0.4557 0.9872 0.8730 -0.0808 -0.0943 0.0335  345 LYS B CB  
246  N N   . GLY A 36 ? 0.6327 1.0024 0.9024 -0.0509 -0.0156 0.0367  346 GLY B N   
247  C CA  . GLY A 36 ? 0.5587 0.8907 0.7965 -0.0254 0.0033  0.0490  346 GLY B CA  
248  C C   . GLY A 36 ? 0.5061 0.8447 0.7861 -0.0085 0.0291  0.0618  346 GLY B C   
249  O O   . GLY A 36 ? 0.3921 0.7057 0.6494 0.0139  0.0402  0.0732  346 GLY B O   
250  N N   . ALA A 37 ? 0.4926 0.8613 0.8343 -0.0198 0.0421  0.0591  347 ALA B N   
251  C CA  . ALA A 37 ? 0.4262 0.8011 0.8135 -0.0036 0.0720  0.0714  347 ALA B CA  
252  C C   . ALA A 37 ? 0.5481 0.8552 0.8849 0.0056  0.1102  0.0719  347 ALA B C   
253  O O   . ALA A 37 ? 0.5486 0.8379 0.8851 0.0266  0.1324  0.0837  347 ALA B O   
254  C CB  . ALA A 37 ? 0.3790 0.8042 0.8526 -0.0203 0.0794  0.0670  347 ALA B CB  
255  N N   . THR A 38 ? 0.7126 0.9780 1.0034 -0.0091 0.1178  0.0594  348 THR B N   
256  C CA  . THR A 38 ? 0.5657 0.7641 0.8030 -0.0001 0.1492  0.0605  348 THR B CA  
257  C C   . THR A 38 ? 0.5204 0.6824 0.6973 0.0200  0.1398  0.0661  348 THR B C   
258  O O   . THR A 38 ? 0.5349 0.6596 0.6865 0.0366  0.1620  0.0733  348 THR B O   
259  C CB  . THR A 38 ? 0.4358 0.5998 0.6422 -0.0188 0.1569  0.0477  348 THR B CB  
260  O OG1 . THR A 38 ? 0.5348 0.7292 0.8003 -0.0397 0.1702  0.0411  348 THR B OG1 
261  C CG2 . THR A 38 ? 0.4686 0.5602 0.6131 -0.0072 0.1848  0.0509  348 THR B CG2 
262  N N   . ILE A 39 ? 0.5950 0.7642 0.7473 0.0173  0.1089  0.0615  349 ILE B N   
263  C CA  . ILE A 39 ? 0.4005 0.5372 0.5031 0.0333  0.1008  0.0649  349 ILE B CA  
264  C C   . ILE A 39 ? 0.5693 0.7238 0.6920 0.0523  0.1017  0.0783  349 ILE B C   
265  O O   . ILE A 39 ? 0.6662 0.7846 0.7531 0.0675  0.1090  0.0823  349 ILE B O   
266  C CB  . ILE A 39 ? 0.4248 0.5632 0.5017 0.0244  0.0737  0.0562  349 ILE B CB  
267  C CG1 . ILE A 39 ? 0.4576 0.5586 0.4885 0.0379  0.0691  0.0570  349 ILE B CG1 
268  C CG2 . ILE A 39 ? 0.4402 0.6300 0.5488 0.0186  0.0498  0.0584  349 ILE B CG2 
269  C CD1 . ILE A 39 ? 0.6516 0.6998 0.6432 0.0433  0.0841  0.0539  349 ILE B CD1 
270  N N   . LYS A 40 ? 0.4647 0.6737 0.6460 0.0521  0.0936  0.0854  350 LYS B N   
271  C CA  . LYS A 40 ? 0.4227 0.6486 0.6301 0.0731  0.0974  0.1006  350 LYS B CA  
272  C C   . LYS A 40 ? 0.4895 0.6896 0.7074 0.0854  0.1363  0.1066  350 LYS B C   
273  O O   . LYS A 40 ? 0.6132 0.7924 0.8190 0.1051  0.1491  0.1159  350 LYS B O   
274  C CB  . LYS A 40 ? 0.3775 0.6712 0.6490 0.0713  0.0744  0.1078  350 LYS B CB  
275  N N   . ARG A 41 ? 0.5419 0.7371 0.7781 0.0734  0.1589  0.1008  351 ARG B N   
276  C CA  . ARG A 41 ? 0.5755 0.7361 0.8125 0.0835  0.2020  0.1056  351 ARG B CA  
277  C C   . ARG A 41 ? 0.5383 0.6217 0.6878 0.0919  0.2151  0.1021  351 ARG B C   
278  O O   . ARG A 41 ? 0.5137 0.5606 0.6443 0.1076  0.2430  0.1081  351 ARG B O   
279  C CB  . ARG A 41 ? 0.4634 0.6327 0.7375 0.0661  0.2250  0.0997  351 ARG B CB  
280  C CG  . ARG A 41 ? 0.6458 0.7650 0.9062 0.0736  0.2759  0.1031  351 ARG B CG  
281  C CD  . ARG A 41 ? 0.8088 0.9455 1.1201 0.0932  0.3009  0.1161  351 ARG B CD  
282  N NE  . ARG A 41 ? 1.0646 1.1454 1.3565 0.0985  0.3555  0.1178  351 ARG B NE  
283  C CZ  . ARG A 41 ? 1.1752 1.2683 1.5225 0.0882  0.3907  0.1172  351 ARG B CZ  
284  N NH1 . ARG A 41 ? 1.1321 1.2963 1.5632 0.0705  0.3730  0.1134  351 ARG B NH1 
285  N NH2 . ARG A 41 ? 1.2930 1.3237 1.6096 0.0942  0.4447  0.1193  351 ARG B NH2 
286  N N   . ILE A 42 ? 0.4785 0.5358 0.5747 0.0819  0.1944  0.0918  352 ILE B N   
287  C CA  . ILE A 42 ? 0.5674 0.5569 0.5847 0.0892  0.1983  0.0876  352 ILE B CA  
288  C C   . ILE A 42 ? 0.6328 0.6130 0.6314 0.1046  0.1887  0.0917  352 ILE B C   
289  O O   . ILE A 42 ? 0.7058 0.6333 0.6569 0.1154  0.2053  0.0916  352 ILE B O   
290  C CB  . ILE A 42 ? 0.5160 0.4891 0.4960 0.0763  0.1753  0.0767  352 ILE B CB  
291  C CG1 . ILE A 42 ? 0.5167 0.4821 0.5040 0.0625  0.1925  0.0731  352 ILE B CG1 
292  C CG2 . ILE A 42 ? 0.5293 0.4431 0.4371 0.0847  0.1683  0.0723  352 ILE B CG2 
293  C CD1 . ILE A 42 ? 0.5687 0.5127 0.5205 0.0522  0.1745  0.0639  352 ILE B CD1 
294  N N   . GLN A 43 ? 0.4717 0.4977 0.5024 0.1051  0.1632  0.0949  353 GLN B N   
295  C CA  . GLN A 43 ? 0.5450 0.5603 0.5598 0.1190  0.1568  0.0995  353 GLN B CA  
296  C C   . GLN A 43 ? 0.6066 0.6160 0.6428 0.1368  0.1860  0.1112  353 GLN B C   
297  O O   . GLN A 43 ? 0.7677 0.7335 0.7659 0.1482  0.1975  0.1113  353 GLN B O   
298  C CB  . GLN A 43 ? 0.5194 0.5800 0.5593 0.1159  0.1265  0.1023  353 GLN B CB  
299  C CG  . GLN A 43 ? 0.6262 0.6853 0.6415 0.0997  0.1024  0.0900  353 GLN B CG  
300  C CD  . GLN A 43 ? 0.6408 0.7354 0.6709 0.0964  0.0775  0.0926  353 GLN B CD  
301  O OE1 . GLN A 43 ? 0.5236 0.6049 0.5348 0.1039  0.0716  0.0950  353 GLN B OE1 
302  N NE2 . GLN A 43 ? 0.6753 0.8107 0.7351 0.0839  0.0640  0.0913  353 GLN B NE2 
303  N N   . GLN A 44 ? 0.4894 0.5420 0.5902 0.1389  0.1992  0.1202  354 GLN B N   
304  C CA  . GLN A 44 ? 0.6858 0.7370 0.8188 0.1579  0.2302  0.1326  354 GLN B CA  
305  C C   . GLN A 44 ? 0.6489 0.6338 0.7367 0.1618  0.2710  0.1282  354 GLN B C   
306  O O   . GLN A 44 ? 0.7160 0.6628 0.7834 0.1777  0.2957  0.1326  354 GLN B O   
307  C CB  . GLN A 44 ? 0.7525 0.8737 0.9782 0.1586  0.2314  0.1428  354 GLN B CB  
308  C CG  . GLN A 44 ? 0.8610 1.0449 1.1254 0.1561  0.1888  0.1483  354 GLN B CG  
309  C CD  . GLN A 44 ? 0.8937 1.1482 1.2454 0.1491  0.1810  0.1528  354 GLN B CD  
310  O OE1 . GLN A 44 ? 0.8744 1.1339 1.2665 0.1456  0.2112  0.1518  354 GLN B OE1 
311  N NE2 . GLN A 44 ? 0.9155 1.2229 1.2954 0.1459  0.1406  0.1571  354 GLN B NE2 
312  N N   . GLN A 45 ? 0.5753 0.5393 0.6409 0.1476  0.2805  0.1196  355 GLN B N   
313  C CA  . GLN A 45 ? 0.8552 0.7502 0.8698 0.1512  0.3214  0.1168  355 GLN B CA  
314  C C   . GLN A 45 ? 0.8471 0.6691 0.7644 0.1541  0.3141  0.1076  355 GLN B C   
315  O O   . GLN A 45 ? 0.9183 0.6777 0.7860 0.1634  0.3462  0.1068  355 GLN B O   
316  C CB  . GLN A 45 ? 0.6737 0.5641 0.6910 0.1356  0.3350  0.1121  355 GLN B CB  
317  C CG  . GLN A 45 ? 0.8965 0.7125 0.8604 0.1395  0.3830  0.1113  355 GLN B CG  
318  C CD  . GLN A 45 ? 1.0562 0.8759 1.0449 0.1254  0.4068  0.1104  355 GLN B CD  
319  O OE1 . GLN A 45 ? 1.0661 0.9558 1.1383 0.1145  0.3969  0.1117  355 GLN B OE1 
320  N NE2 . GLN A 45 ? 1.1930 0.9333 1.1053 0.1248  0.4382  0.1077  355 GLN B NE2 
321  N N   . THR A 46 ? 0.6670 0.4949 0.5574 0.1459  0.2728  0.0996  356 THR B N   
322  C CA  . THR A 46 ? 0.7028 0.4700 0.5117 0.1462  0.2590  0.0891  356 THR B CA  
323  C C   . THR A 46 ? 0.7341 0.5055 0.5429 0.1535  0.2432  0.0885  356 THR B C   
324  O O   . THR A 46 ? 0.7894 0.5150 0.5393 0.1520  0.2298  0.0780  356 THR B O   
325  C CB  . THR A 46 ? 0.7216 0.4865 0.5025 0.1326  0.2267  0.0797  356 THR B CB  
326  O OG1 . THR A 46 ? 0.6399 0.4686 0.4740 0.1251  0.1967  0.0802  356 THR B OG1 
327  C CG2 . THR A 46 ? 0.6891 0.4367 0.4594 0.1259  0.2459  0.0806  356 THR B CG2 
328  N N   . HIS A 47 ? 0.6318 0.4552 0.5049 0.1612  0.2439  0.0997  357 HIS B N   
329  C CA  . HIS A 47 ? 0.7152 0.5399 0.5899 0.1694  0.2337  0.1019  357 HIS B CA  
330  C C   . HIS A 47 ? 0.7554 0.5793 0.6034 0.1576  0.1967  0.0905  357 HIS B C   
331  O O   . HIS A 47 ? 0.6255 0.4114 0.4350 0.1582  0.1917  0.0824  357 HIS B O   
332  C CB  . HIS A 47 ? 0.6840 0.4460 0.5160 0.1816  0.2647  0.1005  357 HIS B CB  
333  C CG  . HIS A 47 ? 1.1760 0.9338 1.0366 0.1948  0.3079  0.1115  357 HIS B CG  
334  N ND1 . HIS A 47 ? 1.2101 0.9133 1.0258 0.1942  0.3398  0.1065  357 HIS B ND1 
335  C CD2 . HIS A 47 ? 1.1384 0.9383 1.0700 0.2099  0.3259  0.1280  357 HIS B CD2 
336  C CE1 . HIS A 47 ? 1.2405 0.9528 1.1023 0.2073  0.3799  0.1184  357 HIS B CE1 
337  N NE2 . HIS A 47 ? 1.1887 0.9629 1.1259 0.2175  0.3705  0.1317  357 HIS B NE2 
338  N N   . THR A 48 ? 0.5617 0.4271 0.4338 0.1457  0.1726  0.0888  358 THR B N   
339  C CA  . THR A 48 ? 0.6326 0.5010 0.4891 0.1344  0.1415  0.0783  358 THR B CA  
340  C C   . THR A 48 ? 0.6964 0.6218 0.5993 0.1306  0.1234  0.0848  358 THR B C   
341  O O   . THR A 48 ? 0.6028 0.5697 0.5488 0.1335  0.1277  0.0956  358 THR B O   
342  C CB  . THR A 48 ? 0.6287 0.4777 0.4545 0.1231  0.1298  0.0674  358 THR B CB  
343  O OG1 . THR A 48 ? 0.6046 0.4849 0.4611 0.1178  0.1358  0.0725  358 THR B OG1 
344  C CG2 . THR A 48 ? 0.6605 0.4445 0.4253 0.1272  0.1426  0.0608  358 THR B CG2 
345  N N   . TYR A 49 ? 0.5976 0.5230 0.4906 0.1234  0.1031  0.0773  359 TYR B N   
346  C CA  . TYR A 49 ? 0.5909 0.5575 0.5110 0.1174  0.0860  0.0807  359 TYR B CA  
347  C C   . TYR A 49 ? 0.5238 0.4946 0.4371 0.1019  0.0693  0.0683  359 TYR B C   
348  O O   . TYR A 49 ? 0.5836 0.5271 0.4744 0.0972  0.0615  0.0567  359 TYR B O   
349  C CB  . TYR A 49 ? 0.4941 0.4516 0.4087 0.1221  0.0838  0.0831  359 TYR B CB  
350  C CG  . TYR A 49 ? 0.5053 0.4919 0.4325 0.1152  0.0684  0.0853  359 TYR B CG  
351  C CD1 . TYR A 49 ? 0.5858 0.5611 0.5010 0.1034  0.0588  0.0729  359 TYR B CD1 
352  C CD2 . TYR A 49 ? 0.5156 0.5393 0.4661 0.1205  0.0636  0.0996  359 TYR B CD2 
353  C CE1 . TYR A 49 ? 0.5841 0.5774 0.5032 0.0968  0.0504  0.0744  359 TYR B CE1 
354  C CE2 . TYR A 49 ? 0.4769 0.5188 0.4256 0.1136  0.0493  0.1012  359 TYR B CE2 
355  C CZ  . TYR A 49 ? 0.5300 0.5532 0.4595 0.1016  0.0455  0.0884  359 TYR B CZ  
356  O OH  . TYR A 49 ? 0.5376 0.5708 0.4582 0.0945  0.0367  0.0894  359 TYR B OH  
357  N N   . ILE A 50 ? 0.5461 0.5509 0.4822 0.0939  0.0635  0.0701  360 ILE B N   
358  C CA  . ILE A 50 ? 0.5593 0.5648 0.4902 0.0800  0.0530  0.0591  360 ILE B CA  
359  C C   . ILE A 50 ? 0.6048 0.6416 0.5511 0.0701  0.0398  0.0581  360 ILE B C   
360  O O   . ILE A 50 ? 0.3789 0.4488 0.3468 0.0698  0.0369  0.0664  360 ILE B O   
361  C CB  . ILE A 50 ? 0.5721 0.5772 0.5072 0.0761  0.0629  0.0590  360 ILE B CB  
362  C CG1 . ILE A 50 ? 0.5104 0.4728 0.4160 0.0860  0.0787  0.0597  360 ILE B CG1 
363  C CG2 . ILE A 50 ? 0.5676 0.5704 0.4975 0.0628  0.0538  0.0487  360 ILE B CG2 
364  C CD1 . ILE A 50 ? 0.5618 0.5144 0.4657 0.0832  0.0954  0.0610  360 ILE B CD1 
365  N N   . VAL A 51 ? 0.5336 0.5586 0.4688 0.0621  0.0317  0.0476  361 VAL B N   
366  C CA  . VAL A 51 ? 0.5799 0.6229 0.5194 0.0508  0.0236  0.0438  361 VAL B CA  
367  C C   . VAL A 51 ? 0.5917 0.6374 0.5343 0.0381  0.0218  0.0344  361 VAL B C   
368  O O   . VAL A 51 ? 0.5270 0.5496 0.4625 0.0379  0.0232  0.0272  361 VAL B O   
369  C CB  . VAL A 51 ? 0.6170 0.6424 0.5471 0.0499  0.0229  0.0378  361 VAL B CB  
370  C CG1 . VAL A 51 ? 0.3750 0.4098 0.3015 0.0376  0.0201  0.0327  361 VAL B CG1 
371  C CG2 . VAL A 51 ? 0.5360 0.5543 0.4615 0.0614  0.0280  0.0472  361 VAL B CG2 
372  N N   . THR A 52 ? 0.5138 0.5856 0.4659 0.0275  0.0174  0.0346  362 THR B N   
373  C CA  . THR A 52 ? 0.4697 0.5419 0.4247 0.0130  0.0184  0.0247  362 THR B CA  
374  C C   . THR A 52 ? 0.4343 0.4929 0.3762 0.0035  0.0170  0.0135  362 THR B C   
375  O O   . THR A 52 ? 0.4490 0.5124 0.3807 0.0012  0.0131  0.0140  362 THR B O   
376  C CB  . THR A 52 ? 0.4893 0.5956 0.4632 0.0026  0.0133  0.0267  362 THR B CB  
377  O OG1 . THR A 52 ? 0.4126 0.5297 0.4082 0.0107  0.0211  0.0357  362 THR B OG1 
378  C CG2 . THR A 52 ? 0.4814 0.5849 0.4551 -0.0165 0.0151  0.0137  362 THR B CG2 
379  N N   . PRO A 53 ? 0.4823 0.5200 0.4226 -0.0008 0.0225  0.0044  363 PRO B N   
380  C CA  . PRO A 53 ? 0.4559 0.4796 0.3904 -0.0088 0.0259  -0.0065 363 PRO B CA  
381  C C   . PRO A 53 ? 0.5387 0.5736 0.4629 -0.0262 0.0254  -0.0131 363 PRO B C   
382  O O   . PRO A 53 ? 0.5796 0.6344 0.5079 -0.0350 0.0202  -0.0121 363 PRO B O   
383  C CB  . PRO A 53 ? 0.4606 0.4610 0.3999 -0.0067 0.0312  -0.0119 363 PRO B CB  
384  C CG  . PRO A 53 ? 0.5789 0.5817 0.5184 -0.0051 0.0326  -0.0058 363 PRO B CG  
385  C CD  . PRO A 53 ? 0.5442 0.5650 0.4858 0.0035  0.0280  0.0049  363 PRO B CD  
386  N N   . SER A 54 ? 0.5068 0.5271 0.4180 -0.0322 0.0316  -0.0211 364 SER B N   
387  C CA  . SER A 54 ? 0.5972 0.6181 0.4850 -0.0494 0.0315  -0.0291 364 SER B CA  
388  C C   . SER A 54 ? 0.6053 0.6189 0.4947 -0.0648 0.0372  -0.0410 364 SER B C   
389  O O   . SER A 54 ? 0.7760 0.7838 0.6842 -0.0606 0.0421  -0.0407 364 SER B O   
390  C CB  . SER A 54 ? 0.5457 0.5428 0.4139 -0.0511 0.0439  -0.0348 364 SER B CB  
391  N N   . ARG A 55 ? 0.7919 0.8003 0.6554 -0.0834 0.0372  -0.0518 365 ARG B N   
392  C CA  . ARG A 55 ? 0.8873 0.8888 0.7499 -0.1021 0.0421  -0.0649 365 ARG B CA  
393  C C   . ARG A 55 ? 0.9439 0.9118 0.8161 -0.0994 0.0639  -0.0725 365 ARG B C   
394  O O   . ARG A 55 ? 0.9750 0.9383 0.8647 -0.0997 0.0691  -0.0729 365 ARG B O   
395  C CB  . ARG A 55 ? 0.8610 0.8575 0.6852 -0.1238 0.0364  -0.0772 365 ARG B CB  
396  N N   . ASP A 56 ? 0.6353 0.5778 0.4982 -0.0955 0.0785  -0.0776 366 ASP B N   
397  C CA  . ASP A 56 ? 0.5983 0.5101 0.4759 -0.0915 0.0992  -0.0848 366 ASP B CA  
398  C C   . ASP A 56 ? 0.5799 0.4894 0.4867 -0.0693 0.1017  -0.0765 366 ASP B C   
399  O O   . ASP A 56 ? 0.5309 0.4178 0.4537 -0.0643 0.1190  -0.0824 366 ASP B O   
400  C CB  . ASP A 56 ? 0.7434 0.6234 0.5927 -0.1088 0.1196  -0.1017 366 ASP B CB  
401  C CG  . ASP A 56 ? 0.8278 0.7066 0.6477 -0.1340 0.1150  -0.1135 366 ASP B CG  
402  O OD1 . ASP A 56 ? 0.7238 0.5917 0.5550 -0.1411 0.1227  -0.1193 366 ASP B OD1 
403  O OD2 . ASP A 56 ? 0.8035 0.6906 0.5884 -0.1472 0.1028  -0.1172 366 ASP B OD2 
404  N N   . LYS A 57 ? 0.4660 0.3988 0.3835 -0.0562 0.0848  -0.0637 367 LYS B N   
405  C CA  . LYS A 57 ? 0.5743 0.5073 0.5202 -0.0375 0.0823  -0.0575 367 LYS B CA  
406  C C   . LYS A 57 ? 0.4913 0.4229 0.4545 -0.0239 0.0720  -0.0501 367 LYS B C   
407  O O   . LYS A 57 ? 0.4393 0.3655 0.3932 -0.0287 0.0725  -0.0496 367 LYS B O   
408  C CB  . LYS A 57 ? 0.5441 0.4945 0.4847 -0.0323 0.0729  -0.0495 367 LYS B CB  
409  C CG  . LYS A 57 ? 0.6768 0.6155 0.6104 -0.0368 0.0884  -0.0550 367 LYS B CG  
410  C CD  . LYS A 57 ? 1.0114 0.9336 0.9814 -0.0308 0.1045  -0.0626 367 LYS B CD  
411  C CE  . LYS A 57 ? 1.0234 0.9569 1.0336 -0.0138 0.0900  -0.0564 367 LYS B CE  
412  N NZ  . LYS A 57 ? 0.9153 0.8391 0.9711 -0.0063 0.0989  -0.0630 367 LYS B NZ  
413  N N   . GLU A 58 ? 0.6479 0.5807 0.6338 -0.0077 0.0629  -0.0450 368 GLU B N   
414  C CA  . GLU A 58 ? 0.7054 0.6299 0.6975 0.0068  0.0500  -0.0377 368 GLU B CA  
415  C C   . GLU A 58 ? 0.5132 0.4448 0.4803 0.0057  0.0427  -0.0292 368 GLU B C   
416  O O   . GLU A 58 ? 0.5163 0.4668 0.4760 0.0036  0.0379  -0.0252 368 GLU B O   
417  C CB  . GLU A 58 ? 0.8238 0.7514 0.8403 0.0217  0.0358  -0.0354 368 GLU B CB  
418  C CG  . GLU A 58 ? 1.0660 0.9916 1.1225 0.0243  0.0435  -0.0435 368 GLU B CG  
419  C CD  . GLU A 58 ? 1.1465 1.0800 1.2343 0.0366  0.0255  -0.0427 368 GLU B CD  
420  O OE1 . GLU A 58 ? 1.1138 1.0528 1.1838 0.0397  0.0108  -0.0374 368 GLU B OE1 
421  O OE2 . GLU A 58 ? 1.2021 1.1364 1.3353 0.0427  0.0263  -0.0481 368 GLU B OE2 
422  N N   . PRO A 59 ? 0.4854 0.4002 0.4410 0.0080  0.0446  -0.0254 369 PRO B N   
423  C CA  . PRO A 59 ? 0.4642 0.3839 0.4014 0.0065  0.0438  -0.0176 369 PRO B CA  
424  C C   . PRO A 59 ? 0.5345 0.4494 0.4623 0.0226  0.0308  -0.0087 369 PRO B C   
425  O O   . PRO A 59 ? 0.5510 0.4411 0.4591 0.0324  0.0291  -0.0021 369 PRO B O   
426  C CB  . PRO A 59 ? 0.4893 0.3831 0.4166 0.0033  0.0559  -0.0176 369 PRO B CB  
427  C CG  . PRO A 59 ? 0.4905 0.3598 0.4263 0.0148  0.0540  -0.0193 369 PRO B CG  
428  C CD  . PRO A 59 ? 0.4603 0.3476 0.4200 0.0119  0.0521  -0.0276 369 PRO B CD  
429  N N   . VAL A 60 ? 0.5152 0.4481 0.4514 0.0250  0.0229  -0.0089 370 VAL B N   
430  C CA  . VAL A 60 ? 0.5599 0.4858 0.4872 0.0379  0.0110  -0.0037 370 VAL B CA  
431  C C   . VAL A 60 ? 0.5912 0.5374 0.5147 0.0356  0.0144  0.0014  370 VAL B C   
432  O O   . VAL A 60 ? 0.3961 0.3636 0.3314 0.0285  0.0169  -0.0005 370 VAL B O   
433  C CB  . VAL A 60 ? 0.5587 0.4827 0.5068 0.0443  -0.0013 -0.0096 370 VAL B CB  
434  C CG1 . VAL A 60 ? 0.4128 0.3288 0.3496 0.0539  -0.0146 -0.0071 370 VAL B CG1 
435  C CG2 . VAL A 60 ? 0.4218 0.3277 0.3807 0.0507  -0.0072 -0.0125 370 VAL B CG2 
436  N N   . PHE A 61 ? 0.5830 0.5182 0.4871 0.0429  0.0161  0.0089  371 PHE B N   
437  C CA  . PHE A 61 ? 0.5382 0.4884 0.4417 0.0453  0.0205  0.0154  371 PHE B CA  
438  C C   . PHE A 61 ? 0.5721 0.5078 0.4668 0.0551  0.0120  0.0147  371 PHE B C   
439  O O   . PHE A 61 ? 0.6283 0.5361 0.5057 0.0621  0.0024  0.0118  371 PHE B O   
440  C CB  . PHE A 61 ? 0.4184 0.3631 0.3108 0.0474  0.0336  0.0232  371 PHE B CB  
441  C CG  . PHE A 61 ? 0.4837 0.4492 0.3936 0.0345  0.0430  0.0228  371 PHE B CG  
442  C CD1 . PHE A 61 ? 0.3975 0.3997 0.3315 0.0283  0.0459  0.0266  371 PHE B CD1 
443  C CD2 . PHE A 61 ? 0.4980 0.4454 0.4014 0.0285  0.0478  0.0184  371 PHE B CD2 
444  C CE1 . PHE A 61 ? 0.4322 0.4559 0.3859 0.0138  0.0508  0.0238  371 PHE B CE1 
445  C CE2 . PHE A 61 ? 0.4252 0.3891 0.3457 0.0136  0.0576  0.0156  371 PHE B CE2 
446  C CZ  . PHE A 61 ? 0.5034 0.5071 0.4502 0.0049  0.0579  0.0171  371 PHE B CZ  
447  N N   . GLU A 62 ? 0.4629 0.4154 0.3677 0.0553  0.0144  0.0174  372 GLU B N   
448  C CA  . GLU A 62 ? 0.5708 0.5088 0.4696 0.0620  0.0103  0.0158  372 GLU B CA  
449  C C   . GLU A 62 ? 0.5741 0.5045 0.4569 0.0705  0.0213  0.0249  372 GLU B C   
450  O O   . GLU A 62 ? 0.6458 0.5988 0.5411 0.0714  0.0303  0.0336  372 GLU B O   
451  C CB  . GLU A 62 ? 0.5637 0.5170 0.4826 0.0572  0.0110  0.0130  372 GLU B CB  
452  C CG  . GLU A 62 ? 0.7283 0.6861 0.6671 0.0493  0.0063  0.0032  372 GLU B CG  
453  C CD  . GLU A 62 ? 0.9208 0.8820 0.8764 0.0452  0.0117  -0.0009 372 GLU B CD  
454  O OE1 . GLU A 62 ? 1.0457 0.9975 1.0200 0.0447  0.0058  -0.0103 372 GLU B OE1 
455  O OE2 . GLU A 62 ? 0.9494 0.9210 0.8997 0.0428  0.0215  0.0056  372 GLU B OE2 
456  N N   . VAL A 63 ? 0.6394 0.5357 0.4932 0.0774  0.0203  0.0231  373 VAL B N   
457  C CA  . VAL A 63 ? 0.6315 0.5109 0.4651 0.0860  0.0363  0.0306  373 VAL B CA  
458  C C   . VAL A 63 ? 0.6488 0.5057 0.4692 0.0904  0.0349  0.0263  373 VAL B C   
459  O O   . VAL A 63 ? 0.6846 0.5185 0.4903 0.0882  0.0188  0.0152  373 VAL B O   
460  C CB  . VAL A 63 ? 0.6162 0.4619 0.4140 0.0898  0.0423  0.0315  373 VAL B CB  
461  C CG1 . VAL A 63 ? 0.8315 0.6580 0.6113 0.0985  0.0662  0.0392  373 VAL B CG1 
462  C CG2 . VAL A 63 ? 0.6292 0.4927 0.4416 0.0833  0.0451  0.0340  373 VAL B CG2 
463  N N   . THR A 64 ? 0.4893 0.3530 0.3180 0.0966  0.0509  0.0349  374 THR B N   
464  C CA  . THR A 64 ? 0.7139 0.5535 0.5312 0.1003  0.0552  0.0315  374 THR B CA  
465  C C   . THR A 64 ? 0.7653 0.5783 0.5598 0.1116  0.0781  0.0388  374 THR B C   
