data_5WXN
# 
_entry.id   5WXN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5WXN         
WWPDB D_1300002357 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5WXN 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-08 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Ding, S.'  1 ? 
'Shi, Z.B.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acta Crystallogr F Struct Biol Commun' 
_citation.journal_id_ASTM           ACSFEN 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2053-230X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            73 
_citation.language                  ? 
_citation.page_first                196 
_citation.page_last                 201 
_citation.title                     'Structure of the complex of phosphorylated liver kinase B1 and 14-3-3 zeta' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1107/S2053230X17003521 
_citation.pdbx_database_id_PubMed   28368277 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lu, Y.'   1 
primary 'Ding, S.' 2 
primary 'Zhou, R.' 3 
primary 'Wu, J.'   4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5WXN 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     72.771 
_cell.length_a_esd                 ? 
_cell.length_b                     85.382 
_cell.length_b_esd                 ? 
_cell.length_c                     112.738 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5WXN 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man '14-3-3 protein zeta/delta'             30444.102 2  ? ? ?                      ? 
2 polymer syn 'Serine/threonine-protein kinase STK11' 1733.880  2  ? ? 'UNP residues 331-343' ? 
3 water   nat water                                   18.015    18 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein kinase C inhibitor protein 1,KCIP-1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MSYYHHHHHHLESTSLYKKAGLMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSS
WRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDK
KGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIM
QLLRDNLTLWTSDTQGDEAEAGEGGEN
;
;MSYYHHHHHHLESTSLYKKAGLMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSS
WRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDK
KGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIM
QLLRDNLTLWTSDTQGDEAEAGEGGEN
;
A,B ? 
2 'polypeptide(L)' no yes 'RWRSM(TPO)VVPYLED' RWRSMTVVPYLED C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   TYR n 
1 4   TYR n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  LEU n 
1 12  GLU n 
1 13  SER n 
1 14  THR n 
1 15  SER n 
1 16  LEU n 
1 17  TYR n 
1 18  LYS n 
1 19  LYS n 
1 20  ALA n 
1 21  GLY n 
1 22  LEU n 
1 23  MET n 
1 24  ASP n 
1 25  LYS n 
1 26  ASN n 
1 27  GLU n 
1 28  LEU n 
1 29  VAL n 
1 30  GLN n 
1 31  LYS n 
1 32  ALA n 
1 33  LYS n 
1 34  LEU n 
1 35  ALA n 
1 36  GLU n 
1 37  GLN n 
1 38  ALA n 
1 39  GLU n 
1 40  ARG n 
1 41  TYR n 
1 42  ASP n 
1 43  ASP n 
1 44  MET n 
1 45  ALA n 
1 46  ALA n 
1 47  CYS n 
1 48  MET n 
1 49  LYS n 
1 50  SER n 
1 51  VAL n 
1 52  THR n 
1 53  GLU n 
1 54  GLN n 
1 55  GLY n 
1 56  ALA n 
1 57  GLU n 
1 58  LEU n 
1 59  SER n 
1 60  ASN n 
1 61  GLU n 
1 62  GLU n 
1 63  ARG n 
1 64  ASN n 
1 65  LEU n 
1 66  LEU n 
1 67  SER n 
1 68  VAL n 
1 69  ALA n 
1 70  TYR n 
1 71  LYS n 
1 72  ASN n 
1 73  VAL n 
1 74  VAL n 
1 75  GLY n 
1 76  ALA n 
1 77  ARG n 
1 78  ARG n 
1 79  SER n 
1 80  SER n 
1 81  TRP n 
1 82  ARG n 
1 83  VAL n 
1 84  VAL n 
1 85  SER n 
1 86  SER n 
1 87  ILE n 
1 88  GLU n 
1 89  GLN n 
1 90  LYS n 
1 91  THR n 
1 92  GLU n 
1 93  GLY n 
1 94  ALA n 
1 95  GLU n 
1 96  LYS n 
1 97  LYS n 
1 98  GLN n 
1 99  GLN n 
1 100 MET n 
1 101 ALA n 
1 102 ARG n 
1 103 GLU n 
1 104 TYR n 
1 105 ARG n 
1 106 GLU n 
1 107 LYS n 
1 108 ILE n 
1 109 GLU n 
1 110 THR n 
1 111 GLU n 
1 112 LEU n 
1 113 ARG n 
1 114 ASP n 
1 115 ILE n 
1 116 CYS n 
1 117 ASN n 
1 118 ASP n 
1 119 VAL n 
1 120 LEU n 
1 121 SER n 
1 122 LEU n 
1 123 LEU n 
1 124 GLU n 
1 125 LYS n 
1 126 PHE n 
1 127 LEU n 
1 128 ILE n 
1 129 PRO n 
1 130 ASN n 
1 131 ALA n 
1 132 SER n 
1 133 GLN n 
1 134 ALA n 
1 135 GLU n 
1 136 SER n 
1 137 LYS n 
1 138 VAL n 
1 139 PHE n 
1 140 TYR n 
1 141 LEU n 
1 142 LYS n 
1 143 MET n 
1 144 LYS n 
1 145 GLY n 
1 146 ASP n 
1 147 TYR n 
1 148 TYR n 
1 149 ARG n 
1 150 TYR n 
1 151 LEU n 
1 152 ALA n 
1 153 GLU n 
1 154 VAL n 
1 155 ALA n 
1 156 ALA n 
1 157 GLY n 
1 158 ASP n 
1 159 ASP n 
1 160 LYS n 
1 161 LYS n 
1 162 GLY n 
1 163 ILE n 
1 164 VAL n 
1 165 ASP n 
1 166 GLN n 
1 167 SER n 
1 168 GLN n 
1 169 GLN n 
1 170 ALA n 
1 171 TYR n 
1 172 GLN n 
1 173 GLU n 
1 174 ALA n 
1 175 PHE n 
1 176 GLU n 
1 177 ILE n 
1 178 SER n 
1 179 LYS n 
1 180 LYS n 
1 181 GLU n 
1 182 MET n 
1 183 GLN n 
1 184 PRO n 
1 185 THR n 
1 186 HIS n 
1 187 PRO n 
1 188 ILE n 
1 189 ARG n 
1 190 LEU n 
1 191 GLY n 
1 192 LEU n 
1 193 ALA n 
1 194 LEU n 
1 195 ASN n 
1 196 PHE n 
1 197 SER n 
1 198 VAL n 
1 199 PHE n 
1 200 TYR n 
1 201 TYR n 
1 202 GLU n 
1 203 ILE n 
1 204 LEU n 
1 205 ASN n 
1 206 SER n 
1 207 PRO n 
1 208 GLU n 
1 209 LYS n 
1 210 ALA n 
1 211 CYS n 
1 212 SER n 
1 213 LEU n 
1 214 ALA n 
1 215 LYS n 
1 216 THR n 
1 217 ALA n 
1 218 PHE n 
1 219 ASP n 
1 220 GLU n 
1 221 ALA n 
1 222 ILE n 
1 223 ALA n 
1 224 GLU n 
1 225 LEU n 
1 226 ASP n 
1 227 THR n 
1 228 LEU n 
1 229 SER n 
1 230 GLU n 
1 231 GLU n 
1 232 SER n 
1 233 TYR n 
1 234 LYS n 
1 235 ASP n 
1 236 SER n 
1 237 THR n 
1 238 LEU n 
1 239 ILE n 
1 240 MET n 
1 241 GLN n 
1 242 LEU n 
1 243 LEU n 
1 244 ARG n 
1 245 ASP n 
1 246 ASN n 
1 247 LEU n 
1 248 THR n 
1 249 LEU n 
1 250 TRP n 
1 251 THR n 
1 252 SER n 
1 253 ASP n 
1 254 THR n 
1 255 GLN n 
1 256 GLY n 
1 257 ASP n 
1 258 GLU n 
1 259 ALA n 
1 260 GLU n 
1 261 ALA n 
1 262 GLY n 
1 263 GLU n 
1 264 GLY n 
1 265 GLY n 
1 266 GLU n 
1 267 ASN n 
2 1   ARG n 
2 2   TRP n 
2 3   ARG n 
2 4   SER n 
2 5   MET n 
2 6   TPO n 
2 7   VAL n 
2 8   VAL n 
2 9   PRO n 
2 10  TYR n 
2 11  LEU n 
2 12  GLU n 
2 13  ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   267 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 YWHAZ 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pDEST17 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       13 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP 1433Z_HUMAN P63104 ? 1 
;MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAR
EYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEM
QPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
;
1   
2 UNP STK11_HUMAN Q15831 ? 2 RWRSMTVVPYLED 331 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5WXN A 23 ? 267 ? P63104 1   ? 245 ? 1   245 
2 1 5WXN B 23 ? 267 ? P63104 1   ? 245 ? 1   245 
3 2 5WXN C 1  ? 13  ? Q15831 331 ? 343 ? 331 343 
4 2 5WXN D 1  ? 13  ? Q15831 331 ? 343 ? 331 343 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5WXN MET A 1  ? UNP P63104 ? ? 'expression tag' -21 1  
1 5WXN SER A 2  ? UNP P63104 ? ? 'expression tag' -20 2  
1 5WXN TYR A 3  ? UNP P63104 ? ? 'expression tag' -19 3  
1 5WXN TYR A 4  ? UNP P63104 ? ? 'expression tag' -18 4  
1 5WXN HIS A 5  ? UNP P63104 ? ? 'expression tag' -17 5  
1 5WXN HIS A 6  ? UNP P63104 ? ? 'expression tag' -16 6  
1 5WXN HIS A 7  ? UNP P63104 ? ? 'expression tag' -15 7  
1 5WXN HIS A 8  ? UNP P63104 ? ? 'expression tag' -14 8  
1 5WXN HIS A 9  ? UNP P63104 ? ? 'expression tag' -13 9  
1 5WXN HIS A 10 ? UNP P63104 ? ? 'expression tag' -12 10 
1 5WXN LEU A 11 ? UNP P63104 ? ? 'expression tag' -11 11 
1 5WXN GLU A 12 ? UNP P63104 ? ? 'expression tag' -10 12 
1 5WXN SER A 13 ? UNP P63104 ? ? 'expression tag' -9  13 
1 5WXN THR A 14 ? UNP P63104 ? ? 'expression tag' -8  14 
1 5WXN SER A 15 ? UNP P63104 ? ? 'expression tag' -7  15 
1 5WXN LEU A 16 ? UNP P63104 ? ? 'expression tag' -6  16 
1 5WXN TYR A 17 ? UNP P63104 ? ? 'expression tag' -5  17 
1 5WXN LYS A 18 ? UNP P63104 ? ? 'expression tag' -4  18 
1 5WXN LYS A 19 ? UNP P63104 ? ? 'expression tag' -3  19 
1 5WXN ALA A 20 ? UNP P63104 ? ? 'expression tag' -2  20 
1 5WXN GLY A 21 ? UNP P63104 ? ? 'expression tag' -1  21 
1 5WXN LEU A 22 ? UNP P63104 ? ? 'expression tag' 0   22 
2 5WXN MET B 1  ? UNP P63104 ? ? 'expression tag' -21 23 
2 5WXN SER B 2  ? UNP P63104 ? ? 'expression tag' -20 24 
2 5WXN TYR B 3  ? UNP P63104 ? ? 'expression tag' -19 25 
2 5WXN TYR B 4  ? UNP P63104 ? ? 'expression tag' -18 26 
2 5WXN HIS B 5  ? UNP P63104 ? ? 'expression tag' -17 27 
2 5WXN HIS B 6  ? UNP P63104 ? ? 'expression tag' -16 28 
2 5WXN HIS B 7  ? UNP P63104 ? ? 'expression tag' -15 29 
2 5WXN HIS B 8  ? UNP P63104 ? ? 'expression tag' -14 30 
2 5WXN HIS B 9  ? UNP P63104 ? ? 'expression tag' -13 31 
2 5WXN HIS B 10 ? UNP P63104 ? ? 'expression tag' -12 32 
2 5WXN LEU B 11 ? UNP P63104 ? ? 'expression tag' -11 33 
2 5WXN GLU B 12 ? UNP P63104 ? ? 'expression tag' -10 34 
2 5WXN SER B 13 ? UNP P63104 ? ? 'expression tag' -9  35 
2 5WXN THR B 14 ? UNP P63104 ? ? 'expression tag' -8  36 
2 5WXN SER B 15 ? UNP P63104 ? ? 'expression tag' -7  37 
2 5WXN LEU B 16 ? UNP P63104 ? ? 'expression tag' -6  38 
2 5WXN TYR B 17 ? UNP P63104 ? ? 'expression tag' -5  39 
2 5WXN LYS B 18 ? UNP P63104 ? ? 'expression tag' -4  40 
2 5WXN LYS B 19 ? UNP P63104 ? ? 'expression tag' -3  41 
2 5WXN ALA B 20 ? UNP P63104 ? ? 'expression tag' -2  42 
2 5WXN GLY B 21 ? UNP P63104 ? ? 'expression tag' -1  43 
2 5WXN LEU B 22 ? UNP P63104 ? ? 'expression tag' 0   44 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                  'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                  'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                  'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                  'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ?                  'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ?                  'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                  'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                  'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ?                  'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                  'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                  'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                  'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                  'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ?                  'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ?                  'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                  'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                  'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                  'C4 H9 N O3'     119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P'  199.099 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                  'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                  'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                  'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5WXN 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.72 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.80 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.15 M ammonium chloride, 18% PEG3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-05-02 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97915 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97915 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5WXN 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.93 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       15953 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.9 
_reflns.pdbx_Rmerge_I_obs                0.093 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            22.07 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.93 
_reflns_shell.d_res_low                   2.98 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.78 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.937 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.9 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5WXN 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.930 
_refine.ls_d_res_low                             44.563 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     15587 
_refine.ls_number_reflns_R_free                  1559 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.62 
_refine.ls_percent_reflns_R_free                 10.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1997 
_refine.ls_R_factor_R_free                       0.2542 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1934 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4ZDR 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 31.01 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.42 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5WXN 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3632 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             18 
_refine_hist.number_atoms_total               3650 
_refine_hist.d_res_high                       2.930 
_refine_hist.d_res_low                        44.563 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009 ? 3697 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.239 ? 5020 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 6.878 ? 3017 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.066 ? 584  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.008 ? 649  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.9301 3.0246  . . 139 1252 100.00 . . . 0.3975 . 0.3208 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0246 3.1327  . . 139 1253 100.00 . . . 0.3800 . 0.2829 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1327 3.2581  . . 140 1254 100.00 . . . 0.3315 . 0.2362 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2581 3.4063  . . 139 1258 100.00 . . . 0.3192 . 0.2350 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4063 3.5859  . . 139 1244 99.00  . . . 0.3306 . 0.2228 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5859 3.8104  . . 142 1277 100.00 . . . 0.2644 . 0.1926 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8104 4.1044  . . 142 1273 100.00 . . . 0.2299 . 0.1687 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1044 4.5171  . . 143 1276 100.00 . . . 0.2521 . 0.1560 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5171 5.1699  . . 142 1288 100.00 . . . 0.2235 . 0.1500 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.1699 6.5103  . . 145 1299 100.00 . . . 0.2473 . 0.2109 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.5103 44.5685 . . 149 1354 98.00  . . . 0.2025 . 0.1859 . . . . . . . . . . 
# 
_struct.entry_id                     5WXN 
_struct.title                        'Structure of the LKB1 and 14-3-3 complex' 
_struct.pdbx_descriptor              '14-3-3 protein zeta/delta, Serine/threonine-protein kinase STK11' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5WXN 
_struct_keywords.text            'Kinase, Tumor suppressor, Protein Complex, PROTEIN BINDING-TRANSFERASE complex' 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING/TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 24  ? ALA A 38  ? ASP A 2   ALA A 16  1 ? 15 
HELX_P HELX_P2  AA2 ARG A 40  ? GLU A 53  ? ARG A 18  GLU A 31  1 ? 14 
HELX_P HELX_P3  AA3 SER A 59  ? THR A 91  ? SER A 37  THR A 69  1 ? 33 
HELX_P HELX_P4  AA4 ALA A 94  ? PHE A 126 ? ALA A 72  PHE A 104 1 ? 33 
HELX_P HELX_P5  AA5 GLN A 133 ? ALA A 155 ? GLN A 111 ALA A 133 1 ? 23 
HELX_P HELX_P6  AA6 ALA A 156 ? ASP A 158 ? ALA A 134 ASP A 136 5 ? 3  
HELX_P HELX_P7  AA7 ASP A 159 ? MET A 182 ? ASP A 137 MET A 160 1 ? 24 
HELX_P HELX_P8  AA8 HIS A 186 ? LEU A 204 ? HIS A 164 LEU A 182 1 ? 19 
HELX_P HELX_P9  AA9 SER A 206 ? GLU A 224 ? SER A 184 GLU A 202 1 ? 19 
HELX_P HELX_P10 AB1 LEU A 225 ? LEU A 228 ? LEU A 203 LEU A 206 5 ? 4  
HELX_P HELX_P11 AB2 SER A 232 ? THR A 251 ? SER A 210 THR A 229 1 ? 20 
HELX_P HELX_P12 AB3 ASP B 24  ? ALA B 38  ? ASP B 2   ALA B 16  1 ? 15 
HELX_P HELX_P13 AB4 ARG B 40  ? GLU B 53  ? ARG B 18  GLU B 31  1 ? 14 
HELX_P HELX_P14 AB5 SER B 59  ? THR B 91  ? SER B 37  THR B 69  1 ? 33 
HELX_P HELX_P15 AB6 ALA B 94  ? PHE B 126 ? ALA B 72  PHE B 104 1 ? 33 
HELX_P HELX_P16 AB7 GLN B 133 ? GLU B 153 ? GLN B 111 GLU B 131 1 ? 21 
HELX_P HELX_P17 AB8 ASP B 159 ? MET B 182 ? ASP B 137 MET B 160 1 ? 24 
HELX_P HELX_P18 AB9 HIS B 186 ? ILE B 203 ? HIS B 164 ILE B 181 1 ? 18 
HELX_P HELX_P19 AC1 SER B 206 ? ALA B 223 ? SER B 184 ALA B 201 1 ? 18 
HELX_P HELX_P20 AC2 GLU B 224 ? LEU B 228 ? GLU B 202 LEU B 206 5 ? 5  
HELX_P HELX_P21 AC3 SER B 232 ? THR B 251 ? SER B 210 THR B 229 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? C MET 5 C ? ? ? 1_555 C TPO 6 N ? ? C MET 335 C TPO 336 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale2 covale both ? C TPO 6 C ? ? ? 1_555 C VAL 7 N ? ? C TPO 336 C VAL 337 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale3 covale both ? D MET 5 C ? ? ? 1_555 D TPO 6 N ? ? D MET 335 D TPO 336 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale4 covale both ? D TPO 6 C ? ? ? 1_555 D VAL 7 N ? ? D TPO 336 D VAL 337 1_555 ? ? ? ? ? ? ? 1.328 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_atom_sites.entry_id                    5WXN 
_atom_sites.fract_transf_matrix[1][1]   0.013742 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011712 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008870 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 22  ? 75.483  106.521 -16.996 1.00 121.29 ? 0   LEU A N   1 
ATOM   2    C CA  . LEU A 1 22  ? 74.513  105.621 -16.373 1.00 124.00 ? 0   LEU A CA  1 
ATOM   3    C C   . LEU A 1 22  ? 73.113  105.827 -16.968 1.00 131.88 ? 0   LEU A C   1 
ATOM   4    O O   . LEU A 1 22  ? 72.100  105.514 -16.334 1.00 136.40 ? 0   LEU A O   1 
ATOM   5    C CB  . LEU A 1 22  ? 74.479  105.833 -14.857 1.00 30.00  ? 0   LEU A CB  1 
ATOM   6    N N   . MET A 1 23  ? 73.070  106.374 -18.188 1.00 221.87 ? 1   MET A N   1 
ATOM   7    C CA  . MET A 1 23  ? 71.841  106.506 -18.963 1.00 203.66 ? 1   MET A CA  1 
ATOM   8    C C   . MET A 1 23  ? 71.741  105.462 -20.073 1.00 192.32 ? 1   MET A C   1 
ATOM   9    O O   . MET A 1 23  ? 70.667  105.302 -20.666 1.00 194.28 ? 1   MET A O   1 
ATOM   10   C CB  . MET A 1 23  ? 71.738  107.933 -19.548 1.00 197.92 ? 1   MET A CB  1 
ATOM   11   C CG  . MET A 1 23  ? 70.523  108.227 -20.448 1.00 187.11 ? 1   MET A CG  1 
ATOM   12   S SD  . MET A 1 23  ? 68.907  108.125 -19.637 1.00 173.80 ? 1   MET A SD  1 
ATOM   13   C CE  . MET A 1 23  ? 67.888  107.517 -20.982 1.00 166.98 ? 1   MET A CE  1 
ATOM   14   N N   . ASP A 1 24  ? 72.816  104.721 -20.336 1.00 178.51 ? 2   ASP A N   1 
ATOM   15   C CA  . ASP A 1 24  ? 72.811  103.713 -21.388 1.00 164.82 ? 2   ASP A CA  1 
ATOM   16   C C   . ASP A 1 24  ? 71.989  102.502 -20.948 1.00 153.64 ? 2   ASP A C   1 
ATOM   17   O O   . ASP A 1 24  ? 72.301  101.873 -19.931 1.00 152.01 ? 2   ASP A O   1 
ATOM   18   C CB  . ASP A 1 24  ? 74.257  103.309 -21.682 1.00 162.45 ? 2   ASP A CB  1 
ATOM   19   C CG  . ASP A 1 24  ? 74.415  102.576 -22.994 1.00 163.16 ? 2   ASP A CG  1 
ATOM   20   O OD1 . ASP A 1 24  ? 75.570  102.427 -23.449 1.00 166.61 ? 2   ASP A OD1 1 
ATOM   21   O OD2 . ASP A 1 24  ? 73.392  102.150 -23.570 1.00 161.71 ? 2   ASP A OD2 1 
ATOM   22   N N   . LYS A 1 25  ? 70.950  102.158 -21.722 1.00 143.69 ? 3   LYS A N   1 
ATOM   23   C CA  . LYS A 1 25  ? 70.046  101.086 -21.300 1.00 129.44 ? 3   LYS A CA  1 
ATOM   24   C C   . LYS A 1 25  ? 70.757  99.738  -21.317 1.00 125.41 ? 3   LYS A C   1 
ATOM   25   O O   . LYS A 1 25  ? 70.614  98.939  -20.384 1.00 120.55 ? 3   LYS A O   1 
ATOM   26   C CB  . LYS A 1 25  ? 68.793  101.052 -22.184 1.00 117.03 ? 3   LYS A CB  1 
ATOM   27   C CG  . LYS A 1 25  ? 67.742  100.007 -21.779 1.00 99.86  ? 3   LYS A CG  1 
ATOM   28   N N   . ASN A 1 26  ? 71.528  99.472  -22.373 1.00 127.35 ? 4   ASN A N   1 
ATOM   29   C CA  . ASN A 1 26  ? 72.232  98.203  -22.500 1.00 124.99 ? 4   ASN A CA  1 
ATOM   30   C C   . ASN A 1 26  ? 73.363  98.077  -21.493 1.00 114.85 ? 4   ASN A C   1 
ATOM   31   O O   . ASN A 1 26  ? 73.819  96.958  -21.229 1.00 106.52 ? 4   ASN A O   1 
ATOM   32   C CB  . ASN A 1 26  ? 72.759  98.015  -23.926 1.00 130.53 ? 4   ASN A CB  1 
ATOM   33   C CG  . ASN A 1 26  ? 72.607  96.580  -24.412 1.00 131.79 ? 4   ASN A CG  1 
ATOM   34   O OD1 . ASN A 1 26  ? 72.204  95.686  -23.650 1.00 126.55 ? 4   ASN A OD1 1 
ATOM   35   N ND2 . ASN A 1 26  ? 72.920  96.352  -25.687 1.00 135.49 ? 4   ASN A ND2 1 
ATOM   36   N N   . GLU A 1 27  ? 73.862  99.205  -20.976 1.00 113.57 ? 5   GLU A N   1 
ATOM   37   C CA  . GLU A 1 27  ? 74.920  99.163  -19.972 1.00 111.86 ? 5   GLU A CA  1 
ATOM   38   C C   . GLU A 1 27  ? 74.353  98.823  -18.595 1.00 107.38 ? 5   GLU A C   1 
ATOM   39   O O   . GLU A 1 27  ? 74.980  98.084  -17.828 1.00 99.04  ? 5   GLU A O   1 
ATOM   40   C CB  . GLU A 1 27  ? 75.678  100.494 -19.943 1.00 108.57 ? 5   GLU A CB  1 
ATOM   41   N N   . LEU A 1 28  ? 73.153  99.316  -18.274 1.00 104.79 ? 6   LEU A N   1 
ATOM   42   C CA  . LEU A 1 28  ? 72.534  98.951  -17.001 1.00 89.66  ? 6   LEU A CA  1 
ATOM   43   C C   . LEU A 1 28  ? 72.219  97.458  -16.952 1.00 89.50  ? 6   LEU A C   1 
ATOM   44   O O   . LEU A 1 28  ? 72.328  96.826  -15.895 1.00 89.14  ? 6   LEU A O   1 
ATOM   45   C CB  . LEU A 1 28  ? 71.273  99.778  -16.763 1.00 75.97  ? 6   LEU A CB  1 
ATOM   46   C CG  . LEU A 1 28  ? 71.378  101.298 -16.626 1.00 84.42  ? 6   LEU A CG  1 
ATOM   47   C CD1 . LEU A 1 28  ? 69.996  101.930 -16.470 1.00 93.38  ? 6   LEU A CD1 1 
ATOM   48   C CD2 . LEU A 1 28  ? 72.244  101.652 -15.444 1.00 84.73  ? 6   LEU A CD2 1 
ATOM   49   N N   . VAL A 1 29  ? 71.813  96.877  -18.080 1.00 89.63  ? 7   VAL A N   1 
ATOM   50   C CA  . VAL A 1 29  ? 71.607  95.433  -18.142 1.00 83.74  ? 7   VAL A CA  1 
ATOM   51   C C   . VAL A 1 29  ? 72.936  94.682  -18.056 1.00 83.46  ? 7   VAL A C   1 
ATOM   52   O O   . VAL A 1 29  ? 72.979  93.515  -17.635 1.00 82.52  ? 7   VAL A O   1 
ATOM   53   C CB  . VAL A 1 29  ? 70.818  95.088  -19.418 1.00 76.62  ? 7   VAL A CB  1 
ATOM   54   C CG1 . VAL A 1 29  ? 70.875  93.592  -19.724 1.00 76.81  ? 7   VAL A CG1 1 
ATOM   55   C CG2 . VAL A 1 29  ? 69.384  95.593  -19.296 1.00 71.55  ? 7   VAL A CG2 1 
ATOM   56   N N   . GLN A 1 30  ? 74.037  95.313  -18.473 1.00 80.03  ? 8   GLN A N   1 
ATOM   57   C CA  . GLN A 1 30  ? 75.340  94.682  -18.291 1.00 84.73  ? 8   GLN A CA  1 
ATOM   58   C C   . GLN A 1 30  ? 75.742  94.681  -16.819 1.00 86.08  ? 8   GLN A C   1 
ATOM   59   O O   . GLN A 1 30  ? 76.237  93.670  -16.306 1.00 86.68  ? 8   GLN A O   1 
ATOM   60   C CB  . GLN A 1 30  ? 76.400  95.367  -19.159 1.00 93.72  ? 8   GLN A CB  1 
ATOM   61   N N   . LYS A 1 31  ? 75.509  95.794  -16.114 1.00 87.08  ? 9   LYS A N   1 
ATOM   62   C CA  . LYS A 1 31  ? 75.854  95.865  -14.692 1.00 83.31  ? 9   LYS A CA  1 
ATOM   63   C C   . LYS A 1 31  ? 75.005  94.903  -13.869 1.00 84.27  ? 9   LYS A C   1 
ATOM   64   O O   . LYS A 1 31  ? 75.527  94.159  -13.033 1.00 84.31  ? 9   LYS A O   1 
ATOM   65   C CB  . LYS A 1 31  ? 75.691  97.298  -14.179 1.00 72.29  ? 9   LYS A CB  1 
ATOM   66   N N   . ALA A 1 32  ? 73.691  94.908  -14.088 1.00 84.55  ? 10  ALA A N   1 
ATOM   67   C CA  . ALA A 1 32  ? 72.825  93.985  -13.369 1.00 74.47  ? 10  ALA A CA  1 
ATOM   68   C C   . ALA A 1 32  ? 73.244  92.540  -13.603 1.00 74.31  ? 10  ALA A C   1 
ATOM   69   O O   . ALA A 1 32  ? 73.255  91.735  -12.665 1.00 77.13  ? 10  ALA A O   1 
ATOM   70   C CB  . ALA A 1 32  ? 71.367  94.201  -13.782 1.00 62.41  ? 10  ALA A CB  1 
ATOM   71   N N   . LYS A 1 33  ? 73.610  92.191  -14.842 1.00 74.41  ? 11  LYS A N   1 
ATOM   72   C CA  . LYS A 1 33  ? 74.027  90.816  -15.106 1.00 71.93  ? 11  LYS A CA  1 
ATOM   73   C C   . LYS A 1 33  ? 75.286  90.473  -14.321 1.00 70.05  ? 11  LYS A C   1 
ATOM   74   O O   . LYS A 1 33  ? 75.480  89.310  -13.948 1.00 71.66  ? 11  LYS A O   1 
ATOM   75   C CB  . LYS A 1 33  ? 74.214  90.581  -16.620 1.00 71.22  ? 11  LYS A CB  1 
ATOM   76   N N   . LEU A 1 34  ? 76.129  91.475  -14.028 1.00 71.98  ? 12  LEU A N   1 
ATOM   77   C CA  . LEU A 1 34  ? 77.347  91.254  -13.242 1.00 83.69  ? 12  LEU A CA  1 
ATOM   78   C C   . LEU A 1 34  ? 77.071  91.276  -11.736 1.00 88.17  ? 12  LEU A C   1 
ATOM   79   O O   . LEU A 1 34  ? 77.573  90.416  -11.003 1.00 91.64  ? 12  LEU A O   1 
ATOM   80   C CB  . LEU A 1 34  ? 78.423  92.288  -13.606 1.00 85.18  ? 12  LEU A CB  1 
ATOM   81   N N   . ALA A 1 35  ? 76.290  92.248  -11.249 1.00 83.95  ? 13  ALA A N   1 
ATOM   82   C CA  . ALA A 1 35  ? 75.868  92.210  -9.852  1.00 79.01  ? 13  ALA A CA  1 
ATOM   83   C C   . ALA A 1 35  ? 75.304  90.844  -9.489  1.00 78.66  ? 13  ALA A C   1 
ATOM   84   O O   . ALA A 1 35  ? 75.564  90.339  -8.390  1.00 75.22  ? 13  ALA A O   1 
ATOM   85   C CB  . ALA A 1 35  ? 74.833  93.300  -9.573  1.00 72.06  ? 13  ALA A CB  1 
ATOM   86   N N   . GLU A 1 36  ? 74.586  90.200  -10.424 1.00 62.08  ? 14  GLU A N   1 
ATOM   87   C CA  . GLU A 1 36  ? 73.987  88.900  -10.124 1.00 72.11  ? 14  GLU A CA  1 
ATOM   88   C C   . GLU A 1 36  ? 75.060  87.847  -9.874  1.00 74.97  ? 14  GLU A C   1 
ATOM   89   O O   . GLU A 1 36  ? 74.921  86.998  -8.975  1.00 62.81  ? 14  GLU A O   1 
ATOM   90   C CB  . GLU A 1 36  ? 73.041  88.449  -11.245 1.00 62.36  ? 14  GLU A CB  1 
ATOM   91   C CG  . GLU A 1 36  ? 72.662  86.960  -11.163 1.00 71.05  ? 14  GLU A CG  1 
ATOM   92   C CD  . GLU A 1 36  ? 71.802  86.486  -12.318 1.00 92.75  ? 14  GLU A CD  1 
ATOM   93   O OE1 . GLU A 1 36  ? 71.933  87.031  -13.447 1.00 98.18  ? 14  GLU A OE1 1 
ATOM   94   O OE2 . GLU A 1 36  ? 71.001  85.546  -12.091 1.00 102.66 ? 14  GLU A OE2 1 
ATOM   95   N N   . GLN A 1 37  ? 76.127  87.869  -10.680 1.00 74.97  ? 15  GLN A N   1 
ATOM   96   C CA  . GLN A 1 37  ? 77.214  86.914  -10.497 1.00 78.58  ? 15  GLN A CA  1 
ATOM   97   C C   . GLN A 1 37  ? 77.973  87.151  -9.199  1.00 79.53  ? 15  GLN A C   1 
ATOM   98   O O   . GLN A 1 37  ? 78.512  86.200  -8.621  1.00 79.52  ? 15  GLN A O   1 
ATOM   99   C CB  . GLN A 1 37  ? 78.160  86.976  -11.681 1.00 81.29  ? 15  GLN A CB  1 
ATOM   100  C CG  . GLN A 1 37  ? 77.464  86.857  -13.006 1.00 92.54  ? 15  GLN A CG  1 
ATOM   101  C CD  . GLN A 1 37  ? 78.447  86.883  -14.144 1.00 113.09 ? 15  GLN A CD  1 
ATOM   102  O OE1 . GLN A 1 37  ? 79.389  86.088  -14.181 1.00 122.00 ? 15  GLN A OE1 1 
ATOM   103  N NE2 . GLN A 1 37  ? 78.252  87.810  -15.075 1.00 116.60 ? 15  GLN A NE2 1 
ATOM   104  N N   . ALA A 1 38  ? 78.031  88.400  -8.733  1.00 82.03  ? 16  ALA A N   1 
ATOM   105  C CA  . ALA A 1 38  ? 78.647  88.726  -7.451  1.00 88.00  ? 16  ALA A CA  1 
ATOM   106  C C   . ALA A 1 38  ? 77.706  88.528  -6.272  1.00 87.61  ? 16  ALA A C   1 
ATOM   107  O O   . ALA A 1 38  ? 78.131  88.737  -5.129  1.00 82.37  ? 16  ALA A O   1 
ATOM   108  C CB  . ALA A 1 38  ? 79.145  90.177  -7.467  1.00 91.87  ? 16  ALA A CB  1 
ATOM   109  N N   . GLU A 1 39  ? 76.477  88.070  -6.531  1.00 84.44  ? 17  GLU A N   1 
ATOM   110  C CA  . GLU A 1 39  ? 75.404  87.958  -5.543  1.00 76.14  ? 17  GLU A CA  1 
ATOM   111  C C   . GLU A 1 39  ? 75.248  89.242  -4.727  1.00 75.88  ? 17  GLU A C   1 
ATOM   112  O O   . GLU A 1 39  ? 75.249  89.243  -3.498  1.00 71.77  ? 17  GLU A O   1 
ATOM   113  C CB  . GLU A 1 39  ? 75.604  86.728  -4.658  1.00 78.29  ? 17  GLU A CB  1 
ATOM   114  C CG  . GLU A 1 39  ? 75.954  85.479  -5.462  1.00 89.40  ? 17  GLU A CG  1 
ATOM   115  C CD  . GLU A 1 39  ? 75.986  84.197  -4.635  1.00 98.07  ? 17  GLU A CD  1 
ATOM   116  O OE1 . GLU A 1 39  ? 75.811  84.262  -3.391  1.00 98.96  ? 17  GLU A OE1 1 
ATOM   117  O OE2 . GLU A 1 39  ? 76.141  83.111  -5.242  1.00 98.74  ? 17  GLU A OE2 1 
ATOM   118  N N   . ARG A 1 40  ? 75.097  90.359  -5.441  1.00 74.01  ? 18  ARG A N   1 
ATOM   119  C CA  . ARG A 1 40  ? 74.716  91.633  -4.840  1.00 69.21  ? 18  ARG A CA  1 
ATOM   120  C C   . ARG A 1 40  ? 73.350  92.032  -5.412  1.00 64.07  ? 18  ARG A C   1 
ATOM   121  O O   . ARG A 1 40  ? 73.245  92.864  -6.309  1.00 70.17  ? 18  ARG A O   1 
ATOM   122  C CB  . ARG A 1 40  ? 75.823  92.732  -5.122  1.00 63.03  ? 18  ARG A CB  1 
ATOM   123  C CG  . ARG A 1 40  ? 77.221  92.331  -4.612  1.00 68.71  ? 18  ARG A CG  1 
ATOM   124  C CD  . ARG A 1 40  ? 78.396  93.320  -4.847  1.00 67.97  ? 18  ARG A CD  1 
ATOM   125  N NE  . ARG A 1 40  ? 78.117  94.697  -4.458  1.00 72.37  ? 18  ARG A NE  1 
ATOM   126  C CZ  . ARG A 1 40  ? 78.554  95.238  -3.323  1.00 84.09  ? 18  ARG A CZ  1 
ATOM   127  N NH1 . ARG A 1 40  ? 79.237  94.493  -2.461  1.00 88.08  ? 18  ARG A NH1 1 
ATOM   128  N NH2 . ARG A 1 40  ? 78.285  96.504  -3.027  1.00 79.58  ? 18  ARG A NH2 1 
ATOM   129  N N   . TYR A 1 41  ? 72.293  91.473  -4.821  1.00 58.06  ? 19  TYR A N   1 
ATOM   130  C CA  . TYR A 1 41  ? 70.955  91.624  -5.378  1.00 59.15  ? 19  TYR A CA  1 
ATOM   131  C C   . TYR A 1 41  ? 70.325  92.989  -5.102  1.00 69.63  ? 19  TYR A C   1 
ATOM   132  O O   . TYR A 1 41  ? 69.337  93.331  -5.753  1.00 80.20  ? 19  TYR A O   1 
ATOM   133  C CB  . TYR A 1 41  ? 70.057  90.496  -4.875  1.00 57.29  ? 19  TYR A CB  1 
ATOM   134  C CG  . TYR A 1 41  ? 70.539  89.150  -5.360  1.00 63.23  ? 19  TYR A CG  1 
ATOM   135  C CD1 . TYR A 1 41  ? 70.317  88.725  -6.670  1.00 71.69  ? 19  TYR A CD1 1 
ATOM   136  C CD2 . TYR A 1 41  ? 71.243  88.314  -4.530  1.00 68.54  ? 19  TYR A CD2 1 
ATOM   137  C CE1 . TYR A 1 41  ? 70.779  87.491  -7.115  1.00 70.88  ? 19  TYR A CE1 1 
ATOM   138  C CE2 . TYR A 1 41  ? 71.712  87.089  -4.963  1.00 73.64  ? 19  TYR A CE2 1 
ATOM   139  C CZ  . TYR A 1 41  ? 71.475  86.680  -6.245  1.00 75.43  ? 19  TYR A CZ  1 
ATOM   140  O OH  . TYR A 1 41  ? 71.948  85.451  -6.631  1.00 87.72  ? 19  TYR A OH  1 
ATOM   141  N N   . ASP A 1 42  ? 70.840  93.779  -4.156  1.00 75.15  ? 20  ASP A N   1 
ATOM   142  C CA  . ASP A 1 42  ? 70.353  95.153  -4.044  1.00 80.40  ? 20  ASP A CA  1 
ATOM   143  C C   . ASP A 1 42  ? 70.891  96.001  -5.191  1.00 82.71  ? 20  ASP A C   1 
ATOM   144  O O   . ASP A 1 42  ? 70.153  96.799  -5.789  1.00 80.75  ? 20  ASP A O   1 
ATOM   145  C CB  . ASP A 1 42  ? 70.742  95.773  -2.693  1.00 89.68  ? 20  ASP A CB  1 
ATOM   146  C CG  . ASP A 1 42  ? 69.909  95.251  -1.501  1.00 104.00 ? 20  ASP A CG  1 
ATOM   147  O OD1 . ASP A 1 42  ? 69.130  94.272  -1.606  1.00 108.94 ? 20  ASP A OD1 1 
ATOM   148  O OD2 . ASP A 1 42  ? 70.046  95.848  -0.416  1.00 109.53 ? 20  ASP A OD2 1 
ATOM   149  N N   . ASP A 1 43  ? 72.177  95.821  -5.519  1.00 83.67  ? 21  ASP A N   1 
ATOM   150  C CA  . ASP A 1 43  ? 72.772  96.470  -6.687  1.00 83.39  ? 21  ASP A CA  1 
ATOM   151  C C   . ASP A 1 43  ? 72.046  96.075  -7.966  1.00 91.80  ? 21  ASP A C   1 
ATOM   152  O O   . ASP A 1 43  ? 71.748  96.922  -8.816  1.00 95.95  ? 21  ASP A O   1 
ATOM   153  C CB  . ASP A 1 43  ? 74.252  96.105  -6.796  1.00 77.35  ? 21  ASP A CB  1 
ATOM   154  C CG  . ASP A 1 43  ? 75.127  96.973  -5.929  1.00 97.78  ? 21  ASP A CG  1 
ATOM   155  O OD1 . ASP A 1 43  ? 74.646  98.051  -5.517  1.00 111.84 ? 21  ASP A OD1 1 
ATOM   156  O OD2 . ASP A 1 43  ? 76.304  96.602  -5.697  1.00 98.15  ? 21  ASP A OD2 1 
ATOM   157  N N   . MET A 1 44  ? 71.792  94.775  -8.136  1.00 86.60  ? 22  MET A N   1 
ATOM   158  C CA  . MET A 1 44  ? 71.141  94.279  -9.341  1.00 75.90  ? 22  MET A CA  1 
ATOM   159  C C   . MET A 1 44  ? 69.707  94.795  -9.459  1.00 77.61  ? 22  MET A C   1 
ATOM   160  O O   . MET A 1 44  ? 69.239  95.088  -10.570 1.00 71.11  ? 22  MET A O   1 
ATOM   161  C CB  . MET A 1 44  ? 71.190  92.751  -9.341  1.00 69.53  ? 22  MET A CB  1 
ATOM   162  C CG  . MET A 1 44  ? 70.267  92.085  -10.325 1.00 71.67  ? 22  MET A CG  1 
ATOM   163  S SD  . MET A 1 44  ? 70.375  90.287  -10.242 1.00 77.40  ? 22  MET A SD  1 
ATOM   164  C CE  . MET A 1 44  ? 69.815  89.919  -11.902 1.00 83.18  ? 22  MET A CE  1 
ATOM   165  N N   . ALA A 1 45  ? 69.006  94.949  -8.330  1.00 70.13  ? 23  ALA A N   1 
ATOM   166  C CA  . ALA A 1 45  ? 67.661  95.507  -8.385  1.00 66.83  ? 23  ALA A CA  1 
ATOM   167  C C   . ALA A 1 45  ? 67.697  96.975  -8.790  1.00 73.26  ? 23  ALA A C   1 
ATOM   168  O O   . ALA A 1 45  ? 66.787  97.461  -9.473  1.00 78.37  ? 23  ALA A O   1 
ATOM   169  C CB  . ALA A 1 45  ? 66.948  95.341  -7.042  1.00 67.16  ? 23  ALA A CB  1 
ATOM   170  N N   . ALA A 1 46  ? 68.704  97.717  -8.332  1.00 73.11  ? 24  ALA A N   1 
ATOM   171  C CA  . ALA A 1 46  ? 68.728  99.128  -8.682  1.00 80.98  ? 24  ALA A CA  1 
ATOM   172  C C   . ALA A 1 46  ? 68.955  99.353  -10.183 1.00 92.83  ? 24  ALA A C   1 
ATOM   173  O O   . ALA A 1 46  ? 68.365  100.284 -10.750 1.00 96.68  ? 24  ALA A O   1 
ATOM   174  C CB  . ALA A 1 46  ? 69.765  99.845  -7.820  1.00 62.34  ? 24  ALA A CB  1 
ATOM   175  N N   . CYS A 1 47  ? 69.770  98.516  -10.854 1.00 95.31  ? 25  CYS A N   1 
ATOM   176  C CA  . CYS A 1 47  ? 69.919  98.616  -12.311 1.00 96.34  ? 25  CYS A CA  1 
ATOM   177  C C   . CYS A 1 47  ? 68.609  98.332  -13.030 1.00 93.72  ? 25  CYS A C   1 
ATOM   178  O O   . CYS A 1 47  ? 68.172  99.109  -13.881 1.00 92.65  ? 25  CYS A O   1 
ATOM   179  C CB  . CYS A 1 47  ? 70.991  97.666  -12.844 1.00 94.70  ? 25  CYS A CB  1 
ATOM   180  S SG  . CYS A 1 47  ? 72.632  97.930  -12.211 1.00 107.82 ? 25  CYS A SG  1 
ATOM   181  N N   . MET A 1 48  ? 68.011  97.172  -12.747 1.00 90.59  ? 26  MET A N   1 
ATOM   182  C CA  . MET A 1 48  ? 66.812  96.794  -13.476 1.00 84.69  ? 26  MET A CA  1 
ATOM   183  C C   . MET A 1 48  ? 65.622  97.680  -13.139 1.00 85.79  ? 26  MET A C   1 
ATOM   184  O O   . MET A 1 48  ? 64.661  97.708  -13.912 1.00 98.53  ? 26  MET A O   1 
ATOM   185  C CB  . MET A 1 48  ? 66.471  95.325  -13.229 1.00 81.25  ? 26  MET A CB  1 
ATOM   186  C CG  . MET A 1 48  ? 67.561  94.392  -13.717 1.00 88.36  ? 26  MET A CG  1 
ATOM   187  S SD  . MET A 1 48  ? 68.240  94.807  -15.356 1.00 92.52  ? 26  MET A SD  1 
ATOM   188  C CE  . MET A 1 48  ? 66.782  94.740  -16.408 1.00 95.51  ? 26  MET A CE  1 
ATOM   189  N N   . LYS A 1 49  ? 65.649  98.416  -12.029 1.00 76.34  ? 27  LYS A N   1 
ATOM   190  C CA  . LYS A 1 49  ? 64.605  99.419  -11.857 1.00 75.21  ? 27  LYS A CA  1 
ATOM   191  C C   . LYS A 1 49  ? 64.864  100.619 -12.759 1.00 85.70  ? 27  LYS A C   1 
ATOM   192  O O   . LYS A 1 49  ? 63.926  101.153 -13.359 1.00 93.81  ? 27  LYS A O   1 
ATOM   193  C CB  . LYS A 1 49  ? 64.476  99.847  -10.389 1.00 69.89  ? 27  LYS A CB  1 
ATOM   194  C CG  . LYS A 1 49  ? 63.419  100.931 -10.163 1.00 59.69  ? 27  LYS A CG  1 
ATOM   195  C CD  . LYS A 1 49  ? 63.316  101.314 -8.706  1.00 79.56  ? 27  LYS A CD  1 
ATOM   196  C CE  . LYS A 1 49  ? 62.317  102.438 -8.496  1.00 74.98  ? 27  LYS A CE  1 
ATOM   197  N NZ  . LYS A 1 49  ? 62.533  103.147 -7.196  1.00 68.45  ? 27  LYS A NZ  1 
ATOM   198  N N   . SER A 1 50  ? 66.134  101.017 -12.921 1.00 82.34  ? 28  SER A N   1 
ATOM   199  C CA  . SER A 1 50  ? 66.465  102.132 -13.809 1.00 83.46  ? 28  SER A CA  1 
ATOM   200  C C   . SER A 1 50  ? 66.210  101.784 -15.273 1.00 87.44  ? 28  SER A C   1 
ATOM   201  O O   . SER A 1 50  ? 65.796  102.643 -16.061 1.00 90.46  ? 28  SER A O   1 
ATOM   202  C CB  . SER A 1 50  ? 67.916  102.550 -13.611 1.00 81.69  ? 28  SER A CB  1 
ATOM   203  O OG  . SER A 1 50  ? 68.019  103.396 -12.491 1.00 87.78  ? 28  SER A OG  1 
ATOM   204  N N   . VAL A 1 51  ? 66.478  100.535 -15.654 1.00 83.56  ? 29  VAL A N   1 
ATOM   205  C CA  . VAL A 1 51  ? 66.105  100.058 -16.978 1.00 81.79  ? 29  VAL A CA  1 
ATOM   206  C C   . VAL A 1 51  ? 64.602  100.168 -17.192 1.00 91.86  ? 29  VAL A C   1 
ATOM   207  O O   . VAL A 1 51  ? 64.146  100.623 -18.249 1.00 102.43 ? 29  VAL A O   1 
ATOM   208  C CB  . VAL A 1 51  ? 66.600  98.615  -17.157 1.00 73.92  ? 29  VAL A CB  1 
ATOM   209  C CG1 . VAL A 1 51  ? 65.848  97.927  -18.263 1.00 66.27  ? 29  VAL A CG1 1 
ATOM   210  C CG2 . VAL A 1 51  ? 68.067  98.632  -17.486 1.00 77.62  ? 29  VAL A CG2 1 
ATOM   211  N N   . THR A 1 52  ? 63.807  99.771  -16.192 1.00 93.89  ? 30  THR A N   1 
ATOM   212  C CA  . THR A 1 52  ? 62.350  99.767  -16.346 1.00 93.89  ? 30  THR A CA  1 
ATOM   213  C C   . THR A 1 52  ? 61.784  101.182 -16.426 1.00 98.43  ? 30  THR A C   1 
ATOM   214  O O   . THR A 1 52  ? 61.020  101.496 -17.346 1.00 104.82 ? 30  THR A O   1 
ATOM   215  C CB  . THR A 1 52  ? 61.683  98.995  -15.191 1.00 87.87  ? 30  THR A CB  1 
ATOM   216  O OG1 . THR A 1 52  ? 61.969  97.596  -15.296 1.00 83.55  ? 30  THR A OG1 1 
ATOM   217  C CG2 . THR A 1 52  ? 60.166  99.187  -15.193 1.00 86.33  ? 30  THR A CG2 1 
ATOM   218  N N   . GLU A 1 53  ? 62.226  102.058 -15.586 1.00 101.60 ? 31  GLU A N   1 
ATOM   219  C CA  . GLU A 1 53  ? 61.700  103.392 -15.560 1.00 107.55 ? 31  GLU A CA  1 
ATOM   220  C C   . GLU A 1 53  ? 61.862  104.178 -16.804 1.00 104.36 ? 31  GLU A C   1 
ATOM   221  O O   . GLU A 1 53  ? 61.357  105.250 -16.943 1.00 101.39 ? 31  GLU A O   1 
ATOM   222  C CB  . GLU A 1 53  ? 62.445  104.140 -14.508 1.00 112.74 ? 31  GLU A CB  1 
ATOM   223  C CG  . GLU A 1 53  ? 61.876  103.957 -13.141 1.00 116.53 ? 31  GLU A CG  1 
ATOM   224  C CD  . GLU A 1 53  ? 62.845  104.360 -12.092 1.00 124.02 ? 31  GLU A CD  1 
ATOM   225  O OE1 . GLU A 1 53  ? 62.469  105.114 -11.215 1.00 127.19 ? 31  GLU A OE1 1 
ATOM   226  O OE2 . GLU A 1 53  ? 63.981  103.925 -12.149 1.00 124.89 ? 31  GLU A OE2 1 
ATOM   227  N N   . GLN A 1 54  ? 62.640  103.650 -17.686 1.00 99.31  ? 32  GLN A N   1 
ATOM   228  C CA  . GLN A 1 54  ? 62.987  104.267 -18.956 1.00 99.99  ? 32  GLN A CA  1 
ATOM   229  C C   . GLN A 1 54  ? 61.864  104.166 -19.981 1.00 112.27 ? 32  GLN A C   1 
ATOM   230  O O   . GLN A 1 54  ? 62.080  104.510 -21.151 1.00 123.43 ? 32  GLN A O   1 
ATOM   231  C CB  . GLN A 1 54  ? 64.273  103.643 -19.498 1.00 92.16  ? 32  GLN A CB  1 
ATOM   232  C CG  . GLN A 1 54  ? 65.513  104.252 -18.865 1.00 96.80  ? 32  GLN A CG  1 
ATOM   233  C CD  . GLN A 1 54  ? 66.799  103.811 -19.531 1.00 105.56 ? 32  GLN A CD  1 
ATOM   234  O OE1 . GLN A 1 54  ? 66.786  103.015 -20.468 1.00 109.19 ? 32  GLN A OE1 1 
ATOM   235  N NE2 . GLN A 1 54  ? 67.919  104.353 -19.066 1.00 109.71 ? 32  GLN A NE2 1 
ATOM   236  N N   . GLY A 1 55  ? 60.694  103.762 -19.551 1.00 113.48 ? 33  GLY A N   1 
ATOM   237  C CA  . GLY A 1 55  ? 59.570  103.667 -20.451 1.00 112.70 ? 33  GLY A CA  1 
ATOM   238  C C   . GLY A 1 55  ? 59.569  102.396 -21.206 1.00 113.76 ? 33  GLY A C   1 
ATOM   239  O O   . GLY A 1 55  ? 58.554  101.839 -21.438 1.00 114.87 ? 33  GLY A O   1 
ATOM   240  N N   . ALA A 1 56  ? 60.750  101.986 -21.565 1.00 116.52 ? 34  ALA A N   1 
ATOM   241  C CA  . ALA A 1 56  ? 61.066  100.786 -22.282 1.00 119.52 ? 34  ALA A CA  1 
ATOM   242  C C   . ALA A 1 56  ? 60.009  99.892  -22.864 1.00 120.60 ? 34  ALA A C   1 
ATOM   243  O O   . ALA A 1 56  ? 59.447  100.268 -23.858 1.00 125.14 ? 34  ALA A O   1 
ATOM   244  C CB  . ALA A 1 56  ? 62.088  99.985  -21.503 1.00 111.93 ? 34  ALA A CB  1 
ATOM   245  N N   . GLU A 1 57  ? 59.828  98.746  -22.215 1.00 109.92 ? 35  GLU A N   1 
ATOM   246  C CA  . GLU A 1 57  ? 59.030  97.526  -22.406 1.00 106.80 ? 35  GLU A CA  1 
ATOM   247  C C   . GLU A 1 57  ? 60.183  96.597  -22.487 1.00 99.25  ? 35  GLU A C   1 
ATOM   248  O O   . GLU A 1 57  ? 60.949  96.640  -23.408 1.00 89.42  ? 35  GLU A O   1 
ATOM   249  C CB  . GLU A 1 57  ? 58.154  97.385  -23.615 1.00 114.37 ? 35  GLU A CB  1 
ATOM   250  C CG  . GLU A 1 57  ? 57.762  95.968  -23.886 1.00 121.40 ? 35  GLU A CG  1 
ATOM   251  C CD  . GLU A 1 57  ? 56.288  95.761  -23.847 1.00 125.47 ? 35  GLU A CD  1 
ATOM   252  O OE1 . GLU A 1 57  ? 55.539  96.660  -23.462 1.00 127.89 ? 35  GLU A OE1 1 
ATOM   253  O OE2 . GLU A 1 57  ? 55.878  94.668  -24.201 1.00 131.69 ? 35  GLU A OE2 1 
ATOM   254  N N   . LEU A 1 58  ? 60.284  95.710  -21.527 1.00 100.02 ? 36  LEU A N   1 
ATOM   255  C CA  . LEU A 1 58  ? 61.489  94.938  -21.402 1.00 96.63  ? 36  LEU A CA  1 
ATOM   256  C C   . LEU A 1 58  ? 61.716  93.691  -22.111 1.00 91.21  ? 36  LEU A C   1 
ATOM   257  O O   . LEU A 1 58  ? 60.856  92.947  -22.324 1.00 90.25  ? 36  LEU A O   1 
ATOM   258  C CB  . LEU A 1 58  ? 61.838  94.722  -19.946 1.00 83.82  ? 36  LEU A CB  1 
ATOM   259  C CG  . LEU A 1 58  ? 61.356  95.627  -18.852 1.00 70.93  ? 36  LEU A CG  1 
ATOM   260  C CD1 . LEU A 1 58  ? 61.866  94.986  -17.636 1.00 80.64  ? 36  LEU A CD1 1 
ATOM   261  C CD2 . LEU A 1 58  ? 61.960  96.976  -18.892 1.00 65.24  ? 36  LEU A CD2 1 
ATOM   262  N N   . SER A 1 59  ? 62.959  93.438  -22.401 1.00 89.46  ? 37  SER A N   1 
ATOM   263  C CA  . SER A 1 59  ? 63.244  92.206  -23.135 1.00 91.78  ? 37  SER A CA  1 
ATOM   264  C C   . SER A 1 59  ? 62.769  91.014  -22.322 1.00 96.93  ? 37  SER A C   1 
ATOM   265  O O   . SER A 1 59  ? 62.334  91.179  -21.177 1.00 101.73 ? 37  SER A O   1 
ATOM   266  C CB  . SER A 1 59  ? 64.734  92.065  -23.436 1.00 96.95  ? 37  SER A CB  1 
ATOM   267  O OG  . SER A 1 59  ? 65.287  93.311  -23.777 1.00 111.47 ? 37  SER A OG  1 
ATOM   268  N N   . ASN A 1 60  ? 62.849  89.810  -22.873 1.00 100.43 ? 38  ASN A N   1 
ATOM   269  C CA  . ASN A 1 60  ? 62.530  88.669  -22.030 1.00 97.05  ? 38  ASN A CA  1 
ATOM   270  C C   . ASN A 1 60  ? 63.701  88.217  -21.159 1.00 104.03 ? 38  ASN A C   1 
ATOM   271  O O   . ASN A 1 60  ? 63.465  87.593  -20.113 1.00 101.80 ? 38  ASN A O   1 
ATOM   272  C CB  . ASN A 1 60  ? 61.975  87.534  -22.898 1.00 89.44  ? 38  ASN A CB  1 
ATOM   273  C CG  . ASN A 1 60  ? 60.522  87.792  -23.311 1.00 113.57 ? 38  ASN A CG  1 
ATOM   274  O OD1 . ASN A 1 60  ? 59.802  88.532  -22.626 1.00 120.51 ? 38  ASN A OD1 1 
ATOM   275  N ND2 . ASN A 1 60  ? 60.104  87.244  -24.457 1.00 122.15 ? 38  ASN A ND2 1 
ATOM   276  N N   . GLU A 1 61  ? 64.931  88.640  -21.472 1.00 102.25 ? 39  GLU A N   1 
ATOM   277  C CA  . GLU A 1 61  ? 66.022  88.495  -20.511 1.00 94.84  ? 39  GLU A CA  1 
ATOM   278  C C   . GLU A 1 61  ? 66.012  89.624  -19.490 1.00 88.75  ? 39  GLU A C   1 
ATOM   279  O O   . GLU A 1 61  ? 66.346  89.401  -18.323 1.00 85.61  ? 39  GLU A O   1 
ATOM   280  C CB  . GLU A 1 61  ? 67.378  88.434  -21.230 1.00 99.83  ? 39  GLU A CB  1 
ATOM   281  C CG  . GLU A 1 61  ? 68.130  89.769  -21.328 1.00 104.69 ? 39  GLU A CG  1 
ATOM   282  C CD  . GLU A 1 61  ? 69.608  89.614  -21.631 1.00 113.42 ? 39  GLU A CD  1 
ATOM   283  O OE1 . GLU A 1 61  ? 70.102  90.272  -22.580 1.00 126.68 ? 39  GLU A OE1 1 
ATOM   284  O OE2 . GLU A 1 61  ? 70.277  88.850  -20.909 1.00 106.56 ? 39  GLU A OE2 1 
ATOM   285  N N   . GLU A 1 62  ? 65.599  90.829  -19.898 1.00 90.50  ? 40  GLU A N   1 
ATOM   286  C CA  . GLU A 1 62  ? 65.543  91.940  -18.958 1.00 93.62  ? 40  GLU A CA  1 
ATOM   287  C C   . GLU A 1 62  ? 64.413  91.750  -17.953 1.00 83.15  ? 40  GLU A C   1 
ATOM   288  O O   . GLU A 1 62  ? 64.515  92.193  -16.806 1.00 79.40  ? 40  GLU A O   1 
ATOM   289  C CB  . GLU A 1 62  ? 65.383  93.257  -19.732 1.00 96.78  ? 40  GLU A CB  1 
ATOM   290  N N   . ARG A 1 63  ? 63.362  91.043  -18.348 1.00 85.80  ? 41  ARG A N   1 
ATOM   291  C CA  . ARG A 1 63  ? 62.326  90.652  -17.407 1.00 81.72  ? 41  ARG A CA  1 