466  O O   . THR A 64 ? 0.6496 0.4836 0.4624 0.1186  0.0942  0.0518  374 THR B O   
467  C CB  . THR A 64 ? 0.5490 0.4141 0.3963 0.0991  0.0573  0.0362  374 THR B CB  
468  O OG1 . THR A 64 ? 0.6164 0.5015 0.4834 0.0883  0.0419  0.0288  374 THR B OG1 
469  C CG2 . THR A 64 ? 0.5118 0.3463 0.3476 0.1015  0.0648  0.0317  374 THR B CG2 
470  N N   . GLY A 65 ? 0.7936 0.5601 0.5509 0.1128  0.0798  0.0293  375 GLY B N   
471  C CA  . GLY A 65 ? 0.8400 0.5705 0.5686 0.1233  0.1058  0.0339  375 GLY B CA  
472  C C   . GLY A 65 ? 0.8902 0.5607 0.5603 0.1198  0.0995  0.0182  375 GLY B C   
473  O O   . GLY A 65 ? 0.9054 0.5689 0.5667 0.1098  0.0715  0.0042  375 GLY B O   
474  N N   . MET A 66 ? 0.7377 0.3642 0.3688 0.1282  0.1259  0.0203  376 MET B N   
475  C CA  . MET A 66 ? 0.8082 0.3682 0.3690 0.1247  0.1210  0.0050  376 MET B CA  
476  C C   . MET A 66 ? 1.0133 0.5616 0.5407 0.1198  0.0960  -0.0005 376 MET B C   
477  O O   . MET A 66 ? 0.9973 0.5728 0.5437 0.1224  0.1003  0.0103  376 MET B O   
478  C CB  . MET A 66 ? 0.9251 0.4350 0.4452 0.1356  0.1611  0.0095  376 MET B CB  
479  C CG  . MET A 66 ? 1.0939 0.6053 0.6418 0.1434  0.1874  0.0154  376 MET B CG  
480  S SD  . MET A 66 ? 1.1994 0.6920 0.7417 0.1312  0.1667  -0.0028 376 MET B SD  
481  C CE  . MET A 66 ? 1.1576 0.5656 0.6035 0.1215  0.1557  -0.0265 376 MET B CE  
482  N N   . PRO A 67 ? 1.0512 0.5587 0.5297 0.1125  0.0679  -0.0172 377 PRO B N   
483  C CA  . PRO A 67 ? 0.9960 0.4918 0.4430 0.1107  0.0394  -0.0203 377 PRO B CA  
484  C C   . PRO A 67 ? 0.9291 0.3920 0.3294 0.1194  0.0642  -0.0091 377 PRO B C   
485  O O   . PRO A 67 ? 0.9482 0.4293 0.3580 0.1204  0.0551  -0.0020 377 PRO B O   
486  C CB  . PRO A 67 ? 0.9541 0.4018 0.3478 0.1033  0.0075  -0.0402 377 PRO B CB  
487  C CG  . PRO A 67 ? 0.9340 0.3959 0.3655 0.0959  0.0106  -0.0494 377 PRO B CG  
488  C CD  . PRO A 67 ? 1.0541 0.5275 0.5094 0.1049  0.0572  -0.0344 377 PRO B CD  
489  N N   . GLU A 68 ? 1.0427 0.4539 0.3934 0.1255  0.0996  -0.0075 378 GLU B N   
490  C CA  . GLU A 68 ? 1.1169 0.4941 0.4271 0.1332  0.1315  0.0035  378 GLU B CA  
491  C C   . GLU A 68 ? 1.0220 0.4629 0.4104 0.1364  0.1558  0.0201  378 GLU B C   
492  O O   . GLU A 68 ? 0.9625 0.4014 0.3445 0.1376  0.1659  0.0283  378 GLU B O   
493  C CB  . GLU A 68 ? 1.1120 0.4174 0.3555 0.1390  0.1698  0.0006  378 GLU B CB  
494  N N   . ASN A 69 ? 0.8952 0.3908 0.3563 0.1373  0.1641  0.0251  379 ASN B N   
495  C CA  . ASN A 69 ? 1.0373 0.5970 0.5739 0.1392  0.1800  0.0396  379 ASN B CA  
496  C C   . ASN A 69 ? 1.0601 0.6692 0.6347 0.1304  0.1474  0.0392  379 ASN B C   
497  O O   . ASN A 69 ? 0.9688 0.6108 0.5788 0.1285  0.1571  0.0478  379 ASN B O   
498  C CB  . ASN A 69 ? 0.9678 0.5666 0.5629 0.1450  0.1943  0.0466  379 ASN B CB  
499  C CG  . ASN A 69 ? 1.0459 0.6033 0.6202 0.1566  0.2371  0.0512  379 ASN B CG  
500  O OD1 . ASN A 69 ? 1.1125 0.6324 0.6542 0.1606  0.2668  0.0543  379 ASN B OD1 
501  N ND2 . ASN A 69 ? 1.0311 0.5906 0.6232 0.1626  0.2446  0.0520  379 ASN B ND2 
502  N N   . VAL A 70 ? 0.9418 0.5559 0.5131 0.1240  0.1109  0.0284  380 VAL B N   
503  C CA  . VAL A 70 ? 0.7290 0.3847 0.3360 0.1166  0.0831  0.0271  380 VAL B CA  
504  C C   . VAL A 70 ? 0.8201 0.4458 0.3867 0.1169  0.0781  0.0281  380 VAL B C   
505  O O   . VAL A 70 ? 0.7832 0.4404 0.3818 0.1129  0.0762  0.0330  380 VAL B O   
506  C CB  . VAL A 70 ? 0.7890 0.4547 0.4083 0.1105  0.0501  0.0148  380 VAL B CB  
507  C CG1 . VAL A 70 ? 0.7001 0.3799 0.3294 0.1055  0.0202  0.0101  380 VAL B CG1 
508  C CG2 . VAL A 70 ? 0.6750 0.3874 0.3522 0.1084  0.0557  0.0179  380 VAL B CG2 
509  N N   . ASP A 71 ? 0.9839 0.5430 0.4741 0.1215  0.0769  0.0236  381 ASP B N   
510  C CA  . ASP A 71 ? 1.0802 0.5992 0.5195 0.1245  0.0752  0.0273  381 ASP B CA  
511  C C   . ASP A 71 ? 0.9688 0.4892 0.4185 0.1258  0.1171  0.0397  381 ASP B C   
512  O O   . ASP A 71 ? 0.9328 0.4517 0.3810 0.1243  0.1187  0.0451  381 ASP B O   
513  C CB  . ASP A 71 ? 1.2664 0.7062 0.6098 0.1297  0.0649  0.0203  381 ASP B CB  
514  C CG  . ASP A 71 ? 1.3690 0.8094 0.7069 0.1264  0.0166  0.0063  381 ASP B CG  
515  O OD1 . ASP A 71 ? 1.4675 0.8623 0.7522 0.1261  0.0091  -0.0042 381 ASP B OD1 
516  O OD2 . ASP A 71 ? 1.3996 0.8867 0.7907 0.1229  -0.0120 0.0046  381 ASP B OD2 
517  N N   . ARG A 72 ? 1.0304 0.5532 0.4953 0.1287  0.1529  0.0443  382 ARG B N   
518  C CA  . ARG A 72 ? 1.0555 0.5894 0.5483 0.1288  0.1938  0.0552  382 ARG B CA  
519  C C   . ARG A 72 ? 1.0068 0.6173 0.5847 0.1200  0.1857  0.0592  382 ARG B C   
520  O O   . ARG A 72 ? 0.9872 0.6037 0.5807 0.1151  0.2036  0.0645  382 ARG B O   
521  C CB  . ARG A 72 ? 0.9770 0.5042 0.4815 0.1356  0.2321  0.0594  382 ARG B CB  
522  N N   . ALA A 73 ? 0.9041 0.5688 0.5334 0.1166  0.1606  0.0558  383 ALA B N   
523  C CA  . ALA A 73 ? 0.8406 0.5719 0.5397 0.1072  0.1506  0.0579  383 ALA B CA  
524  C C   . ALA A 73 ? 0.7879 0.5144 0.4748 0.1003  0.1296  0.0535  383 ALA B C   
525  O O   . ALA A 73 ? 0.7275 0.4851 0.4519 0.0913  0.1345  0.0554  383 ALA B O   
526  C CB  . ALA A 73 ? 0.7492 0.5276 0.4922 0.1065  0.1314  0.0561  383 ALA B CB  
527  N N   . ARG A 74 ? 0.7659 0.4537 0.4035 0.1044  0.1050  0.0472  384 ARG B N   
528  C CA  . ARG A 74 ? 0.6900 0.3694 0.3171 0.1018  0.0849  0.0449  384 ARG B CA  
529  C C   . ARG A 74 ? 0.8801 0.5242 0.4778 0.1018  0.1096  0.0520  384 ARG B C   
530  O O   . ARG A 74 ? 0.7843 0.4433 0.4043 0.0953  0.1083  0.0528  384 ARG B O   
531  C CB  . ARG A 74 ? 0.7240 0.3677 0.3061 0.1086  0.0521  0.0378  384 ARG B CB  
532  C CG  . ARG A 74 ? 0.7601 0.3831 0.3223 0.1114  0.0319  0.0383  384 ARG B CG  
533  C CD  . ARG A 74 ? 0.7888 0.3767 0.3077 0.1197  -0.0045 0.0320  384 ARG B CD  
534  N NE  . ARG A 74 ? 1.0292 0.6593 0.5975 0.1151  -0.0298 0.0215  384 ARG B NE  
535  C CZ  . ARG A 74 ? 1.0073 0.6750 0.6279 0.1120  -0.0498 0.0173  384 ARG B CZ  
536  N NH1 . ARG A 74 ? 1.1973 0.8656 0.8265 0.1137  -0.0490 0.0227  384 ARG B NH1 
537  N NH2 . ARG A 74 ? 0.8833 0.5842 0.5478 0.1069  -0.0666 0.0076  384 ARG B NH2 
538  N N   . GLU A 75 ? 0.9301 0.5223 0.4753 0.1085  0.1362  0.0570  385 GLU B N   
539  C CA  . GLU A 75 ? 1.0409 0.5909 0.5530 0.1084  0.1658  0.0644  385 GLU B CA  
540  C C   . GLU A 75 ? 0.7992 0.3988 0.3830 0.0959  0.1941  0.0675  385 GLU B C   
541  O O   . GLU A 75 ? 0.8082 0.4003 0.3961 0.0892  0.2046  0.0698  385 GLU B O   
542  C CB  . GLU A 75 ? 1.2009 0.6783 0.6364 0.1179  0.1934  0.0685  385 GLU B CB  
543  C CG  . GLU A 75 ? 1.4640 0.8624 0.8007 0.1283  0.1751  0.0696  385 GLU B CG  
544  C CD  . GLU A 75 ? 1.6539 1.0269 0.9721 0.1280  0.1799  0.0769  385 GLU B CD  
545  O OE1 . GLU A 75 ? 1.6186 1.0282 0.9758 0.1251  0.1506  0.0747  385 GLU B OE1 
546  O OE2 . GLU A 75 ? 1.7839 1.1014 1.0561 0.1303  0.2145  0.0828  385 GLU B OE2 
547  N N   . GLU A 76 ? 0.8765 0.5264 0.5186 0.0926  0.2052  0.0676  386 GLU B N   
548  C CA  . GLU A 76 ? 0.9459 0.6496 0.6626 0.0801  0.2254  0.0695  386 GLU B CA  
549  C C   . GLU A 76 ? 0.9309 0.6790 0.6882 0.0673  0.1995  0.0635  386 GLU B C   
550  O O   . GLU A 76 ? 0.9878 0.7548 0.7807 0.0540  0.2143  0.0627  386 GLU B O   
551  C CB  . GLU A 76 ? 0.9294 0.6814 0.7020 0.0825  0.2338  0.0722  386 GLU B CB  
552  C CG  . GLU A 76 ? 1.1798 0.8897 0.9246 0.0938  0.2709  0.0782  386 GLU B CG  
553  C CD  . GLU A 76 ? 1.3201 1.0805 1.1300 0.0986  0.2811  0.0829  386 GLU B CD  
554  O OE1 . GLU A 76 ? 1.2959 1.1245 1.1699 0.0927  0.2574  0.0824  386 GLU B OE1 
555  O OE2 . GLU A 76 ? 1.3701 1.0982 1.1636 0.1094  0.3133  0.0877  386 GLU B OE2 
556  N N   . ILE A 77 ? 0.6362 0.3989 0.3898 0.0700  0.1634  0.0580  387 ILE B N   
557  C CA  . ILE A 77 ? 0.6687 0.4642 0.4530 0.0590  0.1423  0.0515  387 ILE B CA  
558  C C   . ILE A 77 ? 0.7334 0.4839 0.4812 0.0582  0.1459  0.0516  387 ILE B C   
559  O O   . ILE A 77 ? 0.6354 0.4005 0.4105 0.0451  0.1540  0.0486  387 ILE B O   
560  C CB  . ILE A 77 ? 0.6506 0.4675 0.4409 0.0629  0.1091  0.0460  387 ILE B CB  
561  C CG1 . ILE A 77 ? 0.5270 0.3896 0.3568 0.0627  0.1076  0.0474  387 ILE B CG1 
562  C CG2 . ILE A 77 ? 0.6284 0.4648 0.4399 0.0535  0.0921  0.0389  387 ILE B CG2 
563  C CD1 . ILE A 77 ? 0.5024 0.3781 0.3343 0.0666  0.0819  0.0427  387 ILE B CD1 
564  N N   . GLU A 78 ? 0.6874 0.3793 0.3702 0.0725  0.1390  0.0552  388 GLU B N   
565  C CA  . GLU A 78 ? 0.8698 0.5130 0.5115 0.0763  0.1393  0.0583  388 GLU B CA  
566  C C   . GLU A 78 ? 0.9404 0.5494 0.5664 0.0707  0.1799  0.0648  388 GLU B C   
567  O O   . GLU A 78 ? 1.0102 0.5876 0.6176 0.0695  0.1865  0.0674  388 GLU B O   
568  C CB  . GLU A 78 ? 0.9486 0.5371 0.5209 0.0944  0.1160  0.0613  388 GLU B CB  
569  C CG  . GLU A 78 ? 0.9593 0.5762 0.5521 0.0987  0.0746  0.0538  388 GLU B CG  
570  C CD  . GLU A 78 ? 1.2295 0.7998 0.7609 0.1142  0.0482  0.0545  388 GLU B CD  
571  O OE1 . GLU A 78 ? 1.4172 0.9235 0.8772 0.1234  0.0589  0.0621  388 GLU B OE1 
572  O OE2 . GLU A 78 ? 1.2789 0.8739 0.8316 0.1163  0.0168  0.0468  388 GLU B OE2 
573  N N   . MET A 79 ? 0.8698 0.4829 0.5066 0.0676  0.2103  0.0678  389 MET B N   
574  C CA  . MET A 79 ? 0.8744 0.4596 0.5090 0.0596  0.2543  0.0728  389 MET B CA  
575  C C   . MET A 79 ? 0.8499 0.4875 0.5583 0.0381  0.2622  0.0659  389 MET B C   
576  O O   . MET A 79 ? 0.8587 0.4699 0.5667 0.0284  0.2943  0.0677  389 MET B O   
577  C CB  . MET A 79 ? 0.8554 0.4323 0.4901 0.0627  0.2879  0.0774  389 MET B CB  
578  C CG  . MET A 79 ? 1.0291 0.5270 0.5686 0.0813  0.2938  0.0839  389 MET B CG  
579  S SD  . MET A 79 ? 1.1252 0.6213 0.6679 0.0880  0.3235  0.0861  389 MET B SD  
580  C CE  . MET A 79 ? 1.0512 0.5250 0.6158 0.0783  0.3899  0.0923  389 MET B CE  
581  N N   . HIS A 80 ? 0.8539 0.5607 0.6211 0.0295  0.2348  0.0575  390 HIS B N   
582  C CA  . HIS A 80 ? 0.7455 0.4999 0.5737 0.0078  0.2346  0.0483  390 HIS B CA  
583  C C   . HIS A 80 ? 0.7405 0.4715 0.5467 0.0058  0.2199  0.0439  390 HIS B C   
584  O O   . HIS A 80 ? 1.0329 0.8048 0.8777 -0.0076 0.2036  0.0337  390 HIS B O   
585  C CB  . HIS A 80 ? 0.7876 0.6171 0.6748 0.0011  0.2102  0.0421  390 HIS B CB  
586  C CG  . HIS A 80 ? 0.8298 0.6941 0.7598 0.0006  0.2264  0.0465  390 HIS B CG  
587  N ND1 . HIS A 80 ? 0.8544 0.6983 0.7584 0.0187  0.2342  0.0551  390 HIS B ND1 
588  C CD2 . HIS A 80 ? 0.8454 0.7640 0.8459 -0.0153 0.2358  0.0431  390 HIS B CD2 
589  C CE1 . HIS A 80 ? 0.8591 0.7423 0.8179 0.0159  0.2510  0.0582  390 HIS B CE1 
590  N NE2 . HIS A 80 ? 0.8421 0.7743 0.8635 -0.0042 0.2501  0.0515  390 HIS B NE2 
591  N N   . ILE A 81 ? 0.8987 0.5611 0.6407 0.0200  0.2260  0.0518  391 ILE B N   
592  C CA  . ILE A 81 ? 0.9421 0.5761 0.6636 0.0226  0.2145  0.0505  391 ILE B CA  
593  C C   . ILE A 81 ? 1.0841 0.6510 0.7644 0.0230  0.2489  0.0585  391 ILE B C   
594  O O   . ILE A 81 ? 1.1546 0.6635 0.7733 0.0386  0.2616  0.0703  391 ILE B O   
595  C CB  . ILE A 81 ? 0.8964 0.5120 0.5796 0.0447  0.1782  0.0543  391 ILE B CB  
596  C CG1 . ILE A 81 ? 0.8428 0.5194 0.5660 0.0434  0.1495  0.0464  391 ILE B CG1 
597  C CG2 . ILE A 81 ? 0.9664 0.5548 0.6382 0.0500  0.1681  0.0544  391 ILE B CG2 
598  C CD1 . ILE A 81 ? 0.7738 0.4381 0.4711 0.0620  0.1150  0.0478  391 ILE B CD1 
599  N N   . ALA A 82 ? 1.1198 0.6883 0.8281 0.0054  0.2655  0.0517  392 ALA B N   
600  C CA  . ALA A 82 ? 1.1728 0.6745 0.8450 0.0038  0.3020  0.0589  392 ALA B CA  
601  C C   . ALA A 82 ? 1.2576 0.6942 0.8638 0.0282  0.2872  0.0705  392 ALA B C   
602  O O   . ALA A 82 ? 1.2551 0.7106 0.8692 0.0379  0.2519  0.0675  392 ALA B O   
603  C CB  . ALA A 82 ? 1.1258 0.6498 0.8522 -0.0253 0.3244  0.0457  392 ALA B CB  
604  N N   . MET A 83 ? 1.3581 0.7161 0.9000 0.0387  0.3155  0.0845  393 MET B N   
605  C CA  . MET A 83 ? 1.4716 0.7603 0.9436 0.0650  0.3008  0.0990  393 MET B CA  
606  C C   . MET A 83 ? 1.4043 0.6767 0.8947 0.0592  0.3102  0.0965  393 MET B C   
607  O O   . MET A 83 ? 1.4009 0.6550 0.8742 0.0788  0.2825  0.1024  393 MET B O   
608  C CB  . MET A 83 ? 1.7323 0.9417 1.1214 0.0799  0.3261  0.1136  393 MET B CB  
609  C CG  . MET A 83 ? 1.9653 1.1256 1.2874 0.1097  0.2969  0.1228  393 MET B CG  
610  S SD  . MET A 83 ? 2.0395 1.1318 1.2756 0.1245  0.3191  0.1268  393 MET B SD  
611  C CE  . MET A 83 ? 2.0512 1.1028 1.2218 0.1569  0.2703  0.1380  393 MET B CE  
612  N N   . HIS B 4  ? 1.4428 1.0659 1.0882 0.2489  -0.1292 -0.0989 314 HIS A N   
613  C CA  . HIS B 4  ? 1.4632 1.0055 1.0876 0.2199  -0.1524 -0.0953 314 HIS A CA  
614  C C   . HIS B 4  ? 1.2964 0.7405 0.8719 0.2064  -0.1876 -0.0893 314 HIS A C   
615  O O   . HIS B 4  ? 1.3323 0.7849 0.9166 0.1921  -0.1812 -0.0786 314 HIS A O   
616  C CB  . HIS B 4  ? 1.3891 0.9753 1.0762 0.1655  -0.1247 -0.0784 314 HIS A CB  
617  C CG  . HIS B 4  ? 1.0840 0.6193 0.7627 0.1404  -0.1448 -0.0743 314 HIS A CG  
618  N ND1 . HIS B 4  ? 1.1087 0.5731 0.7687 0.1029  -0.1721 -0.0613 314 HIS A ND1 
619  C CD2 . HIS B 4  ? 0.9631 0.5120 0.6495 0.1453  -0.1437 -0.0795 314 HIS A CD2 
620  C CE1 . HIS B 4  ? 0.9340 0.3758 0.5948 0.0835  -0.1881 -0.0586 314 HIS A CE1 
621  N NE2 . HIS B 4  ? 1.0667 0.5569 0.7418 0.1107  -0.1718 -0.0707 314 HIS A NE2 
622  N N   . HIS B 5  ? 1.1244 0.4699 0.6429 0.2089  -0.2271 -0.0952 315 HIS A N   
623  C CA  . HIS B 5  ? 1.3113 0.5476 0.7709 0.1952  -0.2661 -0.0882 315 HIS A CA  
624  C C   . HIS B 5  ? 1.2941 0.5281 0.7917 0.1233  -0.2594 -0.0593 315 HIS A C   
625  O O   . HIS B 5  ? 1.2565 0.4169 0.7145 0.1051  -0.2836 -0.0470 315 HIS A O   
626  C CB  . HIS B 5  ? 1.5491 0.6836 0.9355 0.2090  -0.3118 -0.1005 315 HIS A CB  
627  C CG  . HIS B 5  ? 1.7694 0.9040 1.1001 0.2789  -0.3231 -0.1230 315 HIS A CG  
628  N ND1 . HIS B 5  ? 1.8923 0.9864 1.1669 0.3085  -0.3432 -0.1262 315 HIS A ND1 
629  C CD2 . HIS B 5  ? 1.8361 1.0103 1.1562 0.3252  -0.3164 -0.1415 315 HIS A CD2 
630  C CE1 . HIS B 5  ? 1.9594 1.0699 1.1918 0.3708  -0.3481 -0.1462 315 HIS A CE1 
631  N NE2 . HIS B 5  ? 1.9074 1.0686 1.1670 0.3809  -0.3313 -0.1544 315 HIS A NE2 
632  N N   . HIS B 6  ? 1.1935 0.5064 0.7630 0.0850  -0.2266 -0.0469 316 HIS A N   
633  C CA  . HIS B 6  ? 1.1951 0.5192 0.8027 0.0222  -0.2165 -0.0186 316 HIS A CA  
634  C C   . HIS B 6  ? 1.0977 0.5198 0.7689 0.0096  -0.1676 -0.0093 316 HIS A C   
635  O O   . HIS B 6  ? 1.2050 0.6609 0.9180 -0.0342 -0.1485 0.0119  316 HIS A O   
636  C CB  . HIS B 6  ? 1.2266 0.5460 0.8554 -0.0147 -0.2276 -0.0087 316 HIS A CB  
637  C CG  . HIS B 6  ? 1.3968 0.6071 0.9566 -0.0134 -0.2816 -0.0161 316 HIS A CG  
638  N ND1 . HIS B 6  ? 1.4369 0.6170 0.9577 0.0307  -0.3007 -0.0426 316 HIS A ND1 
639  C CD2 . HIS B 6  ? 1.4683 0.5854 0.9839 -0.0521 -0.3225 -0.0001 316 HIS A CD2 
640  C CE1 . HIS B 6  ? 1.5106 0.5914 0.9669 0.0213  -0.3497 -0.0443 316 HIS A CE1 
641  N NE2 . HIS B 6  ? 1.6091 0.6687 1.0686 -0.0300 -0.3602 -0.0171 316 HIS A NE2 
642  N N   . HIS B 7  ? 1.0396 0.5088 0.7162 0.0473  -0.1483 -0.0240 317 HIS A N   
643  C CA  . HIS B 7  ? 0.9892 0.5376 0.7143 0.0344  -0.1077 -0.0176 317 HIS A CA  
644  C C   . HIS B 7  ? 1.0082 0.5648 0.7113 0.0625  -0.1089 -0.0252 317 HIS A C   
645  O O   . HIS B 7  ? 1.0449 0.5659 0.7040 0.1036  -0.1347 -0.0385 317 HIS A O   
646  C CB  . HIS B 7  ? 0.7478 0.3711 0.5195 0.0422  -0.0768 -0.0254 317 HIS A CB  
647  C CG  . HIS B 7  ? 0.8686 0.4977 0.6684 0.0158  -0.0717 -0.0159 317 HIS A CG  
648  N ND1 . HIS B 7  ? 0.9125 0.4990 0.6908 0.0219  -0.1002 -0.0210 317 HIS A ND1 
649  C CD2 . HIS B 7  ? 0.8579 0.5317 0.7032 -0.0137 -0.0429 -0.0017 317 HIS A CD2 
650  C CE1 . HIS B 7  ? 0.9932 0.6057 0.8085 -0.0057 -0.0901 -0.0088 317 HIS A CE1 
651  N NE2 . HIS B 7  ? 0.9055 0.5726 0.7623 -0.0248 -0.0541 0.0033  317 HIS A NE2 
652  N N   . HIS B 8  ? 0.9949 0.5993 0.7258 0.0429  -0.0820 -0.0169 318 HIS A N   
653  C CA  . HIS B 8  ? 0.9382 0.5604 0.6537 0.0631  -0.0835 -0.0217 318 HIS A CA  
654  C C   . HIS B 8  ? 0.7488 0.4464 0.5067 0.0456  -0.0483 -0.0206 318 HIS A C   
655  O O   . HIS B 8  ? 0.8029 0.5190 0.5908 0.0150  -0.0235 -0.0126 318 HIS A O   
656  C CB  . HIS B 8  ? 1.0855 0.6412 0.7572 0.0512  -0.1056 -0.0084 318 HIS A CB  
657  C CG  . HIS B 8  ? 1.1052 0.6576 0.7925 0.0018  -0.0876 0.0130  318 HIS A CG  
658  N ND1 . HIS B 8  ? 1.0516 0.5676 0.7411 -0.0306 -0.0933 0.0291  318 HIS A ND1 
659  C CD2 . HIS B 8  ? 1.0076 0.5929 0.7068 -0.0190 -0.0640 0.0217  318 HIS A CD2 
660  C CE1 . HIS B 8  ? 1.0175 0.5529 0.7235 -0.0664 -0.0708 0.0483  318 HIS A CE1 
661  N NE2 . HIS B 8  ? 1.0197 0.5914 0.7273 -0.0580 -0.0526 0.0427  318 HIS A NE2 
662  N N   . MET B 9  ? 0.7219 0.4612 0.4783 0.0667  -0.0485 -0.0286 319 MET A N   
663  C CA  . MET B 9  ? 0.7432 0.5452 0.5300 0.0477  -0.0226 -0.0285 319 MET A CA  
664  C C   . MET B 9  ? 0.7533 0.5324 0.5201 0.0237  -0.0220 -0.0185 319 MET A C   
665  O O   . MET B 9  ? 0.7423 0.4902 0.4739 0.0383  -0.0454 -0.0159 319 MET A O   
666  C CB  . MET B 9  ? 0.7943 0.6649 0.5938 0.0766  -0.0252 -0.0391 319 MET A CB  
667  C CG  . MET B 9  ? 1.0972 1.0109 0.9226 0.0942  -0.0149 -0.0465 319 MET A CG  
668  S SD  . MET B 9  ? 1.2106 1.1610 1.0779 0.0539  0.0213  -0.0420 319 MET A SD  
669  C CE  . MET B 9  ? 1.2502 1.2830 1.1384 0.0447  0.0285  -0.0423 319 MET A CE  
670  N N   . SER B 10 ? 0.6682 0.4587 0.4510 -0.0092 0.0044  -0.0129 320 SER A N   
671  C CA  . SER B 10 ? 0.8701 0.6410 0.6287 -0.0300 0.0086  -0.0042 320 SER A CA  
672  C C   . SER B 10 ? 0.8651 0.6776 0.6329 -0.0446 0.0259  -0.0113 320 SER A C   
673  O O   . SER B 10 ? 0.6371 0.4762 0.4316 -0.0537 0.0457  -0.0166 320 SER A O   
674  C CB  . SER B 10 ? 0.8436 0.5789 0.5989 -0.0553 0.0235  0.0115  320 SER A CB  
675  O OG  . SER B 10 ? 1.0011 0.6909 0.7422 -0.0518 0.0021  0.0215  320 SER A OG  
676  N N   . PRO B 11 ? 0.9209 0.7338 0.6620 -0.0485 0.0162  -0.0113 321 PRO A N   
677  C CA  . PRO B 11 ? 0.9224 0.7649 0.6639 -0.0679 0.0275  -0.0186 321 PRO A CA  
678  C C   . PRO B 11 ? 0.9399 0.7528 0.6701 -0.0921 0.0558  -0.0157 321 PRO A C   
679  O O   . PRO B 11 ? 0.8063 0.5827 0.5177 -0.0961 0.0640  -0.0044 321 PRO A O   
680  C CB  . PRO B 11 ? 0.7995 0.6424 0.5079 -0.0636 0.0047  -0.0178 321 PRO A CB  
681  C CG  . PRO B 11 ? 0.9049 0.7275 0.6014 -0.0333 -0.0199 -0.0120 321 PRO A CG  
682  C CD  . PRO B 11 ? 0.9115 0.6934 0.6154 -0.0350 -0.0094 -0.0045 321 PRO A CD  
683  N N   . ASN B 12 ? 0.8640 0.6931 0.6030 -0.1073 0.0706  -0.0245 322 ASN A N   
684  C CA  . ASN B 12 ? 0.8476 0.6428 0.5661 -0.1222 0.0969  -0.0245 322 ASN A CA  
685  C C   . ASN B 12 ? 0.8675 0.6342 0.5347 -0.1323 0.0949  -0.0252 322 ASN A C   