ATOM   292  C C   . ARG A 1 63  ? 62.884  89.668  -16.389 1.00 82.85  ? 41  ARG A C   1 
ATOM   293  O O   . ARG A 1 63  ? 62.631  89.779  -15.184 1.00 74.06  ? 41  ARG A O   1 
ATOM   294  C CB  . ARG A 1 63  ? 61.172  90.020  -18.172 1.00 84.77  ? 41  ARG A CB  1 
ATOM   295  C CG  . ARG A 1 63  ? 59.916  89.839  -17.387 1.00 75.20  ? 41  ARG A CG  1 
ATOM   296  C CD  . ARG A 1 63  ? 58.890  89.158  -18.260 1.00 80.01  ? 41  ARG A CD  1 
ATOM   297  N NE  . ARG A 1 63  ? 59.267  87.769  -18.514 1.00 84.96  ? 41  ARG A NE  1 
ATOM   298  C CZ  . ARG A 1 63  ? 58.836  87.040  -19.539 1.00 98.75  ? 41  ARG A CZ  1 
ATOM   299  N NH1 . ARG A 1 63  ? 57.991  87.556  -20.439 1.00 100.48 ? 41  ARG A NH1 1 
ATOM   300  N NH2 . ARG A 1 63  ? 59.246  85.782  -19.649 1.00 98.95  ? 41  ARG A NH2 1 
ATOM   301  N N   . ASN A 1 64  ? 63.642  88.681  -16.873 1.00 94.46  ? 42  ASN A N   1 
ATOM   302  C CA  . ASN A 1 64  ? 64.179  87.643  -16.002 1.00 91.65  ? 42  ASN A CA  1 
ATOM   303  C C   . ASN A 1 64  ? 65.132  88.232  -14.972 1.00 88.07  ? 42  ASN A C   1 
ATOM   304  O O   . ASN A 1 64  ? 65.044  87.908  -13.785 1.00 97.39  ? 42  ASN A O   1 
ATOM   305  C CB  . ASN A 1 64  ? 64.878  86.587  -16.854 1.00 101.54 ? 42  ASN A CB  1 
ATOM   306  C CG  . ASN A 1 64  ? 65.028  85.268  -16.149 1.00 110.17 ? 42  ASN A CG  1 
ATOM   307  O OD1 . ASN A 1 64  ? 65.633  85.186  -15.081 1.00 117.49 ? 42  ASN A OD1 1 
ATOM   308  N ND2 . ASN A 1 64  ? 64.485  84.211  -16.754 1.00 112.86 ? 42  ASN A ND2 1 
ATOM   309  N N   . LEU A 1 65  ? 66.009  89.144  -15.392 1.00 81.37  ? 43  LEU A N   1 
ATOM   310  C CA  . LEU A 1 65  ? 66.964  89.738  -14.463 1.00 76.21  ? 43  LEU A CA  1 
ATOM   311  C C   . LEU A 1 65  ? 66.252  90.552  -13.389 1.00 86.22  ? 43  LEU A C   1 
ATOM   312  O O   . LEU A 1 65  ? 66.682  90.575  -12.227 1.00 93.29  ? 43  LEU A O   1 
ATOM   313  C CB  . LEU A 1 65  ? 67.956  90.605  -15.224 1.00 77.47  ? 43  LEU A CB  1 
ATOM   314  C CG  . LEU A 1 65  ? 68.879  89.828  -16.165 1.00 89.98  ? 43  LEU A CG  1 
ATOM   315  C CD1 . LEU A 1 65  ? 69.506  90.771  -17.160 1.00 80.13  ? 43  LEU A CD1 1 
ATOM   316  C CD2 . LEU A 1 65  ? 69.944  89.055  -15.392 1.00 100.60 ? 43  LEU A CD2 1 
ATOM   317  N N   . LEU A 1 66  ? 65.137  91.186  -13.743 1.00 80.99  ? 44  LEU A N   1 
ATOM   318  C CA  . LEU A 1 66  ? 64.453  92.011  -12.764 1.00 80.36  ? 44  LEU A CA  1 
ATOM   319  C C   . LEU A 1 66  ? 63.656  91.146  -11.800 1.00 85.48  ? 44  LEU A C   1 
ATOM   320  O O   . LEU A 1 66  ? 63.521  91.488  -10.619 1.00 79.95  ? 44  LEU A O   1 
ATOM   321  C CB  . LEU A 1 66  ? 63.509  92.976  -13.482 1.00 77.06  ? 44  LEU A CB  1 
ATOM   322  C CG  . LEU A 1 66  ? 62.407  93.654  -12.670 1.00 70.84  ? 44  LEU A CG  1 
ATOM   323  C CD1 . LEU A 1 66  ? 63.077  94.605  -11.699 1.00 78.41  ? 44  LEU A CD1 1 
ATOM   324  C CD2 . LEU A 1 66  ? 61.406  94.384  -13.528 1.00 67.18  ? 44  LEU A CD2 1 
ATOM   325  N N   . SER A 1 67  ? 63.182  89.994  -12.268 1.00 89.80  ? 45  SER A N   1 
ATOM   326  C CA  . SER A 1 67  ? 62.574  89.014  -11.380 1.00 75.52  ? 45  SER A CA  1 
ATOM   327  C C   . SER A 1 67  ? 63.559  88.505  -10.341 1.00 66.87  ? 45  SER A C   1 
ATOM   328  O O   . SER A 1 67  ? 63.295  88.613  -9.146  1.00 75.59  ? 45  SER A O   1 
ATOM   329  C CB  . SER A 1 67  ? 62.006  87.864  -12.193 1.00 75.79  ? 45  SER A CB  1 
ATOM   330  O OG  . SER A 1 67  ? 60.964  88.370  -13.003 1.00 86.06  ? 45  SER A OG  1 
ATOM   331  N N   . VAL A 1 68  ? 64.701  87.940  -10.779 1.00 64.18  ? 46  VAL A N   1 
ATOM   332  C CA  . VAL A 1 68  ? 65.613  87.310  -9.816  1.00 60.87  ? 46  VAL A CA  1 
ATOM   333  C C   . VAL A 1 68  ? 66.086  88.342  -8.799  1.00 64.20  ? 46  VAL A C   1 
ATOM   334  O O   . VAL A 1 68  ? 66.194  88.044  -7.603  1.00 67.57  ? 46  VAL A O   1 
ATOM   335  C CB  . VAL A 1 68  ? 66.817  86.592  -10.500 1.00 61.22  ? 46  VAL A CB  1 
ATOM   336  C CG1 . VAL A 1 68  ? 66.424  85.773  -11.708 1.00 60.66  ? 46  VAL A CG1 1 
ATOM   337  C CG2 . VAL A 1 68  ? 68.028  87.478  -10.740 1.00 61.32  ? 46  VAL A CG2 1 
ATOM   338  N N   . ALA A 1 69  ? 66.333  89.581  -9.245  1.00 59.30  ? 47  ALA A N   1 
ATOM   339  C CA  . ALA A 1 69  ? 66.780  90.656  -8.369  1.00 57.31  ? 47  ALA A CA  1 
ATOM   340  C C   . ALA A 1 69  ? 65.798  90.838  -7.228  1.00 66.51  ? 47  ALA A C   1 
ATOM   341  O O   . ALA A 1 69  ? 66.123  90.559  -6.066  1.00 68.14  ? 47  ALA A O   1 
ATOM   342  C CB  . ALA A 1 69  ? 66.912  91.975  -9.129  1.00 59.75  ? 47  ALA A CB  1 
ATOM   343  N N   . TYR A 1 70  ? 64.584  91.294  -7.552  1.00 66.80  ? 48  TYR A N   1 
ATOM   344  C CA  . TYR A 1 70  ? 63.652  91.620  -6.488  1.00 63.96  ? 48  TYR A CA  1 
ATOM   345  C C   . TYR A 1 70  ? 63.213  90.374  -5.742  1.00 63.91  ? 48  TYR A C   1 
ATOM   346  O O   . TYR A 1 70  ? 62.931  90.453  -4.545  1.00 67.31  ? 48  TYR A O   1 
ATOM   347  C CB  . TYR A 1 70  ? 62.464  92.393  -7.035  1.00 53.92  ? 48  TYR A CB  1 
ATOM   348  C CG  . TYR A 1 70  ? 62.710  93.892  -7.103  1.00 55.94  ? 48  TYR A CG  1 
ATOM   349  C CD1 . TYR A 1 70  ? 62.701  94.660  -5.949  1.00 55.62  ? 48  TYR A CD1 1 
ATOM   350  C CD2 . TYR A 1 70  ? 62.904  94.543  -8.310  1.00 58.52  ? 48  TYR A CD2 1 
ATOM   351  C CE1 . TYR A 1 70  ? 62.906  96.029  -5.985  1.00 59.24  ? 48  TYR A CE1 1 
ATOM   352  C CE2 . TYR A 1 70  ? 63.101  95.926  -8.359  1.00 60.82  ? 48  TYR A CE2 1 
ATOM   353  C CZ  . TYR A 1 70  ? 63.104  96.657  -7.185  1.00 66.41  ? 48  TYR A CZ  1 
ATOM   354  O OH  . TYR A 1 70  ? 63.300  98.020  -7.186  1.00 77.69  ? 48  TYR A OH  1 
ATOM   355  N N   . LYS A 1 71  ? 63.225  89.209  -6.397  1.00 62.41  ? 49  LYS A N   1 
ATOM   356  C CA  . LYS A 1 71  ? 62.883  87.976  -5.691  1.00 60.82  ? 49  LYS A CA  1 
ATOM   357  C C   . LYS A 1 71  ? 63.886  87.704  -4.580  1.00 68.76  ? 49  LYS A C   1 
ATOM   358  O O   . LYS A 1 71  ? 63.505  87.479  -3.424  1.00 67.32  ? 49  LYS A O   1 
ATOM   359  C CB  . LYS A 1 71  ? 62.846  86.788  -6.657  1.00 58.83  ? 49  LYS A CB  1 
ATOM   360  C CG  . LYS A 1 71  ? 62.834  85.416  -5.983  1.00 63.42  ? 49  LYS A CG  1 
ATOM   361  C CD  . LYS A 1 71  ? 61.395  85.008  -5.598  1.00 81.56  ? 49  LYS A CD  1 
ATOM   362  C CE  . LYS A 1 71  ? 61.317  83.582  -5.058  1.00 87.14  ? 49  LYS A CE  1 
ATOM   363  N NZ  . LYS A 1 71  ? 60.164  82.785  -5.537  1.00 88.91  ? 49  LYS A NZ  1 
ATOM   364  N N   . ASN A 1 72  ? 65.176  87.811  -4.903  1.00 71.56  ? 50  ASN A N   1 
ATOM   365  C CA  . ASN A 1 72  ? 66.223  87.660  -3.897  1.00 65.07  ? 50  ASN A CA  1 
ATOM   366  C C   . ASN A 1 72  ? 66.179  88.773  -2.849  1.00 60.65  ? 50  ASN A C   1 
ATOM   367  O O   . ASN A 1 72  ? 66.339  88.510  -1.651  1.00 56.47  ? 50  ASN A O   1 
ATOM   368  C CB  . ASN A 1 72  ? 67.576  87.591  -4.598  1.00 51.68  ? 50  ASN A CB  1 
ATOM   369  C CG  . ASN A 1 72  ? 67.860  86.208  -5.128  1.00 64.27  ? 50  ASN A CG  1 
ATOM   370  O OD1 . ASN A 1 72  ? 68.334  85.348  -4.394  1.00 67.43  ? 50  ASN A OD1 1 
ATOM   371  N ND2 . ASN A 1 72  ? 67.547  85.970  -6.401  1.00 66.78  ? 50  ASN A ND2 1 
ATOM   372  N N   . VAL A 1 73  ? 65.937  90.013  -3.264  1.00 58.53  ? 51  VAL A N   1 
ATOM   373  C CA  . VAL A 1 73  ? 65.867  91.128  -2.325  1.00 56.72  ? 51  VAL A CA  1 
ATOM   374  C C   . VAL A 1 73  ? 64.723  90.927  -1.318  1.00 67.03  ? 51  VAL A C   1 
ATOM   375  O O   . VAL A 1 73  ? 64.932  90.939  -0.100  1.00 69.60  ? 51  VAL A O   1 
ATOM   376  C CB  . VAL A 1 73  ? 65.714  92.445  -3.100  1.00 55.02  ? 51  VAL A CB  1 
ATOM   377  C CG1 . VAL A 1 73  ? 65.372  93.585  -2.176  1.00 52.97  ? 51  VAL A CG1 1 
ATOM   378  C CG2 . VAL A 1 73  ? 66.992  92.743  -3.855  1.00 60.06  ? 51  VAL A CG2 1 
ATOM   379  N N   . VAL A 1 74  ? 63.493  90.792  -1.819  1.00 66.93  ? 52  VAL A N   1 
ATOM   380  C CA  . VAL A 1 74  ? 62.353  90.571  -0.928  1.00 56.01  ? 52  VAL A CA  1 
ATOM   381  C C   . VAL A 1 74  ? 62.512  89.241  -0.203  1.00 53.11  ? 52  VAL A C   1 
ATOM   382  O O   . VAL A 1 74  ? 62.164  89.119  0.973   1.00 56.61  ? 52  VAL A O   1 
ATOM   383  C CB  . VAL A 1 74  ? 60.999  90.682  -1.692  1.00 48.95  ? 52  VAL A CB  1 
ATOM   384  C CG1 . VAL A 1 74  ? 60.551  89.374  -2.392  1.00 49.06  ? 52  VAL A CG1 1 
ATOM   385  C CG2 . VAL A 1 74  ? 59.902  91.223  -0.792  1.00 52.53  ? 52  VAL A CG2 1 
ATOM   386  N N   . GLY A 1 75  ? 62.971  88.203  -0.906  1.00 57.76  ? 53  GLY A N   1 
ATOM   387  C CA  . GLY A 1 75  ? 63.007  86.883  -0.302  1.00 67.75  ? 53  GLY A CA  1 
ATOM   388  C C   . GLY A 1 75  ? 63.866  86.813  0.948   1.00 71.18  ? 53  GLY A C   1 
ATOM   389  O O   . GLY A 1 75  ? 63.599  86.008  1.844   1.00 70.24  ? 53  GLY A O   1 
ATOM   390  N N   . ALA A 1 76  ? 64.907  87.649  1.019   1.00 68.20  ? 54  ALA A N   1 
ATOM   391  C CA  . ALA A 1 76  ? 65.732  87.725  2.219   1.00 52.44  ? 54  ALA A CA  1 
ATOM   392  C C   . ALA A 1 76  ? 64.935  88.299  3.387   1.00 57.19  ? 54  ALA A C   1 
ATOM   393  O O   . ALA A 1 76  ? 64.880  87.700  4.465   1.00 70.84  ? 54  ALA A O   1 
ATOM   394  C CB  . ALA A 1 76  ? 66.985  88.551  1.932   1.00 46.12  ? 54  ALA A CB  1 
ATOM   395  N N   . ARG A 1 77  ? 64.280  89.437  3.173   1.00 49.41  ? 55  ARG A N   1 
ATOM   396  C CA  . ARG A 1 77  ? 63.404  89.998  4.203   1.00 54.44  ? 55  ARG A CA  1 
ATOM   397  C C   . ARG A 1 77  ? 62.280  89.033  4.580   1.00 63.57  ? 55  ARG A C   1 
ATOM   398  O O   . ARG A 1 77  ? 61.827  89.008  5.733   1.00 63.53  ? 55  ARG A O   1 
ATOM   399  C CB  . ARG A 1 77  ? 62.809  91.320  3.738   1.00 49.62  ? 55  ARG A CB  1 
ATOM   400  C CG  . ARG A 1 77  ? 63.695  92.497  3.975   1.00 54.68  ? 55  ARG A CG  1 
ATOM   401  C CD  . ARG A 1 77  ? 64.815  92.541  2.991   1.00 61.81  ? 55  ARG A CD  1 
ATOM   402  N NE  . ARG A 1 77  ? 65.583  93.753  3.215   1.00 76.26  ? 55  ARG A NE  1 
ATOM   403  C CZ  . ARG A 1 77  ? 66.541  94.182  2.405   1.00 83.99  ? 55  ARG A CZ  1 
ATOM   404  N NH1 . ARG A 1 77  ? 66.844  93.487  1.311   1.00 76.79  ? 55  ARG A NH1 1 
ATOM   405  N NH2 . ARG A 1 77  ? 67.182  95.312  2.690   1.00 92.98  ? 55  ARG A NH2 1 
ATOM   406  N N   . ARG A 1 78  ? 61.759  88.266  3.616   1.00 62.25  ? 56  ARG A N   1 
ATOM   407  C CA  . ARG A 1 78  ? 60.771  87.249  3.953   1.00 49.88  ? 56  ARG A CA  1 
ATOM   408  C C   . ARG A 1 78  ? 61.347  86.231  4.912   1.00 44.59  ? 56  ARG A C   1 
ATOM   409  O O   . ARG A 1 78  ? 60.748  85.927  5.944   1.00 55.71  ? 56  ARG A O   1 
ATOM   410  C CB  . ARG A 1 78  ? 60.232  86.504  2.708   1.00 53.97  ? 56  ARG A CB  1 
ATOM   411  C CG  . ARG A 1 78  ? 59.471  87.352  1.692   1.00 48.73  ? 56  ARG A CG  1 
ATOM   412  C CD  . ARG A 1 78  ? 58.247  86.630  1.031   1.00 44.80  ? 56  ARG A CD  1 
ATOM   413  N NE  . ARG A 1 78  ? 58.545  85.550  0.072   1.00 56.07  ? 56  ARG A NE  1 
ATOM   414  C CZ  . ARG A 1 78  ? 57.864  84.401  -0.042  1.00 59.16  ? 56  ARG A CZ  1 
ATOM   415  N NH1 . ARG A 1 78  ? 58.235  83.501  -0.935  1.00 65.86  ? 56  ARG A NH1 1 
ATOM   416  N NH2 . ARG A 1 78  ? 56.784  84.162  0.692   1.00 58.94  ? 56  ARG A NH2 1 
ATOM   417  N N   . SER A 1 79  ? 62.584  85.799  4.656   1.00 54.16  ? 57  SER A N   1 
ATOM   418  C CA  . SER A 1 79  ? 63.149  84.734  5.474   1.00 54.66  ? 57  SER A CA  1 
ATOM   419  C C   . SER A 1 79  ? 63.474  85.236  6.885   1.00 60.56  ? 57  SER A C   1 
ATOM   420  O O   . SER A 1 79  ? 63.161  84.568  7.879   1.00 55.09  ? 57  SER A O   1 
ATOM   421  C CB  . SER A 1 79  ? 64.375  84.179  4.773   1.00 46.68  ? 57  SER A CB  1 
ATOM   422  O OG  . SER A 1 79  ? 65.066  83.278  5.619   1.00 66.18  ? 57  SER A OG  1 
ATOM   423  N N   . SER A 1 80  ? 64.046  86.439  6.984   1.00 56.74  ? 58  SER A N   1 
ATOM   424  C CA  . SER A 1 80  ? 64.273  87.070  8.279   1.00 54.07  ? 58  SER A CA  1 
ATOM   425  C C   . SER A 1 80  ? 62.972  87.221  9.042   1.00 61.40  ? 58  SER A C   1 
ATOM   426  O O   . SER A 1 80  ? 62.906  86.958  10.244  1.00 66.65  ? 58  SER A O   1 
ATOM   427  C CB  . SER A 1 80  ? 64.914  88.449  8.094   1.00 64.79  ? 58  SER A CB  1 
ATOM   428  O OG  . SER A 1 80  ? 66.142  88.403  7.393   1.00 78.49  ? 58  SER A OG  1 
ATOM   429  N N   . TRP A 1 81  ? 61.929  87.687  8.356   1.00 72.15  ? 59  TRP A N   1 
ATOM   430  C CA  . TRP A 1 81  ? 60.642  87.885  9.009   1.00 66.74  ? 59  TRP A CA  1 
ATOM   431  C C   . TRP A 1 81  ? 60.129  86.579  9.602   1.00 74.64  ? 59  TRP A C   1 
ATOM   432  O O   . TRP A 1 81  ? 59.668  86.551  10.746  1.00 83.44  ? 59  TRP A O   1 
ATOM   433  C CB  . TRP A 1 81  ? 59.622  88.480  8.031   1.00 55.38  ? 59  TRP A CB  1 
ATOM   434  C CG  . TRP A 1 81  ? 58.305  88.836  8.678   1.00 51.54  ? 59  TRP A CG  1 
ATOM   435  C CD1 . TRP A 1 81  ? 57.935  90.054  9.183   1.00 56.93  ? 59  TRP A CD1 1 
ATOM   436  C CD2 . TRP A 1 81  ? 57.200  87.956  8.912   1.00 54.27  ? 59  TRP A CD2 1 
ATOM   437  N NE1 . TRP A 1 81  ? 56.666  89.984  9.716   1.00 59.22  ? 59  TRP A NE1 1 
ATOM   438  C CE2 . TRP A 1 81  ? 56.196  88.704  9.559   1.00 61.52  ? 59  TRP A CE2 1 
ATOM   439  C CE3 . TRP A 1 81  ? 56.962  86.605  8.638   1.00 53.46  ? 59  TRP A CE3 1 
ATOM   440  C CZ2 . TRP A 1 81  ? 54.971  88.144  9.931   1.00 63.31  ? 59  TRP A CZ2 1 
ATOM   441  C CZ3 . TRP A 1 81  ? 55.753  86.054  9.009   1.00 61.22  ? 59  TRP A CZ3 1 
ATOM   442  C CH2 . TRP A 1 81  ? 54.769  86.821  9.649   1.00 60.05  ? 59  TRP A CH2 1 
ATOM   443  N N   . ARG A 1 82  ? 60.212  85.476  8.850   1.00 70.99  ? 60  ARG A N   1 
ATOM   444  C CA  . ARG A 1 82  ? 59.737  84.221  9.424   1.00 70.81  ? 60  ARG A CA  1 
ATOM   445  C C   . ARG A 1 82  ? 60.546  83.813  10.657  1.00 65.02  ? 60  ARG A C   1 
ATOM   446  O O   . ARG A 1 82  ? 59.984  83.214  11.576  1.00 70.59  ? 60  ARG A O   1 
ATOM   447  C CB  . ARG A 1 82  ? 59.766  83.077  8.401   1.00 68.80  ? 60  ARG A CB  1 
ATOM   448  C CG  . ARG A 1 82  ? 58.895  83.210  7.179   1.00 63.18  ? 60  ARG A CG  1 
ATOM   449  C CD  . ARG A 1 82  ? 59.034  81.972  6.285   1.00 67.94  ? 60  ARG A CD  1 
ATOM   450  N NE  . ARG A 1 82  ? 59.447  82.307  4.922   1.00 77.30  ? 60  ARG A NE  1 
ATOM   451  C CZ  . ARG A 1 82  ? 60.510  81.785  4.312   1.00 89.56  ? 60  ARG A CZ  1 
ATOM   452  N NH1 . ARG A 1 82  ? 61.283  80.895  4.932   1.00 91.86  ? 60  ARG A NH1 1 
ATOM   453  N NH2 . ARG A 1 82  ? 60.800  82.157  3.075   1.00 98.58  ? 60  ARG A NH2 1 
ATOM   454  N N   . VAL A 1 83  ? 61.847  84.135  10.703  1.00 62.55  ? 61  VAL A N   1 
ATOM   455  C CA  . VAL A 1 83  ? 62.704  83.749  11.835  1.00 66.96  ? 61  VAL A CA  1 
ATOM   456  C C   . VAL A 1 83  ? 62.381  84.561  13.097  1.00 60.60  ? 61  VAL A C   1 
ATOM   457  O O   . VAL A 1 83  ? 62.214  83.998  14.183  1.00 59.70  ? 61  VAL A O   1 
ATOM   458  C CB  . VAL A 1 83  ? 64.189  83.872  11.435  1.00 64.76  ? 61  VAL A CB  1 
ATOM   459  C CG1 . VAL A 1 83  ? 65.067  83.955  12.643  1.00 64.91  ? 61  VAL A CG1 1 
ATOM   460  C CG2 . VAL A 1 83  ? 64.602  82.670  10.629  1.00 72.13  ? 61  VAL A CG2 1 
ATOM   461  N N   . VAL A 1 84  ? 62.258  85.884  12.963  1.00 50.03  ? 62  VAL A N   1 
ATOM   462  C CA  . VAL A 1 84  ? 61.959  86.760  14.090  1.00 50.13  ? 62  VAL A CA  1 
ATOM   463  C C   . VAL A 1 84  ? 60.513  86.621  14.531  1.00 64.11  ? 62  VAL A C   1 
ATOM   464  O O   . VAL A 1 84  ? 60.207  86.740  15.720  1.00 71.27  ? 62  VAL A O   1 
ATOM   465  C CB  . VAL A 1 84  ? 62.284  88.212  13.712  1.00 51.80  ? 62  VAL A CB  1 
ATOM   466  C CG1 . VAL A 1 84  ? 62.127  89.136  14.876  1.00 52.77  ? 62  VAL A CG1 1 
ATOM   467  C CG2 . VAL A 1 84  ? 63.709  88.273  13.285  1.00 61.18  ? 62  VAL A CG2 1 
ATOM   468  N N   . SER A 1 85  ? 59.606  86.364  13.595  1.00 69.03  ? 63  SER A N   1 
ATOM   469  C CA  . SER A 1 85  ? 58.206  86.241  13.954  1.00 69.73  ? 63  SER A CA  1 
ATOM   470  C C   . SER A 1 85  ? 57.947  84.973  14.739  1.00 71.78  ? 63  SER A C   1 
ATOM   471  O O   . SER A 1 85  ? 57.044  84.950  15.582  1.00 74.55  ? 63  SER A O   1 
ATOM   472  C CB  . SER A 1 85  ? 57.344  86.261  12.699  1.00 62.81  ? 63  SER A CB  1 
ATOM   473  O OG  . SER A 1 85  ? 56.122  85.600  12.963  1.00 72.29  ? 63  SER A OG  1 
ATOM   474  N N   . SER A 1 86  ? 58.698  83.906  14.457  1.00 70.97  ? 64  SER A N   1 
ATOM   475  C CA  . SER A 1 86  ? 58.526  82.676  15.218  1.00 75.25  ? 64  SER A CA  1 
ATOM   476  C C   . SER A 1 86  ? 59.226  82.742  16.571  1.00 74.93  ? 64  SER A C   1 
ATOM   477  O O   . SER A 1 86  ? 58.842  82.021  17.499  1.00 76.20  ? 64  SER A O   1 
ATOM   478  C CB  . SER A 1 86  ? 59.026  81.475  14.426  1.00 68.73  ? 64  SER A CB  1 
ATOM   479  O OG  . SER A 1 86  ? 60.367  81.206  14.737  1.00 66.09  ? 64  SER A OG  1 
ATOM   480  N N   . ILE A 1 87  ? 60.267  83.566  16.698  1.00 66.21  ? 65  ILE A N   1 
ATOM   481  C CA  . ILE A 1 87  ? 60.878  83.740  18.003  1.00 67.05  ? 65  ILE A CA  1 
ATOM   482  C C   . ILE A 1 87  ? 59.936  84.517  18.920  1.00 73.00  ? 65  ILE A C   1 
ATOM   483  O O   . ILE A 1 87  ? 59.714  84.133  20.072  1.00 69.33  ? 65  ILE A O   1 
ATOM   484  C CB  . ILE A 1 87  ? 62.232  84.451  17.873  1.00 62.05  ? 65  ILE A CB  1 
ATOM   485  C CG1 . ILE A 1 87  ? 63.275  83.513  17.280  1.00 60.16  ? 65  ILE A CG1 1 
ATOM   486  C CG2 . ILE A 1 87  ? 62.687  84.934  19.267  1.00 55.47  ? 65  ILE A CG2 1 
ATOM   487  C CD1 . ILE A 1 87  ? 64.580  84.227  16.922  1.00 50.96  ? 65  ILE A CD1 1 
ATOM   488  N N   . GLU A 1 88  ? 59.319  85.580  18.393  1.00 70.88  ? 66  GLU A N   1 
ATOM   489  C CA  . GLU A 1 88  ? 58.371  86.374  19.165  1.00 74.67  ? 66  GLU A CA  1 
ATOM   490  C C   . GLU A 1 88  ? 57.177  85.550  19.641  1.00 84.53  ? 66  GLU A C   1 
ATOM   491  O O   . GLU A 1 88  ? 56.647  85.807  20.728  1.00 93.25  ? 66  GLU A O   1 
ATOM   492  C CB  . GLU A 1 88  ? 57.895  87.567  18.329  1.00 70.86  ? 66  GLU A CB  1 
ATOM   493  C CG  . GLU A 1 88  ? 56.418  87.886  18.513  1.00 93.20  ? 66  GLU A CG  1 
ATOM   494  C CD  . GLU A 1 88  ? 55.951  89.106  17.730  1.00 107.83 ? 66  GLU A CD  1 
ATOM   495  O OE1 . GLU A 1 88  ? 54.980  88.998  16.948  1.00 120.90 ? 66  GLU A OE1 1 
ATOM   496  O OE2 . GLU A 1 88  ? 56.518  90.188  17.918  1.00 111.01 ? 66  GLU A OE2 1 
ATOM   497  N N   . GLN A 1 89  ? 56.754  84.550  18.865  1.00 80.38  ? 67  GLN A N   1 
ATOM   498  C CA  . GLN A 1 89  ? 55.667  83.687  19.317  1.00 87.91  ? 67  GLN A CA  1 
ATOM   499  C C   . GLN A 1 89  ? 56.155  82.672  20.342  1.00 93.99  ? 67  GLN A C   1 
ATOM   500  O O   . GLN A 1 89  ? 55.417  82.327  21.274  1.00 103.65 ? 67  GLN A O   1 
ATOM   501  C CB  . GLN A 1 89  ? 55.017  82.976  18.132  1.00 93.71  ? 67  GLN A CB  1 
ATOM   502  C CG  . GLN A 1 89  ? 54.269  83.905  17.199  1.00 109.35 ? 67  GLN A CG  1 
ATOM   503  C CD  . GLN A 1 89  ? 53.605  83.147  16.077  1.00 123.52 ? 67  GLN A CD  1 
ATOM   504  O OE1 . GLN A 1 89  ? 53.524  81.919  16.119  1.00 130.87 ? 67  GLN A OE1 1 
ATOM   505  N NE2 . GLN A 1 89  ? 53.119  83.867  15.069  1.00 125.93 ? 67  GLN A NE2 1 
ATOM   506  N N   . LYS A 1 90  ? 57.374  82.154  20.168  1.00 83.89  ? 68  LYS A N   1 
ATOM   507  C CA  . LYS A 1 90  ? 57.942  81.235  21.146  1.00 78.55  ? 68  LYS A CA  1 
ATOM   508  C C   . LYS A 1 90  ? 58.400  81.946  22.417  1.00 88.69  ? 68  LYS A C   1 
ATOM   509  O O   . LYS A 1 90  ? 58.861  81.284  23.357  1.00 89.80  ? 68  LYS A O   1 
ATOM   510  C CB  . LYS A 1 90  ? 59.095  80.454  20.519  1.00 72.40  ? 68  LYS A CB  1 
ATOM   511  N N   . THR A 1 91  ? 58.274  83.274  22.463  1.00 91.02  ? 69  THR A N   1 
ATOM   512  C CA  . THR A 1 91  ? 58.774  84.102  23.549  1.00 83.41  ? 69  THR A CA  1 
ATOM   513  C C   . THR A 1 91  ? 57.632  84.537  24.469  1.00 86.98  ? 69  THR A C   1 
ATOM   514  O O   . THR A 1 91  ? 57.809  85.416  25.327  1.00 85.13  ? 69  THR A O   1 
ATOM   515  C CB  . THR A 1 91  ? 59.519  85.299  22.945  1.00 83.63  ? 69  THR A CB  1 
ATOM   516  O OG1 . THR A 1 91  ? 60.632  84.803  22.211  1.00 99.54  ? 69  THR A OG1 1 
ATOM   517  C CG2 . THR A 1 91  ? 60.131  86.150  23.958  1.00 83.06  ? 69  THR A CG2 1 
ATOM   518  N N   . GLU A 1 92  ? 56.462  83.916  24.322  1.00 82.28  ? 70  GLU A N   1 
ATOM   519  C CA  . GLU A 1 92  ? 55.330  84.275  25.157  1.00 88.70  ? 70  GLU A CA  1 
ATOM   520  C C   . GLU A 1 92  ? 55.684  83.960  26.603  1.00 88.71  ? 70  GLU A C   1 
ATOM   521  O O   . GLU A 1 92  ? 56.121  82.849  26.906  1.00 89.83  ? 70  GLU A O   1 
ATOM   522  C CB  . GLU A 1 92  ? 54.091  83.498  24.712  1.00 98.32  ? 70  GLU A CB  1 
ATOM   523  C CG  . GLU A 1 92  ? 52.994  83.410  25.752  1.00 110.06 ? 70  GLU A CG  1 
ATOM   524  C CD  . GLU A 1 92  ? 51.879  84.393  25.489  1.00 119.88 ? 70  GLU A CD  1 
ATOM   525  O OE1 . GLU A 1 92  ? 51.907  85.036  24.409  1.00 112.03 ? 70  GLU A OE1 1 
ATOM   526  O OE2 . GLU A 1 92  ? 50.984  84.519  26.364  1.00 129.42 ? 70  GLU A OE2 1 
ATOM   527  N N   . GLY A 1 93  ? 55.549  84.954  27.487  1.00 91.37  ? 71  GLY A N   1 
ATOM   528  C CA  . GLY A 1 93  ? 55.854  84.803  28.898  1.00 93.91  ? 71  GLY A CA  1 
ATOM   529  C C   . GLY A 1 93  ? 57.100  85.535  29.347  1.00 93.32  ? 71  GLY A C   1 
ATOM   530  O O   . GLY A 1 93  ? 57.230  85.831  30.544  1.00 96.43  ? 71  GLY A O   1 
ATOM   531  N N   . ALA A 1 94  ? 58.026  85.823  28.420  1.00 96.26  ? 72  ALA A N   1 
ATOM   532  C CA  . ALA A 1 94  ? 59.262  86.566  28.684  1.00 93.44  ? 72  ALA A CA  1 
ATOM   533  C C   . ALA A 1 94  ? 59.087  87.966  28.113  1.00 91.09  ? 72  ALA A C   1 
ATOM   534  O O   . ALA A 1 94  ? 59.357  88.201  26.933  1.00 87.11  ? 72  ALA A O   1 
ATOM   535  C CB  . ALA A 1 94  ? 60.468  85.870  28.058  1.00 81.37  ? 72  ALA A CB  1 
ATOM   536  N N   . GLU A 1 95  ? 58.692  88.905  28.973  1.00 93.06  ? 73  GLU A N   1 
ATOM   537  C CA  . GLU A 1 95  ? 58.216  90.200  28.508  1.00 88.92  ? 73  GLU A CA  1 
ATOM   538  C C   . GLU A 1 95  ? 59.281  90.939  27.714  1.00 89.08  ? 73  GLU A C   1 
ATOM   539  O O   . GLU A 1 95  ? 58.972  91.599  26.720  1.00 98.59  ? 73  GLU A O   1 
ATOM   540  C CB  . GLU A 1 95  ? 57.774  91.055  29.697  1.00 91.09  ? 73  GLU A CB  1 
ATOM   541  N N   . LYS A 1 96  ? 60.546  90.823  28.119  1.00 82.25  ? 74  LYS A N   1 
ATOM   542  C CA  . LYS A 1 96  ? 61.546  91.674  27.483  1.00 78.19  ? 74  LYS A CA  1 
ATOM   543  C C   . LYS A 1 96  ? 62.123  91.070  26.215  1.00 83.13  ? 74  LYS A C   1 
ATOM   544  O O   . LYS A 1 96  ? 62.429  91.811  25.276  1.00 67.57  ? 74  LYS A O   1 
ATOM   545  C CB  . LYS A 1 96  ? 62.653  92.004  28.476  1.00 80.33  ? 74  LYS A CB  1 
ATOM   546  C CG  . LYS A 1 96  ? 62.231  93.170  29.359  1.00 94.60  ? 74  LYS A CG  1 
ATOM   547  C CD  . LYS A 1 96  ? 63.274  93.710  30.316  1.00 88.47  ? 74  LYS A CD  1 
ATOM   548  C CE  . LYS A 1 96  ? 64.398  92.775  30.650  1.00 80.56  ? 74  LYS A CE  1 
ATOM   549  N NZ  . LYS A 1 96  ? 65.042  93.328  31.880  1.00 86.02  ? 74  LYS A NZ  1 
ATOM   550  N N   . LYS A 1 97  ? 62.164  89.747  26.105  1.00 82.84  ? 75  LYS A N   1 
ATOM   551  C CA  . LYS A 1 97  ? 62.573  89.163  24.833  1.00 70.74  ? 75  LYS A CA  1 
ATOM   552  C C   . LYS A 1 97  ? 61.472  89.307  23.785  1.00 74.38  ? 75  LYS A C   1 
ATOM   553  O O   . LYS A 1 97  ? 61.761  89.451  22.592  1.00 85.34  ? 75  LYS A O   1 
ATOM   554  C CB  . LYS A 1 97  ? 62.971  87.680  25.006  1.00 68.65  ? 75  LYS A CB  1 
ATOM   555  C CG  . LYS A 1 97  ? 63.992  87.381  26.101  1.00 74.91  ? 75  LYS A CG  1 
ATOM   556  C CD  . LYS A 1 97  ? 64.535  85.945  25.994  1.00 67.37  ? 75  LYS A CD  1 
ATOM   557  N N   . GLN A 1 98  ? 60.215  89.332  24.198  1.00 79.62  ? 76  GLN A N   1 
ATOM   558  C CA  . GLN A 1 98  ? 59.160  89.427  23.202  1.00 77.38  ? 76  GLN A CA  1 
ATOM   559  C C   . GLN A 1 98  ? 58.961  90.860  22.728  1.00 82.83  ? 76  GLN A C   1 
ATOM   560  O O   . GLN A 1 98  ? 58.675  91.088  21.544  1.00 84.60  ? 76  GLN A O   1 
ATOM   561  C CB  . GLN A 1 98  ? 57.865  88.892  23.764  1.00 77.85  ? 76  GLN A CB  1 
ATOM   562  C CG  . GLN A 1 98  ? 56.701  89.071  22.847  1.00 80.64  ? 76  GLN A CG  1 
ATOM   563  C CD  . GLN A 1 98  ? 55.523  88.316  23.350  1.00 82.91  ? 76  GLN A CD  1 
ATOM   564  O OE1 . GLN A 1 98  ? 55.115  87.309  22.781  1.00 87.25  ? 76  GLN A OE1 1 
ATOM   565  N NE2 . GLN A 1 98  ? 54.982  88.780  24.466  1.00 74.93  ? 76  GLN A NE2 1 
ATOM   566  N N   . GLN A 1 99  ? 59.078  91.839  23.633  1.00 78.07  ? 77  GLN A N   1 
ATOM   567  C CA  . GLN A 1 99  ? 59.043  93.229  23.187  1.00 76.89  ? 77  GLN A CA  1 
ATOM   568  C C   . GLN A 1 99  ? 60.191  93.542  22.229  1.00 82.13  ? 77  GLN A C   1 
ATOM   569  O O   . GLN A 1 99  ? 60.073  94.437  21.383  1.00 79.73  ? 77  GLN A O   1 
ATOM   570  C CB  . GLN A 1 99  ? 59.083  94.174  24.383  1.00 72.03  ? 77  GLN A CB  1 
ATOM   571  N N   . MET A 1 100 ? 61.312  92.828  22.348  1.00 88.37  ? 78  MET A N   1 
ATOM   572  C CA  . MET A 1 100 ? 62.437  93.072  21.452  1.00 89.27  ? 78  MET A CA  1 
ATOM   573  C C   . MET A 1 100 ? 62.242  92.365  20.124  1.00 76.54  ? 78  MET A C   1 
ATOM   574  O O   . MET A 1 100 ? 62.536  92.936  19.067  1.00 73.38  ? 78  MET A O   1 
ATOM   575  C CB  . MET A 1 100 ? 63.742  92.639  22.110  1.00 99.61  ? 78  MET A CB  1 
ATOM   576  C CG  . MET A 1 100 ? 64.938  92.655  21.195  1.00 105.21 ? 78  MET A CG  1 
ATOM   577  S SD  . MET A 1 100 ? 66.372  92.082  22.110  1.00 120.26 ? 78  MET A SD  1 
ATOM   578  C CE  . MET A 1 100 ? 66.052  90.313  22.152  1.00 122.44 ? 78  MET A CE  1 
ATOM   579  N N   . ALA A 1 101 ? 61.729  91.132  20.165  1.00 73.69  ? 79  ALA A N   1 
ATOM   580  C CA  . ALA A 1 101 ? 61.403  90.427  18.933  1.00 62.65  ? 79  ALA A CA  1 
ATOM   581  C C   . ALA A 1 101 ? 60.276  91.129  18.194  1.00 70.07  ? 79  ALA A C   1 
ATOM   582  O O   . ALA A 1 101 ? 60.234  91.100  16.967  1.00 63.00  ? 79  ALA A O   1 
ATOM   583  C CB  . ALA A 1 101 ? 61.025  88.977  19.235  1.00 59.55  ? 79  ALA A CB  1 
ATOM   584  N N   . ARG A 1 102 ? 59.332  91.739  18.916  1.00 83.36  ? 80  ARG A N   1 
ATOM   585  C CA  . ARG A 1 102 ? 58.290  92.494  18.227  1.00 72.33  ? 80  ARG A CA  1 
ATOM   586  C C   . ARG A 1 102 ? 58.877  93.703  17.520  1.00 65.09  ? 80  ARG A C   1 
ATOM   587  O O   . ARG A 1 102 ? 58.556  93.960  16.356  1.00 65.12  ? 80  ARG A O   1 
ATOM   588  C CB  . ARG A 1 102 ? 57.182  92.929  19.187  1.00 72.09  ? 80  ARG A CB  1 
ATOM   589  C CG  . ARG A 1 102 ? 56.123  93.757  18.456  1.00 84.35  ? 80  ARG A CG  1 
ATOM   590  C CD  . ARG A 1 102 ? 54.976  94.226  19.332  1.00 96.60  ? 80  ARG A CD  1 
ATOM   591  N NE  . ARG A 1 102 ? 55.421  95.071  20.433  1.00 108.00 ? 80  ARG A NE  1 
ATOM   592  C CZ  . ARG A 1 102 ? 55.518  94.652  21.695  1.00 121.08 ? 80  ARG A CZ  1 
ATOM   593  N NH1 . ARG A 1 102 ? 55.201  93.399  22.011  1.00 123.90 ? 80  ARG A NH1 1 
ATOM   594  N NH2 . ARG A 1 102 ? 55.927  95.482  22.647  1.00 121.42 ? 80  ARG A NH2 1 
ATOM   595  N N   . GLU A 1 103 ? 59.754  94.447  18.201  1.00 65.58  ? 81  GLU A N   1 
ATOM   596  C CA  . GLU A 1 103 ? 60.297  95.667  17.616  1.00 70.30  ? 81  GLU A CA  1 
ATOM   597  C C   . GLU A 1 103 ? 61.189  95.357  16.416  1.00 72.84  ? 81  GLU A C   1 
ATOM   598  O O   . GLU A 1 103 ? 61.224  96.136  15.456  1.00 70.67  ? 81  GLU A O   1 
ATOM   599  C CB  . GLU A 1 103 ? 61.058  96.466  18.678  1.00 69.64  ? 81  GLU A CB  1 
ATOM   600  N N   . TYR A 1 104 ? 61.889  94.219  16.437  1.00 65.55  ? 82  TYR A N   1 
ATOM   601  C CA  . TYR A 1 104 ? 62.701  93.832  15.289  1.00 63.37  ? 82  TYR A CA  1 
ATOM   602  C C   . TYR A 1 104 ? 61.826  93.351  14.128  1.00 64.89  ? 82  TYR A C   1 
ATOM   603  O O   . TYR A 1 104 ? 62.065  93.708  12.962  1.00 65.22  ? 82  TYR A O   1 
ATOM   604  C CB  . TYR A 1 104 ? 63.720  92.764  15.718  1.00 62.79  ? 82  TYR A CB  1 
ATOM   605  C CG  . TYR A 1 104 ? 64.947  92.661  14.821  1.00 68.84  ? 82  TYR A CG  1 
ATOM   606  C CD1 . TYR A 1 104 ? 65.573  93.809  14.336  1.00 75.98  ? 82  TYR A CD1 1 
ATOM   607  C CD2 . TYR A 1 104 ? 65.513  91.430  14.503  1.00 65.76  ? 82  TYR A CD2 1 
ATOM   608  C CE1 . TYR A 1 104 ? 66.706  93.739  13.535  1.00 68.96  ? 82  TYR A CE1 1 
ATOM   609  C CE2 . TYR A 1 104 ? 66.651  91.353  13.691  1.00 67.76  ? 82  TYR A CE2 1 
ATOM   610  C CZ  . TYR A 1 104 ? 67.246  92.516  13.216  1.00 70.15  ? 82  TYR A CZ  1 
ATOM   611  O OH  . TYR A 1 104 ? 68.376  92.469  12.415  1.00 76.21  ? 82  TYR A OH  1 
ATOM   612  N N   . ARG A 1 105 ? 60.801  92.555  14.427  1.00 66.97  ? 83  ARG A N   1 
ATOM   613  C CA  . ARG A 1 105 ? 59.854  92.143  13.399  1.00 63.84  ? 83  ARG A CA  1 
ATOM   614  C C   . ARG A 1 105 ? 59.205  93.365  12.753  1.00 66.97  ? 83  ARG A C   1 
ATOM   615  O O   . ARG A 1 105 ? 59.132  93.468  11.524  1.00 52.13  ? 83  ARG A O   1 
ATOM   616  C CB  . ARG A 1 105 ? 58.803  91.214  14.019  1.00 52.38  ? 83  ARG A CB  1 
ATOM   617  C CG  . ARG A 1 105 ? 57.881  90.493  13.056  1.00 51.65  ? 83  ARG A CG  1 
ATOM   618  C CD  . ARG A 1 105 ? 56.486  90.355  13.654  1.00 62.65  ? 83  ARG A CD  1 
ATOM   619  N NE  . ARG A 1 105 ? 55.775  91.622  13.561  1.00 66.74  ? 83  ARG A NE  1 
ATOM   620  C CZ  . ARG A 1 105 ? 55.041  92.140  14.531  1.00 84.41  ? 83  ARG A CZ  1 
ATOM   621  N NH1 . ARG A 1 105 ? 54.918  91.490  15.681  1.00 91.64  ? 83  ARG A NH1 1 
ATOM   622  N NH2 . ARG A 1 105 ? 54.441  93.310  14.348  1.00 90.87  ? 83  ARG A NH2 1 
ATOM   623  N N   . GLU A 1 106 ? 58.788  94.339  13.557  1.00 73.32  ? 84  GLU A N   1 
ATOM   624  C CA  . GLU A 1 106 ? 58.232  95.544  12.957  1.00 75.10  ? 84  GLU A CA  1 
ATOM   625  C C   . GLU A 1 106 ? 59.263  96.223  12.047  1.00 68.70  ? 84  GLU A C   1 
ATOM   626  O O   . GLU A 1 106 ? 58.934  96.597  10.919  1.00 67.86  ? 84  GLU A O   1 
ATOM   627  C CB  . GLU A 1 106 ? 57.710  96.503  14.044  1.00 83.25  ? 84  GLU A CB  1 
ATOM   628  C CG  . GLU A 1 106 ? 56.563  95.936  14.914  1.00 93.94  ? 84  GLU A CG  1 
ATOM   629  C CD  . GLU A 1 106 ? 55.866  96.977  15.825  1.00 106.41 ? 84  GLU A CD  1 
ATOM   630  O OE1 . GLU A 1 106 ? 56.492  97.476  16.789  1.00 108.76 ? 84  GLU A OE1 1 
ATOM   631  O OE2 . GLU A 1 106 ? 54.659  97.252  15.613  1.00 108.95 ? 84  GLU A OE2 1 
ATOM   632  N N   . LYS A 1 107 ? 60.530  96.316  12.484  1.00 69.47  ? 85  LYS A N   1 
ATOM   633  C CA  . LYS A 1 107 ? 61.594  96.907  11.657  1.00 70.77  ? 85  LYS A CA  1 
ATOM   634  C C   . LYS A 1 107 ? 61.765  96.175  10.320  1.00 73.82  ? 85  LYS A C   1 
ATOM   635  O O   . LYS A 1 107 ? 61.849  96.801  9.251   1.00 60.93  ? 85  LYS A O   1 
ATOM   636  C CB  . LYS A 1 107 ? 62.914  96.906  12.433  1.00 61.88  ? 85  LYS A CB  1 
ATOM   637  C CG  . LYS A 1 107 ? 64.154  97.326  11.662  1.00 57.78  ? 85  LYS A CG  1 
ATOM   638  N N   . ILE A 1 108 ? 61.861  94.848  10.368  1.00 74.68  ? 86  ILE A N   1 
ATOM   639  C CA  . ILE A 1 108 ? 62.007  94.054  9.153   1.00 62.09  ? 86  ILE A CA  1 
ATOM   640  C C   . ILE A 1 108 ? 60.808  94.253  8.238   1.00 65.04  ? 86  ILE A C   1 
ATOM   641  O O   . ILE A 1 108 ? 60.969  94.386  7.024   1.00 69.62  ? 86  ILE A O   1 
ATOM   642  C CB  . ILE A 1 108 ? 62.226  92.576  9.522   1.00 61.88  ? 86  ILE A CB  1 
ATOM   643  C CG1 . ILE A 1 108 ? 63.556  92.439  10.306  1.00 64.68  ? 86  ILE A CG1 1 
ATOM   644  C CG2 . ILE A 1 108 ? 62.198  91.702  8.287   1.00 52.92  ? 86  ILE A CG2 1 
ATOM   645  C CD1 . ILE A 1 108 ? 63.860  91.042  10.893  1.00 55.44  ? 86  ILE A CD1 1 
ATOM   646  N N   . GLU A 1 109 ? 59.596  94.369  8.812   1.00 73.57  ? 87  GLU A N   1 
ATOM   647  C CA  . GLU A 1 109 ? 58.372  94.398  8.005   1.00 68.59  ? 87  GLU A CA  1 
ATOM   648  C C   . GLU A 1 109 ? 58.264  95.670  7.182   1.00 71.60  ? 87  GLU A C   1 
ATOM   649  O O   . GLU A 1 109 ? 57.854  95.619  6.018   1.00 72.70  ? 87  GLU A O   1 
ATOM   650  C CB  . GLU A 1 109 ? 57.134  94.344  8.903   1.00 73.30  ? 87  GLU A CB  1 
ATOM   651  C CG  . GLU A 1 109 ? 56.464  93.010  9.135   1.00 74.78  ? 87  GLU A CG  1 
ATOM   652  C CD  . GLU A 1 109 ? 55.298  93.115  10.134  1.00 90.51  ? 87  GLU A CD  1 
ATOM   653  O OE1 . GLU A 1 109 ? 54.862  92.066  10.662  1.00 90.81  ? 87  GLU A OE1 1 
ATOM   654  O OE2 . GLU A 1 109 ? 54.827  94.249  10.403  1.00 94.13  ? 87  GLU A OE2 1 
ATOM   655  N N   . THR A 1 110 ? 58.688  96.811  7.727   1.00 71.40  ? 88  THR A N   1 
ATOM   656  C CA  . THR A 1 110 ? 58.685  98.021  6.910   1.00 75.21  ? 88  THR A CA  1 
ATOM   657  C C   . THR A 1 110 ? 59.653  97.902  5.741   1.00 76.61  ? 88  THR A C   1 
ATOM   658  O O   . THR A 1 110 ? 59.374  98.422  4.659   1.00 85.21  ? 88  THR A O   1 
ATOM   659  C CB  . THR A 1 110 ? 59.006  99.251  7.741   1.00 70.68  ? 88  THR A CB  1 
ATOM   660  O OG1 . THR A 1 110 ? 60.145  98.977  8.558   1.00 78.35  ? 88  THR A OG1 1 
ATOM   661  C CG2 . THR A 1 110 ? 57.813  99.618  8.603   1.00 67.99  ? 88  THR A CG2 1 
ATOM   662  N N   . GLU A 1 111 ? 60.817  97.273  5.950   1.00 70.54  ? 89  GLU A N   1 
ATOM   663  C CA  . GLU A 1 111 ? 61.718  96.987  4.834   1.00 66.69  ? 89  GLU A CA  1 
ATOM   664  C C   . GLU A 1 111 ? 61.039  96.128  3.779   1.00 61.50  ? 89  GLU A C   1 
ATOM   665  O O   . GLU A 1 111 ? 61.058  96.462  2.590   1.00 67.50  ? 89  GLU A O   1 
ATOM   666  C CB  . GLU A 1 111 ? 62.994  96.296  5.317   1.00 77.16  ? 89  GLU A CB  1 
ATOM   667  C CG  . GLU A 1 111 ? 64.108  97.228  5.796   1.00 84.99  ? 89  GLU A CG  1 
ATOM   668  C CD  . GLU A 1 111 ? 65.354  96.464  6.203   1.00 91.76  ? 89  GLU A CD  1 
ATOM   669  O OE1 . GLU A 1 111 ? 65.981  96.825  7.224   1.00 87.59  ? 89  GLU A OE1 1 
ATOM   670  O OE2 . GLU A 1 111 ? 65.706  95.503  5.480   1.00 96.14  ? 89  GLU A OE2 1 
ATOM   671  N N   . LEU A 1 112 ? 60.408  95.028  4.205   1.00 60.89  ? 90  LEU A N   1 
ATOM   672  C CA  . LEU A 1 112 ? 59.652  94.182  3.282   1.00 61.48  ? 90  LEU A CA  1 
ATOM   673  C C   . LEU A 1 112 ? 58.535  94.971  2.611   1.00 64.33  ? 90  LEU A C   1 
ATOM   674  O O   . LEU A 1 112 ? 58.311  94.841  1.403   1.00 81.00  ? 90  LEU A O   1 
ATOM   675  C CB  . LEU A 1 112 ? 59.085  92.970  4.025   1.00 57.14  ? 90  LEU A CB  1 
ATOM   676  C CG  . LEU A 1 112 ? 58.554  91.781  3.232   1.00 75.82  ? 90  LEU A CG  1 
ATOM   677  C CD1 . LEU A 1 112 ? 58.674  90.511  4.068   1.00 80.50  ? 90  LEU A CD1 1 
ATOM   678  C CD2 . LEU A 1 112 ? 57.117  91.991  2.773   1.00 84.70  ? 90  LEU A CD2 1 
ATOM   679  N N   . ARG A 1 113 ? 57.804  95.769  3.381   1.00 55.47  ? 91  ARG A N   1 
ATOM   680  C CA  . ARG A 1 113 ? 56.720  96.557  2.804   1.00 65.00  ? 91  ARG A CA  1 
ATOM   681  C C   . ARG A 1 113 ? 57.234  97.570  1.785   1.00 63.30  ? 91  ARG A C   1 
ATOM   682  O O   . ARG A 1 113 ? 56.604  97.776  0.746   1.00 61.57  ? 91  ARG A O   1 
ATOM   683  C CB  . ARG A 1 113 ? 55.940  97.266  3.910   1.00 73.24  ? 91  ARG A CB  1 
ATOM   684  C CG  . ARG A 1 113 ? 54.456  97.108  3.802   1.00 77.96  ? 91  ARG A CG  1 
ATOM   685  C CD  . ARG A 1 113 ? 53.739  97.947  4.840   1.00 96.84  ? 91  ARG A CD  1 
ATOM   686  N NE  . ARG A 1 113 ? 53.982  97.478  6.203   1.00 103.95 ? 91  ARG A NE  1 
ATOM   687  C CZ  . ARG A 1 113 ? 53.428  96.390  6.730   1.00 100.73 ? 91  ARG A CZ  1 
ATOM   688  N NH1 . ARG A 1 113 ? 52.599  95.638  6.004   1.00 101.42 ? 91  ARG A NH1 1 
ATOM   689  N NH2 . ARG A 1 113 ? 53.708  96.054  7.983   1.00 93.97  ? 91  ARG A NH2 1 
ATOM   690  N N   . ASP A 1 114 ? 58.364  98.232  2.067   1.00 70.77  ? 92  ASP A N   1 
ATOM   691  C CA  . ASP A 1 114 ? 58.850  99.247  1.133   1.00 75.04  ? 92  ASP A CA  1 
ATOM   692  C C   . ASP A 1 114 ? 59.402  98.619  -0.144  1.00 71.56  ? 92  ASP A C   1 
ATOM   693  O O   . ASP A 1 114 ? 59.277  99.210  -1.220  1.00 66.99  ? 92  ASP A O   1 
ATOM   694  C CB  . ASP A 1 114 ? 59.893  100.148 1.799   1.00 86.30  ? 92  ASP A CB  1 
ATOM   695  C CG  . ASP A 1 114 ? 59.339  100.886 3.019   1.00 108.86 ? 92  ASP A CG  1 
ATOM   696  O OD1 . ASP A 1 114 ? 58.109  100.857 3.230   1.00 117.30 ? 92  ASP A OD1 1 
ATOM   697  O OD2 . ASP A 1 114 ? 60.122  101.525 3.757   1.00 114.24 ? 92  ASP A OD2 1 
ATOM   698  N N   . ILE A 1 115 ? 59.977  97.418  -0.057  1.00 64.54  ? 93  ILE A N   1 
ATOM   699  C CA  . ILE A 1 115 ? 60.384  96.703  -1.263  1.00 63.69  ? 93  ILE A CA  1 
ATOM   700  C C   . ILE A 1 115 ? 59.168  96.379  -2.121  1.00 71.68  ? 93  ILE A C   1 
ATOM   701  O O   . ILE A 1 115 ? 59.205  96.501  -3.349  1.00 73.67  ? 93  ILE A O   1 
ATOM   702  C CB  . ILE A 1 115 ? 61.148  95.415  -0.904  1.00 63.75  ? 93  ILE A CB  1 
ATOM   703  C CG1 . ILE A 1 115 ? 62.457  95.718  -0.180  1.00 52.33  ? 93  ILE A CG1 1 
ATOM   704  C CG2 . ILE A 1 115 ? 61.434  94.592  -2.175  1.00 56.56  ? 93  ILE A CG2 1 
ATOM   705  C CD1 . ILE A 1 115 ? 63.069  94.480  0.377   1.00 50.24  ? 93  ILE A CD1 1 
ATOM   706  N N   . CYS A 1 116 ? 58.083  95.925  -1.486  1.00 78.98  ? 94  CYS A N   1 
ATOM   707  C CA  . CYS A 1 116 ? 56.906  95.479  -2.232  1.00 73.90  ? 94  CYS A CA  1 
ATOM   708  C C   . CYS A 1 116 ? 56.173  96.644  -2.881  1.00 76.31  ? 94  CYS A C   1 
ATOM   709  O O   . CYS A 1 116 ? 55.688  96.527  -4.008  1.00 82.43  ? 94  CYS A O   1 
ATOM   710  C CB  . CYS A 1 116 ? 55.958  94.706  -1.313  1.00 65.90  ? 94  CYS A CB  1 
ATOM   711  S SG  . CYS A 1 116 ? 56.466  93.007  -0.951  1.00 63.77  ? 94  CYS A SG  1 
ATOM   712  N N   . ASN A 1 117 ? 56.058  97.764  -2.180  1.00 74.82  ? 95  ASN A N   1 
ATOM   713  C CA  . ASN A 1 117 ? 55.459  98.943  -2.786  1.00 83.63  ? 95  ASN A CA  1 
ATOM   714  C C   . ASN A 1 117 ? 56.354  99.500  -3.883  1.00 85.98  ? 95  ASN A C   1 
ATOM   715  O O   . ASN A 1 117 ? 55.873  100.179 -4.798  1.00 91.85  ? 95  ASN A O   1 
ATOM   716  C CB  . ASN A 1 117 ? 55.198  99.982  -1.702  1.00 90.75  ? 95  ASN A CB  1 
ATOM   717  C CG  . ASN A 1 117 ? 54.311  99.446  -0.611  1.00 89.75  ? 95  ASN A CG  1 
ATOM   718  O OD1 . ASN A 1 117 ? 53.465  98.580  -0.855  1.00 87.70  ? 95  ASN A OD1 1 
ATOM   719  N ND2 . ASN A 1 117 ? 54.532  99.913  0.615   1.00 93.60  ? 95  ASN A ND2 1 
ATOM   720  N N   . ASP A 1 118 ? 57.657  99.238  -3.782  1.00 90.33  ? 96  ASP A N   1 
ATOM   721  C CA  . ASP A 1 118 ? 58.590  99.586  -4.844  1.00 96.02  ? 96  ASP A CA  1 
ATOM   722  C C   . ASP A 1 118 ? 58.256  98.817  -6.127  1.00 92.39  ? 96  ASP A C   1 
ATOM   723  O O   . ASP A 1 118 ? 58.089  99.414  -7.203  1.00 95.25  ? 96  ASP A O   1 
ATOM   724  C CB  . ASP A 1 118 ? 60.011  99.291  -4.353  1.00 104.56 ? 96  ASP A CB  1 
ATOM   725  C CG  . ASP A 1 118 ? 61.073  100.027 -5.130  1.00 123.96 ? 96  ASP A CG  1 
ATOM   726  O OD1 . ASP A 1 118 ? 60.788  101.151 -5.599  1.00 133.42 ? 96  ASP A OD1 1 
ATOM   727  O OD2 . ASP A 1 118 ? 62.199  99.486  -5.256  1.00 126.04 ? 96  ASP A OD2 1 
ATOM   728  N N   . VAL A 1 119 ? 58.074  97.495  -6.010  1.00 79.95  ? 97  VAL A N   1 
ATOM   729  C CA  . VAL A 1 119 ? 57.833  96.661  -7.188  1.00 68.60  ? 97  VAL A CA  1 
ATOM   730  C C   . VAL A 1 119 ? 56.453  96.925  -7.762  1.00 70.27  ? 97  VAL A C   1 
ATOM   731  O O   . VAL A 1 119 ? 56.289  97.053  -8.982  1.00 79.30  ? 97  VAL A O   1 
ATOM   732  C CB  . VAL A 1 119 ? 57.998  95.170  -6.845  1.00 62.51  ? 97  VAL A CB  1 
ATOM   733  C CG1 . VAL A 1 119 ? 57.571  94.313  -8.011  1.00 57.56  ? 97  VAL A CG1 1 
ATOM   734  C CG2 . VAL A 1 119 ? 59.407  94.881  -6.528  1.00 56.36  ? 97  VAL A CG2 1 
ATOM   735  N N   . LEU A 1 120 ? 55.437  96.997  -6.900  1.00 72.44  ? 98  LEU A N   1 
ATOM   736  C CA  . LEU A 1 120 ? 54.091  97.195  -7.409  1.00 81.92  ? 98  LEU A CA  1 
ATOM   737  C C   . LEU A 1 120 ? 53.914  98.576  -8.021  1.00 94.80  ? 98  LEU A C   1 
ATOM   738  O O   . LEU A 1 120 ? 52.963  98.778  -8.785  1.00 101.94 ? 98  LEU A O   1 
ATOM   739  C CB  . LEU A 1 120 ? 53.041  96.985  -6.315  1.00 64.09  ? 98  LEU A CB  1 
ATOM   740  C CG  . LEU A 1 120 ? 52.980  95.643  -5.585  1.00 64.46  ? 98  LEU A CG  1 
ATOM   741  C CD1 . LEU A 1 120 ? 52.339  95.847  -4.225  1.00 61.23  ? 98  LEU A CD1 1 
ATOM   742  C CD2 . LEU A 1 120 ? 52.315  94.521  -6.369  1.00 60.27  ? 98  LEU A CD2 1 
ATOM   743  N N   . SER A 1 121 ? 54.832  99.505  -7.748  1.00 93.08  ? 99  SER A N   1 
ATOM   744  C CA  . SER A 1 121 ? 54.817  100.790 -8.433  1.00 100.77 ? 99  SER A CA  1 
ATOM   745  C C   . SER A 1 121 ? 55.404  100.676 -9.838  1.00 97.29  ? 99  SER A C   1 
ATOM   746  O O   . SER A 1 121 ? 54.961  101.371 -10.759 1.00 106.39 ? 99  SER A O   1 
ATOM   747  C CB  . SER A 1 121 ? 55.577  101.823 -7.604  1.00 109.78 ? 99  SER A CB  1 
ATOM   748  O OG  . SER A 1 121 ? 56.135  102.821 -8.432  1.00 122.99 ? 99  SER A OG  1 
ATOM   749  N N   . LEU A 1 122 ? 56.417  99.824  -10.012 1.00 90.00  ? 100 LEU A N   1 
ATOM   750  C CA  . LEU A 1 122 ? 56.920  99.517  -11.348 1.00 82.29  ? 100 LEU A CA  1 
ATOM   751  C C   . LEU A 1 122 ? 55.858  98.823  -12.187 1.00 89.34  ? 100 LEU A C   1 
ATOM   752  O O   . LEU A 1 122 ? 55.704  99.113  -13.380 1.00 93.81  ? 100 LEU A O   1 
ATOM   753  C CB  . LEU A 1 122 ? 58.168  98.636  -11.241 1.00 78.39  ? 100 LEU A CB  1 
ATOM   754  C CG  . LEU A 1 122 ? 59.387  99.226  -10.532 1.00 85.48  ? 100 LEU A CG  1 
ATOM   755  C CD1 . LEU A 1 122 ? 60.661  98.547  -10.984 1.00 83.82  ? 100 LEU A CD1 1 
ATOM   756  C CD2 . LEU A 1 122 ? 59.467  100.719 -10.823 1.00 98.44  ? 100 LEU A CD2 1 
ATOM   757  N N   . LEU A 1 123 ? 55.078  97.941  -11.568 1.00 89.10  ? 101 LEU A N   1 
ATOM   758  C CA  . LEU A 1 123 ? 54.162  97.128  -12.354 1.00 88.94  ? 101 LEU A CA  1 
ATOM   759  C C   . LEU A 1 123 ? 52.949  97.919  -12.816 1.00 93.57  ? 101 LEU A C   1 
ATOM   760  O O   . LEU A 1 123 ? 52.381  97.614  -13.869 1.00 92.40  ? 101 LEU A O   1 
ATOM   761  C CB  . LEU A 1 123 ? 53.699  95.911  -11.558 1.00 77.24  ? 101 LEU A CB  1 
ATOM   762  C CG  . LEU A 1 123 ? 54.705  94.824  -11.227 1.00 67.43  ? 101 LEU A CG  1 
ATOM   763  C CD1 . LEU A 1 123 ? 54.448  94.362  -9.824  1.00 76.30  ? 101 LEU A CD1 1 
ATOM   764  C CD2 . LEU A 1 123 ? 54.588  93.677  -12.195 1.00 71.57  ? 101 LEU A CD2 1 
ATOM   765  N N   . GLU A 1 124 ? 52.517  98.908  -12.043 1.00 96.94  ? 102 GLU A N   1 
ATOM   766  C CA  . GLU A 1 124 ? 51.373  99.703  -12.460 1.00 100.82 ? 102 GLU A CA  1 
ATOM   767  C C   . GLU A 1 124 ? 51.753  100.855 -13.379 1.00 106.83 ? 102 GLU A C   1 
ATOM   768  O O   . GLU A 1 124 ? 50.953  101.229 -14.248 1.00 114.05 ? 102 GLU A O   1 
ATOM   769  C CB  . GLU A 1 124 ? 50.619  100.225 -11.235 1.00 107.46 ? 102 GLU A CB  1 
ATOM   770  C CG  . GLU A 1 124 ? 49.895  99.122  -10.464 1.00 112.35 ? 102 GLU A CG  1 
ATOM   771  C CD  . GLU A 1 124 ? 48.502  98.855  -11.002 1.00 113.54 ? 102 GLU A CD  1 
ATOM   772  O OE1 . GLU A 1 124 ? 47.563  99.542  -10.545 1.00 126.55 ? 102 GLU A OE1 1 
ATOM   773  O OE2 . GLU A 1 124 ? 48.350  97.969  -11.879 1.00 97.97  ? 102 GLU A OE2 1 
ATOM   774  N N   . LYS A 1 125 ? 52.953  101.421 -13.224 1.00 106.17 ? 103 LYS A N   1 
ATOM   775  C CA  . LYS A 1 125 ? 53.314  102.595 -14.009 1.00 108.20 ? 103 LYS A CA  1 
ATOM   776  C C   . LYS A 1 125 ? 54.055  102.249 -15.292 1.00 115.03 ? 103 LYS A C   1 
ATOM   777  O O   . LYS A 1 125 ? 54.009  103.036 -16.249 1.00 121.31 ? 103 LYS A O   1 
ATOM   778  C CB  . LYS A 1 125 ? 54.173  103.552 -13.166 1.00 95.17  ? 103 LYS A CB  1 
ATOM   779  N N   . PHE A 1 126 ? 54.681  101.073 -15.360 1.00 101.52 ? 104 PHE A N   1 
ATOM   780  C CA  . PHE A 1 126 ? 55.506  100.740 -16.511 1.00 93.81  ? 104 PHE A CA  1 
ATOM   781  C C   . PHE A 1 126 ? 55.209  99.365  -17.097 1.00 88.31  ? 104 PHE A C   1 
ATOM   782  O O   . PHE A 1 126 ? 55.029  99.237  -18.310 1.00 102.35 ? 104 PHE A O   1 
ATOM   783  C CB  . PHE A 1 126 ? 56.980  100.871 -16.113 1.00 85.04  ? 104 PHE A CB  1 
ATOM   784  C CG  . PHE A 1 126 ? 57.350  102.265 -15.712 1.00 81.17  ? 104 PHE A CG  1 
ATOM   785  C CD1 . PHE A 1 126 ? 57.446  102.613 -14.382 1.00 82.01  ? 104 PHE A CD1 1 
ATOM   786  C CD2 . PHE A 1 126 ? 57.530  103.251 -16.673 1.00 87.22  ? 104 PHE A CD2 1 
ATOM   787  C CE1 . PHE A 1 126 ? 57.757  103.916 -14.013 1.00 90.19  ? 104 PHE A CE1 1 
ATOM   788  C CE2 . PHE A 1 126 ? 57.843  104.550 -16.314 1.00 91.80  ? 104 PHE A CE2 1 
ATOM   789  C CZ  . PHE A 1 126 ? 57.954  104.884 -14.984 1.00 98.99  ? 104 PHE A CZ  1 
ATOM   790  N N   . LEU A 1 127 ? 55.140  98.334  -16.259 1.00 69.60  ? 105 LEU A N   1 
ATOM   791  C CA  . LEU A 1 127 ? 55.218  96.968  -16.769 1.00 71.58  ? 105 LEU A CA  1 
ATOM   792  C C   . LEU A 1 127 ? 53.883  96.460  -17.313 1.00 78.06  ? 105 LEU A C   1 
ATOM   793  O O   . LEU A 1 127 ? 53.842  95.852  -18.388 1.00 87.23  ? 105 LEU A O   1 
ATOM   794  C CB  . LEU A 1 127 ? 55.758  96.043  -15.681 1.00 79.74  ? 105 LEU A CB  1 
ATOM   795  C CG  . LEU A 1 127 ? 57.257  96.242  -15.411 1.00 81.89  ? 105 LEU A CG  1 
ATOM   796  C CD1 . LEU A 1 127 ? 57.767  95.383  -14.238 1.00 72.71  ? 105 LEU A CD1 1 
ATOM   797  C CD2 . LEU A 1 127 ? 58.053  95.963  -16.675 1.00 72.29  ? 105 LEU A CD2 1 
ATOM   798  N N   . ILE A 1 128 ? 52.797  96.679  -16.579 1.00 83.24  ? 106 ILE A N   1 
ATOM   799  C CA  . ILE A 1 128 ? 51.481  96.210  -17.018 1.00 86.90  ? 106 ILE A CA  1 
ATOM   800  C C   . ILE A 1 128 ? 50.886  97.089  -18.116 1.00 97.35  ? 106 ILE A C   1 
ATOM   801  O O   . ILE A 1 128 ? 50.114  96.626  -18.955 1.00 99.33  ? 106 ILE A O   1 
ATOM   802  C CB  . ILE A 1 128 ? 50.489  96.135  -15.842 1.00 88.11  ? 106 ILE A CB  1 
ATOM   803  C CG1 . ILE A 1 128 ? 50.737  94.872  -15.015 1.00 82.27  ? 106 ILE A CG1 1 
ATOM   804  C CG2 . ILE A 1 128 ? 49.056  96.171  -16.350 1.00 68.00  ? 106 ILE A CG2 1 
ATOM   805  C CD1 . ILE A 1 128 ? 50.583  95.079  -13.524 1.00 67.96  ? 106 ILE A CD1 1 
ATOM   806  N N   . PRO A 1 129 ? 51.260  98.361  -18.091 1.00 93.59  ? 107 PRO A N   1 
ATOM   807  C CA  . PRO A 1 129 ? 50.809  99.333  -19.023 1.00 92.49  ? 107 PRO A CA  1 
ATOM   808  C C   . PRO A 1 129 ? 51.452  99.254  -20.348 1.00 97.78  ? 107 PRO A C   1 
ATOM   809  O O   . PRO A 1 129 ? 50.832  99.701  -21.251 1.00 109.43 ? 107 PRO A O   1 
ATOM   810  C CB  . PRO A 1 129 ? 51.142  100.590 -18.312 1.00 85.80  ? 107 PRO A CB  1 
ATOM   811  C CG  . PRO A 1 129 ? 50.887  100.241 -16.914 1.00 81.99  ? 107 PRO A CG  1 
ATOM   812  C CD  . PRO A 1 129 ? 50.895  98.757  -16.762 1.00 92.20  ? 107 PRO A CD  1 
ATOM   813  N N   . ASN A 1 130 ? 52.630  98.710  -20.510 1.00 98.16  ? 108 ASN A N   1 
ATOM   814  C CA  . ASN A 1 130 ? 53.190  98.546  -21.785 1.00 110.38 ? 108 ASN A CA  1 
ATOM   815  C C   . ASN A 1 130 ? 52.655  97.222  -22.196 1.00 114.21 ? 108 ASN A C   1 
ATOM   816  O O   . ASN A 1 130 ? 51.601  97.182  -22.740 1.00 119.26 ? 108 ASN A O   1 
ATOM   817  C CB  . ASN A 1 130 ? 54.659  98.618  -21.665 1.00 109.89 ? 108 ASN A CB  1 
ATOM   818  C CG  . ASN A 1 130 ? 55.099  99.991  -21.247 1.00 114.51 ? 108 ASN A CG  1 
ATOM   819  O OD1 . ASN A 1 130 ? 54.306  100.780 -20.771 1.00 117.99 ? 108 ASN A OD1 1 
ATOM   820  N ND2 . ASN A 1 130 ? 56.360  100.292 -21.447 1.00 116.69 ? 108 ASN A ND2 1 
ATOM   821  N N   . ALA A 1 131 ? 53.375  96.144  -22.044 1.00 107.18 ? 109 ALA A N   1 
ATOM   822  C CA  . ALA A 1 131 ? 52.822  94.821  -22.322 1.00 102.26 ? 109 ALA A CA  1 
ATOM   823  C C   . ALA A 1 131 ? 52.032  94.547  -23.585 1.00 102.71 ? 109 ALA A C   1 
ATOM   824  O O   . ALA A 1 131 ? 50.837  94.371  -23.571 1.00 98.89  ? 109 ALA A O   1 
ATOM   825  C CB  . ALA A 1 131 ? 51.991  94.418  -21.148 1.00 98.35  ? 109 ALA A CB  1 
ATOM   826  N N   . SER A 1 132 ? 52.730  94.513  -24.686 1.00 106.74 ? 110 SER A N   1 
ATOM   827  C CA  . SER A 1 132 ? 52.121  94.266  -25.942 1.00 105.71 ? 110 SER A CA  1 
ATOM   828  C C   . SER A 1 132 ? 51.519  92.907  -25.973 1.00 100.00 ? 110 SER A C   1 
ATOM   829  O O   . SER A 1 132 ? 50.360  92.761  -26.207 1.00 102.35 ? 110 SER A O   1 
ATOM   830  C CB  . SER A 1 132 ? 53.193  94.326  -26.972 1.00 109.73 ? 110 SER A CB  1 
ATOM   831  O OG  . SER A 1 132 ? 54.166  93.384  -26.655 1.00 111.95 ? 110 SER A OG  1 
ATOM   832  N N   . GLN A 1 133 ? 52.327  91.906  -25.734 1.00 93.94  ? 111 GLN A N   1 
ATOM   833  C CA  . GLN A 1 133 ? 51.911  90.526  -25.760 1.00 91.88  ? 111 GLN A CA  1 
ATOM   834  C C   . GLN A 1 133 ? 50.982  90.045  -24.664 1.00 94.43  ? 111 GLN A C   1 
ATOM   835  O O   . GLN A 1 133 ? 50.558  90.802  -23.866 1.00 105.94 ? 111 GLN A O   1 
ATOM   836  C CB  . GLN A 1 133 ? 53.151  89.728  -25.600 1.00 87.14  ? 111 GLN A CB  1 
ATOM   837  C CG  . GLN A 1 133 ? 53.552  88.914  -26.766 1.00 102.07 ? 111 GLN A CG  1 
ATOM   838  C CD  . GLN A 1 133 ? 54.843  89.371  -27.288 1.00 107.58 ? 111 GLN A CD  1 
ATOM   839  O OE1 . GLN A 1 133 ? 54.968  90.492  -27.673 1.00 108.13 ? 111 GLN A OE1 1 
ATOM   840  N NE2 . GLN A 1 133 ? 55.815  88.516  -27.292 1.00 109.91 ? 111 GLN A NE2 1 
ATOM   841  N N   . ALA A 1 134 ? 50.612  88.779  -24.709 1.00 92.22  ? 112 ALA A N   1 
ATOM   842  C CA  . ALA A 1 134 ? 49.844  88.093  -23.678 1.00 89.28  ? 112 ALA A CA  1 
ATOM   843  C C   . ALA A 1 134 ? 50.735  87.294  -22.749 1.00 89.06  ? 112 ALA A C   1 
ATOM   844  O O   . ALA A 1 134 ? 50.429  87.172  -21.560 1.00 84.35  ? 112 ALA A O   1 
ATOM   845  C CB  . ALA A 1 134 ? 48.806  87.163  -24.310 1.00 72.62  ? 112 ALA A CB  1 
ATOM   846  N N   . GLU A 1 135 ? 51.818  86.727  -23.281 1.00 99.50  ? 113 GLU A N   1 
ATOM   847  C CA  . GLU A 1 135 ? 52.814  86.079  -22.439 1.00 92.77  ? 113 GLU A CA  1 
ATOM   848  C C   . GLU A 1 135 ? 53.283  87.035  -21.358 1.00 83.79  ? 113 GLU A C   1 
ATOM   849  O O   . GLU A 1 135 ? 53.384  86.666  -20.186 1.00 83.50  ? 113 GLU A O   1 
ATOM   850  C CB  . GLU A 1 135 ? 53.984  85.599  -23.296 1.00 99.49  ? 113 GLU A CB  1 
ATOM   851  C CG  . GLU A 1 135 ? 55.143  85.010  -22.548 1.00 98.61  ? 113 GLU A CG  1 
ATOM   852  C CD  . GLU A 1 135 ? 56.355  84.830  -23.446 1.00 118.90 ? 113 GLU A CD  1 
ATOM   853  O OE1 . GLU A 1 135 ? 56.171  84.588  -24.664 1.00 129.78 ? 113 GLU A OE1 1 
ATOM   854  O OE2 . GLU A 1 135 ? 57.493  84.950  -22.942 1.00 116.83 ? 113 GLU A OE2 1 
ATOM   855  N N   . SER A 1 136 ? 53.558  88.284  -21.734 1.00 84.29  ? 114 SER A N   1 
ATOM   856  C CA  . SER A 1 136 ? 54.021  89.257  -20.751 1.00 83.05  ? 114 SER A CA  1 
ATOM   857  C C   . SER A 1 136 ? 52.897  89.717  -19.831 1.00 81.73  ? 114 SER A C   1 
ATOM   858  O O   . SER A 1 136 ? 53.107  89.837  -18.620 1.00 83.85  ? 114 SER A O   1 
ATOM   859  C CB  . SER A 1 136 ? 54.685  90.449  -21.440 1.00 87.43  ? 114 SER A CB  1 
ATOM   860  O OG  . SER A 1 136 ? 56.001  90.115  -21.850 1.00 88.65  ? 114 SER A OG  1 
ATOM   861  N N   . LYS A 1 137 ? 51.702  89.988  -20.368 1.00 84.96  ? 115 LYS A N   1 
ATOM   862  C CA  . LYS A 1 137 ? 50.627  90.479  -19.504 1.00 78.67  ? 115 LYS A CA  1 
ATOM   863  C C   . LYS A 1 137 ? 50.362  89.507  -18.356 1.00 77.09  ? 115 LYS A C   1 
ATOM   864  O O   . LYS A 1 137 ? 50.357  89.902  -17.182 1.00 83.89  ? 115 LYS A O   1 
ATOM   865  C CB  . LYS A 1 137 ? 49.350  90.729  -20.307 1.00 69.97  ? 115 LYS A CB  1 
ATOM   866  N N   . VAL A 1 138 ? 50.246  88.212  -18.665 1.00 70.24  ? 116 VAL A N   1 
ATOM   867  C CA  . VAL A 1 138 ? 50.044  87.216  -17.615 1.00 69.58  ? 116 VAL A CA  1 
ATOM   868  C C   . VAL A 1 138 ? 51.220  87.216  -16.635 1.00 77.09  ? 116 VAL A C   1 
ATOM   869  O O   . VAL A 1 138 ? 51.021  87.190  -15.411 1.00 84.34  ? 116 VAL A O   1 
ATOM   870  C CB  . VAL A 1 138 ? 49.832  85.821  -18.229 1.00 62.05  ? 116 VAL A CB  1 
ATOM   871  C CG1 . VAL A 1 138 ? 50.066  84.738  -17.178 1.00 57.72  ? 116 VAL A CG1 1 
ATOM   872  C CG2 . VAL A 1 138 ? 48.470  85.704  -18.896 1.00 60.40  ? 116 VAL A CG2 1 
ATOM   873  N N   . PHE A 1 139 ? 52.461  87.251  -17.152 1.00 64.77  ? 117 PHE A N   1 
ATOM   874  C CA  . PHE A 1 139 ? 53.637  87.231  -16.280 1.00 58.96  ? 117 PHE A CA  1 
ATOM   875  C C   . PHE A 1 139 ? 53.589  88.368  -15.268 1.00 68.31  ? 117 PHE A C   1 
ATOM   876  O O   . PHE A 1 139 ? 53.808  88.158  -14.065 1.00 74.46  ? 117 PHE A O   1 
ATOM   877  C CB  . PHE A 1 139 ? 54.927  87.305  -17.103 1.00 62.86  ? 117 PHE A CB  1 
ATOM   878  C CG  . PHE A 1 139 ? 56.198  87.324  -16.274 1.00 67.63  ? 117 PHE A CG  1 
ATOM   879  C CD1 . PHE A 1 139 ? 56.705  88.527  -15.782 1.00 76.57  ? 117 PHE A CD1 1 
ATOM   880  C CD2 . PHE A 1 139 ? 56.883  86.152  -15.984 1.00 67.96  ? 117 PHE A CD2 1 
ATOM   881  C CE1 . PHE A 1 139 ? 57.880  88.566  -15.018 1.00 70.11  ? 117 PHE A CE1 1 
ATOM   882  C CE2 . PHE A 1 139 ? 58.052  86.175  -15.219 1.00 74.48  ? 117 PHE A CE2 1 
ATOM   883  C CZ  . PHE A 1 139 ? 58.556  87.386  -14.737 1.00 68.90  ? 117 PHE A CZ  1 
ATOM   884  N N   . TYR A 1 140 ? 53.330  89.588  -15.736 1.00 62.73  ? 118 TYR A N   1 
ATOM   885  C CA  . TYR A 1 140 ? 53.334  90.704  -14.806 1.00 66.14  ? 118 TYR A CA  1 
ATOM   886  C C   . TYR A 1 140 ? 52.096  90.745  -13.915 1.00 77.32  ? 118 TYR A C   1 
ATOM   887  O O   . TYR A 1 140 ? 52.148  91.349  -12.836 1.00 86.06  ? 118 TYR A O   1 
ATOM   888  C CB  . TYR A 1 140 ? 53.481  92.018  -15.542 1.00 72.96  ? 118 TYR A CB  1 
ATOM   889  C CG  . TYR A 1 140 ? 54.826  92.197  -16.225 1.00 84.83  ? 118 TYR A CG  1 
ATOM   890  C CD1 . TYR A 1 140 ? 55.989  92.368  -15.484 1.00 89.54  ? 118 TYR A CD1 1 
ATOM   891  C CD2 . TYR A 1 140 ? 54.920  92.280  -17.607 1.00 90.28  ? 118 TYR A CD2 1 
ATOM   892  C CE1 . TYR A 1 140 ? 57.216  92.559  -16.103 1.00 89.33  ? 118 TYR A CE1 1 
ATOM   893  C CE2 . TYR A 1 140 ? 56.135  92.478  -18.233 1.00 94.01  ? 118 TYR A CE2 1 
ATOM   894  C CZ  . TYR A 1 140 ? 57.281  92.621  -17.479 1.00 92.23  ? 118 TYR A CZ  1 
ATOM   895  O OH  . TYR A 1 140 ? 58.492  92.822  -18.103 1.00 96.70  ? 118 TYR A OH  1 
ATOM   896  N N   . LEU A 1 141 ? 50.985  90.111  -14.296 1.00 80.44  ? 119 LEU A N   1 
ATOM   897  C CA  . LEU A 1 141 ? 49.891  90.146  -13.336 1.00 78.26  ? 119 LEU A CA  1 
ATOM   898  C C   . LEU A 1 141 ? 49.944  89.007  -12.343 1.00 78.81  ? 119 LEU A C   1 
ATOM   899  O O   . LEU A 1 141 ? 49.362  89.134  -11.268 1.00 89.54  ? 119 LEU A O   1 
ATOM   900  C CB  . LEU A 1 141 ? 48.511  90.141  -13.993 1.00 70.25  ? 119 LEU A CB  1 
ATOM   901  C CG  . LEU A 1 141 ? 48.087  91.297  -14.884 1.00 67.32  ? 119 LEU A CG  1 
ATOM   902  C CD1 . LEU A 1 141 ? 46.953  90.821  -15.743 1.00 67.50  ? 119 LEU A CD1 1 
ATOM   903  C CD2 . LEU A 1 141 ? 47.682  92.494  -14.065 1.00 66.75  ? 119 LEU A CD2 1 
ATOM   904  N N   . LYS A 1 142 ? 50.641  87.915  -12.645 1.00 72.30  ? 120 LYS A N   1 
ATOM   905  C CA  . LYS A 1 142 ? 50.970  86.989  -11.571 1.00 64.16  ? 120 LYS A CA  1 
ATOM   906  C C   . LYS A 1 142 ? 51.977  87.637  -10.635 1.00 72.26  ? 120 LYS A C   1 
ATOM   907  O O   . LYS A 1 142 ? 51.870  87.510  -9.417  1.00 75.77  ? 120 LYS A O   1 
ATOM   908  C CB  . LYS A 1 142 ? 51.502  85.664  -12.130 1.00 56.84  ? 120 LYS A CB  1 
ATOM   909  C CG  . LYS A 1 142 ? 52.637  85.059  -11.321 1.00 59.34  ? 120 LYS A CG  1 
ATOM   910  C CD  . LYS A 1 142 ? 53.081  83.657  -11.797 1.00 60.11  ? 120 LYS A CD  1 
ATOM   911  C CE  . LYS A 1 142 ? 54.516  83.325  -11.316 1.00 61.92  ? 120 LYS A CE  1 
ATOM   912  N NZ  . LYS A 1 142 ? 55.627  84.044  -12.107 1.00 67.48  ? 120 LYS A NZ  1 
ATOM   913  N N   . MET A 1 143 ? 52.949  88.367  -11.193 1.00 79.80  ? 121 MET A N   1 
ATOM   914  C CA  . MET A 1 143 ? 53.918  89.089  -10.367 1.00 71.73  ? 121 MET A CA  1 
ATOM   915  C C   . MET A 1 143 ? 53.228  90.092  -9.449  1.00 74.74  ? 121 MET A C   1 
ATOM   916  O O   . MET A 1 143 ? 53.637  90.269  -8.296  1.00 73.14  ? 121 MET A O   1 
ATOM   917  C CB  . MET A 1 143 ? 54.951  89.785  -11.263 1.00 64.19  ? 121 MET A CB  1 
ATOM   918  C CG  . MET A 1 143 ? 56.092  90.418  -10.536 1.00 64.02  ? 121 MET A CG  1 
ATOM   919  S SD  . MET A 1 143 ? 57.499  90.748  -11.600 1.00 77.25  ? 121 MET A SD  1 
ATOM   920  C CE  . MET A 1 143 ? 57.995  92.383  -11.067 1.00 68.14  ? 121 MET A CE  1 
ATOM   921  N N   . LYS A 1 144 ? 52.171  90.754  -9.940  1.00 72.27  ? 122 LYS A N   1 
ATOM   922  C CA  . LYS A 1 144 ? 51.391  91.635  -9.077  1.00 65.94  ? 122 LYS A CA  1 
ATOM   923  C C   . LYS A 1 144 ? 50.711  90.836  -7.977  1.00 67.94  ? 122 LYS A C   1 
ATOM   924  O O   . LYS A 1 144 ? 50.729  91.229  -6.806  1.00 79.10  ? 122 LYS A O   1 
ATOM   925  C CB  . LYS A 1 144 ? 50.356  92.400  -9.890  1.00 66.64  ? 122 LYS A CB  1 
ATOM   926  C CG  . LYS A 1 144 ? 49.685  93.545  -9.151  1.00 63.45  ? 122 LYS A CG  1 
ATOM   927  C CD  . LYS A 1 144 ? 48.379  93.877  -9.852  1.00 69.44  ? 122 LYS A CD  1 
ATOM   928  C CE  . LYS A 1 144 ? 47.816  95.216  -9.440  1.00 81.16  ? 122 LYS A CE  1 
ATOM   929  N NZ  . LYS A 1 144 ? 46.585  95.497  -10.239 1.00 78.98  ? 122 LYS A NZ  1 
ATOM   930  N N   . GLY A 1 145 ? 50.106  89.703  -8.336  1.00 65.56  ? 123 GLY A N   1 
ATOM   931  C CA  . GLY A 1 145 ? 49.493  88.855  -7.328  1.00 60.80  ? 123 GLY A CA  1 
ATOM   932  C C   . GLY A 1 145 ? 50.486  88.392  -6.283  1.00 62.62  ? 123 GLY A C   1 
ATOM   933  O O   . GLY A 1 145 ? 50.208  88.457  -5.087  1.00 67.89  ? 123 GLY A O   1 
ATOM   934  N N   . ASP A 1 146 ? 51.682  87.975  -6.720  1.00 67.49  ? 124 ASP A N   1 
ATOM   935  C CA  . ASP A 1 146 ? 52.743  87.534  -5.818  1.00 63.25  ? 124 ASP A CA  1 
ATOM   936  C C   . ASP A 1 146 ? 53.067  88.607  -4.781  1.00 65.04  ? 124 ASP A C   1 
ATOM   937  O O   . ASP A 1 146 ? 52.923  88.394  -3.574  1.00 64.73  ? 124 ASP A O   1 
ATOM   938  C CB  . ASP A 1 146 ? 54.011  87.185  -6.619  1.00 58.94  ? 124 ASP A CB  1 
ATOM   939  C CG  . ASP A 1 146 ? 53.897  85.872  -7.423  1.00 56.45  ? 124 ASP A CG  1 
ATOM   940  O OD1 . ASP A 1 146 ? 53.127  84.976  -7.027  1.00 58.59  ? 124 ASP A OD1 1 
ATOM   941  O OD2 . ASP A 1 146 ? 54.627  85.716  -8.439  1.00 59.06  ? 124 ASP A OD2 1 
ATOM   942  N N   . TYR A 1 147 ? 53.487  89.787  -5.245  1.00 64.72  ? 125 TYR A N   1 
ATOM   943  C CA  . TYR A 1 147 ? 53.943  90.831  -4.336  1.00 61.03  ? 125 TYR A CA  1 
ATOM   944  C C   . TYR A 1 147 ? 52.811  91.440  -3.494  1.00 76.24  ? 125 TYR A C   1 
ATOM   945  O O   . TYR A 1 147 ? 53.104  92.035  -2.448  1.00 89.37  ? 125 TYR A O   1 
ATOM   946  C CB  . TYR A 1 147 ? 54.697  91.909  -5.132  1.00 56.32  ? 125 TYR A CB  1 
ATOM   947  C CG  . TYR A 1 147 ? 56.110  91.470  -5.522  1.00 67.31  ? 125 TYR A CG  1 
ATOM   948  C CD1 . TYR A 1 147 ? 56.339  90.731  -6.684  1.00 63.39  ? 125 TYR A CD1 1 
ATOM   949  C CD2 . TYR A 1 147 ? 57.215  91.779  -4.716  1.00 70.96  ? 125 TYR A CD2 1 
ATOM   950  C CE1 . TYR A 1 147 ? 57.618  90.306  -7.028  1.00 60.37  ? 125 TYR A CE1 1 
ATOM   951  C CE2 . TYR A 1 147 ? 58.498  91.364  -5.061  1.00 72.63  ? 125 TYR A CE2 1 
ATOM   952  C CZ  . TYR A 1 147 ? 58.700  90.628  -6.219  1.00 71.02  ? 125 TYR A CZ  1 
ATOM   953  O OH  . TYR A 1 147 ? 59.977  90.216  -6.574  1.00 68.05  ? 125 TYR A OH  1 
ATOM   954  N N   . TYR A 1 148 ? 51.530  91.274  -3.870  1.00 68.62  ? 126 TYR A N   1 
ATOM   955  C CA  . TYR A 1 148 ? 50.497  91.611  -2.890  1.00 69.49  ? 126 TYR A CA  1 
ATOM   956  C C   . TYR A 1 148 ? 50.364  90.503  -1.854  1.00 70.73  ? 126 TYR A C   1 
ATOM   957  O O   . TYR A 1 148 ? 50.101  90.782  -0.686  1.00 82.40  ? 126 TYR A O   1 
ATOM   958  C CB  . TYR A 1 148 ? 49.141  91.903  -3.557  1.00 61.92  ? 126 TYR A CB  1 
ATOM   959  C CG  . TYR A 1 148 ? 48.910  93.371  -3.873  1.00 62.37  ? 126 TYR A CG  1 
ATOM   960  C CD1 . TYR A 1 148 ? 48.845  94.311  -2.857  1.00 68.38  ? 126 TYR A CD1 1 
ATOM   961  C CD2 . TYR A 1 148 ? 48.743  93.817  -5.180  1.00 60.09  ? 126 TYR A CD2 1 
ATOM   962  C CE1 . TYR A 1 148 ? 48.639  95.662  -3.126  1.00 63.03  ? 126 TYR A CE1 1 
ATOM   963  C CE2 . TYR A 1 148 ? 48.549  95.171  -5.461  1.00 62.42  ? 126 TYR A CE2 1 
ATOM   964  C CZ  . TYR A 1 148 ? 48.497  96.088  -4.418  1.00 64.27  ? 126 TYR A CZ  1 
ATOM   965  O OH  . TYR A 1 148 ? 48.311  97.442  -4.624  1.00 70.18  ? 126 TYR A OH  1 
ATOM   966  N N   . ARG A 1 149 ? 50.742  89.315  -2.193  1.00 65.11  ? 127 ARG A N   1 
ATOM   967  C CA  . ARG A 1 149 ? 50.687  88.211  -1.291  1.00 64.82  ? 127 ARG A CA  1 
ATOM   968  C C   . ARG A 1 149 ? 51.753  88.388  -0.311  1.00 72.63  ? 127 ARG A C   1 
ATOM   969  O O   . ARG A 1 149 ? 51.612  88.195  0.818   1.00 70.35  ? 127 ARG A O   1 
ATOM   970  C CB  . ARG A 1 149 ? 50.972  86.998  -2.072  1.00 52.86  ? 127 ARG A CB  1 
ATOM   971  C CG  . ARG A 1 149 ? 50.958  85.752  -1.330  1.00 51.73  ? 127 ARG A CG  1 
ATOM   972  C CD  . ARG A 1 149 ? 50.824  84.633  -2.275  1.00 52.58  ? 127 ARG A CD  1 
ATOM   973  N NE  . ARG A 1 149 ? 51.908  83.713  -2.186  1.00 70.99  ? 127 ARG A NE  1 
ATOM   974  C CZ  . ARG A 1 149 ? 52.894  83.698  -3.028  1.00 83.67  ? 127 ARG A CZ  1 
ATOM   975  N NH1 . ARG A 1 149 ? 52.915  84.540  -3.964  1.00 71.50  ? 127 ARG A NH1 1 
ATOM   976  N NH2 . ARG A 1 149 ? 53.866  82.883  -2.922  1.00 104.38 ? 127 ARG A NH2 1 
ATOM   977  N N   . TYR A 1 150 ? 52.899  88.695  -0.775  1.00 65.73  ? 128 TYR A N   1 
ATOM   978  C CA  . TYR A 1 150 ? 53.978  88.985  0.162   1.00 57.65  ? 128 TYR A CA  1 
ATOM   979  C C   . TYR A 1 150 ? 53.521  90.006  1.190   1.00 69.45  ? 128 TYR A C   1 
ATOM   980  O O   . TYR A 1 150 ? 53.902  89.933  2.373   1.00 83.33  ? 128 TYR A O   1 
ATOM   981  C CB  . TYR A 1 150 ? 55.231  89.484  -0.584  1.00 47.25  ? 128 TYR A CB  1 
ATOM   982  C CG  . TYR A 1 150 ? 55.757  88.451  -1.520  1.00 46.27  ? 128 TYR A CG  1 
ATOM   983  C CD1 . TYR A 1 150 ? 55.493  87.108  -1.281  1.00 42.52  ? 128 TYR A CD1 1 
ATOM   984  C CD2 . TYR A 1 150 ? 56.458  88.805  -2.685  1.00 54.26  ? 128 TYR A CD2 1 
ATOM   985  C CE1 . TYR A 1 150 ? 55.932  86.138  -2.154  1.00 55.25  ? 128 TYR A CE1 1 
ATOM   986  C CE2 . TYR A 1 150 ? 56.900  87.828  -3.590  1.00 47.46  ? 128 TYR A CE2 1 
ATOM   987  C CZ  . TYR A 1 150 ? 56.622  86.500  -3.310  1.00 51.53  ? 128 TYR A CZ  1 
ATOM   988  O OH  . TYR A 1 150 ? 57.022  85.512  -4.161  1.00 48.43  ? 128 TYR A OH  1 
ATOM   989  N N   . LEU A 1 151 ? 52.709  90.970  0.751   1.00 54.54  ? 129 LEU A N   1 
ATOM   990  C CA  . LEU A 1 151 ? 52.192  91.977  1.667   1.00 63.56  ? 129 LEU A CA  1 
ATOM   991  C C   . LEU A 1 151 ? 51.165  91.380  2.612   1.00 72.60  ? 129 LEU A C   1 
ATOM   992  O O   . LEU A 1 151 ? 51.093  91.764  3.785   1.00 74.98  ? 129 LEU A O   1 
ATOM   993  C CB  . LEU A 1 151 ? 51.587  93.136  0.879   1.00 62.26  ? 129 LEU A CB  1 
ATOM   994  C CG  . LEU A 1 151 ? 52.636  94.132  0.410   1.00 60.00  ? 129 LEU A CG  1 
ATOM   995  C CD1 . LEU A 1 151 ? 52.015  95.311  -0.325  1.00 66.33  ? 129 LEU A CD1 1 
ATOM   996  C CD2 . LEU A 1 151 ? 53.446  94.580  1.615   1.00 54.79  ? 129 LEU A CD2 1 
ATOM   997  N N   . ALA A 1 152 ? 50.371  90.432  2.114   1.00 75.01  ? 130 ALA A N   1 
ATOM   998  C CA  . ALA A 1 152 ? 49.371  89.771  2.938   1.00 71.39  ? 130 ALA A CA  1 
ATOM   999  C C   . ALA A 1 152 ? 50.018  88.844  3.958   1.00 76.52  ? 130 ALA A C   1 
ATOM   1000 O O   . ALA A 1 152 ? 49.505  88.706  5.079   1.00 80.30  ? 130 ALA A O   1 
ATOM   1001 C CB  . ALA A 1 152 ? 48.393  89.009  2.045   1.00 56.89  ? 130 ALA A CB  1 
ATOM   1002 N N   . GLU A 1 153 ? 51.139  88.204  3.586   1.00 75.28  ? 131 GLU A N   1 
ATOM   1003 C CA  . GLU A 1 153 ? 51.914  87.385  4.520   1.00 69.23  ? 131 GLU A CA  1 
ATOM   1004 C C   . GLU A 1 153 ? 52.295  88.177  5.761   1.00 73.42  ? 131 GLU A C   1 
ATOM   1005 O O   . GLU A 1 153 ? 52.506  87.595  6.836   1.00 56.92  ? 131 GLU A O   1 
ATOM   1006 C CB  . GLU A 1 153 ? 53.168  86.860  3.829   1.00 67.37  ? 131 GLU A CB  1 
ATOM   1007 C CG  . GLU A 1 153 ? 52.904  85.730  2.845   1.00 70.70  ? 131 GLU A CG  1 
ATOM   1008 C CD  . GLU A 1 153 ? 54.181  85.116  2.286   1.00 68.83  ? 131 GLU A CD  1 
ATOM   1009 O OE1 . GLU A 1 153 ? 54.097  83.940  1.834   1.00 63.68  ? 131 GLU A OE1 1 
ATOM   1010 O OE2 . GLU A 1 153 ? 55.242  85.813  2.311   1.00 61.29  ? 131 GLU A OE2 1 
ATOM   1011 N N   . VAL A 1 154 ? 52.316  89.496  5.624   1.00 77.30  ? 132 VAL A N   1 
ATOM   1012 C CA  . VAL A 1 154 ? 52.773  90.410  6.662   1.00 79.58  ? 132 VAL A CA  1 
ATOM   1013 C C   . VAL A 1 154 ? 51.665  91.318  7.166   1.00 87.74  ? 132 VAL A C   1 
ATOM   1014 O O   . VAL A 1 154 ? 51.742  91.776  8.318   1.00 91.81  ? 132 VAL A O   1 
ATOM   1015 C CB  . VAL A 1 154 ? 53.953  91.244  6.116   1.00 81.90  ? 132 VAL A CB  1 
ATOM   1016 C CG1 . VAL A 1 154 ? 54.067  92.584  6.786   1.00 90.66  ? 132 VAL A CG1 1 
ATOM   1017 C CG2 . VAL A 1 154 ? 55.240  90.470  6.300   1.00 82.12  ? 132 VAL A CG2 1 
ATOM   1018 N N   . ALA A 1 155 ? 50.612  91.544  6.388   1.00 98.49  ? 133 ALA A N   1 
ATOM   1019 C CA  . ALA A 1 155 ? 49.556  92.475  6.758   1.00 103.18 ? 133 ALA A CA  1 
ATOM   1020 C C   . ALA A 1 155 ? 48.771  91.972  7.965   1.00 100.70 ? 133 ALA A C   1 
ATOM   1021 O O   . ALA A 1 155 ? 48.566  90.769  8.153   1.00 100.35 ? 133 ALA A O   1 
ATOM   1022 C CB  . ALA A 1 155 ? 48.607  92.702  5.586   1.00 111.80 ? 133 ALA A CB  1 
ATOM   1023 N N   . ALA A 1 156 ? 48.345  92.913  8.798   1.00 99.81  ? 134 ALA A N   1 
ATOM   1024 C CA  . ALA A 1 156 ? 47.537  92.605  9.962   1.00 110.71 ? 134 ALA A CA  1 
ATOM   1025 C C   . ALA A 1 156 ? 46.348  93.555  10.045  1.00 126.35 ? 134 ALA A C   1 
ATOM   1026 O O   . ALA A 1 156 ? 46.466  94.744  9.732   1.00 133.67 ? 134 ALA A O   1 
ATOM   1027 C CB  . ALA A 1 156 ? 48.377  92.697  11.234  1.00 112.66 ? 134 ALA A CB  1 
ATOM   1028 N N   . GLY A 1 157 ? 45.201  93.010  10.446  1.00 131.04 ? 135 GLY A N   1 
ATOM   1029 C CA  . GLY A 1 157 ? 44.015  93.816  10.705  1.00 143.33 ? 135 GLY A CA  1 
ATOM   1030 C C   . GLY A 1 157 ? 43.556  94.703  9.561   1.00 146.02 ? 135 GLY A C   1 
ATOM   1031 O O   . GLY A 1 157 ? 43.394  94.257  8.415   1.00 142.19 ? 135 GLY A O   1 
ATOM   1032 N N   . ASP A 1 158 ? 43.307  95.971  9.912   1.00 151.72 ? 136 ASP A N   1 
ATOM   1033 C CA  . ASP A 1 158 ? 42.765  97.039  9.070   1.00 150.78 ? 136 ASP A CA  1 
ATOM   1034 C C   . ASP A 1 158 ? 43.026  96.900  7.572   1.00 140.51 ? 136 ASP A C   1 
ATOM   1035 O O   . ASP A 1 158 ? 42.086  96.823  6.774   1.00 134.55 ? 136 ASP A O   1 
ATOM   1036 C CB  . ASP A 1 158 ? 43.322  98.384  9.551   1.00 150.48 ? 136 ASP A CB  1 
ATOM   1037 C CG  . ASP A 1 158 ? 43.433  98.462  11.063  1.00 149.11 ? 136 ASP A CG  1 
ATOM   1038 O OD1 . ASP A 1 158 ? 42.556  99.086  11.704  1.00 155.86 ? 136 ASP A OD1 1 
ATOM   1039 O OD2 . ASP A 1 158 ? 44.398  97.889  11.610  1.00 141.14 ? 136 ASP A OD2 1 
ATOM   1040 N N   . ASP A 1 159 ? 44.293  96.856  7.174   1.00 131.56 ? 137 ASP A N   1 
ATOM   1041 C CA  . ASP A 1 159 ? 44.591  96.908  5.755   1.00 115.49 ? 137 ASP A CA  1 
ATOM   1042 C C   . ASP A 1 159 ? 44.738  95.534  5.122   1.00 104.51 ? 137 ASP A C   1 
ATOM   1043 O O   . ASP A 1 159 ? 44.836  95.458  3.894   1.00 110.86 ? 137 ASP A O   1 
ATOM   1044 C CB  . ASP A 1 159 ? 45.868  97.720  5.516   1.00 108.01 ? 137 ASP A CB  1 
ATOM   1045 N N   . LYS A 1 160 ? 44.735  94.451  5.909   1.00 98.39  ? 138 LYS A N   1 
ATOM   1046 C CA  . LYS A 1 160 ? 44.898  93.113  5.333   1.00 81.62  ? 138 LYS A CA  1 
ATOM   1047 C C   . LYS A 1 160 ? 43.784  92.765  4.349   1.00 82.55  ? 138 LYS A C   1 
ATOM   1048 O O   . LYS A 1 160 ? 44.058  92.263  3.253   1.00 94.02  ? 138 LYS A O   1 
ATOM   1049 C CB  . LYS A 1 160 ? 44.993  92.031  6.406   1.00 87.95  ? 138 LYS A CB  1 
ATOM   1050 C CG  . LYS A 1 160 ? 44.879  90.667  5.741   1.00 90.25  ? 138 LYS A CG  1 
ATOM   1051 C CD  . LYS A 1 160 ? 45.624  89.540  6.417   1.00 91.98  ? 138 LYS A CD  1 
ATOM   1052 C CE  . LYS A 1 160 ? 44.869  88.231  6.229   1.00 99.94  ? 138 LYS A CE  1 
ATOM   1053 N NZ  . LYS A 1 160 ? 45.535  87.078  6.883   1.00 100.59 ? 138 LYS A NZ  1 
ATOM   1054 N N   . LYS A 1 161 ? 42.524  92.939  4.758   1.00 101.73 ? 139 LYS A N   1 
ATOM   1055 C CA  . LYS A 1 161 ? 41.403  92.555  3.898   1.00 107.88 ? 139 LYS A CA  1 
ATOM   1056 C C   . LYS A 1 161 ? 41.590  93.063  2.470   1.00 107.65 ? 139 LYS A C   1 
ATOM   1057 O O   . LYS A 1 161 ? 41.396  92.325  1.492   1.00 92.02  ? 139 LYS A O   1 
ATOM   1058 C CB  . LYS A 1 161 ? 40.096  93.083  4.484   1.00 99.26  ? 139 LYS A CB  1 
ATOM   1059 N N   . GLY A 1 162 ? 41.997  94.325  2.330   1.00 113.95 ? 140 GLY A N   1 
ATOM   1060 C CA  . GLY A 1 162 ? 42.164  94.899  1.010   1.00 108.80 ? 140 GLY A CA  1 
ATOM   1061 C C   . GLY A 1 162 ? 43.394  94.390  0.300   1.00 104.21 ? 140 GLY A C   1 
ATOM   1062 O O   . GLY A 1 162 ? 43.387  94.240  -0.925  1.00 107.23 ? 140 GLY A O   1 
ATOM   1063 N N   . ILE A 1 163 ? 44.468  94.132  1.053   1.00 95.85  ? 141 ILE A N   1 
ATOM   1064 C CA  . ILE A 1 163 ? 45.701  93.615  0.467   1.00 83.57  ? 141 ILE A CA  1 
ATOM   1065 C C   . ILE A 1 163 ? 45.496  92.212  -0.088  1.00 83.46  ? 141 ILE A C   1 
ATOM   1066 O O   . ILE A 1 163 ? 46.103  91.842  -1.098  1.00 85.03  ? 141 ILE A O   1 
ATOM   1067 C CB  . ILE A 1 163 ? 46.834  93.656  1.512   1.00 78.01  ? 141 ILE A CB  1 
ATOM   1068 C CG1 . ILE A 1 163 ? 47.210  95.100  1.842   1.00 82.93  ? 141 ILE A CG1 1 
ATOM   1069 C CG2 . ILE A 1 163 ? 48.025  92.871  1.057   1.00 67.67  ? 141 ILE A CG2 1 
ATOM   1070 C CD1 . ILE A 1 163 ? 48.089  95.230  3.058   1.00 87.15  ? 141 ILE A CD1 1 
ATOM   1071 N N   . VAL A 1 164 ? 44.648  91.407  0.548   1.00 87.91  ? 142 VAL A N   1 
ATOM   1072 C CA  . VAL A 1 164 ? 44.397  90.066  0.027   1.00 90.53  ? 142 VAL A CA  1 
ATOM   1073 C C   . VAL A 1 164 ? 43.546  90.158  -1.231  1.00 98.00  ? 142 VAL A C   1 
ATOM   1074 O O   . VAL A 1 164 ? 43.798  89.469  -2.228  1.00 99.79  ? 142 VAL A O   1 
ATOM   1075 C CB  . VAL A 1 164 ? 43.738  89.174  1.094   1.00 86.20  ? 142 VAL A CB  1 
ATOM   1076 C CG1 . VAL A 1 164 ? 43.165  87.917  0.451   1.00 75.21  ? 142 VAL A CG1 1 
ATOM   1077 C CG2 . VAL A 1 164 ? 44.742  88.807  2.172   1.00 82.79  ? 142 VAL A CG2 1 
ATOM   1078 N N   . ASP A 1 165 ? 42.534  91.025  -1.205  1.00 102.38 ? 143 ASP A N   1 
ATOM   1079 C CA  . ASP A 1 165 ? 41.661  91.187  -2.355  1.00 102.98 ? 143 ASP A CA  1 
ATOM   1080 C C   . ASP A 1 165 ? 42.435  91.687  -3.563  1.00 91.43  ? 143 ASP A C   1 
ATOM   1081 O O   . ASP A 1 165 ? 42.126  91.304  -4.694  1.00 86.66  ? 143 ASP A O   1 
ATOM   1082 C CB  . ASP A 1 165 ? 40.540  92.175  -2.010  1.00 116.62 ? 143 ASP A CB  1 
ATOM   1083 C CG  . ASP A 1 165 ? 39.167  91.521  -1.933  1.00 125.38 ? 143 ASP A CG  1 
ATOM   1084 O OD1 . ASP A 1 165 ? 39.059  90.303  -2.203  1.00 124.35 ? 143 ASP A OD1 1 
ATOM   1085 O OD2 . ASP A 1 165 ? 38.195  92.234  -1.583  1.00 129.32 ? 143 ASP A OD2 1 
ATOM   1086 N N   . GLN A 1 166 ? 43.482  92.487  -3.344  1.00 90.20  ? 144 GLN A N   1 
ATOM   1087 C CA  . GLN A 1 166 ? 44.218  93.037  -4.475  1.00 83.97  ? 144 GLN A CA  1 
ATOM   1088 C C   . GLN A 1 166 ? 45.067  91.973  -5.145  1.00 87.62  ? 144 GLN A C   1 
ATOM   1089 O O   . GLN A 1 166 ? 45.177  91.945  -6.376  1.00 93.83  ? 144 GLN A O   1 
ATOM   1090 C CB  . GLN A 1 166 ? 45.109  94.189  -4.001  1.00 77.47  ? 144 GLN A CB  1 
ATOM   1091 C CG  . GLN A 1 166 ? 44.434  95.551  -3.880  1.00 80.73  ? 144 GLN A CG  1 
ATOM   1092 C CD  . GLN A 1 166 ? 44.732  96.457  -5.064  1.00 92.33  ? 144 GLN A CD  1 
ATOM   1093 O OE1 . GLN A 1 166 ? 44.786  96.005  -6.218  1.00 100.65 ? 144 GLN A OE1 1 
ATOM   1094 N NE2 . GLN A 1 166 ? 44.945  97.741  -4.784  1.00 94.85  ? 144 GLN A NE2 1 
ATOM   1095 N N   . SER A 1 167 ? 45.622  91.057  -4.346  1.00 80.25  ? 145 SER A N   1 
ATOM   1096 C CA  . SER A 1 167 ? 46.365  89.917  -4.870  1.00 66.55  ? 145 SER A CA  1 
ATOM   1097 C C   . SER A 1 167 ? 45.444  88.949  -5.599  1.00 69.50  ? 145 SER A C   1 
ATOM   1098 O O   . SER A 1 167 ? 45.838  88.335  -6.592  1.00 61.73  ? 145 SER A O   1 
ATOM   1099 C CB  . SER A 1 167 ? 47.112  89.224  -3.719  1.00 61.38  ? 145 SER A CB  1 
ATOM   1100 O OG  . SER A 1 167 ? 47.472  87.880  -4.005  1.00 61.94  ? 145 SER A OG  1 
ATOM   1101 N N   . GLN A 1 168 ? 44.213  88.784  -5.124  1.00 79.35  ? 146 GLN A N   1 
ATOM   1102 C CA  . GLN A 1 168 ? 43.355  87.807  -5.778  1.00 70.83  ? 146 GLN A CA  1 
ATOM   1103 C C   . GLN A 1 168 ? 42.831  88.325  -7.108  1.00 77.40  ? 146 GLN A C   1 
ATOM   1104 O O   . GLN A 1 168 ? 42.583  87.525  -8.012  1.00 80.21  ? 146 GLN A O   1 
ATOM   1105 C CB  . GLN A 1 168 ? 42.203  87.405  -4.864  1.00 70.13  ? 146 GLN A CB  1 
ATOM   1106 C CG  . GLN A 1 168 ? 41.429  86.203  -5.387  1.00 85.28  ? 146 GLN A CG  1 
ATOM   1107 C CD  . GLN A 1 168 ? 40.308  85.732  -4.454  1.00 96.91  ? 146 GLN A CD  1 
ATOM   1108 O OE1 . GLN A 1 168 ? 39.995  86.367  -3.437  1.00 93.97  ? 146 GLN A OE1 1 
ATOM   1109 N NE2 . GLN A 1 168 ? 39.703  84.601  -4.802  1.00 106.33 ? 146 GLN A NE2 1 
ATOM   1110 N N   . GLN A 1 169 ? 42.642  89.642  -7.244  1.00 85.96  ? 147 GLN A N   1 
ATOM   1111 C CA  . GLN A 1 169 ? 42.198  90.209  -8.513  1.00 88.32  ? 147 GLN A CA  1 
ATOM   1112 C C   . GLN A 1 169 ? 43.325  90.258  -9.541  1.00 93.05  ? 147 GLN A C   1 
ATOM   1113 O O   . GLN A 1 169 ? 43.055  90.271  -10.749 1.00 104.32 ? 147 GLN A O   1 
ATOM   1114 C CB  . GLN A 1 169 ? 41.594  91.604  -8.300  1.00 87.71  ? 147 GLN A CB  1 
ATOM   1115 N N   . ALA A 1 170 ? 44.583  90.317  -9.096  1.00 80.27  ? 148 ALA A N   1 
ATOM   1116 C CA  . ALA A 1 170 ? 45.699  90.178  -10.030 1.00 74.51  ? 148 ALA A CA  1 
ATOM   1117 C C   . ALA A 1 170 ? 45.814  88.749  -10.537 1.00 74.55  ? 148 ALA A C   1 
ATOM   1118 O O   . ALA A 1 170 ? 45.947  88.512  -11.744 1.00 84.77  ? 148 ALA A O   1 
ATOM   1119 C CB  . ALA A 1 170 ? 47.010  90.604  -9.373  1.00 64.45  ? 148 ALA A CB  1 
ATOM   1120 N N   . TYR A 1 171 ? 45.796  87.782  -9.623  1.00 61.28  ? 149 TYR A N   1 
ATOM   1121 C CA  . TYR A 1 171 ? 45.893  86.387  -10.028 1.00 56.65  ? 149 TYR A CA  1 
ATOM   1122 C C   . TYR A 1 171 ? 44.761  86.007  -10.970 1.00 60.99  ? 149 TYR A C   1 
ATOM   1123 O O   . TYR A 1 171 ? 44.976  85.276  -11.943 1.00 70.09  ? 149 TYR A O   1 
ATOM   1124 C CB  . TYR A 1 171 ? 45.870  85.475  -8.808  1.00 60.19  ? 149 TYR A CB  1 
ATOM   1125 C CG  . TYR A 1 171 ? 47.177  85.375  -8.069  1.00 70.19  ? 149 TYR A CG  1 
ATOM   1126 C CD1 . TYR A 1 171 ? 48.371  85.259  -8.757  1.00 66.97  ? 149 TYR A CD1 1 
ATOM   1127 C CD2 . TYR A 1 171 ? 47.213  85.393  -6.669  1.00 74.09  ? 149 TYR A CD2 1 
ATOM   1128 C CE1 . TYR A 1 171 ? 49.574  85.166  -8.082  1.00 73.99  ? 149 TYR A CE1 1 
ATOM   1129 C CE2 . TYR A 1 171 ? 48.398  85.304  -5.993  1.00 78.98  ? 149 TYR A CE2 1 
ATOM   1130 C CZ  . TYR A 1 171 ? 49.588  85.184  -6.705  1.00 77.32  ? 149 TYR A CZ  1 
ATOM   1131 O OH  . TYR A 1 171 ? 50.793  85.085  -6.037  1.00 73.28  ? 149 TYR A OH  1 
ATOM   1132 N N   . GLN A 1 172 ? 43.538  86.460  -10.684 1.00 69.02  ? 150 GLN A N   1 
ATOM   1133 C CA  . GLN A 1 172 ? 42.406  85.939  -11.444 1.00 76.08  ? 150 GLN A CA  1 
ATOM   1134 C C   . GLN A 1 172 ? 42.385  86.506  -12.852 1.00 83.15  ? 150 GLN A C   1 
ATOM   1135 O O   . GLN A 1 172 ? 41.964  85.809  -13.783 1.00 84.77  ? 150 GLN A O   1 
ATOM   1136 C CB  . GLN A 1 172 ? 41.086  86.198  -10.705 1.00 68.41  ? 150 GLN A CB  1 
ATOM   1137 C CG  . GLN A 1 172 ? 39.886  85.521  -11.325 1.00 69.42  ? 150 GLN A CG  1 
ATOM   1138 C CD  . GLN A 1 172 ? 39.842  84.006  -11.075 1.00 84.74  ? 150 GLN A CD  1 
ATOM   1139 O OE1 . GLN A 1 172 ? 40.101  83.527  -9.970  1.00 83.17  ? 150 GLN A OE1 1 
ATOM   1140 N NE2 . GLN A 1 172 ? 39.497  83.246  -12.121 1.00 81.52  ? 150 GLN A NE2 1 
ATOM   1141 N N   . GLU A 1 173 ? 42.911  87.721  -13.044 1.00 80.56  ? 151 GLU A N   1 
ATOM   1142 C CA  . GLU A 1 173 ? 43.014  88.256  -14.397 1.00 76.70  ? 151 GLU A CA  1 
ATOM   1143 C C   . GLU A 1 173 ? 44.035  87.463  -15.198 1.00 67.95  ? 151 GLU A C   1 
ATOM   1144 O O   . GLU A 1 173 ? 43.735  86.961  -16.289 1.00 71.08  ? 151 GLU A O   1 
ATOM   1145 C CB  . GLU A 1 173 ? 43.350  89.755  -14.363 1.00 78.27  ? 151 GLU A CB  1 
ATOM   1146 C CG  . GLU A 1 173 ? 43.382  90.408  -15.750 1.00 92.84  ? 151 GLU A CG  1 
ATOM   1147 C CD  . GLU A 1 173 ? 43.544  91.932  -15.733 1.00 101.06 ? 151 GLU A CD  1 
ATOM   1148 O OE1 . GLU A 1 173 ? 43.644  92.519  -16.839 1.00 107.81 ? 151 GLU A OE1 1 
ATOM   1149 O OE2 . GLU A 1 173 ? 43.556  92.543  -14.638 1.00 97.04  ? 151 GLU A OE2 1 
ATOM   1150 N N   . ALA A 1 174 ? 45.224  87.277  -14.637 1.00 66.16  ? 152 ALA A N   1 
ATOM   1151 C CA  . ALA A 1 174 ? 46.232  86.461  -15.299 1.00 67.43  ? 152 ALA A CA  1 
ATOM   1152 C C   . ALA A 1 174 ? 45.751  85.023  -15.514 1.00 68.79  ? 152 ALA A C   1 
ATOM   1153 O O   . ALA A 1 174 ? 46.101  84.399  -16.520 1.00 74.01  ? 152 ALA A O   1 
ATOM   1154 C CB  . ALA A 1 174 ? 47.534  86.499  -14.504 1.00 63.20  ? 152 ALA A CB  1 
ATOM   1155 N N   . PHE A 1 175 ? 44.999  84.456  -14.559 1.00 62.85  ? 153 PHE A N   1 
ATOM   1156 C CA  . PHE A 1 175 ? 44.488  83.094  -14.736 1.00 66.17  ? 153 PHE A CA  1 
ATOM   1157 C C   . PHE A 1 175 ? 43.530  83.015  -15.920 1.00 80.66  ? 153 PHE A C   1 
ATOM   1158 O O   . PHE A 1 175 ? 43.520  82.021  -16.659 1.00 85.72  ? 153 PHE A O   1 
ATOM   1159 C CB  . PHE A 1 175 ? 43.856  82.566  -13.437 1.00 57.13  ? 153 PHE A CB  1 
ATOM   1160 C CG  . PHE A 1 175 ? 43.374  81.132  -13.528 1.00 66.54  ? 153 PHE A CG  1 
ATOM   1161 C CD1 . PHE A 1 175 ? 44.127  80.088  -13.017 1.00 64.27  ? 153 PHE A CD1 1 
ATOM   1162 C CD2 . PHE A 1 175 ? 42.145  80.832  -14.097 1.00 79.99  ? 153 PHE A CD2 1 
ATOM   1163 C CE1 . PHE A 1 175 ? 43.690  78.765  -13.122 1.00 70.08  ? 153 PHE A CE1 1 
ATOM   1164 C CE2 . PHE A 1 175 ? 41.686  79.510  -14.181 1.00 86.19  ? 153 PHE A CE2 1 
ATOM   1165 C CZ  . PHE A 1 175 ? 42.462  78.485  -13.691 1.00 86.38  ? 153 PHE A CZ  1 
ATOM   1166 N N   . GLU A 1 176 ? 42.667  84.017  -16.074 1.00 81.63  ? 154 GLU A N   1 
ATOM   1167 C CA  . GLU A 1 176 ? 41.718  84.001  -17.178 1.00 82.27  ? 154 GLU A CA  1 
ATOM   1168 C C   . GLU A 1 176 ? 42.424  84.210  -18.513 1.00 80.92  ? 154 GLU A C   1 
ATOM   1169 O O   . GLU A 1 176 ? 42.119  83.514  -19.491 1.00 89.47  ? 154 GLU A O   1 
ATOM   1170 C CB  . GLU A 1 176 ? 40.635  85.056  -16.931 1.00 85.67  ? 154 GLU A CB  1 
ATOM   1171 C CG  . GLU A 1 176 ? 39.759  84.715  -15.742 1.00 89.50  ? 154 GLU A CG  1 
ATOM   1172 C CD  . GLU A 1 176 ? 38.965  85.903  -15.244 1.00 105.65 ? 154 GLU A CD  1 
ATOM   1173 O OE1 . GLU A 1 176 ? 39.162  87.015  -15.785 1.00 112.30 ? 154 GLU A OE1 1 
ATOM   1174 O OE2 . GLU A 1 176 ? 38.178  85.730  -14.284 1.00 106.62 ? 154 GLU A OE2 1 
ATOM   1175 N N   . ILE A 1 177 ? 43.372  85.156  -18.575 1.00 71.84  ? 155 ILE A N   1 
ATOM   1176 C CA  . ILE A 1 177 ? 44.120  85.376  -19.814 1.00 70.43  ? 155 ILE A CA  1 
ATOM   1177 C C   . ILE A 1 177 ? 44.897  84.118  -20.190 1.00 72.43  ? 155 ILE A C   1 
ATOM   1178 O O   . ILE A 1 177 ? 45.035  83.788  -21.371 1.00 76.68  ? 155 ILE A O   1 
ATOM   1179 C CB  . ILE A 1 177 ? 45.062  86.594  -19.679 1.00 68.23  ? 155 ILE A CB  1 
ATOM   1180 C CG1 . ILE A 1 177 ? 44.299  87.867  -19.295 1.00 67.51  ? 155 ILE A CG1 1 
ATOM   1181 C CG2 . ILE A 1 177 ? 45.840  86.833  -20.979 1.00 67.46  ? 155 ILE A CG2 1 
ATOM   1182 C CD1 . ILE A 1 177 ? 45.105  89.154  -19.476 1.00 67.76  ? 155 ILE A CD1 1 
ATOM   1183 N N   . SER A 1 178 ? 45.398  83.381  -19.191 1.00 81.76  ? 156 SER A N   1 
ATOM   1184 C CA  . SER A 1 178 ? 46.257  82.224  -19.444 1.00 79.47  ? 156 SER A CA  1 
ATOM   1185 C C   . SER A 1 178 ? 45.457  81.018  -19.914 1.00 74.33  ? 156 SER A C   1 
ATOM   1186 O O   . SER A 1 178 ? 45.943  80.249  -20.742 1.00 75.88  ? 156 SER A O   1 
ATOM   1187 C CB  . SER A 1 178 ? 47.084  81.857  -18.210 1.00 79.78  ? 156 SER A CB  1 
ATOM   1188 O OG  . SER A 1 178 ? 46.327  81.053  -17.313 1.00 92.90  ? 156 SER A OG  1 
ATOM   1189 N N   . LYS A 1 179 ? 44.277  80.774  -19.342 1.00 79.01  ? 157 LYS A N   1 
ATOM   1190 C CA  . LYS A 1 179 ? 43.431  79.715  -19.888 1.00 80.84  ? 157 LYS A CA  1 
ATOM   1191 C C   . LYS A 1 179 ? 43.092  79.980  -21.351 1.00 84.22  ? 157 LYS A C   1 
ATOM   1192 O O   . LYS A 1 179 ? 43.073  79.044  -22.161 1.00 89.56  ? 157 LYS A O   1 
ATOM   1193 C CB  . LYS A 1 179 ? 42.150  79.562  -19.057 1.00 82.99  ? 157 LYS A CB  1 
ATOM   1194 C CG  . LYS A 1 179 ? 42.269  78.631  -17.824 1.00 83.93  ? 157 LYS A CG  1 
ATOM   1195 N N   . LYS A 1 180 ? 42.927  81.258  -21.723 1.00 81.68  ? 158 LYS A N   1 
ATOM   1196 C CA  . LYS A 1 180 ? 42.487  81.644  -23.066 1.00 80.90  ? 158 LYS A CA  1 
ATOM   1197 C C   . LYS A 1 180 ? 43.628  81.600  -24.081 1.00 81.26  ? 158 LYS A C   1 
ATOM   1198 O O   . LYS A 1 180 ? 43.504  80.976  -25.139 1.00 93.86  ? 158 LYS A O   1 
ATOM   1199 C CB  . LYS A 1 180 ? 41.857  83.049  -23.020 1.00 79.51  ? 158 LYS A CB  1 
ATOM   1200 C CG  . LYS A 1 180 ? 40.788  83.352  -24.079 1.00 89.41  ? 158 LYS A CG  1 
ATOM   1201 C CD  . LYS A 1 180 ? 40.351  84.822  -24.034 1.00 98.84  ? 158 LYS A CD  1 
ATOM   1202 C CE  . LYS A 1 180 ? 41.494  85.782  -24.409 1.00 104.75 ? 158 LYS A CE  1 
ATOM   1203 N N   . GLU A 1 181 ? 44.739  82.259  -23.785 1.00 80.29  ? 159 GLU A N   1 
ATOM   1204 C CA  . GLU A 1 181 ? 45.773  82.503  -24.775 1.00 84.70  ? 159 GLU A CA  1 
ATOM   1205 C C   . GLU A 1 181 ? 47.010  81.600  -24.656 1.00 76.47  ? 159 GLU A C   1 
ATOM   1206 O O   . GLU A 1 181 ? 47.907  81.723  -25.491 1.00 89.41  ? 159 GLU A O   1 
ATOM   1207 C CB  . GLU A 1 181 ? 46.157  83.998  -24.746 1.00 86.59  ? 159 GLU A CB  1 
ATOM   1208 C CG  . GLU A 1 181 ? 44.940  84.922  -25.069 1.00 94.13  ? 159 GLU A CG  1 
ATOM   1209 C CD  . GLU A 1 181 ? 45.146  85.832  -26.282 1.00 82.84  ? 159 GLU A CD  1 
ATOM   1210 N N   . MET A 1 182 ? 47.075  80.655  -23.703 1.00 94.57  ? 160 MET A N   1 
ATOM   1211 C CA  . MET A 1 182 ? 48.257  79.796  -23.548 1.00 93.51  ? 160 MET A CA  1 
ATOM   1212 C C   . MET A 1 182 ? 47.934  78.318  -23.356 1.00 92.44  ? 160 MET A C   1 
ATOM   1213 O O   . MET A 1 182 ? 46.888  77.941  -22.822 1.00 97.68  ? 160 MET A O   1 
ATOM   1214 C CB  . MET A 1 182 ? 49.159  80.186  -22.364 1.00 81.05  ? 160 MET A CB  1 
ATOM   1215 C CG  . MET A 1 182 ? 49.667  81.590  -22.333 1.00 92.75  ? 160 MET A CG  1 
ATOM   1216 S SD  . MET A 1 182 ? 50.852  81.720  -20.964 1.00 99.89  ? 160 MET A SD  1 
ATOM   1217 C CE  . MET A 1 182 ? 50.500  83.348  -20.400 1.00 102.57 ? 160 MET A CE  1 
ATOM   1218 N N   . GLN A 1 183 ? 48.897  77.484  -23.753 1.00 89.04  ? 161 GLN A N   1 
ATOM   1219 C CA  . GLN A 1 183 ? 48.877  76.034  -23.638 1.00 95.54  ? 161 GLN A CA  1 
ATOM   1220 C C   . GLN A 1 183 ? 49.055  75.609  -22.177 1.00 88.45  ? 161 GLN A C   1 
ATOM   1221 O O   . GLN A 1 183 ? 49.725  76.302  -21.403 1.00 90.82  ? 161 GLN A O   1 
ATOM   1222 C CB  . GLN A 1 183 ? 49.984  75.435  -24.511 1.00 106.31 ? 161 GLN A CB  1 
ATOM   1223 C CG  . GLN A 1 183 ? 49.568  74.194  -25.302 1.00 113.82 ? 161 GLN A CG  1 
ATOM   1224 C CD  . GLN A 1 183 ? 48.577  74.474  -26.434 1.00 119.60 ? 161 GLN A CD  1 
ATOM   1225 O OE1 . GLN A 1 183 ? 48.928  75.062  -27.464 1.00 126.73 ? 161 GLN A OE1 1 
ATOM   1226 N NE2 . GLN A 1 183 ? 47.335  74.032  -26.251 1.00 118.63 ? 161 GLN A NE2 1 
ATOM   1227 N N   . PRO A 1 184 ? 48.456  74.486  -21.759 1.00 89.50  ? 162 PRO A N   1 
ATOM   1228 C CA  . PRO A 1 184 ? 48.492  74.121  -20.329 1.00 88.20  ? 162 PRO A CA  1 
ATOM   1229 C C   . PRO A 1 184 ? 49.884  73.792  -19.799 1.00 74.59  ? 162 PRO A C   1 
ATOM   1230 O O   . PRO A 1 184 ? 50.025  73.593  -18.579 1.00 64.98  ? 162 PRO A O   1 
ATOM   1231 C CB  . PRO A 1 184 ? 47.568  72.894  -20.247 1.00 88.69  ? 162 PRO A CB  1 
ATOM   1232 C CG  . PRO A 1 184 ? 46.745  72.945  -21.442 1.00 91.37  ? 162 PRO A CG  1 
ATOM   1233 C CD  . PRO A 1 184 ? 47.603  73.558  -22.517 1.00 97.78  ? 162 PRO A CD  1 
ATOM   1234 N N   . THR A 1 185 ? 50.885  73.701  -20.681 1.00 74.82  ? 163 THR A N   1 
ATOM   1235 C CA  . THR A 1 185 ? 52.265  73.364  -20.354 1.00 70.15  ? 163 THR A CA  1 
ATOM   1236 C C   . THR A 1 185 ? 53.196  74.567  -20.251 1.00 70.11  ? 163 THR A C   1 
ATOM   1237 O O   . THR A 1 185 ? 54.357  74.389  -19.863 1.00 70.17  ? 163 THR A O   1 
ATOM   1238 C CB  . THR A 1 185 ? 52.840  72.400  -21.402 1.00 73.12  ? 163 THR A CB  1 
ATOM   1239 O OG1 . THR A 1 185 ? 53.238  73.153  -22.575 1.00 90.95  ? 163 THR A OG1 1 
ATOM   1240 C CG2 . THR A 1 185 ? 51.844  71.347  -21.780 1.00 78.09  ? 163 THR A CG2 1 
ATOM   1241 N N   . HIS A 1 186 ? 52.767  75.752  -20.676 1.00 66.60  ? 164 HIS A N   1 
ATOM   1242 C CA  . HIS A 1 186 ? 53.675  76.882  -20.657 1.00 68.59  ? 164 HIS A CA  1 
ATOM   1243 C C   . HIS A 1 186 ? 54.121  77.119  -19.242 1.00 85.27  ? 164 HIS A C   1 
ATOM   1244 O O   . HIS A 1 186 ? 53.281  77.178  -18.315 1.00 92.98  ? 164 HIS A O   1 
ATOM   1245 C CB  . HIS A 1 186 ? 53.013  78.118  -21.259 1.00 70.37  ? 164 HIS A CB  1 
ATOM   1246 C CG  . HIS A 1 186 ? 53.972  79.225  -21.598 1.00 92.68  ? 164 HIS A CG  1 
ATOM   1247 N ND1 . HIS A 1 186 ? 53.586  80.361  -22.273 1.00 100.83 ? 164 HIS A ND1 1 
ATOM   1248 C CD2 . HIS A 1 186 ? 55.279  79.401  -21.287 1.00 95.29  ? 164 HIS A CD2 1 
ATOM   1249 C CE1 . HIS A 1 186 ? 54.632  81.158  -22.436 1.00 101.75 ? 164 HIS A CE1 1 
ATOM   1250 N NE2 . HIS A 1 186 ? 55.667  80.601  -21.840 1.00 99.14  ? 164 HIS A NE2 1 
ATOM   1251 N N   . PRO A 1 187 ? 55.417  77.194  -18.971 1.00 82.75  ? 165 PRO A N   1 
ATOM   1252 C CA  . PRO A 1 187 ? 55.873  77.433  -17.608 1.00 80.92  ? 165 PRO A CA  1 
ATOM   1253 C C   . PRO A 1 187 ? 55.212  78.656  -16.989 1.00 72.30  ? 165 PRO A C   1 
ATOM   1254 O O   . PRO A 1 187 ? 55.022  78.697  -15.774 1.00 56.12  ? 165 PRO A O   1 
ATOM   1255 C CB  . PRO A 1 187 ? 57.396  77.570  -17.763 1.00 83.91  ? 165 PRO A CB  1 
ATOM   1256 C CG  . PRO A 1 187 ? 57.644  77.618  -19.272 1.00 76.90  ? 165 PRO A CG  1 
ATOM   1257 C CD  . PRO A 1 187 ? 56.530  76.862  -19.873 1.00 61.91  ? 165 PRO A CD  1 
ATOM   1258 N N   . ILE A 1 188 ? 54.785  79.621  -17.804 1.00 77.95  ? 166 ILE A N   1 
ATOM   1259 C CA  . ILE A 1 188 ? 54.159  80.799  -17.232 1.00 72.56  ? 166 ILE A CA  1 
ATOM   1260 C C   . ILE A 1 188 ? 52.739  80.478  -16.783 1.00 68.25  ? 166 ILE A C   1 
ATOM   1261 O O   . ILE A 1 188 ? 52.262  81.032  -15.790 1.00 78.62  ? 166 ILE A O   1 
ATOM   1262 C CB  . ILE A 1 188 ? 54.141  81.950  -18.246 1.00 78.18  ? 166 ILE A CB  1 
ATOM   1263 C CG1 . ILE A 1 188 ? 55.557  82.483  -18.470 1.00 93.38  ? 166 ILE A CG1 1 
ATOM   1264 C CG2 . ILE A 1 188 ? 53.258  83.069  -17.702 1.00 71.79  ? 166 ILE A CG2 1 
ATOM   1265 C CD1 . ILE A 1 188 ? 56.019  83.401  -17.407 1.00 99.56  ? 166 ILE A CD1 1 
ATOM   1266 N N   . ARG A 1 189 ? 52.035  79.587  -17.488 1.00 67.66  ? 167 ARG A N   1 
ATOM   1267 C CA  . ARG A 1 189 ? 50.690  79.232  -17.049 1.00 61.93  ? 167 ARG A CA  1 