686  O O   . ASN B 12 ? 0.8152 0.5941 0.4658 -0.1349 0.0720  -0.0289 322 ASN A O   
687  C CB  . ASN B 12 ? 0.7684 0.5721 0.4985 -0.1349 0.1097  -0.0339 322 ASN A CB  
688  C CG  . ASN B 12 ? 0.8298 0.6570 0.6040 -0.1242 0.1166  -0.0315 322 ASN A CG  
689  O OD1 . ASN B 12 ? 0.8340 0.6630 0.6271 -0.1080 0.1149  -0.0240 322 ASN A OD1 
690  N ND2 . ASN B 12 ? 0.6382 0.4792 0.4243 -0.1357 0.1225  -0.0368 322 ASN A ND2 
691  N N   . LEU B 13 ? 0.9462 0.6787 0.5866 -0.1348 0.1193  -0.0210 323 LEU A N   
692  C CA  . LEU B 13 ? 1.0200 0.7210 0.6024 -0.1419 0.1222  -0.0237 323 LEU A CA  
693  C C   . LEU B 13 ? 1.0896 0.7782 0.6451 -0.1583 0.1165  -0.0420 323 LEU A C   
694  O O   . LEU B 13 ? 0.9961 0.6918 0.5751 -0.1654 0.1210  -0.0493 323 LEU A O   
695  C CB  . LEU B 13 ? 1.1199 0.7962 0.6801 -0.1349 0.1539  -0.0138 323 LEU A CB  
696  C CG  . LEU B 13 ? 1.1226 0.8128 0.7078 -0.1285 0.1579  0.0089  323 LEU A CG  
697  C CD1 . LEU B 13 ? 1.2473 0.9333 0.8186 -0.1228 0.1921  0.0220  323 LEU A CD1 
698  C CD2 . LEU B 13 ? 1.0037 0.6871 0.5668 -0.1311 0.1324  0.0184  323 LEU A CD2 
699  N N   . PRO B 14 ? 1.1913 0.8582 0.6940 -0.1675 0.1037  -0.0484 324 PRO A N   
700  C CA  . PRO B 14 ? 1.1471 0.7933 0.6162 -0.1896 0.0931  -0.0657 324 PRO A CA  
701  C C   . PRO B 14 ? 1.0900 0.6862 0.5325 -0.1895 0.1204  -0.0743 324 PRO A C   
702  O O   . PRO B 14 ? 1.1541 0.7177 0.5655 -0.1709 0.1471  -0.0711 324 PRO A O   
703  C CB  . PRO B 14 ? 1.1797 0.8012 0.5857 -0.1942 0.0775  -0.0693 324 PRO A CB  
704  C CG  . PRO B 14 ? 1.2071 0.8585 0.6331 -0.1775 0.0680  -0.0527 324 PRO A CG  
705  C CD  . PRO B 14 ? 1.2236 0.8835 0.6930 -0.1610 0.0927  -0.0390 324 PRO A CD  
706  N N   . GLY B 15 ? 0.9946 0.5870 0.4483 -0.2091 0.1137  -0.0834 325 GLY A N   
707  C CA  . GLY B 15 ? 1.0296 0.5668 0.4558 -0.2073 0.1357  -0.0912 325 GLY A CA  
708  C C   . GLY B 15 ? 1.0278 0.5900 0.5115 -0.1917 0.1561  -0.0814 325 GLY A C   
709  O O   . GLY B 15 ? 0.9964 0.5145 0.4603 -0.1882 0.1725  -0.0866 325 GLY A O   
710  N N   . GLN B 16 ? 1.0154 0.6395 0.5624 -0.1803 0.1538  -0.0680 326 GLN A N   
711  C CA  . GLN B 16 ? 0.9783 0.6284 0.5786 -0.1659 0.1687  -0.0590 326 GLN A CA  
712  C C   . GLN B 16 ? 0.9758 0.6706 0.6217 -0.1813 0.1513  -0.0585 326 GLN A C   
713  O O   . GLN B 16 ? 0.9672 0.7034 0.6287 -0.1919 0.1273  -0.0585 326 GLN A O   
714  C CB  . GLN B 16 ? 1.0214 0.7038 0.6554 -0.1449 0.1747  -0.0444 326 GLN A CB  
715  C CG  . GLN B 16 ? 1.0629 0.7192 0.6629 -0.1299 0.1972  -0.0380 326 GLN A CG  
716  C CD  . GLN B 16 ? 0.9821 0.6724 0.6197 -0.1187 0.2005  -0.0190 326 GLN A CD  
717  O OE1 . GLN B 16 ? 0.9051 0.6262 0.5872 -0.1193 0.1840  -0.0137 326 GLN A OE1 
718  N NE2 . GLN B 16 ? 0.9931 0.6768 0.6089 -0.1090 0.2212  -0.0077 326 GLN A NE2 
719  N N   . THR B 17 ? 0.9233 0.6146 0.5896 -0.1795 0.1643  -0.0565 327 THR A N   
720  C CA  . THR B 17 ? 0.7862 0.5242 0.4950 -0.1919 0.1533  -0.0528 327 THR A CA  
721  C C   . THR B 17 ? 0.7018 0.4677 0.4566 -0.1675 0.1658  -0.0438 327 THR A C   
722  O O   . THR B 17 ? 0.7791 0.5217 0.5314 -0.1472 0.1837  -0.0404 327 THR A O   
723  C CB  . THR B 17 ? 0.8486 0.5504 0.5294 -0.2216 0.1527  -0.0571 327 THR A CB  
724  O OG1 . THR B 17 ? 0.9468 0.7086 0.6721 -0.2371 0.1427  -0.0491 327 THR A OG1 
725  C CG2 . THR B 17 ? 0.8247 0.4617 0.4774 -0.2072 0.1774  -0.0582 327 THR A CG2 
726  N N   . THR B 18 ? 0.6649 0.4864 0.4610 -0.1687 0.1554  -0.0393 328 THR A N   
727  C CA  . THR B 18 ? 0.6586 0.5055 0.4924 -0.1463 0.1631  -0.0325 328 THR A CA  
728  C C   . THR B 18 ? 0.6716 0.5393 0.5201 -0.1594 0.1664  -0.0282 328 THR A C   
729  O O   . THR B 18 ? 0.7151 0.6290 0.5765 -0.1770 0.1535  -0.0264 328 THR A O   
730  C CB  . THR B 18 ? 0.5911 0.4834 0.4536 -0.1253 0.1466  -0.0307 328 THR A CB  
731  O OG1 . THR B 18 ? 0.5790 0.4460 0.4231 -0.1183 0.1425  -0.0309 328 THR A OG1 
732  C CG2 . THR B 18 ? 0.5331 0.4409 0.4246 -0.1025 0.1513  -0.0260 328 THR A CG2 
733  N N   . VAL B 19 ? 0.7432 0.5825 0.5904 -0.1510 0.1837  -0.0241 329 VAL A N   
734  C CA  . VAL B 19 ? 0.7918 0.6437 0.6477 -0.1629 0.1887  -0.0166 329 VAL A CA  
735  C C   . VAL B 19 ? 0.6213 0.4972 0.5071 -0.1335 0.1957  -0.0108 329 VAL A C   
736  O O   . VAL B 19 ? 0.7366 0.6042 0.6308 -0.1089 0.1979  -0.0123 329 VAL A O   
737  C CB  . VAL B 19 ? 0.7564 0.5356 0.5676 -0.1831 0.2000  -0.0164 329 VAL A CB  
738  C CG1 . VAL B 19 ? 0.7238 0.4601 0.4918 -0.2077 0.1912  -0.0261 329 VAL A CG1 
739  C CG2 . VAL B 19 ? 0.7967 0.5294 0.5959 -0.1537 0.2190  -0.0156 329 VAL A CG2 
740  N N   . GLN B 20 ? 0.6616 0.5694 0.5618 -0.1389 0.1979  -0.0023 330 GLN A N   
741  C CA  . GLN B 20 ? 0.6262 0.5552 0.5472 -0.1122 0.2032  0.0032  330 GLN A CA  
742  C C   . GLN B 20 ? 0.5657 0.4476 0.4662 -0.1163 0.2193  0.0114  330 GLN A C   
743  O O   . GLN B 20 ? 0.6061 0.4674 0.4854 -0.1454 0.2232  0.0180  330 GLN A O   
744  C CB  . GLN B 20 ? 0.6170 0.6215 0.5643 -0.1073 0.1956  0.0080  330 GLN A CB  
745  C CG  . GLN B 20 ? 0.8053 0.8529 0.7682 -0.0911 0.1782  -0.0005 330 GLN A CG  
746  C CD  . GLN B 20 ? 1.0791 1.2069 1.0639 -0.0773 0.1727  0.0038  330 GLN A CD  
747  O OE1 . GLN B 20 ? 1.1872 1.3329 1.1783 -0.0442 0.1710  0.0021  330 GLN A OE1 
748  N NE2 . GLN B 20 ? 1.1648 1.3446 1.1595 -0.1017 0.1692  0.0099  330 GLN A NE2 
749  N N   . VAL B 21 ? 0.5646 0.4278 0.4692 -0.0884 0.2262  0.0123  331 VAL A N   
750  C CA  . VAL B 21 ? 0.7156 0.5342 0.5997 -0.0824 0.2404  0.0206  331 VAL A CA  
751  C C   . VAL B 21 ? 0.6398 0.4948 0.5459 -0.0593 0.2393  0.0276  331 VAL A C   
752  O O   . VAL B 21 ? 0.6293 0.4972 0.5540 -0.0337 0.2342  0.0246  331 VAL A O   
753  C CB  . VAL B 21 ? 0.6331 0.4008 0.4990 -0.0657 0.2502  0.0168  331 VAL A CB  
754  C CG1 . VAL B 21 ? 0.7246 0.4428 0.5631 -0.0539 0.2639  0.0254  331 VAL A CG1 
755  C CG2 . VAL B 21 ? 0.7646 0.4972 0.6024 -0.0839 0.2502  0.0075  331 VAL A CG2 
756  N N   . ARG B 22 ? 0.5730 0.4449 0.4743 -0.0704 0.2429  0.0383  332 ARG A N   
757  C CA  . ARG B 22 ? 0.6521 0.5582 0.5659 -0.0476 0.2425  0.0452  332 ARG A CA  
758  C C   . ARG B 22 ? 0.6897 0.5486 0.5816 -0.0355 0.2534  0.0556  332 ARG A C   
759  O O   . ARG B 22 ? 0.8214 0.6268 0.6812 -0.0536 0.2633  0.0635  332 ARG A O   
760  C CB  . ARG B 22 ? 0.6654 0.6285 0.5860 -0.0620 0.2429  0.0543  332 ARG A CB  
761  C CG  . ARG B 22 ? 0.7040 0.7013 0.6282 -0.0356 0.2445  0.0616  332 ARG A CG  
762  C CD  . ARG B 22 ? 0.6653 0.7421 0.6039 -0.0358 0.2434  0.0662  332 ARG A CD  
763  N NE  . ARG B 22 ? 0.6747 0.7828 0.6106 -0.0006 0.2426  0.0677  332 ARG A NE  
764  C CZ  . ARG B 22 ? 0.7381 0.9123 0.6828 0.0231  0.2375  0.0632  332 ARG A CZ  
765  N NH1 . ARG B 22 ? 0.7905 1.0132 0.7530 0.0161  0.2328  0.0583  332 ARG A NH1 
766  N NH2 . ARG B 22 ? 0.7774 0.9684 0.7087 0.0577  0.2360  0.0629  332 ARG A NH2 
767  N N   . VAL B 23 ? 0.6061 0.4800 0.5108 -0.0041 0.2487  0.0556  333 VAL A N   
768  C CA  . VAL B 23 ? 0.6194 0.4607 0.5066 0.0142  0.2561  0.0667  333 VAL A CA  
769  C C   . VAL B 23 ? 0.6600 0.5421 0.5523 0.0320  0.2504  0.0726  333 VAL A C   
770  O O   . VAL B 23 ? 0.6886 0.6196 0.5987 0.0384  0.2391  0.0642  333 VAL A O   
771  C CB  . VAL B 23 ? 0.5908 0.4134 0.4880 0.0380  0.2545  0.0623  333 VAL A CB  
772  C CG1 . VAL B 23 ? 0.6096 0.3931 0.4944 0.0259  0.2631  0.0561  333 VAL A CG1 
773  C CG2 . VAL B 23 ? 0.5431 0.4130 0.4750 0.0530  0.2363  0.0536  333 VAL A CG2 
774  N N   . PRO B 24 ? 0.6707 0.5292 0.5404 0.0434  0.2574  0.0869  334 PRO A N   
775  C CA  . PRO B 24 ? 0.7018 0.5958 0.5710 0.0663  0.2505  0.0915  334 PRO A CA  
776  C C   . PRO B 24 ? 0.7097 0.6276 0.6033 0.0924  0.2304  0.0776  334 PRO A C   
777  O O   . PRO B 24 ? 0.5959 0.4983 0.5055 0.0978  0.2254  0.0728  334 PRO A O   
778  C CB  . PRO B 24 ? 0.6671 0.5173 0.5039 0.0755  0.2605  0.1099  334 PRO A CB  
779  C CG  . PRO B 24 ? 0.7521 0.5394 0.5741 0.0665  0.2698  0.1112  334 PRO A CG  
780  C CD  . PRO B 24 ? 0.7113 0.5033 0.5449 0.0361  0.2710  0.1000  334 PRO A CD  
781  N N   . TYR B 25 ? 0.7322 0.6885 0.6252 0.1081  0.2180  0.0720  335 TYR A N   
782  C CA  . TYR B 25 ? 0.7327 0.7021 0.6404 0.1270  0.1929  0.0573  335 TYR A CA  
783  C C   . TYR B 25 ? 0.7511 0.7056 0.6632 0.1434  0.1826  0.0628  335 TYR A C   
784  O O   . TYR B 25 ? 0.7107 0.6701 0.6438 0.1464  0.1626  0.0549  335 TYR A O   
785  C CB  . TYR B 25 ? 0.5553 0.5562 0.4461 0.1465  0.1807  0.0488  335 TYR A CB  
786  C CG  . TYR B 25 ? 0.5511 0.5490 0.4446 0.1629  0.1493  0.0317  335 TYR A CG  
787  C CD1 . TYR B 25 ? 0.5752 0.5681 0.4505 0.1858  0.1295  0.0299  335 TYR A CD1 
788  C CD2 . TYR B 25 ? 0.5323 0.5256 0.4414 0.1528  0.1364  0.0184  335 TYR A CD2 
789  C CE1 . TYR B 25 ? 0.7339 0.7139 0.6053 0.1945  0.0956  0.0146  335 TYR A CE1 
790  C CE2 . TYR B 25 ? 0.6785 0.6566 0.5830 0.1625  0.1044  0.0049  335 TYR A CE2 
791  C CZ  . TYR B 25 ? 0.7719 0.7415 0.6571 0.1814  0.0830  0.0028  335 TYR A CZ  
792  O OH  . TYR B 25 ? 0.8167 0.7617 0.6911 0.1851  0.0462  -0.0104 335 TYR A OH  
793  N N   . ARG B 26 ? 0.5890 0.5278 0.4814 0.1530  0.1945  0.0786  336 ARG A N   
794  C CA  . ARG B 26 ? 0.7102 0.6442 0.6071 0.1737  0.1837  0.0857  336 ARG A CA  
795  C C   . ARG B 26 ? 0.7817 0.7059 0.7056 0.1703  0.1884  0.0883  336 ARG A C   
796  O O   . ARG B 26 ? 0.8743 0.8158 0.8179 0.1854  0.1742  0.0923  336 ARG A O   
797  C CB  . ARG B 26 ? 0.7826 0.6971 0.6446 0.1879  0.1960  0.1037  336 ARG A CB  
798  C CG  . ARG B 26 ? 0.8111 0.7329 0.6707 0.2163  0.1785  0.1105  336 ARG A CG  
799  C CD  . ARG B 26 ? 0.8707 0.7633 0.6901 0.2308  0.1927  0.1309  336 ARG A CD  
800  N NE  . ARG B 26 ? 0.9407 0.8363 0.7258 0.2240  0.2024  0.1358  336 ARG A NE  
801  C CZ  . ARG B 26 ? 1.0197 0.9376 0.7817 0.2429  0.1898  0.1357  336 ARG A CZ  
802  N NH1 . ARG B 26 ? 1.0307 0.9626 0.7982 0.2664  0.1626  0.1294  336 ARG A NH1 
803  N NH2 . ARG B 26 ? 1.0391 0.9690 0.7709 0.2378  0.2039  0.1428  336 ARG A NH2 
804  N N   . VAL B 27 ? 0.7330 0.6349 0.6573 0.1516  0.2073  0.0868  337 VAL A N   
805  C CA  . VAL B 27 ? 0.6958 0.5840 0.6340 0.1543  0.2175  0.0901  337 VAL A CA  
806  C C   . VAL B 27 ? 0.7444 0.6524 0.7130 0.1367  0.2116  0.0785  337 VAL A C   
807  O O   . VAL B 27 ? 0.7111 0.6121 0.6889 0.1374  0.2233  0.0806  337 VAL A O   
808  C CB  . VAL B 27 ? 0.7750 0.6065 0.6764 0.1504  0.2424  0.0975  337 VAL A CB  
809  C CG1 . VAL B 27 ? 0.6818 0.4864 0.5469 0.1647  0.2470  0.1122  337 VAL A CG1 
810  C CG2 . VAL B 27 ? 0.8372 0.6531 0.7282 0.1173  0.2505  0.0889  337 VAL A CG2 
811  N N   . VAL B 28 ? 0.9348 0.8639 0.9130 0.1239  0.1942  0.0670  338 VAL A N   
812  C CA  . VAL B 28 ? 0.7146 0.6554 0.7156 0.1068  0.1858  0.0579  338 VAL A CA  
813  C C   . VAL B 28 ? 0.6160 0.5820 0.6495 0.1112  0.1770  0.0655  338 VAL A C   
814  O O   . VAL B 28 ? 0.5919 0.5633 0.6415 0.0995  0.1836  0.0662  338 VAL A O   
815  C CB  . VAL B 28 ? 0.7196 0.6714 0.7170 0.1008  0.1640  0.0448  338 VAL A CB  
816  C CG1 . VAL B 28 ? 0.4698 0.4231 0.4828 0.0829  0.1541  0.0371  338 VAL A CG1 
817  C CG2 . VAL B 28 ? 0.8008 0.7481 0.7724 0.0993  0.1754  0.0412  338 VAL A CG2 
818  N N   . GLY B 29 ? 0.7220 0.7100 0.7659 0.1272  0.1619  0.0733  339 GLY A N   
819  C CA  . GLY B 29 ? 0.6614 0.6893 0.7431 0.1289  0.1521  0.0848  339 GLY A CA  
820  C C   . GLY B 29 ? 0.6548 0.6893 0.7449 0.1441  0.1804  0.0967  339 GLY A C   
821  O O   . GLY B 29 ? 0.6820 0.7564 0.8059 0.1404  0.1815  0.1061  339 GLY A O   
822  N N   . LEU B 30 ? 0.7895 0.7834 0.8448 0.1620  0.2033  0.0976  340 LEU A N   
823  C CA  . LEU B 30 ? 0.8403 0.8244 0.8887 0.1842  0.2294  0.1062  340 LEU A CA  
824  C C   . LEU B 30 ? 0.7811 0.7511 0.8263 0.1683  0.2459  0.0992  340 LEU A C   
825  O O   . LEU B 30 ? 0.7525 0.7447 0.8103 0.1837  0.2609  0.1068  340 LEU A O   
826  C CB  . LEU B 30 ? 0.8569 0.7812 0.8556 0.2043  0.2452  0.1086  340 LEU A CB  
827  C CG  . LEU B 30 ? 0.9543 0.8866 0.9466 0.2269  0.2330  0.1189  340 LEU A CG  
828  C CD1 . LEU B 30 ? 1.0223 0.8829 0.9571 0.2413  0.2500  0.1238  340 LEU A CD1 
829  C CD2 . LEU B 30 ? 1.0445 1.0377 1.0752 0.2550  0.2253  0.1329  340 LEU A CD2 
830  N N   . VAL B 31 ? 0.6788 0.6172 0.7059 0.1404  0.2438  0.0855  341 VAL A N   
831  C CA  . VAL B 31 ? 0.7707 0.6946 0.7910 0.1242  0.2560  0.0783  341 VAL A CA  
832  C C   . VAL B 31 ? 0.8965 0.8740 0.9593 0.1102  0.2437  0.0829  341 VAL A C   
833  O O   . VAL B 31 ? 0.9479 0.9366 1.0155 0.1102  0.2583  0.0865  341 VAL A O   
834  C CB  . VAL B 31 ? 0.7870 0.6707 0.7788 0.0984  0.2542  0.0645  341 VAL A CB  
835  C CG1 . VAL B 31 ? 0.6314 0.4989 0.6124 0.0818  0.2638  0.0568  341 VAL A CG1 
836  C CG2 . VAL B 31 ? 0.5807 0.4138 0.5309 0.1042  0.2653  0.0653  341 VAL A CG2 
837  N N   . VAL B 32 ? 0.8274 0.8345 0.9159 0.0975  0.2157  0.0836  342 VAL A N   
838  C CA  . VAL B 32 ? 0.7040 0.7532 0.8282 0.0776  0.1985  0.0908  342 VAL A CA  
839  C C   . VAL B 32 ? 0.7824 0.8921 0.9445 0.0917  0.2042  0.1113  342 VAL A C   
840  O O   . VAL B 32 ? 0.7926 0.9377 0.9764 0.0833  0.2137  0.1225  342 VAL A O   
841  C CB  . VAL B 32 ? 0.5596 0.6072 0.6878 0.0611  0.1626  0.0839  342 VAL A CB  
842  C CG1 . VAL B 32 ? 0.4472 0.5277 0.6068 0.0357  0.1395  0.0944  342 VAL A CG1 
843  C CG2 . VAL B 32 ? 0.4795 0.4820 0.5739 0.0525  0.1598  0.0654  342 VAL A CG2 
844  N N   . GLY B 33 ? 0.6929 0.8221 0.8635 0.1149  0.1991  0.1185  343 GLY A N   
845  C CA  . GLY B 33 ? 0.5595 0.7582 0.7698 0.1331  0.2029  0.1396  343 GLY A CA  
846  C C   . GLY B 33 ? 0.6444 0.9032 0.9016 0.1047  0.1687  0.1526  343 GLY A C   
847  O O   . GLY B 33 ? 0.5646 0.7970 0.8148 0.0733  0.1408  0.1429  343 GLY A O   
848  N N   . PRO B 34 ? 0.7329 1.0733 1.0363 0.1155  0.1683  0.1756  344 PRO A N   
849  C CA  . PRO B 34 ? 0.7139 1.1170 1.0647 0.0811  0.1315  0.1920  344 PRO A CA  
850  C C   . PRO B 34 ? 0.7636 1.1716 1.1269 0.0370  0.1257  0.1974  344 PRO A C   
851  O O   . PRO B 34 ? 0.7866 1.2316 1.1655 0.0395  0.1547  0.2101  344 PRO A O   
852  C CB  . PRO B 34 ? 0.6807 1.1835 1.0813 0.1074  0.1412  0.2188  344 PRO A CB  
853  C CG  . PRO B 34 ? 0.7545 1.2475 1.1337 0.1514  0.1894  0.2174  344 PRO A CG  
854  C CD  . PRO B 34 ? 0.7491 1.1291 1.0610 0.1613  0.1998  0.1887  344 PRO A CD  
855  N N   . LYS B 35 ? 0.7020 1.0673 1.0514 -0.0002 0.0877  0.1877  345 LYS A N   
856  C CA  . LYS B 35 ? 0.7413 1.0936 1.0921 -0.0443 0.0749  0.1926  345 LYS A CA  
857  C C   . LYS B 35 ? 0.7490 1.0578 1.0683 -0.0364 0.1095  0.1810  345 LYS A C   
858  O O   . LYS B 35 ? 0.7347 1.0564 1.0624 -0.0629 0.1146  0.1931  345 LYS A O   
859  C CB  . LYS B 35 ? 0.7122 1.1598 1.1230 -0.0757 0.0662  0.2276  345 LYS A CB  
860  N N   . GLY B 36 ? 0.7963 1.0529 1.0766 -0.0029 0.1317  0.1591  346 GLY A N   
861  C CA  . GLY B 36 ? 0.8214 1.0336 1.0680 0.0025  0.1600  0.1465  346 GLY A CA  
862  C C   . GLY B 36 ? 0.7417 0.9934 0.9982 0.0220  0.1996  0.1595  346 GLY A C   
863  O O   . GLY B 36 ? 0.7507 0.9723 0.9807 0.0185  0.2188  0.1528  346 GLY A O   
864  N N   . ALA B 37 ? 0.6555 0.9749 0.9457 0.0464  0.2120  0.1776  347 ALA A N   
865  C CA  . ALA B 37 ? 0.6019 0.9655 0.8985 0.0728  0.2508  0.1908  347 ALA A CA  
866  C C   . ALA B 37 ? 0.6696 0.9613 0.9083 0.1098  0.2814  0.1696  347 ALA A C   
867  O O   . ALA B 37 ? 0.8453 1.1299 1.0608 0.1223  0.3102  0.1690  347 ALA A O   
868  C CB  . ALA B 37 ? 0.4679 0.9304 0.8165 0.0957  0.2547  0.2165  347 ALA A CB  
869  N N   . THR B 38 ? 0.6324 0.8671 0.8422 0.1257  0.2745  0.1530  348 THR A N   
870  C CA  . THR B 38 ? 0.6668 0.8270 0.8183 0.1547  0.2995  0.1358  348 THR A CA  
871  C C   . THR B 38 ? 0.6482 0.7428 0.7595 0.1288  0.3015  0.1172  348 THR A C   
872  O O   . THR B 38 ? 0.6557 0.7134 0.7270 0.1426  0.3259  0.1098  348 THR A O   
873  C CB  . THR B 38 ? 0.7054 0.8257 0.8373 0.1723  0.2901  0.1282  348 THR A CB  
874  O OG1 . THR B 38 ? 0.7469 0.9294 0.9130 0.2012  0.2879  0.1462  348 THR A OG1 
875  C CG2 . THR B 38 ? 0.5864 0.6207 0.6531 0.1944  0.3123  0.1134  348 THR A CG2 
876  N N   . ILE B 39 ? 0.6611 0.7392 0.7782 0.0940  0.2745  0.1087  349 ILE A N   
877  C CA  . ILE B 39 ? 0.5659 0.5909 0.6485 0.0716  0.2736  0.0922  349 ILE A CA  
878  C C   . ILE B 39 ? 0.6158 0.6627 0.7030 0.0573  0.2826  0.0998  349 ILE A C   
879  O O   . ILE B 39 ? 0.6291 0.6337 0.6785 0.0510  0.2929  0.0881  349 ILE A O   
880  C CB  . ILE B 39 ? 0.4855 0.4926 0.5709 0.0475  0.2429  0.0818  349 ILE A CB  
881  C CG1 . ILE B 39 ? 0.6141 0.5730 0.6642 0.0308  0.2427  0.0650  349 ILE A CG1 
882  C CG2 . ILE B 39 ? 0.4929 0.5419 0.6162 0.0256  0.2161  0.0933  349 ILE A CG2 
883  C CD1 . ILE B 39 ? 0.7321 0.6421 0.7405 0.0423  0.2623  0.0541  349 ILE A CD1 
884  N N   . LYS B 40 ? 0.6080 0.7235 0.7397 0.0496  0.2783  0.1215  350 LYS A N   
885  C CA  . LYS B 40 ? 0.5722 0.7154 0.7075 0.0356  0.2903  0.1339  350 LYS A CA  
886  C C   . LYS B 40 ? 0.6317 0.7767 0.7389 0.0710  0.3292  0.1347  350 LYS A C   
887  O O   . LYS B 40 ? 0.5659 0.6947 0.6436 0.0662  0.3439  0.1325  350 LYS A O   
888  C CB  . LYS B 40 ? 0.5466 0.7690 0.7387 0.0128  0.2750  0.1618  350 LYS A CB  
889  N N   . ARG B 41 ? 0.5596 0.7193 0.6685 0.1105  0.3453  0.1373  351 ARG A N   
890  C CA  . ARG B 41 ? 0.7369 0.8762 0.8028 0.1473  0.3651  0.1299  351 ARG A CA  
891  C C   . ARG B 41 ? 0.7638 0.7993 0.7584 0.1514  0.3711  0.1034  351 ARG A C   
892  O O   . ARG B 41 ? 0.8078 0.8119 0.7568 0.1656  0.3840  0.0953  351 ARG A O   
893  C CB  . ARG B 41 ? 0.8145 0.9881 0.8953 0.1884  0.3700  0.1388  351 ARG A CB  
894  C CG  . ARG B 41 ? 0.9330 1.0729 0.9615 0.2325  0.3885  0.1309  351 ARG A CG  
895  C CD  . ARG B 41 ? 1.1251 1.3112 1.1549 0.2321  0.4009  0.1394  351 ARG A CD  
896  N NE  . ARG B 41 ? 1.3511 1.5131 1.3320 0.2798  0.4190  0.1340  351 ARG A NE  
897  C CZ  . ARG B 41 ? 1.4845 1.7092 1.4863 0.3173  0.4267  0.1494  351 ARG A CZ  
898  N NH1 . ARG B 41 ? 1.5963 1.9148 1.6700 0.3084  0.4167  0.1715  351 ARG A NH1 
899  N NH2 . ARG B 41 ? 1.4894 1.6832 1.4384 0.3639  0.4428  0.1437  351 ARG A NH2 
900  N N   . ILE B 42 ? 0.7818 0.7654 0.7648 0.1376  0.3612  0.0908  352 ILE A N   
901  C CA  . ILE B 42 ? 0.7822 0.6737 0.7016 0.1317  0.3641  0.0683  352 ILE A CA  
902  C C   . ILE B 42 ? 0.7527 0.6302 0.6539 0.1026  0.3620  0.0612  352 ILE A C   
903  O O   . ILE B 42 ? 0.7410 0.5585 0.5843 0.1056  0.3699  0.0466  352 ILE A O   
904  C CB  . ILE B 42 ? 0.7401 0.5968 0.6602 0.1157  0.3446  0.0595  352 ILE A CB  
905  C CG1 . ILE B 42 ? 0.6896 0.5442 0.6109 0.1492  0.3506  0.0662  352 ILE A CG1 
906  C CG2 . ILE B 42 ? 0.7774 0.5549 0.6423 0.0960  0.3409  0.0401  352 ILE A CG2 