ATOM   1268 C C   . ARG A 1 189 ? 50.703  78.219  -15.909 1.00 60.76  ? 167 ARG A C   1 
ATOM   1269 O O   . ARG A 1 189 ? 49.827  78.283  -15.029 1.00 61.39  ? 167 ARG A O   1 
ATOM   1270 C CB  . ARG A 1 189 ? 49.844  78.731  -18.220 1.00 62.71  ? 167 ARG A CB  1 
ATOM   1271 C CG  . ARG A 1 189 ? 48.489  78.284  -17.787 1.00 63.12  ? 167 ARG A CG  1 
ATOM   1272 C CD  . ARG A 1 189 ? 47.587  77.923  -18.900 1.00 79.42  ? 167 ARG A CD  1 
ATOM   1273 N NE  . ARG A 1 189 ? 46.668  76.872  -18.474 1.00 93.82  ? 167 ARG A NE  1 
ATOM   1274 C CZ  . ARG A 1 189 ? 45.660  76.409  -19.209 1.00 97.52  ? 167 ARG A CZ  1 
ATOM   1275 N NH1 . ARG A 1 189 ? 45.416  76.912  -20.413 1.00 92.75  ? 167 ARG A NH1 1 
ATOM   1276 N NH2 . ARG A 1 189 ? 44.889  75.442  -18.733 1.00 103.10 ? 167 ARG A NH2 1 
ATOM   1277 N N   . LEU A 1 190 ? 51.690  77.308  -15.869 1.00 59.64  ? 168 LEU A N   1 
ATOM   1278 C CA  . LEU A 1 190 ? 51.757  76.423  -14.703 1.00 63.89  ? 168 LEU A CA  1 
ATOM   1279 C C   . LEU A 1 190 ? 52.383  77.116  -13.491 1.00 66.29  ? 168 LEU A C   1 
ATOM   1280 O O   . LEU A 1 190 ? 52.033  76.802  -12.349 1.00 58.98  ? 168 LEU A O   1 
ATOM   1281 C CB  . LEU A 1 190 ? 52.562  75.156  -14.989 1.00 56.52  ? 168 LEU A CB  1 
ATOM   1282 C CG  . LEU A 1 190 ? 52.270  74.111  -16.051 1.00 52.99  ? 168 LEU A CG  1 
ATOM   1283 C CD1 . LEU A 1 190 ? 53.554  73.834  -16.788 1.00 51.49  ? 168 LEU A CD1 1 
ATOM   1284 C CD2 . LEU A 1 190 ? 51.731  72.843  -15.453 1.00 48.18  ? 168 LEU A CD2 1 
ATOM   1285 N N   . GLY A 1 191 ? 53.265  78.084  -13.718 1.00 65.96  ? 169 GLY A N   1 
ATOM   1286 C CA  . GLY A 1 191 ? 53.764  78.888  -12.625 1.00 44.56  ? 169 GLY A CA  1 
ATOM   1287 C C   . GLY A 1 191 ? 52.677  79.719  -12.002 1.00 65.28  ? 169 GLY A C   1 
ATOM   1288 O O   . GLY A 1 191 ? 52.681  79.927  -10.792 1.00 70.85  ? 169 GLY A O   1 
ATOM   1289 N N   . LEU A 1 192 ? 51.640  80.035  -12.706 1.00 66.83  ? 170 LEU A N   1 
ATOM   1290 C CA  . LEU A 1 192 ? 50.575  80.807  -12.144 1.00 64.87  ? 170 LEU A CA  1 
ATOM   1291 C C   . LEU A 1 192 ? 49.718  79.897  -11.383 1.00 66.04  ? 170 LEU A C   1 
ATOM   1292 O O   . LEU A 1 192 ? 49.219  80.187  -10.381 1.00 58.38  ? 170 LEU A O   1 
ATOM   1293 C CB  . LEU A 1 192 ? 49.754  81.310  -13.247 1.00 64.92  ? 170 LEU A CB  1 
ATOM   1294 C CG  . LEU A 1 192 ? 49.169  82.640  -13.043 1.00 62.03  ? 170 LEU A CG  1 
ATOM   1295 C CD1 . LEU A 1 192 ? 48.036  82.630  -13.954 1.00 66.29  ? 170 LEU A CD1 1 
ATOM   1296 C CD2 . LEU A 1 192 ? 48.624  82.606  -11.695 1.00 61.68  ? 170 LEU A CD2 1 
ATOM   1297 N N   . ALA A 1 193 ? 49.486  78.762  -11.916 1.00 64.50  ? 171 ALA A N   1 
ATOM   1298 C CA  . ALA A 1 193 ? 48.682  77.797  -11.179 1.00 56.23  ? 171 ALA A CA  1 
ATOM   1299 C C   . ALA A 1 193 ? 49.317  77.465  -9.843  1.00 60.95  ? 171 ALA A C   1 
ATOM   1300 O O   . ALA A 1 193 ? 48.628  77.404  -8.815  1.00 70.85  ? 171 ALA A O   1 
ATOM   1301 C CB  . ALA A 1 193 ? 48.470  76.538  -12.018 1.00 53.42  ? 171 ALA A CB  1 
ATOM   1302 N N   . LEU A 1 194 ? 50.630  77.236  -9.840  1.00 70.20  ? 172 LEU A N   1 
ATOM   1303 C CA  . LEU A 1 194 ? 51.310  76.855  -8.608  1.00 63.29  ? 172 LEU A CA  1 
ATOM   1304 C C   . LEU A 1 194 ? 51.177  77.953  -7.560  1.00 62.49  ? 172 LEU A C   1 
ATOM   1305 O O   . LEU A 1 194 ? 50.703  77.708  -6.445  1.00 67.88  ? 172 LEU A O   1 
ATOM   1306 C CB  . LEU A 1 194 ? 52.772  76.563  -8.911  1.00 49.11  ? 172 LEU A CB  1 
ATOM   1307 C CG  . LEU A 1 194 ? 53.656  76.172  -7.734  1.00 49.96  ? 172 LEU A CG  1 
ATOM   1308 C CD1 . LEU A 1 194 ? 53.417  74.698  -7.431  1.00 54.56  ? 172 LEU A CD1 1 
ATOM   1309 C CD2 . LEU A 1 194 ? 55.135  76.461  -8.025  1.00 39.34  ? 172 LEU A CD2 1 
ATOM   1310 N N   . ASN A 1 195 ? 51.473  79.193  -7.944  1.00 52.05  ? 173 ASN A N   1 
ATOM   1311 C CA  . ASN A 1 195 ? 51.419  80.283  -6.983  1.00 41.13  ? 173 ASN A CA  1 
ATOM   1312 C C   . ASN A 1 195 ? 49.999  80.601  -6.574  1.00 58.62  ? 173 ASN A C   1 
ATOM   1313 O O   . ASN A 1 195 ? 49.761  80.951  -5.414  1.00 58.16  ? 173 ASN A O   1 
ATOM   1314 C CB  . ASN A 1 195 ? 52.061  81.542  -7.542  1.00 42.75  ? 173 ASN A CB  1 
ATOM   1315 C CG  . ASN A 1 195 ? 53.560  81.493  -7.511  1.00 42.15  ? 173 ASN A CG  1 
ATOM   1316 O OD1 . ASN A 1 195 ? 54.168  80.413  -7.505  1.00 40.51  ? 173 ASN A OD1 1 
ATOM   1317 N ND2 . ASN A 1 195 ? 54.176  82.670  -7.495  1.00 44.11  ? 173 ASN A ND2 1 
ATOM   1318 N N   . PHE A 1 196 ? 49.056  80.542  -7.526  1.00 59.23  ? 174 PHE A N   1 
ATOM   1319 C CA  . PHE A 1 196 ? 47.648  80.782  -7.218  1.00 61.80  ? 174 PHE A CA  1 
ATOM   1320 C C   . PHE A 1 196 ? 47.142  79.746  -6.224  1.00 57.59  ? 174 PHE A C   1 
ATOM   1321 O O   . PHE A 1 196 ? 46.526  80.103  -5.209  1.00 53.03  ? 174 PHE A O   1 
ATOM   1322 C CB  . PHE A 1 196 ? 46.821  80.750  -8.515  1.00 69.63  ? 174 PHE A CB  1 
ATOM   1323 C CG  . PHE A 1 196 ? 45.556  81.608  -8.503  1.00 70.58  ? 174 PHE A CG  1 
ATOM   1324 C CD1 . PHE A 1 196 ? 45.183  82.349  -7.390  1.00 72.60  ? 174 PHE A CD1 1 
ATOM   1325 C CD2 . PHE A 1 196 ? 44.740  81.656  -9.626  1.00 67.52  ? 174 PHE A CD2 1 
ATOM   1326 C CE1 . PHE A 1 196 ? 44.009  83.122  -7.395  1.00 67.40  ? 174 PHE A CE1 1 
ATOM   1327 C CE2 . PHE A 1 196 ? 43.575  82.434  -9.634  1.00 79.55  ? 174 PHE A CE2 1 
ATOM   1328 C CZ  . PHE A 1 196 ? 43.213  83.167  -8.515  1.00 72.63  ? 174 PHE A CZ  1 
ATOM   1329 N N   . SER A 1 197 ? 47.433  78.452  -6.476  1.00 48.47  ? 175 SER A N   1 
ATOM   1330 C CA  . SER A 1 197 ? 47.080  77.412  -5.507  1.00 46.94  ? 175 SER A CA  1 
ATOM   1331 C C   . SER A 1 197 ? 47.661  77.711  -4.122  1.00 62.81  ? 175 SER A C   1 
ATOM   1332 O O   . SER A 1 197 ? 46.966  77.570  -3.113  1.00 76.44  ? 175 SER A O   1 
ATOM   1333 C CB  . SER A 1 197 ? 47.496  76.027  -6.019  1.00 56.12  ? 175 SER A CB  1 
ATOM   1334 O OG  . SER A 1 197 ? 48.906  75.848  -6.142  1.00 70.25  ? 175 SER A OG  1 
ATOM   1335 N N   . VAL A 1 198 ? 48.898  78.216  -4.058  1.00 67.40  ? 176 VAL A N   1 
ATOM   1336 C CA  . VAL A 1 198 ? 49.517  78.512  -2.766  1.00 57.77  ? 176 VAL A CA  1 
ATOM   1337 C C   . VAL A 1 198 ? 48.808  79.672  -2.083  1.00 64.28  ? 176 VAL A C   1 
ATOM   1338 O O   . VAL A 1 198 ? 48.640  79.674  -0.857  1.00 80.33  ? 176 VAL A O   1 
ATOM   1339 C CB  . VAL A 1 198 ? 51.026  78.792  -2.948  1.00 49.58  ? 176 VAL A CB  1 
ATOM   1340 C CG1 . VAL A 1 198 ? 51.611  79.520  -1.734  1.00 41.52  ? 176 VAL A CG1 1 
ATOM   1341 C CG2 . VAL A 1 198 ? 51.770  77.482  -3.162  1.00 39.61  ? 176 VAL A CG2 1 
ATOM   1342 N N   . PHE A 1 199 ? 48.372  80.666  -2.856  1.00 59.86  ? 177 PHE A N   1 
ATOM   1343 C CA  . PHE A 1 199 ? 47.556  81.757  -2.319  1.00 63.79  ? 177 PHE A CA  1 
ATOM   1344 C C   . PHE A 1 199 ? 46.285  81.233  -1.668  1.00 66.41  ? 177 PHE A C   1 
ATOM   1345 O O   . PHE A 1 199 ? 45.890  81.684  -0.584  1.00 62.54  ? 177 PHE A O   1 
ATOM   1346 C CB  . PHE A 1 199 ? 47.199  82.723  -3.437  1.00 63.44  ? 177 PHE A CB  1 
ATOM   1347 C CG  . PHE A 1 199 ? 46.238  83.787  -3.046  1.00 62.08  ? 177 PHE A CG  1 
ATOM   1348 C CD1 . PHE A 1 199 ? 44.910  83.723  -3.469  1.00 61.60  ? 177 PHE A CD1 1 
ATOM   1349 C CD2 . PHE A 1 199 ? 46.660  84.888  -2.305  1.00 66.08  ? 177 PHE A CD2 1 
ATOM   1350 C CE1 . PHE A 1 199 ? 44.005  84.742  -3.144  1.00 62.83  ? 177 PHE A CE1 1 
ATOM   1351 C CE2 . PHE A 1 199 ? 45.767  85.913  -1.969  1.00 63.83  ? 177 PHE A CE2 1 
ATOM   1352 C CZ  . PHE A 1 199 ? 44.438  85.843  -2.388  1.00 62.41  ? 177 PHE A CZ  1 
ATOM   1353 N N   . TYR A 1 200 ? 45.602  80.306  -2.334  1.00 67.24  ? 178 TYR A N   1 
ATOM   1354 C CA  . TYR A 1 200 ? 44.396  79.764  -1.728  1.00 81.71  ? 178 TYR A CA  1 
ATOM   1355 C C   . TYR A 1 200 ? 44.721  79.061  -0.422  1.00 76.43  ? 178 TYR A C   1 
ATOM   1356 O O   . TYR A 1 200 ? 44.058  79.296  0.597   1.00 79.34  ? 178 TYR A O   1 
ATOM   1357 C CB  . TYR A 1 200 ? 43.694  78.820  -2.702  1.00 84.21  ? 178 TYR A CB  1 
ATOM   1358 C CG  . TYR A 1 200 ? 42.817  79.592  -3.645  1.00 78.27  ? 178 TYR A CG  1 
ATOM   1359 C CD1 . TYR A 1 200 ? 41.670  80.223  -3.191  1.00 69.16  ? 178 TYR A CD1 1 
ATOM   1360 C CD2 . TYR A 1 200 ? 43.166  79.735  -4.985  1.00 79.46  ? 178 TYR A CD2 1 
ATOM   1361 C CE1 . TYR A 1 200 ? 40.879  80.954  -4.045  1.00 74.18  ? 178 TYR A CE1 1 
ATOM   1362 C CE2 . TYR A 1 200 ? 42.379  80.466  -5.848  1.00 86.49  ? 178 TYR A CE2 1 
ATOM   1363 C CZ  . TYR A 1 200 ? 41.232  81.077  -5.373  1.00 86.53  ? 178 TYR A CZ  1 
ATOM   1364 O OH  . TYR A 1 200 ? 40.440  81.811  -6.229  1.00 95.42  ? 178 TYR A OH  1 
ATOM   1365 N N   . TYR A 1 201 ? 45.784  78.256  -0.421  1.00 61.41  ? 179 TYR A N   1 
ATOM   1366 C CA  . TYR A 1 201 ? 46.130  77.477  0.761   1.00 61.60  ? 179 TYR A CA  1 
ATOM   1367 C C   . TYR A 1 201 ? 46.715  78.362  1.851   1.00 67.89  ? 179 TYR A C   1 
ATOM   1368 O O   . TYR A 1 201 ? 46.282  78.300  3.006   1.00 81.73  ? 179 TYR A O   1 
ATOM   1369 C CB  . TYR A 1 201 ? 47.098  76.354  0.400   1.00 60.45  ? 179 TYR A CB  1 
ATOM   1370 C CG  . TYR A 1 201 ? 47.296  75.370  1.520   1.00 64.66  ? 179 TYR A CG  1 
ATOM   1371 C CD1 . TYR A 1 201 ? 46.590  74.175  1.558   1.00 68.29  ? 179 TYR A CD1 1 
ATOM   1372 C CD2 . TYR A 1 201 ? 48.193  75.636  2.546   1.00 70.96  ? 179 TYR A CD2 1 
ATOM   1373 C CE1 . TYR A 1 201 ? 46.776  73.273  2.593   1.00 76.33  ? 179 TYR A CE1 1 
ATOM   1374 C CE2 . TYR A 1 201 ? 48.375  74.749  3.585   1.00 78.87  ? 179 TYR A CE2 1 
ATOM   1375 C CZ  . TYR A 1 201 ? 47.669  73.571  3.604   1.00 82.98  ? 179 TYR A CZ  1 
ATOM   1376 O OH  . TYR A 1 201 ? 47.862  72.695  4.646   1.00 94.39  ? 179 TYR A OH  1 
ATOM   1377 N N   . GLU A 1 202 ? 47.723  79.168  1.524   1.00 59.23  ? 180 GLU A N   1 
ATOM   1378 C CA  . GLU A 1 202 ? 48.419  79.856  2.595   1.00 72.07  ? 180 GLU A CA  1 
ATOM   1379 C C   . GLU A 1 202 ? 47.831  81.222  2.937   1.00 73.52  ? 180 GLU A C   1 
ATOM   1380 O O   . GLU A 1 202 ? 48.144  81.750  4.002   1.00 88.32  ? 180 GLU A O   1 
ATOM   1381 C CB  . GLU A 1 202 ? 49.909  80.001  2.247   1.00 86.43  ? 180 GLU A CB  1 
ATOM   1382 C CG  . GLU A 1 202 ? 50.856  79.057  3.014   1.00 98.59  ? 180 GLU A CG  1 
ATOM   1383 C CD  . GLU A 1 202 ? 52.302  79.096  2.469   1.00 118.60 ? 180 GLU A CD  1 
ATOM   1384 O OE1 . GLU A 1 202 ? 52.716  80.128  1.880   1.00 122.81 ? 180 GLU A OE1 1 
ATOM   1385 O OE2 . GLU A 1 202 ? 53.036  78.094  2.640   1.00 123.55 ? 180 GLU A OE2 1 
ATOM   1386 N N   . ILE A 1 203 ? 46.925  81.778  2.142   1.00 73.63  ? 181 ILE A N   1 
ATOM   1387 C CA  . ILE A 1 203 ? 46.434  83.119  2.460   1.00 69.88  ? 181 ILE A CA  1 
ATOM   1388 C C   . ILE A 1 203 ? 44.931  83.120  2.703   1.00 74.28  ? 181 ILE A C   1 
ATOM   1389 O O   . ILE A 1 203 ? 44.407  83.981  3.416   1.00 77.88  ? 181 ILE A O   1 
ATOM   1390 C CB  . ILE A 1 203 ? 46.801  84.110  1.344   1.00 66.25  ? 181 ILE A CB  1 
ATOM   1391 C CG1 . ILE A 1 203 ? 48.314  84.182  1.197   1.00 62.63  ? 181 ILE A CG1 1 
ATOM   1392 C CG2 . ILE A 1 203 ? 46.292  85.506  1.668   1.00 64.82  ? 181 ILE A CG2 1 
ATOM   1393 C CD1 . ILE A 1 203 ? 48.954  85.073  2.212   1.00 77.83  ? 181 ILE A CD1 1 
ATOM   1394 N N   . LEU A 1 204 ? 44.201  82.298  2.020   1.00 80.18  ? 182 LEU A N   1 
ATOM   1395 C CA  . LEU A 1 204 ? 42.788  82.270  2.207   1.00 77.22  ? 182 LEU A CA  1 
ATOM   1396 C C   . LEU A 1 204 ? 42.319  81.094  2.944   1.00 87.08  ? 182 LEU A C   1 
ATOM   1397 O O   . LEU A 1 204 ? 41.174  80.923  3.071   1.00 99.94  ? 182 LEU A O   1 
ATOM   1398 C CB  . LEU A 1 204 ? 42.104  82.187  0.885   1.00 77.98  ? 182 LEU A CB  1 
ATOM   1399 C CG  . LEU A 1 204 ? 42.060  83.386  0.033   1.00 77.30  ? 182 LEU A CG  1 
ATOM   1400 C CD1 . LEU A 1 204 ? 40.825  83.245  -0.747  1.00 67.23  ? 182 LEU A CD1 1 
ATOM   1401 C CD2 . LEU A 1 204 ? 41.936  84.514  0.959   1.00 68.90  ? 182 LEU A CD2 1 
ATOM   1402 N N   A ASN A 1 205 ? 43.189  80.227  3.353   0.50 100.43 ? 183 ASN A N   1 
ATOM   1403 N N   B ASN A 1 205 ? 43.289  80.227  3.353   0.50 100.43 ? 183 ASN A N   1 
ATOM   1404 C CA  A ASN A 1 205 ? 42.861  79.058  4.089   0.50 104.14 ? 183 ASN A CA  1 
ATOM   1405 C CA  B ASN A 1 205 ? 42.961  79.058  4.089   0.50 104.14 ? 183 ASN A CA  1 
ATOM   1406 C C   A ASN A 1 205 ? 41.789  78.208  3.503   0.50 103.76 ? 183 ASN A C   1 
ATOM   1407 C C   B ASN A 1 205 ? 41.889  78.208  3.503   0.50 103.76 ? 183 ASN A C   1 
ATOM   1408 O O   A ASN A 1 205 ? 40.977  77.718  4.193   0.50 119.57 ? 183 ASN A O   1 
ATOM   1409 O O   B ASN A 1 205 ? 41.077  77.718  4.193   0.50 119.57 ? 183 ASN A O   1 
ATOM   1410 C CB  A ASN A 1 205 ? 42.589  79.418  5.520   0.50 114.10 ? 183 ASN A CB  1 
ATOM   1411 C CB  B ASN A 1 205 ? 42.689  79.418  5.520   0.50 114.10 ? 183 ASN A CB  1 
ATOM   1412 C CG  A ASN A 1 205 ? 42.795  78.275  6.435   0.50 133.06 ? 183 ASN A CG  1 
ATOM   1413 C CG  B ASN A 1 205 ? 43.918  79.807  6.244   0.50 133.06 ? 183 ASN A CG  1 
ATOM   1414 O OD1 A ASN A 1 205 ? 42.017  77.347  6.486   0.50 143.71 ? 183 ASN A OD1 1 
ATOM   1415 O OD1 B ASN A 1 205 ? 45.016  79.449  5.879   0.50 143.71 ? 183 ASN A OD1 1 
ATOM   1416 N ND2 A ASN A 1 205 ? 43.853  78.330  7.168   0.50 134.34 ? 183 ASN A ND2 1 
ATOM   1417 N ND2 B ASN A 1 205 ? 43.742  80.551  7.281   0.50 134.34 ? 183 ASN A ND2 1 
ATOM   1418 N N   . SER A 1 206 ? 41.829  77.980  2.214   1.00 83.52  ? 184 SER A N   1 
ATOM   1419 C CA  . SER A 1 206 ? 40.855  77.167  1.560   1.00 75.29  ? 184 SER A CA  1 
ATOM   1420 C C   . SER A 1 206 ? 41.627  76.136  0.855   1.00 71.99  ? 184 SER A C   1 
ATOM   1421 O O   . SER A 1 206 ? 41.961  76.297  -0.238  1.00 81.21  ? 184 SER A O   1 
ATOM   1422 C CB  . SER A 1 206 ? 40.034  77.964  0.565   1.00 78.50  ? 184 SER A CB  1 
ATOM   1423 O OG  . SER A 1 206 ? 39.891  79.295  0.919   1.00 72.55  ? 184 SER A OG  1 
ATOM   1424 N N   . PRO A 1 207 ? 41.809  75.011  1.453   1.00 74.62  ? 185 PRO A N   1 
ATOM   1425 C CA  . PRO A 1 207 ? 42.620  73.972  0.914   1.00 78.14  ? 185 PRO A CA  1 
ATOM   1426 C C   . PRO A 1 207 ? 42.024  73.187  -0.092  1.00 81.17  ? 185 PRO A C   1 
ATOM   1427 O O   . PRO A 1 207 ? 42.747  72.472  -0.667  1.00 73.89  ? 185 PRO A O   1 
ATOM   1428 C CB  . PRO A 1 207 ? 42.731  73.059  2.057   1.00 85.38  ? 185 PRO A CB  1 
ATOM   1429 C CG  . PRO A 1 207 ? 42.817  73.974  3.160   1.00 91.16  ? 185 PRO A CG  1 
ATOM   1430 C CD  . PRO A 1 207 ? 41.716  74.883  2.880   1.00 86.90  ? 185 PRO A CD  1 
ATOM   1431 N N   . GLU A 1 208 ? 40.745  73.228  -0.263  1.00 87.63  ? 186 GLU A N   1 
ATOM   1432 C CA  . GLU A 1 208 ? 40.117  72.412  -1.244  1.00 87.35  ? 186 GLU A CA  1 
ATOM   1433 C C   . GLU A 1 208 ? 40.152  73.044  -2.567  1.00 78.74  ? 186 GLU A C   1 
ATOM   1434 O O   . GLU A 1 208 ? 40.161  72.359  -3.520  1.00 77.05  ? 186 GLU A O   1 
ATOM   1435 C CB  . GLU A 1 208 ? 38.702  72.129  -0.823  1.00 91.69  ? 186 GLU A CB  1 
ATOM   1436 N N   . LYS A 1 209 ? 40.135  74.348  -2.625  1.00 71.99  ? 187 LYS A N   1 
ATOM   1437 C CA  . LYS A 1 209 ? 40.238  75.017  -3.855  1.00 66.51  ? 187 LYS A CA  1 
ATOM   1438 C C   . LYS A 1 209 ? 41.674  74.913  -4.219  1.00 75.38  ? 187 LYS A C   1 
ATOM   1439 O O   . LYS A 1 209 ? 42.030  74.559  -5.290  1.00 86.80  ? 187 LYS A O   1 
ATOM   1440 C CB  . LYS A 1 209 ? 39.909  76.445  -3.676  1.00 64.86  ? 187 LYS A CB  1 
ATOM   1441 C CG  . LYS A 1 209 ? 39.461  77.068  -4.958  1.00 81.09  ? 187 LYS A CG  1 
ATOM   1442 C CD  . LYS A 1 209 ? 38.281  77.994  -4.793  1.00 71.95  ? 187 LYS A CD  1 
ATOM   1443 N N   . ALA A 1 210 ? 42.545  75.150  -3.281  1.00 78.05  ? 188 ALA A N   1 
ATOM   1444 C CA  . ALA A 1 210 ? 43.969  75.128  -3.598  1.00 65.94  ? 188 ALA A CA  1 
ATOM   1445 C C   . ALA A 1 210 ? 44.367  73.820  -4.270  1.00 66.50  ? 188 ALA A C   1 
ATOM   1446 O O   . ALA A 1 210 ? 45.112  73.826  -5.254  1.00 76.97  ? 188 ALA A O   1 
ATOM   1447 C CB  . ALA A 1 210 ? 44.789  75.374  -2.333  1.00 51.64  ? 188 ALA A CB  1 
ATOM   1448 N N   . CYS A 1 211 ? 43.876  72.686  -3.771  1.00 69.13  ? 189 CYS A N   1 
ATOM   1449 C CA  . CYS A 1 211 ? 44.233  71.420  -4.408  1.00 72.88  ? 189 CYS A CA  1 
ATOM   1450 C C   . CYS A 1 211 ? 43.458  71.178  -5.695  1.00 85.12  ? 189 CYS A C   1 
ATOM   1451 O O   . CYS A 1 211 ? 43.976  70.511  -6.595  1.00 86.34  ? 189 CYS A O   1 
ATOM   1452 C CB  . CYS A 1 211 ? 43.996  70.235  -3.473  1.00 75.29  ? 189 CYS A CB  1 
ATOM   1453 S SG  . CYS A 1 211 ? 44.568  70.439  -1.793  1.00 76.35  ? 189 CYS A SG  1 
ATOM   1454 N N   . SER A 1 212 ? 42.218  71.668  -5.804  1.00 94.04  ? 190 SER A N   1 
ATOM   1455 C CA  . SER A 1 212 ? 41.518  71.521  -7.077  1.00 99.10  ? 190 SER A CA  1 
ATOM   1456 C C   . SER A 1 212 ? 42.256  72.284  -8.174  1.00 88.96  ? 190 SER A C   1 
ATOM   1457 O O   . SER A 1 212 ? 42.395  71.793  -9.302  1.00 87.59  ? 190 SER A O   1 
ATOM   1458 C CB  . SER A 1 212 ? 40.049  71.969  -6.962  1.00 92.00  ? 190 SER A CB  1 
ATOM   1459 O OG  . SER A 1 212 ? 39.860  73.341  -7.285  1.00 87.42  ? 190 SER A OG  1 
ATOM   1460 N N   . LEU A 1 213 ? 42.815  73.444  -7.830  1.00 74.45  ? 191 LEU A N   1 
ATOM   1461 C CA  . LEU A 1 213 ? 43.502  74.259  -8.821  1.00 66.84  ? 191 LEU A CA  1 
ATOM   1462 C C   . LEU A 1 213 ? 44.820  73.614  -9.234  1.00 70.17  ? 191 LEU A C   1 
ATOM   1463 O O   . LEU A 1 213 ? 45.092  73.453  -10.428 1.00 82.52  ? 191 LEU A O   1 
ATOM   1464 C CB  . LEU A 1 213 ? 43.728  75.662  -8.255  1.00 59.47  ? 191 LEU A CB  1 
ATOM   1465 C CG  . LEU A 1 213 ? 43.859  76.855  -9.205  1.00 62.32  ? 191 LEU A CG  1 
ATOM   1466 C CD1 . LEU A 1 213 ? 43.569  78.150  -8.457  1.00 58.72  ? 191 LEU A CD1 1 
ATOM   1467 C CD2 . LEU A 1 213 ? 45.234  76.928  -9.880  1.00 69.86  ? 191 LEU A CD2 1 
ATOM   1468 N N   . ALA A 1 214 ? 45.633  73.187  -8.261  1.00 54.49  ? 192 ALA A N   1 
ATOM   1469 C CA  . ALA A 1 214 ? 46.890  72.510  -8.587  1.00 69.98  ? 192 ALA A CA  1 
ATOM   1470 C C   . ALA A 1 214 ? 46.659  71.219  -9.364  1.00 64.71  ? 192 ALA A C   1 
ATOM   1471 O O   . ALA A 1 214 ? 47.334  70.952  -10.363 1.00 73.33  ? 192 ALA A O   1 
ATOM   1472 C CB  . ALA A 1 214 ? 47.692  72.218  -7.316  1.00 74.50  ? 192 ALA A CB  1 
ATOM   1473 N N   . LYS A 1 215 ? 45.720  70.395  -8.915  1.00 53.23  ? 193 LYS A N   1 
ATOM   1474 C CA  . LYS A 1 215 ? 45.482  69.129  -9.594  1.00 60.12  ? 193 LYS A CA  1 
ATOM   1475 C C   . LYS A 1 215 ? 44.975  69.354  -11.023 1.00 70.65  ? 193 LYS A C   1 
ATOM   1476 O O   . LYS A 1 215 ? 45.376  68.640  -11.948 1.00 80.08  ? 193 LYS A O   1 
ATOM   1477 C CB  . LYS A 1 215 ? 44.506  68.283  -8.768  1.00 55.90  ? 193 LYS A CB  1 
ATOM   1478 C CG  . LYS A 1 215 ? 44.366  66.849  -9.250  1.00 69.55  ? 193 LYS A CG  1 
ATOM   1479 C CD  . LYS A 1 215 ? 43.091  66.209  -8.732  1.00 70.46  ? 193 LYS A CD  1 
ATOM   1480 C CE  . LYS A 1 215 ? 42.262  65.524  -9.841  1.00 85.90  ? 193 LYS A CE  1 
ATOM   1481 N NZ  . LYS A 1 215 ? 43.031  64.633  -10.781 1.00 95.85  ? 193 LYS A NZ  1 
ATOM   1482 N N   . THR A 1 216 ? 44.091  70.342  -11.224 1.00 71.29  ? 194 THR A N   1 
ATOM   1483 C CA  . THR A 1 216 ? 43.550  70.623  -12.557 1.00 72.23  ? 194 THR A CA  1 
ATOM   1484 C C   . THR A 1 216 ? 44.649  71.107  -13.500 1.00 74.20  ? 194 THR A C   1 
ATOM   1485 O O   . THR A 1 216 ? 44.785  70.606  -14.625 1.00 67.70  ? 194 THR A O   1 
ATOM   1486 C CB  . THR A 1 216 ? 42.419  71.669  -12.460 1.00 72.17  ? 194 THR A CB  1 
ATOM   1487 O OG1 . THR A 1 216 ? 41.187  71.057  -12.029 1.00 79.91  ? 194 THR A OG1 1 
ATOM   1488 C CG2 . THR A 1 216 ? 42.191  72.369  -13.776 1.00 64.01  ? 194 THR A CG2 1 
ATOM   1489 N N   . ALA A 1 217 ? 45.449  72.077  -13.051 1.00 69.44  ? 195 ALA A N   1 
ATOM   1490 C CA  . ALA A 1 217 ? 46.595  72.531  -13.833 1.00 63.16  ? 195 ALA A CA  1 
ATOM   1491 C C   . ALA A 1 217 ? 47.496  71.371  -14.218 1.00 67.40  ? 195 ALA A C   1 
ATOM   1492 O O   . ALA A 1 217 ? 47.955  71.270  -15.364 1.00 85.08  ? 195 ALA A O   1 
ATOM   1493 C CB  . ALA A 1 217 ? 47.400  73.553  -13.030 1.00 49.12  ? 195 ALA A CB  1 
ATOM   1494 N N   . PHE A 1 218 ? 47.734  70.474  -13.271 1.00 59.04  ? 196 PHE A N   1 
ATOM   1495 C CA  . PHE A 1 218 ? 48.611  69.342  -13.500 1.00 50.36  ? 196 PHE A CA  1 
ATOM   1496 C C   . PHE A 1 218 ? 48.024  68.391  -14.521 1.00 61.15  ? 196 PHE A C   1 
ATOM   1497 O O   . PHE A 1 218 ? 48.687  68.039  -15.504 1.00 78.64  ? 196 PHE A O   1 
ATOM   1498 C CB  . PHE A 1 218 ? 48.869  68.629  -12.181 1.00 60.64  ? 196 PHE A CB  1 
ATOM   1499 C CG  . PHE A 1 218 ? 49.794  67.468  -12.297 1.00 51.12  ? 196 PHE A CG  1 
ATOM   1500 C CD1 . PHE A 1 218 ? 51.176  67.666  -12.212 1.00 46.82  ? 196 PHE A CD1 1 
ATOM   1501 C CD2 . PHE A 1 218 ? 49.291  66.177  -12.462 1.00 52.10  ? 196 PHE A CD2 1 
ATOM   1502 C CE1 . PHE A 1 218 ? 52.050  66.589  -12.301 1.00 47.61  ? 196 PHE A CE1 1 
ATOM   1503 C CE2 . PHE A 1 218 ? 50.140  65.099  -12.564 1.00 66.22  ? 196 PHE A CE2 1 
ATOM   1504 C CZ  . PHE A 1 218 ? 51.533  65.298  -12.486 1.00 70.95  ? 196 PHE A CZ  1 
ATOM   1505 N N   . ASP A 1 219 ? 46.792  67.923  -14.280 1.00 59.24  ? 197 ASP A N   1 
ATOM   1506 C CA  . ASP A 1 219 ? 46.210  66.903  -15.150 1.00 69.26  ? 197 ASP A CA  1 
ATOM   1507 C C   . ASP A 1 219 ? 45.956  67.452  -16.553 1.00 74.39  ? 197 ASP A C   1 
ATOM   1508 O O   . ASP A 1 219 ? 46.045  66.707  -17.538 1.00 67.65  ? 197 ASP A O   1 
ATOM   1509 C CB  . ASP A 1 219 ? 44.937  66.348  -14.528 1.00 82.65  ? 197 ASP A CB  1 
ATOM   1510 C CG  . ASP A 1 219 ? 45.199  65.629  -13.224 1.00 101.30 ? 197 ASP A CG  1 
ATOM   1511 O OD1 . ASP A 1 219 ? 46.088  64.752  -13.179 1.00 109.01 ? 197 ASP A OD1 1 
ATOM   1512 O OD2 . ASP A 1 219 ? 44.495  65.923  -12.245 1.00 108.48 ? 197 ASP A OD2 1 
ATOM   1513 N N   . GLU A 1 220 ? 45.664  68.754  -16.656 1.00 72.01  ? 198 GLU A N   1 
ATOM   1514 C CA  . GLU A 1 220 ? 45.564  69.409  -17.952 1.00 77.43  ? 198 GLU A CA  1 
ATOM   1515 C C   . GLU A 1 220 ? 46.912  69.483  -18.655 1.00 87.36  ? 198 GLU A C   1 
ATOM   1516 O O   . GLU A 1 220 ? 46.962  69.526  -19.889 1.00 108.02 ? 198 GLU A O   1 
ATOM   1517 C CB  . GLU A 1 220 ? 44.988  70.813  -17.777 1.00 78.33  ? 198 GLU A CB  1 
ATOM   1518 C CG  . GLU A 1 220 ? 43.462  70.867  -17.813 1.00 98.68  ? 198 GLU A CG  1 
ATOM   1519 C CD  . GLU A 1 220 ? 42.934  72.237  -17.449 1.00 101.60 ? 198 GLU A CD  1 
ATOM   1520 O OE1 . GLU A 1 220 ? 41.770  72.554  -17.812 1.00 94.52  ? 198 GLU A OE1 1 
ATOM   1521 O OE2 . GLU A 1 220 ? 43.706  72.989  -16.800 1.00 99.86  ? 198 GLU A OE2 1 
ATOM   1522 N N   . ALA A 1 221 ? 48.009  69.489  -17.900 1.00 77.61  ? 199 ALA A N   1 
ATOM   1523 C CA  . ALA A 1 221 ? 49.332  69.579  -18.509 1.00 72.61  ? 199 ALA A CA  1 
ATOM   1524 C C   . ALA A 1 221 ? 49.850  68.221  -18.977 1.00 77.73  ? 199 ALA A C   1 
ATOM   1525 O O   . ALA A 1 221 ? 50.422  68.122  -20.070 1.00 80.28  ? 199 ALA A O   1 
ATOM   1526 C CB  . ALA A 1 221 ? 50.309  70.210  -17.525 1.00 64.55  ? 199 ALA A CB  1 
ATOM   1527 N N   . ILE A 1 222 ? 49.632  67.150  -18.202 1.00 78.25  ? 200 ILE A N   1 
ATOM   1528 C CA  . ILE A 1 222 ? 50.029  65.841  -18.719 1.00 81.95  ? 200 ILE A CA  1 
ATOM   1529 C C   . ILE A 1 222 ? 49.151  65.467  -19.891 1.00 84.36  ? 200 ILE A C   1 
ATOM   1530 O O   . ILE A 1 222 ? 49.601  64.782  -20.812 1.00 97.61  ? 200 ILE A O   1 
ATOM   1531 C CB  . ILE A 1 222 ? 50.004  64.729  -17.645 1.00 92.73  ? 200 ILE A CB  1 
ATOM   1532 C CG1 . ILE A 1 222 ? 48.750  64.774  -16.792 1.00 107.93 ? 200 ILE A CG1 1 
ATOM   1533 C CG2 . ILE A 1 222 ? 51.231  64.761  -16.728 1.00 88.66  ? 200 ILE A CG2 1 
ATOM   1534 C CD1 . ILE A 1 222 ? 48.721  63.643  -15.761 1.00 114.97 ? 200 ILE A CD1 1 
ATOM   1535 N N   . ALA A 1 223 ? 47.886  65.907  -19.879 1.00 88.74  ? 201 ALA A N   1 
ATOM   1536 C CA  . ALA A 1 223 ? 46.951  65.553  -20.943 1.00 87.68  ? 201 ALA A CA  1 
ATOM   1537 C C   . ALA A 1 223 ? 47.448  65.988  -22.315 1.00 90.22  ? 201 ALA A C   1 
ATOM   1538 O O   . ALA A 1 223 ? 47.228  65.285  -23.306 1.00 86.13  ? 201 ALA A O   1 
ATOM   1539 C CB  . ALA A 1 223 ? 45.593  66.178  -20.648 1.00 84.46  ? 201 ALA A CB  1 
ATOM   1540 N N   . GLU A 1 224 ? 48.172  67.102  -22.384 1.00 90.48  ? 202 GLU A N   1 
ATOM   1541 C CA  . GLU A 1 224 ? 48.626  67.674  -23.645 1.00 98.94  ? 202 GLU A CA  1 
ATOM   1542 C C   . GLU A 1 224 ? 50.142  67.876  -23.577 1.00 103.80 ? 202 GLU A C   1 
ATOM   1543 O O   . GLU A 1 224 ? 50.642  68.999  -23.654 1.00 97.85  ? 202 GLU A O   1 
ATOM   1544 C CB  . GLU A 1 224 ? 47.892  68.985  -23.950 1.00 98.41  ? 202 GLU A CB  1 
ATOM   1545 N N   . LEU A 1 225 ? 50.877  66.764  -23.384 1.00 110.11 ? 203 LEU A N   1 
ATOM   1546 C CA  . LEU A 1 225 ? 52.342  66.740  -23.430 1.00 98.41  ? 203 LEU A CA  1 
ATOM   1547 C C   . LEU A 1 225 ? 52.881  66.750  -24.848 1.00 110.13 ? 203 LEU A C   1 
ATOM   1548 O O   . LEU A 1 225 ? 54.106  66.718  -25.016 1.00 108.95 ? 203 LEU A O   1 
ATOM   1549 C CB  . LEU A 1 225 ? 52.923  65.504  -22.715 1.00 83.61  ? 203 LEU A CB  1 
ATOM   1550 C CG  . LEU A 1 225 ? 52.902  65.323  -21.181 1.00 82.68  ? 203 LEU A CG  1 
ATOM   1551 C CD1 . LEU A 1 225 ? 53.333  63.906  -20.800 1.00 84.48  ? 203 LEU A CD1 1 
ATOM   1552 C CD2 . LEU A 1 225 ? 53.767  66.347  -20.442 1.00 68.97  ? 203 LEU A CD2 1 
ATOM   1553 N N   . ASP A 1 226 ? 52.001  66.732  -25.860 1.00 119.94 ? 204 ASP A N   1 
ATOM   1554 C CA  . ASP A 1 226 ? 52.424  66.952  -27.241 1.00 124.00 ? 204 ASP A CA  1 
ATOM   1555 C C   . ASP A 1 226 ? 53.044  68.332  -27.420 1.00 120.11 ? 204 ASP A C   1 
ATOM   1556 O O   . ASP A 1 226 ? 53.925  68.514  -28.268 1.00 122.97 ? 204 ASP A O   1 
ATOM   1557 C CB  . ASP A 1 226 ? 51.236  66.776  -28.190 1.00 127.52 ? 204 ASP A CB  1 
ATOM   1558 N N   . THR A 1 227 ? 52.567  69.315  -26.657 1.00 115.15 ? 205 THR A N   1 
ATOM   1559 C CA  . THR A 1 227 ? 52.899  70.725  -26.818 1.00 117.38 ? 205 THR A CA  1 
ATOM   1560 C C   . THR A 1 227 ? 54.109  71.171  -25.984 1.00 121.97 ? 205 THR A C   1 
ATOM   1561 O O   . THR A 1 227 ? 54.222  72.358  -25.653 1.00 127.76 ? 205 THR A O   1 
ATOM   1562 C CB  . THR A 1 227 ? 51.672  71.578  -26.477 1.00 109.01 ? 205 THR A CB  1 
ATOM   1563 O OG1 . THR A 1 227 ? 51.544  71.711  -25.051 1.00 108.58 ? 205 THR A OG1 1 
ATOM   1564 C CG2 . THR A 1 227 ? 50.410  70.927  -27.030 1.00 101.42 ? 205 THR A CG2 1 
ATOM   1565 N N   . LEU A 1 228 ? 54.998  70.256  -25.619 1.00 117.90 ? 206 LEU A N   1 
ATOM   1566 C CA  . LEU A 1 228 ? 56.236  70.623  -24.945 1.00 105.16 ? 206 LEU A CA  1 
ATOM   1567 C C   . LEU A 1 228 ? 57.328  70.960  -25.963 1.00 110.04 ? 206 LEU A C   1 
ATOM   1568 O O   . LEU A 1 228 ? 57.489  70.271  -26.976 1.00 100.74 ? 206 LEU A O   1 
ATOM   1569 C CB  . LEU A 1 228 ? 56.693  69.496  -24.022 1.00 86.52  ? 206 LEU A CB  1 
ATOM   1570 C CG  . LEU A 1 228 ? 56.037  69.492  -22.649 1.00 72.30  ? 206 LEU A CG  1 
ATOM   1571 C CD1 . LEU A 1 228 ? 56.571  68.315  -21.877 1.00 74.58  ? 206 LEU A CD1 1 
ATOM   1572 C CD2 . LEU A 1 228 ? 56.287  70.796  -21.915 1.00 66.99  ? 206 LEU A CD2 1 
ATOM   1573 N N   . SER A 1 229 ? 58.102  72.003  -25.659 1.00 115.43 ? 207 SER A N   1 
ATOM   1574 C CA  . SER A 1 229 ? 59.131  72.549  -26.532 1.00 124.69 ? 207 SER A CA  1 
ATOM   1575 C C   . SER A 1 229 ? 60.496  71.899  -26.296 1.00 128.31 ? 207 SER A C   1 
ATOM   1576 O O   . SER A 1 229 ? 60.773  71.322  -25.242 1.00 122.11 ? 207 SER A O   1 
ATOM   1577 C CB  . SER A 1 229 ? 59.257  74.057  -26.295 1.00 125.03 ? 207 SER A CB  1 
ATOM   1578 O OG  . SER A 1 229 ? 57.991  74.673  -26.138 1.00 119.03 ? 207 SER A OG  1 
ATOM   1579 N N   . GLU A 1 230 ? 61.363  72.013  -27.307 1.00 140.30 ? 208 GLU A N   1 
ATOM   1580 C CA  . GLU A 1 230 ? 62.740  71.562  -27.138 1.00 145.44 ? 208 GLU A CA  1 
ATOM   1581 C C   . GLU A 1 230 ? 63.475  72.441  -26.136 1.00 147.24 ? 208 GLU A C   1 
ATOM   1582 O O   . GLU A 1 230 ? 64.460  72.000  -25.534 1.00 149.30 ? 208 GLU A O   1 
ATOM   1583 C CB  . GLU A 1 230 ? 63.480  71.560  -28.481 1.00 145.97 ? 208 GLU A CB  1 
ATOM   1584 N N   . GLU A 1 231 ? 62.982  73.660  -25.930 1.00 145.74 ? 209 GLU A N   1 
ATOM   1585 C CA  . GLU A 1 231 ? 63.575  74.632  -25.028 1.00 137.90 ? 209 GLU A CA  1 
ATOM   1586 C C   . GLU A 1 231 ? 62.940  74.665  -23.640 1.00 122.77 ? 209 GLU A C   1 
ATOM   1587 O O   . GLU A 1 231 ? 63.650  74.902  -22.659 1.00 128.76 ? 209 GLU A O   1 
ATOM   1588 C CB  . GLU A 1 231 ? 63.487  76.031  -25.659 1.00 137.72 ? 209 GLU A CB  1 
ATOM   1589 C CG  . GLU A 1 231 ? 62.099  76.382  -26.206 1.00 123.21 ? 209 GLU A CG  1 
ATOM   1590 C CD  . GLU A 1 231 ? 61.795  77.867  -26.141 1.00 112.75 ? 209 GLU A CD  1 
ATOM   1591 N N   A SER A 1 232 ? 61.631  74.435  -23.528 0.45 113.65 ? 210 SER A N   1 
ATOM   1592 N N   B SER A 1 232 ? 61.634  74.421  -23.526 0.55 113.60 ? 210 SER A N   1 
ATOM   1593 C CA  A SER A 1 232 ? 60.921  74.613  -22.266 0.45 102.92 ? 210 SER A CA  1 
ATOM   1594 C CA  B SER A 1 232 ? 60.923  74.610  -22.268 0.55 102.93 ? 210 SER A CA  1 
ATOM   1595 C C   A SER A 1 232 ? 60.559  73.308  -21.567 0.45 99.64  ? 210 SER A C   1 
ATOM   1596 C C   B SER A 1 232 ? 60.557  73.308  -21.568 0.55 99.66  ? 210 SER A C   1 
ATOM   1597 O O   A SER A 1 232 ? 60.029  73.358  -20.453 0.45 95.49  ? 210 SER A O   1 
ATOM   1598 O O   B SER A 1 232 ? 60.023  73.356  -20.455 0.55 95.72  ? 210 SER A O   1 
ATOM   1599 C CB  A SER A 1 232 ? 59.632  75.427  -22.485 0.45 95.63  ? 210 SER A CB  1 
ATOM   1600 C CB  B SER A 1 232 ? 59.641  75.433  -22.491 0.55 95.75  ? 210 SER A CB  1 
ATOM   1601 O OG  A SER A 1 232 ? 59.757  76.759  -22.003 0.45 88.90  ? 210 SER A OG  1 
ATOM   1602 O OG  B SER A 1 232 ? 58.555  74.613  -22.905 0.55 84.75  ? 210 SER A OG  1 
ATOM   1603 N N   . TYR A 1 233 ? 60.818  72.148  -22.178 1.00 97.92  ? 211 TYR A N   1 
ATOM   1604 C CA  . TYR A 1 233 ? 60.343  70.904  -21.577 1.00 86.18  ? 211 TYR A CA  1 
ATOM   1605 C C   . TYR A 1 233 ? 60.942  70.685  -20.196 1.00 82.84  ? 211 TYR A C   1 
ATOM   1606 O O   . TYR A 1 233 ? 60.242  70.236  -19.287 1.00 76.18  ? 211 TYR A O   1 
ATOM   1607 C CB  . TYR A 1 233 ? 60.616  69.700  -22.481 1.00 91.00  ? 211 TYR A CB  1 
ATOM   1608 C CG  . TYR A 1 233 ? 62.009  69.111  -22.415 1.00 118.27 ? 211 TYR A CG  1 
ATOM   1609 C CD1 . TYR A 1 233 ? 63.148  69.902  -22.615 1.00 130.84 ? 211 TYR A CD1 1 
ATOM   1610 C CD2 . TYR A 1 233 ? 62.190  67.753  -22.175 1.00 128.57 ? 211 TYR A CD2 1 
ATOM   1611 C CE1 . TYR A 1 233 ? 64.435  69.350  -22.571 1.00 133.94 ? 211 TYR A CE1 1 
ATOM   1612 C CE2 . TYR A 1 233 ? 63.474  67.191  -22.132 1.00 137.26 ? 211 TYR A CE2 1 
ATOM   1613 C CZ  . TYR A 1 233 ? 64.591  67.991  -22.329 1.00 134.75 ? 211 TYR A CZ  1 
ATOM   1614 O OH  . TYR A 1 233 ? 65.850  67.420  -22.283 1.00 131.05 ? 211 TYR A OH  1 
ATOM   1615 N N   . LYS A 1 234 ? 62.203  71.081  -19.987 1.00 92.33  ? 212 LYS A N   1 
ATOM   1616 C CA  . LYS A 1 234 ? 62.798  70.981  -18.653 1.00 87.53  ? 212 LYS A CA  1 
ATOM   1617 C C   . LYS A 1 234 ? 62.081  71.887  -17.652 1.00 73.13  ? 212 LYS A C   1 
ATOM   1618 O O   . LYS A 1 234 ? 61.675  71.434  -16.583 1.00 73.22  ? 212 LYS A O   1 
ATOM   1619 C CB  . LYS A 1 234 ? 64.293  71.310  -18.714 1.00 93.47  ? 212 LYS A CB  1 
ATOM   1620 N N   . ASP A 1 235 ? 61.829  73.147  -18.024 1.00 79.88  ? 213 ASP A N   1 
ATOM   1621 C CA  . ASP A 1 235 ? 61.272  74.113  -17.079 1.00 74.64  ? 213 ASP A CA  1 
ATOM   1622 C C   . ASP A 1 235 ? 59.810  73.832  -16.759 1.00 71.70  ? 213 ASP A C   1 
ATOM   1623 O O   . ASP A 1 235 ? 59.393  74.008  -15.614 1.00 70.64  ? 213 ASP A O   1 
ATOM   1624 C CB  . ASP A 1 235 ? 61.414  75.540  -17.625 1.00 94.90  ? 213 ASP A CB  1 
ATOM   1625 C CG  . ASP A 1 235 ? 62.767  75.790  -18.322 1.00 118.02 ? 213 ASP A CG  1 
ATOM   1626 O OD1 . ASP A 1 235 ? 63.822  75.505  -17.709 1.00 125.49 ? 213 ASP A OD1 1 
ATOM   1627 O OD2 . ASP A 1 235 ? 62.774  76.259  -19.493 1.00 120.93 ? 213 ASP A OD2 1 
ATOM   1628 N N   . SER A 1 236 ? 59.023  73.343  -17.715 1.00 78.58  ? 214 SER A N   1 
ATOM   1629 C CA  . SER A 1 236 ? 57.625  73.061  -17.389 1.00 71.33  ? 214 SER A CA  1 
ATOM   1630 C C   . SER A 1 236 ? 57.478  71.733  -16.658 1.00 64.17  ? 214 SER A C   1 
ATOM   1631 O O   . SER A 1 236 ? 56.615  71.600  -15.785 1.00 69.63  ? 214 SER A O   1 
ATOM   1632 C CB  . SER A 1 236 ? 56.747  73.089  -18.641 1.00 77.93  ? 214 SER A CB  1 
ATOM   1633 O OG  . SER A 1 236 ? 57.409  72.583  -19.778 1.00 93.71  ? 214 SER A OG  1 
ATOM   1634 N N   . THR A 1 237 ? 58.323  70.758  -16.980 1.00 67.29  ? 215 THR A N   1 
ATOM   1635 C CA  . THR A 1 237 ? 58.360  69.509  -16.230 1.00 64.34  ? 215 THR A CA  1 
ATOM   1636 C C   . THR A 1 237 ? 58.740  69.754  -14.774 1.00 78.67  ? 215 THR A C   1 
ATOM   1637 O O   . THR A 1 237 ? 58.256  69.065  -13.870 1.00 81.57  ? 215 THR A O   1 
ATOM   1638 C CB  . THR A 1 237 ? 59.355  68.569  -16.906 1.00 68.45  ? 215 THR A CB  1 
ATOM   1639 O OG1 . THR A 1 237 ? 58.750  68.013  -18.075 1.00 88.58  ? 215 THR A OG1 1 
ATOM   1640 C CG2 . THR A 1 237 ? 59.827  67.496  -16.007 1.00 73.70  ? 215 THR A CG2 1 
ATOM   1641 N N   . LEU A 1 238 ? 59.605  70.738  -14.525 1.00 75.83  ? 216 LEU A N   1 
ATOM   1642 C CA  . LEU A 1 238 ? 59.941  71.087  -13.153 1.00 71.47  ? 216 LEU A CA  1 
ATOM   1643 C C   . LEU A 1 238 ? 58.711  71.594  -12.402 1.00 71.57  ? 216 LEU A C   1 
ATOM   1644 O O   . LEU A 1 238 ? 58.410  71.135  -11.291 1.00 77.51  ? 216 LEU A O   1 
ATOM   1645 C CB  . LEU A 1 238 ? 61.043  72.145  -13.146 1.00 80.11  ? 216 LEU A CB  1 
ATOM   1646 C CG  . LEU A 1 238 ? 61.912  72.262  -11.904 1.00 86.91  ? 216 LEU A CG  1 
ATOM   1647 C CD1 . LEU A 1 238 ? 62.962  71.154  -11.937 1.00 92.98  ? 216 LEU A CD1 1 
ATOM   1648 C CD2 . LEU A 1 238 ? 62.521  73.655  -11.838 1.00 93.53  ? 216 LEU A CD2 1 
ATOM   1649 N N   . ILE A 1 239 ? 57.982  72.545  -12.992 1.00 69.04  ? 217 ILE A N   1 
ATOM   1650 C CA  . ILE A 1 239 ? 56.815  73.101  -12.311 1.00 63.91  ? 217 ILE A CA  1 
ATOM   1651 C C   . ILE A 1 239 ? 55.736  72.034  -12.126 1.00 63.40  ? 217 ILE A C   1 
ATOM   1652 O O   . ILE A 1 239 ? 55.019  72.031  -11.119 1.00 60.37  ? 217 ILE A O   1 
ATOM   1653 C CB  . ILE A 1 239 ? 56.282  74.345  -13.044 1.00 63.72  ? 217 ILE A CB  1 
ATOM   1654 C CG1 . ILE A 1 239 ? 57.401  75.378  -13.251 1.00 57.19  ? 217 ILE A CG1 1 
ATOM   1655 C CG2 . ILE A 1 239 ? 55.170  74.979  -12.216 1.00 55.87  ? 217 ILE A CG2 1 
ATOM   1656 C CD1 . ILE A 1 239 ? 56.996  76.623  -14.055 1.00 45.74  ? 217 ILE A CD1 1 
ATOM   1657 N N   . MET A 1 240 ? 55.580  71.123  -13.091 1.00 58.00  ? 218 MET A N   1 
ATOM   1658 C CA  . MET A 1 240 ? 54.570  70.088  -12.880 1.00 62.35  ? 218 MET A CA  1 
ATOM   1659 C C   . MET A 1 240 ? 54.871  69.260  -11.641 1.00 65.82  ? 218 MET A C   1 
ATOM   1660 O O   . MET A 1 240 ? 53.947  68.820  -10.946 1.00 73.25  ? 218 MET A O   1 
ATOM   1661 C CB  . MET A 1 240 ? 54.435  69.159  -14.092 1.00 53.90  ? 218 MET A CB  1 
ATOM   1662 C CG  . MET A 1 240 ? 53.584  69.708  -15.217 1.00 52.43  ? 218 MET A CG  1 
ATOM   1663 S SD  . MET A 1 240 ? 53.948  68.862  -16.736 1.00 70.69  ? 218 MET A SD  1 
ATOM   1664 C CE  . MET A 1 240 ? 53.002  67.411  -16.468 1.00 55.62  ? 218 MET A CE  1 
ATOM   1665 N N   . GLN A 1 241 ? 56.152  69.046  -11.341 1.00 63.84  ? 219 GLN A N   1 
ATOM   1666 C CA  . GLN A 1 241 ? 56.499  68.308  -10.131 1.00 63.53  ? 219 GLN A CA  1 
ATOM   1667 C C   . GLN A 1 241 ? 56.193  69.112  -8.873  1.00 57.47  ? 219 GLN A C   1 
ATOM   1668 O O   . GLN A 1 241 ? 55.762  68.534  -7.873  1.00 51.70  ? 219 GLN A O   1 
ATOM   1669 C CB  . GLN A 1 241 ? 57.963  67.886  -10.158 1.00 62.27  ? 219 GLN A CB  1 
ATOM   1670 C CG  . GLN A 1 241 ? 58.307  67.011  -11.319 1.00 67.61  ? 219 GLN A CG  1 
ATOM   1671 C CD  . GLN A 1 241 ? 59.628  66.310  -11.138 1.00 67.97  ? 219 GLN A CD  1 
ATOM   1672 O OE1 . GLN A 1 241 ? 60.348  66.559  -10.180 1.00 75.16  ? 219 GLN A OE1 1 
ATOM   1673 N NE2 . GLN A 1 241 ? 59.949  65.415  -12.059 1.00 73.17  ? 219 GLN A NE2 1 
ATOM   1674 N N   . LEU A 1 242 ? 56.410  70.439  -8.893  1.00 49.93  ? 220 LEU A N   1 
ATOM   1675 C CA  . LEU A 1 242 ? 56.080  71.241  -7.717  1.00 56.17  ? 220 LEU A CA  1 
ATOM   1676 C C   . LEU A 1 242 ? 54.587  71.368  -7.494  1.00 65.29  ? 220 LEU A C   1 
ATOM   1677 O O   . LEU A 1 242 ? 54.170  71.562  -6.341  1.00 53.37  ? 220 LEU A O   1 
ATOM   1678 C CB  . LEU A 1 242 ? 56.689  72.644  -7.772  1.00 55.09  ? 220 LEU A CB  1 
ATOM   1679 C CG  . LEU A 1 242 ? 58.142  72.777  -8.193  1.00 61.48  ? 220 LEU A CG  1 
ATOM   1680 C CD1 . LEU A 1 242 ? 58.470  74.238  -8.302  1.00 59.13  ? 220 LEU A CD1 1 
ATOM   1681 C CD2 . LEU A 1 242 ? 59.016  72.083  -7.162  1.00 38.07  ? 220 LEU A CD2 1 
ATOM   1682 N N   . LEU A 1 243 ? 53.776  71.281  -8.563  1.00 60.56  ? 221 LEU A N   1 
ATOM   1683 C CA  . LEU A 1 243 ? 52.334  71.208  -8.380  1.00 43.45  ? 221 LEU A CA  1 
ATOM   1684 C C   . LEU A 1 243 ? 51.974  69.964  -7.581  1.00 53.53  ? 221 LEU A C   1 
ATOM   1685 O O   . LEU A 1 243 ? 51.260  70.036  -6.574  1.00 60.69  ? 221 LEU A O   1 
ATOM   1686 C CB  . LEU A 1 243 ? 51.623  71.206  -9.723  1.00 50.07  ? 221 LEU A CB  1 
ATOM   1687 C CG  . LEU A 1 243 ? 51.536  72.505  -10.530 1.00 58.84  ? 221 LEU A CG  1 
ATOM   1688 C CD1 . LEU A 1 243 ? 50.887  72.255  -11.932 1.00 66.39  ? 221 LEU A CD1 1 
ATOM   1689 C CD2 . LEU A 1 243 ? 50.818  73.574  -9.773  1.00 45.83  ? 221 LEU A CD2 1 
ATOM   1690 N N   . ARG A 1 244 ? 52.521  68.818  -7.969  1.00 50.90  ? 222 ARG A N   1 
ATOM   1691 C CA  . ARG A 1 244 ? 52.106  67.615  -7.275  1.00 58.96  ? 222 ARG A CA  1 
ATOM   1692 C C   . ARG A 1 244 ? 52.851  67.441  -5.946  1.00 67.37  ? 222 ARG A C   1 
ATOM   1693 O O   . ARG A 1 244 ? 52.444  66.630  -5.113  1.00 74.02  ? 222 ARG A O   1 
ATOM   1694 C CB  . ARG A 1 244 ? 52.290  66.388  -8.202  1.00 52.07  ? 222 ARG A CB  1 
ATOM   1695 C CG  . ARG A 1 244 ? 51.922  65.095  -7.523  1.00 61.48  ? 222 ARG A CG  1 
ATOM   1696 C CD  . ARG A 1 244 ? 51.993  63.823  -8.307  1.00 49.89  ? 222 ARG A CD  1 
ATOM   1697 N NE  . ARG A 1 244 ? 53.174  63.650  -9.101  1.00 76.51  ? 222 ARG A NE  1 
ATOM   1698 C CZ  . ARG A 1 244 ? 54.066  62.690  -8.862  1.00 86.38  ? 222 ARG A CZ  1 
ATOM   1699 N NH1 . ARG A 1 244 ? 55.140  62.539  -9.656  1.00 88.92  ? 222 ARG A NH1 1 
ATOM   1700 N NH2 . ARG A 1 244 ? 53.878  61.880  -7.818  1.00 75.89  ? 222 ARG A NH2 1 
ATOM   1701 N N   . ASP A 1 245 ? 53.860  68.258  -5.668  1.00 71.17  ? 223 ASP A N   1 
ATOM   1702 C CA  . ASP A 1 245 ? 54.494  68.230  -4.355  1.00 71.96  ? 223 ASP A CA  1 
ATOM   1703 C C   . ASP A 1 245 ? 53.767  69.102  -3.350  1.00 73.08  ? 223 ASP A C   1 
ATOM   1704 O O   . ASP A 1 245 ? 53.592  68.697  -2.200  1.00 82.26  ? 223 ASP A O   1 
ATOM   1705 C CB  . ASP A 1 245 ? 55.956  68.669  -4.471  1.00 66.53  ? 223 ASP A CB  1 
ATOM   1706 C CG  . ASP A 1 245 ? 56.830  67.603  -5.049  1.00 77.12  ? 223 ASP A CG  1 
ATOM   1707 O OD1 . ASP A 1 245 ? 56.311  66.488  -5.276  1.00 92.42  ? 223 ASP A OD1 1 
ATOM   1708 O OD2 . ASP A 1 245 ? 58.013  67.898  -5.338  1.00 83.04  ? 223 ASP A OD2 1 
ATOM   1709 N N   . ASN A 1 246 ? 53.305  70.277  -3.767  1.00 66.28  ? 224 ASN A N   1 
ATOM   1710 C CA  . ASN A 1 246 ? 52.419  71.037  -2.904  1.00 56.16  ? 224 ASN A CA  1 
ATOM   1711 C C   . ASN A 1 246 ? 51.149  70.250  -2.657  1.00 71.33  ? 224 ASN A C   1 
ATOM   1712 O O   . ASN A 1 246 ? 50.621  70.239  -1.541  1.00 77.72  ? 224 ASN A O   1 
ATOM   1713 C CB  . ASN A 1 246 ? 52.101  72.389  -3.534  1.00 46.76  ? 224 ASN A CB  1 
ATOM   1714 C CG  . ASN A 1 246 ? 53.247  73.364  -3.395  1.00 54.72  ? 224 ASN A CG  1 
ATOM   1715 O OD1 . ASN A 1 246 ? 54.145  73.145  -2.587  1.00 60.70  ? 224 ASN A OD1 1 
ATOM   1716 N ND2 . ASN A 1 246 ? 53.225  74.446  -4.175  1.00 57.48  ? 224 ASN A ND2 1 
ATOM   1717 N N   . LEU A 1 247 ? 50.697  69.509  -3.665  1.00 73.42  ? 225 LEU A N   1 
ATOM   1718 C CA  . LEU A 1 247 ? 49.526  68.664  -3.496  1.00 68.00  ? 225 LEU A CA  1 
ATOM   1719 C C   . LEU A 1 247 ? 49.756  67.631  -2.401  1.00 73.24  ? 225 LEU A C   1 
ATOM   1720 O O   . LEU A 1 247 ? 48.961  67.525  -1.464  1.00 80.84  ? 225 LEU A O   1 
ATOM   1721 C CB  . LEU A 1 247 ? 49.195  67.983  -4.821  1.00 72.05  ? 225 LEU A CB  1 
ATOM   1722 C CG  . LEU A 1 247 ? 47.741  67.712  -5.193  1.00 67.18  ? 225 LEU A CG  1 
ATOM   1723 C CD1 . LEU A 1 247 ? 46.925  68.958  -4.988  1.00 57.63  ? 225 LEU A CD1 1 
ATOM   1724 C CD2 . LEU A 1 247 ? 47.680  67.229  -6.650  1.00 72.16  ? 225 LEU A CD2 1 
ATOM   1725 N N   . THR A 1 248 ? 50.833  66.847  -2.512  1.00 81.44  ? 226 THR A N   1 
ATOM   1726 C CA  . THR A 1 248 ? 51.106  65.803  -1.519  1.00 85.70  ? 226 THR A CA  1 
ATOM   1727 C C   . THR A 1 248 ? 51.297  66.389  -0.126  1.00 82.01  ? 226 THR A C   1 
ATOM   1728 O O   . THR A 1 248 ? 50.954  65.755  0.877   1.00 89.44  ? 226 THR A O   1 
ATOM   1729 C CB  . THR A 1 248 ? 52.332  64.978  -1.909  1.00 81.76  ? 226 THR A CB  1 
ATOM   1730 O OG1 . THR A 1 248 ? 52.236  64.599  -3.278  1.00 83.57  ? 226 THR A OG1 1 
ATOM   1731 C CG2 . THR A 1 248 ? 52.358  63.715  -1.102  1.00 91.57  ? 226 THR A CG2 1 
ATOM   1732 N N   . LEU A 1 249 ? 51.898  67.573  -0.050  1.00 72.21  ? 227 LEU A N   1 
ATOM   1733 C CA  . LEU A 1 249 ? 52.089  68.249  1.226   1.00 69.13  ? 227 LEU A CA  1 
ATOM   1734 C C   . LEU A 1 249 ? 50.743  68.628  1.847   1.00 75.85  ? 227 LEU A C   1 
ATOM   1735 O O   . LEU A 1 249 ? 50.509  68.407  3.038   1.00 71.59  ? 227 LEU A O   1 
ATOM   1736 C CB  . LEU A 1 249 ? 52.955  69.492  0.994   1.00 52.55  ? 227 LEU A CB  1 
ATOM   1737 C CG  . LEU A 1 249 ? 53.113  70.561  2.061   1.00 56.71  ? 227 LEU A CG  1 
ATOM   1738 C CD1 . LEU A 1 249 ? 53.769  69.939  3.286   1.00 50.09  ? 227 LEU A CD1 1 
ATOM   1739 C CD2 . LEU A 1 249 ? 53.878  71.769  1.545   1.00 50.19  ? 227 LEU A CD2 1 
ATOM   1740 N N   . TRP A 1 250 ? 49.840  69.184  1.037   1.00 80.88  ? 228 TRP A N   1 
ATOM   1741 C CA  . TRP A 1 250 ? 48.590  69.769  1.507   1.00 76.57  ? 228 TRP A CA  1 
ATOM   1742 C C   . TRP A 1 250 ? 47.581  68.722  1.961   1.00 89.79  ? 228 TRP A C   1 
ATOM   1743 O O   . TRP A 1 250 ? 46.650  69.057  2.700   1.00 94.90  ? 228 TRP A O   1 
ATOM   1744 C CB  . TRP A 1 250 ? 47.992  70.630  0.397   1.00 67.19  ? 228 TRP A CB  1 
ATOM   1745 C CG  . TRP A 1 250 ? 48.752  71.916  0.123   1.00 72.09  ? 228 TRP A CG  1 
ATOM   1746 C CD1 . TRP A 1 250 ? 49.668  72.533  0.942   1.00 78.44  ? 228 TRP A CD1 1 
ATOM   1747 C CD2 . TRP A 1 250 ? 48.663  72.732  -1.058  1.00 69.73  ? 228 TRP A CD2 1 
ATOM   1748 N NE1 . TRP A 1 250 ? 50.135  73.688  0.346   1.00 73.42  ? 228 TRP A NE1 1 
ATOM   1749 C CE2 . TRP A 1 250 ? 49.533  73.830  -0.878  1.00 71.48  ? 228 TRP A CE2 1 
ATOM   1750 C CE3 . TRP A 1 250 ? 47.922  72.644  -2.243  1.00 68.43  ? 228 TRP A CE3 1 
ATOM   1751 C CZ2 . TRP A 1 250 ? 49.680  74.829  -1.840  1.00 75.76  ? 228 TRP A CZ2 1 
ATOM   1752 C CZ3 . TRP A 1 250 ? 48.067  73.636  -3.193  1.00 72.79  ? 228 TRP A CZ3 1 
ATOM   1753 C CH2 . TRP A 1 250 ? 48.945  74.712  -2.989  1.00 77.54  ? 228 TRP A CH2 1 
ATOM   1754 N N   . THR A 1 251 ? 47.751  67.466  1.548   1.00 90.77  ? 229 THR A N   1 
ATOM   1755 C CA  . THR A 1 251 ? 46.824  66.391  1.864   1.00 91.21  ? 229 THR A CA  1 
ATOM   1756 C C   . THR A 1 251 ? 47.241  65.588  3.090   1.00 105.08 ? 229 THR A C   1 
ATOM   1757 O O   . THR A 1 251 ? 46.809  64.438  3.231   1.00 116.19 ? 229 THR A O   1 
ATOM   1758 C CB  . THR A 1 251 ? 46.653  65.448  0.670   1.00 90.15  ? 229 THR A CB  1 
ATOM   1759 O OG1 . THR A 1 251 ? 47.838  64.658  0.515   1.00 104.69 ? 229 THR A OG1 1 
ATOM   1760 C CG2 . THR A 1 251 ? 46.363  66.220  -0.618  1.00 69.43  ? 229 THR A CG2 1 
ATOM   1761 N N   . SER A 1 252 ? 48.130  66.122  3.925   1.00 115.36 ? 230 SER A N   1 
ATOM   1762 C CA  . SER A 1 252 ? 48.399  65.508  5.234   1.00 121.88 ? 230 SER A CA  1 
ATOM   1763 C C   . SER A 1 252 ? 48.205  66.519  6.378   1.00 126.49 ? 230 SER A C   1 
ATOM   1764 O O   . SER A 1 252 ? 47.437  67.483  6.261   1.00 119.60 ? 230 SER A O   1 
ATOM   1765 C CB  . SER A 1 252 ? 49.807  64.898  5.279   1.00 99.72  ? 230 SER A CB  1 
ATOM   1766 O OG  . SER A 1 252 ? 50.758  65.781  4.732   1.00 79.95  ? 230 SER A OG  1 
ATOM   1767 N N   . MET B 1 23  ? 71.467  103.403 24.650  1.00 125.75 ? 1   MET B N   1 
ATOM   1768 C CA  . MET B 1 23  ? 71.424  101.949 24.804  1.00 119.03 ? 1   MET B CA  1 
ATOM   1769 C C   . MET B 1 23  ? 72.246  101.470 26.026  1.00 127.11 ? 1   MET B C   1 
ATOM   1770 O O   . MET B 1 23  ? 72.820  102.284 26.766  1.00 128.19 ? 1   MET B O   1 
ATOM   1771 C CB  . MET B 1 23  ? 71.909  101.275 23.516  1.00 104.22 ? 1   MET B CB  1 
ATOM   1772 N N   . ASP B 1 24  ? 72.272  100.150 26.238  1.00 123.67 ? 2   ASP B N   1 
ATOM   1773 C CA  . ASP B 1 24  ? 72.974  99.518  27.353  1.00 125.26 ? 2   ASP B CA  1 
ATOM   1774 C C   . ASP B 1 24  ? 73.439  98.134  26.906  1.00 117.97 ? 2   ASP B C   1 
ATOM   1775 O O   . ASP B 1 24  ? 72.773  97.472  26.104  1.00 120.09 ? 2   ASP B O   1 
ATOM   1776 C CB  . ASP B 1 24  ? 72.118  99.443  28.631  1.00 130.23 ? 2   ASP B CB  1 
ATOM   1777 C CG  . ASP B 1 24  ? 71.186  98.244  28.652  1.00 133.73 ? 2   ASP B CG  1 
ATOM   1778 O OD1 . ASP B 1 24  ? 71.656  97.116  28.914  1.00 131.93 ? 2   ASP B OD1 1 
ATOM   1779 O OD2 . ASP B 1 24  ? 69.972  98.435  28.427  1.00 138.53 ? 2   ASP B OD2 1 
ATOM   1780 N N   . LYS B 1 25  ? 74.591  97.706  27.437  1.00 107.93 ? 3   LYS B N   1 
ATOM   1781 C CA  . LYS B 1 25  ? 75.296  96.543  26.896  1.00 93.47  ? 3   LYS B CA  1 
ATOM   1782 C C   . LYS B 1 25  ? 74.451  95.271  26.911  1.00 101.64 ? 3   LYS B C   1 
ATOM   1783 O O   . LYS B 1 25  ? 74.487  94.495  25.949  1.00 108.25 ? 3   LYS B O   1 
ATOM   1784 C CB  . LYS B 1 25  ? 76.601  96.311  27.663  1.00 85.81  ? 3   LYS B CB  1 
ATOM   1785 N N   . ASN B 1 26  ? 73.671  95.035  27.971  1.00 107.41 ? 4   ASN B N   1 
ATOM   1786 C CA  . ASN B 1 26  ? 72.958  93.760  28.044  1.00 100.07 ? 4   ASN B CA  1 
ATOM   1787 C C   . ASN B 1 26  ? 71.907  93.631  26.955  1.00 83.14  ? 4   ASN B C   1 
ATOM   1788 O O   . ASN B 1 26  ? 71.688  92.523  26.454  1.00 77.55  ? 4   ASN B O   1 
ATOM   1789 C CB  . ASN B 1 26  ? 72.296  93.599  29.415  1.00 114.38 ? 4   ASN B CB  1 
ATOM   1790 C CG  . ASN B 1 26  ? 73.075  92.673  30.343  1.00 125.46 ? 4   ASN B CG  1 
ATOM   1791 O OD1 . ASN B 1 26  ? 72.837  91.465  30.366  1.00 135.68 ? 4   ASN B OD1 1 
ATOM   1792 N ND2 . ASN B 1 26  ? 74.006  93.238  31.116  1.00 120.84 ? 4   ASN B ND2 1 
ATOM   1793 N N   . GLU B 1 27  ? 71.315  94.755  26.521  1.00 85.22  ? 5   GLU B N   1 
ATOM   1794 C CA  . GLU B 1 27  ? 70.292  94.742  25.472  1.00 87.33  ? 5   GLU B CA  1 
ATOM   1795 C C   . GLU B 1 27  ? 70.892  94.696  24.070  1.00 93.31  ? 5   GLU B C   1 
ATOM   1796 O O   . GLU B 1 27  ? 70.334  94.047  23.181  1.00 95.32  ? 5   GLU B O   1 
ATOM   1797 C CB  . GLU B 1 27  ? 69.368  95.959  25.604  1.00 83.92  ? 5   GLU B CB  1 
ATOM   1798 N N   . LEU B 1 28  ? 72.023  95.373  23.845  1.00 98.97  ? 6   LEU B N   1 
ATOM   1799 C CA  . LEU B 1 28  ? 72.646  95.355  22.520  1.00 89.89  ? 6   LEU B CA  1 
ATOM   1800 C C   . LEU B 1 28  ? 73.134  93.958  22.143  1.00 82.87  ? 6   LEU B C   1 
ATOM   1801 O O   . LEU B 1 28  ? 73.030  93.556  20.975  1.00 78.79  ? 6   LEU B O   1 
ATOM   1802 C CB  . LEU B 1 28  ? 73.799  96.364  22.466  1.00 84.64  ? 6   LEU B CB  1 
ATOM   1803 C CG  . LEU B 1 28  ? 73.501  97.863  22.627  1.00 76.85  ? 6   LEU B CG  1 
ATOM   1804 C CD1 . LEU B 1 28  ? 74.789  98.680  22.704  1.00 73.67  ? 6   LEU B CD1 1 
ATOM   1805 C CD2 . LEU B 1 28  ? 72.610  98.369  21.488  1.00 57.69  ? 6   LEU B CD2 1 
ATOM   1806 N N   . VAL B 1 29  ? 73.678  93.204  23.107  1.00 82.36  ? 7   VAL B N   1 
ATOM   1807 C CA  . VAL B 1 29  ? 74.054  91.821  22.809  1.00 85.57  ? 7   VAL B CA  1 
ATOM   1808 C C   . VAL B 1 29  ? 72.816  90.957  22.595  1.00 92.29  ? 7   VAL B C   1 
ATOM   1809 O O   . VAL B 1 29  ? 72.883  89.936  21.902  1.00 100.16 ? 7   VAL B O   1 
ATOM   1810 C CB  . VAL B 1 29  ? 74.974  91.224  23.896  1.00 73.96  ? 7   VAL B CB  1 
ATOM   1811 C CG1 . VAL B 1 29  ? 76.021  92.223  24.279  1.00 61.35  ? 7   VAL B CG1 1 
ATOM   1812 C CG2 . VAL B 1 29  ? 74.174  90.786  25.098  1.00 95.85  ? 7   VAL B CG2 1 
ATOM   1813 N N   . GLN B 1 30  ? 71.678  91.319  23.201  1.00 89.09  ? 8   GLN B N   1 
ATOM   1814 C CA  . GLN B 1 30  ? 70.445  90.594  22.906  1.00 87.26  ? 8   GLN B CA  1 
ATOM   1815 C C   . GLN B 1 30  ? 69.956  90.903  21.495  1.00 78.08  ? 8   GLN B C   1 
ATOM   1816 O O   . GLN B 1 30  ? 69.546  89.993  20.765  1.00 74.88  ? 8   GLN B O   1 
ATOM   1817 C CB  . GLN B 1 30  ? 69.361  90.912  23.943  1.00 94.70  ? 8   GLN B CB  1 
ATOM   1818 C CG  . GLN B 1 30  ? 69.629  90.329  25.325  1.00 99.94  ? 8   GLN B CG  1 
ATOM   1819 C CD  . GLN B 1 30  ? 69.941  88.839  25.289  1.00 105.59 ? 8   GLN B CD  1 
ATOM   1820 O OE1 . GLN B 1 30  ? 69.327  88.077  24.533  1.00 110.86 ? 8   GLN B OE1 1 
ATOM   1821 N NE2 . GLN B 1 30  ? 70.906  88.417  26.107  1.00 102.04 ? 8   GLN B NE2 1 
ATOM   1822 N N   . LYS B 1 31  ? 69.999  92.176  21.085  1.00 74.74  ? 9   LYS B N   1 
ATOM   1823 C CA  . LYS B 1 31  ? 69.560  92.512  19.735  1.00 69.21  ? 9   LYS B CA  1 
ATOM   1824 C C   . LYS B 1 31  ? 70.499  91.895  18.702  1.00 72.31  ? 9   LYS B C   1 
ATOM   1825 O O   . LYS B 1 31  ? 70.043  91.223  17.771  1.00 73.75  ? 9   LYS B O   1 
ATOM   1826 C CB  . LYS B 1 31  ? 69.458  94.033  19.567  1.00 63.36  ? 9   LYS B CB  1 
ATOM   1827 N N   . ALA B 1 32  ? 71.820  92.078  18.885  1.00 70.77  ? 10  ALA B N   1 
ATOM   1828 C CA  . ALA B 1 32  ? 72.813  91.491  17.982  1.00 65.93  ? 10  ALA B CA  1 
ATOM   1829 C C   . ALA B 1 32  ? 72.665  89.976  17.907  1.00 65.48  ? 10  ALA B C   1 
ATOM   1830 O O   . ALA B 1 32  ? 72.834  89.376  16.834  1.00 63.69  ? 10  ALA B O   1 
ATOM   1831 C CB  . ALA B 1 32  ? 74.226  91.870  18.426  1.00 61.38  ? 10  ALA B CB  1 
ATOM   1832 N N   . LYS B 1 33  ? 72.382  89.338  19.045  1.00 65.28  ? 11  LYS B N   1 
ATOM   1833 C CA  . LYS B 1 33  ? 72.100  87.904  19.056  1.00 64.06  ? 11  LYS B CA  1 
ATOM   1834 C C   . LYS B 1 33  ? 70.846  87.565  18.251  1.00 61.52  ? 11  LYS B C   1 
ATOM   1835 O O   . LYS B 1 33  ? 70.695  86.419  17.812  1.00 62.35  ? 11  LYS B O   1 
ATOM   1836 C CB  . LYS B 1 33  ? 71.931  87.409  20.490  1.00 58.44  ? 11  LYS B CB  1 
ATOM   1837 C CG  . LYS B 1 33  ? 72.874  86.329  20.915  1.00 61.12  ? 11  LYS B CG  1 
ATOM   1838 C CD  . LYS B 1 33  ? 72.827  86.180  22.431  1.00 69.04  ? 11  LYS B CD  1 
ATOM   1839 C CE  . LYS B 1 33  ? 72.933  84.723  22.836  1.00 79.35  ? 11  LYS B CE  1 
ATOM   1840 N NZ  . LYS B 1 33  ? 72.819  84.566  24.312  1.00 88.13  ? 11  LYS B NZ  1 
ATOM   1841 N N   . LEU B 1 34  ? 69.910  88.526  18.108  1.00 62.92  ? 12  LEU B N   1 
ATOM   1842 C CA  . LEU B 1 34  ? 68.676  88.339  17.329  1.00 65.80  ? 12  LEU B CA  1 
ATOM   1843 C C   . LEU B 1 34  ? 68.909  88.537  15.839  1.00 66.91  ? 12  LEU B C   1 
ATOM   1844 O O   . LEU B 1 34  ? 68.430  87.750  15.013  1.00 61.68  ? 12  LEU B O   1 
ATOM   1845 C CB  . LEU B 1 34  ? 67.604  89.333  17.772  1.00 67.07  ? 12  LEU B CB  1 
ATOM   1846 C CG  . LEU B 1 34  ? 66.350  88.913  18.514  1.00 65.57  ? 12  LEU B CG  1 
ATOM   1847 C CD1 . LEU B 1 34  ? 65.299  90.003  18.312  1.00 58.74  ? 12  LEU B CD1 1 
ATOM   1848 C CD2 . LEU B 1 34  ? 65.856  87.576  17.986  1.00 67.34  ? 12  LEU B CD2 1 
ATOM   1849 N N   . ALA B 1 35  ? 69.597  89.626  15.489  1.00 67.09  ? 13  ALA B N   1 
ATOM   1850 C CA  . ALA B 1 35  ? 70.061  89.841  14.129  1.00 55.61  ? 13  ALA B CA  1 
ATOM   1851 C C   . ALA B 1 35  ? 70.815  88.635  13.598  1.00 61.24  ? 13  ALA B C   1 
ATOM   1852 O O   . ALA B 1 35  ? 70.758  88.352  12.397  1.00 66.50  ? 13  ALA B O   1 
ATOM   1853 C CB  . ALA B 1 35  ? 70.939  91.087  14.075  1.00 50.31  ? 13  ALA B CB  1 
ATOM   1854 N N   . GLU B 1 36  ? 71.554  87.927  14.453  1.00 58.65  ? 14  GLU B N   1 
ATOM   1855 C CA  . GLU B 1 36  ? 72.327  86.807  13.932  1.00 68.67  ? 14  GLU B CA  1 
ATOM   1856 C C   . GLU B 1 36  ? 71.413  85.676  13.475  1.00 67.72  ? 14  GLU B C   1 
ATOM   1857 O O   . GLU B 1 36  ? 71.584  85.131  12.372  1.00 64.84  ? 14  GLU B O   1 
ATOM   1858 C CB  . GLU B 1 36  ? 73.329  86.314  14.962  1.00 74.93  ? 14  GLU B CB  1 
ATOM   1859 C CG  . GLU B 1 36  ? 73.954  85.018  14.547  1.00 79.23  ? 14  GLU B CG  1 
ATOM   1860 C CD  . GLU B 1 36  ? 74.851  84.476  15.592  1.00 96.91  ? 14  GLU B CD  1 
ATOM   1861 O OE1 . GLU B 1 36  ? 74.340  83.828  16.526  1.00 108.59 ? 14  GLU B OE1 1 
ATOM   1862 O OE2 . GLU B 1 36  ? 76.065  84.721  15.493  1.00 106.84 ? 14  GLU B OE2 1 
ATOM   1863 N N   . GLN B 1 37  ? 70.401  85.343  14.283  1.00 62.65  ? 15  GLN B N   1 
ATOM   1864 C CA  . GLN B 1 37  ? 69.464  84.295  13.878  1.00 67.80  ? 15  GLN B CA  1 
ATOM   1865 C C   . GLN B 1 37  ? 68.646  84.711  12.654  1.00 67.96  ? 15  GLN B C   1 
ATOM   1866 O O   . GLN B 1 37  ? 68.238  83.859  11.852  1.00 60.12  ? 15  GLN B O   1 
ATOM   1867 C CB  . GLN B 1 37  ? 68.512  83.960  15.014  1.00 68.23  ? 15  GLN B CB  1 
ATOM   1868 C CG  . GLN B 1 37  ? 69.142  83.684  16.326  1.00 81.69  ? 15  GLN B CG  1 
ATOM   1869 C CD  . GLN B 1 37  ? 68.094  83.301  17.345  1.00 100.61 ? 15  GLN B CD  1 
ATOM   1870 O OE1 . GLN B 1 37  ? 67.334  82.351  17.135  1.00 104.94 ? 15  GLN B OE1 1 
ATOM   1871 N NE2 . GLN B 1 37  ? 68.001  84.072  18.428  1.00 109.69 ? 15  GLN B NE2 1 
ATOM   1872 N N   . ALA B 1 38  ? 68.401  86.010  12.503  1.00 59.62  ? 16  ALA B N   1 
ATOM   1873 C CA  . ALA B 1 38  ? 67.726  86.570  11.352  1.00 55.41  ? 16  ALA B CA  1 
ATOM   1874 C C   . ALA B 1 38  ? 68.650  86.710  10.146  1.00 63.55  ? 16  ALA B C   1 
ATOM   1875 O O   . ALA B 1 38  ? 68.194  87.175  9.091   1.00 59.71  ? 16  ALA B O   1 
ATOM   1876 C CB  . ALA B 1 38  ? 67.158  87.936  11.734  1.00 47.91  ? 16  ALA B CB  1 
ATOM   1877 N N   . GLU B 1 39  ? 69.912  86.284  10.294  1.00 67.79  ? 17  GLU B N   1 
ATOM   1878 C CA  . GLU B 1 39  ? 70.994  86.412  9.311   1.00 57.42  ? 17  GLU B CA  1 
ATOM   1879 C C   . GLU B 1 39  ? 71.009  87.787  8.673   1.00 58.79  ? 17  GLU B C   1 
ATOM   1880 O O   . GLU B 1 39  ? 71.197  87.932  7.469   1.00 61.46  ? 17  GLU B O   1 
ATOM   1881 C CB  . GLU B 1 39  ? 70.944  85.333  8.231   1.00 45.99  ? 17  GLU B CB  1 
ATOM   1882 C CG  . GLU B 1 39  ? 70.681  83.942  8.748   1.00 61.37  ? 17  GLU B CG  1 
ATOM   1883 C CD  . GLU B 1 39  ? 70.821  82.864  7.677   1.00 83.69  ? 17  GLU B CD  1 
ATOM   1884 O OE1 . GLU B 1 39  ? 70.575  81.676  7.999   1.00 93.18  ? 17  GLU B OE1 1 
ATOM   1885 O OE2 . GLU B 1 39  ? 71.133  83.204  6.507   1.00 87.72  ? 17  GLU B OE2 1 
ATOM   1886 N N   . ARG B 1 40  ? 70.926  88.819  9.514   1.00 53.35  ? 18  ARG B N   1 
ATOM   1887 C CA  . ARG B 1 40  ? 71.140  90.178  9.046   1.00 53.71  ? 18  ARG B CA  1 
ATOM   1888 C C   . ARG B 1 40  ? 72.410  90.673  9.747   1.00 59.10  ? 18  ARG B C   1 
ATOM   1889 O O   . ARG B 1 40  ? 72.362  91.360  10.770  1.00 60.95  ? 18  ARG B O   1 
ATOM   1890 C CB  . ARG B 1 40  ? 69.926  91.083  9.332   1.00 53.21  ? 18  ARG B CB  1 
ATOM   1891 C CG  . ARG B 1 40  ? 68.571  90.391  9.075   1.00 65.25  ? 18  ARG B CG  1 
ATOM   1892 C CD  . ARG B 1 40  ? 67.392  91.346  8.731   1.00 68.23  ? 18  ARG B CD  1 
ATOM   1893 N NE  . ARG B 1 40  ? 67.512  92.745  9.173   1.00 62.18  ? 18  ARG B NE  1 
ATOM   1894 C CZ  . ARG B 1 40  ? 66.933  93.753  8.505   1.00 63.20  ? 18  ARG B CZ  1 
ATOM   1895 N NH1 . ARG B 1 40  ? 66.261  93.501  7.384   1.00 67.65  ? 18  ARG B NH1 1 
ATOM   1896 N NH2 . ARG B 1 40  ? 67.064  95.009  8.895   1.00 60.90  ? 18  ARG B NH2 1 
ATOM   1897 N N   . TYR B 1 41  ? 73.556  90.350  9.135   1.00 64.75  ? 19  TYR B N   1 
ATOM   1898 C CA  . TYR B 1 41  ? 74.824  90.548  9.827   1.00 67.51  ? 19  TYR B CA  1 
ATOM   1899 C C   . TYR B 1 41  ? 75.284  92.004  9.864   1.00 72.25  ? 19  TYR B C   1 
ATOM   1900 O O   . TYR B 1 41  ? 76.119  92.344  10.706  1.00 71.03  ? 19  TYR B O   1 
ATOM   1901 C CB  . TYR B 1 41  ? 75.899  89.657  9.198   1.00 55.87  ? 19  TYR B CB  1 
ATOM   1902 C CG  . TYR B 1 41  ? 75.600  88.169  9.358   1.00 53.61  ? 19  TYR B CG  1 
ATOM   1903 C CD1 . TYR B 1 41  ? 75.830  87.522  10.559  1.00 56.47  ? 19  TYR B CD1 1 
ATOM   1904 C CD2 . TYR B 1 41  ? 75.042  87.424  8.318   1.00 51.55  ? 19  TYR B CD2 1 
ATOM   1905 C CE1 . TYR B 1 41  ? 75.532  86.163  10.714  1.00 64.35  ? 19  TYR B CE1 1 
ATOM   1906 C CE2 . TYR B 1 41  ? 74.752  86.069  8.460   1.00 52.33  ? 19  TYR B CE2 1 
ATOM   1907 C CZ  . TYR B 1 41  ? 75.003  85.445  9.663   1.00 67.30  ? 19  TYR B CZ  1 
ATOM   1908 O OH  . TYR B 1 41  ? 74.724  84.103  9.815   1.00 80.49  ? 19  TYR B OH  1 
ATOM   1909 N N   . ASP B 1 42  ? 74.747  92.890  9.024   1.00 78.23  ? 20  ASP B N   1 
ATOM   1910 C CA  . ASP B 1 42  ? 75.126  94.296  9.169   1.00 76.23  ? 20  ASP B CA  1 
ATOM   1911 C C   . ASP B 1 42  ? 74.522  94.880  10.440  1.00 80.13  ? 20  ASP B C   1 
ATOM   1912 O O   . ASP B 1 42  ? 75.173  95.669  11.136  1.00 77.42  ? 20  ASP B O   1 
ATOM   1913 C CB  . ASP B 1 42  ? 74.711  95.118  7.942   1.00 81.05  ? 20  ASP B CB  1 
ATOM   1914 C CG  . ASP B 1 42  ? 75.545  94.797  6.698   1.00 103.14 ? 20  ASP B CG  1 
ATOM   1915 O OD1 . ASP B 1 42  ? 76.294  93.799  6.707   1.00 112.49 ? 20  ASP B OD1 1 
ATOM   1916 O OD2 . ASP B 1 42  ? 75.464  95.547  5.701   1.00 114.18 ? 20  ASP B OD2 1 
ATOM   1917 N N   . ASP B 1 43  ? 73.267  94.510  10.743  1.00 85.65  ? 21  ASP B N   1 
ATOM   1918 C CA  . ASP B 1 43  ? 72.636  94.888  12.008  1.00 73.97  ? 21  ASP B CA  1 
ATOM   1919 C C   . ASP B 1 43  ? 73.427  94.347  13.192  1.00 63.06  ? 21  ASP B C   1 
ATOM   1920 O O   . ASP B 1 43  ? 73.751  95.080  14.132  1.00 61.71  ? 21  ASP B O   1 
ATOM   1921 C CB  . ASP B 1 43  ? 71.198  94.351  12.070  1.00 71.12  ? 21  ASP B CB  1 
ATOM   1922 C CG  . ASP B 1 43  ? 70.191  95.243  11.371  1.00 77.33  ? 21  ASP B CG  1 
ATOM   1923 O OD1 . ASP B 1 43  ? 70.507  96.427  11.130  1.00 86.72  ? 21  ASP B OD1 1 
ATOM   1924 O OD2 . ASP B 1 43  ? 69.061  94.761  11.109  1.00 74.73  ? 21  ASP B OD2 1 
ATOM   1925 N N   . MET B 1 44  ? 73.761  93.057  13.145  1.00 49.49  ? 22  MET B N   1 
ATOM   1926 C CA  . MET B 1 44  ? 74.469  92.432  14.245  1.00 55.11  ? 22  MET B CA  1 
ATOM   1927 C C   . MET B 1 44  ? 75.830  93.095  14.466  1.00 67.27  ? 22  MET B C   1 
ATOM   1928 O O   . MET B 1 44  ? 76.270  93.272  15.606  1.00 66.56  ? 22  MET B O   1 
ATOM   1929 C CB  . MET B 1 44  ? 74.613  90.939  13.942  1.00 49.13  ? 22  MET B CB  1 
ATOM   1930 C CG  . MET B 1 44  ? 75.730  90.232  14.701  1.00 50.12  ? 22  MET B CG  1 
ATOM   1931 S SD  . MET B 1 44  ? 75.867  88.497  14.212  1.00 61.47  ? 22  MET B SD  1 
ATOM   1932 C CE  . MET B 1 44  ? 76.694  87.799  15.628  1.00 79.40  ? 22  MET B CE  1 
ATOM   1933 N N   . ALA B 1 45  ? 76.488  93.515  13.387  1.00 70.27  ? 23  ALA B N   1 
ATOM   1934 C CA  . ALA B 1 45  ? 77.766  94.196  13.518  1.00 60.37  ? 23  ALA B CA  1 
ATOM   1935 C C   . ALA B 1 45  ? 77.605  95.594  14.088  1.00 56.99  ? 23  ALA B C   1 
ATOM   1936 O O   . ALA B 1 45  ? 78.413  96.018  14.917  1.00 62.91  ? 23  ALA B O   1 
ATOM   1937 C CB  . ALA B 1 45  ? 78.468  94.250  12.165  1.00 74.55  ? 23  ALA B CB  1 
ATOM   1938 N N   . ALA B 1 46  ? 76.581  96.338  13.670  1.00 60.35  ? 24  ALA B N   1 
ATOM   1939 C CA  . ALA B 1 46  ? 76.455  97.690  14.214  1.00 63.25  ? 24  ALA B CA  1 
ATOM   1940 C C   . ALA B 1 46  ? 76.209  97.665  15.719  1.00 62.45  ? 24  ALA B C   1 
ATOM   1941 O O   . ALA B 1 46  ? 76.649  98.581  16.430  1.00 62.90  ? 24  ALA B O   1 
ATOM   1942 C CB  . ALA B 1 46  ? 75.341  98.460  13.515  1.00 57.17  ? 24  ALA B CB  1 
ATOM   1943 N N   . CYS B 1 47  ? 75.496  96.638  16.213  1.00 58.14  ? 25  CYS B N   1 
ATOM   1944 C CA  . CYS B 1 47  ? 75.314  96.462  17.655  1.00 73.90  ? 25  CYS B CA  1 
ATOM   1945 C C   . CYS B 1 47  ? 76.643  96.228  18.353  1.00 68.63  ? 25  CYS B C   1 
ATOM   1946 O O   . CYS B 1 47  ? 76.953  96.878  19.360  1.00 68.40  ? 25  CYS B O   1 
ATOM   1947 C CB  . CYS B 1 47  ? 74.342  95.314  17.966  1.00 81.08  ? 25  CYS B CB  1 
ATOM   1948 S SG  . CYS B 1 47  ? 72.628  95.540  17.421  1.00 85.20  ? 25  CYS B SG  1 
ATOM   1949 N N   . MET B 1 48  ? 77.417  95.258  17.868  1.00 61.28  ? 26  MET B N   1 
ATOM   1950 C CA  . MET B 1 48  ? 78.667  94.911  18.524  1.00 61.60  ? 26  MET B CA  1 
ATOM   1951 C C   . MET B 1 48  ? 79.739  96.000  18.387  1.00 71.54  ? 26  MET B C   1 
ATOM   1952 O O   . MET B 1 48  ? 80.705  96.000  19.160  1.00 77.90  ? 26  MET B O   1 
ATOM   1953 C CB  . MET B 1 48  ? 79.163  93.574  17.996  1.00 60.02  ? 26  MET B CB  1 
ATOM   1954 C CG  . MET B 1 48  ? 78.216  92.391  18.279  1.00 72.20  ? 26  MET B CG  1 
ATOM   1955 S SD  . MET B 1 48  ? 77.545  92.285  19.956  1.00 86.09  ? 26  MET B SD  1 
ATOM   1956 C CE  . MET B 1 48  ? 79.058  92.199  20.929  1.00 90.47  ? 26  MET B CE  1 
ATOM   1957 N N   . LYS B 1 49  ? 79.600  96.930  17.442  1.00 69.64  ? 27  LYS B N   1 
ATOM   1958 C CA  . LYS B 1 49  ? 80.468  98.105  17.461  1.00 71.49  ? 27  LYS B CA  1 
ATOM   1959 C C   . LYS B 1 49  ? 80.048  99.076  18.556  1.00 80.59  ? 27  LYS B C   1 
ATOM   1960 O O   . LYS B 1 49  ? 80.893  99.781  19.124  1.00 85.84  ? 27  LYS B O   1 
ATOM   1961 C CB  . LYS B 1 49  ? 80.471  98.800  16.092  1.00 70.44  ? 27  LYS B CB  1 
ATOM   1962 C CG  . LYS B 1 49  ? 81.301  100.089 16.029  1.00 63.79  ? 27  LYS B CG  1 
ATOM   1963 C CD  . LYS B 1 49  ? 81.272  100.742 14.660  1.00 65.47  ? 27  LYS B CD  1 
ATOM   1964 C CE  . LYS B 1 49  ? 82.056  102.052 14.667  1.00 73.00  ? 27  LYS B CE  1 
ATOM   1965 N NZ  . LYS B 1 49  ? 81.724  102.968 13.535  1.00 77.32  ? 27  LYS B NZ  1 
ATOM   1966 N N   . SER B 1 50  ? 78.745  99.170  18.825  1.00 86.57  ? 28  SER B N   1 
ATOM   1967 C CA  . SER B 1 50  ? 78.262  100.065 19.875  1.00 91.06  ? 28  SER B CA  1 
ATOM   1968 C C   . SER B 1 50  ? 78.616  99.554  21.274  1.00 81.53  ? 28  SER B C   1 
ATOM   1969 O O   . SER B 1 50  ? 78.954  100.351 22.161  1.00 80.46  ? 28  SER B O   1 
ATOM   1970 C CB  . SER B 1 50  ? 76.758  100.271 19.717  1.00 92.25  ? 28  SER B CB  1 
ATOM   1971 O OG  . SER B 1 50  ? 76.494  101.228 18.702  1.00 93.95  ? 28  SER B OG  1 
ATOM   1972 N N   . VAL B 1 51  ? 78.537  98.235  21.495  1.00 72.03  ? 29  VAL B N   1 
ATOM   1973 C CA  . VAL B 1 51  ? 79.011  97.653  22.754  1.00 80.90  ? 29  VAL B CA  1 
ATOM   1974 C C   . VAL B 1 51  ? 80.509  97.901  22.931  1.00 96.39  ? 29  VAL B C   1 
ATOM   1975 O O   . VAL B 1 51  ? 80.978  98.239  24.030  1.00 104.05 ? 29  VAL B O   1 
ATOM   1976 C CB  . VAL B 1 51  ? 78.670  96.150  22.812  1.00 72.71  ? 29  VAL B CB  1 
ATOM   1977 C CG1 . VAL B 1 51  ? 79.466  95.447  23.884  1.00 59.24  ? 29  VAL B CG1 1 
ATOM   1978 C CG2 . VAL B 1 51  ? 77.202  95.956  23.060  1.00 76.27  ? 29  VAL B CG2 1 
ATOM   1979 N N   . THR B 1 52  ? 81.285  97.731  21.852  1.00 92.49  ? 30  THR B N   1 
ATOM   1980 C CA  . THR B 1 52  ? 82.730  97.917  21.931  1.00 89.12  ? 30  THR B CA  1 
ATOM   1981 C C   . THR B 1 52  ? 83.069  99.378  22.210  1.00 99.20  ? 30  THR B C   1 
ATOM   1982 O O   . THR B 1 52  ? 83.931  99.672  23.052  1.00 107.05 ? 30  THR B O   1 
ATOM   1983 C CB  . THR B 1 52  ? 83.404  97.424  20.641  1.00 73.57  ? 30  THR B CB  1 
ATOM   1984 O OG1 . THR B 1 52  ? 83.278  96.000  20.545  1.00 62.07  ? 30  THR B OG1 1 
ATOM   1985 C CG2 . THR B 1 52  ? 84.889  97.785  20.602  1.00 74.52  ? 30  THR B CG2 1 
ATOM   1986 N N   . GLU B 1 53  ? 82.369  100.314 21.543  1.00 89.84  ? 31  GLU B N   1 
ATOM   1987 C CA  . GLU B 1 53  ? 82.657  101.735 21.741  1.00 98.76  ? 31  GLU B CA  1 
ATOM   1988 C C   . GLU B 1 53  ? 82.275  102.241 23.134  1.00 101.04 ? 31  GLU B C   1 
ATOM   1989 O O   . GLU B 1 53  ? 82.340  103.460 23.371  1.00 98.96  ? 31  GLU B O   1 
ATOM   1990 C CB  . GLU B 1 53  ? 81.917  102.573 20.703  1.00 107.13 ? 31  GLU B CB  1 
ATOM   1991 C CG  . GLU B 1 53  ? 82.473  102.551 19.298  1.00 108.40 ? 31  GLU B CG  1 
ATOM   1992 C CD  . GLU B 1 53  ? 81.566  103.310 18.354  1.00 106.56 ? 31  GLU B CD  1 
ATOM   1993 O OE1 . GLU B 1 53  ? 80.353  103.008 18.348  1.00 107.07 ? 31  GLU B OE1 1 
ATOM   1994 O OE2 . GLU B 1 53  ? 82.050  104.226 17.654  1.00 105.09 ? 31  GLU B OE2 1 
ATOM   1995 N N   . GLN B 1 54  ? 81.864  101.354 24.037  1.00 105.39 ? 32  GLN B N   1 
ATOM   1996 C CA  . GLN B 1 54  ? 81.611  101.704 25.422  1.00 108.06 ? 32  GLN B CA  1 
ATOM   1997 C C   . GLN B 1 54  ? 82.845  101.563 26.302  1.00 120.74 ? 32  GLN B C   1 
ATOM   1998 O O   . GLN B 1 54  ? 82.784  101.905 27.490  1.00 124.09 ? 32  GLN B O   1 
ATOM   1999 C CB  . GLN B 1 54  ? 80.495  100.826 25.969  1.00 101.93 ? 32  GLN B CB  1 
ATOM   2000 C CG  . GLN B 1 54  ? 79.120  101.285 25.593  1.00 108.28 ? 32  GLN B CG  1 
ATOM   2001 C CD  . GLN B 1 54  ? 78.063  100.505 26.331  1.00 114.85 ? 32  GLN B CD  1 
ATOM   2002 O OE1 . GLN B 1 54  ? 78.382  99.618  27.122  1.00 116.94 ? 32  GLN B OE1 1 
ATOM   2003 N NE2 . GLN B 1 54  ? 76.797  100.825 26.079  1.00 112.24 ? 32  GLN B NE2 1 
ATOM   2004 N N   . GLY B 1 55  ? 83.961  101.103 25.747  1.00 121.68 ? 33  GLY B N   1 
ATOM   2005 C CA  . GLY B 1 55  ? 85.220  100.997 26.470  1.00 125.91 ? 33  GLY B CA  1 
ATOM   2006 C C   . GLY B 1 55  ? 85.545  99.715  27.221  1.00 119.53 ? 33  GLY B C   1 
ATOM   2007 O O   . GLY B 1 55  ? 86.684  99.247  27.176  1.00 125.05 ? 33  GLY B O   1 
ATOM   2008 N N   . ALA B 1 56  ? 84.567  99.141  27.914  1.00 111.56 ? 34  ALA B N   1 
ATOM   2009 C CA  . ALA B 1 56  ? 84.814  97.949  28.716  1.00 104.97 ? 34  ALA B CA  1 
ATOM   2010 C C   . ALA B 1 56  ? 85.186  96.746  27.860  1.00 106.39 ? 34  ALA B C   1 
ATOM   2011 O O   . ALA B 1 56  ? 84.674  96.560  26.747  1.00 111.25 ? 34  ALA B O   1 
ATOM   2012 C CB  . ALA B 1 56  ? 83.588  97.614  29.558  1.00 98.53  ? 34  ALA B CB  1 
ATOM   2013 N N   . GLU B 1 57  ? 86.084  95.925  28.402  1.00 101.70 ? 35  GLU B N   1 
ATOM   2014 C CA  . GLU B 1 57  ? 86.471  94.685  27.748  1.00 96.17  ? 35  GLU B CA  1 
ATOM   2015 C C   . GLU B 1 57  ? 85.271  93.746  27.651  1.00 93.02  ? 35  GLU B C   1 
ATOM   2016 O O   . GLU B 1 57  ? 84.401  93.735  28.525  1.00 86.83  ? 35  GLU B O   1 
ATOM   2017 C CB  . GLU B 1 57  ? 87.621  94.021  28.515  1.00 82.54  ? 35  GLU B CB  1 
ATOM   2018 N N   . LEU B 1 58  ? 85.214  92.988  26.554  1.00 90.04  ? 36  LEU B N   1 
ATOM   2019 C CA  . LEU B 1 58  ? 84.056  92.189  26.162  1.00 90.54  ? 36  LEU B CA  1 
ATOM   2020 C C   . LEU B 1 58  ? 84.149  90.752  26.679  1.00 86.08  ? 36  LEU B C   1 
ATOM   2021 O O   . LEU B 1 58  ? 85.243  90.185  26.809  1.00 79.78  ? 36  LEU B O   1 
ATOM   2022 C CB  . LEU B 1 58  ? 83.895  92.181  24.631  1.00 90.07  ? 36  LEU B CB  1 
ATOM   2023 C CG  . LEU B 1 58  ? 83.315  93.319  23.769  1.00 82.12  ? 36  LEU B CG  1 
ATOM   2024 C CD1 . LEU B 1 58  ? 83.658  94.744  24.211  1.00 81.99  ? 36  LEU B CD1 1 
ATOM   2025 C CD2 . LEU B 1 58  ? 83.853  93.092  22.374  1.00 63.18  ? 36  LEU B CD2 1 
ATOM   2026 N N   . SER B 1 59  ? 82.969  90.155  26.914  1.00 80.00  ? 37  SER B N   1 
ATOM   2027 C CA  . SER B 1 59  ? 82.829  88.775  27.373  1.00 78.60  ? 37  SER B CA  1 
ATOM   2028 C C   . SER B 1 59  ? 83.465  87.797  26.389  1.00 93.58  ? 37  SER B C   1 
ATOM   2029 O O   . SER B 1 59  ? 83.804  88.132  25.248  1.00 82.98  ? 37  SER B O   1 
ATOM   2030 C CB  . SER B 1 59  ? 81.364  88.352  27.461  1.00 73.80  ? 37  SER B CB  1 
ATOM   2031 O OG  . SER B 1 59  ? 80.512  89.398  27.863  1.00 90.10  ? 37  SER B OG  1 
ATOM   2032 N N   . ASN B 1 60  ? 83.514  86.534  26.798  1.00 107.07 ? 38  ASN B N   1 
ATOM   2033 C CA  . ASN B 1 60  ? 83.922  85.543  25.820  1.00 116.64 ? 38  ASN B CA  1 
ATOM   2034 C C   . ASN B 1 60  ? 82.764  85.166  24.913  1.00 119.78 ? 38  ASN B C   1 
ATOM   2035 O O   . ASN B 1 60  ? 82.997  84.573  23.854  1.00 125.68 ? 38  ASN B O   1 
ATOM   2036 C CB  . ASN B 1 60  ? 84.491  84.304  26.522  1.00 130.93 ? 38  ASN B CB  1 
ATOM   2037 C CG  . ASN B 1 60  ? 85.878  84.548  27.119  1.00 145.50 ? 38  ASN B CG  1 
ATOM   2038 O OD1 . ASN B 1 60  ? 86.623  85.417  26.663  1.00 147.78 ? 38  ASN B OD1 1 
ATOM   2039 N ND2 . ASN B 1 60  ? 86.216  83.792  28.165  1.00 153.08 ? 38  ASN B ND2 1 
ATOM   2040 N N   . GLU B 1 61  ? 81.532  85.529  25.290  1.00 116.18 ? 39  GLU B N   1 
ATOM   2041 C CA  . GLU B 1 61  ? 80.390  85.496  24.383  1.00 96.56  ? 39  GLU B CA  1 
ATOM   2042 C C   . GLU B 1 61  ? 80.280  86.762  23.544  1.00 87.94  ? 39  GLU B C   1 
ATOM   2043 O O   . GLU B 1 61  ? 79.912  86.693  22.366  1.00 92.82  ? 39  GLU B O   1 
ATOM   2044 C CB  . GLU B 1 61  ? 79.093  85.291  25.166  1.00 88.59  ? 39  GLU B CB  1 
ATOM   2045 C CG  . GLU B 1 61  ? 77.839  85.707  24.412  1.00 90.20  ? 39  GLU B CG  1 
ATOM   2046 C CD  . GLU B 1 61  ? 76.580  85.550  25.231  1.00 95.37  ? 39  GLU B CD  1 
ATOM   2047 O OE1 . GLU B 1 61  ? 76.637  85.785  26.459  1.00 95.72  ? 39  GLU B OE1 1 
ATOM   2048 O OE2 . GLU B 1 61  ? 75.539  85.170  24.649  1.00 100.04 ? 39  GLU B OE2 1 
ATOM   2049 N N   . GLU B 1 62  ? 80.605  87.923  24.115  1.00 75.13  ? 40  GLU B N   1 
ATOM   2050 C CA  . GLU B 1 62  ? 80.574  89.133  23.309  1.00 72.05  ? 40  GLU B CA  1 
ATOM   2051 C C   . GLU B 1 62  ? 81.707  89.129  22.308  1.00 83.58  ? 40  GLU B C   1 
ATOM   2052 O O   . GLU B 1 62  ? 81.588  89.757  21.254  1.00 83.17  ? 40  GLU B O   1 
ATOM   2053 C CB  . GLU B 1 62  ? 80.685  90.386  24.181  1.00 77.74  ? 40  GLU B CB  1 
ATOM   2054 C CG  . GLU B 1 62  ? 79.419  90.798  24.905  1.00 81.30  ? 40  GLU B CG  1 
ATOM   2055 N N   . ARG B 1 63  ? 82.668  88.290  22.523  1.00 92.26  ? 41  ARG B N   1 
ATOM   2056 C CA  . ARG B 1 63  ? 83.740  88.231  21.591  1.00 79.98  ? 41  ARG B CA  1 
ATOM   2057 C C   . ARG B 1 63  ? 83.273  87.516  20.410  1.00 81.40  ? 41  ARG B C   1 
ATOM   2058 O O   . ARG B 1 63  ? 83.377  87.982  19.355  1.00 82.62  ? 41  ARG B O   1 
ATOM   2059 C CB  . ARG B 1 63  ? 84.853  87.412  22.149  1.00 75.02  ? 41  ARG B CB  1 
ATOM   2060 C CG  . ARG B 1 63  ? 86.156  88.133  22.223  1.00 69.46  ? 41  ARG B CG  1 
ATOM   2061 C CD  . ARG B 1 63  ? 87.237  87.152  21.987  1.00 82.94  ? 41  ARG B CD  1 
ATOM   2062 N NE  . ARG B 1 63  ? 87.790  86.649  23.201  1.00 99.09  ? 41  ARG B NE  1 
ATOM   2063 C CZ  . ARG B 1 63  ? 87.814  85.376  23.484  1.00 114.34 ? 41  ARG B CZ  1 
ATOM   2064 N NH1 . ARG B 1 63  ? 88.341  84.963  24.601  1.00 113.89 ? 41  ARG B NH1 1 
ATOM   2065 N NH2 . ARG B 1 63  ? 87.289  84.534  22.643  1.00 124.89 ? 41  ARG B NH2 1 
ATOM   2066 N N   . ASN B 1 64  ? 82.728  86.353  20.584  1.00 78.34  ? 42  ASN B N   1 
ATOM   2067 C CA  . ASN B 1 64  ? 82.328  85.580  19.404  1.00 82.65  ? 42  ASN B CA  1 
ATOM   2068 C C   . ASN B 1 64  ? 81.369  86.360  18.510  1.00 76.95  ? 42  ASN B C   1 
ATOM   2069 O O   . ASN B 1 64  ? 81.505  86.326  17.283  1.00 82.83  ? 42  ASN B O   1 
ATOM   2070 C CB  . ASN B 1 64  ? 81.711  84.241  19.800  1.00 98.20  ? 42  ASN B CB  1 
ATOM   2071 C CG  . ASN B 1 64  ? 82.740  83.266  20.334  1.00 123.81 ? 42  ASN B CG  1 
ATOM   2072 O OD1 . ASN B 1 64  ? 83.924  83.328  19.982  1.00 134.21 ? 42  ASN B OD1 1 
ATOM   2073 N ND2 . ASN B 1 64  ? 82.296  82.363  21.203  1.00 131.91 ? 42  ASN B ND2 1 
ATOM   2074 N N   . LEU B 1 65  ? 80.413  87.092  19.100  1.00 75.40  ? 43  LEU B N   1 
ATOM   2075 C CA  . LEU B 1 65  ? 79.408  87.793  18.301  1.00 76.38  ? 43  LEU B CA  1 
ATOM   2076 C C   . LEU B 1 65  ? 80.028  88.865  17.420  1.00 81.64  ? 43  LEU B C   1 
ATOM   2077 O O   . LEU B 1 65  ? 79.593  89.075  16.284  1.00 90.46  ? 43  LEU B O   1 
ATOM   2078 C CB  . LEU B 1 65  ? 78.358  88.432  19.197  1.00 69.47  ? 43  LEU B CB  1 
ATOM   2079 C CG  . LEU B 1 65  ? 77.487  87.423  19.919  1.00 72.00  ? 43  LEU B CG  1 
ATOM   2080 C CD1 . LEU B 1 65  ? 76.754  88.099  21.083  1.00 60.83  ? 43  LEU B CD1 1 
ATOM   2081 C CD2 . LEU B 1 65  ? 76.535  86.790  18.926  1.00 69.89  ? 43  LEU B CD2 1 
ATOM   2082 N N   . LEU B 1 66  ? 81.047  89.547  17.903  1.00 73.84  ? 44  LEU B N   1 
ATOM   2083 C CA  . LEU B 1 66  ? 81.560  90.618  17.067  1.00 73.26  ? 44  LEU B CA  1 
ATOM   2084 C C   . LEU B 1 66  ? 82.472  90.049  15.974  1.00 77.38  ? 44  LEU B C   1 
ATOM   2085 O O   . LEU B 1 66  ? 82.535  90.591  14.857  1.00 68.11  ? 44  LEU B O   1 
ATOM   2086 C CB  . LEU B 1 66  ? 82.281  91.639  17.950  1.00 70.19  ? 44  LEU B CB  1 
ATOM   2087 C CG  . LEU B 1 66  ? 83.162  92.672  17.265  1.00 84.93  ? 44  LEU B CG  1 
ATOM   2088 C CD1 . LEU B 1 66  ? 82.248  93.459  16.369  1.00 93.57  ? 44  LEU B CD1 1 
ATOM   2089 C CD2 . LEU B 1 66  ? 83.858  93.585  18.230  1.00 90.19  ? 44  LEU B CD2 1 
ATOM   2090 N N   . SER B 1 67  ? 83.112  88.911  16.249  1.00 71.47  ? 45  SER B N   1 
ATOM   2091 C CA  . SER B 1 67  ? 83.779  88.162  15.195  1.00 66.18  ? 45  SER B CA  1 
ATOM   2092 C C   . SER B 1 67  ? 82.785  87.721  14.133  1.00 73.38  ? 45  SER B C   1 
ATOM   2093 O O   . SER B 1 67  ? 82.932  88.051  12.950  1.00 87.05  ? 45  SER B O   1 
ATOM   2094 C CB  . SER B 1 67  ? 84.499  86.951  15.777  1.00 79.03  ? 45  SER B CB  1 
ATOM   2095 O OG  . SER B 1 67  ? 85.559  87.356  16.624  1.00 94.48  ? 45  SER B OG  1 
ATOM   2096 N N   . VAL B 1 68  ? 81.744  86.993  14.549  1.00 69.18  ? 46  VAL B N   1 
ATOM   2097 C CA  . VAL B 1 68  ? 80.807  86.413  13.594  1.00 64.42  ? 46  VAL B CA  1 
ATOM   2098 C C   . VAL B 1 68  ? 80.178  87.499  12.737  1.00 65.60  ? 46  VAL B C   1 
ATOM   2099 O O   . VAL B 1 68  ? 80.033  87.343  11.518  1.00 59.27  ? 46  VAL B O   1 
ATOM   2100 C CB  . VAL B 1 68  ? 79.732  85.597  14.334  1.00 70.46  ? 46  VAL B CB  1 
ATOM   2101 C CG1 . VAL B 1 68  ? 78.512  85.353  13.428  1.00 78.09  ? 46  VAL B CG1 1 
ATOM   2102 C CG2 . VAL B 1 68  ? 80.311  84.299  14.811  1.00 68.27  ? 46  VAL B CG2 1 
ATOM   2103 N N   . ALA B 1 69  ? 79.830  88.630  13.352  1.00 57.55  ? 47  ALA B N   1 
ATOM   2104 C CA  . ALA B 1 69  ? 79.214  89.733  12.622  1.00 50.17  ? 47  ALA B CA  1 
ATOM   2105 C C   . ALA B 1 69  ? 80.103  90.202  11.483  1.00 54.42  ? 47  ALA B C   1 
ATOM   2106 O O   . ALA B 1 69  ? 79.764  90.030  10.311  1.00 75.75  ? 47  ALA B O   1 
ATOM   2107 C CB  . ALA B 1 69  ? 78.900  90.912  13.543  1.00 55.69  ? 47  ALA B CB  1 
ATOM   2108 N N   . TYR B 1 70  ? 81.255  90.771  11.807  1.00 61.53  ? 48  TYR B N   1 
ATOM   2109 C CA  . TYR B 1 70  ? 82.059  91.405  10.771  1.00 60.46  ? 48  TYR B CA  1 
ATOM   2110 C C   . TYR B 1 70  ? 82.639  90.390  9.803   1.00 69.85  ? 48  TYR B C   1 
ATOM   2111 O O   . TYR B 1 70  ? 82.824  90.695  8.618   1.00 78.11  ? 48  TYR B O   1 
ATOM   2112 C CB  . TYR B 1 70  ? 83.186  92.212  11.407  1.00 51.75  ? 48  TYR B CB  1 
ATOM   2113 C CG  . TYR B 1 70  ? 82.809  93.627  11.802  1.00 56.44  ? 48  TYR B CG  1 
ATOM   2114 C CD1 . TYR B 1 70  ? 82.748  94.648  10.854  1.00 62.53  ? 48  TYR B CD1 1 
ATOM   2115 C CD2 . TYR B 1 70  ? 82.480  93.942  13.133  1.00 52.78  ? 48  TYR B CD2 1 
ATOM   2116 C CE1 . TYR B 1 70  ? 82.424  95.961  11.222  1.00 67.56  ? 48  TYR B CE1 1 
ATOM   2117 C CE2 . TYR B 1 70  ? 82.127  95.260  13.508  1.00 53.12  ? 48  TYR B CE2 1 
ATOM   2118 C CZ  . TYR B 1 70  ? 82.105  96.258  12.549  1.00 63.01  ? 48  TYR B CZ  1 
ATOM   2119 O OH  . TYR B 1 70  ? 81.762  97.549  12.929  1.00 65.50  ? 48  TYR B OH  1 
ATOM   2120 N N   . LYS B 1 71  ? 82.913  89.170  10.251  1.00 61.02  ? 49  LYS B N   1 
ATOM   2121 C CA  . LYS B 1 71  ? 83.495  88.266  9.267   1.00 65.51  ? 49  LYS B CA  1 
ATOM   2122 C C   . LYS B 1 71  ? 82.454  87.896  8.203   1.00 83.58  ? 49  LYS B C   1 
ATOM   2123 O O   . LYS B 1 71  ? 82.749  87.890  6.990   1.00 89.39  ? 49  LYS B O   1 
ATOM   2124 C CB  . LYS B 1 71  ? 84.141  87.064  9.931   1.00 76.21  ? 49  LYS B CB  1 
ATOM   2125 C CG  . LYS B 1 71  ? 84.807  86.195  8.849   1.00 91.35  ? 49  LYS B CG  1 
ATOM   2126 C CD  . LYS B 1 71  ? 85.875  85.271  9.480   1.00 102.75 ? 49  LYS B CD  1 
ATOM   2127 C CE  . LYS B 1 71  ? 85.944  83.877  8.896   1.00 102.62 ? 49  LYS B CE  1 
ATOM   2128 N NZ  . LYS B 1 71  ? 86.741  84.213  7.668   1.00 106.66 ? 49  LYS B NZ  1 
ATOM   2129 N N   . ASN B 1 72  ? 81.201  87.715  8.628   1.00 89.81  ? 50  ASN B N   1 
ATOM   2130 C CA  . ASN B 1 72  ? 80.097  87.594  7.680   1.00 64.76  ? 50  ASN B CA  1 
ATOM   2131 C C   . ASN B 1 72  ? 79.942  88.870  6.861   1.00 69.16  ? 50  ASN B C   1 
ATOM   2132 O O   . ASN B 1 72  ? 79.759  88.809  5.635   1.00 82.31  ? 50  ASN B O   1 
ATOM   2133 C CB  . ASN B 1 72  ? 78.795  87.306  8.418   1.00 47.59  ? 50  ASN B CB  1 
ATOM   2134 C CG  . ASN B 1 72  ? 78.641  85.873  8.780   1.00 59.76  ? 50  ASN B CG  1 
ATOM   2135 O OD1 . ASN B 1 72  ? 78.169  85.087  7.980   1.00 68.97  ? 50  ASN B OD1 1 
ATOM   2136 N ND2 . ASN B 1 72  ? 78.994  85.519  10.023  1.00 68.08  ? 50  ASN B ND2 1 
ATOM   2137 N N   . VAL B 1 73  ? 80.062  90.041  7.495   1.00 51.96  ? 51  VAL B N   1 
ATOM   2138 C CA  . VAL B 1 73  ? 79.959  91.281  6.729   1.00 60.53  ? 51  VAL B CA  1 
ATOM   2139 C C   . VAL B 1 73  ? 81.076  91.354  5.690   1.00 69.93  ? 51  VAL B C   1 
ATOM   2140 O O   . VAL B 1 73  ? 80.810  91.471  4.485   1.00 72.04  ? 51  VAL B O   1 
ATOM   2141 C CB  . VAL B 1 73  ? 79.977  92.510  7.655   1.00 62.91  ? 51  VAL B CB  1 
ATOM   2142 C CG1 . VAL B 1 73  ? 80.099  93.802  6.844   1.00 61.75  ? 51  VAL B CG1 1 
ATOM   2143 C CG2 . VAL B 1 73  ? 78.744  92.537  8.560   1.00 53.82  ? 51  VAL B CG2 1 
ATOM   2144 N N   . VAL B 1 74  ? 82.341  91.279  6.155   1.00 75.58  ? 52  VAL B N   1 
ATOM   2145 C CA  . VAL B 1 74  ? 83.515  91.346  5.267   1.00 72.20  ? 52  VAL B CA  1 
ATOM   2146 C C   . VAL B 1 74  ? 83.575  90.156  4.309   1.00 71.89  ? 52  VAL B C   1 
ATOM   2147 O O   . VAL B 1 74  ? 83.886  90.323  3.126   1.00 81.29  ? 52  VAL B O   1 
ATOM   2148 C CB  . VAL B 1 74  ? 84.821  91.496  6.074   1.00 67.30  ? 52  VAL B CB  1 
ATOM   2149 C CG1 . VAL B 1 74  ? 85.375  90.160  6.563   1.00 75.50  ? 52  VAL B CG1 1 
ATOM   2150 C CG2 . VAL B 1 74  ? 85.838  92.203  5.243   1.00 56.29  ? 52  VAL B CG2 1 
ATOM   2151 N N   . GLY B 1 75  ? 83.328  88.937  4.801   1.00 70.35  ? 53  GLY B N   1 
ATOM   2152 C CA  . GLY B 1 75  ? 83.459  87.765  3.940   1.00 77.69  ? 53  GLY B CA  1 
ATOM   2153 C C   . GLY B 1 75  ? 82.570  87.806  2.704   1.00 76.21  ? 53  GLY B C   1 
ATOM   2154 O O   . GLY B 1 75  ? 82.904  87.202  1.677   1.00 71.53  ? 53  GLY B O   1 
ATOM   2155 N N   . ALA B 1 76  ? 81.420  88.496  2.786   1.00 69.24  ? 54  ALA B N   1 
ATOM   2156 C CA  . ALA B 1 76  ? 80.586  88.703  1.604   1.00 65.27  ? 54  ALA B CA  1 
ATOM   2157 C C   . ALA B 1 76  ? 81.298  89.571  0.573   1.00 67.91  ? 54  ALA B C   1 
ATOM   2158 O O   . ALA B 1 76  ? 81.297  89.252  -0.622  1.00 76.92  ? 54  ALA B O   1 
ATOM   2159 C CB  . ALA B 1 76  ? 79.251  89.340  1.987   1.00 50.55  ? 54  ALA B CB  1 
ATOM   2160 N N   . ARG B 1 77  ? 81.863  90.705  1.009   1.00 61.40  ? 55  ARG B N   1 
ATOM   2161 C CA  . ARG B 1 77  ? 82.636  91.546  0.095   1.00 71.21  ? 55  ARG B CA  1 
ATOM   2162 C C   . ARG B 1 77  ? 83.837  90.799  -0.486  1.00 67.21  ? 55  ARG B C   1 
ATOM   2163 O O   . ARG B 1 77  ? 84.157  90.954  -1.673  1.00 58.81  ? 55  ARG B O   1 
ATOM   2164 C CB  . ARG B 1 77  ? 83.084  92.825  0.798   1.00 67.62  ? 55  ARG B CB  1 
ATOM   2165 C CG  . ARG B 1 77  ? 82.047  93.916  0.744   1.00 64.86  ? 55  ARG B CG  1 
ATOM   2166 C CD  . ARG B 1 77  ? 80.933  93.592  1.665   1.00 67.77  ? 55  ARG B CD  1 
ATOM   2167 N NE  . ARG B 1 77  ? 79.887  94.605  1.693   1.00 71.74  ? 55  ARG B NE  1 
ATOM   2168 C CZ  . ARG B 1 77  ? 78.872  94.550  2.537   1.00 74.56  ? 55  ARG B CZ  1 
ATOM   2169 N NH1 . ARG B 1 77  ? 78.806  93.531  3.395   1.00 63.51  ? 55  ARG B NH1 1 
ATOM   2170 N NH2 . ARG B 1 77  ? 77.929  95.487  2.513   1.00 90.22  ? 55  ARG B NH2 1 
ATOM   2171 N N   . ARG B 1 78  ? 84.489  89.962  0.329   1.00 60.43  ? 56  ARG B N   1 
ATOM   2172 C CA  . ARG B 1 78  ? 85.570  89.129  -0.175  1.00 60.01  ? 56  ARG B CA  1 
ATOM   2173 C C   . ARG B 1 78  ? 85.094  88.200  -1.290  1.00 67.68  ? 56  ARG B C   1 
ATOM   2174 O O   . ARG B 1 78  ? 85.773  88.045  -2.311  1.00 75.59  ? 56  ARG B O   1 
ATOM   2175 C CB  . ARG B 1 78  ? 86.176  88.324  0.981   1.00 63.88  ? 56  ARG B CB  1 
ATOM   2176 C CG  . ARG B 1 78  ? 87.006  89.143  1.970   1.00 67.65  ? 56  ARG B CG  1 
ATOM   2177 C CD  . ARG B 1 78  ? 88.213  88.348  2.484   1.00 71.26  ? 56  ARG B CD  1 
ATOM   2178 N NE  . ARG B 1 78  ? 87.862  87.324  3.468   1.00 67.67  ? 56  ARG B NE  1 
ATOM   2179 C CZ  . ARG B 1 78  ? 88.571  86.221  3.702   1.00 77.20  ? 56  ARG B CZ  1 
ATOM   2180 N NH1 . ARG B 1 78  ? 89.672  85.955  3.003   1.00 81.87  ? 56  ARG B NH1 1 
ATOM   2181 N NH2 . ARG B 1 78  ? 88.177  85.379  4.646   1.00 78.67  ? 56  ARG B NH2 1 
ATOM   2182 N N   . SER B 1 79  ? 83.922  87.589  -1.136  1.00 72.01  ? 57  SER B N   1 
ATOM   2183 C CA  . SER B 1 79  ? 83.501  86.620  -2.138  1.00 71.52  ? 57  SER B CA  1 
ATOM   2184 C C   . SER B 1 79  ? 83.092  87.319  -3.432  1.00 76.27  ? 57  SER B C   1 
ATOM   2185 O O   . SER B 1 79  ? 83.448  86.876  -4.536  1.00 70.10  ? 57  SER B O   1 
ATOM   2186 C CB  . SER B 1 79  ? 82.371  85.771  -1.579  1.00 63.55  ? 57  SER B CB  1 
ATOM   2187 O OG  . SER B 1 79  ? 81.824  84.977  -2.598  1.00 76.15  ? 57  SER B OG  1 
ATOM   2188 N N   . SER B 1 80  ? 82.366  88.431  -3.305  1.00 75.69  ? 58  SER B N   1 
ATOM   2189 C CA  . SER B 1 80  ? 82.032  89.242  -4.467  1.00 71.33  ? 58  SER B CA  1 
ATOM   2190 C C   . SER B 1 80  ? 83.288  89.706  -5.184  1.00 60.48  ? 58  SER B C   1 
ATOM   2191 O O   . SER B 1 80  ? 83.380  89.603  -6.406  1.00 72.39  ? 58  SER B O   1 
ATOM   2192 C CB  . SER B 1 80  ? 81.187  90.445  -4.039  1.00 79.56  ? 58  SER B CB  1 
ATOM   2193 O OG  . SER B 1 80  ? 80.017  90.046  -3.350  1.00 76.81  ? 58  SER B OG  1 
ATOM   2194 N N   . TRP B 1 81  ? 84.283  90.180  -4.434  1.00 71.52  ? 59  TRP B N   1 
ATOM   2195 C CA  . TRP B 1 81  ? 85.507  90.702  -5.048  1.00 77.44  ? 59  TRP B CA  1 
ATOM   2196 C C   . TRP B 1 81  ? 86.200  89.656  -5.920  1.00 79.05  ? 59  TRP B C   1 
ATOM   2197 O O   . TRP B 1 81  ? 86.583  89.940  -7.062  1.00 71.99  ? 59  TRP B O   1 
ATOM   2198 C CB  . TRP B 1 81  ? 86.465  91.212  -3.964  1.00 73.87  ? 59  TRP B CB  1 
ATOM   2199 C CG  . TRP B 1 81  ? 87.690  91.852  -4.529  1.00 77.28  ? 59  TRP B CG  1 
ATOM   2200 C CD1 . TRP B 1 81  ? 87.882  93.183  -4.798  1.00 72.77  ? 59  TRP B CD1 1 
ATOM   2201 C CD2 . TRP B 1 81  ? 88.896  91.186  -4.920  1.00 80.68  ? 59  TRP B CD2 1 
ATOM   2202 N NE1 . TRP B 1 81  ? 89.133  93.380  -5.339  1.00 74.87  ? 59  TRP B NE1 1 
ATOM   2203 C CE2 . TRP B 1 81  ? 89.771  92.167  -5.430  1.00 80.68  ? 59  TRP B CE2 1 
ATOM   2204 C CE3 . TRP B 1 81  ? 89.315  89.851  -4.901  1.00 83.90  ? 59  TRP B CE3 1 
ATOM   2205 C CZ2 . TRP B 1 81  ? 91.051  91.858  -5.888  1.00 84.08  ? 59  TRP B CZ2 1 
ATOM   2206 C CZ3 . TRP B 1 81  ? 90.579  89.546  -5.365  1.00 85.68  ? 59  TRP B CZ3 1 
ATOM   2207 C CH2 . TRP B 1 81  ? 91.433  90.544  -5.850  1.00 83.48  ? 59  TRP B CH2 1 
ATOM   2208 N N   . ARG B 1 82  ? 86.355  88.430  -5.408  1.00 79.09  ? 60  ARG B N   1 
ATOM   2209 C CA  . ARG B 1 82  ? 87.028  87.392  -6.185  1.00 78.89  ? 60  ARG B CA  1 
ATOM   2210 C C   . ARG B 1 82  ? 86.261  87.047  -7.456  1.00 73.05  ? 60  ARG B C   1 
ATOM   2211 O O   . ARG B 1 82  ? 86.868  86.753  -8.489  1.00 80.85  ? 60  ARG B O   1 
ATOM   2212 C CB  . ARG B 1 82  ? 87.217  86.123  -5.351  1.00 64.22  ? 60  ARG B CB  1 
ATOM   2213 C CG  . ARG B 1 82  ? 87.998  86.262  -4.096  1.00 66.47  ? 60  ARG B CG  1 
ATOM   2214 C CD  . ARG B 1 82  ? 87.977  84.937  -3.332  1.00 75.97  ? 60  ARG B CD  1 
ATOM   2215 N NE  . ARG B 1 82  ? 87.467  85.069  -1.966  1.00 86.04  ? 60  ARG B NE  1 
ATOM   2216 C CZ  . ARG B 1 82  ? 86.496  84.319  -1.448  1.00 97.48  ? 60  ARG B CZ  1 
ATOM   2217 N NH1 . ARG B 1 82  ? 85.897  83.371  -2.179  1.00 101.83 ? 60  ARG B NH1 1 
ATOM   2218 N NH2 . ARG B 1 82  ? 86.118  84.526  -0.194  1.00 97.65  ? 60  ARG B NH2 1 
ATOM   2219 N N   . VAL B 1 83  ? 84.928  87.093  -7.413  1.00 81.34  ? 61  VAL B N   1 
ATOM   2220 C CA  . VAL B 1 83  ? 84.154  86.775  -8.609  1.00 91.07  ? 61  VAL B CA  1 
ATOM   2221 C C   . VAL B 1 83  ? 84.297  87.882  -9.643  1.00 94.35  ? 61  VAL B C   1 
ATOM   2222 O O   . VAL B 1 83  ? 84.532  87.619  -10.827 1.00 90.55  ? 61  VAL B O   1 
ATOM   2223 C CB  . VAL B 1 83  ? 82.688  86.484  -8.238  1.00 77.95  ? 61  VAL B CB  1 
ATOM   2224 C CG1 . VAL B 1 83  ? 81.758  86.789  -9.384  1.00 66.99  ? 61  VAL B CG1 1 
ATOM   2225 C CG2 . VAL B 1 83  ? 82.565  85.016  -7.899  1.00 70.88  ? 61  VAL B CG2 1 
ATOM   2226 N N   . VAL B 1 84  ? 84.229  89.133  -9.200  1.00 92.11  ? 62  VAL B N   1 
ATOM   2227 C CA  . VAL B 1 84  ? 84.347  90.256  -10.118 1.00 87.67  ? 62  VAL B CA  1 
ATOM   2228 C C   . VAL B 1 84  ? 85.783  90.442  -10.612 1.00 93.27  ? 62  VAL B C   1 
ATOM   2229 O O   . VAL B 1 84  ? 85.998  90.864  -11.754 1.00 102.78 ? 62  VAL B O   1 
ATOM   2230 C CB  . VAL B 1 84  ? 83.768  91.497  -9.424  1.00 75.70  ? 62  VAL B CB  1 
ATOM   2231 C CG1 . VAL B 1 84  ? 83.902  92.728  -10.285 1.00 71.79  ? 62  VAL B CG1 1 
ATOM   2232 C CG2 . VAL B 1 84  ? 82.292  91.228  -9.140  1.00 67.15  ? 62  VAL B CG2 1 
ATOM   2233 N N   . SER B 1 85  ? 86.784  90.127  -9.788  1.00 90.70  ? 63  SER B N   1 
ATOM   2234 C CA  . SER B 1 85  ? 88.165  90.262  -10.238 1.00 88.69  ? 63  SER B CA  1 
ATOM   2235 C C   . SER B 1 85  ? 88.523  89.186  -11.264 1.00 103.31 ? 63  SER B C   1 
ATOM   2236 O O   . SER B 1 85  ? 89.368  89.420  -12.141 1.00 114.78 ? 63  SER B O   1 
ATOM   2237 C CB  . SER B 1 85  ? 89.120  90.208  -9.041  1.00 81.59  ? 63  SER B CB  1 
ATOM   2238 O OG  . SER B 1 85  ? 90.448  89.855  -9.426  1.00 88.35  ? 63  SER B OG  1 
ATOM   2239 N N   . SER B 1 86  ? 87.897  88.005  -11.176 1.00 98.03  ? 64  SER B N   1 
ATOM   2240 C CA  . SER B 1 86  ? 88.174  86.942  -12.138 1.00 98.19  ? 64  SER B CA  1 
ATOM   2241 C C   . SER B 1 86  ? 87.503  87.195  -13.485 1.00 101.25 ? 64  SER B C   1 
ATOM   2242 O O   . SER B 1 86  ? 88.017  86.763  -14.527 1.00 108.03 ? 64  SER B O   1 
ATOM   2243 C CB  . SER B 1 86  ? 87.721  85.597  -11.573 1.00 89.17  ? 64  SER B CB  1 
ATOM   2244 O OG  . SER B 1 86  ? 87.310  84.723  -12.609 1.00 102.59 ? 64  SER B OG  1 