907  C CD1 . ILE B 42 ? 0.7082 0.5301 0.6249 0.1351  0.3330  0.0605  352 ILE A CD1 
908  N N   . GLN B 43 ? 0.6215 0.5475 0.5670 0.0728  0.3439  0.0710  353 GLN A N   
909  C CA  . GLN B 43 ? 0.6855 0.5987 0.6128 0.0469  0.3383  0.0669  353 GLN A CA  
910  C C   . GLN B 43 ? 0.6654 0.5940 0.5694 0.0640  0.3623  0.0741  353 GLN A C   
911  O O   . GLN B 43 ? 0.7009 0.5861 0.5561 0.0587  0.3664  0.0622  353 GLN A O   
912  C CB  . GLN B 43 ? 0.6319 0.5848 0.6047 0.0152  0.3114  0.0780  353 GLN A CB  
913  C CG  . GLN B 43 ? 0.7649 0.7010 0.7524 0.0015  0.2834  0.0679  353 GLN A CG  
914  C CD  . GLN B 43 ? 0.8877 0.8474 0.9058 -0.0243 0.2547  0.0767  353 GLN A CD  
915  O OE1 . GLN B 43 ? 0.6814 0.6202 0.6824 -0.0428 0.2418  0.0722  353 GLN A OE1 
916  N NE2 . GLN B 43 ? 0.9899 0.9876 1.0482 -0.0251 0.2418  0.0892  353 GLN A NE2 
917  N N   . GLN B 44 ? 0.6644 0.6598 0.6034 0.0842  0.3707  0.0929  354 GLN A N   
918  C CA  . GLN B 44 ? 0.7675 0.7915 0.6894 0.1022  0.3871  0.1002  354 GLN A CA  
919  C C   . GLN B 44 ? 0.7747 0.7344 0.6310 0.1401  0.4021  0.0815  354 GLN A C   
920  O O   . GLN B 44 ? 0.8884 0.8241 0.6985 0.1478  0.4123  0.0748  354 GLN A O   
921  C CB  . GLN B 44 ? 0.8679 0.9910 0.8494 0.1109  0.3908  0.1266  354 GLN A CB  
922  C CG  . GLN B 44 ? 1.0013 1.1824 1.0407 0.0676  0.3734  0.1487  354 GLN A CG  
923  C CD  . GLN B 44 ? 1.1791 1.4597 1.2788 0.0700  0.3737  0.1757  354 GLN A CD  
924  O OE1 . GLN B 44 ? 1.3521 1.6611 1.4591 0.1080  0.3848  0.1770  354 GLN A OE1 
925  N NE2 . GLN B 44 ? 1.0890 1.4195 1.2295 0.0280  0.3589  0.1988  354 GLN A NE2 
926  N N   . GLN B 45 ? 0.9584 0.8825 0.8038 0.1637  0.4024  0.0735  355 GLN A N   
927  C CA  . GLN B 45 ? 0.9684 0.8207 0.7449 0.2001  0.4139  0.0584  355 GLN A CA  
928  C C   . GLN B 45 ? 1.0679 0.8196 0.7749 0.1809  0.4093  0.0347  355 GLN A C   
929  O O   . GLN B 45 ? 0.9904 0.6820 0.6299 0.2015  0.4171  0.0224  355 GLN A O   
930  C CB  . GLN B 45 ? 0.8838 0.7198 0.6631 0.2283  0.4131  0.0598  355 GLN A CB  
931  N N   . THR B 46 ? 0.9747 0.7080 0.6945 0.1414  0.3955  0.0281  356 THR A N   
932  C CA  . THR B 46 ? 1.0078 0.6565 0.6669 0.1167  0.3889  0.0066  356 THR A CA  
933  C C   . THR B 46 ? 0.9621 0.6278 0.6209 0.0859  0.3829  0.0053  356 THR A C   
934  O O   . THR B 46 ? 0.9125 0.5178 0.5221 0.0625  0.3746  -0.0120 356 THR A O   
935  C CB  . THR B 46 ? 0.9984 0.6149 0.6647 0.0933  0.3773  -0.0008 356 THR A CB  
936  O OG1 . THR B 46 ? 0.7885 0.4788 0.5305 0.0696  0.3602  0.0121  356 THR A OG1 
937  C CG2 . THR B 46 ? 0.9116 0.4961 0.5645 0.1238  0.3836  0.0008  356 THR A CG2 
938  N N   . HIS B 47 ? 0.8906 0.6361 0.6001 0.0830  0.3843  0.0247  357 HIS A N   
939  C CA  . HIS B 47 ? 0.8511 0.6113 0.5577 0.0554  0.3780  0.0280  357 HIS A CA  
940  C C   . HIS B 47 ? 0.9529 0.6892 0.6668 0.0173  0.3514  0.0178  357 HIS A C   
941  O O   . HIS B 47 ? 0.8919 0.5926 0.5677 -0.0015 0.3393  0.0060  357 HIS A O   
942  C CB  . HIS B 47 ? 0.8996 0.6190 0.5374 0.0689  0.3880  0.0177  357 HIS A CB  
943  C CG  . HIS B 47 ? 0.9925 0.7449 0.6265 0.1098  0.4071  0.0273  357 HIS A CG  
944  N ND1 . HIS B 47 ? 1.0351 0.7312 0.6157 0.1456  0.4163  0.0136  357 HIS A ND1 
945  C CD2 . HIS B 47 ? 0.9225 0.7604 0.5981 0.1196  0.4178  0.0504  357 HIS A CD2 
946  C CE1 . HIS B 47 ? 1.0611 0.8102 0.6518 0.1805  0.4329  0.0267  357 HIS A CE1 
947  N NE2 . HIS B 47 ? 1.0743 0.9148 0.7248 0.1635  0.4349  0.0492  357 HIS A NE2 
948  N N   . THR B 48 ? 0.7337 0.4968 0.5005 0.0082  0.3359  0.0226  358 THR A N   
949  C CA  . THR B 48 ? 0.8163 0.5713 0.5993 -0.0201 0.3065  0.0141  358 THR A CA  
950  C C   . THR B 48 ? 0.7138 0.5225 0.5554 -0.0318 0.2890  0.0290  358 THR A C   
951  O O   . THR B 48 ? 0.6823 0.5342 0.5586 -0.0227 0.2972  0.0464  358 THR A O   
952  C CB  . THR B 48 ? 0.8731 0.5959 0.6500 -0.0192 0.3018  0.0027  358 THR A CB  
953  O OG1 . THR B 48 ? 0.6808 0.4296 0.4910 0.0020  0.3115  0.0133  358 THR A OG1 
954  C CG2 . THR B 48 ? 0.9916 0.6432 0.6999 -0.0148 0.3121  -0.0127 358 THR A CG2 
955  N N   . TYR B 49 ? 0.6270 0.4319 0.4762 -0.0516 0.2627  0.0223  359 TYR A N   
956  C CA  . TYR B 49 ? 0.6627 0.4981 0.5528 -0.0605 0.2400  0.0314  359 TYR A CA  
957  C C   . TYR B 49 ? 0.5996 0.4364 0.5082 -0.0570 0.2275  0.0223  359 TYR A C   
958  O O   . TYR B 49 ? 0.6138 0.4354 0.5067 -0.0633 0.2188  0.0092  359 TYR A O   
959  C CB  . TYR B 49 ? 0.5831 0.4102 0.4594 -0.0768 0.2193  0.0311  359 TYR A CB  
960  C CG  . TYR B 49 ? 0.7066 0.5447 0.6089 -0.0829 0.1907  0.0364  359 TYR A CG  
961  C CD1 . TYR B 49 ? 0.6055 0.4362 0.5056 -0.0809 0.1682  0.0231  359 TYR A CD1 
962  C CD2 . TYR B 49 ? 0.8157 0.6712 0.7409 -0.0904 0.1850  0.0554  359 TYR A CD2 
963  C CE1 . TYR B 49 ? 0.6438 0.4731 0.5552 -0.0792 0.1411  0.0252  359 TYR A CE1 
964  C CE2 . TYR B 49 ? 0.8073 0.6555 0.7438 -0.0969 0.1543  0.0584  359 TYR A CE2 
965  C CZ  . TYR B 49 ? 0.7759 0.6054 0.7010 -0.0879 0.1326  0.0416  359 TYR A CZ  
966  O OH  . TYR B 49 ? 0.7694 0.5809 0.6939 -0.0872 0.1012  0.0419  359 TYR A OH  
967  N N   . ILE B 50 ? 0.5586 0.4198 0.5005 -0.0478 0.2262  0.0309  360 ILE A N   
968  C CA  . ILE B 50 ? 0.6549 0.5191 0.6104 -0.0401 0.2185  0.0246  360 ILE A CA  
969  C C   . ILE B 50 ? 0.4852 0.3685 0.4671 -0.0419 0.1925  0.0288  360 ILE A C   
970  O O   . ILE B 50 ? 0.5796 0.4812 0.5826 -0.0451 0.1875  0.0425  360 ILE A O   
971  C CB  . ILE B 50 ? 0.6002 0.4657 0.5601 -0.0222 0.2392  0.0293  360 ILE A CB  
972  C CG1 . ILE B 50 ? 0.6335 0.4609 0.5522 -0.0175 0.2619  0.0225  360 ILE A CG1 
973  C CG2 . ILE B 50 ? 0.5122 0.3814 0.4834 -0.0152 0.2304  0.0257  360 ILE A CG2 
974  C CD1 . ILE B 50 ? 0.6677 0.4839 0.5792 0.0068  0.2821  0.0268  360 ILE A CD1 
975  N N   . VAL B 51 ? 0.5919 0.4718 0.5698 -0.0397 0.1751  0.0178  361 VAL A N   
976  C CA  . VAL B 51 ? 0.5288 0.4140 0.5180 -0.0343 0.1485  0.0172  361 VAL A CA  
977  C C   . VAL B 51 ? 0.4567 0.3548 0.4579 -0.0195 0.1512  0.0159  361 VAL A C   
978  O O   . VAL B 51 ? 0.4530 0.3538 0.4462 -0.0135 0.1625  0.0096  361 VAL A O   
979  C CB  . VAL B 51 ? 0.6514 0.5275 0.6224 -0.0311 0.1280  0.0056  361 VAL A CB  
980  C CG1 . VAL B 51 ? 0.4834 0.3528 0.4531 -0.0178 0.1000  0.0016  361 VAL A CG1 
981  C CG2 . VAL B 51 ? 0.6858 0.5452 0.6407 -0.0445 0.1230  0.0085  361 VAL A CG2 
982  N N   . THR B 52 ? 0.5514 0.4582 0.5702 -0.0166 0.1393  0.0239  362 THR A N   
983  C CA  . THR B 52 ? 0.5497 0.4680 0.5764 -0.0009 0.1383  0.0236  362 THR A CA  
984  C C   . THR B 52 ? 0.5726 0.4830 0.5835 0.0113  0.1141  0.0113  362 THR A C   
985  O O   . THR B 52 ? 0.4736 0.3661 0.4746 0.0083  0.0880  0.0076  362 THR A O   
986  C CB  . THR B 52 ? 0.6234 0.5610 0.6760 -0.0029 0.1328  0.0380  362 THR A CB  
987  O OG1 . THR B 52 ? 0.5710 0.5249 0.6360 -0.0026 0.1609  0.0493  362 THR A OG1 
988  C CG2 . THR B 52 ? 0.6024 0.5488 0.6583 0.0140  0.1232  0.0367  362 THR A CG2 
989  N N   . PRO B 53 ? 0.5817 0.5022 0.5846 0.0269  0.1220  0.0056  363 PRO A N   
990  C CA  . PRO B 53 ? 0.4647 0.3849 0.4488 0.0460  0.1021  -0.0058 363 PRO A CA  
991  C C   . PRO B 53 ? 0.5278 0.4333 0.5079 0.0536  0.0741  -0.0064 363 PRO A C   
992  O O   . PRO B 53 ? 0.4818 0.3927 0.4813 0.0451  0.0736  0.0045  363 PRO A O   
993  C CB  . PRO B 53 ? 0.4575 0.4006 0.4377 0.0569  0.1225  -0.0052 363 PRO A CB  
994  C CG  . PRO B 53 ? 0.5597 0.5005 0.5537 0.0469  0.1446  0.0071  363 PRO A CG  
995  C CD  . PRO B 53 ? 0.4832 0.4121 0.4876 0.0288  0.1495  0.0108  363 PRO A CD  
996  N N   . SER B 54 ? 0.7455 0.6323 0.6968 0.0715  0.0488  -0.0196 364 SER A N   
997  C CA  . SER B 54 ? 0.8368 0.6938 0.7708 0.0769  0.0147  -0.0235 364 SER A CA  
998  C C   . SER B 54 ? 0.8605 0.7353 0.7959 0.0913  0.0176  -0.0214 364 SER A C   
999  O O   . SER B 54 ? 1.1312 1.0376 1.0807 0.0961  0.0470  -0.0148 364 SER A O   
1000 C CB  . SER B 54 ? 0.8233 0.6428 0.7120 0.0998  -0.0136 -0.0411 364 SER A CB  
1001 O OG  . SER B 54 ? 0.6908 0.4865 0.5744 0.0864  -0.0212 -0.0409 364 SER A OG  
1002 N N   . ARG B 55 ? 0.8383 0.6855 0.7529 0.0967  -0.0163 -0.0264 365 ARG A N   
1003 C CA  . ARG B 55 ? 0.9604 0.8226 0.8758 0.1075  -0.0193 -0.0226 365 ARG A CA  
1004 C C   . ARG B 55 ? 0.9911 0.8729 0.8832 0.1401  0.0003  -0.0298 365 ARG A C   
1005 O O   . ARG B 55 ? 0.9620 0.8739 0.8700 0.1431  0.0246  -0.0186 365 ARG A O   
1006 C CB  . ARG B 55 ? 1.0137 0.8357 0.9024 0.1049  -0.0661 -0.0291 365 ARG A CB  
1007 N N   . ASP B 56 ? 0.8915 0.7577 0.7431 0.1665  -0.0097 -0.0467 366 ASP A N   
1008 C CA  . ASP B 56 ? 0.8277 0.7220 0.6545 0.1996  0.0073  -0.0515 366 ASP A CA  
1009 C C   . ASP B 56 ? 0.7947 0.7219 0.6248 0.2079  0.0315  -0.0537 366 ASP A C   
1010 O O   . ASP B 56 ? 0.7165 0.6676 0.5183 0.2408  0.0373  -0.0611 366 ASP A O   
1011 C CB  . ASP B 56 ? 0.7851 0.6453 0.5548 0.2340  -0.0250 -0.0691 366 ASP A CB  
1012 C CG  . ASP B 56 ? 0.8797 0.7143 0.6455 0.2235  -0.0519 -0.0659 366 ASP A CG  
1013 O OD1 . ASP B 56 ? 0.9348 0.7226 0.6923 0.2058  -0.0885 -0.0710 366 ASP A OD1 
1014 O OD2 . ASP B 56 ? 0.7758 0.6383 0.5472 0.2302  -0.0380 -0.0562 366 ASP A OD2 
1015 N N   . LYS B 57 ? 0.7920 0.7266 0.6558 0.1794  0.0453  -0.0463 367 LYS A N   
1016 C CA  . LYS B 57 ? 0.5570 0.5287 0.4291 0.1809  0.0659  -0.0460 367 LYS A CA  
1017 C C   . LYS B 57 ? 0.5572 0.5692 0.4574 0.1602  0.1015  -0.0289 367 LYS A C   
1018 O O   . LYS B 57 ? 0.5184 0.5242 0.4268 0.1509  0.1107  -0.0183 367 LYS A O   
1019 C CB  . LYS B 57 ? 0.5507 0.4994 0.4325 0.1629  0.0557  -0.0492 367 LYS A CB  
1020 N N   . GLU B 58 ? 0.5808 0.6316 0.4923 0.1525  0.1192  -0.0254 368 GLU A N   
1021 C CA  . GLU B 58 ? 0.5896 0.6683 0.5198 0.1270  0.1487  -0.0088 368 GLU A CA  
1022 C C   . GLU B 58 ? 0.5970 0.6362 0.5442 0.0964  0.1558  -0.0016 368 GLU A C   
1023 O O   . GLU B 58 ? 0.6192 0.6348 0.5750 0.0850  0.1460  -0.0071 368 GLU A O   
1024 C CB  . GLU B 58 ? 0.6347 0.7647 0.5755 0.1180  0.1604  -0.0058 368 GLU A CB  
1025 C CG  . GLU B 58 ? 0.9005 1.0240 0.8458 0.1174  0.1449  -0.0172 368 GLU A CG  
1026 C CD  . GLU B 58 ? 1.0383 1.2218 0.9988 0.1054  0.1556  -0.0115 368 GLU A CD  
1027 O OE1 . GLU B 58 ? 1.0794 1.3116 1.0488 0.0933  0.1749  0.0027  368 GLU A OE1 
1028 O OE2 . GLU B 58 ? 1.1643 1.3483 1.1277 0.1057  0.1432  -0.0192 368 GLU A OE2 
1029 N N   . PRO B 59 ? 0.6082 0.6385 0.5563 0.0861  0.1730  0.0117  369 PRO A N   
1030 C CA  . PRO B 59 ? 0.5575 0.5501 0.5156 0.0680  0.1806  0.0178  369 PRO A CA  
1031 C C   . PRO B 59 ? 0.5922 0.5749 0.5545 0.0397  0.1944  0.0199  369 PRO A C   
1032 O O   . PRO B 59 ? 0.5678 0.5317 0.5208 0.0240  0.2121  0.0300  369 PRO A O   
1033 C CB  . PRO B 59 ? 0.5287 0.5120 0.4759 0.0739  0.1936  0.0312  369 PRO A CB  
1034 C CG  . PRO B 59 ? 0.6031 0.6186 0.5350 0.0951  0.1894  0.0312  369 PRO A CG  
1035 C CD  . PRO B 59 ? 0.5699 0.6220 0.5040 0.0957  0.1858  0.0226  369 PRO A CD  
1036 N N   . VAL B 60 ? 0.4582 0.4454 0.4275 0.0334  0.1840  0.0103  370 VAL A N   
1037 C CA  . VAL B 60 ? 0.4605 0.4397 0.4291 0.0072  0.1928  0.0102  370 VAL A CA  
1038 C C   . VAL B 60 ? 0.5378 0.4886 0.5109 0.0032  0.1864  0.0052  370 VAL A C   
1039 O O   . VAL B 60 ? 0.5821 0.5364 0.5605 0.0137  0.1679  -0.0013 370 VAL A O   
1040 C CB  . VAL B 60 ? 0.5185 0.5422 0.4901 0.0027  0.1873  0.0064  370 VAL A CB  
1041 C CG1 . VAL B 60 ? 0.4623 0.4761 0.4315 -0.0261 0.1907  0.0054  370 VAL A CG1 
1042 C CG2 . VAL B 60 ? 0.4640 0.5292 0.4342 0.0032  0.1977  0.0164  370 VAL A CG2 
1043 N N   . PHE B 61 ? 0.5643 0.4831 0.5293 -0.0113 0.2015  0.0092  371 PHE A N   
1044 C CA  . PHE B 61 ? 0.6162 0.5153 0.5820 -0.0164 0.2008  0.0070  371 PHE A CA  
1045 C C   . PHE B 61 ? 0.5972 0.4920 0.5499 -0.0362 0.2000  0.0008  371 PHE A C   
1046 O O   . PHE B 61 ? 0.6053 0.4940 0.5432 -0.0529 0.2079  0.0011  371 PHE A O   
1047 C CB  . PHE B 61 ? 0.6620 0.5318 0.6206 -0.0121 0.2190  0.0141  371 PHE A CB  
1048 C CG  . PHE B 61 ? 0.6359 0.5175 0.6119 0.0082  0.2172  0.0219  371 PHE A CG  
1049 C CD1 . PHE B 61 ? 0.5222 0.4182 0.5194 0.0140  0.2102  0.0268  371 PHE A CD1 
1050 C CD2 . PHE B 61 ? 0.6132 0.4948 0.5840 0.0187  0.2210  0.0267  371 PHE A CD2 
1051 C CE1 . PHE B 61 ? 0.5425 0.4567 0.5587 0.0292  0.2047  0.0353  371 PHE A CE1 
1052 C CE2 . PHE B 61 ? 0.4836 0.3778 0.4686 0.0382  0.2164  0.0339  371 PHE A CE2 
1053 C CZ  . PHE B 61 ? 0.4704 0.3829 0.4798 0.0431  0.2071  0.0377  371 PHE A CZ  
1054 N N   . GLU B 62 ? 0.6012 0.4973 0.5568 -0.0371 0.1880  -0.0031 372 GLU A N   
1055 C CA  . GLU B 62 ? 0.5888 0.4803 0.5296 -0.0534 0.1845  -0.0085 372 GLU A CA  
1056 C C   . GLU B 62 ? 0.6877 0.5459 0.6125 -0.0596 0.1962  -0.0065 372 GLU A C   
1057 O O   . GLU B 62 ? 0.7263 0.5844 0.6602 -0.0530 0.1929  -0.0014 372 GLU A O   
1058 C CB  . GLU B 62 ? 0.5154 0.4299 0.4622 -0.0458 0.1617  -0.0135 372 GLU A CB  
1059 C CG  . GLU B 62 ? 0.8601 0.8148 0.8172 -0.0324 0.1523  -0.0165 372 GLU A CG  
1060 C CD  . GLU B 62 ? 1.2237 1.1990 1.1776 -0.0199 0.1308  -0.0229 372 GLU A CD  
1061 O OE1 . GLU B 62 ? 1.2972 1.2486 1.2443 -0.0075 0.1147  -0.0248 372 GLU A OE1 
1062 O OE2 . GLU B 62 ? 1.2679 1.2839 1.2250 -0.0226 0.1286  -0.0246 372 GLU A OE2 
1063 N N   . VAL B 63 ? 0.6315 0.4608 0.5287 -0.0729 0.2094  -0.0095 373 VAL A N   
1064 C CA  . VAL B 63 ? 0.6061 0.3997 0.4769 -0.0724 0.2244  -0.0094 373 VAL A CA  
1065 C C   . VAL B 63 ? 0.5897 0.3720 0.4346 -0.0893 0.2160  -0.0167 373 VAL A C   
1066 O O   . VAL B 63 ? 0.6169 0.3971 0.4482 -0.1080 0.2074  -0.0231 373 VAL A O   
1067 C CB  . VAL B 63 ? 0.6740 0.4250 0.5165 -0.0688 0.2435  -0.0098 373 VAL A CB  
1068 C CG1 . VAL B 63 ? 0.6492 0.3652 0.4589 -0.0576 0.2610  -0.0107 373 VAL A CG1 
1069 C CG2 . VAL B 63 ? 0.6935 0.4584 0.5604 -0.0509 0.2491  -0.0014 373 VAL A CG2 
1070 N N   . THR B 64 ? 0.6716 0.4507 0.5095 -0.0849 0.2177  -0.0136 374 THR A N   
1071 C CA  . THR B 64 ? 0.6204 0.3876 0.4295 -0.0977 0.2091  -0.0190 374 THR A CA  
1072 C C   . THR B 64 ? 0.6654 0.3973 0.4357 -0.0919 0.2295  -0.0185 374 THR A C   
1073 O O   . THR B 64 ? 0.7521 0.4929 0.5341 -0.0756 0.2460  -0.0081 374 THR A O   
1074 C CB  . THR B 64 ? 0.6947 0.4889 0.5229 -0.0962 0.1892  -0.0137 374 THR A CB  
1075 O OG1 . THR B 64 ? 0.7090 0.5340 0.5660 -0.0925 0.1715  -0.0160 374 THR A OG1 
1076 C CG2 . THR B 64 ? 0.6693 0.4512 0.4646 -0.1075 0.1785  -0.0181 374 THR A CG2 
1077 N N   . GLY B 65 ? 0.7134 0.4097 0.4365 -0.1043 0.2279  -0.0294 375 GLY A N   
1078 C CA  . GLY B 65 ? 0.8015 0.4579 0.4747 -0.0941 0.2471  -0.0320 375 GLY A CA  
1079 C C   . GLY B 65 ? 0.9258 0.5261 0.5390 -0.1103 0.2409  -0.0486 375 GLY A C   
1080 O O   . GLY B 65 ? 0.8472 0.4521 0.4649 -0.1354 0.2194  -0.0548 375 GLY A O   
1081 N N   . MET B 66 ? 0.9859 0.5354 0.5404 -0.0951 0.2594  -0.0549 376 MET A N   
1082 C CA  . MET B 66 ? 1.0502 0.5277 0.5331 -0.1096 0.2517  -0.0726 376 MET A CA  
1083 C C   . MET B 66 ? 0.9994 0.4451 0.4815 -0.1244 0.2453  -0.0772 376 MET A C   
1084 O O   . MET B 66 ? 1.0462 0.5040 0.5601 -0.1068 0.2594  -0.0689 376 MET A O   
1085 C CB  . MET B 66 ? 1.1986 0.6196 0.6103 -0.0801 0.2756  -0.0798 376 MET A CB  
1086 N N   . PRO B 67 ? 1.1963 0.6033 0.6421 -0.1598 0.2225  -0.0881 377 PRO A N   
1087 C CA  . PRO B 67 ? 1.1413 0.5207 0.5868 -0.1826 0.2145  -0.0877 377 PRO A CA  
1088 C C   . PRO B 67 ? 1.1535 0.4572 0.5536 -0.1560 0.2358  -0.0904 377 PRO A C   
1089 O O   . PRO B 67 ? 1.1071 0.4172 0.5359 -0.1553 0.2404  -0.0811 377 PRO A O   
1090 C CB  . PRO B 67 ? 1.1518 0.4945 0.5514 -0.2282 0.1852  -0.0985 377 PRO A CB  
1091 C CG  . PRO B 67 ? 1.1734 0.5670 0.5868 -0.2304 0.1730  -0.1001 377 PRO A CG  
1092 C CD  . PRO B 67 ? 1.1813 0.5775 0.5904 -0.1852 0.1998  -0.0980 377 PRO A CD  
1093 N N   . GLU B 68 ? 1.2124 0.4437 0.5375 -0.1297 0.2491  -0.1029 378 GLU A N   
1094 C CA  . GLU B 68 ? 1.4178 0.5765 0.6943 -0.0933 0.2704  -0.1059 378 GLU A CA  
1095 C C   . GLU B 68 ? 1.3657 0.5955 0.7096 -0.0522 0.2962  -0.0894 378 GLU A C   
1096 O O   . GLU B 68 ? 1.2172 0.4213 0.5593 -0.0319 0.3069  -0.0842 378 GLU A O   
1097 C CB  . GLU B 68 ? 1.3905 0.4655 0.5703 -0.0655 0.2794  -0.1226 378 GLU A CB  
1098 N N   . ASN B 69 ? 1.1224 0.4392 0.5233 -0.0417 0.3036  -0.0797 379 ASN A N   
1099 C CA  . ASN B 69 ? 1.0502 0.4397 0.5178 -0.0107 0.3228  -0.0623 379 ASN A CA  
1100 C C   . ASN B 69 ? 1.1093 0.5503 0.6480 -0.0304 0.3094  -0.0512 379 ASN A C   
1101 O O   . ASN B 69 ? 0.9422 0.4088 0.5151 -0.0065 0.3213  -0.0402 379 ASN A O   
1102 C CB  . ASN B 69 ? 1.1010 0.5600 0.6018 -0.0018 0.3310  -0.0528 379 ASN A CB  
1103 C CG  . ASN B 69 ? 1.2116 0.6377 0.6484 0.0309  0.3539  -0.0583 379 ASN A CG  
1104 O OD1 . ASN B 69 ? 1.2550 0.6335 0.6491 0.0645  0.3668  -0.0623 379 ASN A OD1 
1105 N ND2 . ASN B 69 ? 1.1416 0.5983 0.5761 0.0233  0.3533  -0.0551 379 ASN A ND2 
1106 N N   . VAL B 70 ? 1.0601 0.5212 0.6199 -0.0706 0.2848  -0.0534 380 VAL A N   
1107 C CA  . VAL B 70 ? 0.9345 0.4488 0.5563 -0.0850 0.2734  -0.0434 380 VAL A CA  
1108 C C   . VAL B 70 ? 0.9667 0.4323 0.5667 -0.0880 0.2759  -0.0418 380 VAL A C   
1109 O O   . VAL B 70 ? 0.8865 0.3850 0.5273 -0.0760 0.2802  -0.0308 380 VAL A O   
1110 C CB  . VAL B 70 ? 0.9035 0.4593 0.5500 -0.1205 0.2483  -0.0454 380 VAL A CB  
1111 C CG1 . VAL B 70 ? 0.8886 0.4881 0.5812 -0.1349 0.2380  -0.0371 380 VAL A CG1 
1112 C CG2 . VAL B 70 ? 0.9095 0.5186 0.5873 -0.1121 0.2445  -0.0420 380 VAL A CG2 
1113 N N   . ASP B 71 ? 1.0814 0.4613 0.6108 -0.1048 0.2712  -0.0521 381 ASP A N   
1114 C CA  . ASP B 71 ? 1.2131 0.5295 0.7092 -0.1091 0.2725  -0.0486 381 ASP A CA  
1115 C C   . ASP B 71 ? 1.1955 0.4864 0.6790 -0.0571 0.2964  -0.0444 381 ASP A C   
1116 O O   . ASP B 71 ? 1.2496 0.5326 0.7429 -0.0490 0.2999  -0.0339 381 ASP A O   
1117 C CB  . ASP B 71 ? 1.5021 0.7170 0.9139 -0.1414 0.2581  -0.0607 381 ASP A CB  
1118 C CG  . ASP B 71 ? 1.7366 0.9882 1.1681 -0.1982 0.2313  -0.0603 381 ASP A CG  
1119 O OD1 . ASP B 71 ? 1.7384 1.0755 1.2396 -0.2149 0.2252  -0.0470 381 ASP A OD1 
1120 O OD2 . ASP B 71 ? 1.8909 1.0889 1.2663 -0.2240 0.2157  -0.0732 381 ASP A OD2 
1121 N N   . ARG B 72 ? 1.2013 0.4851 0.6629 -0.0197 0.3134  -0.0507 382 ARG A N   
1122 C CA  . ARG B 72 ? 1.2026 0.4871 0.6639 0.0345  0.3372  -0.0439 382 ARG A CA  
1123 C C   . ARG B 72 ? 1.1545 0.5421 0.7073 0.0444  0.3399  -0.0263 382 ARG A C   
1124 O O   . ARG B 72 ? 1.0655 0.4559 0.6296 0.0731  0.3490  -0.0166 382 ARG A O   
1125 C CB  . ARG B 72 ? 1.1539 0.4294 0.5785 0.0719  0.3568  -0.0513 382 ARG A CB  
1126 N N   . ALA B 73 ? 0.9223 0.3891 0.5353 0.0217  0.3293  -0.0226 383 ALA A N   
1127 C CA  . ALA B 73 ? 0.8341 0.3868 0.5245 0.0275  0.3263  -0.0081 383 ALA A CA  
1128 C C   . ALA B 73 ? 0.8822 0.4358 0.5909 0.0114  0.3140  -0.0030 383 ALA A C   
1129 O O   . ALA B 73 ? 0.8134 0.4038 0.5590 0.0303  0.3162  0.0080  383 ALA A O   
1130 C CB  . ALA B 73 ? 0.8814 0.4988 0.6163 0.0078  0.3145  -0.0066 383 ALA A CB  
1131 N N   . ARG B 74 ? 0.8930 0.4121 0.5766 -0.0248 0.3006  -0.0092 384 ARG A N   
1132 C CA  . ARG B 74 ? 0.9177 0.4391 0.6126 -0.0414 0.2924  -0.0010 384 ARG A CA  
1133 C C   . ARG B 74 ? 1.1047 0.5646 0.7614 -0.0165 0.3046  0.0053  384 ARG A C   
1134 O O   . ARG B 74 ? 1.1058 0.5890 0.7871 -0.0075 0.3046  0.0170  384 ARG A O   
1135 C CB  . ARG B 74 ? 0.9160 0.4181 0.5900 -0.0886 0.2768  -0.0051 384 ARG A CB  
1136 C CG  . ARG B 74 ? 0.9704 0.4649 0.6425 -0.1099 0.2721  0.0070  384 ARG A CG  
1137 C CD  . ARG B 74 ? 1.1406 0.6219 0.7922 -0.1621 0.2565  0.0068  384 ARG A CD  
1138 N NE  . ARG B 74 ? 1.2360 0.8052 0.9386 -0.1790 0.2436  0.0046  384 ARG A NE  
1139 C CZ  . ARG B 74 ? 1.1885 0.8387 0.9418 -0.1839 0.2388  0.0146  384 ARG A CZ  
1140 N NH1 . ARG B 74 ? 1.0439 0.7003 0.8047 -0.1769 0.2462  0.0282  384 ARG A NH1 
1141 N NH2 . ARG B 74 ? 1.1701 0.8934 0.9615 -0.1916 0.2266  0.0111  384 ARG A NH2 
1142 N N   . GLU B 75 ? 1.1323 0.5083 0.7219 -0.0014 0.3143  -0.0029 385 GLU A N   
1143 C CA  . GLU B 75 ? 1.2011 0.5057 0.7427 0.0301  0.3252  0.0021  385 GLU A CA  
1144 C C   . GLU B 75 ? 1.1004 0.4639 0.6855 0.0806  0.3393  0.0121  385 GLU A C   
1145 O O   . GLU B 75 ? 1.0274 0.3791 0.6105 0.1014  0.3420  0.0233  385 GLU A O   
1146 C CB  . GLU B 75 ? 1.3680 0.5621 0.8178 0.0410  0.3306  -0.0121 385 GLU A CB  
1147 C CG  . GLU B 75 ? 1.5603 0.6494 0.9379 0.0654  0.3354  -0.0086 385 GLU A CG  
1148 C CD  . GLU B 75 ? 2.0171 1.0186 1.3062 0.0662  0.3259  -0.0215 385 GLU A CD  
1149 O OE1 . GLU B 75 ? 2.1159 1.1179 1.3915 0.0555  0.3241  -0.0351 385 GLU A OE1 
1150 O OE2 . GLU B 75 ? 2.2744 1.2032 1.5035 0.0782  0.3188  -0.0179 385 GLU A OE2 
1151 N N   . GLU B 76 ? 1.0484 0.4778 0.6722 0.0985  0.3471  0.0104  386 GLU A N   
1152 C CA  . GLU B 76 ? 1.0546 0.5541 0.7272 0.1394  0.3577  0.0229  386 GLU A CA  
1153 C C   . GLU B 76 ? 0.9674 0.5329 0.7027 0.1274  0.3436  0.0348  386 GLU A C   
1154 O O   . GLU B 76 ? 0.9406 0.5333 0.6968 0.1584  0.3470  0.0466  386 GLU A O   
1155 C CB  . GLU B 76 ? 1.1183 0.6823 0.8235 0.1479  0.3662  0.0228  386 GLU A CB  
1156 C CG  . GLU B 76 ? 1.2140 0.7275 0.8581 0.1733  0.3835  0.0134  386 GLU A CG  
1157 C CD  . GLU B 76 ? 1.2863 0.8260 0.9335 0.2239  0.3906  0.0267  386 GLU A CD  
1158 O OE1 . GLU B 76 ? 1.3441 0.8651 0.9845 0.2461  0.3894  0.0342  386 GLU A OE1 
1159 O OE2 . GLU B 76 ? 1.3097 0.8929 0.9656 0.2421  0.3977  0.0306  386 GLU A OE2 
1160 N N   . ILE B 77 ? 0.8805 0.4736 0.6429 0.0863  0.3267  0.0314  387 ILE A N   
1161 C CA  . ILE B 77 ? 0.9088 0.5570 0.7191 0.0783  0.3127  0.0398  387 ILE A CA  
1162 C C   . ILE B 77 ? 1.0486 0.6519 0.8288 0.0816  0.3131  0.0473  387 ILE A C   
1163 O O   . ILE B 77 ? 0.8519 0.4827 0.6532 0.1034  0.3109  0.0581  387 ILE A O   
1164 C CB  . ILE B 77 ? 0.7470 0.4329 0.5850 0.0416  0.2961  0.0333  387 ILE A CB  
1165 C CG1 . ILE B 77 ? 0.7545 0.4859 0.6241 0.0407  0.2928  0.0301  387 ILE A CG1 
1166 C CG2 . ILE B 77 ? 0.6384 0.3664 0.5081 0.0374  0.2825  0.0395  387 ILE A CG2 
1167 C CD1 . ILE B 77 ? 0.6575 0.4151 0.5441 0.0111  0.2757  0.0227  387 ILE A CD1 
1168 N N   . GLU B 78 ? 1.0817 0.6132 0.8089 0.0573  0.3138  0.0435  388 GLU A N   
1169 C CA  . GLU B 78 ? 1.0731 0.5550 0.7655 0.0522  0.3132  0.0543  388 GLU A CA  
1170 C C   . GLU B 78 ? 1.0917 0.5161 0.7438 0.0966  0.3250  0.0612  388 GLU A C   
1171 O O   . GLU B 78 ? 1.2596 0.6563 0.8920 0.1027  0.3238  0.0741  388 GLU A O   
1172 C CB  . GLU B 78 ? 1.2992 0.7172 0.9435 0.0068  0.3079  0.0511  388 GLU A CB  
1173 C CG  . GLU B 78 ? 1.3754 0.8588 1.0598 -0.0358 0.2953  0.0498  388 GLU A CG  
1174 C CD  . GLU B 78 ? 1.5039 0.9363 1.1466 -0.0834 0.2878  0.0463  388 GLU A CD  
1175 O OE1 . GLU B 78 ? 1.6317 0.9644 1.2067 -0.0893 0.2899  0.0473  388 GLU A OE1 
1176 O OE2 . GLU B 78 ? 1.4433 0.9331 1.1180 -0.1144 0.2775  0.0430  388 GLU A OE2 
1177 N N   . MET B 79 ? 1.0509 0.4593 0.6877 0.1309  0.3369  0.0540  389 MET A N   
1178 C CA  . MET B 79 ? 1.2058 0.5695 0.8055 0.1837  0.3491  0.0605  389 MET A CA  
1179 C C   . MET B 79 ? 1.3460 0.7947 1.0051 0.2178  0.3484  0.0744  389 MET A C   
1180 O O   . MET B 79 ? 1.5625 0.9804 1.1950 0.2577  0.3533  0.0846  389 MET A O   
1181 C CB  . MET B 79 ? 1.2224 0.5528 0.7857 0.2155  0.3645  0.0488  389 MET A CB  
1182 C CG  . MET B 79 ? 1.4005 0.6876 0.9146 0.2662  0.3692  0.0557  389 MET A CG  
1183 S SD  . MET B 79 ? 1.7202 1.0128 1.2072 0.2995  0.3775  0.0476  389 MET A SD  
1184 C CE  . MET B 79 ? 1.6259 1.0684 1.2205 0.3016  0.3829  0.0543  389 MET A CE  
1185 N N   . HIS B 80 ? 1.3588 0.9078 1.0923 0.2026  0.3392  0.0752  390 HIS A N   
1186 C CA  . HIS B 80 ? 1.3965 1.0239 1.1839 0.2283  0.3327  0.0881  390 HIS A CA  
1187 C C   . HIS B 80 ? 1.5144 1.1375 1.3006 0.2180  0.3198  0.0970  390 HIS A C   
1188 O O   . HIS B 80 ? 1.6632 1.3040 1.4562 0.2502  0.3169  0.1094  390 HIS A O   
1189 C CB  . HIS B 80 ? 1.2661 0.9884 1.1235 0.2127  0.3236  0.0862  390 HIS A CB  
1190 C CG  . HIS B 80 ? 1.4382 1.1888 1.3070 0.2319  0.3383  0.0854  390 HIS A CG  
1191 N ND1 . HIS B 80 ? 1.5169 1.2222 1.3490 0.2209  0.3502  0.0729  390 HIS A ND1 
1192 C CD2 . HIS B 80 ? 1.4803 1.3064 1.3926 0.2609  0.3433  0.0975  390 HIS A CD2 
1193 C CE1 . HIS B 80 ? 1.5174 1.2670 1.3664 0.2451  0.3640  0.0771  390 HIS A CE1 
1194 N NE2 . HIS B 80 ? 1.4775 1.3057 1.3786 0.2662  0.3579  0.0934  390 HIS A NE2 
1195 N N   . ILE B 81 ? 1.3730 0.9793 1.1501 0.1754  0.3122  0.0924  391 ILE A N   
1196 C CA  . ILE B 81 ? 1.3319 0.9364 1.1017 0.1651  0.3036  0.1025  391 ILE A CA  
1197 C C   . ILE B 81 ? 1.2342 0.8070 0.9793 0.1181  0.3026  0.0997  391 ILE A C   
1198 O O   . ILE B 81 ? 1.1851 0.8076 0.9639 0.0910  0.2950  0.0911  391 ILE A O   
1199 C CB  . ILE B 81 ? 1.3304 1.0224 1.1574 0.1704  0.2874  0.1046  391 ILE A CB  
1200 N N   . HIS C 4  ? 1.0597 0.9435 1.5278 0.0019  -0.0217 0.0991  314 HIS C N   
1201 C CA  . HIS C 4  ? 1.0152 0.8558 1.4676 0.0077  -0.0165 0.0519  314 HIS C CA  
1202 C C   . HIS C 4  ? 0.9755 0.7939 1.4920 0.0127  -0.0036 0.0238  314 HIS C C   
1203 O O   . HIS C 4  ? 1.0117 0.8343 1.5326 0.0136  0.0081  0.0233  314 HIS C O   
1204 C CB  . HIS C 4  ? 0.8696 0.6927 1.2125 0.0083  -0.0090 0.0211  314 HIS C CB  
1205 C CG  . HIS C 4  ? 0.7080 0.5014 1.0223 0.0107  -0.0085 -0.0177 314 HIS C CG  
1206 N ND1 . HIS C 4  ? 0.7244 0.5010 1.1015 0.0128  -0.0084 -0.0410 314 HIS C ND1 
1207 C CD2 . HIS C 4  ? 0.7240 0.5056 0.9575 0.0100  -0.0083 -0.0370 314 HIS C CD2 
1208 C CE1 . HIS C 4  ? 0.6905 0.4497 1.0204 0.0123  -0.0083 -0.0743 314 HIS C CE1 
1209 N NE2 . HIS C 4  ? 0.7348 0.4971 0.9777 0.0107  -0.0088 -0.0693 314 HIS C NE2 
1210 N N   . HIS C 5  ? 0.8473 0.6442 1.4167 0.0156  -0.0053 -0.0022 315 HIS C N   
1211 C CA  . HIS C 5  ? 0.8028 0.5812 1.4446 0.0201  0.0079  -0.0366 315 HIS C CA  
1212 C C   . HIS C 5  ? 0.8700 0.6304 1.4419 0.0221  0.0270  -0.0905 315 HIS C C   
1213 O O   . HIS C 5  ? 0.9116 0.6644 1.5346 0.0256  0.0417  -0.1209 315 HIS C O   
1214 C CB  . HIS C 5  ? 0.8184 0.5821 1.5432 0.0212  0.0002  -0.0532 315 HIS C CB  
1215 C CG  . HIS C 5  ? 0.9567 0.7397 1.7936 0.0199  -0.0152 -0.0004 315 HIS C CG  
1216 N ND1 . HIS C 5  ? 0.9756 0.7869 1.8011 0.0148  -0.0340 0.0531  315 HIS C ND1 
1217 C CD2 . HIS C 5  ? 0.9865 0.7901 1.9342 0.0204  -0.0145 0.0094  315 HIS C CD2 
1218 C CE1 . HIS C 5  ? 0.9650 0.8038 1.9005 0.0125  -0.0452 0.0965  315 HIS C CE1 
1219 N NE2 . HIS C 5  ? 0.9847 0.8249 1.9915 0.0153  -0.0336 0.0705  315 HIS C NE2 
1220 N N   . HIS C 6  ? 0.8055 0.5633 1.2684 0.0195  0.0274  -0.1018 316 HIS C N   
1221 C CA  . HIS C 6  ? 0.8695 0.6183 1.2666 0.0193  0.0435  -0.1476 316 HIS C CA  
1222 C C   . HIS C 6  ? 0.8225 0.5800 1.1407 0.0179  0.0495  -0.1316 316 HIS C C   
1223 O O   . HIS C 6  ? 0.9716 0.7267 1.2209 0.0161  0.0590  -0.1585 316 HIS C O   
1224 C CB  . HIS C 6  ? 0.9834 0.7235 1.3290 0.0158  0.0389  -0.1786 316 HIS C CB  
1225 C CG  . HIS C 6  ? 1.0915 0.8226 1.5124 0.0158  0.0336  -0.2020 316 HIS C CG  
1226 N ND1 . HIS C 6  ? 1.1159 0.8454 1.5769 0.0153  0.0152  -0.1730 316 HIS C ND1 
1227 C CD2 . HIS C 6  ? 1.1534 0.8796 1.6209 0.0153  0.0444  -0.2539 316 HIS C CD2 
1228 C CE1 . HIS C 6  ? 1.1414 0.8611 1.6732 0.0148  0.0140  -0.2040 316 HIS C CE1 
1229 N NE2 . HIS C 6  ? 1.1456 0.8632 1.6835 0.0147  0.0320  -0.2561 316 HIS C NE2 
1230 N N   . HIS C 7  ? 0.7733 0.5457 1.1036 0.0174  0.0437  -0.0877 317 HIS C N   
1231 C CA  . HIS C 7  ? 0.5918 0.3736 0.8590 0.0153  0.0492  -0.0739 317 HIS C CA  
1232 C C   . HIS C 7  ? 0.6232 0.4244 0.9454 0.0149  0.0507  -0.0411 317 HIS C C   
1233 O O   . HIS C 7  ? 0.6028 0.4145 1.0084 0.0156  0.0437  -0.0183 317 HIS C O   
1234 C CB  . HIS C 7  ? 0.5802 0.3677 0.7781 0.0116  0.0377  -0.0547 317 HIS C CB  
1235 C CG  . HIS C 7  ? 0.7121 0.4838 0.8505 0.0111  0.0364  -0.0815 317 HIS C CG  
1236 N ND1 . HIS C 7  ? 0.7418 0.5050 0.8994 0.0116  0.0281  -0.0938 317 HIS C ND1 
1237 C CD2 . HIS C 7  ? 0.7540 0.5204 0.8189 0.0092  0.0415  -0.0947 317 HIS C CD2 
1238 C CE1 . HIS C 7  ? 0.6332 0.3885 0.7278 0.0095  0.0281  -0.1137 317 HIS C CE1 
1239 N NE2 . HIS C 7  ? 0.7345 0.4924 0.7744 0.0082  0.0360  -0.1127 317 HIS C NE2 
1240 N N   . HIS C 8  ? 0.5830 0.3918 0.8624 0.0130  0.0590  -0.0360 318 HIS C N   
1241 C CA  . HIS C 8  ? 0.6775 0.5091 1.0007 0.0109  0.0607  -0.0046 318 HIS C CA  
1242 C C   . HIS C 8  ? 0.6970 0.5420 0.9507 0.0052  0.0613  0.0086  318 HIS C C   
1243 O O   . HIS C 8  ? 0.7235 0.5537 0.9050 0.0049  0.0655  -0.0125 318 HIS C O   
1244 C CB  . HIS C 8  ? 0.6380 0.4624 1.0172 0.0159  0.0765  -0.0234 318 HIS C CB  
1245 C CG  . HIS C 8  ? 0.7109 0.5214 1.0299 0.0175  0.0928  -0.0607 318 HIS C CG  
1246 N ND1 . HIS C 8  ? 0.7120 0.5057 1.0074 0.0200  0.1002  -0.1045 318 HIS C ND1 
1247 C CD2 . HIS C 8  ? 0.7010 0.5182 0.9807 0.0155  0.1025  -0.0583 318 HIS C CD2 
1248 C CE1 . HIS C 8  ? 0.6256 0.4203 0.8691 0.0190  0.1137  -0.1250 318 HIS C CE1 
1249 N NE2 . HIS C 8  ? 0.7084 0.5142 0.9430 0.0169  0.1152  -0.0972 318 HIS C NE2 
1250 N N   . MET C 9  ? 0.7146 0.5916 0.9965 -0.0004 0.0566  0.0449  319 MET C N   
1251 C CA  . MET C 9  ? 0.6262 0.5215 0.8538 -0.0076 0.0571  0.0559  319 MET C CA  
1252 C C   . MET C 9  ? 0.5941 0.4840 0.8209 -0.0065 0.0719  0.0468  319 MET C C   
1253 O O   . MET C 9  ? 0.6530 0.5516 0.9451 -0.0046 0.0770  0.0582  319 MET C O   
1254 C CB  . MET C 9  ? 0.5191 0.4629 0.7733 -0.0172 0.0443  0.0980  319 MET C CB  
1255 C CG  . MET C 9  ? 0.8689 0.8275 1.1036 -0.0206 0.0303  0.1068  319 MET C CG  
1256 S SD  . MET C 9  ? 1.0807 1.0292 1.2191 -0.0233 0.0313  0.0820  319 MET C SD  
1257 C CE  . MET C 9  ? 1.1844 1.1918 1.3174 -0.0377 0.0279  0.1073  319 MET C CE  
1258 N N   . SER C 10 ? 0.6261 0.5030 0.7849 -0.0079 0.0786  0.0285  320 SER C N   
1259 C CA  . SER C 10 ? 0.6822 0.5563 0.8327 -0.0079 0.0920  0.0213  320 SER C CA  
1260 C C   . SER C 10 ? 0.7961 0.6867 0.9035 -0.0168 0.0896  0.0335  320 SER C C   
1261 O O   . SER C 10 ? 0.8091 0.6973 0.8708 -0.0201 0.0825  0.0289  320 SER C O   
1262 C CB  . SER C 10 ? 0.7330 0.5786 0.8490 -0.0020 0.1042  -0.0146 320 SER C CB  
1263 O OG  . SER C 10 ? 1.0189 0.8536 1.1798 0.0050  0.1089  -0.0336 320 SER C OG  
1264 N N   . PRO C 11 ? 0.7686 0.6771 0.8942 -0.0211 0.0954  0.0474  321 PRO C N   
1265 C CA  . PRO C 11 ? 0.7165 0.6408 0.8041 -0.0307 0.0937  0.0540  321 PRO C CA  
1266 C C   . PRO C 11 ? 0.6959 0.5912 0.7277 -0.0287 0.1008  0.0297  321 PRO C C   
1267 O O   . PRO C 11 ? 0.7578 0.6320 0.7845 -0.0219 0.1113  0.0132  321 PRO C O   
1268 C CB  . PRO C 11 ? 0.7053 0.6548 0.8339 -0.0351 0.0989  0.0749  321 PRO C CB  
1269 C CG  . PRO C 11 ? 0.5311 0.4628 0.7049 -0.0244 0.1095  0.0670  321 PRO C CG  
1270 C CD  . PRO C 11 ? 0.5328 0.4492 0.7213 -0.0177 0.1037  0.0572  321 PRO C CD  
1271 N N   . ASN C 12 ? 0.6985 0.5980 0.6935 -0.0357 0.0950  0.0279  322 ASN C N   
1272 C CA  . ASN C 12 ? 0.6449 0.5203 0.5976 -0.0352 0.0996  0.0117  322 ASN C CA  
1273 C C   . ASN C 12 ? 0.7267 0.6038 0.6812 -0.0378 0.1099  0.0149  322 ASN C C   
1274 O O   . ASN C 12 ? 0.7175 0.6171 0.7009 -0.0422 0.1120  0.0295  322 ASN C O   
1275 C CB  . ASN C 12 ? 0.7149 0.5947 0.6427 -0.0419 0.0911  0.0075  322 ASN C CB  
1276 C CG  . ASN C 12 ? 0.7096 0.5859 0.6305 -0.0385 0.0819  0.0026  322 ASN C CG  
1277 O OD1 . ASN C 12 ? 0.6628 0.5263 0.5906 -0.0308 0.0816  0.0004  322 ASN C OD1 
1278 N ND2 . ASN C 12 ? 0.5638 0.4534 0.4737 -0.0445 0.0749  -0.0018 322 ASN C ND2 
1279 N N   . LEU C 13 ? 0.8825 0.7398 0.8083 -0.0359 0.1159  0.0045  323 LEU C N   
1280 C CA  . LEU C 13 ? 0.9249 0.7858 0.8499 -0.0394 0.1248  0.0092  323 LEU C CA  
1281 C C   . LEU C 13 ? 0.8561 0.7312 0.7830 -0.0502 0.1194  0.0178  323 LEU C C   
1282 O O   . LEU C 13 ? 0.8034 0.6807 0.7217 -0.0547 0.1100  0.0133  323 LEU C O   
1283 C CB  . LEU C 13 ? 0.9167 0.7616 0.8119 -0.0372 0.1301  0.0014  323 LEU C CB  
1284 C CG  . LEU C 13 ? 0.9483 0.7879 0.8366 -0.0294 0.1364  -0.0123 323 LEU C CG  
1285 C CD1 . LEU C 13 ? 1.0112 0.8483 0.8676 -0.0310 0.1398  -0.0145 323 LEU C CD1 
1286 C CD2 . LEU C 13 ? 0.9164 0.7680 0.8366 -0.0249 0.1482  -0.0165 323 LEU C CD2 
1287 N N   . PRO C 14 ? 1.0709 0.9590 1.0112 -0.0552 0.1255  0.0276  324 PRO C N   
1288 C CA  . PRO C 14 ? 1.0934 0.9990 1.0378 -0.0674 0.1203  0.0325  324 PRO C CA  
1289 C C   . PRO C 14 ? 0.9134 0.8013 0.8377 -0.0713 0.1160  0.0213  324 PRO C C   
1290 O O   . PRO C 14 ? 0.9657 0.8332 0.8777 -0.0679 0.1204  0.0213  324 PRO C O   
1291 C CB  . PRO C 14 ? 1.1849 1.1021 1.1460 -0.0703 0.1292  0.0452  324 PRO C CB  
1292 C CG  . PRO C 14 ? 1.2308 1.1314 1.1874 -0.0593 0.1404  0.0421  324 PRO C CG  
1293 C CD  . PRO C 14 ? 1.1915 1.0824 1.1469 -0.0505 0.1380  0.0324  324 PRO C CD  
1294 N N   . GLY C 15 ? 0.7730 0.6737 0.6994 -0.0794 0.1074  0.0124  325 GLY C N   
1295 C CA  . GLY C 15 ? 0.8572 0.7423 0.7782 -0.0831 0.1032  -0.0016 325 GLY C CA  
1296 C C   . GLY C 15 ? 0.8636 0.7292 0.7713 -0.0755 0.0983  -0.0118 325 GLY C C   
1297 O O   . GLY C 15 ? 0.8428 0.6979 0.7550 -0.0784 0.0941  -0.0244 325 GLY C O   
1298 N N   . GLN C 16 ? 0.8555 0.7163 0.7529 -0.0662 0.0986  -0.0076 326 GLN C N   
1299 C CA  . GLN C 16 ? 0.7382 0.5826 0.6226 -0.0593 0.0934  -0.0156 326 GLN C CA  
1300 C C   . GLN C 16 ? 0.8003 0.6683 0.6900 -0.0613 0.0865  -0.0208 326 GLN C C   
1301 O O   . GLN C 16 ? 0.9107 0.8056 0.8130 -0.0641 0.0863  -0.0112 326 GLN C O   
1302 C CB  . GLN C 16 ? 0.6603 0.4878 0.5308 -0.0492 0.0976  -0.0104 326 GLN C CB  
1303 C CG  . GLN C 16 ? 0.8446 0.6587 0.7059 -0.0485 0.1040  -0.0039 326 GLN C CG  
1304 C CD  . GLN C 16 ? 0.9011 0.7089 0.7455 -0.0410 0.1082  -0.0044 326 GLN C CD  
1305 O OE1 . GLN C 16 ? 0.9326 0.7399 0.7753 -0.0356 0.1061  -0.0116 326 GLN C OE1 
1306 N NE2 . GLN C 16 ? 1.0287 0.8368 0.8629 -0.0421 0.1140  0.0029  326 GLN C NE2 
1307 N N   . THR C 17 ? 0.7450 0.6070 0.6295 -0.0603 0.0805  -0.0333 327 THR C N   
1308 C CA  . THR C 17 ? 0.6955 0.5854 0.5836 -0.0629 0.0739  -0.0388 327 THR C CA  
1309 C C   . THR C 17 ? 0.6570 0.5277 0.5336 -0.0529 0.0695  -0.0395 327 THR C C   
1310 O O   . THR C 17 ? 0.6700 0.5079 0.5349 -0.0458 0.0709  -0.0395 327 THR C O   
1311 C CB  . THR C 17 ? 0.7019 0.6131 0.5990 -0.0730 0.0714  -0.0591 327 THR C CB  
1312 O OG1 . THR C 17 ? 0.8383 0.7867 0.7367 -0.0766 0.0656  -0.0640 327 THR C OG1 
1313 C CG2 . THR C 17 ? 0.7557 0.6319 0.6547 -0.0687 0.0715  -0.0728 327 THR C CG2 
1314 N N   . THR C 18 ? 0.5738 0.4711 0.4552 -0.0538 0.0635  -0.0375 328 THR C N   
1315 C CA  . THR C 18 ? 0.5516 0.4364 0.4253 -0.0457 0.0580  -0.0376 328 THR C CA  
1316 C C   . THR C 18 ? 0.7200 0.6322 0.5964 -0.0505 0.0524  -0.0500 328 THR C C   
1317 O O   . THR C 18 ? 0.6213 0.5805 0.5083 -0.0598 0.0499  -0.0478 328 THR C O   
1318 C CB  . THR C 18 ? 0.6767 0.5692 0.5616 -0.0415 0.0558  -0.0210 328 THR C CB  
1319 O OG1 . THR C 18 ? 0.7038 0.5749 0.5907 -0.0372 0.0633  -0.0158 328 THR C OG1 
1320 C CG2 . THR C 18 ? 0.5422 0.4210 0.4211 -0.0339 0.0495  -0.0223 328 THR C CG2 
1321 N N   . VAL C 19 ? 0.6535 0.5420 0.5225 -0.0451 0.0506  -0.0621 329 VAL C N   
1322 C CA  . VAL C 19 ? 0.5590 0.4715 0.4336 -0.0482 0.0470  -0.0783 329 VAL C CA  
1323 C C   . VAL C 19 ? 0.6816 0.5807 0.5486 -0.0392 0.0409  -0.0729 329 VAL C C   
1324 O O   . VAL C 19 ? 0.7350 0.6008 0.5917 -0.0311 0.0398  -0.0615 329 VAL C O   
1325 C CB  . VAL C 19 ? 0.6024 0.5019 0.4888 -0.0507 0.0510  -0.1015 329 VAL C CB  
1326 C CG1 . VAL C 19 ? 0.5699 0.4731 0.4650 -0.0590 0.0567  -0.1049 329 VAL C CG1 
1327 C CG2 . VAL C 19 ? 0.6191 0.4703 0.5037 -0.0406 0.0502  -0.0979 329 VAL C CG2 
1328 N N   . GLN C 20 ? 0.7276 0.6583 0.6002 -0.0417 0.0371  -0.0828 330 GLN C N   
1329 C CA  . GLN C 20 ? 0.7182 0.6421 0.5862 -0.0343 0.0307  -0.0779 330 GLN C CA  
1330 C C   . GLN C 20 ? 0.6908 0.5943 0.5642 -0.0299 0.0319  -0.0968 330 GLN C C   
1331 O O   . GLN C 20 ? 0.6705 0.5942 0.5592 -0.0356 0.0362  -0.1199 330 GLN C O   
1332 C CB  . GLN C 20 ? 0.5262 0.5056 0.4010 -0.0401 0.0250  -0.0712 330 GLN C CB  
1333 C CG  . GLN C 20 ? 0.6723 0.6735 0.5548 -0.0438 0.0216  -0.0450 330 GLN C CG  
1334 C CD  . GLN C 20 ? 0.9928 1.0578 0.8886 -0.0516 0.0145  -0.0311 330 GLN C CD  
1335 O OE1 . GLN C 20 ? 1.0790 1.1662 0.9728 -0.0518 0.0115  -0.0403 330 GLN C OE1 
1336 N NE2 . GLN C 20 ? 1.1720 1.2713 1.0855 -0.0587 0.0115  -0.0062 330 GLN C NE2 
1337 N N   . VAL C 21 ? 0.7084 0.5745 0.5741 -0.0207 0.0282  -0.0878 331 VAL C N   
1338 C CA  . VAL C 21 ? 0.7389 0.5849 0.6165 -0.0156 0.0278  -0.0983 331 VAL C CA  
1339 C C   . VAL C 21 ? 0.7078 0.5599 0.5794 -0.0101 0.0204  -0.0913 331 VAL C C   
1340 O O   . VAL C 21 ? 0.6171 0.4462 0.4737 -0.0049 0.0150  -0.0742 331 VAL C O   
1341 C CB  . VAL C 21 ? 0.6882 0.4903 0.5654 -0.0116 0.0289  -0.0880 331 VAL C CB  
1342 C CG1 . VAL C 21 ? 0.5964 0.3821 0.4986 -0.0073 0.0278  -0.0941 331 VAL C CG1 
1343 C CG2 . VAL C 21 ? 0.5903 0.3882 0.4728 -0.0174 0.0356  -0.0903 331 VAL C CG2 
1344 N N   . ARG C 22 ? 0.5579 0.4454 0.4423 -0.0122 0.0202  -0.1063 332 ARG C N   
1345 C CA  . ARG C 22 ? 0.5734 0.4732 0.4548 -0.0077 0.0131  -0.0990 332 ARG C CA  
1346 C C   . ARG C 22 ? 0.6282 0.5022 0.5239 -0.0003 0.0125  -0.1056 332 ARG C C   