ATOM   2245 N N   . ILE B 1 87  ? 86.368  87.892  -13.479 1.00 92.83  ? 65  ILE B N   1 
ATOM   2246 C CA  . ILE B 1 87  ? 85.741  88.308  -14.725 1.00 93.53  ? 65  ILE B CA  1 
ATOM   2247 C C   . ILE B 1 87  ? 86.550  89.425  -15.373 1.00 99.86  ? 65  ILE B C   1 
ATOM   2248 O O   . ILE B 1 87  ? 86.742  89.446  -16.598 1.00 100.87 ? 65  ILE B O   1 
ATOM   2249 C CB  . ILE B 1 87  ? 84.274  88.725  -14.489 1.00 93.71  ? 65  ILE B CB  1 
ATOM   2250 C CG1 . ILE B 1 87  ? 83.312  87.517  -14.390 1.00 99.23  ? 65  ILE B CG1 1 
ATOM   2251 C CG2 . ILE B 1 87  ? 83.818  89.687  -15.584 1.00 87.40  ? 65  ILE B CG2 1 
ATOM   2252 C CD1 . ILE B 1 87  ? 83.499  86.521  -13.245 1.00 94.73  ? 65  ILE B CD1 1 
ATOM   2253 N N   . GLU B 1 88  ? 87.045  90.368  -14.563 1.00 98.41  ? 66  GLU B N   1 
ATOM   2254 C CA  . GLU B 1 88  ? 87.834  91.472  -15.107 1.00 113.04 ? 66  GLU B CA  1 
ATOM   2255 C C   . GLU B 1 88  ? 89.107  90.978  -15.793 1.00 117.05 ? 66  GLU B C   1 
ATOM   2256 O O   . GLU B 1 88  ? 89.562  91.591  -16.767 1.00 122.86 ? 66  GLU B O   1 
ATOM   2257 C CB  . GLU B 1 88  ? 88.149  92.482  -13.995 1.00 115.04 ? 66  GLU B CB  1 
ATOM   2258 C CG  . GLU B 1 88  ? 89.494  93.200  -14.106 1.00 117.68 ? 66  GLU B CG  1 
ATOM   2259 C CD  . GLU B 1 88  ? 89.710  94.215  -12.990 1.00 115.48 ? 66  GLU B CD  1 
ATOM   2260 O OE1 . GLU B 1 88  ? 89.479  95.420  -13.227 1.00 113.70 ? 66  GLU B OE1 1 
ATOM   2261 O OE2 . GLU B 1 88  ? 90.116  93.812  -11.879 1.00 112.35 ? 66  GLU B OE2 1 
ATOM   2262 N N   . GLN B 1 89  ? 89.678  89.862  -15.324 1.00 113.73 ? 67  GLN B N   1 
ATOM   2263 C CA  . GLN B 1 89  ? 90.836  89.274  -15.991 1.00 107.67 ? 67  GLN B CA  1 
ATOM   2264 C C   . GLN B 1 89  ? 90.445  88.493  -17.247 1.00 116.64 ? 67  GLN B C   1 
ATOM   2265 O O   . GLN B 1 89  ? 91.138  88.570  -18.266 1.00 126.41 ? 67  GLN B O   1 
ATOM   2266 C CB  . GLN B 1 89  ? 91.591  88.372  -15.017 1.00 99.84  ? 67  GLN B CB  1 
ATOM   2267 N N   . LYS B 1 90  ? 89.330  87.763  -17.217 1.00 117.87 ? 68  LYS B N   1 
ATOM   2268 C CA  . LYS B 1 90  ? 88.892  87.012  -18.397 1.00 127.07 ? 68  LYS B CA  1 
ATOM   2269 C C   . LYS B 1 90  ? 88.335  87.888  -19.531 1.00 126.74 ? 68  LYS B C   1 
ATOM   2270 O O   . LYS B 1 90  ? 87.962  87.330  -20.571 1.00 124.49 ? 68  LYS B O   1 
ATOM   2271 C CB  . LYS B 1 90  ? 87.832  85.971  -17.999 1.00 123.60 ? 68  LYS B CB  1 
ATOM   2272 C CG  . LYS B 1 90  ? 88.324  84.861  -17.082 1.00 120.60 ? 68  LYS B CG  1 
ATOM   2273 C CD  . LYS B 1 90  ? 87.405  83.644  -17.146 1.00 116.90 ? 68  LYS B CD  1 
ATOM   2274 N N   . THR B 1 91  ? 88.265  89.213  -19.373 1.00 124.70 ? 69  THR B N   1 
ATOM   2275 C CA  . THR B 1 91  ? 87.556  90.092  -20.299 1.00 121.54 ? 69  THR B CA  1 
ATOM   2276 C C   . THR B 1 91  ? 88.509  90.866  -21.224 1.00 132.29 ? 69  THR B C   1 
ATOM   2277 O O   . THR B 1 91  ? 88.072  91.747  -21.973 1.00 128.04 ? 69  THR B O   1 
ATOM   2278 C CB  . THR B 1 91  ? 86.662  91.030  -19.457 1.00 112.85 ? 69  THR B CB  1 
ATOM   2279 O OG1 . THR B 1 91  ? 85.646  90.251  -18.817 1.00 113.01 ? 69  THR B OG1 1 
ATOM   2280 C CG2 . THR B 1 91  ? 85.918  92.083  -20.270 1.00 106.03 ? 69  THR B CG2 1 
ATOM   2281 N N   . GLU B 1 92  ? 89.784  90.481  -21.270 1.00 144.72 ? 70  GLU B N   1 
ATOM   2282 C CA  . GLU B 1 92  ? 90.769  91.231  -22.046 1.00 150.70 ? 70  GLU B CA  1 
ATOM   2283 C C   . GLU B 1 92  ? 90.410  91.243  -23.531 1.00 161.29 ? 70  GLU B C   1 
ATOM   2284 O O   . GLU B 1 92  ? 90.110  90.199  -24.118 1.00 169.66 ? 70  GLU B O   1 
ATOM   2285 C CB  . GLU B 1 92  ? 92.168  90.641  -21.836 1.00 145.38 ? 70  GLU B CB  1 
ATOM   2286 N N   . GLY B 1 93  ? 90.408  92.440  -24.129 1.00 157.20 ? 71  GLY B N   1 
ATOM   2287 C CA  . GLY B 1 93  ? 90.111  92.633  -25.537 1.00 151.27 ? 71  GLY B CA  1 
ATOM   2288 C C   . GLY B 1 93  ? 88.834  93.401  -25.849 1.00 152.39 ? 71  GLY B C   1 
ATOM   2289 O O   . GLY B 1 93  ? 88.744  93.992  -26.932 1.00 154.84 ? 71  GLY B O   1 
ATOM   2290 N N   . ALA B 1 94  ? 87.844  93.415  -24.952 1.00 147.92 ? 72  ALA B N   1 
ATOM   2291 C CA  . ALA B 1 94  ? 86.622  94.210  -25.125 1.00 138.47 ? 72  ALA B CA  1 
ATOM   2292 C C   . ALA B 1 94  ? 86.692  95.379  -24.139 1.00 131.81 ? 72  ALA B C   1 
ATOM   2293 O O   . ALA B 1 94  ? 86.420  95.215  -22.941 1.00 118.83 ? 72  ALA B O   1 
ATOM   2294 C CB  . ALA B 1 94  ? 85.370  93.363  -24.932 1.00 133.85 ? 72  ALA B CB  1 
ATOM   2295 N N   . GLU B 1 95  ? 87.096  96.551  -24.651 1.00 135.51 ? 73  GLU B N   1 
ATOM   2296 C CA  . GLU B 1 95  ? 87.456  97.675  -23.787 1.00 134.38 ? 73  GLU B CA  1 
ATOM   2297 C C   . GLU B 1 95  ? 86.278  98.136  -22.939 1.00 133.68 ? 73  GLU B C   1 
ATOM   2298 O O   . GLU B 1 95  ? 86.451  98.493  -21.767 1.00 136.39 ? 73  GLU B O   1 
ATOM   2299 C CB  . GLU B 1 95  ? 87.997  98.835  -24.625 1.00 139.15 ? 73  GLU B CB  1 
ATOM   2300 N N   . LYS B 1 96  ? 85.066  98.098  -23.495 1.00 134.44 ? 74  LYS B N   1 
ATOM   2301 C CA  . LYS B 1 96  ? 83.921  98.656  -22.788 1.00 119.73 ? 74  LYS B CA  1 
ATOM   2302 C C   . LYS B 1 96  ? 83.363  97.672  -21.772 1.00 121.72 ? 74  LYS B C   1 
ATOM   2303 O O   . LYS B 1 96  ? 82.755  98.092  -20.779 1.00 120.31 ? 74  LYS B O   1 
ATOM   2304 C CB  . LYS B 1 96  ? 82.827  99.057  -23.783 1.00 118.04 ? 74  LYS B CB  1 
ATOM   2305 N N   . LYS B 1 97  ? 83.565  96.369  -21.996 1.00 123.64 ? 75  LYS B N   1 
ATOM   2306 C CA  . LYS B 1 97  ? 83.213  95.377  -20.986 1.00 122.81 ? 75  LYS B CA  1 
ATOM   2307 C C   . LYS B 1 97  ? 84.237  95.311  -19.856 1.00 122.64 ? 75  LYS B C   1 
ATOM   2308 O O   . LYS B 1 97  ? 83.880  94.946  -18.733 1.00 121.07 ? 75  LYS B O   1 
ATOM   2309 C CB  . LYS B 1 97  ? 83.037  94.002  -21.635 1.00 120.08 ? 75  LYS B CB  1 
ATOM   2310 N N   . GLN B 1 98  ? 85.508  95.621  -20.125 1.00 122.98 ? 76  GLN B N   1 
ATOM   2311 C CA  . GLN B 1 98  ? 86.497  95.548  -19.056 1.00 115.95 ? 76  GLN B CA  1 
ATOM   2312 C C   . GLN B 1 98  ? 86.515  96.815  -18.204 1.00 111.32 ? 76  GLN B C   1 
ATOM   2313 O O   . GLN B 1 98  ? 86.653  96.733  -16.977 1.00 96.17  ? 76  GLN B O   1 
ATOM   2314 C CB  . GLN B 1 98  ? 87.880  95.258  -19.634 1.00 109.96 ? 76  GLN B CB  1 
ATOM   2315 C CG  . GLN B 1 98  ? 88.991  95.320  -18.599 1.00 102.91 ? 76  GLN B CG  1 
ATOM   2316 C CD  . GLN B 1 98  ? 90.266  94.650  -19.076 1.00 119.36 ? 76  GLN B CD  1 
ATOM   2317 O OE1 . GLN B 1 98  ? 91.065  95.221  -19.849 1.00 125.06 ? 76  GLN B OE1 1 
ATOM   2318 N NE2 . GLN B 1 98  ? 90.464  93.410  -18.620 1.00 108.50 ? 76  GLN B NE2 1 
ATOM   2319 N N   . GLN B 1 99  ? 86.359  97.988  -18.829 1.00 115.73 ? 77  GLN B N   1 
ATOM   2320 C CA  . GLN B 1 99  ? 86.252  99.222  -18.057 1.00 112.48 ? 77  GLN B CA  1 
ATOM   2321 C C   . GLN B 1 99  ? 85.053  99.175  -17.126 1.00 115.90 ? 77  GLN B C   1 
ATOM   2322 O O   . GLN B 1 99  ? 85.067  99.807  -16.063 1.00 117.65 ? 77  GLN B O   1 
ATOM   2323 C CB  . GLN B 1 99  ? 86.143  100.433 -18.985 1.00 107.19 ? 77  GLN B CB  1 
ATOM   2324 N N   . MET B 1 100 ? 84.030  98.393  -17.490 1.00 117.38 ? 78  MET B N   1 
ATOM   2325 C CA  . MET B 1 100 ? 82.807  98.244  -16.704 1.00 108.88 ? 78  MET B CA  1 
ATOM   2326 C C   . MET B 1 100 ? 83.019  97.314  -15.515 1.00 105.29 ? 78  MET B C   1 
ATOM   2327 O O   . MET B 1 100 ? 82.515  97.579  -14.415 1.00 104.06 ? 78  MET B O   1 
ATOM   2328 C CB  . MET B 1 100 ? 81.696  97.714  -17.615 1.00 116.99 ? 78  MET B CB  1 
ATOM   2329 C CG  . MET B 1 100 ? 80.378  97.305  -16.964 1.00 123.69 ? 78  MET B CG  1 
ATOM   2330 S SD  . MET B 1 100 ? 79.019  98.451  -17.335 1.00 131.83 ? 78  MET B SD  1 
ATOM   2331 C CE  . MET B 1 100 ? 78.604  98.057  -19.035 1.00 132.68 ? 78  MET B CE  1 
ATOM   2332 N N   . ALA B 1 101 ? 83.750  96.214  -15.723 1.00 102.63 ? 79  ALA B N   1 
ATOM   2333 C CA  . ALA B 1 101 ? 84.112  95.334  -14.617 1.00 96.73  ? 79  ALA B CA  1 
ATOM   2334 C C   . ALA B 1 101 ? 85.119  95.981  -13.667 1.00 92.83  ? 79  ALA B C   1 
ATOM   2335 O O   . ALA B 1 101 ? 85.070  95.720  -12.463 1.00 83.47  ? 79  ALA B O   1 
ATOM   2336 C CB  . ALA B 1 101 ? 84.659  94.007  -15.152 1.00 92.16  ? 79  ALA B CB  1 
ATOM   2337 N N   . ARG B 1 102 ? 86.032  96.821  -14.177 1.00 95.89  ? 80  ARG B N   1 
ATOM   2338 C CA  . ARG B 1 102 ? 87.022  97.447  -13.303 1.00 90.39  ? 80  ARG B CA  1 
ATOM   2339 C C   . ARG B 1 102 ? 86.367  98.378  -12.292 1.00 88.93  ? 80  ARG B C   1 
ATOM   2340 O O   . ARG B 1 102 ? 86.698  98.337  -11.102 1.00 83.12  ? 80  ARG B O   1 
ATOM   2341 C CB  . ARG B 1 102 ? 88.059  98.209  -14.125 1.00 91.83  ? 80  ARG B CB  1 
ATOM   2342 N N   . GLU B 1 103 ? 85.426  99.213  -12.744 1.00 95.00  ? 81  GLU B N   1 
ATOM   2343 C CA  . GLU B 1 103 ? 84.821  100.216 -11.867 1.00 101.03 ? 81  GLU B CA  1 
ATOM   2344 C C   . GLU B 1 103 ? 83.948  99.592  -10.785 1.00 91.66  ? 81  GLU B C   1 
ATOM   2345 O O   . GLU B 1 103 ? 83.828  100.160 -9.692  1.00 82.99  ? 81  GLU B O   1 
ATOM   2346 C CB  . GLU B 1 103 ? 84.026  101.224 -12.696 1.00 114.35 ? 81  GLU B CB  1 
ATOM   2347 C CG  . GLU B 1 103 ? 84.915  102.004 -13.665 1.00 127.72 ? 81  GLU B CG  1 
ATOM   2348 C CD  . GLU B 1 103 ? 84.194  103.138 -14.369 1.00 136.12 ? 81  GLU B CD  1 
ATOM   2349 O OE1 . GLU B 1 103 ? 84.874  103.913 -15.081 1.00 142.10 ? 81  GLU B OE1 1 
ATOM   2350 O OE2 . GLU B 1 103 ? 82.956  103.255 -14.208 1.00 135.25 ? 81  GLU B OE2 1 
ATOM   2351 N N   . TYR B 1 104 ? 83.313  98.450  -11.070 1.00 94.02  ? 82  TYR B N   1 
ATOM   2352 C CA  . TYR B 1 104 ? 82.530  97.762  -10.043 1.00 91.51  ? 82  TYR B CA  1 
ATOM   2353 C C   . TYR B 1 104 ? 83.433  97.118  -8.998  1.00 86.32  ? 82  TYR B C   1 
ATOM   2354 O O   . TYR B 1 104 ? 83.129  97.145  -7.801  1.00 81.53  ? 82  TYR B O   1 
ATOM   2355 C CB  . TYR B 1 104 ? 81.629  96.700  -10.674 1.00 88.56  ? 82  TYR B CB  1 
ATOM   2356 C CG  . TYR B 1 104 ? 80.460  96.264  -9.799  1.00 79.58  ? 82  TYR B CG  1 
ATOM   2357 C CD1 . TYR B 1 104 ? 79.677  97.192  -9.124  1.00 82.22  ? 82  TYR B CD1 1 
ATOM   2358 C CD2 . TYR B 1 104 ? 80.158  94.912  -9.634  1.00 73.14  ? 82  TYR B CD2 1 
ATOM   2359 C CE1 . TYR B 1 104 ? 78.604  96.785  -8.323  1.00 82.75  ? 82  TYR B CE1 1 
ATOM   2360 C CE2 . TYR B 1 104 ? 79.095  94.497  -8.832  1.00 78.64  ? 82  TYR B CE2 1 
ATOM   2361 C CZ  . TYR B 1 104 ? 78.328  95.436  -8.180  1.00 80.86  ? 82  TYR B CZ  1 
ATOM   2362 O OH  . TYR B 1 104 ? 77.285  95.025  -7.386  1.00 85.06  ? 82  TYR B OH  1 
ATOM   2363 N N   . ARG B 1 105 ? 84.533  96.515  -9.437  1.00 83.49  ? 83  ARG B N   1 
ATOM   2364 C CA  . ARG B 1 105 ? 85.492  95.950  -8.498  1.00 83.97  ? 83  ARG B CA  1 
ATOM   2365 C C   . ARG B 1 105 ? 85.998  97.011  -7.532  1.00 84.67  ? 83  ARG B C   1 
ATOM   2366 O O   . ARG B 1 105 ? 86.091  96.769  -6.324  1.00 84.53  ? 83  ARG B O   1 
ATOM   2367 C CB  . ARG B 1 105 ? 86.653  95.330  -9.271  1.00 91.41  ? 83  ARG B CB  1 
ATOM   2368 C CG  . ARG B 1 105 ? 87.607  94.558  -8.436  1.00 90.45  ? 83  ARG B CG  1 
ATOM   2369 C CD  . ARG B 1 105 ? 88.860  95.360  -8.272  1.00 95.06  ? 83  ARG B CD  1 
ATOM   2370 N NE  . ARG B 1 105 ? 89.856  94.946  -9.235  1.00 104.68 ? 83  ARG B NE  1 
ATOM   2371 C CZ  . ARG B 1 105 ? 90.843  95.723  -9.646  1.00 105.07 ? 83  ARG B CZ  1 
ATOM   2372 N NH1 . ARG B 1 105 ? 91.707  95.256  -10.525 1.00 106.16 ? 83  ARG B NH1 1 
ATOM   2373 N NH2 . ARG B 1 105 ? 90.954  96.961  -9.179  1.00 103.59 ? 83  ARG B NH2 1 
ATOM   2374 N N   . GLU B 1 106 ? 86.323  98.198  -8.040  1.00 91.52  ? 84  GLU B N   1 
ATOM   2375 C CA  . GLU B 1 106 ? 86.772  99.264  -7.153  1.00 101.84 ? 84  GLU B CA  1 
ATOM   2376 C C   . GLU B 1 106 ? 85.685  99.659  -6.158  1.00 104.76 ? 84  GLU B C   1 
ATOM   2377 O O   . GLU B 1 106 ? 85.974  99.874  -4.975  1.00 111.88 ? 84  GLU B O   1 
ATOM   2378 C CB  . GLU B 1 106 ? 87.277  100.449 -7.977  1.00 105.03 ? 84  GLU B CB  1 
ATOM   2379 C CG  . GLU B 1 106 ? 88.543  100.054 -8.758  1.00 112.83 ? 84  GLU B CG  1 
ATOM   2380 C CD  . GLU B 1 106 ? 89.247  101.208 -9.452  1.00 121.00 ? 84  GLU B CD  1 
ATOM   2381 O OE1 . GLU B 1 106 ? 90.359  101.578 -9.005  1.00 128.74 ? 84  GLU B OE1 1 
ATOM   2382 O OE2 . GLU B 1 106 ? 88.697  101.736 -10.443 1.00 120.14 ? 84  GLU B OE2 1 
ATOM   2383 N N   . LYS B 1 107 ? 84.429  99.744  -6.607  1.00 98.11  ? 85  LYS B N   1 
ATOM   2384 C CA  . LYS B 1 107 ? 83.339  100.010 -5.668  1.00 92.92  ? 85  LYS B CA  1 
ATOM   2385 C C   . LYS B 1 107 ? 83.273  98.929  -4.600  1.00 85.07  ? 85  LYS B C   1 
ATOM   2386 O O   . LYS B 1 107 ? 83.190  99.229  -3.403  1.00 86.61  ? 85  LYS B O   1 
ATOM   2387 C CB  . LYS B 1 107 ? 82.000  100.117 -6.401  1.00 92.94  ? 85  LYS B CB  1 
ATOM   2388 N N   . ILE B 1 108 ? 83.308  97.661  -5.021  1.00 81.49  ? 86  ILE B N   1 
ATOM   2389 C CA  . ILE B 1 108 ? 83.248  96.544  -4.084  1.00 72.67  ? 86  ILE B CA  1 
ATOM   2390 C C   . ILE B 1 108 ? 84.428  96.583  -3.137  1.00 70.93  ? 86  ILE B C   1 
ATOM   2391 O O   . ILE B 1 108 ? 84.289  96.301  -1.944  1.00 65.34  ? 86  ILE B O   1 
ATOM   2392 C CB  . ILE B 1 108 ? 83.207  95.194  -4.827  1.00 78.67  ? 86  ILE B CB  1 
ATOM   2393 C CG1 . ILE B 1 108 ? 81.919  95.033  -5.643  1.00 85.50  ? 86  ILE B CG1 1 
ATOM   2394 C CG2 . ILE B 1 108 ? 83.392  94.035  -3.842  1.00 68.46  ? 86  ILE B CG2 1 
ATOM   2395 C CD1 . ILE B 1 108 ? 81.902  93.780  -6.497  1.00 80.98  ? 86  ILE B CD1 1 
ATOM   2396 N N   . GLU B 1 109 ? 85.619  96.861  -3.657  1.00 84.80  ? 87  GLU B N   1 
ATOM   2397 C CA  . GLU B 1 109 ? 86.781  96.787  -2.785  1.00 90.56  ? 87  GLU B CA  1 
ATOM   2398 C C   . GLU B 1 109 ? 86.865  98.014  -1.892  1.00 90.37  ? 87  GLU B C   1 
ATOM   2399 O O   . GLU B 1 109 ? 87.360  97.919  -0.765  1.00 100.10 ? 87  GLU B O   1 
ATOM   2400 C CB  . GLU B 1 109 ? 88.060  96.549  -3.598  1.00 99.38  ? 87  GLU B CB  1 
ATOM   2401 C CG  . GLU B 1 109 ? 88.836  97.757  -4.027  1.00 114.22 ? 87  GLU B CG  1 
ATOM   2402 C CD  . GLU B 1 109 ? 90.137  97.368  -4.704  1.00 123.98 ? 87  GLU B CD  1 
ATOM   2403 O OE1 . GLU B 1 109 ? 90.128  96.522  -5.631  1.00 123.57 ? 87  GLU B OE1 1 
ATOM   2404 O OE2 . GLU B 1 109 ? 91.180  97.902  -4.289  1.00 128.26 ? 87  GLU B OE2 1 
ATOM   2405 N N   . THR B 1 110 ? 86.342  99.153  -2.348  1.00 78.76  ? 88  THR B N   1 
ATOM   2406 C CA  . THR B 1 110 ? 86.270  100.315 -1.470  1.00 76.24  ? 88  THR B CA  1 
ATOM   2407 C C   . THR B 1 110 ? 85.369  100.022 -0.272  1.00 78.80  ? 88  THR B C   1 
ATOM   2408 O O   . THR B 1 110 ? 85.724  100.316 0.874   1.00 71.15  ? 88  THR B O   1 
ATOM   2409 C CB  . THR B 1 110 ? 85.773  101.530 -2.261  1.00 74.57  ? 88  THR B CB  1 
ATOM   2410 O OG1 . THR B 1 110 ? 86.865  102.106 -2.999  1.00 84.12  ? 88  THR B OG1 1 
ATOM   2411 C CG2 . THR B 1 110 ? 85.159  102.575 -1.336  1.00 70.20  ? 88  THR B CG2 1 
ATOM   2412 N N   . GLU B 1 111 ? 84.228  99.376  -0.519  1.00 85.62  ? 89  GLU B N   1 
ATOM   2413 C CA  . GLU B 1 111 ? 83.380  98.880  0.561   1.00 80.69  ? 89  GLU B CA  1 
ATOM   2414 C C   . GLU B 1 111 ? 84.158  97.949  1.483   1.00 80.56  ? 89  GLU B C   1 
ATOM   2415 O O   . GLU B 1 111 ? 84.013  98.015  2.707   1.00 83.14  ? 89  GLU B O   1 
ATOM   2416 C CB  . GLU B 1 111 ? 82.162  98.167  -0.037  1.00 82.39  ? 89  GLU B CB  1 
ATOM   2417 C CG  . GLU B 1 111 ? 81.028  99.121  -0.450  1.00 92.73  ? 89  GLU B CG  1 
ATOM   2418 C CD  . GLU B 1 111 ? 79.842  98.427  -1.141  1.00 87.15  ? 89  GLU B CD  1 
ATOM   2419 O OE1 . GLU B 1 111 ? 79.425  97.331  -0.714  1.00 84.51  ? 89  GLU B OE1 1 
ATOM   2420 O OE2 . GLU B 1 111 ? 79.324  98.997  -2.123  1.00 82.34  ? 89  GLU B OE2 1 
ATOM   2421 N N   . LEU B 1 112 ? 84.952  97.040  0.903   1.00 88.02  ? 90  LEU B N   1 
ATOM   2422 C CA  . LEU B 1 112 ? 85.795  96.135  1.685   1.00 81.09  ? 90  LEU B CA  1 
ATOM   2423 C C   . LEU B 1 112 ? 86.814  96.906  2.515   1.00 83.01  ? 90  LEU B C   1 
ATOM   2424 O O   . LEU B 1 112 ? 87.021  96.606  3.695   1.00 86.20  ? 90  LEU B O   1 
ATOM   2425 C CB  . LEU B 1 112 ? 86.503  95.143  0.756   1.00 79.27  ? 90  LEU B CB  1 
ATOM   2426 C CG  . LEU B 1 112 ? 87.132  93.841  1.277   1.00 82.51  ? 90  LEU B CG  1 
ATOM   2427 C CD1 . LEU B 1 112 ? 87.488  92.920  0.113   1.00 87.26  ? 90  LEU B CD1 1 
ATOM   2428 C CD2 . LEU B 1 112 ? 88.367  94.077  2.122   1.00 88.83  ? 90  LEU B CD2 1 
ATOM   2429 N N   . ARG B 1 113 ? 87.469  97.902  1.914   1.00 77.60  ? 91  ARG B N   1 
ATOM   2430 C CA  . ARG B 1 113 ? 88.486  98.643  2.659   1.00 80.60  ? 91  ARG B CA  1 
ATOM   2431 C C   . ARG B 1 113 ? 87.892  99.320  3.880   1.00 77.71  ? 91  ARG B C   1 
ATOM   2432 O O   . ARG B 1 113 ? 88.499  99.318  4.951   1.00 86.97  ? 91  ARG B O   1 
ATOM   2433 C CB  . ARG B 1 113 ? 89.167  99.682  1.768   1.00 85.73  ? 91  ARG B CB  1 
ATOM   2434 C CG  . ARG B 1 113 ? 90.280  99.136  0.921   1.00 79.38  ? 91  ARG B CG  1 
ATOM   2435 C CD  . ARG B 1 113 ? 90.699  100.156 -0.099  1.00 91.89  ? 91  ARG B CD  1 
ATOM   2436 N NE  . ARG B 1 113 ? 91.224  99.514  -1.302  1.00 113.09 ? 91  ARG B NE  1 
ATOM   2437 C CZ  . ARG B 1 113 ? 92.378  98.851  -1.356  1.00 125.31 ? 91  ARG B CZ  1 
ATOM   2438 N NH1 . ARG B 1 113 ? 93.136  98.725  -0.267  1.00 125.04 ? 91  ARG B NH1 1 
ATOM   2439 N NH2 . ARG B 1 113 ? 92.775  98.305  -2.502  1.00 129.77 ? 91  ARG B NH2 1 
ATOM   2440 N N   . ASP B 1 114 ? 86.695  99.881  3.750   1.00 91.32  ? 92  ASP B N   1 
ATOM   2441 C CA  . ASP B 1 114 ? 86.103  100.588 4.878   1.00 103.12 ? 92  ASP B CA  1 
ATOM   2442 C C   . ASP B 1 114 ? 85.681  99.621  5.982   1.00 94.75  ? 92  ASP B C   1 
ATOM   2443 O O   . ASP B 1 114 ? 85.759  99.962  7.166   1.00 96.69  ? 92  ASP B O   1 
ATOM   2444 C CB  . ASP B 1 114 ? 84.919  101.425 4.391   1.00 115.99 ? 92  ASP B CB  1 
ATOM   2445 C CG  . ASP B 1 114 ? 85.313  102.410 3.290   1.00 129.56 ? 92  ASP B CG  1 
ATOM   2446 O OD1 . ASP B 1 114 ? 86.532  102.597 3.055   1.00 132.67 ? 92  ASP B OD1 1 
ATOM   2447 O OD2 . ASP B 1 114 ? 84.402  103.000 2.660   1.00 133.00 ? 92  ASP B OD2 1 
ATOM   2448 N N   . ILE B 1 115 ? 85.281  98.402  5.620   1.00 85.79  ? 93  ILE B N   1 
ATOM   2449 C CA  . ILE B 1 115 ? 84.988  97.385  6.627   1.00 78.50  ? 93  ILE B CA  1 
ATOM   2450 C C   . ILE B 1 115 ? 86.232  97.046  7.438   1.00 78.41  ? 93  ILE B C   1 
ATOM   2451 O O   . ILE B 1 115 ? 86.176  96.921  8.666   1.00 78.13  ? 93  ILE B O   1 
ATOM   2452 C CB  . ILE B 1 115 ? 84.400  96.129  5.961   1.00 69.01  ? 93  ILE B CB  1 
ATOM   2453 C CG1 . ILE B 1 115 ? 83.024  96.438  5.368   1.00 65.31  ? 93  ILE B CG1 1 
ATOM   2454 C CG2 . ILE B 1 115 ? 84.370  94.975  6.955   1.00 64.73  ? 93  ILE B CG2 1 
ATOM   2455 C CD1 . ILE B 1 115 ? 82.459  95.327  4.505   1.00 67.63  ? 93  ILE B CD1 1 
ATOM   2456 N N   . CYS B 1 116 ? 87.369  96.874  6.769   1.00 81.80  ? 94  CYS B N   1 
ATOM   2457 C CA  . CYS B 1 116 ? 88.582  96.465  7.470   1.00 78.82  ? 94  CYS B CA  1 
ATOM   2458 C C   . CYS B 1 116 ? 89.126  97.599  8.329   1.00 82.90  ? 94  CYS B C   1 
ATOM   2459 O O   . CYS B 1 116 ? 89.599  97.368  9.448   1.00 89.70  ? 94  CYS B O   1 
ATOM   2460 C CB  . CYS B 1 116 ? 89.627  96.002  6.460   1.00 73.14  ? 94  CYS B CB  1 
ATOM   2461 S SG  . CYS B 1 116 ? 89.237  94.393  5.729   1.00 80.28  ? 94  CYS B SG  1 
ATOM   2462 N N   . ASN B 1 117 ? 89.071  98.833  7.826   1.00 79.18  ? 95  ASN B N   1 
ATOM   2463 C CA  . ASN B 1 117 ? 89.508  99.963  8.631   1.00 84.22  ? 95  ASN B CA  1 
ATOM   2464 C C   . ASN B 1 117 ? 88.560  100.212 9.796   1.00 100.15 ? 95  ASN B C   1 
ATOM   2465 O O   . ASN B 1 117 ? 88.988  100.716 10.838  1.00 113.32 ? 95  ASN B O   1 
ATOM   2466 C CB  . ASN B 1 117 ? 89.636  101.213 7.761   1.00 84.48  ? 95  ASN B CB  1 
ATOM   2467 C CG  . ASN B 1 117 ? 90.596  101.019 6.580   1.00 91.37  ? 95  ASN B CG  1 
ATOM   2468 O OD1 . ASN B 1 117 ? 91.529  100.210 6.631   1.00 90.56  ? 95  ASN B OD1 1 
ATOM   2469 N ND2 . ASN B 1 117 ? 90.379  101.790 5.520   1.00 96.64  ? 95  ASN B ND2 1 
ATOM   2470 N N   . ASP B 1 118 ? 87.281  99.853  9.643   1.00 101.01 ? 96  ASP B N   1 
ATOM   2471 C CA  . ASP B 1 118 ? 86.338  99.918  10.759  1.00 101.00 ? 96  ASP B CA  1 
ATOM   2472 C C   . ASP B 1 118 ? 86.768  98.987  11.883  1.00 92.97  ? 96  ASP B C   1 
ATOM   2473 O O   . ASP B 1 118 ? 86.766  99.362  13.062  1.00 92.63  ? 96  ASP B O   1 
ATOM   2474 C CB  . ASP B 1 118 ? 84.930  99.553  10.280  1.00 106.88 ? 96  ASP B CB  1 
ATOM   2475 C CG  . ASP B 1 118 ? 83.846  99.983  11.251  1.00 112.68 ? 96  ASP B CG  1 
ATOM   2476 O OD1 . ASP B 1 118 ? 83.996  101.029 11.916  1.00 116.41 ? 96  ASP B OD1 1 
ATOM   2477 O OD2 . ASP B 1 118 ? 82.862  99.231  11.390  1.00 115.41 ? 96  ASP B OD2 1 
ATOM   2478 N N   . VAL B 1 119 ? 87.127  97.750  11.531  1.00 84.57  ? 97  VAL B N   1 
ATOM   2479 C CA  . VAL B 1 119 ? 87.503  96.739  12.518  1.00 81.94  ? 97  VAL B CA  1 
ATOM   2480 C C   . VAL B 1 119 ? 88.849  97.053  13.141  1.00 83.22  ? 97  VAL B C   1 
ATOM   2481 O O   . VAL B 1 119 ? 89.005  97.010  14.370  1.00 80.35  ? 97  VAL B O   1 
ATOM   2482 C CB  . VAL B 1 119 ? 87.500  95.344  11.867  1.00 75.42  ? 97  VAL B CB  1 
ATOM   2483 C CG1 . VAL B 1 119 ? 87.884  94.299  12.852  1.00 68.74  ? 97  VAL B CG1 1 
ATOM   2484 C CG2 . VAL B 1 119 ? 86.096  95.027  11.417  1.00 77.06  ? 97  VAL B CG2 1 
ATOM   2485 N N   . LEU B 1 120 ? 89.846  97.403  12.323  1.00 86.49  ? 98  LEU B N   1 
ATOM   2486 C CA  . LEU B 1 120 ? 91.169  97.646  12.880  1.00 83.45  ? 98  LEU B CA  1 
ATOM   2487 C C   . LEU B 1 120 ? 91.235  98.904  13.748  1.00 85.22  ? 98  LEU B C   1 
ATOM   2488 O O   . LEU B 1 120 ? 92.138  99.013  14.590  1.00 78.35  ? 98  LEU B O   1 
ATOM   2489 C CB  . LEU B 1 120 ? 92.222  97.735  11.767  1.00 70.08  ? 98  LEU B CB  1 
ATOM   2490 C CG  . LEU B 1 120 ? 92.410  96.513  10.864  1.00 73.74  ? 98  LEU B CG  1 
ATOM   2491 C CD1 . LEU B 1 120 ? 93.002  96.907  9.514   1.00 67.60  ? 98  LEU B CD1 1 
ATOM   2492 C CD2 . LEU B 1 120 ? 93.248  95.448  11.560  1.00 84.93  ? 98  LEU B CD2 1 
ATOM   2493 N N   . SER B 1 121 ? 90.269  99.816  13.621  1.00 85.62  ? 99  SER B N   1 
ATOM   2494 C CA  . SER B 1 121 ? 90.212  100.961 14.528  1.00 93.02  ? 99  SER B CA  1 
ATOM   2495 C C   . SER B 1 121 ? 89.583  100.590 15.869  1.00 88.59  ? 99  SER B C   1 
ATOM   2496 O O   . SER B 1 121 ? 89.997  101.097 16.916  1.00 96.31  ? 99  SER B O   1 
ATOM   2497 C CB  . SER B 1 121 ? 89.468  102.117 13.863  1.00 94.88  ? 99  SER B CB  1 
ATOM   2498 O OG  . SER B 1 121 ? 90.189  102.572 12.729  1.00 97.26  ? 99  SER B OG  1 
ATOM   2499 N N   . LEU B 1 122 ? 88.593  99.703  15.865  1.00 77.71  ? 100 LEU B N   1 
ATOM   2500 C CA  . LEU B 1 122 ? 88.131  99.148  17.130  1.00 76.54  ? 100 LEU B CA  1 
ATOM   2501 C C   . LEU B 1 122 ? 89.249  98.401  17.848  1.00 76.10  ? 100 LEU B C   1 
ATOM   2502 O O   . LEU B 1 122 ? 89.342  98.462  19.077  1.00 80.53  ? 100 LEU B O   1 
ATOM   2503 C CB  . LEU B 1 122 ? 86.915  98.241  16.910  1.00 72.94  ? 100 LEU B CB  1 
ATOM   2504 C CG  . LEU B 1 122 ? 85.619  98.868  16.382  1.00 70.23  ? 100 LEU B CG  1 
ATOM   2505 C CD1 . LEU B 1 122 ? 84.446  98.038  16.839  1.00 67.25  ? 100 LEU B CD1 1 
ATOM   2506 C CD2 . LEU B 1 122 ? 85.439  100.304 16.919  1.00 60.11  ? 100 LEU B CD2 1 
ATOM   2507 N N   . LEU B 1 123 ? 90.123  97.704  17.109  1.00 79.35  ? 101 LEU B N   1 
ATOM   2508 C CA  . LEU B 1 123 ? 91.140  96.915  17.800  1.00 79.76  ? 101 LEU B CA  1 
ATOM   2509 C C   . LEU B 1 123 ? 92.264  97.785  18.356  1.00 87.95  ? 101 LEU B C   1 
ATOM   2510 O O   . LEU B 1 123 ? 92.784  97.496  19.439  1.00 81.01  ? 101 LEU B O   1 
ATOM   2511 C CB  . LEU B 1 123 ? 91.745  95.848  16.883  1.00 67.51  ? 101 LEU B CB  1 
ATOM   2512 C CG  . LEU B 1 123 ? 90.883  94.651  16.520  1.00 74.16  ? 101 LEU B CG  1 
ATOM   2513 C CD1 . LEU B 1 123 ? 91.177  94.210  15.100  1.00 75.87  ? 101 LEU B CD1 1 
ATOM   2514 C CD2 . LEU B 1 123 ? 91.068  93.516  17.513  1.00 77.37  ? 101 LEU B CD2 1 
ATOM   2515 N N   . GLU B 1 124 ? 92.613  98.878  17.686  1.00 84.49  ? 102 GLU B N   1 
ATOM   2516 C CA  . GLU B 1 124 ? 93.698  99.682  18.218  1.00 87.72  ? 102 GLU B CA  1 
ATOM   2517 C C   . GLU B 1 124 ? 93.220  100.605 19.328  1.00 105.02 ? 102 GLU B C   1 
ATOM   2518 O O   . GLU B 1 124 ? 93.996  100.895 20.245  1.00 126.49 ? 102 GLU B O   1 
ATOM   2519 C CB  . GLU B 1 124 ? 94.385  100.488 17.108  1.00 83.82  ? 102 GLU B CB  1 
ATOM   2520 N N   . LYS B 1 125 ? 91.967  101.073 19.293  1.00 101.21 ? 103 LYS B N   1 
ATOM   2521 C CA  . LYS B 1 125 ? 91.558  102.027 20.322  1.00 97.36  ? 103 LYS B CA  1 
ATOM   2522 C C   . LYS B 1 125 ? 90.815  101.389 21.498  1.00 97.44  ? 103 LYS B C   1 
ATOM   2523 O O   . LYS B 1 125 ? 90.855  101.943 22.605  1.00 104.97 ? 103 LYS B O   1 
ATOM   2524 C CB  . LYS B 1 125 ? 90.753  103.180 19.685  1.00 93.12  ? 103 LYS B CB  1 
ATOM   2525 C CG  . LYS B 1 125 ? 89.622  103.745 20.527  1.00 91.50  ? 103 LYS B CG  1 
ATOM   2526 C CD  . LYS B 1 125 ? 88.812  104.852 19.841  1.00 86.94  ? 103 LYS B CD  1 
ATOM   2527 C CE  . LYS B 1 125 ? 89.174  106.222 20.440  1.00 87.13  ? 103 LYS B CE  1 
ATOM   2528 N NZ  . LYS B 1 125 ? 88.217  107.315 20.094  1.00 92.37  ? 103 LYS B NZ  1 
ATOM   2529 N N   . PHE B 1 126 ? 90.227  100.200 21.328  1.00 93.35  ? 104 PHE B N   1 
ATOM   2530 C CA  . PHE B 1 126 ? 89.418  99.588  22.387  1.00 91.76  ? 104 PHE B CA  1 
ATOM   2531 C C   . PHE B 1 126 ? 89.812  98.149  22.725  1.00 93.44  ? 104 PHE B C   1 
ATOM   2532 O O   . PHE B 1 126 ? 89.960  97.798  23.903  1.00 97.15  ? 104 PHE B O   1 
ATOM   2533 C CB  . PHE B 1 126 ? 87.926  99.562  22.016  1.00 89.80  ? 104 PHE B CB  1 
ATOM   2534 C CG  . PHE B 1 126 ? 87.305  100.915 21.788  1.00 88.73  ? 104 PHE B CG  1 
ATOM   2535 C CD1 . PHE B 1 126 ? 86.936  101.311 20.506  1.00 69.91  ? 104 PHE B CD1 1 
ATOM   2536 C CD2 . PHE B 1 126 ? 87.031  101.763 22.859  1.00 94.08  ? 104 PHE B CD2 1 
ATOM   2537 C CE1 . PHE B 1 126 ? 86.347  102.547 20.286  1.00 72.16  ? 104 PHE B CE1 1 
ATOM   2538 C CE2 . PHE B 1 126 ? 86.445  103.010 22.648  1.00 92.11  ? 104 PHE B CE2 1 
ATOM   2539 C CZ  . PHE B 1 126 ? 86.105  103.403 21.354  1.00 84.80  ? 104 PHE B CZ  1 
ATOM   2540 N N   . LEU B 1 127 ? 89.964  97.299  21.705  1.00 92.74  ? 105 LEU B N   1 
ATOM   2541 C CA  . LEU B 1 127 ? 89.987  95.860  21.949  1.00 90.57  ? 105 LEU B CA  1 
ATOM   2542 C C   . LEU B 1 127 ? 91.354  95.361  22.396  1.00 89.03  ? 105 LEU B C   1 
ATOM   2543 O O   . LEU B 1 127 ? 91.447  94.632  23.389  1.00 88.91  ? 105 LEU B O   1 
ATOM   2544 C CB  . LEU B 1 127 ? 89.504  95.109  20.710  1.00 81.08  ? 105 LEU B CB  1 
ATOM   2545 C CG  . LEU B 1 127 ? 87.987  95.304  20.589  1.00 73.30  ? 105 LEU B CG  1 
ATOM   2546 C CD1 . LEU B 1 127 ? 87.408  94.657  19.350  1.00 73.02  ? 105 LEU B CD1 1 
ATOM   2547 C CD2 . LEU B 1 127 ? 87.280  94.787  21.831  1.00 71.34  ? 105 LEU B CD2 1 
ATOM   2548 N N   . ILE B 1 128 ? 92.418  95.735  21.689  1.00 92.87  ? 106 ILE B N   1 
ATOM   2549 C CA  . ILE B 1 128 ? 93.772  95.302  22.052  1.00 94.76  ? 106 ILE B CA  1 
ATOM   2550 C C   . ILE B 1 128 ? 94.210  95.960  23.359  1.00 99.35  ? 106 ILE B C   1 
ATOM   2551 O O   . ILE B 1 128 ? 94.612  95.234  24.279  1.00 101.18 ? 106 ILE B O   1 
ATOM   2552 C CB  . ILE B 1 128 ? 94.790  95.586  20.929  1.00 87.93  ? 106 ILE B CB  1 
ATOM   2553 C CG1 . ILE B 1 128 ? 94.513  94.722  19.690  1.00 87.89  ? 106 ILE B CG1 1 
ATOM   2554 C CG2 . ILE B 1 128 ? 96.212  95.369  21.417  1.00 78.86  ? 106 ILE B CG2 1 
ATOM   2555 C CD1 . ILE B 1 128 ? 95.265  95.194  18.435  1.00 88.87  ? 106 ILE B CD1 1 
ATOM   2556 N N   . PRO B 1 129 ? 94.129  97.294  23.523  1.00 100.88 ? 107 PRO B N   1 
ATOM   2557 C CA  . PRO B 1 129 ? 94.611  97.891  24.785  1.00 101.70 ? 107 PRO B CA  1 
ATOM   2558 C C   . PRO B 1 129 ? 93.893  97.415  26.046  1.00 99.80  ? 107 PRO B C   1 
ATOM   2559 O O   . PRO B 1 129 ? 94.527  97.369  27.109  1.00 106.01 ? 107 PRO B O   1 
ATOM   2560 C CB  . PRO B 1 129 ? 94.428  99.402  24.560  1.00 102.30 ? 107 PRO B CB  1 
ATOM   2561 C CG  . PRO B 1 129 ? 93.504  99.547  23.446  1.00 98.18  ? 107 PRO B CG  1 
ATOM   2562 C CD  . PRO B 1 129 ? 93.633  98.328  22.594  1.00 98.29  ? 107 PRO B CD  1 
ATOM   2563 N N   . ASN B 1 130 ? 92.612  97.042  25.976  1.00 96.20  ? 108 ASN B N   1 
ATOM   2564 C CA  . ASN B 1 130 ? 91.889  96.578  27.157  1.00 100.40 ? 108 ASN B CA  1 
ATOM   2565 C C   . ASN B 1 130 ? 91.856  95.055  27.266  1.00 102.18 ? 108 ASN B C   1 
ATOM   2566 O O   . ASN B 1 130 ? 91.100  94.511  28.081  1.00 98.22  ? 108 ASN B O   1 
ATOM   2567 C CB  . ASN B 1 130 ? 90.467  97.145  27.184  1.00 97.58  ? 108 ASN B CB  1 
ATOM   2568 C CG  . ASN B 1 130 ? 90.437  98.655  27.038  1.00 110.30 ? 108 ASN B CG  1 
ATOM   2569 O OD1 . ASN B 1 130 ? 91.479  99.304  26.980  1.00 125.52 ? 108 ASN B OD1 1 
ATOM   2570 N ND2 . ASN B 1 130 ? 89.243  99.225  27.009  1.00 107.74 ? 108 ASN B ND2 1 
ATOM   2571 N N   . ALA B 1 131 ? 92.678  94.362  26.477  1.00 107.62 ? 109 ALA B N   1 
ATOM   2572 C CA  . ALA B 1 131 ? 92.783  92.905  26.530  1.00 106.34 ? 109 ALA B CA  1 
ATOM   2573 C C   . ALA B 1 131 ? 93.648  92.566  27.733  1.00 110.11 ? 109 ALA B C   1 
ATOM   2574 O O   . ALA B 1 131 ? 94.872  92.706  27.699  1.00 118.95 ? 109 ALA B O   1 
ATOM   2575 C CB  . ALA B 1 131 ? 93.376  92.356  25.237  1.00 102.28 ? 109 ALA B CB  1 
ATOM   2576 N N   A SER B 1 132 ? 93.005  92.111  28.817  0.51 105.55 ? 110 SER B N   1 
ATOM   2577 N N   B SER B 1 132 ? 93.000  92.117  28.815  0.49 105.71 ? 110 SER B N   1 
ATOM   2578 C CA  A SER B 1 132 ? 93.712  91.894  30.076  0.51 104.16 ? 110 SER B CA  1 
ATOM   2579 C CA  B SER B 1 132 ? 93.702  91.892  30.073  0.49 104.11 ? 110 SER B CA  1 
ATOM   2580 C C   A SER B 1 132 ? 94.623  90.672  30.002  0.51 107.79 ? 110 SER B C   1 
ATOM   2581 C C   B SER B 1 132 ? 94.622  90.677  29.988  0.49 107.69 ? 110 SER B C   1 
ATOM   2582 O O   A SER B 1 132 ? 95.832  90.762  30.248  0.51 112.92 ? 110 SER B O   1 
ATOM   2583 O O   B SER B 1 132 ? 95.835  90.778  30.210  0.49 113.14 ? 110 SER B O   1 
ATOM   2584 C CB  A SER B 1 132 ? 92.698  91.750  31.217  0.51 98.65  ? 110 SER B CB  1 
ATOM   2585 C CB  B SER B 1 132 ? 92.684  91.727  31.205  0.49 98.56  ? 110 SER B CB  1 
ATOM   2586 O OG  A SER B 1 132 ? 93.282  91.195  32.385  0.51 95.62  ? 110 SER B OG  1 
ATOM   2587 O OG  B SER B 1 132 ? 91.352  91.702  30.702  0.49 94.74  ? 110 SER B OG  1 
ATOM   2588 N N   . GLN B 1 133 ? 94.059  89.522  29.654  1.00 109.60 ? 111 GLN B N   1 
ATOM   2589 C CA  . GLN B 1 133 ? 94.743  88.245  29.755  1.00 115.35 ? 111 GLN B CA  1 
ATOM   2590 C C   . GLN B 1 133 ? 95.420  87.873  28.435  1.00 103.45 ? 111 GLN B C   1 
ATOM   2591 O O   . GLN B 1 133 ? 95.417  88.631  27.463  1.00 101.87 ? 111 GLN B O   1 
ATOM   2592 C CB  . GLN B 1 133 ? 93.731  87.201  30.216  1.00 127.06 ? 111 GLN B CB  1 
ATOM   2593 C CG  . GLN B 1 133 ? 93.136  87.541  31.589  1.00 132.27 ? 111 GLN B CG  1 
ATOM   2594 C CD  . GLN B 1 133 ? 91.695  87.092  31.719  1.00 132.85 ? 111 GLN B CD  1 
ATOM   2595 O OE1 . GLN B 1 133 ? 91.355  85.940  31.444  1.00 127.81 ? 111 GLN B OE1 1 
ATOM   2596 N NE2 . GLN B 1 133 ? 90.833  88.008  32.167  1.00 136.00 ? 111 GLN B NE2 1 
ATOM   2597 N N   . ALA B 1 134 ? 96.038  86.693  28.400  1.00 101.21 ? 112 ALA B N   1 
ATOM   2598 C CA  . ALA B 1 134 ? 96.746  86.294  27.190  1.00 89.91  ? 112 ALA B CA  1 
ATOM   2599 C C   . ALA B 1 134 ? 95.819  85.641  26.173  1.00 98.38  ? 112 ALA B C   1 
ATOM   2600 O O   . ALA B 1 134 ? 96.057  85.771  24.966  1.00 105.56 ? 112 ALA B O   1 
ATOM   2601 C CB  . ALA B 1 134 ? 97.912  85.359  27.528  1.00 81.34  ? 112 ALA B CB  1 
ATOM   2602 N N   . GLU B 1 135 ? 94.774  84.933  26.620  1.00 101.29 ? 113 GLU B N   1 
ATOM   2603 C CA  . GLU B 1 135 ? 93.795  84.400  25.673  1.00 96.48  ? 113 GLU B CA  1 
ATOM   2604 C C   . GLU B 1 135 ? 93.267  85.509  24.778  1.00 97.99  ? 113 GLU B C   1 
ATOM   2605 O O   . GLU B 1 135 ? 93.230  85.370  23.551  1.00 86.88  ? 113 GLU B O   1 
ATOM   2606 C CB  . GLU B 1 135 ? 92.639  83.707  26.408  1.00 89.78  ? 113 GLU B CB  1 
ATOM   2607 N N   . SER B 1 136 ? 92.905  86.648  25.380  1.00 108.86 ? 114 SER B N   1 
ATOM   2608 C CA  . SER B 1 136 ? 92.369  87.760  24.601  1.00 106.15 ? 114 SER B CA  1 
ATOM   2609 C C   . SER B 1 136 ? 93.452  88.456  23.785  1.00 97.59  ? 114 SER B C   1 
ATOM   2610 O O   . SER B 1 136 ? 93.238  88.759  22.608  1.00 96.13  ? 114 SER B O   1 
ATOM   2611 C CB  . SER B 1 136 ? 91.658  88.743  25.524  1.00 106.91 ? 114 SER B CB  1 
ATOM   2612 O OG  . SER B 1 136 ? 90.402  88.211  25.898  1.00 118.04 ? 114 SER B OG  1 
ATOM   2613 N N   . LYS B 1 137 ? 94.619  88.715  24.384  1.00 99.06  ? 115 LYS B N   1 
ATOM   2614 C CA  . LYS B 1 137 ? 95.692  89.402  23.662  1.00 104.01 ? 115 LYS B CA  1 
ATOM   2615 C C   . LYS B 1 137 ? 96.059  88.657  22.384  1.00 103.36 ? 115 LYS B C   1 
ATOM   2616 O O   . LYS B 1 137 ? 96.258  89.274  21.332  1.00 101.44 ? 115 LYS B O   1 
ATOM   2617 C CB  . LYS B 1 137 ? 96.925  89.571  24.556  1.00 107.41 ? 115 LYS B CB  1 
ATOM   2618 N N   . VAL B 1 138 ? 96.183  87.331  22.463  1.00 97.28  ? 116 VAL B N   1 
ATOM   2619 C CA  . VAL B 1 138 ? 96.420  86.525  21.268  1.00 94.04  ? 116 VAL B CA  1 
ATOM   2620 C C   . VAL B 1 138 ? 95.231  86.595  20.313  1.00 95.59  ? 116 VAL B C   1 
ATOM   2621 O O   . VAL B 1 138 ? 95.394  86.801  19.105  1.00 101.83 ? 116 VAL B O   1 
ATOM   2622 C CB  . VAL B 1 138 ? 96.716  85.072  21.665  1.00 95.52  ? 116 VAL B CB  1 
ATOM   2623 C CG1 . VAL B 1 138 ? 96.442  84.120  20.494  1.00 86.35  ? 116 VAL B CG1 1 
ATOM   2624 C CG2 . VAL B 1 138 ? 98.140  84.951  22.188  1.00 104.43 ? 116 VAL B CG2 1 
ATOM   2625 N N   . PHE B 1 139 ? 94.017  86.405  20.835  1.00 90.49  ? 117 PHE B N   1 
ATOM   2626 C CA  . PHE B 1 139 ? 92.839  86.388  19.974  1.00 80.42  ? 117 PHE B CA  1 
ATOM   2627 C C   . PHE B 1 139 ? 92.705  87.692  19.206  1.00 82.20  ? 117 PHE B C   1 
ATOM   2628 O O   . PHE B 1 139 ? 92.602  87.693  17.975  1.00 89.46  ? 117 PHE B O   1 
ATOM   2629 C CB  . PHE B 1 139 ? 91.584  86.129  20.808  1.00 80.74  ? 117 PHE B CB  1 
ATOM   2630 C CG  . PHE B 1 139 ? 90.316  86.078  19.999  1.00 82.12  ? 117 PHE B CG  1 
ATOM   2631 C CD1 . PHE B 1 139 ? 89.625  87.236  19.678  1.00 79.55  ? 117 PHE B CD1 1 
ATOM   2632 C CD2 . PHE B 1 139 ? 89.812  84.871  19.561  1.00 78.83  ? 117 PHE B CD2 1 
ATOM   2633 C CE1 . PHE B 1 139 ? 88.456  87.187  18.933  1.00 69.89  ? 117 PHE B CE1 1 
ATOM   2634 C CE2 . PHE B 1 139 ? 88.654  84.824  18.824  1.00 74.23  ? 117 PHE B CE2 1 
ATOM   2635 C CZ  . PHE B 1 139 ? 87.971  85.984  18.513  1.00 68.65  ? 117 PHE B CZ  1 
ATOM   2636 N N   . TYR B 1 140 ? 92.741  88.821  19.912  1.00 77.40  ? 118 TYR B N   1 
ATOM   2637 C CA  . TYR B 1 140 ? 92.543  90.090  19.231  1.00 76.42  ? 118 TYR B CA  1 
ATOM   2638 C C   . TYR B 1 140 ? 93.725  90.471  18.343  1.00 80.39  ? 118 TYR B C   1 
ATOM   2639 O O   . TYR B 1 140 ? 93.556  91.297  17.442  1.00 79.97  ? 118 TYR B O   1 
ATOM   2640 C CB  . TYR B 1 140 ? 92.285  91.216  20.229  1.00 79.78  ? 118 TYR B CB  1 
ATOM   2641 C CG  . TYR B 1 140 ? 90.982  91.141  20.974  1.00 94.29  ? 118 TYR B CG  1 
ATOM   2642 C CD1 . TYR B 1 140 ? 89.779  91.409  20.338  1.00 102.52 ? 118 TYR B CD1 1 
ATOM   2643 C CD2 . TYR B 1 140 ? 90.955  90.858  22.333  1.00 111.96 ? 118 TYR B CD2 1 
ATOM   2644 C CE1 . TYR B 1 140 ? 88.573  91.357  21.026  1.00 110.67 ? 118 TYR B CE1 1 
ATOM   2645 C CE2 . TYR B 1 140 ? 89.757  90.805  23.032  1.00 123.93 ? 118 TYR B CE2 1 
ATOM   2646 C CZ  . TYR B 1 140 ? 88.570  91.055  22.370  1.00 122.18 ? 118 TYR B CZ  1 
ATOM   2647 O OH  . TYR B 1 140 ? 87.381  91.005  23.059  1.00 130.58 ? 118 TYR B OH  1 
ATOM   2648 N N   . LEU B 1 141 ? 94.917  89.912  18.556  1.00 86.00  ? 119 LEU B N   1 
ATOM   2649 C CA  . LEU B 1 141 ? 95.994  90.243  17.628  1.00 86.36  ? 119 LEU B CA  1 
ATOM   2650 C C   . LEU B 1 141 ? 96.030  89.318  16.429  1.00 82.70  ? 119 LEU B C   1 
ATOM   2651 O O   . LEU B 1 141 ? 96.530  89.710  15.370  1.00 91.27  ? 119 LEU B O   1 
ATOM   2652 C CB  . LEU B 1 141 ? 97.375  90.201  18.305  1.00 81.99  ? 119 LEU B CB  1 
ATOM   2653 C CG  . LEU B 1 141 ? 97.750  91.234  19.369  1.00 83.29  ? 119 LEU B CG  1 
ATOM   2654 C CD1 . LEU B 1 141 ? 98.953  90.769  20.181  1.00 85.64  ? 119 LEU B CD1 1 
ATOM   2655 C CD2 . LEU B 1 141 ? 98.029  92.575  18.731  1.00 88.56  ? 119 LEU B CD2 1 
ATOM   2656 N N   . LYS B 1 142 ? 95.459  88.124  16.546  1.00 75.81  ? 120 LYS B N   1 
ATOM   2657 C CA  . LYS B 1 142 ? 95.218  87.319  15.357  1.00 72.25  ? 120 LYS B CA  1 
ATOM   2658 C C   . LYS B 1 142 ? 94.157  87.965  14.488  1.00 72.81  ? 120 LYS B C   1 
ATOM   2659 O O   . LYS B 1 142 ? 94.274  87.983  13.259  1.00 79.16  ? 120 LYS B O   1 
ATOM   2660 C CB  . LYS B 1 142 ? 94.826  85.906  15.764  1.00 66.34  ? 120 LYS B CB  1 
ATOM   2661 C CG  . LYS B 1 142 ? 93.754  85.281  14.948  1.00 63.25  ? 120 LYS B CG  1 
ATOM   2662 C CD  . LYS B 1 142 ? 93.584  83.833  15.374  1.00 71.57  ? 120 LYS B CD  1 
ATOM   2663 C CE  . LYS B 1 142 ? 92.215  83.315  15.010  1.00 75.69  ? 120 LYS B CE  1 
ATOM   2664 N NZ  . LYS B 1 142 ? 91.991  83.507  13.560  1.00 76.32  ? 120 LYS B NZ  1 
ATOM   2665 N N   . MET B 1 143 ? 93.130  88.523  15.115  1.00 76.65  ? 121 MET B N   1 
ATOM   2666 C CA  . MET B 1 143 ? 92.113  89.251  14.372  1.00 77.92  ? 121 MET B CA  1 
ATOM   2667 C C   . MET B 1 143 ? 92.717  90.427  13.619  1.00 79.03  ? 121 MET B C   1 
ATOM   2668 O O   . MET B 1 143 ? 92.334  90.706  12.477  1.00 82.09  ? 121 MET B O   1 
ATOM   2669 C CB  . MET B 1 143 ? 91.037  89.729  15.336  1.00 75.36  ? 121 MET B CB  1 
ATOM   2670 C CG  . MET B 1 143 ? 89.841  90.288  14.661  1.00 81.88  ? 121 MET B CG  1 
ATOM   2671 S SD  . MET B 1 143 ? 88.506  90.345  15.834  1.00 91.07  ? 121 MET B SD  1 
ATOM   2672 C CE  . MET B 1 143 ? 87.771  91.927  15.463  1.00 93.93  ? 121 MET B CE  1 
ATOM   2673 N N   . LYS B 1 144 ? 93.686  91.107  14.227  1.00 75.66  ? 122 LYS B N   1 
ATOM   2674 C CA  . LYS B 1 144 ? 94.353  92.201  13.538  1.00 76.15  ? 122 LYS B CA  1 
ATOM   2675 C C   . LYS B 1 144 ? 95.086  91.683  12.307  1.00 82.85  ? 122 LYS B C   1 
ATOM   2676 O O   . LYS B 1 144 ? 94.970  92.255  11.216  1.00 92.36  ? 122 LYS B O   1 
ATOM   2677 C CB  . LYS B 1 144 ? 95.318  92.906  14.503  1.00 78.04  ? 122 LYS B CB  1 
ATOM   2678 C CG  . LYS B 1 144 ? 95.806  94.277  14.031  1.00 73.63  ? 122 LYS B CG  1 
ATOM   2679 C CD  . LYS B 1 144 ? 97.037  94.739  14.765  1.00 68.07  ? 122 LYS B CD  1 
ATOM   2680 C CE  . LYS B 1 144 ? 97.238  96.241  14.581  1.00 75.34  ? 122 LYS B CE  1 
ATOM   2681 N NZ  . LYS B 1 144 ? 98.415  96.794  15.337  1.00 78.96  ? 122 LYS B NZ  1 
ATOM   2682 N N   . GLY B 1 145 ? 95.828  90.580  12.460  1.00 73.18  ? 123 GLY B N   1 
ATOM   2683 C CA  . GLY B 1 145 ? 96.533  90.008  11.324  1.00 74.55  ? 123 GLY B CA  1 
ATOM   2684 C C   . GLY B 1 145 ? 95.595  89.602  10.205  1.00 78.49  ? 123 GLY B C   1 
ATOM   2685 O O   . GLY B 1 145 ? 95.842  89.898  9.033   1.00 81.80  ? 123 GLY B O   1 
ATOM   2686 N N   . ASP B 1 146 ? 94.487  88.952  10.560  1.00 77.20  ? 124 ASP B N   1 
ATOM   2687 C CA  . ASP B 1 146 ? 93.482  88.563  9.578   1.00 66.04  ? 124 ASP B CA  1 
ATOM   2688 C C   . ASP B 1 146 ? 93.002  89.766  8.784   1.00 65.51  ? 124 ASP B C   1 
ATOM   2689 O O   . ASP B 1 146 ? 93.046  89.775  7.550   1.00 64.08  ? 124 ASP B O   1 
ATOM   2690 C CB  . ASP B 1 146 ? 92.321  87.869  10.282  1.00 55.12  ? 124 ASP B CB  1 
ATOM   2691 C CG  . ASP B 1 146 ? 92.679  86.464  10.741  1.00 68.82  ? 124 ASP B CG  1 
ATOM   2692 O OD1 . ASP B 1 146 ? 93.554  85.837  10.104  1.00 76.89  ? 124 ASP B OD1 1 
ATOM   2693 O OD2 . ASP B 1 146 ? 92.073  85.964  11.711  1.00 71.38  ? 124 ASP B OD2 1 
ATOM   2694 N N   . TYR B 1 147 ? 92.506  90.782  9.479   1.00 66.16  ? 125 TYR B N   1 
ATOM   2695 C CA  . TYR B 1 147 ? 91.933  91.921  8.783   1.00 67.03  ? 125 TYR B CA  1 
ATOM   2696 C C   . TYR B 1 147 ? 92.979  92.774  8.086   1.00 77.22  ? 125 TYR B C   1 
ATOM   2697 O O   . TYR B 1 147 ? 92.609  93.622  7.276   1.00 90.02  ? 125 TYR B O   1 
ATOM   2698 C CB  . TYR B 1 147 ? 91.079  92.742  9.749   1.00 63.57  ? 125 TYR B CB  1 
ATOM   2699 C CG  . TYR B 1 147 ? 89.725  92.076  9.988   1.00 73.45  ? 125 TYR B CG  1 
ATOM   2700 C CD1 . TYR B 1 147 ? 89.594  91.072  10.942  1.00 73.96  ? 125 TYR B CD1 1 
ATOM   2701 C CD2 . TYR B 1 147 ? 88.589  92.436  9.252   1.00 64.45  ? 125 TYR B CD2 1 
ATOM   2702 C CE1 . TYR B 1 147 ? 88.388  90.441  11.169  1.00 75.16  ? 125 TYR B CE1 1 
ATOM   2703 C CE2 . TYR B 1 147 ? 87.360  91.809  9.484   1.00 73.70  ? 125 TYR B CE2 1 
ATOM   2704 C CZ  . TYR B 1 147 ? 87.266  90.808  10.450  1.00 77.41  ? 125 TYR B CZ  1 
ATOM   2705 O OH  . TYR B 1 147 ? 86.066  90.161  10.720  1.00 66.84  ? 125 TYR B OH  1 
ATOM   2706 N N   . TYR B 1 148 ? 94.267  92.623  8.396   1.00 76.76  ? 126 TYR B N   1 
ATOM   2707 C CA  . TYR B 1 148 ? 95.232  93.233  7.486   1.00 80.40  ? 126 TYR B CA  1 
ATOM   2708 C C   . TYR B 1 148 ? 95.469  92.340  6.260   1.00 70.78  ? 126 TYR B C   1 
ATOM   2709 O O   . TYR B 1 148 ? 95.642  92.845  5.149   1.00 66.56  ? 126 TYR B O   1 
ATOM   2710 C CB  . TYR B 1 148 ? 96.535  93.550  8.227   1.00 76.37  ? 126 TYR B CB  1 
ATOM   2711 C CG  . TYR B 1 148 ? 96.569  94.910  8.891   1.00 75.02  ? 126 TYR B CG  1 
ATOM   2712 C CD1 . TYR B 1 148 ? 96.492  96.078  8.144   1.00 71.31  ? 126 TYR B CD1 1 
ATOM   2713 C CD2 . TYR B 1 148 ? 96.683  95.024  10.281  1.00 77.77  ? 126 TYR B CD2 1 
ATOM   2714 C CE1 . TYR B 1 148 ? 96.527  97.334  8.760   1.00 72.70  ? 126 TYR B CE1 1 
ATOM   2715 C CE2 . TYR B 1 148 ? 96.713  96.275  10.908  1.00 76.22  ? 126 TYR B CE2 1 
ATOM   2716 C CZ  . TYR B 1 148 ? 96.637  97.424  10.144  1.00 74.21  ? 126 TYR B CZ  1 
ATOM   2717 O OH  . TYR B 1 148 ? 96.655  98.653  10.771  1.00 71.01  ? 126 TYR B OH  1 
ATOM   2718 N N   . ARG B 1 149 ? 95.430  91.021  6.440   1.00 61.92  ? 127 ARG B N   1 
ATOM   2719 C CA  . ARG B 1 149 ? 95.516  90.086  5.323   1.00 61.41  ? 127 ARG B CA  1 
ATOM   2720 C C   . ARG B 1 149 ? 94.358  90.255  4.358   1.00 74.33  ? 127 ARG B C   1 
ATOM   2721 O O   . ARG B 1 149 ? 94.547  90.118  3.143   1.00 86.14  ? 127 ARG B O   1 
ATOM   2722 C CB  . ARG B 1 149 ? 95.502  88.658  5.854   1.00 62.96  ? 127 ARG B CB  1 
ATOM   2723 C CG  . ARG B 1 149 ? 95.326  87.550  4.836   1.00 64.58  ? 127 ARG B CG  1 
ATOM   2724 C CD  . ARG B 1 149 ? 95.966  86.363  5.462   1.00 70.91  ? 127 ARG B CD  1 
ATOM   2725 N NE  . ARG B 1 149 ? 95.053  85.690  6.378   1.00 72.02  ? 127 ARG B NE  1 
ATOM   2726 C CZ  . ARG B 1 149 ? 93.919  85.075  6.052   1.00 71.72  ? 127 ARG B CZ  1 
ATOM   2727 N NH1 . ARG B 1 149 ? 93.526  84.960  4.777   1.00 77.57  ? 127 ARG B NH1 1 
ATOM   2728 N NH2 . ARG B 1 149 ? 93.197  84.528  7.028   1.00 59.22  ? 127 ARG B NH2 1 
ATOM   2729 N N   . TYR B 1 150 ? 93.147  90.478  4.868   1.00 77.21  ? 128 TYR B N   1 
ATOM   2730 C CA  . TYR B 1 150 ? 92.035  90.774  3.975   1.00 74.54  ? 128 TYR B CA  1 
ATOM   2731 C C   . TYR B 1 150 ? 92.373  91.986  3.117   1.00 74.68  ? 128 TYR B C   1 
ATOM   2732 O O   . TYR B 1 150 ? 92.144  91.977  1.900   1.00 84.17  ? 128 TYR B O   1 