1347 O O   . ARG C 22 ? 0.6515 0.5225 0.5729 -0.0006 0.0189  -0.1261 332 ARG C O   
1348 C CB  . ARG C 22 ? 0.6237 0.5862 0.5116 -0.0150 0.0131  -0.1081 332 ARG C CB  
1349 C CG  . ARG C 22 ? 0.6574 0.6389 0.5454 -0.0112 0.0056  -0.0989 332 ARG C CG  
1350 C CD  . ARG C 22 ? 0.5166 0.5665 0.4068 -0.0205 0.0026  -0.0923 332 ARG C CD  
1351 N NE  . ARG C 22 ? 0.5085 0.5740 0.3997 -0.0170 -0.0065 -0.0744 332 ARG C NE  
1352 C CZ  . ARG C 22 ? 0.5856 0.6971 0.4812 -0.0231 -0.0141 -0.0506 332 ARG C CZ  
1353 N NH1 . ARG C 22 ? 0.4871 0.6349 0.3868 -0.0332 -0.0135 -0.0402 332 ARG C NH1 
1354 N NH2 . ARG C 22 ? 0.5864 0.7094 0.4872 -0.0198 -0.0230 -0.0337 332 ARG C NH2 
1355 N N   . VAL C 23 ? 0.6184 0.4748 0.5034 0.0060  0.0044  -0.0877 333 VAL C N   
1356 C CA  . VAL C 23 ? 0.7123 0.5489 0.6125 0.0128  0.0018  -0.0875 333 VAL C CA  
1357 C C   . VAL C 23 ? 0.5622 0.4223 0.4593 0.0155  -0.0051 -0.0822 333 VAL C C   
1358 O O   . VAL C 23 ? 0.5724 0.4548 0.4544 0.0125  -0.0099 -0.0718 333 VAL C O   
1359 C CB  . VAL C 23 ? 0.7330 0.5269 0.6229 0.0160  -0.0025 -0.0667 333 VAL C CB  
1360 C CG1 . VAL C 23 ? 0.5945 0.3705 0.4898 0.0126  0.0041  -0.0683 333 VAL C CG1 
1361 C CG2 . VAL C 23 ? 0.5808 0.3700 0.4400 0.0158  -0.0100 -0.0489 333 VAL C CG2 
1362 N N   . PRO C 24 ? 0.6306 0.4884 0.5483 0.0210  -0.0061 -0.0871 334 PRO C N   
1363 C CA  . PRO C 24 ? 0.5594 0.4360 0.4733 0.0241  -0.0138 -0.0777 334 PRO C CA  
1364 C C   . PRO C 24 ? 0.6393 0.4931 0.5269 0.0251  -0.0246 -0.0511 334 PRO C C   
1365 O O   . PRO C 24 ? 0.7868 0.6061 0.6631 0.0255  -0.0262 -0.0408 334 PRO C O   
1366 C CB  . PRO C 24 ? 0.6462 0.5127 0.5913 0.0309  -0.0122 -0.0853 334 PRO C CB  
1367 C CG  . PRO C 24 ? 0.7150 0.5783 0.6905 0.0295  -0.0009 -0.1103 334 PRO C CG  
1368 C CD  . PRO C 24 ? 0.6438 0.4868 0.5984 0.0244  0.0004  -0.1028 334 PRO C CD  
1369 N N   . TYR C 25 ? 0.6411 0.5198 0.5225 0.0241  -0.0319 -0.0409 335 TYR C N   
1370 C CA  . TYR C 25 ? 0.7277 0.5883 0.5922 0.0238  -0.0419 -0.0211 335 TYR C CA  
1371 C C   . TYR C 25 ? 0.7310 0.5597 0.5896 0.0279  -0.0483 -0.0111 335 TYR C C   
1372 O O   . TYR C 25 ? 0.8815 0.6892 0.7235 0.0260  -0.0536 -0.0018 335 TYR C O   
1373 C CB  . TYR C 25 ? 0.7367 0.6324 0.6075 0.0217  -0.0496 -0.0096 335 TYR C CB  
1374 C CG  . TYR C 25 ? 0.6458 0.5232 0.5108 0.0210  -0.0598 0.0069  335 TYR C CG  
1375 C CD1 . TYR C 25 ? 0.5342 0.3990 0.3958 0.0176  -0.0584 0.0085  335 TYR C CD1 
1376 C CD2 . TYR C 25 ? 0.6093 0.4832 0.4771 0.0233  -0.0704 0.0182  335 TYR C CD2 
1377 C CE1 . TYR C 25 ? 0.6907 0.5398 0.5557 0.0167  -0.0664 0.0168  335 TYR C CE1 
1378 C CE2 . TYR C 25 ? 0.6731 0.5314 0.5411 0.0215  -0.0796 0.0280  335 TYR C CE2 
1379 C CZ  . TYR C 25 ? 0.6769 0.5229 0.5454 0.0182  -0.0771 0.0252  335 TYR C CZ  
1380 O OH  . TYR C 25 ? 0.7265 0.5582 0.6037 0.0161  -0.0849 0.0285  335 TYR C OH  
1381 N N   . ARG C 26 ? 0.6135 0.4430 0.4892 0.0325  -0.0477 -0.0138 336 ARG C N   
1382 C CA  . ARG C 26 ? 0.6674 0.4744 0.5427 0.0352  -0.0551 0.0010  336 ARG C CA  
1383 C C   . ARG C 26 ? 0.8295 0.6082 0.6973 0.0329  -0.0531 0.0074  336 ARG C C   
1384 O O   . ARG C 26 ? 0.9745 0.7412 0.8324 0.0313  -0.0611 0.0241  336 ARG C O   
1385 C CB  . ARG C 26 ? 0.6962 0.5139 0.6022 0.0412  -0.0536 -0.0027 336 ARG C CB  
1386 C CG  . ARG C 26 ? 0.7121 0.5193 0.6218 0.0438  -0.0642 0.0174  336 ARG C CG  
1387 C CD  . ARG C 26 ? 0.6463 0.4624 0.5967 0.0507  -0.0603 0.0122  336 ARG C CD  
1388 N NE  . ARG C 26 ? 0.6040 0.4566 0.5668 0.0530  -0.0548 -0.0068 336 ARG C NE  
1389 C CZ  . ARG C 26 ? 0.6237 0.4999 0.5859 0.0546  -0.0616 0.0007  336 ARG C CZ  
1390 N NH1 . ARG C 26 ? 0.5536 0.4730 0.5273 0.0550  -0.0557 -0.0160 336 ARG C NH1 
1391 N NH2 . ARG C 26 ? 0.6139 0.4763 0.5644 0.0545  -0.0745 0.0249  336 ARG C NH2 
1392 N N   . VAL C 27 ? 0.8239 0.5977 0.6967 0.0314  -0.0433 -0.0037 337 VAL C N   
1393 C CA  . VAL C 27 ? 0.8085 0.5613 0.6820 0.0289  -0.0410 0.0052  337 VAL C CA  
1394 C C   . VAL C 27 ? 0.8652 0.6121 0.7088 0.0231  -0.0387 0.0051  337 VAL C C   
1395 O O   . VAL C 27 ? 1.1416 0.8777 0.9836 0.0199  -0.0355 0.0121  337 VAL C O   
1396 C CB  . VAL C 27 ? 0.8239 0.5731 0.7359 0.0313  -0.0318 -0.0058 337 VAL C CB  
1397 C CG1 . VAL C 27 ? 0.9032 0.6607 0.8527 0.0377  -0.0322 -0.0109 337 VAL C CG1 
1398 C CG2 . VAL C 27 ? 0.8306 0.5914 0.7411 0.0289  -0.0220 -0.0289 337 VAL C CG2 
1399 N N   . VAL C 28 ? 0.6450 0.4013 0.4709 0.0217  -0.0400 -0.0016 338 VAL C N   
1400 C CA  . VAL C 28 ? 0.7641 0.5153 0.5695 0.0171  -0.0367 -0.0044 338 VAL C CA  
1401 C C   . VAL C 28 ? 0.8344 0.5766 0.6200 0.0126  -0.0406 0.0062  338 VAL C C   
1402 O O   . VAL C 28 ? 0.7345 0.4732 0.5081 0.0084  -0.0350 0.0054  338 VAL C O   
1403 C CB  . VAL C 28 ? 0.7360 0.4995 0.5394 0.0166  -0.0393 -0.0094 338 VAL C CB  
1404 C CG1 . VAL C 28 ? 0.7055 0.4636 0.4983 0.0128  -0.0343 -0.0148 338 VAL C CG1 
1405 C CG2 . VAL C 28 ? 0.7235 0.5100 0.5454 0.0182  -0.0364 -0.0155 338 VAL C CG2 
1406 N N   . GLY C 29 ? 0.8474 0.5917 0.6291 0.0122  -0.0504 0.0166  339 GLY C N   
1407 C CA  . GLY C 29 ? 0.7266 0.4740 0.4881 0.0051  -0.0551 0.0270  339 GLY C CA  
1408 C C   . GLY C 29 ? 0.8117 0.5592 0.5801 0.0022  -0.0527 0.0442  339 GLY C C   
1409 O O   . GLY C 29 ? 0.8798 0.6381 0.6292 -0.0058 -0.0524 0.0517  339 GLY C O   
1410 N N   . LEU C 30 ? 0.9446 0.6845 0.7454 0.0080  -0.0508 0.0505  340 LEU C N   
1411 C CA  . LEU C 30 ? 0.9094 0.6481 0.7321 0.0055  -0.0494 0.0703  340 LEU C CA  
1412 C C   . LEU C 30 ? 0.9246 0.6601 0.7424 0.0023  -0.0396 0.0643  340 LEU C C   
1413 O O   . LEU C 30 ? 0.9963 0.7401 0.8146 -0.0044 -0.0399 0.0842  340 LEU C O   
1414 C CB  . LEU C 30 ? 0.8785 0.6083 0.7496 0.0132  -0.0488 0.0729  340 LEU C CB  
1415 N N   . VAL C 31 ? 0.8772 0.6059 0.6921 0.0059  -0.0315 0.0402  341 VAL C N   
1416 C CA  . VAL C 31 ? 0.8703 0.5966 0.6810 0.0028  -0.0223 0.0343  341 VAL C CA  
1417 C C   . VAL C 31 ? 0.9469 0.6842 0.7208 -0.0039 -0.0213 0.0345  341 VAL C C   
1418 O O   . VAL C 31 ? 0.9468 0.6901 0.7149 -0.0093 -0.0164 0.0424  341 VAL C O   
1419 C CB  . VAL C 31 ? 0.7647 0.4878 0.5846 0.0070  -0.0148 0.0105  341 VAL C CB  
1420 C CG1 . VAL C 31 ? 0.6447 0.3661 0.4617 0.0033  -0.0056 0.0057  341 VAL C CG1 
1421 C CG2 . VAL C 31 ? 0.7193 0.4402 0.5768 0.0121  -0.0141 0.0033  341 VAL C CG2 
1422 N N   . VAL C 32 ? 0.9277 0.6704 0.6803 -0.0042 -0.0255 0.0245  342 VAL C N   
1423 C CA  . VAL C 32 ? 0.9293 0.6853 0.6532 -0.0109 -0.0235 0.0170  342 VAL C CA  
1424 C C   . VAL C 32 ? 0.9959 0.7737 0.7051 -0.0201 -0.0287 0.0369  342 VAL C C   
1425 O O   . VAL C 32 ? 0.9586 0.7545 0.6519 -0.0277 -0.0233 0.0393  342 VAL C O   
1426 C CB  . VAL C 32 ? 0.8214 0.5770 0.5387 -0.0090 -0.0272 -0.0012 342 VAL C CB  
1427 C CG1 . VAL C 32 ? 0.7746 0.5460 0.4701 -0.0166 -0.0244 -0.0153 342 VAL C CG1 
1428 C CG2 . VAL C 32 ? 0.7713 0.5160 0.5065 -0.0023 -0.0224 -0.0139 342 VAL C CG2 
1429 N N   . GLY C 33 ? 0.9491 0.7314 0.6647 -0.0207 -0.0394 0.0537  343 GLY C N   
1430 C CA  . GLY C 33 ? 0.7596 0.5706 0.4655 -0.0313 -0.0464 0.0792  343 GLY C CA  
1431 C C   . GLY C 33 ? 0.8526 0.6915 0.5238 -0.0411 -0.0502 0.0665  343 GLY C C   
1432 O O   . GLY C 33 ? 0.7671 0.5976 0.4280 -0.0385 -0.0473 0.0363  343 GLY C O   
1433 N N   . PRO C 34 ? 0.9435 0.8207 0.6013 -0.0538 -0.0571 0.0897  344 PRO C N   
1434 C CA  . PRO C 34 ? 0.9111 0.8249 0.5353 -0.0662 -0.0608 0.0738  344 PRO C CA  
1435 C C   . PRO C 34 ? 0.9957 0.9232 0.5979 -0.0708 -0.0480 0.0407  344 PRO C C   
1436 O O   . PRO C 34 ? 1.1506 1.0996 0.7457 -0.0767 -0.0407 0.0503  344 PRO C O   
1437 C CB  . PRO C 34 ? 0.9731 0.9346 0.5916 -0.0808 -0.0706 0.1136  344 PRO C CB  
1438 C CG  . PRO C 34 ? 1.0823 1.0351 0.7307 -0.0772 -0.0677 0.1469  344 PRO C CG  
1439 C CD  . PRO C 34 ? 1.0389 0.9331 0.7181 -0.0587 -0.0627 0.1332  344 PRO C CD  
1440 N N   . LYS C 35 ? 0.9841 0.9001 0.5817 -0.0681 -0.0454 0.0025  345 LYS C N   
1441 C CA  . LYS C 35 ? 1.0841 1.0100 0.6719 -0.0710 -0.0325 -0.0347 345 LYS C CA  
1442 C C   . LYS C 35 ? 1.1110 1.0134 0.7121 -0.0621 -0.0202 -0.0338 345 LYS C C   
1443 O O   . LYS C 35 ? 1.0772 0.9986 0.6686 -0.0667 -0.0085 -0.0517 345 LYS C O   
1444 C CB  . LYS C 35 ? 1.1032 1.0914 0.6593 -0.0896 -0.0304 -0.0430 345 LYS C CB  
1445 N N   . GLY C 36 ? 1.0458 0.9106 0.6701 -0.0502 -0.0224 -0.0150 346 GLY C N   
1446 C CA  . GLY C 36 ? 0.9033 0.7476 0.5415 -0.0431 -0.0121 -0.0140 346 GLY C CA  
1447 C C   . GLY C 36 ? 0.9082 0.7730 0.5409 -0.0496 -0.0085 0.0114  346 GLY C C   
1448 O O   . GLY C 36 ? 0.9048 0.7610 0.5446 -0.0467 0.0015  0.0087  346 GLY C O   
1449 N N   . ALA C 37 ? 0.9462 0.8411 0.5708 -0.0593 -0.0172 0.0399  347 ALA C N   
1450 C CA  . ALA C 37 ? 1.0237 0.9460 0.6496 -0.0675 -0.0154 0.0708  347 ALA C CA  
1451 C C   . ALA C 37 ? 1.0368 0.9241 0.7004 -0.0583 -0.0153 0.0928  347 ALA C C   
1452 O O   . ALA C 37 ? 1.0549 0.9494 0.7274 -0.0611 -0.0092 0.1065  347 ALA C O   
1453 C CB  . ALA C 37 ? 0.8109 0.7817 0.4253 -0.0818 -0.0268 0.1019  347 ALA C CB  
1454 N N   . THR C 38 ? 0.9840 0.8367 0.6726 -0.0481 -0.0216 0.0943  348 THR C N   
1455 C CA  . THR C 38 ? 0.9761 0.7998 0.7061 -0.0404 -0.0207 0.1085  348 THR C CA  
1456 C C   . THR C 38 ? 0.8476 0.6478 0.5814 -0.0338 -0.0089 0.0839  348 THR C C   
1457 O O   . THR C 38 ? 0.7295 0.5249 0.4849 -0.0344 -0.0042 0.0952  348 THR C O   
1458 C CB  . THR C 38 ? 0.9539 0.7539 0.7098 -0.0317 -0.0288 0.1102  348 THR C CB  
1459 O OG1 . THR C 38 ? 1.0049 0.8287 0.7622 -0.0384 -0.0404 0.1382  348 THR C OG1 
1460 C CG2 . THR C 38 ? 0.7217 0.4953 0.5259 -0.0243 -0.0261 0.1160  348 THR C CG2 
1461 N N   . ILE C 39 ? 0.7168 0.5048 0.4347 -0.0283 -0.0049 0.0528  349 ILE C N   
1462 C CA  . ILE C 39 ? 0.8592 0.6307 0.5835 -0.0232 0.0052  0.0333  349 ILE C CA  
1463 C C   . ILE C 39 ? 0.8515 0.6414 0.5595 -0.0297 0.0147  0.0317  349 ILE C C   
1464 O O   . ILE C 39 ? 0.8940 0.6747 0.6137 -0.0280 0.0225  0.0285  349 ILE C O   
1465 C CB  . ILE C 39 ? 0.8820 0.6416 0.6026 -0.0168 0.0054  0.0080  349 ILE C CB  
1466 C CG1 . ILE C 39 ? 0.8315 0.5793 0.5659 -0.0124 0.0137  -0.0053 349 ILE C CG1 
1467 C CG2 . ILE C 39 ? 0.7368 0.5124 0.4334 -0.0209 0.0059  -0.0071 349 ILE C CG2 
1468 C CD1 . ILE C 39 ? 0.7486 0.4845 0.5098 -0.0096 0.0138  0.0007  349 ILE C CD1 
1469 N N   . LYS C 40 ? 0.8165 0.6375 0.4979 -0.0382 0.0146  0.0328  350 LYS C N   
1470 C CA  . LYS C 40 ? 0.8497 0.6968 0.5159 -0.0453 0.0247  0.0305  350 LYS C CA  
1471 C C   . LYS C 40 ? 0.8841 0.7430 0.5651 -0.0509 0.0241  0.0644  350 LYS C C   
1472 O O   . LYS C 40 ? 0.7558 0.6207 0.4388 -0.0527 0.0332  0.0650  350 LYS C O   
1473 C CB  . LYS C 40 ? 0.8067 0.6941 0.4416 -0.0549 0.0254  0.0182  350 LYS C CB  
1474 N N   . ARG C 41 ? 0.8518 0.7149 0.5496 -0.0538 0.0130  0.0951  351 ARG C N   
1475 C CA  . ARG C 41 ? 0.8036 0.6761 0.5305 -0.0590 0.0107  0.1318  351 ARG C CA  
1476 C C   . ARG C 41 ? 0.7985 0.6303 0.5630 -0.0502 0.0147  0.1264  351 ARG C C   
1477 O O   . ARG C 41 ? 0.7996 0.6360 0.5844 -0.0540 0.0183  0.1431  351 ARG C O   
1478 C CB  . ARG C 41 ? 0.7786 0.6671 0.5254 -0.0642 -0.0029 0.1685  351 ARG C CB  
1479 C CG  . ARG C 41 ? 0.9169 0.8119 0.7119 -0.0689 -0.0075 0.2119  351 ARG C CG  
1480 C CD  . ARG C 41 ? 1.1980 1.1219 1.0135 -0.0767 -0.0215 0.2544  351 ARG C CD  
1481 N NE  . ARG C 41 ? 1.3580 1.2568 1.1771 -0.0685 -0.0282 0.2409  351 ARG C NE  
1482 C CZ  . ARG C 41 ? 1.4225 1.3439 1.2526 -0.0738 -0.0406 0.2707  351 ARG C CZ  
1483 N NH1 . ARG C 41 ? 1.5458 1.5196 1.3851 -0.0887 -0.0484 0.3183  351 ARG C NH1 
1484 N NH2 . ARG C 41 ? 1.2965 1.1934 1.1301 -0.0654 -0.0457 0.2560  351 ARG C NH2 
1485 N N   . ILE C 42 ? 0.7487 0.5461 0.5237 -0.0399 0.0139  0.1027  352 ILE C N   
1486 C CA  . ILE C 42 ? 0.7747 0.5426 0.5820 -0.0337 0.0185  0.0907  352 ILE C CA  
1487 C C   . ILE C 42 ? 0.7831 0.5530 0.5745 -0.0345 0.0297  0.0744  352 ILE C C   
1488 O O   . ILE C 42 ? 0.7106 0.4723 0.5271 -0.0356 0.0339  0.0779  352 ILE C O   
1489 C CB  . ILE C 42 ? 0.7821 0.5266 0.5986 -0.0246 0.0157  0.0678  352 ILE C CB  
1490 C CG1 . ILE C 42 ? 0.7777 0.5188 0.6204 -0.0230 0.0055  0.0856  352 ILE C CG1 
1491 C CG2 . ILE C 42 ? 0.6864 0.4128 0.5286 -0.0207 0.0218  0.0484  352 ILE C CG2 
1492 C CD1 . ILE C 42 ? 0.7911 0.5151 0.6452 -0.0145 0.0032  0.0639  352 ILE C CD1 
1493 N N   . GLN C 43 ? 0.7121 0.4935 0.4674 -0.0343 0.0346  0.0557  353 GLN C N   
1494 C CA  . GLN C 43 ? 0.7351 0.5208 0.4805 -0.0348 0.0458  0.0415  353 GLN C CA  
1495 C C   . GLN C 43 ? 0.7250 0.5355 0.4686 -0.0433 0.0504  0.0628  353 GLN C C   
1496 O O   . GLN C 43 ? 0.8791 0.6862 0.6339 -0.0440 0.0575  0.0626  353 GLN C O   
1497 C CB  . GLN C 43 ? 0.7069 0.5007 0.4263 -0.0326 0.0502  0.0166  353 GLN C CB  
1498 C CG  . GLN C 43 ? 0.7669 0.5404 0.4930 -0.0249 0.0456  -0.0009 353 GLN C CG  
1499 C CD  . GLN C 43 ? 0.8845 0.6649 0.5979 -0.0232 0.0491  -0.0232 353 GLN C CD  
1500 O OE1 . GLN C 43 ? 0.8461 0.6266 0.5668 -0.0212 0.0576  -0.0365 353 GLN C OE1 
1501 N NE2 . GLN C 43 ? 0.9107 0.6977 0.6112 -0.0242 0.0423  -0.0272 353 GLN C NE2 
1502 N N   . GLN C 44 ? 0.7440 0.5853 0.4741 -0.0511 0.0458  0.0837  354 GLN C N   
1503 C CA  . GLN C 44 ? 0.7612 0.6375 0.4896 -0.0612 0.0493  0.1091  354 GLN C CA  
1504 C C   . GLN C 44 ? 0.7609 0.6244 0.5347 -0.0631 0.0443  0.1402  354 GLN C C   
1505 O O   . GLN C 44 ? 0.7695 0.6435 0.5544 -0.0675 0.0499  0.1526  354 GLN C O   
1506 C CB  . GLN C 44 ? 0.7893 0.7141 0.4916 -0.0718 0.0447  0.1253  354 GLN C CB  
1507 N N   . GLN C 45 ? 0.7569 0.5982 0.5631 -0.0597 0.0340  0.1520  355 GLN C N   
1508 C CA  . GLN C 45 ? 0.7595 0.5886 0.6221 -0.0617 0.0289  0.1798  355 GLN C CA  
1509 C C   . GLN C 45 ? 0.7447 0.5399 0.6324 -0.0560 0.0355  0.1562  355 GLN C C   
1510 O O   . GLN C 45 ? 0.7495 0.5419 0.6777 -0.0602 0.0356  0.1742  355 GLN C O   
1511 C CB  . GLN C 45 ? 0.7611 0.5779 0.6600 -0.0592 0.0171  0.1963  355 GLN C CB  
1512 C CG  . GLN C 45 ? 0.9071 0.7656 0.7973 -0.0685 0.0078  0.2344  355 GLN C CG  
1513 C CD  . GLN C 45 ? 0.9541 0.8000 0.8917 -0.0660 -0.0042 0.2560  355 GLN C CD  
1514 O OE1 . GLN C 45 ? 1.0095 0.8145 0.9810 -0.0559 -0.0041 0.2347  355 GLN C OE1 
1515 N NE2 . GLN C 45 ? 0.9354 0.8221 0.8778 -0.0759 -0.0142 0.2987  355 GLN C NE2 
1516 N N   . THR C 46 ? 0.7327 0.5067 0.6004 -0.0481 0.0403  0.1183  356 THR C N   
1517 C CA  . THR C 46 ? 0.8085 0.5599 0.6969 -0.0449 0.0458  0.0951  356 THR C CA  
1518 C C   . THR C 46 ? 0.7766 0.5371 0.6346 -0.0457 0.0562  0.0799  356 THR C C   
1519 O O   . THR C 46 ? 0.6969 0.4459 0.5692 -0.0450 0.0606  0.0632  356 THR C O   
1520 C CB  . THR C 46 ? 0.8040 0.5346 0.6994 -0.0374 0.0433  0.0670  356 THR C CB  
1521 O OG1 . THR C 46 ? 0.7391 0.4759 0.5909 -0.0332 0.0442  0.0517  356 THR C OG1 
1522 C CG2 . THR C 46 ? 0.7051 0.4252 0.6400 -0.0357 0.0344  0.0796  356 THR C CG2 
1523 N N   . HIS C 47 ? 0.8218 0.6067 0.6421 -0.0480 0.0605  0.0841  357 HIS C N   
1524 C CA  . HIS C 47 ? 0.9677 0.7636 0.7661 -0.0481 0.0716  0.0697  357 HIS C CA  
1525 C C   . HIS C 47 ? 0.8829 0.6608 0.6794 -0.0413 0.0746  0.0403  357 HIS C C   
1526 O O   . HIS C 47 ? 0.6831 0.4585 0.4888 -0.0418 0.0806  0.0325  357 HIS C O   
1527 C CB  . HIS C 47 ? 1.0711 0.8750 0.8892 -0.0543 0.0764  0.0868  357 HIS C CB  
1528 C CG  . HIS C 47 ? 1.0969 0.9208 0.8929 -0.0555 0.0884  0.0787  357 HIS C CG  
1529 N ND1 . HIS C 47 ? 1.0492 0.8792 0.8605 -0.0599 0.0942  0.0888  357 HIS C ND1 
1530 C CD2 . HIS C 47 ? 1.0391 0.8786 0.8050 -0.0529 0.0961  0.0600  357 HIS C CD2 
1531 C CE1 . HIS C 47 ? 0.9850 0.8345 0.7749 -0.0594 0.1055  0.0777  357 HIS C CE1 
1532 N NE2 . HIS C 47 ? 1.0650 0.9202 0.8299 -0.0549 0.1072  0.0586  357 HIS C NE2 
1533 N N   . THR C 48 ? 0.7653 0.5351 0.5521 -0.0361 0.0693  0.0275  358 THR C N   
1534 C CA  . THR C 48 ? 0.7899 0.5503 0.5786 -0.0308 0.0699  0.0059  358 THR C CA  
1535 C C   . THR C 48 ? 0.8828 0.6496 0.6501 -0.0269 0.0707  -0.0064 358 THR C C   
1536 O O   . THR C 48 ? 0.8681 0.6450 0.6171 -0.0283 0.0693  -0.0028 358 THR C O   
1537 C CB  . THR C 48 ? 0.7054 0.4517 0.5139 -0.0285 0.0620  0.0004  358 THR C CB  
1538 O OG1 . THR C 48 ? 0.7304 0.4727 0.5341 -0.0266 0.0542  0.0080  358 THR C OG1 
1539 C CG2 . THR C 48 ? 0.6616 0.4014 0.5012 -0.0329 0.0622  0.0045  358 THR C CG2 
1540 N N   . TYR C 49 ? 0.7895 0.5546 0.5642 -0.0232 0.0726  -0.0201 359 TYR C N   
1541 C CA  . TYR C 49 ? 0.7482 0.5161 0.5177 -0.0190 0.0722  -0.0327 359 TYR C CA  
1542 C C   . TYR C 49 ? 0.7869 0.5474 0.5652 -0.0156 0.0625  -0.0355 359 TYR C C   
1543 O O   . TYR C 49 ? 0.7997 0.5632 0.5946 -0.0158 0.0612  -0.0358 359 TYR C O   
1544 C CB  . TYR C 49 ? 0.6781 0.4541 0.4618 -0.0178 0.0813  -0.0408 359 TYR C CB  
1545 C CG  . TYR C 49 ? 0.7366 0.5136 0.5324 -0.0132 0.0806  -0.0537 359 TYR C CG  
1546 C CD1 . TYR C 49 ? 0.6918 0.4742 0.4773 -0.0128 0.0840  -0.0679 359 TYR C CD1 
1547 C CD2 . TYR C 49 ? 0.8403 0.6182 0.6627 -0.0109 0.0762  -0.0514 359 TYR C CD2 
1548 C CE1 . TYR C 49 ? 0.7112 0.4927 0.5176 -0.0090 0.0833  -0.0826 359 TYR C CE1 
1549 C CE2 . TYR C 49 ? 0.7696 0.5485 0.6144 -0.0071 0.0744  -0.0592 359 TYR C CE2 
1550 C CZ  . TYR C 49 ? 0.7753 0.5525 0.6146 -0.0056 0.0781  -0.0763 359 TYR C CZ  
1551 O OH  . TYR C 49 ? 0.7528 0.5291 0.6237 -0.0021 0.0762  -0.0869 359 TYR C OH  
1552 N N   . ILE C 50 ? 0.6584 0.4154 0.4253 -0.0137 0.0557  -0.0371 360 ILE C N   
1553 C CA  . ILE C 50 ? 0.7005 0.4526 0.4742 -0.0106 0.0461  -0.0377 360 ILE C CA  
1554 C C   . ILE C 50 ? 0.8148 0.5688 0.5899 -0.0075 0.0427  -0.0461 360 ILE C C   
1555 O O   . ILE C 50 ? 0.6412 0.3970 0.4025 -0.0084 0.0437  -0.0523 360 ILE C O   
1556 C CB  . ILE C 50 ? 0.7222 0.4670 0.4895 -0.0111 0.0394  -0.0287 360 ILE C CB  
1557 C CG1 . ILE C 50 ? 0.8365 0.5776 0.6166 -0.0142 0.0423  -0.0210 360 ILE C CG1 
1558 C CG2 . ILE C 50 ? 0.7588 0.5013 0.5340 -0.0073 0.0305  -0.0312 360 ILE C CG2 
1559 C CD1 . ILE C 50 ? 0.9587 0.6924 0.7472 -0.0146 0.0359  -0.0090 360 ILE C CD1 
1560 N N   . VAL C 51 ? 0.7649 0.5238 0.5602 -0.0052 0.0384  -0.0462 361 VAL C N   
1561 C CA  . VAL C 51 ? 0.7354 0.4958 0.5437 -0.0024 0.0331  -0.0506 361 VAL C CA  
1562 C C   . VAL C 51 ? 0.6378 0.3962 0.4403 -0.0007 0.0221  -0.0462 361 VAL C C   
1563 O O   . VAL C 51 ? 0.6525 0.4182 0.4600 -0.0008 0.0187  -0.0402 361 VAL C O   
1564 C CB  . VAL C 51 ? 0.8373 0.6108 0.6804 -0.0020 0.0338  -0.0458 361 VAL C CB  
1565 C CG1 . VAL C 51 ? 0.8569 0.6319 0.7250 0.0006  0.0264  -0.0465 361 VAL C CG1 
1566 C CG2 . VAL C 51 ? 0.7915 0.5666 0.6452 -0.0029 0.0451  -0.0498 361 VAL C CG2 
1567 N N   . THR C 52 ? 0.6345 0.3870 0.4278 0.0000  0.0173  -0.0514 362 THR C N   