ATOM   2733 C CB  . TYR B 1 150 ? 90.758  91.001  4.806   1.00 66.00  ? 128 TYR B CB  1 
ATOM   2734 C CG  . TYR B 1 150 ? 90.371  89.801  5.655   1.00 60.00  ? 128 TYR B CG  1 
ATOM   2735 C CD1 . TYR B 1 150 ? 89.595  89.931  6.815   1.00 60.53  ? 128 TYR B CD1 1 
ATOM   2736 C CD2 . TYR B 1 150 ? 90.780  88.538  5.285   1.00 57.12  ? 128 TYR B CD2 1 
ATOM   2737 C CE1 . TYR B 1 150 ? 89.272  88.833  7.574   1.00 68.14  ? 128 TYR B CE1 1 
ATOM   2738 C CE2 . TYR B 1 150 ? 90.450  87.437  6.034   1.00 67.21  ? 128 TYR B CE2 1 
ATOM   2739 C CZ  . TYR B 1 150 ? 89.705  87.582  7.171   1.00 63.96  ? 128 TYR B CZ  1 
ATOM   2740 O OH  . TYR B 1 150 ? 89.411  86.438  7.881   1.00 71.67  ? 128 TYR B OH  1 
ATOM   2741 N N   . LEU B 1 151 ? 93.001  93.002  3.714   1.00 67.76  ? 129 LEU B N   1 
ATOM   2742 C CA  . LEU B 1 151 ? 93.411  94.182  2.961   1.00 77.10  ? 129 LEU B CA  1 
ATOM   2743 C C   . LEU B 1 151 ? 94.550  93.860  2.007   1.00 93.77  ? 129 LEU B C   1 
ATOM   2744 O O   . LEU B 1 151 ? 94.653  94.474  0.943   1.00 109.00 ? 129 LEU B O   1 
ATOM   2745 C CB  . LEU B 1 151 ? 93.839  95.302  3.905   1.00 69.61  ? 129 LEU B CB  1 
ATOM   2746 C CG  . LEU B 1 151 ? 92.774  96.182  4.539   1.00 72.42  ? 129 LEU B CG  1 
ATOM   2747 C CD1 . LEU B 1 151 ? 93.456  97.262  5.346   1.00 73.62  ? 129 LEU B CD1 1 
ATOM   2748 C CD2 . LEU B 1 151 ? 91.873  96.777  3.480   1.00 83.18  ? 129 LEU B CD2 1 
ATOM   2749 N N   . ALA B 1 152 ? 95.439  92.942  2.391   1.00 89.72  ? 130 ALA B N   1 
ATOM   2750 C CA  . ALA B 1 152 ? 96.513  92.543  1.494   1.00 90.01  ? 130 ALA B CA  1 
ATOM   2751 C C   . ALA B 1 152 ? 95.985  91.729  0.316   1.00 91.90  ? 130 ALA B C   1 
ATOM   2752 O O   . ALA B 1 152 ? 96.505  91.854  -0.800  1.00 96.83  ? 130 ALA B O   1 
ATOM   2753 C CB  . ALA B 1 152 ? 97.572  91.753  2.266   1.00 87.32  ? 130 ALA B CB  1 
ATOM   2754 N N   . GLU B 1 153 ? 94.945  90.916  0.538   1.00 93.75  ? 131 GLU B N   1 
ATOM   2755 C CA  . GLU B 1 153 ? 94.317  90.160  -0.544  1.00 91.95  ? 131 GLU B CA  1 
ATOM   2756 C C   . GLU B 1 153 ? 93.906  91.041  -1.712  1.00 95.27  ? 131 GLU B C   1 
ATOM   2757 O O   . GLU B 1 153 ? 93.768  90.543  -2.841  1.00 90.96  ? 131 GLU B O   1 
ATOM   2758 C CB  . GLU B 1 153 ? 93.095  89.386  -0.019  1.00 79.36  ? 131 GLU B CB  1 
ATOM   2759 C CG  . GLU B 1 153 ? 93.464  88.108  0.717   1.00 81.75  ? 131 GLU B CG  1 
ATOM   2760 C CD  . GLU B 1 153 ? 92.266  87.255  1.068   1.00 81.06  ? 131 GLU B CD  1 
ATOM   2761 O OE1 . GLU B 1 153 ? 91.154  87.827  1.174   1.00 75.21  ? 131 GLU B OE1 1 
ATOM   2762 O OE2 . GLU B 1 153 ? 92.437  86.011  1.177   1.00 83.87  ? 131 GLU B OE2 1 
ATOM   2763 N N   . VAL B 1 154 ? 93.700  92.337  -1.476  1.00 94.16  ? 132 VAL B N   1 
ATOM   2764 C CA  . VAL B 1 154 ? 93.146  93.214  -2.473  1.00 95.15  ? 132 VAL B CA  1 
ATOM   2765 C C   . VAL B 1 154 ? 94.087  94.371  -2.834  1.00 97.94  ? 132 VAL B C   1 
ATOM   2766 O O   . VAL B 1 154 ? 93.965  94.947  -3.924  1.00 101.08 ? 132 VAL B O   1 
ATOM   2767 C CB  . VAL B 1 154 ? 91.792  93.758  -1.956  1.00 96.37  ? 132 VAL B CB  1 
ATOM   2768 C CG1 . VAL B 1 154 ? 91.918  94.989  -1.090  1.00 105.76 ? 132 VAL B CG1 1 
ATOM   2769 C CG2 . VAL B 1 154 ? 90.739  93.792  -2.978  1.00 99.52  ? 132 VAL B CG2 1 
ATOM   2770 N N   . ALA B 1 155 ? 95.046  94.701  -1.954  1.00 100.08 ? 133 ALA B N   1 
ATOM   2771 C CA  . ALA B 1 155 ? 95.882  95.881  -2.125  1.00 101.30 ? 133 ALA B CA  1 
ATOM   2772 C C   . ALA B 1 155 ? 96.804  95.733  -3.315  1.00 115.64 ? 133 ALA B C   1 
ATOM   2773 O O   . ALA B 1 155 ? 97.356  94.657  -3.567  1.00 111.49 ? 133 ALA B O   1 
ATOM   2774 C CB  . ALA B 1 155 ? 96.706  96.129  -0.867  1.00 91.34  ? 133 ALA B CB  1 
ATOM   2775 N N   . ALA B 1 156 ? 96.998  96.849  -4.020  1.00 128.27 ? 134 ALA B N   1 
ATOM   2776 C CA  . ALA B 1 156 ? 97.897  96.936  -5.160  1.00 131.63 ? 134 ALA B CA  1 
ATOM   2777 C C   . ALA B 1 156 ? 98.743  98.197  -5.054  1.00 141.66 ? 134 ALA B C   1 
ATOM   2778 O O   . ALA B 1 156 ? 99.077  98.639  -3.947  1.00 143.49 ? 134 ALA B O   1 
ATOM   2779 C CB  . ALA B 1 156 ? 97.112  96.927  -6.473  1.00 125.81 ? 134 ALA B CB  1 
ATOM   2780 N N   . GLY B 1 157 ? 99.044  98.804  -6.197  1.00 147.01 ? 135 GLY B N   1 
ATOM   2781 C CA  . GLY B 1 157 ? 99.822  100.029 -6.198  1.00 148.87 ? 135 GLY B CA  1 
ATOM   2782 C C   . GLY B 1 157 ? 101.106 99.794  -5.445  1.00 151.28 ? 135 GLY B C   1 
ATOM   2783 O O   . GLY B 1 157 ? 101.754 98.749  -5.585  1.00 154.50 ? 135 GLY B O   1 
ATOM   2784 N N   . ASP B 1 158 ? 101.450 100.736 -4.575  1.00 151.16 ? 136 ASP B N   1 
ATOM   2785 C CA  . ASP B 1 158 ? 102.682 100.668 -3.806  1.00 147.80 ? 136 ASP B CA  1 
ATOM   2786 C C   . ASP B 1 158 ? 102.406 100.435 -2.328  1.00 142.54 ? 136 ASP B C   1 
ATOM   2787 O O   . ASP B 1 158 ? 103.336 100.443 -1.513  1.00 137.97 ? 136 ASP B O   1 
ATOM   2788 C CB  . ASP B 1 158 ? 103.490 101.945 -4.031  1.00 147.07 ? 136 ASP B CB  1 
ATOM   2789 C CG  . ASP B 1 158 ? 103.448 102.397 -5.486  1.00 147.19 ? 136 ASP B CG  1 
ATOM   2790 O OD1 . ASP B 1 158 ? 103.331 101.519 -6.372  1.00 143.84 ? 136 ASP B OD1 1 
ATOM   2791 O OD2 . ASP B 1 158 ? 103.531 103.619 -5.749  1.00 147.58 ? 136 ASP B OD2 1 
ATOM   2792 N N   . ASP B 1 159 ? 101.141 100.217 -1.972  1.00 136.79 ? 137 ASP B N   1 
ATOM   2793 C CA  . ASP B 1 159 ? 100.707 100.114 -0.591  1.00 128.88 ? 137 ASP B CA  1 
ATOM   2794 C C   . ASP B 1 159 ? 100.621 98.683  -0.094  1.00 112.07 ? 137 ASP B C   1 
ATOM   2795 O O   . ASP B 1 159 ? 100.363 98.485  1.096   1.00 109.11 ? 137 ASP B O   1 
ATOM   2796 C CB  . ASP B 1 159 ? 99.341  100.802 -0.421  1.00 135.92 ? 137 ASP B CB  1 
ATOM   2797 C CG  . ASP B 1 159 ? 99.314  102.201 -1.029  1.00 153.19 ? 137 ASP B CG  1 
ATOM   2798 O OD1 . ASP B 1 159 ? 99.327  103.194 -0.264  1.00 156.93 ? 137 ASP B OD1 1 
ATOM   2799 O OD2 . ASP B 1 159 ? 99.295  102.314 -2.277  1.00 161.48 ? 137 ASP B OD2 1 
ATOM   2800 N N   . LYS B 1 160 ? 100.800 97.685  -0.973  1.00 107.26 ? 138 LYS B N   1 
ATOM   2801 C CA  . LYS B 1 160 ? 100.745 96.290  -0.540  1.00 101.76 ? 138 LYS B CA  1 
ATOM   2802 C C   . LYS B 1 160 ? 101.817 96.005  0.502   1.00 102.90 ? 138 LYS B C   1 
ATOM   2803 O O   . LYS B 1 160 ? 101.536 95.415  1.548   1.00 88.99  ? 138 LYS B O   1 
ATOM   2804 C CB  . LYS B 1 160 ? 100.882 95.326  -1.729  1.00 83.40  ? 138 LYS B CB  1 
ATOM   2805 C CG  . LYS B 1 160 ? 100.528 93.862  -1.348  1.00 80.31  ? 138 LYS B CG  1 
ATOM   2806 C CD  . LYS B 1 160 ? 100.283 92.950  -2.553  1.00 79.82  ? 138 LYS B CD  1 
ATOM   2807 N N   . LYS B 1 161 ? 103.072 96.377  0.185   1.00 117.75 ? 139 LYS B N   1 
ATOM   2808 C CA  . LYS B 1 161 ? 104.243 96.100  1.020   1.00 112.29 ? 139 LYS B CA  1 
ATOM   2809 C C   . LYS B 1 161 ? 104.002 96.445  2.489   1.00 111.76 ? 139 LYS B C   1 
ATOM   2810 O O   . LYS B 1 161 ? 104.305 95.647  3.377   1.00 108.98 ? 139 LYS B O   1 
ATOM   2811 C CB  . LYS B 1 161 ? 105.453 96.875  0.474   1.00 106.60 ? 139 LYS B CB  1 
ATOM   2812 N N   . GLY B 1 162 ? 103.437 97.632  2.752   1.00 116.35 ? 140 GLY B N   1 
ATOM   2813 C CA  . GLY B 1 162 ? 103.213 98.045  4.134   1.00 113.90 ? 140 GLY B CA  1 
ATOM   2814 C C   . GLY B 1 162 ? 102.058 97.322  4.804   1.00 103.81 ? 140 GLY B C   1 
ATOM   2815 O O   . GLY B 1 162 ? 102.116 97.017  5.997   1.00 102.73 ? 140 GLY B O   1 
ATOM   2816 N N   . ILE B 1 163 ? 100.995 97.039  4.053   1.00 103.58 ? 141 ILE B N   1 
ATOM   2817 C CA  . ILE B 1 163 ? 99.860  96.320  4.626   1.00 95.52  ? 141 ILE B CA  1 
ATOM   2818 C C   . ILE B 1 163 ? 100.242 94.888  4.978   1.00 96.17  ? 141 ILE B C   1 
ATOM   2819 O O   . ILE B 1 163 ? 99.744  94.331  5.968   1.00 97.00  ? 141 ILE B O   1 
ATOM   2820 C CB  . ILE B 1 163 ? 98.663  96.354  3.653   1.00 83.04  ? 141 ILE B CB  1 
ATOM   2821 C CG1 . ILE B 1 163 ? 98.120  97.775  3.495   1.00 77.24  ? 141 ILE B CG1 1 
ATOM   2822 C CG2 . ILE B 1 163 ? 97.577  95.384  4.085   1.00 81.89  ? 141 ILE B CG2 1 
ATOM   2823 C CD1 . ILE B 1 163 ? 97.159  97.930  2.323   1.00 83.70  ? 141 ILE B CD1 1 
ATOM   2824 N N   . VAL B 1 164 ? 101.146 94.275  4.206   1.00 93.48  ? 142 VAL B N   1 
ATOM   2825 C CA  . VAL B 1 164 ? 101.455 92.867  4.434   1.00 89.26  ? 142 VAL B CA  1 
ATOM   2826 C C   . VAL B 1 164 ? 102.289 92.690  5.691   1.00 97.32  ? 142 VAL B C   1 
ATOM   2827 O O   . VAL B 1 164 ? 102.003 91.820  6.524   1.00 105.17 ? 142 VAL B O   1 
ATOM   2828 C CB  . VAL B 1 164 ? 102.165 92.253  3.221   1.00 82.54  ? 142 VAL B CB  1 
ATOM   2829 C CG1 . VAL B 1 164 ? 102.724 90.892  3.607   1.00 73.62  ? 142 VAL B CG1 1 
ATOM   2830 C CG2 . VAL B 1 164 ? 101.212 92.148  2.042   1.00 94.06  ? 142 VAL B CG2 1 
ATOM   2831 N N   . ASP B 1 165 ? 103.344 93.492  5.851   1.00 96.57  ? 143 ASP B N   1 
ATOM   2832 C CA  . ASP B 1 165 ? 104.167 93.279  7.038   1.00 109.47 ? 143 ASP B CA  1 
ATOM   2833 C C   . ASP B 1 165 ? 103.408 93.667  8.303   1.00 105.09 ? 143 ASP B C   1 
ATOM   2834 O O   . ASP B 1 165 ? 103.647 93.083  9.371   1.00 102.91 ? 143 ASP B O   1 
ATOM   2835 C CB  . ASP B 1 165 ? 105.558 93.947  6.902   1.00 116.99 ? 143 ASP B CB  1 
ATOM   2836 C CG  . ASP B 1 165 ? 105.554 95.454  7.102   1.00 123.76 ? 143 ASP B CG  1 
ATOM   2837 O OD1 . ASP B 1 165 ? 104.496 96.061  7.356   1.00 126.72 ? 143 ASP B OD1 1 
ATOM   2838 O OD2 . ASP B 1 165 ? 106.656 96.041  6.987   1.00 127.35 ? 143 ASP B OD2 1 
ATOM   2839 N N   . GLN B 1 166 ? 102.459 94.605  8.222   1.00 102.43 ? 144 GLN B N   1 
ATOM   2840 C CA  . GLN B 1 166 ? 101.740 94.891  9.454   1.00 98.21  ? 144 GLN B CA  1 
ATOM   2841 C C   . GLN B 1 166 ? 100.804 93.753  9.831   1.00 87.96  ? 144 GLN B C   1 
ATOM   2842 O O   . GLN B 1 166 ? 100.592 93.500  11.021  1.00 85.49  ? 144 GLN B O   1 
ATOM   2843 C CB  . GLN B 1 166 ? 100.991 96.217  9.391   1.00 94.92  ? 144 GLN B CB  1 
ATOM   2844 C CG  . GLN B 1 166 ? 100.359 96.485  10.748  1.00 100.06 ? 144 GLN B CG  1 
ATOM   2845 C CD  . GLN B 1 166 ? 100.338 97.938  11.130  1.00 108.53 ? 144 GLN B CD  1 
ATOM   2846 O OE1 . GLN B 1 166 ? 100.432 98.814  10.271  1.00 111.78 ? 144 GLN B OE1 1 
ATOM   2847 N NE2 . GLN B 1 166 ? 100.251 98.208  12.442  1.00 105.31 ? 144 GLN B NE2 1 
ATOM   2848 N N   . SER B 1 167 ? 100.297 93.015  8.845   1.00 85.08  ? 145 SER B N   1 
ATOM   2849 C CA  . SER B 1 167 ? 99.566  91.789  9.166   1.00 90.41  ? 145 SER B CA  1 
ATOM   2850 C C   . SER B 1 167 ? 100.499 90.734  9.759   1.00 96.68  ? 145 SER B C   1 
ATOM   2851 O O   . SER B 1 167 ? 100.092 89.943  10.618  1.00 97.25  ? 145 SER B O   1 
ATOM   2852 C CB  . SER B 1 167 ? 98.861  91.232  7.931   1.00 89.78  ? 145 SER B CB  1 
ATOM   2853 O OG  . SER B 1 167 ? 98.700  89.832  8.045   1.00 95.16  ? 145 SER B OG  1 
ATOM   2854 N N   . GLN B 1 168 ? 101.745 90.681  9.291   1.00 99.44  ? 146 GLN B N   1 
ATOM   2855 C CA  . GLN B 1 168 ? 102.654 89.672  9.818   1.00 104.45 ? 146 GLN B CA  1 
ATOM   2856 C C   . GLN B 1 168 ? 103.159 90.030  11.213  1.00 110.71 ? 146 GLN B C   1 
ATOM   2857 O O   . GLN B 1 168 ? 103.401 89.130  12.028  1.00 112.34 ? 146 GLN B O   1 
ATOM   2858 C CB  . GLN B 1 168 ? 103.837 89.485  8.874   1.00 108.69 ? 146 GLN B CB  1 
ATOM   2859 C CG  . GLN B 1 168 ? 104.735 88.328  9.240   1.00 112.57 ? 146 GLN B CG  1 
ATOM   2860 C CD  . GLN B 1 168 ? 105.874 88.150  8.263   1.00 118.17 ? 146 GLN B CD  1 
ATOM   2861 O OE1 . GLN B 1 168 ? 106.062 88.963  7.356   1.00 114.92 ? 146 GLN B OE1 1 
ATOM   2862 N NE2 . GLN B 1 168 ? 106.646 87.081  8.441   1.00 123.40 ? 146 GLN B NE2 1 
ATOM   2863 N N   . GLN B 1 169 ? 103.306 91.324  11.518  1.00 108.88 ? 147 GLN B N   1 
ATOM   2864 C CA  . GLN B 1 169 ? 103.752 91.710  12.853  1.00 104.09 ? 147 GLN B CA  1 
ATOM   2865 C C   . GLN B 1 169 ? 102.654 91.495  13.887  1.00 105.97 ? 147 GLN B C   1 
ATOM   2866 O O   . GLN B 1 169 ? 102.953 91.261  15.066  1.00 108.37 ? 147 GLN B O   1 
ATOM   2867 C CB  . GLN B 1 169 ? 104.217 93.170  12.861  1.00 103.37 ? 147 GLN B CB  1 
ATOM   2868 N N   . ALA B 1 170 ? 101.383 91.557  13.468  1.00 98.50  ? 148 ALA B N   1 
ATOM   2869 C CA  . ALA B 1 170 ? 100.294 91.179  14.363  1.00 81.24  ? 148 ALA B CA  1 
ATOM   2870 C C   . ALA B 1 170 ? 100.294 89.679  14.612  1.00 75.08  ? 148 ALA B C   1 
ATOM   2871 O O   . ALA B 1 170 ? 100.198 89.230  15.757  1.00 80.35  ? 148 ALA B O   1 
ATOM   2872 C CB  . ALA B 1 170 ? 98.947  91.620  13.791  1.00 73.00  ? 148 ALA B CB  1 
ATOM   2873 N N   . TYR B 1 171 ? 100.378 88.888  13.544  1.00 63.94  ? 149 TYR B N   1 
ATOM   2874 C CA  . TYR B 1 171 ? 100.407 87.438  13.698  1.00 76.16  ? 149 TYR B CA  1 
ATOM   2875 C C   . TYR B 1 171 ? 101.600 86.997  14.539  1.00 86.62  ? 149 TYR B C   1 
ATOM   2876 O O   . TYR B 1 171 ? 101.469 86.148  15.428  1.00 90.91  ? 149 TYR B O   1 
ATOM   2877 C CB  . TYR B 1 171 ? 100.467 86.770  12.329  1.00 78.85  ? 149 TYR B CB  1 
ATOM   2878 C CG  . TYR B 1 171 ? 99.166  86.662  11.560  1.00 87.59  ? 149 TYR B CG  1 
ATOM   2879 C CD1 . TYR B 1 171 ? 97.976  86.273  12.179  1.00 88.46  ? 149 TYR B CD1 1 
ATOM   2880 C CD2 . TYR B 1 171 ? 99.138  86.940  10.196  1.00 94.96  ? 149 TYR B CD2 1 
ATOM   2881 C CE1 . TYR B 1 171 ? 96.790  86.166  11.452  1.00 88.30  ? 149 TYR B CE1 1 
ATOM   2882 C CE2 . TYR B 1 171 ? 97.973  86.846  9.469   1.00 97.18  ? 149 TYR B CE2 1 
ATOM   2883 C CZ  . TYR B 1 171 ? 96.799  86.457  10.092  1.00 91.63  ? 149 TYR B CZ  1 
ATOM   2884 O OH  . TYR B 1 171 ? 95.658  86.362  9.330   1.00 84.44  ? 149 TYR B OH  1 
ATOM   2885 N N   . GLN B 1 172 ? 102.782 87.567  14.280  1.00 93.01  ? 150 GLN B N   1 
ATOM   2886 C CA  . GLN B 1 172 ? 103.965 87.013  14.920  1.00 95.86  ? 150 GLN B CA  1 
ATOM   2887 C C   . GLN B 1 172 ? 103.984 87.365  16.396  1.00 93.74  ? 150 GLN B C   1 
ATOM   2888 O O   . GLN B 1 172 ? 104.434 86.556  17.212  1.00 96.94  ? 150 GLN B O   1 
ATOM   2889 C CB  . GLN B 1 172 ? 105.246 87.517  14.236  1.00 101.24 ? 150 GLN B CB  1 
ATOM   2890 C CG  . GLN B 1 172 ? 106.539 86.795  14.674  1.00 95.41  ? 150 GLN B CG  1 
ATOM   2891 C CD  . GLN B 1 172 ? 106.848 85.561  13.832  1.00 96.77  ? 150 GLN B CD  1 
ATOM   2892 O OE1 . GLN B 1 172 ? 106.805 85.601  12.595  1.00 94.72  ? 150 GLN B OE1 1 
ATOM   2893 N NE2 . GLN B 1 172 ? 107.113 84.444  14.502  1.00 96.03  ? 150 GLN B NE2 1 
ATOM   2894 N N   . GLU B 1 173 ? 103.419 88.518  16.767  1.00 84.69  ? 151 GLU B N   1 
ATOM   2895 C CA  . GLU B 1 173 ? 103.326 88.853  18.183  1.00 93.44  ? 151 GLU B CA  1 
ATOM   2896 C C   . GLU B 1 173 ? 102.379 87.901  18.890  1.00 95.29  ? 151 GLU B C   1 
ATOM   2897 O O   . GLU B 1 173 ? 102.732 87.281  19.899  1.00 100.01 ? 151 GLU B O   1 
ATOM   2898 C CB  . GLU B 1 173 ? 102.851 90.293  18.361  1.00 93.28  ? 151 GLU B CB  1 
ATOM   2899 C CG  . GLU B 1 173 ? 102.794 90.735  19.813  1.00 102.54 ? 151 GLU B CG  1 
ATOM   2900 C CD  . GLU B 1 173 ? 102.410 92.196  19.957  1.00 112.35 ? 151 GLU B CD  1 
ATOM   2901 O OE1 . GLU B 1 173 ? 102.233 92.865  18.917  1.00 110.78 ? 151 GLU B OE1 1 
ATOM   2902 O OE2 . GLU B 1 173 ? 102.306 92.682  21.105  1.00 117.58 ? 151 GLU B OE2 1 
ATOM   2903 N N   . ALA B 1 174 ? 101.185 87.735  18.333  1.00 90.87  ? 152 ALA B N   1 
ATOM   2904 C CA  . ALA B 1 174 ? 100.226 86.805  18.906  1.00 90.68  ? 152 ALA B CA  1 
ATOM   2905 C C   . ALA B 1 174 ? 100.788 85.387  18.943  1.00 93.50  ? 152 ALA B C   1 
ATOM   2906 O O   . ALA B 1 174 ? 100.538 84.638  19.897  1.00 94.80  ? 152 ALA B O   1 
ATOM   2907 C CB  . ALA B 1 174 ? 98.917  86.873  18.116  1.00 79.68  ? 152 ALA B CB  1 
ATOM   2908 N N   . PHE B 1 175 ? 101.542 84.998  17.907  1.00 87.56  ? 153 PHE B N   1 
ATOM   2909 C CA  . PHE B 1 175 ? 102.119 83.656  17.864  1.00 86.08  ? 153 PHE B CA  1 
ATOM   2910 C C   . PHE B 1 175 ? 103.074 83.423  19.027  1.00 92.70  ? 153 PHE B C   1 
ATOM   2911 O O   . PHE B 1 175 ? 103.055 82.353  19.649  1.00 89.28  ? 153 PHE B O   1 
ATOM   2912 C CB  . PHE B 1 175 ? 102.813 83.425  16.514  1.00 91.24  ? 153 PHE B CB  1 
ATOM   2913 C CG  . PHE B 1 175 ? 103.376 82.026  16.334  1.00 98.52  ? 153 PHE B CG  1 
ATOM   2914 C CD1 . PHE B 1 175 ? 104.630 81.695  16.827  1.00 99.89  ? 153 PHE B CD1 1 
ATOM   2915 C CD2 . PHE B 1 175 ? 102.640 81.038  15.698  1.00 101.57 ? 153 PHE B CD2 1 
ATOM   2916 C CE1 . PHE B 1 175 ? 105.145 80.418  16.676  1.00 100.34 ? 153 PHE B CE1 1 
ATOM   2917 C CE2 . PHE B 1 175 ? 103.155 79.753  15.541  1.00 99.18  ? 153 PHE B CE2 1 
ATOM   2918 C CZ  . PHE B 1 175 ? 104.406 79.446  16.030  1.00 99.97  ? 153 PHE B CZ  1 
ATOM   2919 N N   . GLU B 1 176 ? 103.923 84.406  19.328  1.00 99.64  ? 154 GLU B N   1 
ATOM   2920 C CA  . GLU B 1 176 ? 104.919 84.219  20.375  1.00 106.43 ? 154 GLU B CA  1 
ATOM   2921 C C   . GLU B 1 176 ? 104.259 84.098  21.740  1.00 99.91  ? 154 GLU B C   1 
ATOM   2922 O O   . GLU B 1 176 ? 104.658 83.256  22.557  1.00 106.10 ? 154 GLU B O   1 
ATOM   2923 C CB  . GLU B 1 176 ? 105.916 85.371  20.355  1.00 117.13 ? 154 GLU B CB  1 
ATOM   2924 C CG  . GLU B 1 176 ? 106.709 85.465  19.074  1.00 128.70 ? 154 GLU B CG  1 
ATOM   2925 C CD  . GLU B 1 176 ? 107.521 86.737  19.004  1.00 141.56 ? 154 GLU B CD  1 
ATOM   2926 O OE1 . GLU B 1 176 ? 107.344 87.601  19.890  1.00 148.98 ? 154 GLU B OE1 1 
ATOM   2927 O OE2 . GLU B 1 176 ? 108.339 86.869  18.068  1.00 142.55 ? 154 GLU B OE2 1 
ATOM   2928 N N   . ILE B 1 177 ? 103.247 84.931  22.008  1.00 84.93  ? 155 ILE B N   1 
ATOM   2929 C CA  . ILE B 1 177 ? 102.520 84.817  23.268  1.00 83.32  ? 155 ILE B CA  1 
ATOM   2930 C C   . ILE B 1 177 ? 101.853 83.444  23.370  1.00 92.90  ? 155 ILE B C   1 
ATOM   2931 O O   . ILE B 1 177 ? 101.720 82.886  24.466  1.00 95.70  ? 155 ILE B O   1 
ATOM   2932 C CB  . ILE B 1 177 ? 101.485 85.951  23.414  1.00 78.18  ? 155 ILE B CB  1 
ATOM   2933 C CG1 . ILE B 1 177 ? 102.131 87.329  23.329  1.00 81.87  ? 155 ILE B CG1 1 
ATOM   2934 C CG2 . ILE B 1 177 ? 100.787 85.835  24.741  1.00 78.55  ? 155 ILE B CG2 1 
ATOM   2935 C CD1 . ILE B 1 177 ? 101.443 88.276  22.370  1.00 80.09  ? 155 ILE B CD1 1 
ATOM   2936 N N   . SER B 1 178 ? 101.420 82.882  22.233  1.00 93.63  ? 156 SER B N   1 
ATOM   2937 C CA  . SER B 1 178 ? 100.684 81.617  22.228  1.00 94.18  ? 156 SER B CA  1 
ATOM   2938 C C   . SER B 1 178 ? 101.607 80.426  22.476  1.00 100.12 ? 156 SER B C   1 
ATOM   2939 O O   . SER B 1 178 ? 101.269 79.518  23.240  1.00 102.46 ? 156 SER B O   1 
ATOM   2940 C CB  . SER B 1 178 ? 99.963  81.428  20.890  1.00 90.63  ? 156 SER B CB  1 
ATOM   2941 O OG  . SER B 1 178 ? 99.339  82.625  20.455  1.00 96.76  ? 156 SER B OG  1 
ATOM   2942 N N   . LYS B 1 179 ? 102.761 80.393  21.799  1.00 100.35 ? 157 LYS B N   1 
ATOM   2943 C CA  . LYS B 1 179 ? 103.763 79.370  22.081  1.00 87.19  ? 157 LYS B CA  1 
ATOM   2944 C C   . LYS B 1 179 ? 104.210 79.428  23.537  1.00 87.16  ? 157 LYS B C   1 
ATOM   2945 O O   . LYS B 1 179 ? 104.526 78.386  24.132  1.00 80.97  ? 157 LYS B O   1 
ATOM   2946 C CB  . LYS B 1 179 ? 104.946 79.529  21.126  1.00 86.32  ? 157 LYS B CB  1 
ATOM   2947 N N   . LYS B 1 180 ? 104.234 80.635  24.127  1.00 88.82  ? 158 LYS B N   1 
ATOM   2948 C CA  . LYS B 1 180 ? 104.630 80.813  25.524  1.00 92.69  ? 158 LYS B CA  1 
ATOM   2949 C C   . LYS B 1 180 ? 103.478 80.524  26.492  1.00 100.19 ? 158 LYS B C   1 
ATOM   2950 O O   . LYS B 1 180 ? 103.601 79.666  27.371  1.00 97.81  ? 158 LYS B O   1 
ATOM   2951 C CB  . LYS B 1 180 ? 105.162 82.234  25.745  1.00 92.07  ? 158 LYS B CB  1 
ATOM   2952 C CG  . LYS B 1 180 ? 105.750 82.490  27.142  1.00 97.69  ? 158 LYS B CG  1 
ATOM   2953 N N   . GLU B 1 181 ? 102.328 81.181  26.310  1.00 107.93 ? 159 GLU B N   1 
ATOM   2954 C CA  . GLU B 1 181 ? 101.286 81.232  27.336  1.00 113.13 ? 159 GLU B CA  1 
ATOM   2955 C C   . GLU B 1 181 ? 100.102 80.280  27.114  1.00 115.23 ? 159 GLU B C   1 
ATOM   2956 O O   . GLU B 1 181 ? 99.186  80.274  27.943  1.00 116.08 ? 159 GLU B O   1 
ATOM   2957 C CB  . GLU B 1 181 ? 100.761 82.670  27.473  1.00 108.02 ? 159 GLU B CB  1 
ATOM   2958 N N   . MET B 1 182 ? 100.087 79.473  26.047  1.00 114.60 ? 160 MET B N   1 
ATOM   2959 C CA  . MET B 1 182 ? 98.969  78.566  25.782  1.00 107.66 ? 160 MET B CA  1 
ATOM   2960 C C   . MET B 1 182 ? 99.448  77.189  25.346  1.00 103.79 ? 160 MET B C   1 
ATOM   2961 O O   . MET B 1 182 ? 100.520 77.045  24.756  1.00 115.33 ? 160 MET B O   1 
ATOM   2962 C CB  . MET B 1 182 ? 98.032  79.086  24.692  1.00 105.75 ? 160 MET B CB  1 
ATOM   2963 C CG  . MET B 1 182 ? 97.399  80.411  24.954  1.00 110.53 ? 160 MET B CG  1 
ATOM   2964 S SD  . MET B 1 182 ? 96.186  80.721  23.665  1.00 116.65 ? 160 MET B SD  1 
ATOM   2965 C CE  . MET B 1 182 ? 96.183  82.484  23.684  1.00 115.86 ? 160 MET B CE  1 
ATOM   2966 N N   . GLN B 1 183 ? 98.578  76.142  25.609  1.00 93.53  ? 161 GLN B N   1 
ATOM   2967 C CA  . GLN B 1 183 ? 98.847  74.746  25.294  1.00 99.14  ? 161 GLN B CA  1 
ATOM   2968 C C   . GLN B 1 183 ? 98.506  74.434  23.836  1.00 103.80 ? 161 GLN B C   1 
ATOM   2969 O O   . GLN B 1 183 ? 97.636  75.088  23.242  1.00 103.50 ? 161 GLN B O   1 
ATOM   2970 C CB  . GLN B 1 183 ? 98.054  73.834  26.226  1.00 104.08 ? 161 GLN B CB  1 
ATOM   2971 C CG  . GLN B 1 183 ? 96.738  74.430  26.695  1.00 108.81 ? 161 GLN B CG  1 
ATOM   2972 C CD  . GLN B 1 183 ? 95.960  73.505  27.622  1.00 120.06 ? 161 GLN B CD  1 
ATOM   2973 O OE1 . GLN B 1 183 ? 96.538  72.714  28.377  1.00 124.36 ? 161 GLN B OE1 1 
ATOM   2974 N NE2 . GLN B 1 183 ? 94.637  73.606  27.570  1.00 122.58 ? 161 GLN B NE2 1 
ATOM   2975 N N   . PRO B 1 184 ? 99.173  73.439  23.235  1.00 100.97 ? 162 PRO B N   1 
ATOM   2976 C CA  . PRO B 1 184 ? 99.051  73.235  21.781  1.00 98.05  ? 162 PRO B CA  1 
ATOM   2977 C C   . PRO B 1 184 ? 97.661  72.856  21.324  1.00 93.05  ? 162 PRO B C   1 
ATOM   2978 O O   . PRO B 1 184 ? 97.429  72.802  20.109  1.00 96.76  ? 162 PRO B O   1 
ATOM   2979 C CB  . PRO B 1 184 ? 100.043 72.099  21.496  1.00 95.91  ? 162 PRO B CB  1 
ATOM   2980 C CG  . PRO B 1 184 ? 100.206 71.412  22.781  1.00 92.15  ? 162 PRO B CG  1 
ATOM   2981 C CD  . PRO B 1 184 ? 100.091 72.459  23.835  1.00 94.25  ? 162 PRO B CD  1 
ATOM   2982 N N   . THR B 1 185 ? 96.748  72.548  22.243  1.00 86.46  ? 163 THR B N   1 
ATOM   2983 C CA  . THR B 1 185 ? 95.377  72.195  21.899  1.00 90.23  ? 163 THR B CA  1 
ATOM   2984 C C   . THR B 1 185 ? 94.385  73.341  22.062  1.00 94.76  ? 163 THR B C   1 
ATOM   2985 O O   . THR B 1 185 ? 93.242  73.202  21.615  1.00 103.82 ? 163 THR B O   1 
ATOM   2986 C CB  . THR B 1 185 ? 94.907  70.969  22.695  1.00 98.27  ? 163 THR B CB  1 
ATOM   2987 O OG1 . THR B 1 185 ? 94.543  71.351  24.027  1.00 108.98 ? 163 THR B OG1 1 
ATOM   2988 C CG2 . THR B 1 185 ? 95.952  69.869  22.681  1.00 98.57  ? 163 THR B CG2 1 
ATOM   2989 N N   . HIS B 1 186 ? 94.779  74.453  22.685  1.00 93.66  ? 164 HIS B N   1 
ATOM   2990 C CA  . HIS B 1 186 ? 93.844  75.551  22.910  1.00 90.10  ? 164 HIS B CA  1 
ATOM   2991 C C   . HIS B 1 186 ? 93.277  76.004  21.555  1.00 90.93  ? 164 HIS B C   1 
ATOM   2992 O O   . HIS B 1 186 ? 94.046  76.240  20.619  1.00 73.29  ? 164 HIS B O   1 
ATOM   2993 C CB  . HIS B 1 186 ? 94.549  76.714  23.610  1.00 83.36  ? 164 HIS B CB  1 
ATOM   2994 C CG  . HIS B 1 186 ? 93.621  77.748  24.176  1.00 95.42  ? 164 HIS B CG  1 
ATOM   2995 N ND1 . HIS B 1 186 ? 92.932  78.645  23.389  1.00 96.18  ? 164 HIS B ND1 1 
ATOM   2996 C CD2 . HIS B 1 186 ? 93.273  78.030  25.456  1.00 101.52 ? 164 HIS B CD2 1 
ATOM   2997 C CE1 . HIS B 1 186 ? 92.211  79.442  24.158  1.00 95.78  ? 164 HIS B CE1 1 
ATOM   2998 N NE2 . HIS B 1 186 ? 92.397  79.088  25.417  1.00 99.13  ? 164 HIS B NE2 1 
ATOM   2999 N N   . PRO B 1 187 ? 91.946  76.078  21.423  1.00 93.36  ? 165 PRO B N   1 
ATOM   3000 C CA  . PRO B 1 187 ? 91.385  76.446  20.105  1.00 87.02  ? 165 PRO B CA  1 
ATOM   3001 C C   . PRO B 1 187 ? 91.918  77.760  19.565  1.00 83.69  ? 165 PRO B C   1 
ATOM   3002 O O   . PRO B 1 187 ? 92.032  77.919  18.344  1.00 83.66  ? 165 PRO B O   1 
ATOM   3003 C CB  . PRO B 1 187 ? 89.872  76.512  20.379  1.00 81.31  ? 165 PRO B CB  1 
ATOM   3004 C CG  . PRO B 1 187 ? 89.726  76.481  21.871  1.00 84.93  ? 165 PRO B CG  1 
ATOM   3005 C CD  . PRO B 1 187 ? 90.901  75.747  22.397  1.00 86.47  ? 165 PRO B CD  1 
ATOM   3006 N N   . ILE B 1 188 ? 92.280  78.701  20.433  1.00 82.47  ? 166 ILE B N   1 
ATOM   3007 C CA  . ILE B 1 188 ? 92.757  79.981  19.934  1.00 79.75  ? 166 ILE B CA  1 
ATOM   3008 C C   . ILE B 1 188 ? 94.202  79.865  19.464  1.00 85.97  ? 166 ILE B C   1 
ATOM   3009 O O   . ILE B 1 188 ? 94.623  80.591  18.553  1.00 90.76  ? 166 ILE B O   1 
ATOM   3010 C CB  . ILE B 1 188 ? 92.579  81.080  20.988  1.00 79.28  ? 166 ILE B CB  1 
ATOM   3011 C CG1 . ILE B 1 188 ? 91.090  81.342  21.221  1.00 87.57  ? 166 ILE B CG1 1 
ATOM   3012 C CG2 . ILE B 1 188 ? 93.168  82.378  20.481  1.00 72.11  ? 166 ILE B CG2 1 
ATOM   3013 C CD1 . ILE B 1 188 ? 90.805  82.480  22.196  1.00 95.24  ? 166 ILE B CD1 1 
ATOM   3014 N N   . ARG B 1 189 ? 94.992  78.966  20.056  1.00 85.60  ? 167 ARG B N   1 
ATOM   3015 C CA  . ARG B 1 189 ? 96.348  78.803  19.545  1.00 80.54  ? 167 ARG B CA  1 
ATOM   3016 C C   . ARG B 1 189 ? 96.367  77.982  18.260  1.00 72.33  ? 167 ARG B C   1 
ATOM   3017 O O   . ARG B 1 189 ? 97.183  78.250  17.381  1.00 81.07  ? 167 ARG B O   1 
ATOM   3018 C CB  . ARG B 1 189 ? 97.262  78.174  20.600  1.00 88.01  ? 167 ARG B CB  1 
ATOM   3019 C CG  . ARG B 1 189 ? 98.670  77.946  20.080  1.00 90.62  ? 167 ARG B CG  1 
ATOM   3020 C CD  . ARG B 1 189 ? 99.598  77.409  21.140  1.00 104.20 ? 167 ARG B CD  1 
ATOM   3021 N NE  . ARG B 1 189 ? 100.608 76.543  20.539  1.00 109.65 ? 167 ARG B NE  1 
ATOM   3022 C CZ  . ARG B 1 189 ? 101.603 75.979  21.209  1.00 105.00 ? 167 ARG B CZ  1 
ATOM   3023 N NH1 . ARG B 1 189 ? 101.715 76.198  22.508  1.00 96.08  ? 167 ARG B NH1 1 
ATOM   3024 N NH2 . ARG B 1 189 ? 102.477 75.195  20.580  1.00 105.56 ? 167 ARG B NH2 1 
ATOM   3025 N N   . LEU B 1 190 ? 95.466  77.010  18.102  1.00 79.26  ? 168 LEU B N   1 
ATOM   3026 C CA  . LEU B 1 190 ? 95.401  76.299  16.827  1.00 81.37  ? 168 LEU B CA  1 
ATOM   3027 C C   . LEU B 1 190 ? 94.713  77.140  15.761  1.00 83.98  ? 168 LEU B C   1 
ATOM   3028 O O   . LEU B 1 190 ? 94.928  76.924  14.560  1.00 84.43  ? 168 LEU B O   1 
ATOM   3029 C CB  . LEU B 1 190 ? 94.653  74.974  16.958  1.00 77.04  ? 168 LEU B CB  1 
ATOM   3030 C CG  . LEU B 1 190 ? 95.163  73.827  17.814  1.00 80.54  ? 168 LEU B CG  1 
ATOM   3031 C CD1 . LEU B 1 190 ? 94.008  73.236  18.596  1.00 76.92  ? 168 LEU B CD1 1 
ATOM   3032 C CD2 . LEU B 1 190 ? 95.807  72.778  16.942  1.00 88.08  ? 168 LEU B CD2 1 
ATOM   3033 N N   . GLY B 1 191 ? 93.861  78.077  16.166  1.00 78.95  ? 169 GLY B N   1 
ATOM   3034 C CA  . GLY B 1 191 ? 93.322  79.008  15.200  1.00 74.23  ? 169 GLY B CA  1 
ATOM   3035 C C   . GLY B 1 191 ? 94.385  79.939  14.642  1.00 77.86  ? 169 GLY B C   1 
ATOM   3036 O O   . GLY B 1 191 ? 94.410  80.212  13.435  1.00 78.99  ? 169 GLY B O   1 
ATOM   3037 N N   . LEU B 1 192 ? 95.313  80.388  15.498  1.00 76.27  ? 170 LEU B N   1 
ATOM   3038 C CA  . LEU B 1 192 ? 96.392  81.254  15.016  1.00 79.21  ? 170 LEU B CA  1 
ATOM   3039 C C   . LEU B 1 192 ? 97.338  80.501  14.083  1.00 71.38  ? 170 LEU B C   1 
ATOM   3040 O O   . LEU B 1 192 ? 97.758  81.033  13.048  1.00 61.69  ? 170 LEU B O   1 
ATOM   3041 C CB  . LEU B 1 192 ? 97.170  81.834  16.189  1.00 86.13  ? 170 LEU B CB  1 
ATOM   3042 C CG  . LEU B 1 192 ? 98.274  82.839  15.835  1.00 87.70  ? 170 LEU B CG  1 
ATOM   3043 C CD1 . LEU B 1 192 ? 97.906  83.773  14.687  1.00 83.02  ? 170 LEU B CD1 1 
ATOM   3044 C CD2 . LEU B 1 192 ? 98.688  83.617  17.064  1.00 94.23  ? 170 LEU B CD2 1 
ATOM   3045 N N   . ALA B 1 193 ? 97.650  79.252  14.405  1.00 65.20  ? 171 ALA B N   1 
ATOM   3046 C CA  . ALA B 1 193 ? 98.471  78.460  13.505  1.00 67.50  ? 171 ALA B CA  1 
ATOM   3047 C C   . ALA B 1 193 ? 97.800  78.294  12.150  1.00 69.92  ? 171 ALA B C   1 
ATOM   3048 O O   . ALA B 1 193 ? 98.420  78.499  11.106  1.00 78.12  ? 171 ALA B O   1 
ATOM   3049 C CB  . ALA B 1 193 ? 98.755  77.108  14.133  1.00 75.28  ? 171 ALA B CB  1 
ATOM   3050 N N   . LEU B 1 194 ? 96.517  77.954  12.144  1.00 76.54  ? 172 LEU B N   1 
ATOM   3051 C CA  . LEU B 1 194 ? 95.828  77.719  10.880  1.00 72.76  ? 172 LEU B CA  1 
ATOM   3052 C C   . LEU B 1 194 ? 95.822  78.968  10.007  1.00 72.09  ? 172 LEU B C   1 
ATOM   3053 O O   . LEU B 1 194 ? 96.097  78.900  8.807   1.00 79.08  ? 172 LEU B O   1 
ATOM   3054 C CB  . LEU B 1 194 ? 94.407  77.256  11.153  1.00 69.41  ? 172 LEU B CB  1 
ATOM   3055 C CG  . LEU B 1 194 ? 93.608  77.019  9.889   1.00 68.90  ? 172 LEU B CG  1 
ATOM   3056 C CD1 . LEU B 1 194 ? 94.030  75.662  9.339   1.00 69.75  ? 172 LEU B CD1 1 
ATOM   3057 C CD2 . LEU B 1 194 ? 92.090  77.094  10.186  1.00 62.79  ? 172 LEU B CD2 1 
ATOM   3058 N N   . ASN B 1 195 ? 95.503  80.122  10.600  1.00 69.48  ? 173 ASN B N   1 
ATOM   3059 C CA  . ASN B 1 195 ? 95.423  81.362  9.829   1.00 76.82  ? 173 ASN B CA  1 
ATOM   3060 C C   . ASN B 1 195 ? 96.801  81.894  9.436   1.00 79.02  ? 173 ASN B C   1 
ATOM   3061 O O   . ASN B 1 195 ? 96.968  82.450  8.347   1.00 79.93  ? 173 ASN B O   1 
ATOM   3062 C CB  . ASN B 1 195 ? 94.662  82.424  10.623  1.00 83.57  ? 173 ASN B CB  1 
ATOM   3063 C CG  . ASN B 1 195 ? 93.163  82.194  10.638  1.00 81.84  ? 173 ASN B CG  1 
ATOM   3064 O OD1 . ASN B 1 195 ? 92.682  81.075  10.456  1.00 87.89  ? 173 ASN B OD1 1 
ATOM   3065 N ND2 . ASN B 1 195 ? 92.416  83.266  10.855  1.00 67.96  ? 173 ASN B ND2 1 
ATOM   3066 N N   . PHE B 1 196 ? 97.783  81.803  10.337  1.00 84.47  ? 174 PHE B N   1 
ATOM   3067 C CA  . PHE B 1 196 ? 99.141  82.239  10.013  1.00 78.91  ? 174 PHE B CA  1 
ATOM   3068 C C   . PHE B 1 196 ? 99.732  81.380  8.905   1.00 74.13  ? 174 PHE B C   1 
ATOM   3069 O O   . PHE B 1 196 ? 100.256 81.894  7.906   1.00 68.81  ? 174 PHE B O   1 
ATOM   3070 C CB  . PHE B 1 196 ? 100.013 82.179  11.267  1.00 83.11  ? 174 PHE B CB  1 
ATOM   3071 C CG  . PHE B 1 196 ? 101.134 83.158  11.274  1.00 94.94  ? 174 PHE B CG  1 
ATOM   3072 C CD1 . PHE B 1 196 ? 101.331 84.013  10.209  1.00 103.04 ? 174 PHE B CD1 1 
ATOM   3073 C CD2 . PHE B 1 196 ? 102.013 83.208  12.338  1.00 99.19  ? 174 PHE B CD2 1 
ATOM   3074 C CE1 . PHE B 1 196 ? 102.395 84.910  10.208  1.00 106.54 ? 174 PHE B CE1 1 
ATOM   3075 C CE2 . PHE B 1 196 ? 103.066 84.103  12.346  1.00 99.04  ? 174 PHE B CE2 1 
ATOM   3076 C CZ  . PHE B 1 196 ? 103.257 84.957  11.283  1.00 99.63  ? 174 PHE B CZ  1 
ATOM   3077 N N   . SER B 1 197 ? 99.595  80.059  9.051   1.00 69.96  ? 175 SER B N   1 
ATOM   3078 C CA  . SER B 1 197 ? 100.001 79.120  8.017   1.00 75.16  ? 175 SER B CA  1 
ATOM   3079 C C   . SER B 1 197 ? 99.413  79.508  6.662   1.00 81.04  ? 175 SER B C   1 
ATOM   3080 O O   . SER B 1 197 ? 100.106 79.453  5.640   1.00 79.45  ? 175 SER B O   1 
ATOM   3081 C CB  . SER B 1 197 ? 99.594  77.712  8.466   1.00 83.97  ? 175 SER B CB  1 
ATOM   3082 O OG  . SER B 1 197 ? 99.557  76.765  7.426   1.00 104.50 ? 175 SER B OG  1 
ATOM   3083 N N   . VAL B 1 198 ? 98.155  79.960  6.645   1.00 91.91  ? 176 VAL B N   1 
ATOM   3084 C CA  . VAL B 1 198 ? 97.525  80.405  5.402   1.00 83.67  ? 176 VAL B CA  1 
ATOM   3085 C C   . VAL B 1 198 ? 98.115  81.736  4.938   1.00 82.62  ? 176 VAL B C   1 
ATOM   3086 O O   . VAL B 1 198 ? 98.251  81.976  3.731   1.00 88.35  ? 176 VAL B O   1 
ATOM   3087 C CB  . VAL B 1 198 ? 95.998  80.474  5.578   1.00 72.75  ? 176 VAL B CB  1 
ATOM   3088 C CG1 . VAL B 1 198 ? 95.357  81.296  4.474   1.00 71.72  ? 176 VAL B CG1 1 
ATOM   3089 C CG2 . VAL B 1 198 ? 95.425  79.067  5.587   1.00 72.62  ? 176 VAL B CG2 1 
ATOM   3090 N N   . PHE B 1 199 ? 98.477  82.620  5.877   1.00 84.05  ? 177 PHE B N   1 
ATOM   3091 C CA  . PHE B 1 199 ? 99.149  83.866  5.503   1.00 83.45  ? 177 PHE B CA  1 
ATOM   3092 C C   . PHE B 1 199 ? 100.440 83.582  4.753   1.00 93.59  ? 177 PHE B C   1 
ATOM   3093 O O   . PHE B 1 199 ? 100.711 84.185  3.707   1.00 100.44 ? 177 PHE B O   1 
ATOM   3094 C CB  . PHE B 1 199 ? 99.452  84.713  6.733   1.00 74.19  ? 177 PHE B CB  1 
ATOM   3095 C CG  . PHE B 1 199 ? 100.177 85.993  6.422   1.00 71.74  ? 177 PHE B CG  1 
ATOM   3096 C CD1 . PHE B 1 199 ? 99.489  87.086  5.902   1.00 78.61  ? 177 PHE B CD1 1 
ATOM   3097 C CD2 . PHE B 1 199 ? 101.536 86.122  6.655   1.00 67.68  ? 177 PHE B CD2 1 
ATOM   3098 C CE1 . PHE B 1 199 ? 100.159 88.291  5.618   1.00 81.41  ? 177 PHE B CE1 1 
ATOM   3099 C CE2 . PHE B 1 199 ? 102.197 87.320  6.377   1.00 66.33  ? 177 PHE B CE2 1 
ATOM   3100 C CZ  . PHE B 1 199 ? 101.513 88.399  5.852   1.00 70.00  ? 177 PHE B CZ  1 
ATOM   3101 N N   . TYR B 1 200 ? 101.248 82.656  5.274   1.00 92.43  ? 178 TYR B N   1 
ATOM   3102 C CA  . TYR B 1 200 ? 102.497 82.305  4.608   1.00 92.54  ? 178 TYR B CA  1 
ATOM   3103 C C   . TYR B 1 200 ? 102.244 81.765  3.205   1.00 94.80  ? 178 TYR B C   1 
ATOM   3104 O O   . TYR B 1 200 ? 102.974 82.094  2.263   1.00 100.68 ? 178 TYR B O   1 
ATOM   3105 C CB  . TYR B 1 200 ? 103.275 81.297  5.456   1.00 92.32  ? 178 TYR B CB  1 
ATOM   3106 C CG  . TYR B 1 200 ? 104.158 81.953  6.486   1.00 101.67 ? 178 TYR B CG  1 
ATOM   3107 C CD1 . TYR B 1 200 ? 104.282 81.425  7.765   1.00 108.99 ? 178 TYR B CD1 1 
ATOM   3108 C CD2 . TYR B 1 200 ? 104.890 83.094  6.172   1.00 104.19 ? 178 TYR B CD2 1 
ATOM   3109 C CE1 . TYR B 1 200 ? 105.094 82.036  8.709   1.00 117.54 ? 178 TYR B CE1 1 
ATOM   3110 C CE2 . TYR B 1 200 ? 105.707 83.705  7.105   1.00 112.55 ? 178 TYR B CE2 1 
ATOM   3111 C CZ  . TYR B 1 200 ? 105.812 83.172  8.369   1.00 116.18 ? 178 TYR B CZ  1 
ATOM   3112 O OH  . TYR B 1 200 ? 106.625 83.779  9.303   1.00 115.23 ? 178 TYR B OH  1 
ATOM   3113 N N   . TYR B 1 201 ? 101.208 80.946  3.042   1.00 88.80  ? 179 TYR B N   1 
ATOM   3114 C CA  . TYR B 1 201 ? 100.964 80.320  1.748   1.00 92.31  ? 179 TYR B CA  1 
ATOM   3115 C C   . TYR B 1 201 ? 100.401 81.315  0.738   1.00 92.95  ? 179 TYR B C   1 
ATOM   3116 O O   . TYR B 1 201 ? 100.987 81.535  -0.334  1.00 90.34  ? 179 TYR B O   1 
ATOM   3117 C CB  . TYR B 1 201 ? 100.017 79.135  1.925   1.00 86.90  ? 179 TYR B CB  1 
ATOM   3118 C CG  . TYR B 1 201 ? 99.939  78.248  0.718   1.00 86.41  ? 179 TYR B CG  1 
ATOM   3119 C CD1 . TYR B 1 201 ? 99.105  78.555  -0.349  1.00 84.75  ? 179 TYR B CD1 1 
ATOM   3120 C CD2 . TYR B 1 201 ? 100.722 77.102  0.638   1.00 89.10  ? 179 TYR B CD2 1 
ATOM   3121 C CE1 . TYR B 1 201 ? 99.049  77.726  -1.465  1.00 98.04  ? 179 TYR B CE1 1 
ATOM   3122 C CE2 . TYR B 1 201 ? 100.676 76.274  -0.464  1.00 94.90  ? 179 TYR B CE2 1 
ATOM   3123 C CZ  . TYR B 1 201 ? 99.841  76.585  -1.515  1.00 100.05 ? 179 TYR B CZ  1 
ATOM   3124 O OH  . TYR B 1 201 ? 99.811  75.751  -2.612  1.00 101.23 ? 179 TYR B OH  1 
ATOM   3125 N N   . GLU B 1 202 ? 99.276  81.953  1.072   1.00 87.58  ? 180 GLU B N   1 
ATOM   3126 C CA  . GLU B 1 202 ? 98.558  82.733  0.072   1.00 87.16  ? 180 GLU B CA  1 
ATOM   3127 C C   . GLU B 1 202 ? 98.965  84.200  0.032   1.00 93.21  ? 180 GLU B C   1 
ATOM   3128 O O   . GLU B 1 202 ? 98.539  84.908  -0.880  1.00 103.44 ? 180 GLU B O   1 
ATOM   3129 C CB  . GLU B 1 202 ? 97.036  82.617  0.279   1.00 71.61  ? 180 GLU B CB  1 
ATOM   3130 N N   . ILE B 1 203 ? 99.771  84.686  0.970   1.00 85.69  ? 181 ILE B N   1 
ATOM   3131 C CA  . ILE B 1 203 ? 100.132 86.101  0.935   1.00 86.08  ? 181 ILE B CA  1 
ATOM   3132 C C   . ILE B 1 203 ? 101.643 86.273  0.818   1.00 97.65  ? 181 ILE B C   1 
ATOM   3133 O O   . ILE B 1 203 ? 102.120 87.292  0.305   1.00 111.03 ? 181 ILE B O   1 
ATOM   3134 C CB  . ILE B 1 203 ? 99.597  86.854  2.167   1.00 81.22  ? 181 ILE B CB  1 
ATOM   3135 C CG1 . ILE B 1 203 ? 98.071  86.795  2.220   1.00 75.62  ? 181 ILE B CG1 1 
ATOM   3136 C CG2 . ILE B 1 203 ? 100.012 88.337  2.114   1.00 79.79  ? 181 ILE B CG2 1 
ATOM   3137 C CD1 . ILE B 1 203 ? 97.392  87.803  1.318   1.00 79.72  ? 181 ILE B CD1 1 
ATOM   3138 N N   . LEU B 1 204 ? 102.417 85.300  1.300   1.00 98.81  ? 182 LEU B N   1 
ATOM   3139 C CA  . LEU B 1 204 ? 103.876 85.386  1.259   1.00 98.50  ? 182 LEU B CA  1 
ATOM   3140 C C   . LEU B 1 204 ? 104.528 84.410  0.288   1.00 99.38  ? 182 LEU B C   1 
ATOM   3141 O O   . LEU B 1 204 ? 105.754 84.390  0.198   1.00 100.64 ? 182 LEU B O   1 
ATOM   3142 C CB  . LEU B 1 204 ? 104.459 85.182  2.661   1.00 91.36  ? 182 LEU B CB  1 
ATOM   3143 C CG  . LEU B 1 204 ? 104.311 86.394  3.578   1.00 85.58  ? 182 LEU B CG  1 
ATOM   3144 C CD1 . LEU B 1 204 ? 105.332 86.359  4.696   1.00 77.53  ? 182 LEU B CD1 1 
ATOM   3145 C CD2 . LEU B 1 204 ? 104.450 87.676  2.767   1.00 84.06  ? 182 LEU B CD2 1 
ATOM   3146 N N   . ASN B 1 205 ? 103.745 83.633  -0.459  1.00 103.72 ? 183 ASN B N   1 
ATOM   3147 C CA  . ASN B 1 205 ? 104.224 82.589  -1.363  1.00 101.58 ? 183 ASN B CA  1 
ATOM   3148 C C   . ASN B 1 205 ? 105.354 81.752  -0.779  1.00 101.29 ? 183 ASN B C   1 
ATOM   3149 O O   . ASN B 1 205 ? 106.222 81.302  -1.531  1.00 112.35 ? 183 ASN B O   1 
ATOM   3150 C CB  . ASN B 1 205 ? 104.713 83.213  -2.670  1.00 104.55 ? 183 ASN B CB  1 
ATOM   3151 C CG  . ASN B 1 205 ? 103.580 83.639  -3.578  1.00 114.90 ? 183 ASN B CG  1 
ATOM   3152 O OD1 . ASN B 1 205 ? 102.405 83.340  -3.320  1.00 115.93 ? 183 ASN B OD1 1 
ATOM   3153 N ND2 . ASN B 1 205 ? 103.924 84.357  -4.649  1.00 122.21 ? 183 ASN B ND2 1 
ATOM   3154 N N   . SER B 1 206 ? 105.314 81.473  0.538   1.00 90.87  ? 184 SER B N   1 
ATOM   3155 C CA  . SER B 1 206 ? 106.262 80.584  1.202   1.00 99.55  ? 184 SER B CA  1 
ATOM   3156 C C   . SER B 1 206 ? 105.592 79.292  1.641   1.00 102.09 ? 184 SER B C   1 
ATOM   3157 O O   . SER B 1 206 ? 105.292 79.140  2.833   1.00 103.10 ? 184 SER B O   1 
ATOM   3158 C CB  . SER B 1 206 ? 106.886 81.239  2.439   1.00 106.82 ? 184 SER B CB  1 
ATOM   3159 O OG  . SER B 1 206 ? 107.471 82.494  2.161   1.00 114.36 ? 184 SER B OG  1 
ATOM   3160 N N   . PRO B 1 207 ? 105.351 78.338  0.739   1.00 98.29  ? 185 PRO B N   1 
ATOM   3161 C CA  . PRO B 1 207 ? 104.690 77.097  1.167   1.00 97.99  ? 185 PRO B CA  1 
ATOM   3162 C C   . PRO B 1 207 ? 105.459 76.336  2.230   1.00 102.80 ? 185 PRO B C   1 
ATOM   3163 O O   . PRO B 1 207 ? 104.834 75.642  3.039   1.00 108.91 ? 185 PRO B O   1 
ATOM   3164 C CB  . PRO B 1 207 ? 104.559 76.295  -0.135  1.00 95.66  ? 185 PRO B CB  1 
ATOM   3165 C CG  . PRO B 1 207 ? 104.574 77.321  -1.200  1.00 96.46  ? 185 PRO B CG  1 
ATOM   3166 C CD  . PRO B 1 207 ? 105.516 78.386  -0.721  1.00 97.37  ? 185 PRO B CD  1 
ATOM   3167 N N   . GLU B 1 208 ? 106.784 76.470  2.294   1.00 102.62 ? 186 GLU B N   1 
ATOM   3168 C CA  . GLU B 1 208 ? 107.531 75.610  3.208   1.00 103.20 ? 186 GLU B CA  1 
ATOM   3169 C C   . GLU B 1 208 ? 107.426 76.067  4.664   1.00 98.78  ? 186 GLU B C   1 
ATOM   3170 O O   . GLU B 1 208 ? 107.265 75.225  5.555   1.00 91.56  ? 186 GLU B O   1 
ATOM   3171 C CB  . GLU B 1 208 ? 108.987 75.511  2.754   1.00 105.47 ? 186 GLU B CB  1 
ATOM   3172 C CG  . GLU B 1 208 ? 109.082 75.234  1.276   1.00 107.91 ? 186 GLU B CG  1 
ATOM   3173 C CD  . GLU B 1 208 ? 110.496 75.098  0.810   1.00 124.43 ? 186 GLU B CD  1 
ATOM   3174 O OE1 . GLU B 1 208 ? 111.202 74.261  1.403   1.00 133.62 ? 186 GLU B OE1 1 
ATOM   3175 O OE2 . GLU B 1 208 ? 110.895 75.792  -0.155  1.00 128.85 ? 186 GLU B OE2 1 
ATOM   3176 N N   . LYS B 1 209 ? 107.515 77.376  4.939   1.00 99.90  ? 187 LYS B N   1 
ATOM   3177 C CA  . LYS B 1 209 ? 107.176 77.852  6.280   1.00 94.79  ? 187 LYS B CA  1 
ATOM   3178 C C   . LYS B 1 209 ? 105.712 77.568  6.579   1.00 95.34  ? 187 LYS B C   1 
ATOM   3179 O O   . LYS B 1 209 ? 105.359 77.165  7.694   1.00 92.95  ? 187 LYS B O   1 
ATOM   3180 C CB  . LYS B 1 209 ? 107.486 79.347  6.437   1.00 76.04  ? 187 LYS B CB  1 
ATOM   3181 N N   . ALA B 1 210 ? 104.849 77.760  5.576   1.00 97.18  ? 188 ALA B N   1 
ATOM   3182 C CA  . ALA B 1 210 ? 103.415 77.555  5.750   1.00 84.26  ? 188 ALA B CA  1 
ATOM   3183 C C   . ALA B 1 210 ? 103.090 76.111  6.120   1.00 83.42  ? 188 ALA B C   1 
ATOM   3184 O O   . ALA B 1 210 ? 102.241 75.866  6.986   1.00 91.66  ? 188 ALA B O   1 
ATOM   3185 C CB  . ALA B 1 210 ? 102.671 77.967  4.482   1.00 82.39  ? 188 ALA B CB  1 
ATOM   3186 N N   . CYS B 1 211 ? 103.712 75.127  5.447   1.00 78.35  ? 189 CYS B N   1 
ATOM   3187 C CA  . CYS B 1 211 ? 103.397 73.752  5.830   1.00 83.50  ? 189 CYS B CA  1 
ATOM   3188 C C   . CYS B 1 211 ? 104.142 73.305  7.070   1.00 103.15 ? 189 CYS B C   1 
ATOM   3189 O O   . CYS B 1 211 ? 103.581 72.545  7.870   1.00 115.15 ? 189 CYS B O   1 
ATOM   3190 C CB  . CYS B 1 211 ? 103.665 72.744  4.712   1.00 83.93  ? 189 CYS B CB  1 
ATOM   3191 S SG  . CYS B 1 211 ? 103.045 73.155  3.089   1.00 99.09  ? 189 CYS B SG  1 
ATOM   3192 N N   . SER B 1 212 ? 105.376 73.771  7.272   1.00 107.94 ? 190 SER B N   1 
ATOM   3193 C CA  . SER B 1 212 ? 106.071 73.408  8.499   1.00 111.54 ? 190 SER B CA  1 
ATOM   3194 C C   . SER B 1 212 ? 105.317 73.945  9.705   1.00 101.56 ? 190 SER B C   1 
ATOM   3195 O O   . SER B 1 212 ? 105.188 73.264  10.728  1.00 107.49 ? 190 SER B O   1 
ATOM   3196 C CB  . SER B 1 212 ? 107.513 73.914  8.472   1.00 121.36 ? 190 SER B CB  1 
ATOM   3197 O OG  . SER B 1 212 ? 107.616 75.216  9.021   1.00 127.81 ? 190 SER B OG  1 
ATOM   3198 N N   . LEU B 1 213 ? 104.730 75.128  9.570   1.00 85.66  ? 191 LEU B N   1 
ATOM   3199 C CA  . LEU B 1 213 ? 104.038 75.720  10.705  1.00 84.74  ? 191 LEU B CA  1 
ATOM   3200 C C   . LEU B 1 213 ? 102.749 74.971  11.013  1.00 81.01  ? 191 LEU B C   1 
ATOM   3201 O O   . LEU B 1 213 ? 102.519 74.583  12.163  1.00 84.17  ? 191 LEU B O   1 
ATOM   3202 C CB  . LEU B 1 213 ? 103.817 77.209  10.431  1.00 64.67  ? 191 LEU B CB  1 
ATOM   3203 C CG  . LEU B 1 213 ? 102.803 78.100  11.109  1.00 77.82  ? 191 LEU B CG  1 
ATOM   3204 C CD1 . LEU B 1 213 ? 102.795 77.909  12.609  1.00 77.12  ? 191 LEU B CD1 1 
ATOM   3205 C CD2 . LEU B 1 213 ? 103.272 79.510  10.736  1.00 68.64  ? 191 LEU B CD2 1 
ATOM   3206 N N   . ALA B 1 214 ? 101.927 74.706  9.989   1.00 76.19  ? 192 ALA B N   1 
ATOM   3207 C CA  . ALA B 1 214 ? 100.718 73.906  10.167  1.00 68.09  ? 192 ALA B CA  1 
ATOM   3208 C C   . ALA B 1 214 ? 101.034 72.489  10.636  1.00 75.34  ? 192 ALA B C   1 
ATOM   3209 O O   . ALA B 1 214 ? 100.338 71.951  11.507  1.00 76.13  ? 192 ALA B O   1 
ATOM   3210 C CB  . ALA B 1 214 ? 99.916  73.859  8.872   1.00 57.07  ? 192 ALA B CB  1 
ATOM   3211 N N   . LYS B 1 215 ? 102.051 71.845  10.046  1.00 80.04  ? 193 LYS B N   1 
ATOM   3212 C CA  . LYS B 1 215 ? 102.335 70.474  10.460  1.00 85.24  ? 193 LYS B CA  1 
ATOM   3213 C C   . LYS B 1 215 ? 102.769 70.408  11.921  1.00 89.74  ? 193 LYS B C   1 
ATOM   3214 O O   . LYS B 1 215 ? 102.367 69.493  12.648  1.00 95.81  ? 193 LYS B O   1 
ATOM   3215 C CB  . LYS B 1 215 ? 103.383 69.817  9.568   1.00 86.88  ? 193 LYS B CB  1 
ATOM   3216 C CG  . LYS B 1 215 ? 103.588 68.361  9.960   1.00 96.66  ? 193 LYS B CG  1 
ATOM   3217 C CD  . LYS B 1 215 ? 103.939 67.417  8.824   1.00 96.24  ? 193 LYS B CD  1 
ATOM   3218 C CE  . LYS B 1 215 ? 104.953 66.408  9.312   1.00 86.74  ? 193 LYS B CE  1 
ATOM   3219 N NZ  . LYS B 1 215 ? 104.609 65.953  10.692  1.00 82.80  ? 193 LYS B NZ  1 
ATOM   3220 N N   . THR B 1 216 ? 103.599 71.351  12.372  1.00 83.49  ? 194 THR B N   1 