1568 C CA  . THR C 52 ? 0.6956 0.4467 0.4849 0.0017  0.0066  -0.0461 362 THR C CA  
1569 C C   . THR C 52 ? 0.6220 0.3821 0.4391 0.0038  -0.0004 -0.0426 362 THR C C   
1570 O O   . THR C 52 ? 0.5939 0.3549 0.4328 0.0040  0.0006  -0.0479 362 THR C O   
1571 C CB  . THR C 52 ? 0.7812 0.5278 0.5494 -0.0004 0.0030  -0.0509 362 THR C CB  
1572 O OG1 . THR C 52 ? 1.1117 0.8580 0.8583 -0.0037 0.0067  -0.0448 362 THR C OG1 
1573 C CG2 . THR C 52 ? 0.6260 0.3719 0.3951 0.0014  -0.0089 -0.0450 362 THR C CG2 
1574 N N   . PRO C 53 ? 0.6028 0.3732 0.4257 0.0051  -0.0072 -0.0334 363 PRO C N   
1575 C CA  . PRO C 53 ? 0.6522 0.4396 0.5036 0.0056  -0.0150 -0.0243 363 PRO C CA  
1576 C C   . PRO C 53 ? 0.6802 0.4576 0.5390 0.0068  -0.0228 -0.0274 363 PRO C C   
1577 O O   . PRO C 53 ? 0.7019 0.4649 0.5370 0.0067  -0.0243 -0.0355 363 PRO C O   
1578 C CB  . PRO C 53 ? 0.6598 0.4657 0.5084 0.0057  -0.0192 -0.0176 363 PRO C CB  
1579 C CG  . PRO C 53 ? 0.7633 0.5509 0.5862 0.0072  -0.0164 -0.0248 363 PRO C CG  
1580 C CD  . PRO C 53 ? 0.7562 0.5276 0.5665 0.0055  -0.0075 -0.0311 363 PRO C CD  
1581 N N   . SER C 54 ? 0.6763 0.4657 0.5731 0.0067  -0.0287 -0.0188 364 SER C N   
1582 C CA  . SER C 54 ? 0.7417 0.5221 0.6573 0.0071  -0.0365 -0.0237 364 SER C CA  
1583 C C   . SER C 54 ? 0.8190 0.6010 0.7188 0.0080  -0.0470 -0.0173 364 SER C C   
1584 O O   . SER C 54 ? 0.8832 0.6724 0.7602 0.0091  -0.0471 -0.0110 364 SER C O   
1585 C CB  . SER C 54 ? 0.8873 0.6809 0.8612 0.0066  -0.0409 -0.0115 364 SER C CB  
1586 O OG  . SER C 54 ? 0.9637 0.7527 0.9589 0.0064  -0.0309 -0.0195 364 SER C OG  
1587 N N   . ARG C 55 ? 0.9030 0.6790 0.8207 0.0073  -0.0557 -0.0208 365 ARG C N   
1588 C CA  . ARG C 55 ? 0.8949 0.6706 0.7967 0.0076  -0.0658 -0.0160 365 ARG C CA  
1589 C C   . ARG C 55 ? 0.8852 0.6851 0.7978 0.0095  -0.0723 0.0064  365 ARG C C   
1590 O O   . ARG C 55 ? 1.0513 0.8548 0.9383 0.0114  -0.0729 0.0095  365 ARG C O   
1591 C CB  . ARG C 55 ? 0.8213 0.5889 0.7469 0.0051  -0.0743 -0.0255 365 ARG C CB  
1592 N N   . ASP C 56 ? 0.5771 0.3988 0.5324 0.0084  -0.0770 0.0230  366 ASP C N   
1593 C CA  . ASP C 56 ? 0.7096 0.5670 0.6783 0.0079  -0.0840 0.0456  366 ASP C CA  
1594 C C   . ASP C 56 ? 0.6484 0.5403 0.6309 0.0049  -0.0786 0.0585  366 ASP C C   
1595 O O   . ASP C 56 ? 0.6542 0.5887 0.6635 0.0014  -0.0854 0.0819  366 ASP C O   
1596 C CB  . ASP C 56 ? 0.6900 0.5576 0.7013 0.0065  -0.0981 0.0626  366 ASP C CB  
1597 C CG  . ASP C 56 ? 0.7016 0.5416 0.6987 0.0076  -0.1047 0.0495  366 ASP C CG  
1598 O OD1 . ASP C 56 ? 0.7391 0.5550 0.7511 0.0061  -0.1051 0.0335  366 ASP C OD1 
1599 O OD2 . ASP C 56 ? 0.7232 0.5687 0.6959 0.0093  -0.1089 0.0535  366 ASP C OD2 
1600 N N   . LYS C 57 ? 0.5355 0.4157 0.5004 0.0048  -0.0670 0.0452  367 LYS C N   
1601 C CA  . LYS C 57 ? 0.5014 0.4158 0.4749 0.0004  -0.0614 0.0548  367 LYS C CA  
1602 C C   . LYS C 57 ? 0.5008 0.4278 0.4379 0.0002  -0.0546 0.0427  367 LYS C C   
1603 O O   . LYS C 57 ? 0.5178 0.4258 0.4299 0.0044  -0.0546 0.0306  367 LYS C O   
1604 C CB  . LYS C 57 ? 0.7237 0.6200 0.7074 -0.0001 -0.0528 0.0480  367 LYS C CB  
1605 N N   . GLU C 58 ? 0.6729 0.6346 0.6129 -0.0054 -0.0489 0.0455  368 GLU C N   
1606 C CA  . GLU C 58 ? 0.6019 0.5796 0.5172 -0.0068 -0.0414 0.0284  368 GLU C CA  
1607 C C   . GLU C 58 ? 0.5093 0.4360 0.3964 -0.0014 -0.0331 0.0060  368 GLU C C   
1608 O O   . GLU C 58 ? 0.5166 0.4146 0.3997 -0.0006 -0.0285 0.0030  368 GLU C O   
1609 C CB  . GLU C 58 ? 0.5501 0.5773 0.4747 -0.0161 -0.0366 0.0325  368 GLU C CB  
1610 C CG  . GLU C 58 ? 0.8735 0.8917 0.8128 -0.0188 -0.0335 0.0419  368 GLU C CG  
1611 C CD  . GLU C 58 ? 1.0090 1.0801 0.9545 -0.0295 -0.0291 0.0460  368 GLU C CD  
1612 O OE1 . GLU C 58 ? 0.9792 1.0498 0.9395 -0.0326 -0.0264 0.0558  368 GLU C OE1 
1613 O OE2 . GLU C 58 ? 0.9978 1.1153 0.9348 -0.0356 -0.0281 0.0377  368 GLU C OE2 
1614 N N   . PRO C 59 ? 0.7227 0.6404 0.5952 0.0021  -0.0311 -0.0079 369 PRO C N   
1615 C CA  . PRO C 59 ? 0.5905 0.4639 0.4447 0.0063  -0.0253 -0.0211 369 PRO C CA  
1616 C C   . PRO C 59 ? 0.5359 0.4083 0.3871 0.0029  -0.0148 -0.0337 369 PRO C C   
1617 O O   . PRO C 59 ? 0.6200 0.4914 0.4731 0.0034  -0.0095 -0.0482 369 PRO C O   
1618 C CB  . PRO C 59 ? 0.6705 0.5422 0.5244 0.0107  -0.0276 -0.0271 369 PRO C CB  
1619 C CG  . PRO C 59 ? 0.6138 0.5364 0.4820 0.0073  -0.0280 -0.0293 369 PRO C CG  
1620 C CD  . PRO C 59 ? 0.5937 0.5447 0.4718 0.0022  -0.0341 -0.0101 369 PRO C CD  
1621 N N   . VAL C 60 ? 0.5334 0.4055 0.3859 -0.0005 -0.0116 -0.0287 370 VAL C N   
1622 C CA  . VAL C 60 ? 0.6587 0.5336 0.5100 -0.0049 -0.0023 -0.0381 370 VAL C CA  
1623 C C   . VAL C 60 ? 0.7243 0.5627 0.5647 -0.0030 0.0019  -0.0363 370 VAL C C   
1624 O O   . VAL C 60 ? 0.7060 0.5385 0.5503 -0.0022 -0.0002 -0.0275 370 VAL C O   
1625 C CB  . VAL C 60 ? 0.5666 0.4893 0.4327 -0.0131 -0.0017 -0.0319 370 VAL C CB  
1626 C CG1 . VAL C 60 ? 0.5993 0.5234 0.4639 -0.0184 0.0074  -0.0413 370 VAL C CG1 
1627 C CG2 . VAL C 60 ? 0.5845 0.5562 0.4590 -0.0173 -0.0047 -0.0359 370 VAL C CG2 
1628 N N   . PHE C 61 ? 0.7778 0.5956 0.6101 -0.0029 0.0082  -0.0450 371 PHE C N   
1629 C CA  . PHE C 61 ? 0.6237 0.4178 0.4455 -0.0030 0.0137  -0.0428 371 PHE C CA  
1630 C C   . PHE C 61 ? 0.6406 0.4493 0.4702 -0.0084 0.0209  -0.0451 371 PHE C C   
1631 O O   . PHE C 61 ? 0.6325 0.4597 0.4715 -0.0128 0.0235  -0.0537 371 PHE C O   
1632 C CB  . PHE C 61 ? 0.5865 0.3559 0.4003 -0.0014 0.0151  -0.0435 371 PHE C CB  
1633 C CG  . PHE C 61 ? 0.7570 0.5139 0.5616 0.0024  0.0077  -0.0370 371 PHE C CG  
1634 C CD1 . PHE C 61 ? 0.7573 0.5190 0.5718 0.0054  0.0020  -0.0382 371 PHE C CD1 
1635 C CD2 . PHE C 61 ? 0.6077 0.3531 0.3946 0.0020  0.0068  -0.0313 371 PHE C CD2 
1636 C CE1 . PHE C 61 ? 0.7751 0.5271 0.5825 0.0082  -0.0055 -0.0298 371 PHE C CE1 
1637 C CE2 . PHE C 61 ? 0.6817 0.4218 0.4593 0.0033  -0.0008 -0.0253 371 PHE C CE2 
1638 C CZ  . PHE C 61 ? 0.7094 0.4511 0.4974 0.0066  -0.0075 -0.0226 371 PHE C CZ  
1639 N N   . GLU C 62 ? 0.7511 0.5542 0.5797 -0.0088 0.0246  -0.0397 372 GLU C N   
1640 C CA  . GLU C 62 ? 0.7768 0.5929 0.6142 -0.0138 0.0315  -0.0387 372 GLU C CA  
1641 C C   . GLU C 62 ? 0.7587 0.5516 0.5839 -0.0138 0.0389  -0.0411 372 GLU C C   
1642 O O   . GLU C 62 ? 0.7150 0.4931 0.5306 -0.0110 0.0413  -0.0395 372 GLU C O   
1643 C CB  . GLU C 62 ? 0.6682 0.4996 0.5244 -0.0142 0.0307  -0.0282 372 GLU C CB  
1644 C CG  . GLU C 62 ? 0.8152 0.6786 0.6902 -0.0162 0.0221  -0.0183 372 GLU C CG  
1645 C CD  . GLU C 62 ? 1.1889 1.0745 1.0964 -0.0187 0.0210  -0.0013 372 GLU C CD  
1646 O OE1 . GLU C 62 ? 1.3621 1.2272 1.2832 -0.0137 0.0223  -0.0002 372 GLU C OE1 
1647 O OE2 . GLU C 62 ? 1.3202 1.2480 1.2444 -0.0263 0.0187  0.0108  372 GLU C OE2 
1648 N N   . VAL C 63 ? 0.7398 0.5343 0.5685 -0.0180 0.0427  -0.0458 373 VAL C N   
1649 C CA  . VAL C 63 ? 0.7630 0.5394 0.5862 -0.0192 0.0484  -0.0438 373 VAL C CA  
1650 C C   . VAL C 63 ? 0.7769 0.5651 0.6078 -0.0243 0.0555  -0.0425 373 VAL C C   
1651 O O   . VAL C 63 ? 0.7810 0.5907 0.6250 -0.0299 0.0556  -0.0477 373 VAL C O   
1652 C CB  . VAL C 63 ? 0.6377 0.4041 0.4714 -0.0202 0.0467  -0.0482 373 VAL C CB  
1653 C CG1 . VAL C 63 ? 0.6248 0.3757 0.4595 -0.0223 0.0508  -0.0386 373 VAL C CG1 
1654 C CG2 . VAL C 63 ? 0.6272 0.3855 0.4581 -0.0151 0.0394  -0.0477 373 VAL C CG2 
1655 N N   . THR C 64 ? 0.8036 0.5830 0.6265 -0.0235 0.0616  -0.0363 374 THR C N   
1656 C CA  . THR C 64 ? 0.8117 0.6014 0.6430 -0.0276 0.0689  -0.0331 374 THR C CA  
1657 C C   . THR C 64 ? 0.7673 0.5456 0.5931 -0.0300 0.0745  -0.0279 374 THR C C   
1658 O O   . THR C 64 ? 0.6829 0.4511 0.4945 -0.0277 0.0749  -0.0232 374 THR C O   
1659 C CB  . THR C 64 ? 0.7359 0.5319 0.5723 -0.0242 0.0727  -0.0304 374 THR C CB  
1660 O OG1 . THR C 64 ? 0.6194 0.4283 0.4690 -0.0226 0.0659  -0.0294 374 THR C OG1 
1661 C CG2 . THR C 64 ? 0.5879 0.3965 0.4385 -0.0280 0.0805  -0.0249 374 THR C CG2 
1662 N N   . GLY C 65 ? 0.6090 0.3945 0.4478 -0.0361 0.0779  -0.0271 375 GLY C N   
1663 C CA  . GLY C 65 ? 0.6227 0.4004 0.4634 -0.0395 0.0824  -0.0186 375 GLY C CA  
1664 C C   . GLY C 65 ? 0.6200 0.4037 0.4827 -0.0473 0.0826  -0.0230 375 GLY C C   
1665 O O   . GLY C 65 ? 0.7146 0.5153 0.5866 -0.0512 0.0807  -0.0337 375 GLY C O   
1666 N N   . MET C 66 ? 0.6330 0.4078 0.5063 -0.0510 0.0846  -0.0138 376 MET C N   
1667 C CA  . MET C 66 ? 0.6748 0.4523 0.5760 -0.0592 0.0844  -0.0203 376 MET C CA  
1668 C C   . MET C 66 ? 0.7079 0.4832 0.6287 -0.0604 0.0784  -0.0399 376 MET C C   
1669 O O   . MET C 66 ? 0.6675 0.4305 0.5857 -0.0544 0.0739  -0.0399 376 MET C O   
1670 C CB  . MET C 66 ? 0.7431 0.5100 0.6602 -0.0626 0.0860  -0.0028 376 MET C CB  
1671 C CG  . MET C 66 ? 0.9449 0.7213 0.8443 -0.0626 0.0935  0.0143  376 MET C CG  
1672 S SD  . MET C 66 ? 1.0332 0.8299 0.9328 -0.0669 0.0998  0.0070  376 MET C SD  
1673 C CE  . MET C 66 ? 1.1425 0.9401 1.0794 -0.0785 0.0964  -0.0020 376 MET C CE  
1674 N N   . PRO C 67 ? 0.8599 0.6517 0.8015 -0.0689 0.0786  -0.0589 377 PRO C N   
1675 C CA  . PRO C 67 ? 0.8851 0.6830 0.8475 -0.0709 0.0750  -0.0847 377 PRO C CA  
1676 C C   . PRO C 67 ? 0.7689 0.5386 0.7621 -0.0671 0.0720  -0.0844 377 PRO C C   
1677 O O   . PRO C 67 ? 0.7441 0.5108 0.7440 -0.0625 0.0687  -0.0965 377 PRO C O   
1678 C CB  . PRO C 67 ? 0.9709 0.7963 0.9540 -0.0838 0.0773  -0.1059 377 PRO C CB  
1679 C CG  . PRO C 67 ? 1.0311 0.8724 0.9924 -0.0869 0.0806  -0.0881 377 PRO C CG  
1680 C CD  . PRO C 67 ? 0.9639 0.7762 0.9106 -0.0781 0.0827  -0.0601 377 PRO C CD  
1681 N N   . GLU C 68 ? 0.7511 0.5027 0.7689 -0.0694 0.0725  -0.0681 378 GLU C N   
1682 C CA  . GLU C 68 ? 0.8403 0.5679 0.8973 -0.0663 0.0683  -0.0591 378 GLU C CA  
1683 C C   . GLU C 68 ? 0.8746 0.5921 0.9040 -0.0572 0.0644  -0.0350 378 GLU C C   
1684 O O   . GLU C 68 ? 0.6778 0.3831 0.7317 -0.0529 0.0597  -0.0338 378 GLU C O   
1685 C CB  . GLU C 68 ? 0.7963 0.5130 0.8909 -0.0724 0.0686  -0.0398 378 GLU C CB  
1686 N N   . ASN C 69 ? 0.8585 0.5836 0.8409 -0.0547 0.0667  -0.0175 379 ASN C N   
1687 C CA  . ASN C 69 ? 0.6891 0.4107 0.6443 -0.0482 0.0633  0.0018  379 ASN C CA  
1688 C C   . ASN C 69 ? 0.7317 0.4546 0.6685 -0.0419 0.0601  -0.0152 379 ASN C C   
1689 O O   . ASN C 69 ? 0.7666 0.4824 0.7014 -0.0373 0.0547  -0.0051 379 ASN C O   
1690 C CB  . ASN C 69 ? 0.7325 0.4663 0.6487 -0.0484 0.0684  0.0178  379 ASN C CB  
1691 C CG  . ASN C 69 ? 0.8486 0.5862 0.7806 -0.0544 0.0705  0.0427  379 ASN C CG  
1692 O OD1 . ASN C 69 ? 0.8760 0.6064 0.8450 -0.0573 0.0654  0.0602  379 ASN C OD1 
1693 N ND2 . ASN C 69 ? 0.8942 0.6457 0.8042 -0.0566 0.0780  0.0467  379 ASN C ND2 
1694 N N   . VAL C 70 ? 0.7689 0.5056 0.6943 -0.0426 0.0626  -0.0375 380 VAL C N   
1695 C CA  . VAL C 70 ? 0.6891 0.4324 0.6006 -0.0376 0.0589  -0.0503 380 VAL C CA  
1696 C C   . VAL C 70 ? 0.7044 0.4416 0.6507 -0.0365 0.0553  -0.0651 380 VAL C C   
1697 O O   . VAL C 70 ? 0.6643 0.3984 0.6053 -0.0306 0.0507  -0.0656 380 VAL C O   
1698 C CB  . VAL C 70 ? 0.6607 0.4298 0.5568 -0.0404 0.0613  -0.0635 380 VAL C CB  
1699 C CG1 . VAL C 70 ? 0.6143 0.3868 0.4859 -0.0396 0.0652  -0.0486 380 VAL C CG1 
1700 C CG2 . VAL C 70 ? 0.6154 0.4030 0.5362 -0.0495 0.0642  -0.0833 380 VAL C CG2 
1701 N N   . ASP C 71 ? 0.7437 0.4798 0.7309 -0.0423 0.0578  -0.0794 381 ASP C N   
1702 C CA  . ASP C 71 ? 0.7614 0.4903 0.7945 -0.0410 0.0560  -0.0970 381 ASP C CA  
1703 C C   . ASP C 71 ? 0.7121 0.4163 0.7644 -0.0350 0.0504  -0.0698 381 ASP C C   
1704 O O   . ASP C 71 ? 0.7340 0.4328 0.8078 -0.0298 0.0471  -0.0760 381 ASP C O   
1705 C CB  . ASP C 71 ? 0.9380 0.6700 1.0200 -0.0494 0.0603  -0.1201 381 ASP C CB  
1706 C CG  . ASP C 71 ? 0.9240 0.6913 0.9909 -0.0579 0.0649  -0.1498 381 ASP C CG  
1707 O OD1 . ASP C 71 ? 0.9036 0.6963 0.9431 -0.0567 0.0643  -0.1618 381 ASP C OD1 
1708 O OD2 . ASP C 71 ? 0.8701 0.6441 0.9547 -0.0669 0.0684  -0.1586 381 ASP C OD2 
1709 N N   . ARG C 72 ? 0.6740 0.3687 0.7202 -0.0367 0.0491  -0.0375 382 ARG C N   
1710 C CA  . ARG C 72 ? 0.7236 0.4070 0.7829 -0.0336 0.0426  -0.0045 382 ARG C CA  
1711 C C   . ARG C 72 ? 0.7734 0.4621 0.7868 -0.0275 0.0384  0.0022  382 ARG C C   
1712 O O   . ARG C 72 ? 0.8064 0.4892 0.8374 -0.0238 0.0321  0.0153  382 ARG C O   
1713 C CB  . ARG C 72 ? 0.7711 0.4568 0.8281 -0.0391 0.0424  0.0295  382 ARG C CB  
1714 C CG  . ARG C 72 ? 0.7922 0.4705 0.9057 -0.0456 0.0443  0.0306  382 ARG C CG  
1715 C CD  . ARG C 72 ? 0.9046 0.5928 1.0072 -0.0516 0.0448  0.0658  382 ARG C CD  
1716 N NE  . ARG C 72 ? 1.0246 0.7221 1.1260 -0.0520 0.0378  0.1072  382 ARG C NE  
1717 C CZ  . ARG C 72 ? 0.9421 0.6617 1.0178 -0.0575 0.0381  0.1396  382 ARG C CZ  
1718 N NH1 . ARG C 72 ? 0.8973 0.6263 0.9484 -0.0613 0.0456  0.1346  382 ARG C NH1 
1719 N NH2 . ARG C 72 ? 0.9106 0.6489 0.9857 -0.0603 0.0310  0.1772  382 ARG C NH2 
1720 N N   . ALA C 73 ? 0.6685 0.3690 0.6290 -0.0268 0.0415  -0.0058 383 ALA C N   
1721 C CA  . ALA C 73 ? 0.6663 0.3715 0.5890 -0.0218 0.0375  -0.0030 383 ALA C CA  
1722 C C   . ALA C 73 ? 0.7884 0.4940 0.7235 -0.0169 0.0347  -0.0240 383 ALA C C   
1723 O O   . ALA C 73 ? 0.6549 0.3581 0.5832 -0.0124 0.0286  -0.0162 383 ALA C O   
1724 C CB  . ALA C 73 ? 0.6882 0.4051 0.5660 -0.0222 0.0418  -0.0077 383 ALA C CB  
1725 N N   . ARG C 74 ? 0.6452 0.3593 0.5984 -0.0188 0.0392  -0.0513 384 ARG C N   
1726 C CA  . ARG C 74 ? 0.6381 0.3616 0.6065 -0.0156 0.0379  -0.0739 384 ARG C CA  
1727 C C   . ARG C 74 ? 0.7897 0.4972 0.8054 -0.0118 0.0347  -0.0704 384 ARG C C   
1728 O O   . ARG C 74 ? 0.7564 0.4661 0.7758 -0.0063 0.0309  -0.0740 384 ARG C O   
1729 C CB  . ARG C 74 ? 0.6609 0.4080 0.6419 -0.0216 0.0441  -0.1054 384 ARG C CB  
1730 C CG  . ARG C 74 ? 0.6270 0.3927 0.6326 -0.0204 0.0449  -0.1342 384 ARG C CG  
1731 C CD  . ARG C 74 ? 0.6232 0.4228 0.6426 -0.0296 0.0516  -0.1681 384 ARG C CD  
1732 N NE  . ARG C 74 ? 0.8260 0.6567 0.8038 -0.0349 0.0515  -0.1639 384 ARG C NE  
1733 C CZ  . ARG C 74 ? 0.7861 0.6502 0.7433 -0.0350 0.0488  -0.1671 384 ARG C CZ  
1734 N NH1 . ARG C 74 ? 0.7523 0.6228 0.7207 -0.0299 0.0469  -0.1774 384 ARG C NH1 
1735 N NH2 . ARG C 74 ? 0.8198 0.7132 0.7503 -0.0406 0.0478  -0.1570 384 ARG C NH2 
1736 N N   . GLU C 75 ? 0.7369 0.4294 0.7957 -0.0148 0.0357  -0.0607 385 GLU C N   
1737 C CA  . GLU C 75 ? 0.7797 0.4569 0.8983 -0.0114 0.0321  -0.0525 385 GLU C CA  
1738 C C   . GLU C 75 ? 0.8037 0.4753 0.9056 -0.0074 0.0232  -0.0159 385 GLU C C   
1739 O O   . GLU C 75 ? 0.6843 0.3521 0.8141 -0.0020 0.0192  -0.0147 385 GLU C O   
1740 C CB  . GLU C 75 ? 0.7636 0.4275 0.9389 -0.0166 0.0337  -0.0437 385 GLU C CB  
1741 C CG  . GLU C 75 ? 0.9784 0.6273 1.2392 -0.0137 0.0316  -0.0429 385 GLU C CG  
1742 C CD  . GLU C 75 ? 1.2290 0.8786 1.5484 -0.0165 0.0398  -0.0892 385 GLU C CD  
1743 O OE1 . GLU C 75 ? 1.3081 0.9763 1.5930 -0.0212 0.0464  -0.1222 385 GLU C OE1 
1744 O OE2 . GLU C 75 ? 1.2599 0.8950 1.6646 -0.0149 0.0396  -0.0927 385 GLU C OE2 
1745 N N   . GLU C 76 ? 0.7567 0.4323 0.8146 -0.0108 0.0204  0.0124  386 GLU C N   
1746 C CA  . GLU C 76 ? 0.7046 0.3845 0.7420 -0.0099 0.0119  0.0449  386 GLU C CA  
1747 C C   . GLU C 76 ? 0.7608 0.4465 0.7604 -0.0045 0.0090  0.0316  386 GLU C C   
1748 O O   . GLU C 76 ? 0.8480 0.5346 0.8534 -0.0020 0.0013  0.0493  386 GLU C O   
1749 C CB  . GLU C 76 ? 0.7566 0.4490 0.7541 -0.0167 0.0116  0.0706  386 GLU C CB  
1750 C CG  . GLU C 76 ? 0.7993 0.4916 0.8385 -0.0232 0.0117  0.0965  386 GLU C CG  
1751 C CD  . GLU C 76 ? 1.0893 0.8040 1.0880 -0.0308 0.0117  0.1232  386 GLU C CD  
1752 O OE1 . GLU C 76 ? 1.1991 0.9280 1.1403 -0.0309 0.0120  0.1183  386 GLU C OE1 
1753 O OE2 . GLU C 76 ? 1.2418 0.9628 1.2699 -0.0373 0.0117  0.1480  386 GLU C OE2 
1754 N N   . ILE C 77 ? 0.6734 0.3659 0.6382 -0.0033 0.0139  0.0043  387 ILE C N   
1755 C CA  . ILE C 77 ? 0.6767 0.3770 0.6130 0.0013  0.0104  -0.0058 387 ILE C CA  
1756 C C   . ILE C 77 ? 0.9076 0.6068 0.8836 0.0067  0.0089  -0.0188 387 ILE C C   
1757 O O   . ILE C 77 ? 1.0152 0.7150 0.9884 0.0107  0.0021  -0.0088 387 ILE C O   
1758 C CB  . ILE C 77 ? 0.6385 0.3516 0.5414 0.0003  0.0152  -0.0265 387 ILE C CB  
1759 C CG1 . ILE C 77 ? 0.7607 0.4752 0.6267 -0.0035 0.0169  -0.0147 387 ILE C CG1 
1760 C CG2 . ILE C 77 ? 0.7073 0.4321 0.5961 0.0045  0.0111  -0.0366 387 ILE C CG2 
1761 C CD1 . ILE C 77 ? 0.6449 0.3714 0.4911 -0.0047 0.0218  -0.0301 387 ILE C CD1 
1762 N N   . GLU C 78 ? 0.9233 0.6239 0.9390 0.0064  0.0157  -0.0438 388 GLU C N   
1763 C CA  . GLU C 78 ? 0.9153 0.6190 0.9760 0.0113  0.0168  -0.0630 388 GLU C CA  
1764 C C   . GLU C 78 ? 0.9654 0.6507 1.0788 0.0144  0.0118  -0.0391 388 GLU C C   
1765 O O   . GLU C 78 ? 0.8737 0.5599 1.0237 0.0202  0.0109  -0.0473 388 GLU C O   
1766 C CB  . GLU C 78 ? 0.8821 0.5994 0.9731 0.0079  0.0267  -0.1024 388 GLU C CB  
1767 C CG  . GLU C 78 ? 0.9056 0.6538 0.9512 0.0042  0.0300  -0.1233 388 GLU C CG  
1768 C CD  . GLU C 78 ? 1.0448 0.8150 1.1120 -0.0031 0.0392  -0.1588 388 GLU C CD  
1769 O OE1 . GLU C 78 ? 1.0377 0.8365 1.0698 -0.0090 0.0412  -0.1677 388 GLU C OE1 
1770 O OE2 . GLU C 78 ? 1.1388 0.9000 1.2630 -0.0038 0.0440  -0.1772 388 GLU C OE2 
1771 N N   . MET C 79 ? 0.9690 0.6423 1.0910 0.0102  0.0083  -0.0070 389 MET C N   
1772 C CA  . MET C 79 ? 0.9975 0.6606 1.1725 0.0114  0.0013  0.0264  389 MET C CA  
1773 C C   . MET C 79 ? 1.0468 0.7175 1.1889 0.0132  -0.0089 0.0545  389 MET C C   
1774 O O   . MET C 79 ? 1.0254 0.6933 1.2143 0.0160  -0.0151 0.0764  389 MET C O   
1775 C CB  . MET C 79 ? 1.0341 0.6923 1.2293 0.0042  -0.0004 0.0575  389 MET C CB  
1776 N N   . HIS C 80 ? 1.1224 0.8040 1.1909 0.0110  -0.0108 0.0542  390 HIS C N   
1777 C CA  . HIS C 80 ? 1.1074 0.7983 1.1443 0.0118  -0.0202 0.0730  390 HIS C CA  
1778 C C   . HIS C 80 ? 1.1157 0.8085 1.1534 0.0195  -0.0201 0.0490  390 HIS C C   
1779 O O   . HIS C 80 ? 1.2064 0.9060 1.2237 0.0206  -0.0283 0.0626  390 HIS C O   
1780 C CB  . HIS C 80 ? 1.0975 0.8005 1.0646 0.0057  -0.0221 0.0793  390 HIS C CB  
1781 C CG  . HIS C 80 ? 1.2360 0.9499 1.1971 -0.0033 -0.0249 0.1117  390 HIS C CG  
1782 N ND1 . HIS C 80 ? 1.2981 1.0091 1.2742 -0.0073 -0.0186 0.1144  390 HIS C ND1 
1783 C CD2 . HIS C 80 ? 1.2762 1.0113 1.2185 -0.0107 -0.0337 0.1441  390 HIS C CD2 
1784 C CE1 . HIS C 80 ? 1.3346 1.0653 1.3012 -0.0163 -0.0232 0.1485  390 HIS C CE1 
1785 N NE2 . HIS C 80 ? 1.3170 1.0655 1.2621 -0.0191 -0.0323 0.1664  390 HIS C NE2 
1786 N N   . ILE C 81 ? 0.9682 0.6606 1.0291 0.0234  -0.0112 0.0137  391 ILE C N   
1787 C CA  . ILE C 81 ? 0.9225 0.6255 0.9923 0.0297  -0.0099 -0.0096 391 ILE C CA  
1788 C C   . ILE C 81 ? 1.1746 0.8712 1.3212 0.0353  -0.0074 -0.0154 391 ILE C C   
1789 O O   . ILE C 81 ? 1.3971 1.1064 1.5652 0.0404  -0.0025 -0.0437 391 ILE C O   
1790 C CB  . ILE C 81 ? 0.7483 0.4693 0.7936 0.0285  -0.0017 -0.0458 391 ILE C CB  
1791 N N   . ALA C 82 ? 1.0874 0.7685 1.2814 0.0339  -0.0105 0.0118  392 ALA C N   
1792 C CA  . ALA C 82 ? 1.1313 0.8031 1.4143 0.0392  -0.0086 0.0110  392 ALA C CA  
1793 C C   . ALA C 82 ? 1.2925 0.9558 1.6097 0.0363  -0.0195 0.0651  392 ALA C C   
1794 O O   . ALA C 82 ? 1.3347 1.0054 1.5978 0.0297  -0.0281 0.0988  392 ALA C O   
1795 C CB  . ALA C 82 ? 0.9885 0.6548 1.3238 0.0385  0.0034  -0.0259 392 ALA C CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  311 ?  ?   ?   B . n 
A 1 2  GLY 2  312 ?  ?   ?   B . n 
A 1 3  HIS 3  313 ?  ?   ?   B . n 
A 1 4  HIS 4  314 4  HIS HIS B . n 
A 1 5  HIS 5  315 5  HIS HIS B . n 
A 1 6  HIS 6  316 6  HIS HIS B . n 
A 1 7  HIS 7  317 7  HIS HIS B . n 
A 1 8  HIS 8  318 8  HIS HIS B . n 
A 1 9  MET 9  319 9  MET MET B . n 
A 1 10 SER 10 320 10 SER SER B . n 
A 1 11 PRO 11 321 11 PRO PRO B . n 
A 1 12 ASN 12 322 12 ASN ASN B . n 
A 1 13 LEU 13 323 13 LEU LEU B . n 
A 1 14 PRO 14 324 14 PRO PRO B . n 
A 1 15 GLY 15 325 15 GLY GLY B . n 
A 1 16 GLN 16 326 16 GLN GLN B . n 
A 1 17 THR 17 327 17 THR THR B . n 
A 1 18 THR 18 328 18 THR THR B . n 
A 1 19 VAL 19 329 19 VAL VAL B . n 
A 1 20 GLN 20 330 20 GLN GLN B . n 
A 1 21 VAL 21 331 21 VAL VAL B . n 
A 1 22 ARG 22 332 22 ARG ARG B . n 
A 1 23 VAL 23 333 23 VAL VAL B . n 
A 1 24 PRO 24 334 24 PRO PRO B . n 
A 1 25 TYR 25 335 25 TYR TYR B . n 
A 1 26 ARG 26 336 26 ARG ARG B . n 
A 1 27 VAL 27 337 27 VAL VAL B . n 
A 1 28 VAL 28 338 28 VAL VAL B . n 
A 1 29 GLY 29 339 29 GLY GLY B . n 
A 1 30 LEU 30 340 30 LEU LEU B . n 
A 1 31 VAL 31 341 31 VAL VAL B . n 
A 1 32 VAL 32 342 32 VAL VAL B . n 
A 1 33 GLY 33 343 33 GLY GLY B . n 
A 1 34 PRO 34 344 34 PRO PRO B . n 
A 1 35 LYS 35 345 35 LYS LYS B . n 
A 1 36 GLY 36 346 36 GLY GLY B . n 
A 1 37 ALA 37 347 37 ALA ALA B . n 
A 1 38 THR 38 348 38 THR THR B . n 
A 1 39 ILE 39 349 39 ILE ILE B . n 
A 1 40 LYS 40 350 40 LYS LYS B . n 
A 1 41 ARG 41 351 41 ARG ARG B . n 
A 1 42 ILE 42 352 42 ILE ILE B . n 
A 1 43 GLN 43 353 43 GLN GLN B . n 
A 1 44 GLN 44 354 44 GLN GLN B . n 
A 1 45 GLN 45 355 45 GLN GLN B . n 
A 1 46 THR 46 356 46 THR THR B . n 
A 1 47 HIS 47 357 47 HIS HIS B . n 
A 1 48 THR 48 358 48 THR THR B . n 
A 1 49 TYR 49 359 49 TYR TYR B . n 
A 1 50 ILE 50 360 50 ILE ILE B . n 
A 1 51 VAL 51 361 51 VAL VAL B . n 
A 1 52 THR 52 362 52 THR THR B . n 
A 1 53 PRO 53 363 53 PRO PRO B . n 
A 1 54 SER 54 364 54 SER SER B . n 
A 1 55 ARG 55 365 55 ARG ARG B . n 
A 1 56 ASP 56 366 56 ASP ASP B . n 
A 1 57 LYS 57 367 57 LYS LYS B . n 
A 1 58 GLU 58 368 58 GLU GLU B . n 
A 1 59 PRO 59 369 59 PRO PRO B . n 
A 1 60 VAL 60 370 60 VAL VAL B . n 
A 1 61 PHE 61 371 61 PHE PHE B . n 
A 1 62 GLU 62 372 62 GLU GLU B . n 
A 1 63 VAL 63 373 63 VAL VAL B . n 
A 1 64 THR 64 374 64 THR THR B . n 
A 1 65 GLY 65 375 65 GLY GLY B . n 
A 1 66 MET 66 376 66 MET MET B . n 
A 1 67 PRO 67 377 67 PRO PRO B . n 
A 1 68 GLU 68 378 68 GLU GLU B . n 
A 1 69 ASN 69 379 69 ASN ASN B . n 
A 1 70 VAL 70 380 70 VAL VAL B . n 
A 1 71 ASP 71 381 71 ASP ASP B . n 
A 1 72 ARG 72 382 72 ARG ARG B . n 
A 1 73 ALA 73 383 73 ALA ALA B . n 
A 1 74 ARG 74 384 74 ARG ARG B . n 
A 1 75 GLU 75 385 75 GLU GLU B . n 
A 1 76 GLU 76 386 76 GLU GLU B . n 
A 1 77 ILE 77 387 77 ILE ILE B . n 
A 1 78 GLU 78 388 78 GLU GLU B . n 
A 1 79 MET 79 389 79 MET MET B . n 
A 1 80 HIS 80 390 80 HIS HIS B . n 
A 1 81 ILE 81 391 81 ILE ILE B . n 
A 1 82 ALA 82 392 82 ALA ALA B . n 
A 1 83 MET 83 393 83 MET MET B . n 
A 1 84 ARG 84 394 ?  ?   ?   B . n 
A 1 85 THR 85 395 ?  ?   ?   B . n 
A 1 86 GLY 86 396 ?  ?   ?   B . n 
B 1 1  MET 1  311 ?  ?   ?   A . n 
B 1 2  GLY 2  312 ?  ?   ?   A . n 
B 1 3  HIS 3  313 ?  ?   ?   A . n 
B 1 4  HIS 4  314 4  HIS HIS A . n 
B 1 5  HIS 5  315 5  HIS HIS A . n 
B 1 6  HIS 6  316 6  HIS HIS A . n 
B 1 7  HIS 7  317 7  HIS HIS A . n 
B 1 8  HIS 8  318 8  HIS HIS A . n 
B 1 9  MET 9  319 9  MET MET A . n 
B 1 10 SER 10 320 10 SER SER A . n 
B 1 11 PRO 11 321 11 PRO PRO A . n 
B 1 12 ASN 12 322 12 ASN ASN A . n 
B 1 13 LEU 13 323 13 LEU LEU A . n 
B 1 14 PRO 14 324 14 PRO PRO A . n 
B 1 15 GLY 15 325 15 GLY GLY A . n 
B 1 16 GLN 16 326 16 GLN GLN A . n 
B 1 17 THR 17 327 17 THR THR A . n 
B 1 18 THR 18 328 18 THR THR A . n 
B 1 19 VAL 19 329 19 VAL VAL A . n 
B 1 20 GLN 20 330 20 GLN GLN A . n 
B 1 21 VAL 21 331 21 VAL VAL A . n 
B 1 22 ARG 22 332 22 ARG ARG A . n 
B 1 23 VAL 23 333 23 VAL VAL A . n 
B 1 24 PRO 24 334 24 PRO PRO A . n 
B 1 25 TYR 25 335 25 TYR TYR A . n 
B 1 26 ARG 26 336 26 ARG ARG A . n 
B 1 27 VAL 27 337 27 VAL VAL A . n 
B 1 28 VAL 28 338 28 VAL VAL A . n 
B 1 29 GLY 29 339 29 GLY GLY A . n 
B 1 30 LEU 30 340 30 LEU LEU A . n 
B 1 31 VAL 31 341 31 VAL VAL A . n 
B 1 32 VAL 32 342 32 VAL VAL A . n 
B 1 33 GLY 33 343 33 GLY GLY A . n 
B 1 34 PRO 34 344 34 PRO PRO A . n 
B 1 35 LYS 35 345 35 LYS LYS A . n 
B 1 36 GLY 36 346 36 GLY GLY A . n 
B 1 37 ALA 37 347 37 ALA ALA A . n 
B 1 38 THR 38 348 38 THR THR A . n 
B 1 39 ILE 39 349 39 ILE ILE A . n 
B 1 40 LYS 40 350 40 LYS LYS A . n 
B 1 41 ARG 41 351 41 ARG ARG A . n 
B 1 42 ILE 42 352 42 ILE ILE A . n 
B 1 43 GLN 43 353 43 GLN GLN A . n 
B 1 44 GLN 44 354 44 GLN GLN A . n 
B 1 45 GLN 45 355 45 GLN GLN A . n 
B 1 46 THR 46 356 46 THR THR A . n 
B 1 47 HIS 47 357 47 HIS HIS A . n 
B 1 48 THR 48 358 48 THR THR A . n 
B 1 49 TYR 49 359 49 TYR TYR A . n 
B 1 50 ILE 50 360 50 ILE ILE A . n 
B 1 51 VAL 51 361 51 VAL VAL A . n 
B 1 52 THR 52 362 52 THR THR A . n 
B 1 53 PRO 53 363 53 PRO PRO A . n 
B 1 54 SER 54 364 54 SER SER A . n 
B 1 55 ARG 55 365 55 ARG ARG A . n 
B 1 56 ASP 56 366 56 ASP ASP A . n 
B 1 57 LYS 57 367 57 LYS LYS A . n 
B 1 58 GLU 58 368 58 GLU GLU A . n 
B 1 59 PRO 59 369 59 PRO PRO A . n 
B 1 60 VAL 60 370 60 VAL VAL A . n 
B 1 61 PHE 61 371 61 PHE PHE A . n 
B 1 62 GLU 62 372 62 GLU GLU A . n 
B 1 63 VAL 63 373 63 VAL VAL A . n 
B 1 64 THR 64 374 64 THR THR A . n 
B 1 65 GLY 65 375 65 GLY GLY A . n 
B 1 66 MET 66 376 66 MET MET A . n 
B 1 67 PRO 67 377 67 PRO PRO A . n 
B 1 68 GLU 68 378 68 GLU GLU A . n 
B 1 69 ASN 69 379 69 ASN ASN A . n 
B 1 70 VAL 70 380 70 VAL VAL A . n 
B 1 71 ASP 71 381 71 ASP ASP A . n 
B 1 72 ARG 72 382 72 ARG ARG A . n 
B 1 73 ALA 73 383 73 ALA ALA A . n 
B 1 74 ARG 74 384 74 ARG ARG A . n 
B 1 75 GLU 75 385 75 GLU GLU A . n 
B 1 76 GLU 76 386 76 GLU GLU A . n 
B 1 77 ILE 77 387 77 ILE ILE A . n 
B 1 78 GLU 78 388 78 GLU GLU A . n 
B 1 79 MET 79 389 79 MET MET A . n 
B 1 80 HIS 80 390 80 HIS HIS A . n 
B 1 81 ILE 81 391 81 ILE ILE A . n 
B 1 82 ALA 82 392 ?  ?   ?   A . n 
B 1 83 MET 83 393 ?  ?   ?   A . n 
B 1 84 ARG 84 394 ?  ?   ?   A . n 
B 1 85 THR 85 395 ?  ?   ?   A . n 
B 1 86 GLY 86 396 ?  ?   ?   A . n 
C 1 1  MET 1  311 ?  ?   ?   C . n 
C 1 2  GLY 2  312 ?  ?   ?   C . n 
C 1 3  HIS 3  313 ?  ?   ?   C . n 
C 1 4  HIS 4  314 4  HIS HIS C . n 
C 1 5  HIS 5  315 5  HIS HIS C . n 
C 1 6  HIS 6  316 6  HIS HIS C . n 
C 1 7  HIS 7  317 7  HIS HIS C . n 
C 1 8  HIS 8  318 8  HIS HIS C . n 
C 1 9  MET 9  319 9  MET MET C . n 
C 1 10 SER 10 320 10 SER SER C . n 
C 1 11 PRO 11 321 11 PRO PRO C . n 
C 1 12 ASN 12 322 12 ASN ASN C . n 
C 1 13 LEU 13 323 13 LEU LEU C . n 
C 1 14 PRO 14 324 14 PRO PRO C . n 
C 1 15 GLY 15 325 15 GLY GLY C . n 
C 1 16 GLN 16 326 16 GLN GLN C . n 
C 1 17 THR 17 327 17 THR THR C . n 
C 1 18 THR 18 328 18 THR THR C . n 
C 1 19 VAL 19 329 19 VAL VAL C . n 
C 1 20 GLN 20 330 20 GLN GLN C . n 
C 1 21 VAL 21 331 21 VAL VAL C . n 
C 1 22 ARG 22 332 22 ARG ARG C . n 
C 1 23 VAL 23 333 23 VAL VAL C . n 
C 1 24 PRO 24 334 24 PRO PRO C . n 
C 1 25 TYR 25 335 25 TYR TYR C . n 
C 1 26 ARG 26 336 26 ARG ARG C . n 
C 1 27 VAL 27 337 27 VAL VAL C . n 
C 1 28 VAL 28 338 28 VAL VAL C . n 
C 1 29 GLY 29 339 29 GLY GLY C . n 
C 1 30 LEU 30 340 30 LEU LEU C . n 
C 1 31 VAL 31 341 31 VAL VAL C . n 
C 1 32 VAL 32 342 32 VAL VAL C . n 
C 1 33 GLY 33 343 33 GLY GLY C . n 
C 1 34 PRO 34 344 34 PRO PRO C . n 
C 1 35 LYS 35 345 35 LYS LYS C . n 
C 1 36 GLY 36 346 36 GLY GLY C . n 
C 1 37 ALA 37 347 37 ALA ALA C . n 
C 1 38 THR 38 348 38 THR THR C . n 
C 1 39 ILE 39 349 39 ILE ILE C . n 
C 1 40 LYS 40 350 40 LYS LYS C . n 
C 1 41 ARG 41 351 41 ARG ARG C . n 
C 1 42 ILE 42 352 42 ILE ILE C . n 
C 1 43 GLN 43 353 43 GLN GLN C . n 
C 1 44 GLN 44 354 44 GLN GLN C . n 
C 1 45 GLN 45 355 45 GLN GLN C . n 
C 1 46 THR 46 356 46 THR THR C . n 
C 1 47 HIS 47 357 47 HIS HIS C . n 
C 1 48 THR 48 358 48 THR THR C . n 
C 1 49 TYR 49 359 49 TYR TYR C . n 
C 1 50 ILE 50 360 50 ILE ILE C . n 
C 1 51 VAL 51 361 51 VAL VAL C . n 
C 1 52 THR 52 362 52 THR THR C . n 
C 1 53 PRO 53 363 53 PRO PRO C . n 
C 1 54 SER 54 364 54 SER SER C . n 
C 1 55 ARG 55 365 55 ARG ARG C . n 
C 1 56 ASP 56 366 56 ASP ASP C . n 
C 1 57 LYS 57 367 57 LYS LYS C . n 
C 1 58 GLU 58 368 58 GLU GLU C . n 
C 1 59 PRO 59 369 59 PRO PRO C . n 
C 1 60 VAL 60 370 60 VAL VAL C . n 
C 1 61 PHE 61 371 61 PHE PHE C . n 
C 1 62 GLU 62 372 62 GLU GLU C . n 
C 1 63 VAL 63 373 63 VAL VAL C . n 
C 1 64 THR 64 374 64 THR THR C . n 
C 1 65 GLY 65 375 65 GLY GLY C . n 
C 1 66 MET 66 376 66 MET MET C . n 
C 1 67 PRO 67 377 67 PRO PRO C . n 
C 1 68 GLU 68 378 68 GLU GLU C . n 
C 1 69 ASN 69 379 69 ASN ASN C . n 
C 1 70 VAL 70 380 70 VAL VAL C . n 
C 1 71 ASP 71 381 71 ASP ASP C . n 
C 1 72 ARG 72 382 72 ARG ARG C . n 
C 1 73 ALA 73 383 73 ALA ALA C . n 
C 1 74 ARG 74 384 74 ARG ARG C . n 
C 1 75 GLU 75 385 75 GLU GLU C . n 
C 1 76 GLU 76 386 76 GLU GLU C . n 
C 1 77 ILE 77 387 77 ILE ILE C . n 
C 1 78 GLU 78 388 78 GLU GLU C . n 
C 1 79 MET 79 389 79 MET MET C . n 
C 1 80 HIS 80 390 80 HIS HIS C . n 
C 1 81 ILE 81 391 81 ILE ILE C . n 
C 1 82 ALA 82 392 82 ALA ALA C . n 
C 1 83 MET 83 393 ?  ?   ?   C . n 
C 1 84 ARG 84 394 ?  ?   ?   C . n 
C 1 85 THR 85 395 ?  ?   ?   C . n 
C 1 86 GLY 86 396 ?  ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 SO4 1  401 5  SO4 SO4 B . 
E 2 SO4 1  401 7  SO4 SO4 C . 
F 2 SO4 1  402 8  SO4 SO4 C . 
G 2 SO4 1  403 9  SO4 SO4 C . 
H 3 HOH 1  501 7  HOH HOH B . 
H 3 HOH 2  502 4  HOH HOH B . 
H 3 HOH 3  503 19 HOH HOH B . 
H 3 HOH 4  504 8  HOH HOH B . 
H 3 HOH 5  505 11 HOH HOH B . 
H 3 HOH 6  506 2  HOH HOH B . 
H 3 HOH 7  507 38 HOH HOH B . 
H 3 HOH 8  508 34 HOH HOH B . 
H 3 HOH 9  509 14 HOH HOH B . 
H 3 HOH 10 510 36 HOH HOH B . 
H 3 HOH 11 511 6  HOH HOH B . 
H 3 HOH 12 512 28 HOH HOH B . 
I 3 HOH 1  401 26 HOH HOH A . 
I 3 HOH 2  402 29 HOH HOH A . 
I 3 HOH 3  403 21 HOH HOH A . 
I 3 HOH 4  404 13 HOH HOH A . 
I 3 HOH 5  405 35 HOH HOH A . 
I 3 HOH 6  406 3  HOH HOH A . 
I 3 HOH 7  407 24 HOH HOH A . 
I 3 HOH 8  408 40 HOH HOH A . 
I 3 HOH 9  409 1  HOH HOH A . 
J 3 HOH 1  501 17 HOH HOH C . 
J 3 HOH 2  502 27 HOH HOH C . 
J 3 HOH 3  503 23 HOH HOH C . 
J 3 HOH 4  504 22 HOH HOH C . 
J 3 HOH 5  505 5  HOH HOH C . 
J 3 HOH 6  506 9  HOH HOH C . 
J 3 HOH 7  507 25 HOH HOH C . 
J 3 HOH 8  508 16 HOH HOH C . 
J 3 HOH 9  509 10 HOH HOH C . 
J 3 HOH 10 510 18 HOH HOH C . 
J 3 HOH 11 511 20 HOH HOH C . 
J 3 HOH 12 512 42 HOH HOH C . 
J 3 HOH 13 513 41 HOH HOH C . 
J 3 HOH 14 514 31 HOH HOH C . 
J 3 HOH 15 515 39 HOH HOH C . 
J 3 HOH 16 516 33 HOH HOH C . 
J 3 HOH 17 517 30 HOH HOH C . 
J 3 HOH 18 518 12 HOH HOH C . 
J 3 HOH 19 519 43 HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
3 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,H     
2 1 B,I       
3 1 C,E,F,G,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 130  ? 
1 MORE         -9   ? 
1 'SSA (A^2)'  5860 ? 
2 'ABSA (A^2)' 0    ? 
2 MORE         0    ? 
2 'SSA (A^2)'  5560 ? 
3 'ABSA (A^2)' 0    ? 
3 MORE         0    ? 
3 'SSA (A^2)'  5560 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-08-23 
2 'Structure model' 1 1 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume' 
2 2 'Structure model' '_citation.page_first'     
3 2 'Structure model' '_citation.page_last'      
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 3.5681   -19.0599 -31.6815 0.4197 0.3809 0.3174 0.0603  0.0485 0.0382  2.2117 6.6133 2.8489 0.0217 
-1.6866 0.1967  -0.1166 0.2248  -0.0962 0.1827 -0.0460 0.3245  0.5939  0.0128  -0.3854 
'X-RAY DIFFRACTION' 2 ? refined -2.5907  -27.4472 -9.2402  0.4987 0.3544 0.4559 -0.0193 0.2260 0.0159  2.7982 3.4465 8.6842 
-1.0530 1.8071  -1.6725 -0.4112 -0.0006 0.3743  0.0241 -0.0902 -0.2975 -0.3504 0.5474  0.1609  
'X-RAY DIFFRACTION' 3 ? refined -16.9819 -6.3621  -16.3708 0.6095 0.3579 0.4028 -0.0063 0.0286 -0.0361 7.6049 0.9562 0.6882 1.4020 
0.1499  -0.6927 0.0141  0.0171  -0.0223 0.1040 0.2670  -0.0240 -0.3378 -0.1326 0.0657  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 B 314 B 393 
;(chain 'B' and resid 314 through 393)
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 314 A 391 
;(chain 'A' and resid 314 through 391)
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 C 314 C 392 
;(chain 'C' and resid 314 through 392)
;
? ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.11.1_2575 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .           2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22        3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? MOSFLM      ? ? ? .           4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .           5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER B 364 ? ? -69.79 -177.04 
2 1 HIS B 390 ? ? -81.64 35.76   
3 1 SER A 364 ? ? -69.23 -176.76 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 B LEU 340 ? CG  ? A LEU 30 CG  
2   1 Y 1 B LEU 340 ? CD1 ? A LEU 30 CD1 
3   1 Y 1 B LEU 340 ? CD2 ? A LEU 30 CD2 
4   1 Y 1 B LYS 345 ? CG  ? A LYS 35 CG  
5   1 Y 1 B LYS 345 ? CD  ? A LYS 35 CD  
6   1 Y 1 B LYS 345 ? CE  ? A LYS 35 CE  
7   1 Y 1 B LYS 345 ? NZ  ? A LYS 35 NZ  
8   1 Y 1 B LYS 350 ? CG  ? A LYS 40 CG  
9   1 Y 1 B LYS 350 ? CD  ? A LYS 40 CD  
10  1 Y 1 B LYS 350 ? CE  ? A LYS 40 CE  
11  1 Y 1 B LYS 350 ? NZ  ? A LYS 40 NZ  
12  1 Y 1 B SER 364 ? OG  ? A SER 54 OG  
13  1 Y 1 B ARG 365 ? CG  ? A ARG 55 CG  
14  1 Y 1 B ARG 365 ? CD  ? A ARG 55 CD  
15  1 Y 1 B ARG 365 ? NE  ? A ARG 55 NE  
16  1 Y 1 B ARG 365 ? CZ  ? A ARG 55 CZ  
17  1 Y 1 B ARG 365 ? NH1 ? A ARG 55 NH1 
18  1 Y 1 B ARG 365 ? NH2 ? A ARG 55 NH2 
19  1 Y 1 B GLU 378 ? CG  ? A GLU 68 CG  
20  1 Y 1 B GLU 378 ? CD  ? A GLU 68 CD  
21  1 Y 1 B GLU 378 ? OE1 ? A GLU 68 OE1 
22  1 Y 1 B GLU 378 ? OE2 ? A GLU 68 OE2 
23  1 Y 1 B ARG 382 ? CG  ? A ARG 72 CG  
24  1 Y 1 B ARG 382 ? CD  ? A ARG 72 CD  
25  1 Y 1 B ARG 382 ? NE  ? A ARG 72 NE  
26  1 Y 1 B ARG 382 ? CZ  ? A ARG 72 CZ  
27  1 Y 1 B ARG 382 ? NH1 ? A ARG 72 NH1 
28  1 Y 1 B ARG 382 ? NH2 ? A ARG 72 NH2 
29  1 Y 1 A LYS 345 ? CG  ? B LYS 35 CG  
30  1 Y 1 A LYS 345 ? CD  ? B LYS 35 CD  
31  1 Y 1 A LYS 345 ? CE  ? B LYS 35 CE  
32  1 Y 1 A LYS 345 ? NZ  ? B LYS 35 NZ  
33  1 Y 1 A LYS 350 ? CG  ? B LYS 40 CG  
34  1 Y 1 A LYS 350 ? CD  ? B LYS 40 CD  
35  1 Y 1 A LYS 350 ? CE  ? B LYS 40 CE  
36  1 Y 1 A LYS 350 ? NZ  ? B LYS 40 NZ  
37  1 Y 1 A GLN 355 ? CG  ? B GLN 45 CG  
38  1 Y 1 A GLN 355 ? CD  ? B GLN 45 CD  
39  1 Y 1 A GLN 355 ? OE1 ? B GLN 45 OE1 
40  1 Y 1 A GLN 355 ? NE2 ? B GLN 45 NE2 
41  1 Y 1 A ARG 365 ? CG  ? B ARG 55 CG  
42  1 Y 1 A ARG 365 ? CD  ? B ARG 55 CD  
43  1 Y 1 A ARG 365 ? NE  ? B ARG 55 NE  
44  1 Y 1 A ARG 365 ? CZ  ? B ARG 55 CZ  
45  1 Y 1 A ARG 365 ? NH1 ? B ARG 55 NH1 
46  1 Y 1 A ARG 365 ? NH2 ? B ARG 55 NH2 
47  1 Y 1 A LYS 367 ? CG  ? B LYS 57 CG  
48  1 Y 1 A LYS 367 ? CD  ? B LYS 57 CD  
49  1 Y 1 A LYS 367 ? CE  ? B LYS 57 CE  
50  1 Y 1 A LYS 367 ? NZ  ? B LYS 57 NZ  
51  1 Y 1 A MET 376 ? CG  ? B MET 66 CG  
52  1 Y 1 A MET 376 ? SD  ? B MET 66 SD  
53  1 Y 1 A MET 376 ? CE  ? B MET 66 CE  
54  1 Y 1 A GLU 378 ? CG  ? B GLU 68 CG  
55  1 Y 1 A GLU 378 ? CD  ? B GLU 68 CD  
56  1 Y 1 A GLU 378 ? OE1 ? B GLU 68 OE1 
57  1 Y 1 A GLU 378 ? OE2 ? B GLU 68 OE2 
58  1 Y 1 A ARG 382 ? CG  ? B ARG 72 CG  
59  1 Y 1 A ARG 382 ? CD  ? B ARG 72 CD  
60  1 Y 1 A ARG 382 ? NE  ? B ARG 72 NE  
61  1 Y 1 A ARG 382 ? CZ  ? B ARG 72 CZ  
62  1 Y 1 A ARG 382 ? NH1 ? B ARG 72 NH1 
63  1 Y 1 A ARG 382 ? NH2 ? B ARG 72 NH2 
64  1 Y 1 A ILE 391 ? CG1 ? B ILE 81 CG1 
65  1 Y 1 A ILE 391 ? CG2 ? B ILE 81 CG2 
66  1 Y 1 A ILE 391 ? CD1 ? B ILE 81 CD1 
67  1 Y 1 C LEU 340 ? CG  ? C LEU 30 CG  
68  1 Y 1 C LEU 340 ? CD1 ? C LEU 30 CD1 
69  1 Y 1 C LEU 340 ? CD2 ? C LEU 30 CD2 
70  1 Y 1 C LYS 345 ? CG  ? C LYS 35 CG  
71  1 Y 1 C LYS 345 ? CD  ? C LYS 35 CD  
72  1 Y 1 C LYS 345 ? CE  ? C LYS 35 CE  
73  1 Y 1 C LYS 345 ? NZ  ? C LYS 35 NZ  
74  1 Y 1 C LYS 350 ? CG  ? C LYS 40 CG  
75  1 Y 1 C LYS 350 ? CD  ? C LYS 40 CD  
76  1 Y 1 C LYS 350 ? CE  ? C LYS 40 CE  
77  1 Y 1 C LYS 350 ? NZ  ? C LYS 40 NZ  
78  1 Y 1 C GLN 354 ? CG  ? C GLN 44 CG  
79  1 Y 1 C GLN 354 ? CD  ? C GLN 44 CD  
80  1 Y 1 C GLN 354 ? OE1 ? C GLN 44 OE1 
81  1 Y 1 C GLN 354 ? NE2 ? C GLN 44 NE2 
82  1 Y 1 C ARG 365 ? CG  ? C ARG 55 CG  
83  1 Y 1 C ARG 365 ? CD  ? C ARG 55 CD  
84  1 Y 1 C ARG 365 ? NE  ? C ARG 55 NE  
85  1 Y 1 C ARG 365 ? CZ  ? C ARG 55 CZ  
86  1 Y 1 C ARG 365 ? NH1 ? C ARG 55 NH1 
87  1 Y 1 C ARG 365 ? NH2 ? C ARG 55 NH2 
88  1 Y 1 C LYS 367 ? CG  ? C LYS 57 CG  
89  1 Y 1 C LYS 367 ? CD  ? C LYS 57 CD  
90  1 Y 1 C LYS 367 ? CE  ? C LYS 57 CE  
91  1 Y 1 C LYS 367 ? NZ  ? C LYS 57 NZ  
92  1 Y 1 C GLU 378 ? CG  ? C GLU 68 CG  
93  1 Y 1 C GLU 378 ? CD  ? C GLU 68 CD  
94  1 Y 1 C GLU 378 ? OE1 ? C GLU 68 OE1 
95  1 Y 1 C GLU 378 ? OE2 ? C GLU 68 OE2 
96  1 Y 1 C MET 389 ? CG  ? C MET 79 CG  
97  1 Y 1 C MET 389 ? SD  ? C MET 79 SD  
98  1 Y 1 C MET 389 ? CE  ? C MET 79 CE  
99  1 Y 1 C ILE 391 ? CG1 ? C ILE 81 CG1 
100 1 Y 1 C ILE 391 ? CG2 ? C ILE 81 CG2 
101 1 Y 1 C ILE 391 ? CD1 ? C ILE 81 CD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B MET 311 ? A MET 1  
2  1 Y 1 B GLY 312 ? A GLY 2  
3  1 Y 1 B HIS 313 ? A HIS 3  
4  1 Y 1 B ARG 394 ? A ARG 84 
5  1 Y 1 B THR 395 ? A THR 85 
6  1 Y 1 B GLY 396 ? A GLY 86 
7  1 Y 1 A MET 311 ? B MET 1  
8  1 Y 1 A GLY 312 ? B GLY 2  
9  1 Y 1 A HIS 313 ? B HIS 3  
10 1 Y 1 A ALA 392 ? B ALA 82 
11 1 Y 1 A MET 393 ? B MET 83 
12 1 Y 1 A ARG 394 ? B ARG 84 
13 1 Y 1 A THR 395 ? B THR 85 
14 1 Y 1 A GLY 396 ? B GLY 86 
15 1 Y 1 C MET 311 ? C MET 1  
16 1 Y 1 C GLY 312 ? C GLY 2  
17 1 Y 1 C HIS 313 ? C HIS 3  
18 1 Y 1 C MET 393 ? C MET 83 
19 1 Y 1 C ARG 394 ? C ARG 84 
20 1 Y 1 C THR 395 ? C THR 85 
21 1 Y 1 C GLY 396 ? C GLY 86 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#