ATOM   3221 C CA  . THR B 1 216 ? 104.021 71.324  13.772  1.00 79.38  ? 194 THR B CA  1 
ATOM   3222 C C   . THR B 1 216 ? 102.844 71.601  14.703  1.00 75.09  ? 194 THR B C   1 
ATOM   3223 O O   . THR B 1 216 ? 102.645 70.890  15.699  1.00 69.35  ? 194 THR B O   1 
ATOM   3224 C CB  . THR B 1 216 ? 105.192 72.292  14.008  1.00 83.90  ? 194 THR B CB  1 
ATOM   3225 O OG1 . THR B 1 216 ? 106.411 71.693  13.533  1.00 87.61  ? 194 THR B OG1 1 
ATOM   3226 C CG2 . THR B 1 216 ? 105.357 72.628  15.474  1.00 80.87  ? 194 THR B CG2 1 
ATOM   3227 N N   . ALA B 1 217 ? 102.040 72.622  14.386  1.00 84.29  ? 195 ALA B N   1 
ATOM   3228 C CA  . ALA B 1 217 ? 100.818 72.893  15.147  1.00 86.96  ? 195 ALA B CA  1 
ATOM   3229 C C   . ALA B 1 217 ? 99.926  71.662  15.251  1.00 82.37  ? 195 ALA B C   1 
ATOM   3230 O O   . ALA B 1 217 ? 99.319  71.409  16.298  1.00 75.63  ? 195 ALA B O   1 
ATOM   3231 C CB  . ALA B 1 217 ? 100.039 74.032  14.506  1.00 86.82  ? 195 ALA B CB  1 
ATOM   3232 N N   . PHE B 1 218 ? 99.814  70.898  14.164  1.00 78.81  ? 196 PHE B N   1 
ATOM   3233 C CA  . PHE B 1 218 ? 99.003  69.689  14.204  1.00 77.80  ? 196 PHE B CA  1 
ATOM   3234 C C   . PHE B 1 218 ? 99.610  68.655  15.154  1.00 86.68  ? 196 PHE B C   1 
ATOM   3235 O O   . PHE B 1 218 ? 98.957  68.212  16.106  1.00 91.66  ? 196 PHE B O   1 
ATOM   3236 C CB  . PHE B 1 218 ? 98.854  69.115  12.797  1.00 67.16  ? 196 PHE B CB  1 
ATOM   3237 C CG  . PHE B 1 218 ? 97.980  67.897  12.734  1.00 67.29  ? 196 PHE B CG  1 
ATOM   3238 C CD1 . PHE B 1 218 ? 98.521  66.627  12.877  1.00 67.49  ? 196 PHE B CD1 1 
ATOM   3239 C CD2 . PHE B 1 218 ? 96.612  68.021  12.547  1.00 73.03  ? 196 PHE B CD2 1 
ATOM   3240 C CE1 . PHE B 1 218 ? 97.727  65.503  12.821  1.00 66.30  ? 196 PHE B CE1 1 
ATOM   3241 C CE2 . PHE B 1 218 ? 95.796  66.893  12.485  1.00 70.19  ? 196 PHE B CE2 1 
ATOM   3242 C CZ  . PHE B 1 218 ? 96.355  65.633  12.632  1.00 64.25  ? 196 PHE B CZ  1 
ATOM   3243 N N   . ASP B 1 219 ? 100.873 68.277  14.922  1.00 90.81  ? 197 ASP B N   1 
ATOM   3244 C CA  . ASP B 1 219 ? 101.470 67.165  15.660  1.00 95.77  ? 197 ASP B CA  1 
ATOM   3245 C C   . ASP B 1 219 ? 101.704 67.481  17.143  1.00 88.64  ? 197 ASP B C   1 
ATOM   3246 O O   . ASP B 1 219 ? 101.578 66.583  17.989  1.00 71.42  ? 197 ASP B O   1 
ATOM   3247 C CB  . ASP B 1 219 ? 102.780 66.749  14.989  1.00 107.00 ? 197 ASP B CB  1 
ATOM   3248 C CG  . ASP B 1 219 ? 102.574 66.198  13.587  1.00 115.89 ? 197 ASP B CG  1 
ATOM   3249 O OD1 . ASP B 1 219 ? 101.738 65.280  13.427  1.00 117.91 ? 197 ASP B OD1 1 
ATOM   3250 O OD2 . ASP B 1 219 ? 103.260 66.673  12.650  1.00 121.14 ? 197 ASP B OD2 1 
ATOM   3251 N N   . GLU B 1 220 ? 102.035 68.731  17.489  1.00 78.98  ? 198 GLU B N   1 
ATOM   3252 C CA  . GLU B 1 220 ? 102.154 69.073  18.904  1.00 86.41  ? 198 GLU B CA  1 
ATOM   3253 C C   . GLU B 1 220 ? 100.800 69.018  19.612  1.00 92.63  ? 198 GLU B C   1 
ATOM   3254 O O   . GLU B 1 220 ? 100.753 68.816  20.830  1.00 76.79  ? 198 GLU B O   1 
ATOM   3255 C CB  . GLU B 1 220 ? 102.820 70.447  19.063  1.00 83.39  ? 198 GLU B CB  1 
ATOM   3256 N N   . ALA B 1 221 ? 99.697  69.171  18.864  1.00 103.30 ? 199 ALA B N   1 
ATOM   3257 C CA  . ALA B 1 221 ? 98.347  69.115  19.428  1.00 92.43  ? 199 ALA B CA  1 
ATOM   3258 C C   . ALA B 1 221 ? 97.858  67.677  19.602  1.00 88.05  ? 199 ALA B C   1 
ATOM   3259 O O   . ALA B 1 221 ? 97.119  67.384  20.549  1.00 81.55  ? 199 ALA B O   1 
ATOM   3260 C CB  . ALA B 1 221 ? 97.378  69.900  18.552  1.00 79.09  ? 199 ALA B CB  1 
ATOM   3261 N N   . ILE B 1 222 ? 98.217  66.778  18.678  1.00 90.42  ? 200 ILE B N   1 
ATOM   3262 C CA  . ILE B 1 222 ? 97.919  65.361  18.885  1.00 100.28 ? 200 ILE B CA  1 
ATOM   3263 C C   . ILE B 1 222 ? 98.774  64.766  19.999  1.00 110.90 ? 200 ILE B C   1 
ATOM   3264 O O   . ILE B 1 222 ? 98.301  63.905  20.754  1.00 120.76 ? 200 ILE B O   1 
ATOM   3265 C CB  . ILE B 1 222 ? 98.098  64.565  17.580  1.00 98.13  ? 200 ILE B CB  1 
ATOM   3266 C CG1 . ILE B 1 222 ? 96.961  64.880  16.627  1.00 86.95  ? 200 ILE B CG1 1 
ATOM   3267 C CG2 . ILE B 1 222 ? 98.165  63.061  17.859  1.00 109.60 ? 200 ILE B CG2 1 
ATOM   3268 C CD1 . ILE B 1 222 ? 96.722  63.854  15.595  1.00 79.77  ? 200 ILE B CD1 1 
ATOM   3269 N N   . ALA B 1 223 ? 100.027 65.221  20.141  1.00 111.69 ? 201 ALA B N   1 
ATOM   3270 C CA  . ALA B 1 223 ? 100.916 64.664  21.158  1.00 106.73 ? 201 ALA B CA  1 
ATOM   3271 C C   . ALA B 1 223 ? 100.291 64.754  22.540  1.00 108.02 ? 201 ALA B C   1 
ATOM   3272 O O   . ALA B 1 223 ? 100.567 63.918  23.409  1.00 100.34 ? 201 ALA B O   1 
ATOM   3273 C CB  . ALA B 1 223 ? 102.261 65.388  21.137  1.00 103.44 ? 201 ALA B CB  1 
ATOM   3274 N N   . GLU B 1 224 ? 99.416  65.739  22.736  1.00 109.40 ? 202 GLU B N   1 
ATOM   3275 C CA  . GLU B 1 224 ? 98.816  66.058  24.019  1.00 110.52 ? 202 GLU B CA  1 
ATOM   3276 C C   . GLU B 1 224 ? 97.291  66.086  23.917  1.00 106.91 ? 202 GLU B C   1 
ATOM   3277 O O   . GLU B 1 224 ? 96.683  67.112  24.216  1.00 111.22 ? 202 GLU B O   1 
ATOM   3278 C CB  . GLU B 1 224 ? 99.261  67.437  24.477  1.00 115.00 ? 202 GLU B CB  1 
ATOM   3279 C CG  . GLU B 1 224 ? 100.665 67.559  24.958  1.00 134.50 ? 202 GLU B CG  1 
ATOM   3280 C CD  . GLU B 1 224 ? 100.885 68.927  25.534  1.00 150.95 ? 202 GLU B CD  1 
ATOM   3281 O OE1 . GLU B 1 224 ? 99.963  69.756  25.375  1.00 153.47 ? 202 GLU B OE1 1 
ATOM   3282 O OE2 . GLU B 1 224 ? 101.945 69.168  26.154  1.00 159.16 ? 202 GLU B OE2 1 
ATOM   3283 N N   . LEU B 1 225 ? 96.647  64.985  23.513  1.00 100.93 ? 203 LEU B N   1 
ATOM   3284 C CA  . LEU B 1 225 ? 95.184  65.039  23.574  1.00 101.49 ? 203 LEU B CA  1 
ATOM   3285 C C   . LEU B 1 225 ? 94.650  64.816  24.981  1.00 109.10 ? 203 LEU B C   1 
ATOM   3286 O O   . LEU B 1 225 ? 93.428  64.857  25.170  1.00 100.00 ? 203 LEU B O   1 
ATOM   3287 C CB  . LEU B 1 225 ? 94.517  64.049  22.610  1.00 92.22  ? 203 LEU B CB  1 
ATOM   3288 C CG  . LEU B 1 225 ? 94.590  64.431  21.130  1.00 90.58  ? 203 LEU B CG  1 
ATOM   3289 C CD1 . LEU B 1 225 ? 93.887  63.394  20.276  1.00 93.66  ? 203 LEU B CD1 1 
ATOM   3290 C CD2 . LEU B 1 225 ? 94.037  65.825  20.861  1.00 86.44  ? 203 LEU B CD2 1 
ATOM   3291 N N   . ASP B 1 226 ? 95.541  64.581  25.953  1.00 126.00 ? 204 ASP B N   1 
ATOM   3292 C CA  . ASP B 1 226 ? 95.157  64.558  27.364  1.00 130.81 ? 204 ASP B CA  1 
ATOM   3293 C C   . ASP B 1 226 ? 94.559  65.895  27.802  1.00 123.74 ? 204 ASP B C   1 
ATOM   3294 O O   . ASP B 1 226 ? 93.679  65.932  28.667  1.00 117.32 ? 204 ASP B O   1 
ATOM   3295 C CB  . ASP B 1 226 ? 96.368  64.185  28.238  1.00 137.39 ? 204 ASP B CB  1 
ATOM   3296 C CG  . ASP B 1 226 ? 97.700  64.764  27.714  1.00 139.56 ? 204 ASP B CG  1 
ATOM   3297 O OD1 . ASP B 1 226 ? 97.682  65.742  26.941  1.00 138.84 ? 204 ASP B OD1 1 
ATOM   3298 O OD2 . ASP B 1 226 ? 98.776  64.236  28.078  1.00 140.82 ? 204 ASP B OD2 1 
ATOM   3299 N N   . THR B 1 227 ? 95.037  67.004  27.227  1.00 125.46 ? 205 THR B N   1 
ATOM   3300 C CA  . THR B 1 227 ? 94.693  68.353  27.667  1.00 132.73 ? 205 THR B CA  1 
ATOM   3301 C C   . THR B 1 227 ? 93.480  68.947  26.930  1.00 132.95 ? 205 THR B C   1 
ATOM   3302 O O   . THR B 1 227 ? 93.352  70.176  26.851  1.00 135.42 ? 205 THR B O   1 
ATOM   3303 C CB  . THR B 1 227 ? 95.922  69.277  27.553  1.00 136.35 ? 205 THR B CB  1 
ATOM   3304 O OG1 . THR B 1 227 ? 95.687  70.508  28.254  1.00 139.80 ? 205 THR B OG1 1 
ATOM   3305 C CG2 . THR B 1 227 ? 96.301  69.569  26.101  1.00 128.88 ? 205 THR B CG2 1 
ATOM   3306 N N   . LEU B 1 228 ? 92.590  68.119  26.384  1.00 128.27 ? 206 LEU B N   1 
ATOM   3307 C CA  . LEU B 1 228 ? 91.355  68.660  25.832  1.00 113.60 ? 206 LEU B CA  1 
ATOM   3308 C C   . LEU B 1 228 ? 90.292  68.784  26.911  1.00 120.91 ? 206 LEU B C   1 
ATOM   3309 O O   . LEU B 1 228 ? 90.088  67.874  27.724  1.00 112.00 ? 206 LEU B O   1 
ATOM   3310 C CB  . LEU B 1 228 ? 90.823  67.809  24.677  1.00 94.66  ? 206 LEU B CB  1 
ATOM   3311 C CG  . LEU B 1 228 ? 91.392  68.181  23.314  1.00 86.15  ? 206 LEU B CG  1 
ATOM   3312 C CD1 . LEU B 1 228 ? 90.822  67.266  22.255  1.00 88.49  ? 206 LEU B CD1 1 
ATOM   3313 C CD2 . LEU B 1 228 ? 91.113  69.650  22.995  1.00 71.52  ? 206 LEU B CD2 1 
ATOM   3314 N N   . SER B 1 229 ? 89.598  69.915  26.888  1.00 130.74 ? 207 SER B N   1 
ATOM   3315 C CA  . SER B 1 229 ? 88.547  70.237  27.838  1.00 136.85 ? 207 SER B CA  1 
ATOM   3316 C C   . SER B 1 229 ? 87.190  69.776  27.292  1.00 146.33 ? 207 SER B C   1 
ATOM   3317 O O   . SER B 1 229 ? 87.021  69.542  26.091  1.00 144.38 ? 207 SER B O   1 
ATOM   3318 C CB  . SER B 1 229 ? 88.562  71.741  28.132  1.00 132.05 ? 207 SER B CB  1 
ATOM   3319 O OG  . SER B 1 229 ? 87.389  72.176  28.792  1.00 134.79 ? 207 SER B OG  1 
ATOM   3320 N N   . GLU B 1 230 ? 86.217  69.632  28.202  1.00 154.54 ? 208 GLU B N   1 
ATOM   3321 C CA  . GLU B 1 230 ? 84.875  69.181  27.827  1.00 153.92 ? 208 GLU B CA  1 
ATOM   3322 C C   . GLU B 1 230 ? 84.104  70.177  26.958  1.00 152.99 ? 208 GLU B C   1 
ATOM   3323 O O   . GLU B 1 230 ? 83.196  69.760  26.232  1.00 160.71 ? 208 GLU B O   1 
ATOM   3324 C CB  . GLU B 1 230 ? 84.057  68.866  29.081  1.00 153.32 ? 208 GLU B CB  1 
ATOM   3325 N N   . GLU B 1 231 ? 84.428  71.471  27.004  1.00 145.03 ? 209 GLU B N   1 
ATOM   3326 C CA  . GLU B 1 231 ? 83.733  72.451  26.175  1.00 134.50 ? 209 GLU B CA  1 
ATOM   3327 C C   . GLU B 1 231 ? 84.477  72.790  24.887  1.00 140.50 ? 209 GLU B C   1 
ATOM   3328 O O   . GLU B 1 231 ? 83.857  73.298  23.942  1.00 147.03 ? 209 GLU B O   1 
ATOM   3329 C CB  . GLU B 1 231 ? 83.484  73.741  26.969  1.00 126.30 ? 209 GLU B CB  1 
ATOM   3330 N N   . SER B 1 232 ? 85.778  72.506  24.814  1.00 138.84 ? 210 SER B N   1 
ATOM   3331 C CA  . SER B 1 232 ? 86.598  72.941  23.695  1.00 125.92 ? 210 SER B CA  1 
ATOM   3332 C C   . SER B 1 232 ? 87.091  71.811  22.805  1.00 113.07 ? 210 SER B C   1 
ATOM   3333 O O   . SER B 1 232 ? 87.694  72.098  21.767  1.00 113.71 ? 210 SER B O   1 
ATOM   3334 C CB  . SER B 1 232 ? 87.811  73.745  24.202  1.00 125.29 ? 210 SER B CB  1 
ATOM   3335 O OG  . SER B 1 232 ? 88.850  72.900  24.673  1.00 122.40 ? 210 SER B OG  1 
ATOM   3336 N N   . TYR B 1 233 ? 86.858  70.542  23.164  1.00 109.26 ? 211 TYR B N   1 
ATOM   3337 C CA  . TYR B 1 233 ? 87.397  69.469  22.330  1.00 105.18 ? 211 TYR B CA  1 
ATOM   3338 C C   . TYR B 1 233 ? 86.722  69.443  20.958  1.00 111.31 ? 211 TYR B C   1 
ATOM   3339 O O   . TYR B 1 233 ? 87.365  69.084  19.967  1.00 113.48 ? 211 TYR B O   1 
ATOM   3340 C CB  . TYR B 1 233 ? 87.309  68.109  23.041  1.00 95.36  ? 211 TYR B CB  1 
ATOM   3341 C CG  . TYR B 1 233 ? 86.009  67.343  22.920  1.00 107.90 ? 211 TYR B CG  1 
ATOM   3342 C CD1 . TYR B 1 233 ? 84.783  67.936  23.215  1.00 119.85 ? 211 TYR B CD1 1 
ATOM   3343 C CD2 . TYR B 1 233 ? 86.014  66.006  22.545  1.00 104.98 ? 211 TYR B CD2 1 
ATOM   3344 N N   . LYS B 1 234 ? 85.446  69.837  20.873  1.00 109.48 ? 212 LYS B N   1 
ATOM   3345 C CA  . LYS B 1 234 ? 84.800  69.971  19.568  1.00 99.59  ? 212 LYS B CA  1 
ATOM   3346 C C   . LYS B 1 234 ? 85.468  71.061  18.721  1.00 90.53  ? 212 LYS B C   1 
ATOM   3347 O O   . LYS B 1 234 ? 85.712  70.867  17.524  1.00 84.46  ? 212 LYS B O   1 
ATOM   3348 C CB  . LYS B 1 234 ? 83.307  70.259  19.750  1.00 98.43  ? 212 LYS B CB  1 
ATOM   3349 N N   . ASP B 1 235 ? 85.746  72.225  19.318  1.00 89.88  ? 213 ASP B N   1 
ATOM   3350 C CA  . ASP B 1 235 ? 86.328  73.333  18.563  1.00 95.96  ? 213 ASP B CA  1 
ATOM   3351 C C   . ASP B 1 235 ? 87.797  73.079  18.246  1.00 85.83  ? 213 ASP B C   1 
ATOM   3352 O O   . ASP B 1 235 ? 88.305  73.558  17.223  1.00 76.58  ? 213 ASP B O   1 
ATOM   3353 C CB  . ASP B 1 235 ? 86.198  74.658  19.330  1.00 113.81 ? 213 ASP B CB  1 
ATOM   3354 C CG  . ASP B 1 235 ? 84.831  74.847  19.977  1.00 127.36 ? 213 ASP B CG  1 
ATOM   3355 O OD1 . ASP B 1 235 ? 83.819  74.679  19.265  1.00 136.08 ? 213 ASP B OD1 1 
ATOM   3356 O OD2 . ASP B 1 235 ? 84.773  75.166  21.193  1.00 125.39 ? 213 ASP B OD2 1 
ATOM   3357 N N   . SER B 1 236 ? 88.498  72.340  19.109  1.00 79.88  ? 214 SER B N   1 
ATOM   3358 C CA  . SER B 1 236 ? 89.916  72.112  18.879  1.00 73.12  ? 214 SER B CA  1 
ATOM   3359 C C   . SER B 1 236 ? 90.164  71.008  17.858  1.00 69.49  ? 214 SER B C   1 
ATOM   3360 O O   . SER B 1 236 ? 91.056  71.136  17.006  1.00 70.11  ? 214 SER B O   1 
ATOM   3361 C CB  . SER B 1 236 ? 90.608  71.773  20.197  1.00 86.87  ? 214 SER B CB  1 
ATOM   3362 O OG  . SER B 1 236 ? 90.547  72.863  21.103  1.00 99.90  ? 214 SER B OG  1 
ATOM   3363 N N   . THR B 1 237 ? 89.384  69.931  17.900  1.00 61.25  ? 215 THR B N   1 
ATOM   3364 C CA  . THR B 1 237 ? 89.537  68.915  16.868  1.00 59.22  ? 215 THR B CA  1 
ATOM   3365 C C   . THR B 1 237 ? 89.097  69.418  15.498  1.00 70.07  ? 215 THR B C   1 
ATOM   3366 O O   . THR B 1 237 ? 89.629  68.955  14.483  1.00 82.08  ? 215 THR B O   1 
ATOM   3367 C CB  . THR B 1 237 ? 88.800  67.629  17.233  1.00 68.46  ? 215 THR B CB  1 
ATOM   3368 O OG1 . THR B 1 237 ? 87.451  67.925  17.610  1.00 78.12  ? 215 THR B OG1 1 
ATOM   3369 C CG2 . THR B 1 237 ? 89.521  66.927  18.376  1.00 71.07  ? 215 THR B CG2 1 
ATOM   3370 N N   . LEU B 1 238 ? 88.118  70.324  15.420  1.00 70.50  ? 216 LEU B N   1 
ATOM   3371 C CA  . LEU B 1 238 ? 87.742  70.837  14.100  1.00 80.13  ? 216 LEU B CA  1 
ATOM   3372 C C   . LEU B 1 238 ? 88.920  71.553  13.439  1.00 75.83  ? 216 LEU B C   1 
ATOM   3373 O O   . LEU B 1 238 ? 89.233  71.300  12.270  1.00 74.60  ? 216 LEU B O   1 
ATOM   3374 C CB  . LEU B 1 238 ? 86.512  71.752  14.183  1.00 81.52  ? 216 LEU B CB  1 
ATOM   3375 N N   . ILE B 1 239 ? 89.603  72.432  14.186  1.00 72.24  ? 217 ILE B N   1 
ATOM   3376 C CA  . ILE B 1 239 ? 90.738  73.179  13.636  1.00 63.80  ? 217 ILE B CA  1 
ATOM   3377 C C   . ILE B 1 239 ? 91.864  72.237  13.230  1.00 67.90  ? 217 ILE B C   1 
ATOM   3378 O O   . ILE B 1 239 ? 92.513  72.424  12.195  1.00 65.59  ? 217 ILE B O   1 
ATOM   3379 C CB  . ILE B 1 239 ? 91.240  74.210  14.658  1.00 60.95  ? 217 ILE B CB  1 
ATOM   3380 C CG1 . ILE B 1 239 ? 90.073  75.089  15.142  1.00 69.38  ? 217 ILE B CG1 1 
ATOM   3381 C CG2 . ILE B 1 239 ? 92.397  74.998  14.050  1.00 57.15  ? 217 ILE B CG2 1 
ATOM   3382 C CD1 . ILE B 1 239 ? 90.399  76.087  16.230  1.00 54.01  ? 217 ILE B CD1 1 
ATOM   3383 N N   . MET B 1 240 ? 92.116  71.210  14.038  1.00 69.90  ? 218 MET B N   1 
ATOM   3384 C CA  . MET B 1 240 ? 93.153  70.249  13.698  1.00 62.29  ? 218 MET B CA  1 
ATOM   3385 C C   . MET B 1 240 ? 92.865  69.556  12.389  1.00 62.53  ? 218 MET B C   1 
ATOM   3386 O O   . MET B 1 240 ? 93.800  69.147  11.698  1.00 74.64  ? 218 MET B O   1 
ATOM   3387 C CB  . MET B 1 240 ? 93.309  69.220  14.802  1.00 71.25  ? 218 MET B CB  1 
ATOM   3388 C CG  . MET B 1 240 ? 94.125  69.742  15.941  1.00 80.79  ? 218 MET B CG  1 
ATOM   3389 S SD  . MET B 1 240 ? 93.791  68.696  17.324  1.00 86.68  ? 218 MET B SD  1 
ATOM   3390 C CE  . MET B 1 240 ? 94.742  67.308  16.746  1.00 76.80  ? 218 MET B CE  1 
ATOM   3391 N N   . GLN B 1 241 ? 91.584  69.368  12.058  1.00 67.98  ? 219 GLN B N   1 
ATOM   3392 C CA  . GLN B 1 241 ? 91.230  68.780  10.774  1.00 51.37  ? 219 GLN B CA  1 
ATOM   3393 C C   . GLN B 1 241 ? 91.490  69.753  9.632   1.00 60.24  ? 219 GLN B C   1 
ATOM   3394 O O   . GLN B 1 241 ? 91.947  69.342  8.557   1.00 62.71  ? 219 GLN B O   1 
ATOM   3395 C CB  . GLN B 1 241 ? 89.772  68.363  10.775  1.00 64.55  ? 219 GLN B CB  1 
ATOM   3396 C CG  . GLN B 1 241 ? 89.358  67.405  11.850  1.00 66.62  ? 219 GLN B CG  1 
ATOM   3397 C CD  . GLN B 1 241 ? 88.012  66.793  11.520  1.00 77.58  ? 219 GLN B CD  1 
ATOM   3398 O OE1 . GLN B 1 241 ? 87.388  67.163  10.515  1.00 78.69  ? 219 GLN B OE1 1 
ATOM   3399 N NE2 . GLN B 1 241 ? 87.544  65.878  12.366  1.00 77.43  ? 219 GLN B NE2 1 
ATOM   3400 N N   . LEU B 1 242 ? 91.193  71.045  9.837   1.00 54.55  ? 220 LEU B N   1 
ATOM   3401 C CA  . LEU B 1 242 ? 91.491  72.031  8.802   1.00 63.82  ? 220 LEU B CA  1 
ATOM   3402 C C   . LEU B 1 242 ? 92.981  72.295  8.663   1.00 75.14  ? 220 LEU B C   1 
ATOM   3403 O O   . LEU B 1 242 ? 93.407  72.772  7.605   1.00 87.41  ? 220 LEU B O   1 
ATOM   3404 C CB  . LEU B 1 242 ? 90.782  73.364  9.037   1.00 65.48  ? 220 LEU B CB  1 
ATOM   3405 C CG  . LEU B 1 242 ? 89.313  73.517  9.410   1.00 68.53  ? 220 LEU B CG  1 
ATOM   3406 C CD1 . LEU B 1 242 ? 89.120  74.981  9.646   1.00 69.50  ? 220 LEU B CD1 1 
ATOM   3407 C CD2 . LEU B 1 242 ? 88.349  73.023  8.338   1.00 61.87  ? 220 LEU B CD2 1 
ATOM   3408 N N   . LEU B 1 243 ? 93.771  72.070  9.722   1.00 68.97  ? 221 LEU B N   1 
ATOM   3409 C CA  . LEU B 1 243 ? 95.223  72.113  9.577   1.00 67.58  ? 221 LEU B CA  1 
ATOM   3410 C C   . LEU B 1 243 ? 95.692  71.069  8.577   1.00 69.31  ? 221 LEU B C   1 
ATOM   3411 O O   . LEU B 1 243 ? 96.482  71.371  7.670   1.00 74.55  ? 221 LEU B O   1 
ATOM   3412 C CB  . LEU B 1 243 ? 95.922  71.886  10.915  1.00 67.45  ? 221 LEU B CB  1 
ATOM   3413 C CG  . LEU B 1 243 ? 95.930  73.064  11.861  1.00 64.66  ? 221 LEU B CG  1 
ATOM   3414 C CD1 . LEU B 1 243 ? 96.417  72.580  13.216  1.00 67.85  ? 221 LEU B CD1 1 
ATOM   3415 C CD2 . LEU B 1 243 ? 96.792  74.181  11.294  1.00 57.93  ? 221 LEU B CD2 1 
ATOM   3416 N N   . ARG B 1 244 ? 95.207  69.834  8.714   1.00 58.56  ? 222 ARG B N   1 
ATOM   3417 C CA  . ARG B 1 244 ? 95.735  68.792  7.855   1.00 71.71  ? 222 ARG B CA  1 
ATOM   3418 C C   . ARG B 1 244 ? 95.050  68.788  6.493   1.00 78.91  ? 222 ARG B C   1 
ATOM   3419 O O   . ARG B 1 244 ? 95.547  68.160  5.556   1.00 79.65  ? 222 ARG B O   1 
ATOM   3420 C CB  . ARG B 1 244 ? 95.644  67.426  8.564   1.00 67.62  ? 222 ARG B CB  1 
ATOM   3421 C CG  . ARG B 1 244 ? 95.993  66.286  7.659   1.00 73.91  ? 222 ARG B CG  1 
ATOM   3422 C CD  . ARG B 1 244 ? 96.005  64.929  8.280   1.00 69.42  ? 222 ARG B CD  1 
ATOM   3423 N NE  . ARG B 1 244 ? 94.924  64.633  9.181   1.00 80.04  ? 222 ARG B NE  1 
ATOM   3424 C CZ  . ARG B 1 244 ? 94.023  63.678  8.951   1.00 96.56  ? 222 ARG B CZ  1 
ATOM   3425 N NH1 . ARG B 1 244 ? 94.077  62.971  7.814   1.00 75.61  ? 222 ARG B NH1 1 
ATOM   3426 N NH2 . ARG B 1 244 ? 93.058  63.432  9.851   1.00 113.41 ? 222 ARG B NH2 1 
ATOM   3427 N N   . ASP B 1 245 ? 93.993  69.573  6.321   1.00 81.61  ? 223 ASP B N   1 
ATOM   3428 C CA  . ASP B 1 245 ? 93.449  69.758  4.981   1.00 86.55  ? 223 ASP B CA  1 
ATOM   3429 C C   . ASP B 1 245 ? 94.204  70.836  4.234   1.00 87.81  ? 223 ASP B C   1 
ATOM   3430 O O   . ASP B 1 245 ? 94.457  70.692  3.031   1.00 92.67  ? 223 ASP B O   1 
ATOM   3431 C CB  . ASP B 1 245 ? 91.966  70.127  5.035   1.00 91.94  ? 223 ASP B CB  1 
ATOM   3432 C CG  . ASP B 1 245 ? 91.084  68.951  5.358   1.00 101.15 ? 223 ASP B CG  1 
ATOM   3433 O OD1 . ASP B 1 245 ? 91.597  67.820  5.517   1.00 108.88 ? 223 ASP B OD1 1 
ATOM   3434 O OD2 . ASP B 1 245 ? 89.867  69.170  5.469   1.00 108.46 ? 223 ASP B OD2 1 
ATOM   3435 N N   . ASN B 1 246 ? 94.583  71.913  4.935   1.00 78.15  ? 224 ASN B N   1 
ATOM   3436 C CA  . ASN B 1 246 ? 95.489  72.869  4.329   1.00 73.42  ? 224 ASN B CA  1 
ATOM   3437 C C   . ASN B 1 246 ? 96.802  72.193  4.005   1.00 75.55  ? 224 ASN B C   1 
ATOM   3438 O O   . ASN B 1 246 ? 97.419  72.501  2.988   1.00 77.99  ? 224 ASN B O   1 
ATOM   3439 C CB  . ASN B 1 246 ? 95.706  74.074  5.246   1.00 75.11  ? 224 ASN B CB  1 
ATOM   3440 C CG  . ASN B 1 246 ? 94.567  75.077  5.181   1.00 74.43  ? 224 ASN B CG  1 
ATOM   3441 O OD1 . ASN B 1 246 ? 93.762  75.060  4.252   1.00 69.21  ? 224 ASN B OD1 1 
ATOM   3442 N ND2 . ASN B 1 246 ? 94.513  75.977  6.159   1.00 77.21  ? 224 ASN B ND2 1 
ATOM   3443 N N   . LEU B 1 247 ? 97.227  71.249  4.843   1.00 74.31  ? 225 LEU B N   1 
ATOM   3444 C CA  . LEU B 1 247 ? 98.412  70.460  4.536   1.00 75.92  ? 225 LEU B CA  1 
ATOM   3445 C C   . LEU B 1 247 ? 98.193  69.600  3.292   1.00 70.64  ? 225 LEU B C   1 
ATOM   3446 O O   . LEU B 1 247 ? 98.933  69.711  2.309   1.00 78.33  ? 225 LEU B O   1 
ATOM   3447 C CB  . LEU B 1 247 ? 98.783  69.611  5.751   1.00 84.76  ? 225 LEU B CB  1 
ATOM   3448 C CG  . LEU B 1 247 ? 99.769  70.301  6.687   1.00 84.50  ? 225 LEU B CG  1 
ATOM   3449 C CD1 . LEU B 1 247 ? 99.936  69.526  7.985   1.00 90.54  ? 225 LEU B CD1 1 
ATOM   3450 C CD2 . LEU B 1 247 ? 101.091 70.467  5.977   1.00 82.10  ? 225 LEU B CD2 1 
ATOM   3451 N N   . THR B 1 248 ? 97.155  68.760  3.303   1.00 72.22  ? 226 THR B N   1 
ATOM   3452 C CA  . THR B 1 248 ? 96.884  67.869  2.172   1.00 82.40  ? 226 THR B CA  1 
ATOM   3453 C C   . THR B 1 248 ? 96.663  68.631  0.864   1.00 85.09  ? 226 THR B C   1 
ATOM   3454 O O   . THR B 1 248 ? 97.105  68.185  -0.202  1.00 82.51  ? 226 THR B O   1 
ATOM   3455 C CB  . THR B 1 248 ? 95.671  66.992  2.475   1.00 79.72  ? 226 THR B CB  1 
ATOM   3456 O OG1 . THR B 1 248 ? 95.871  66.301  3.723   1.00 83.08  ? 226 THR B OG1 1 
ATOM   3457 C CG2 . THR B 1 248 ? 95.418  66.012  1.333   1.00 66.92  ? 226 THR B CG2 1 
ATOM   3458 N N   . LEU B 1 249 ? 95.982  69.777  0.921   1.00 85.80  ? 227 LEU B N   1 
ATOM   3459 C CA  . LEU B 1 249 ? 95.811  70.594  -0.277  1.00 81.06  ? 227 LEU B CA  1 
ATOM   3460 C C   . LEU B 1 249 ? 97.154  71.106  -0.777  1.00 89.49  ? 227 LEU B C   1 
ATOM   3461 O O   . LEU B 1 249 ? 97.462  71.023  -1.972  1.00 98.75  ? 227 LEU B O   1 
ATOM   3462 C CB  . LEU B 1 249 ? 94.886  71.780  0.025   1.00 77.76  ? 227 LEU B CB  1 
ATOM   3463 C CG  . LEU B 1 249 ? 94.874  72.950  -0.968  1.00 80.35  ? 227 LEU B CG  1 
ATOM   3464 C CD1 . LEU B 1 249 ? 94.515  72.461  -2.353  1.00 83.83  ? 227 LEU B CD1 1 
ATOM   3465 C CD2 . LEU B 1 249 ? 93.935  74.059  -0.547  1.00 81.05  ? 227 LEU B CD2 1 
ATOM   3466 N N   . TRP B 1 250 ? 97.977  71.613  0.140   1.00 87.85  ? 228 TRP B N   1 
ATOM   3467 C CA  . TRP B 1 250 ? 99.166  72.355  -0.241  1.00 90.58  ? 228 TRP B CA  1 
ATOM   3468 C C   . TRP B 1 250 ? 100.273 71.475  -0.793  1.00 96.28  ? 228 TRP B C   1 
ATOM   3469 O O   . TRP B 1 250 ? 101.151 71.988  -1.494  1.00 101.08 ? 228 TRP B O   1 
ATOM   3470 C CB  . TRP B 1 250 ? 99.691  73.143  0.948   1.00 90.63  ? 228 TRP B CB  1 
ATOM   3471 C CG  . TRP B 1 250 ? 98.815  74.298  1.347   1.00 92.35  ? 228 TRP B CG  1 
ATOM   3472 C CD1 . TRP B 1 250 ? 97.802  74.875  0.613   1.00 91.33  ? 228 TRP B CD1 1 
ATOM   3473 C CD2 . TRP B 1 250 ? 98.893  75.036  2.572   1.00 90.11  ? 228 TRP B CD2 1 
ATOM   3474 N NE1 . TRP B 1 250 ? 97.239  75.921  1.323   1.00 85.94  ? 228 TRP B NE1 1 
ATOM   3475 C CE2 . TRP B 1 250 ? 97.893  76.038  2.523   1.00 85.72  ? 228 TRP B CE2 1 
ATOM   3476 C CE3 . TRP B 1 250 ? 99.712  74.943  3.708   1.00 82.76  ? 228 TRP B CE3 1 
ATOM   3477 C CZ2 . TRP B 1 250 ? 97.705  76.940  3.553   1.00 85.80  ? 228 TRP B CZ2 1 
ATOM   3478 C CZ3 . TRP B 1 250 ? 99.525  75.833  4.721   1.00 78.26  ? 228 TRP B CZ3 1 
ATOM   3479 C CH2 . TRP B 1 250 ? 98.527  76.823  4.640   1.00 87.57  ? 228 TRP B CH2 1 
ATOM   3480 N N   . THR B 1 251 ? 100.275 70.183  -0.479  1.00 98.08  ? 229 THR B N   1 
ATOM   3481 C CA  . THR B 1 251 ? 101.310 69.283  -0.966  1.00 108.47 ? 229 THR B CA  1 
ATOM   3482 C C   . THR B 1 251 ? 100.855 68.432  -2.155  1.00 115.91 ? 229 THR B C   1 
ATOM   3483 O O   . THR B 1 251 ? 101.554 67.487  -2.533  1.00 120.04 ? 229 THR B O   1 
ATOM   3484 C CB  . THR B 1 251 ? 101.808 68.395  0.179   1.00 106.27 ? 229 THR B CB  1 
ATOM   3485 O OG1 . THR B 1 251 ? 100.820 67.403  0.478   1.00 111.99 ? 229 THR B OG1 1 
ATOM   3486 C CG2 . THR B 1 251 ? 102.093 69.235  1.435   1.00 92.58  ? 229 THR B CG2 1 
ATOM   3487 N N   . SER B 1 252 ? 99.713  68.748  -2.757  1.00 119.74 ? 230 SER B N   1 
ATOM   3488 C CA  . SER B 1 252 ? 99.289  68.079  -3.983  1.00 120.02 ? 230 SER B CA  1 
ATOM   3489 C C   . SER B 1 252 ? 98.998  69.093  -5.081  1.00 118.26 ? 230 SER B C   1 
ATOM   3490 O O   . SER B 1 252 ? 99.873  69.853  -5.487  1.00 121.03 ? 230 SER B O   1 
ATOM   3491 C CB  . SER B 1 252 ? 98.056  67.212  -3.724  1.00 120.32 ? 230 SER B CB  1 
ATOM   3492 N N   . TRP C 2 2   ? 57.288  70.748  5.832   1.00 109.17 ? 332 TRP C N   1 
ATOM   3493 C CA  . TRP C 2 2   ? 57.972  71.645  4.908   1.00 108.84 ? 332 TRP C CA  1 
ATOM   3494 C C   . TRP C 2 2   ? 57.133  72.923  4.661   1.00 114.32 ? 332 TRP C C   1 
ATOM   3495 O O   . TRP C 2 2   ? 56.415  73.382  5.555   1.00 121.06 ? 332 TRP C O   1 
ATOM   3496 C CB  . TRP C 2 2   ? 58.285  70.897  3.600   1.00 95.35  ? 332 TRP C CB  1 
ATOM   3497 N N   . ARG C 2 3   ? 57.185  73.490  3.469   1.00 108.48 ? 333 ARG C N   1 
ATOM   3498 C CA  . ARG C 2 3   ? 56.377  74.643  3.175   1.00 98.39  ? 333 ARG C CA  1 
ATOM   3499 C C   . ARG C 2 3   ? 55.967  74.726  1.744   1.00 92.56  ? 333 ARG C C   1 
ATOM   3500 O O   . ARG C 2 3   ? 56.459  74.030  0.937   1.00 92.96  ? 333 ARG C O   1 
ATOM   3501 C CB  . ARG C 2 3   ? 57.116  75.854  3.538   1.00 98.22  ? 333 ARG C CB  1 
ATOM   3502 C CG  . ARG C 2 3   ? 58.462  75.871  2.935   1.00 110.86 ? 333 ARG C CG  1 
ATOM   3503 C CD  . ARG C 2 3   ? 59.284  76.819  3.762   1.00 123.38 ? 333 ARG C CD  1 
ATOM   3504 N NE  . ARG C 2 3   ? 59.225  78.154  3.221   1.00 132.30 ? 333 ARG C NE  1 
ATOM   3505 C CZ  . ARG C 2 3   ? 58.192  78.945  3.372   1.00 128.41 ? 333 ARG C CZ  1 
ATOM   3506 N NH1 . ARG C 2 3   ? 57.168  78.527  4.047   1.00 121.39 ? 333 ARG C NH1 1 
ATOM   3507 N NH2 . ARG C 2 3   ? 58.180  80.132  2.832   1.00 129.67 ? 333 ARG C NH2 1 
ATOM   3508 N N   . SER C 2 4   ? 55.078  75.632  1.422   1.00 89.16  ? 334 SER C N   1 
ATOM   3509 C CA  . SER C 2 4   ? 54.540  75.708  0.070   1.00 84.02  ? 334 SER C CA  1 
ATOM   3510 C C   . SER C 2 4   ? 55.556  76.331  -0.881  1.00 77.35  ? 334 SER C C   1 
ATOM   3511 O O   . SER C 2 4   ? 56.125  77.400  -0.599  1.00 63.95  ? 334 SER C O   1 
ATOM   3512 C CB  . SER C 2 4   ? 53.236  76.502  0.042   1.00 84.88  ? 334 SER C CB  1 
ATOM   3513 O OG  . SER C 2 4   ? 52.297  75.952  0.939   1.00 86.57  ? 334 SER C OG  1 
ATOM   3514 N N   . MET C 2 5   ? 55.762  75.650  -2.016  1.00 68.93  ? 335 MET C N   1 
ATOM   3515 C CA  . MET C 2 5   ? 56.680  76.070  -3.070  1.00 55.51  ? 335 MET C CA  1 
ATOM   3516 C C   . MET C 2 5   ? 56.047  77.055  -4.052  1.00 56.16  ? 335 MET C C   1 
ATOM   3517 O O   . MET C 2 5   ? 54.842  76.978  -4.352  1.00 57.97  ? 335 MET C O   1 
ATOM   3518 C CB  . MET C 2 5   ? 57.214  74.862  -3.856  1.00 63.96  ? 335 MET C CB  1 
ATOM   3519 C CG  . MET C 2 5   ? 58.247  73.979  -3.162  1.00 84.89  ? 335 MET C CG  1 
ATOM   3520 S SD  . MET C 2 5   ? 59.872  74.738  -2.847  1.00 111.33 ? 335 MET C SD  1 
ATOM   3521 C CE  . MET C 2 5   ? 60.089  75.879  -4.222  1.00 119.04 ? 335 MET C CE  1 
HETATM 3522 N N   . TPO C 2 6   ? 56.882  77.964  -4.565  1.00 54.09  ? 336 TPO C N   1 
HETATM 3523 C CA  . TPO C 2 6   ? 56.479  78.997  -5.525  1.00 59.37  ? 336 TPO C CA  1 
HETATM 3524 C CB  . TPO C 2 6   ? 56.032  80.285  -4.775  1.00 53.89  ? 336 TPO C CB  1 
HETATM 3525 C CG2 . TPO C 2 6   ? 54.637  80.032  -4.226  1.00 56.05  ? 336 TPO C CG2 1 
HETATM 3526 O OG1 . TPO C 2 6   ? 56.840  80.552  -3.648  1.00 56.55  ? 336 TPO C OG1 1 
HETATM 3527 P P   . TPO C 2 6   ? 56.942  82.124  -3.317  1.00 63.31  ? 336 TPO C P   1 
HETATM 3528 O O1P . TPO C 2 6   ? 56.441  82.990  -4.556  1.00 59.85  ? 336 TPO C O1P 1 
HETATM 3529 O O2P . TPO C 2 6   ? 58.444  82.571  -2.966  1.00 64.61  ? 336 TPO C O2P 1 
HETATM 3530 O O3P . TPO C 2 6   ? 56.128  82.369  -2.104  1.00 98.63  ? 336 TPO C O3P 1 
HETATM 3531 C C   . TPO C 2 6   ? 57.598  79.306  -6.545  1.00 66.47  ? 336 TPO C C   1 
HETATM 3532 O O   . TPO C 2 6   ? 58.763  79.007  -6.309  1.00 79.86  ? 336 TPO C O   1 
ATOM   3533 N N   . VAL C 2 7   ? 57.235  79.875  -7.694  1.00 76.06  ? 337 VAL C N   1 
ATOM   3534 C CA  . VAL C 2 7   ? 58.190  80.181  -8.772  1.00 83.54  ? 337 VAL C CA  1 
ATOM   3535 C C   . VAL C 2 7   ? 57.796  81.461  -9.497  1.00 88.99  ? 337 VAL C C   1 
ATOM   3536 O O   . VAL C 2 7   ? 56.615  81.768  -9.644  1.00 96.46  ? 337 VAL C O   1 
ATOM   3537 C CB  . VAL C 2 7   ? 58.290  79.051  -9.833  1.00 60.23  ? 337 VAL C CB  1 
ATOM   3538 C CG1 . VAL C 2 7   ? 58.762  77.715  -9.261  1.00 58.73  ? 337 VAL C CG1 1 
ATOM   3539 C CG2 . VAL C 2 7   ? 56.966  78.883  -10.545 1.00 62.05  ? 337 VAL C CG2 1 
ATOM   3540 N N   . VAL C 2 8   ? 58.791  82.194  -9.977  1.00 99.18  ? 338 VAL C N   1 
ATOM   3541 C CA  . VAL C 2 8   ? 58.570  83.302  -10.900 1.00 108.02 ? 338 VAL C CA  1 
ATOM   3542 C C   . VAL C 2 8   ? 59.203  82.823  -12.199 1.00 116.58 ? 338 VAL C C   1 
ATOM   3543 O O   . VAL C 2 8   ? 60.092  83.488  -12.754 1.00 133.88 ? 338 VAL C O   1 
ATOM   3544 C CB  . VAL C 2 8   ? 59.167  84.612  -10.353 1.00 117.56 ? 338 VAL C CB  1 
ATOM   3545 C CG1 . VAL C 2 8   ? 60.625  84.411  -9.910  1.00 115.78 ? 338 VAL C CG1 1 
ATOM   3546 C CG2 . VAL C 2 8   ? 58.986  85.798  -11.333 1.00 123.88 ? 338 VAL C CG2 1 
ATOM   3547 N N   . PRO C 2 9   ? 58.722  81.702  -12.750 1.00 98.97  ? 339 PRO C N   1 
ATOM   3548 C CA  . PRO C 2 9   ? 59.641  80.707  -13.322 1.00 86.47  ? 339 PRO C CA  1 
ATOM   3549 C C   . PRO C 2 9   ? 60.713  81.327  -14.194 1.00 104.69 ? 339 PRO C C   1 
ATOM   3550 O O   . PRO C 2 9   ? 60.420  81.861  -15.267 1.00 121.72 ? 339 PRO C O   1 
ATOM   3551 C CB  . PRO C 2 9   ? 58.709  79.778  -14.107 1.00 69.35  ? 339 PRO C CB  1 
ATOM   3552 C CG  . PRO C 2 9   ? 57.533  80.623  -14.434 1.00 81.37  ? 339 PRO C CG  1 
ATOM   3553 C CD  . PRO C 2 9   ? 57.349  81.539  -13.257 1.00 87.06  ? 339 PRO C CD  1 
ATOM   3554 N N   . TYR C 2 10  ? 61.950  81.332  -13.695 1.00 110.46 ? 340 TYR C N   1 
ATOM   3555 C CA  . TYR C 2 10  ? 63.080  81.766  -14.501 1.00 112.27 ? 340 TYR C CA  1 
ATOM   3556 C C   . TYR C 2 10  ? 63.160  80.905  -15.753 1.00 107.50 ? 340 TYR C C   1 
ATOM   3557 O O   . TYR C 2 10  ? 63.272  79.677  -15.662 1.00 108.10 ? 340 TYR C O   1 
ATOM   3558 C CB  . TYR C 2 10  ? 64.388  81.662  -13.716 1.00 121.37 ? 340 TYR C CB  1 
ATOM   3559 C CG  . TYR C 2 10  ? 64.401  82.168  -12.282 1.00 123.33 ? 340 TYR C CG  1 
ATOM   3560 C CD1 . TYR C 2 10  ? 63.966  83.450  -11.960 1.00 121.40 ? 340 TYR C CD1 1 
ATOM   3561 C CD2 . TYR C 2 10  ? 64.929  81.383  -11.261 1.00 121.79 ? 340 TYR C CD2 1 
ATOM   3562 C CE1 . TYR C 2 10  ? 64.015  83.914  -10.651 1.00 118.13 ? 340 TYR C CE1 1 
ATOM   3563 C CE2 . TYR C 2 10  ? 64.986  81.838  -9.960  1.00 116.44 ? 340 TYR C CE2 1 
ATOM   3564 C CZ  . TYR C 2 10  ? 64.528  83.103  -9.658  1.00 119.86 ? 340 TYR C CZ  1 
ATOM   3565 O OH  . TYR C 2 10  ? 64.585  83.557  -8.357  1.00 130.70 ? 340 TYR C OH  1 
ATOM   3566 N N   . LEU C 2 11  ? 63.080  81.549  -16.917 1.00 110.51 ? 341 LEU C N   1 
ATOM   3567 C CA  . LEU C 2 11  ? 63.130  80.861  -18.209 1.00 117.58 ? 341 LEU C CA  1 
ATOM   3568 C C   . LEU C 2 11  ? 64.380  81.272  -18.964 1.00 107.84 ? 341 LEU C C   1 
ATOM   3569 O O   . LEU C 2 11  ? 64.657  82.461  -19.082 1.00 112.78 ? 341 LEU C O   1 
ATOM   3570 C CB  . LEU C 2 11  ? 61.884  81.176  -19.053 1.00 111.25 ? 341 LEU C CB  1 
ATOM   3571 C CG  . LEU C 2 11  ? 60.503  80.742  -18.545 1.00 99.80  ? 341 LEU C CG  1 
ATOM   3572 C CD1 . LEU C 2 11  ? 59.486  80.747  -19.673 1.00 102.51 ? 341 LEU C CD1 1 
ATOM   3573 C CD2 . LEU C 2 11  ? 60.548  79.372  -17.872 1.00 93.87  ? 341 LEU C CD2 1 
ATOM   3574 N N   . TRP D 2 2   ? 89.223  74.498  -4.724  1.00 113.81 ? 332 TRP D N   1 
ATOM   3575 C CA  . TRP D 2 2   ? 89.375  74.474  -3.271  1.00 111.40 ? 332 TRP D CA  1 
ATOM   3576 C C   . TRP D 2 2   ? 90.518  75.407  -2.801  1.00 115.93 ? 332 TRP D C   1 
ATOM   3577 O O   . TRP D 2 2   ? 91.652  75.328  -3.298  1.00 115.07 ? 332 TRP D O   1 
ATOM   3578 C CB  . TRP D 2 2   ? 89.609  73.036  -2.793  1.00 105.83 ? 332 TRP D CB  1 
ATOM   3579 N N   . ARG D 2 3   ? 90.205  76.279  -1.832  1.00 112.93 ? 333 ARG D N   1 
ATOM   3580 C CA  . ARG D 2 3   ? 91.070  77.363  -1.379  1.00 104.08 ? 333 ARG D CA  1 
ATOM   3581 C C   . ARG D 2 3   ? 91.744  77.011  -0.053  1.00 102.29 ? 333 ARG D C   1 
ATOM   3582 O O   . ARG D 2 3   ? 91.516  75.950  0.536   1.00 107.45 ? 333 ARG D O   1 
ATOM   3583 C CB  . ARG D 2 3   ? 90.273  78.659  -1.228  1.00 103.42 ? 333 ARG D CB  1 
ATOM   3584 C CG  . ARG D 2 3   ? 89.797  79.289  -2.527  1.00 113.31 ? 333 ARG D CG  1 
ATOM   3585 C CD  . ARG D 2 3   ? 88.849  80.460  -2.262  1.00 123.11 ? 333 ARG D CD  1 
ATOM   3586 N NE  . ARG D 2 3   ? 88.918  80.938  -0.876  1.00 128.55 ? 333 ARG D NE  1 
ATOM   3587 C CZ  . ARG D 2 3   ? 89.652  81.970  -0.461  1.00 129.00 ? 333 ARG D CZ  1 
ATOM   3588 N NH1 . ARG D 2 3   ? 90.400  82.649  -1.324  1.00 134.19 ? 333 ARG D NH1 1 
ATOM   3589 N NH2 . ARG D 2 3   ? 89.641  82.323  0.821   1.00 122.54 ? 333 ARG D NH2 1 
ATOM   3590 N N   . SER D 2 4   ? 92.598  77.926  0.409   1.00 93.59  ? 334 SER D N   1 
ATOM   3591 C CA  . SER D 2 4   ? 93.154  77.838  1.751   1.00 93.93  ? 334 SER D CA  1 
ATOM   3592 C C   . SER D 2 4   ? 92.048  78.112  2.767   1.00 95.58  ? 334 SER D C   1 
ATOM   3593 O O   . SER D 2 4   ? 91.329  79.113  2.655   1.00 89.55  ? 334 SER D O   1 
ATOM   3594 C CB  . SER D 2 4   ? 94.300  78.850  1.940   1.00 99.55  ? 334 SER D CB  1 
ATOM   3595 O OG  . SER D 2 4   ? 95.412  78.622  1.082   1.00 97.06  ? 334 SER D OG  1 
ATOM   3596 N N   . MET D 2 5   ? 91.917  77.231  3.763   1.00 92.67  ? 335 MET D N   1 
ATOM   3597 C CA  . MET D 2 5   ? 90.898  77.388  4.816   1.00 83.31  ? 335 MET D CA  1 
ATOM   3598 C C   . MET D 2 5   ? 91.396  78.112  6.076   1.00 77.99  ? 335 MET D C   1 
ATOM   3599 O O   . MET D 2 5   ? 92.568  78.013  6.451   1.00 77.34  ? 335 MET D O   1 
ATOM   3600 C CB  . MET D 2 5   ? 90.330  76.027  5.196   1.00 82.93  ? 335 MET D CB  1 
ATOM   3601 C CG  . MET D 2 5   ? 89.677  75.346  4.015   1.00 98.44  ? 335 MET D CG  1 
ATOM   3602 S SD  . MET D 2 5   ? 88.125  74.575  4.470   1.00 113.59 ? 335 MET D SD  1 
ATOM   3603 C CE  . MET D 2 5   ? 87.328  75.923  5.355   1.00 104.95 ? 335 MET D CE  1 
HETATM 3604 N N   . TPO D 2 6   ? 90.484  78.846  6.713   1.00 70.76  ? 336 TPO D N   1 
HETATM 3605 C CA  . TPO D 2 6   ? 90.800  79.743  7.828   1.00 79.80  ? 336 TPO D CA  1 
HETATM 3606 C CB  . TPO D 2 6   ? 91.129  81.159  7.315   1.00 72.93  ? 336 TPO D CB  1 
HETATM 3607 C CG2 . TPO D 2 6   ? 92.465  81.171  6.558   1.00 79.83  ? 336 TPO D CG2 1 
HETATM 3608 O OG1 . TPO D 2 6   ? 90.049  81.558  6.486   1.00 71.63  ? 336 TPO D OG1 1 
HETATM 3609 P P   . TPO D 2 6   ? 89.842  83.151  6.356   1.00 77.55  ? 336 TPO D P   1 
HETATM 3610 O O1P . TPO D 2 6   ? 90.735  83.616  5.265   1.00 77.29  ? 336 TPO D O1P 1 
HETATM 3611 O O2P . TPO D 2 6   ? 88.302  83.449  5.956   1.00 76.50  ? 336 TPO D O2P 1 
HETATM 3612 O O3P . TPO D 2 6   ? 90.082  84.029  7.683   1.00 78.50  ? 336 TPO D O3P 1 
HETATM 3613 C C   . TPO D 2 6   ? 89.635  79.803  8.808   1.00 87.65  ? 336 TPO D C   1 
HETATM 3614 O O   . TPO D 2 6   ? 88.504  79.479  8.456   1.00 97.94  ? 336 TPO D O   1 
ATOM   3615 N N   . VAL D 2 7   ? 89.899  80.232  10.037  1.00 89.40  ? 337 VAL D N   1 
ATOM   3616 C CA  . VAL D 2 7   ? 88.848  80.277  11.045  1.00 87.21  ? 337 VAL D CA  1 
ATOM   3617 C C   . VAL D 2 7   ? 88.745  81.599  11.794  1.00 91.75  ? 337 VAL D C   1 
ATOM   3618 O O   . VAL D 2 7   ? 89.072  82.672  11.258  1.00 89.32  ? 337 VAL D O   1 
ATOM   3619 C CB  . VAL D 2 7   ? 89.016  79.142  12.078  1.00 85.25  ? 337 VAL D CB  1 
ATOM   3620 C CG1 . VAL D 2 7   ? 88.669  77.801  11.460  1.00 77.49  ? 337 VAL D CG1 1 
ATOM   3621 C CG2 . VAL D 2 7   ? 90.424  79.142  12.675  1.00 76.23  ? 337 VAL D CG2 1 
ATOM   3622 N N   . VAL D 2 8   ? 88.223  81.458  13.017  1.00 97.12  ? 338 VAL D N   1 
ATOM   3623 C CA  . VAL D 2 8   ? 88.108  82.448  14.092  1.00 106.94 ? 338 VAL D CA  1 
ATOM   3624 C C   . VAL D 2 8   ? 87.568  81.679  15.303  1.00 120.64 ? 338 VAL D C   1 
ATOM   3625 O O   . VAL D 2 8   ? 86.406  81.850  15.694  1.00 129.56 ? 338 VAL D O   1 
ATOM   3626 C CB  . VAL D 2 8   ? 87.240  83.658  13.676  1.00 106.62 ? 338 VAL D CB  1 
ATOM   3627 C CG1 . VAL D 2 8   ? 85.903  83.238  13.013  1.00 100.56 ? 338 VAL D CG1 1 
ATOM   3628 C CG2 . VAL D 2 8   ? 87.019  84.635  14.852  1.00 110.02 ? 338 VAL D CG2 1 
ATOM   3629 N N   . PRO D 2 9   ? 88.409  80.857  15.955  1.00 133.46 ? 339 PRO D N   1 
ATOM   3630 C CA  . PRO D 2 9   ? 87.959  79.841  16.929  1.00 149.55 ? 339 PRO D CA  1 
ATOM   3631 C C   . PRO D 2 9   ? 86.477  79.487  17.112  1.00 165.76 ? 339 PRO D C   1 
ATOM   3632 O O   . PRO D 2 9   ? 86.163  78.291  17.125  1.00 174.00 ? 339 PRO D O   1 
ATOM   3633 C CB  . PRO D 2 9   ? 88.537  80.398  18.236  1.00 155.06 ? 339 PRO D CB  1 
ATOM   3634 C CG  . PRO D 2 9   ? 89.836  81.127  17.776  1.00 147.72 ? 339 PRO D CG  1 
ATOM   3635 C CD  . PRO D 2 9   ? 89.783  81.267  16.263  1.00 136.86 ? 339 PRO D CD  1 
ATOM   3636 N N   . TYR D 2 10  ? 85.574  80.466  17.287  1.00 162.90 ? 340 TYR D N   1 
ATOM   3637 C CA  . TYR D 2 10  ? 84.190  80.225  17.716  1.00 159.36 ? 340 TYR D CA  1 
ATOM   3638 C C   . TYR D 2 10  ? 84.173  79.535  19.078  1.00 161.22 ? 340 TYR D C   1 
ATOM   3639 O O   . TYR D 2 10  ? 84.152  78.301  19.152  1.00 161.01 ? 340 TYR D O   1 
ATOM   3640 C CB  . TYR D 2 10  ? 83.393  79.373  16.709  1.00 152.30 ? 340 TYR D CB  1 
ATOM   3641 C CG  . TYR D 2 10  ? 82.933  80.074  15.436  1.00 151.45 ? 340 TYR D CG  1 
ATOM   3642 C CD1 . TYR D 2 10  ? 82.351  79.353  14.394  1.00 150.55 ? 340 TYR D CD1 1 
ATOM   3643 C CD2 . TYR D 2 10  ? 83.085  81.444  15.269  1.00 149.88 ? 340 TYR D CD2 1 
ATOM   3644 C CE1 . TYR D 2 10  ? 81.938  79.979  13.226  1.00 147.58 ? 340 TYR D CE1 1 
ATOM   3645 C CE2 . TYR D 2 10  ? 82.680  82.074  14.102  1.00 145.47 ? 340 TYR D CE2 1 
ATOM   3646 C CZ  . TYR D 2 10  ? 82.105  81.342  13.089  1.00 144.22 ? 340 TYR D CZ  1 
ATOM   3647 O OH  . TYR D 2 10  ? 81.704  81.981  11.939  1.00 142.77 ? 340 TYR D OH  1 
ATOM   3648 N N   . LEU D 2 11  ? 84.177  80.316  20.156  1.00 157.90 ? 341 LEU D N   1 
ATOM   3649 C CA  . LEU D 2 11  ? 84.182  79.764  21.510  1.00 150.27 ? 341 LEU D CA  1 
ATOM   3650 C C   . LEU D 2 11  ? 82.775  79.375  21.963  1.00 150.05 ? 341 LEU D C   1 
ATOM   3651 O O   . LEU D 2 11  ? 82.560  78.995  23.117  1.00 155.93 ? 341 LEU D O   1 
ATOM   3652 C CB  . LEU D 2 11  ? 84.793  80.769  22.489  1.00 150.55 ? 341 LEU D CB  1 
HETATM 3653 O O   . HOH E 3 .   ? 55.182  63.746  -4.324  1.00 57.80  ? 301 HOH A O   1 
HETATM 3654 O O   . HOH E 3 .   ? 45.369  75.540  -15.406 1.00 67.08  ? 302 HOH A O   1 
HETATM 3655 O O   . HOH E 3 .   ? 58.864  102.550 -1.028  1.00 68.79  ? 303 HOH A O   1 
HETATM 3656 O O   . HOH E 3 .   ? 46.061  63.759  6.588   1.00 60.43  ? 304 HOH A O   1 
HETATM 3657 O O   . HOH E 3 .   ? 68.609  82.688  -13.438 1.00 69.48  ? 305 HOH A O   1 
HETATM 3658 O O   . HOH E 3 .   ? 47.285  64.156  -9.380  1.00 69.45  ? 306 HOH A O   1 
HETATM 3659 O O   . HOH F 3 .   ? 76.402  91.937  4.774   1.00 61.36  ? 301 HOH B O   1 
HETATM 3660 O O   . HOH F 3 .   ? 76.765  82.840  11.236  1.00 86.24  ? 302 HOH B O   1 
HETATM 3661 O O   . HOH F 3 .   ? 101.460 64.973  10.174  1.00 59.75  ? 303 HOH B O   1 
HETATM 3662 O O   . HOH F 3 .   ? 97.242  61.966  24.753  1.00 76.37  ? 304 HOH B O   1 
HETATM 3663 O O   . HOH F 3 .   ? 98.447  94.114  28.864  1.00 70.85  ? 305 HOH B O   1 
HETATM 3664 O O   . HOH F 3 .   ? 80.538  84.798  4.544   1.00 82.13  ? 306 HOH B O   1 
HETATM 3665 O O   . HOH F 3 .   ? 99.534  94.283  23.983  1.00 66.72  ? 307 HOH B O   1 
HETATM 3666 O O   . HOH F 3 .   ? 110.307 82.589  5.616   1.00 66.05  ? 308 HOH B O   1 
HETATM 3667 O O   . HOH F 3 .   ? 73.615  77.428  13.344  1.00 84.68  ? 309 HOH B O   1 
HETATM 3668 O O   . HOH G 3 .   ? 62.016  80.429  -9.741  1.00 55.86  ? 401 HOH C O   1 
HETATM 3669 O O   . HOH H 3 .   ? 91.148  82.178  2.920   1.00 63.06  ? 401 HOH D O   1 
HETATM 3670 O O   . HOH H 3 .   ? 79.204  80.561  16.169  1.00 69.89  ? 402 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
6    N N   . MET A 23  ? 2.8055 2.8099 2.8147 -0.3021 0.3188  0.2355  1   MET A N   
7    C CA  . MET A 23  ? 2.6232 2.5720 2.5429 -0.2684 0.3176  0.2356  1   MET A CA  
8    C C   . MET A 23  ? 2.4997 2.4776 2.3299 -0.2196 0.3475  0.2524  1   MET A C   
9    O O   . MET A 23  ? 2.5655 2.5036 2.3126 -0.1858 0.3401  0.2414  1   MET A O   
10   C CB  . MET A 23  ? 2.5577 2.4522 2.5102 -0.2837 0.3237  0.2822  1   MET A CB  
11   C CG  . MET A 23  ? 2.4699 2.3068 2.3327 -0.2474 0.3252  0.2899  1   MET A CG  
12   S SD  . MET A 23  ? 2.3398 2.1226 2.1411 -0.2317 0.2744  0.2146  1   MET A SD  
13   C CE  . MET A 23  ? 2.2989 2.0675 1.9780 -0.1751 0.2912  0.2262  1   MET A CE  
14   N N   . ASP A 24  ? 2.2973 2.3444 2.1409 -0.2107 0.3760  0.2736  2   ASP A N   
15   C CA  . ASP A 24  ? 2.1439 2.2192 1.8991 -0.1550 0.3990  0.2839  2   ASP A CA  
16   C C   . ASP A 24  ? 2.0297 2.0880 1.7198 -0.1322 0.3631  0.2207  2   ASP A C   
17   O O   . ASP A 24  ? 1.9886 2.0725 1.7145 -0.1516 0.3443  0.1867  2   ASP A O   
18   C CB  . ASP A 24  ? 2.0723 2.2333 1.8668 -0.1494 0.4372  0.3231  2   ASP A CB  
19   C CG  . ASP A 24  ? 2.0993 2.2957 1.8043 -0.0822 0.4680  0.3482  2   ASP A CG  
20   O OD1 . ASP A 24  ? 2.1079 2.3834 1.8393 -0.0679 0.5071  0.3938  2   ASP A OD1 
21   O OD2 . ASP A 24  ? 2.1285 2.2785 1.7374 -0.0399 0.4510  0.3218  2   ASP A OD2 
22   N N   . LYS A 25  ? 1.9476 1.9651 1.5468 -0.0908 0.3516  0.2083  3   LYS A N   
23   C CA  . LYS A 25  ? 1.7902 1.7858 1.3422 -0.0761 0.3102  0.1543  3   LYS A CA  
24   C C   . LYS A 25  ? 1.7309 1.7691 1.2652 -0.0513 0.3094  0.1390  3   LYS A C   
25   O O   . LYS A 25  ? 1.6610 1.7051 1.2144 -0.0661 0.2794  0.1027  3   LYS A O   
26   C CB  . LYS A 25  ? 1.6790 1.6219 1.1457 -0.0382 0.2933  0.1459  3   LYS A CB  
27   C CG  . LYS A 25  ? 1.4813 1.4001 0.9129 -0.0286 0.2445  0.0971  3   LYS A CG  
28   N N   . ASN A 26  ? 1.7568 1.8287 1.2533 -0.0090 0.3418  0.1687  4   ASN A N   
29   C CA  . ASN A 26  ? 1.7230 1.8334 1.1927 0.0259  0.3397  0.1525  4   ASN A CA  
30   C C   . ASN A 26  ? 1.5469 1.7152 1.1018 -0.0121 0.3518  0.1555  4   ASN A C   
31   O O   . ASN A 26  ? 1.4370 1.6293 0.9811 0.0066  0.3389  0.1312  4   ASN A O   
32   C CB  . ASN A 26  ? 1.8062 1.9477 1.2054 0.0928  0.3724  0.1837  4   ASN A CB  
33   C CG  . ASN A 26  ? 1.8543 1.9836 1.1696 0.1553  0.3408  0.1419  4   ASN A CG  
34   O OD1 . ASN A 26  ? 1.7956 1.8946 1.1181 0.1413  0.2956  0.0959  4   ASN A OD1 
35   N ND2 . ASN A 26  ? 1.9195 2.0727 1.1556 0.2281  0.3613  0.1591  4   ASN A ND2 
36   N N   . GLU A 27  ? 1.4954 1.6847 1.1350 -0.0619 0.3733  0.1850  5   GLU A N   
37   C CA  . GLU A 27  ? 1.4261 1.6707 1.1532 -0.0999 0.3794  0.1849  5   GLU A CA  
38   C C   . GLU A 27  ? 1.3673 1.5887 1.1241 -0.1335 0.3363  0.1344  5   GLU A C   
39   O O   . GLU A 27  ? 1.2380 1.4994 1.0257 -0.1407 0.3281  0.1153  5   GLU A O   
40   C CB  . GLU A 27  ? 1.3456 1.6185 1.1612 -0.1409 0.4100  0.2348  5   GLU A CB  
41   N N   . LEU A 28  ? 1.3578 1.5218 1.1020 -0.1487 0.3090  0.1146  6   LEU A N   
42   C CA  . LEU A 28  ? 1.1616 1.3174 0.9275 -0.1713 0.2704  0.0728  6   LEU A CA  
43   C C   . LEU A 28  ? 1.1752 1.3319 0.8937 -0.1430 0.2461  0.0470  6   LEU A C   
44   O O   . LEU A 28  ? 1.1511 1.3337 0.9021 -0.1578 0.2258  0.0251  6   LEU A O   
45   C CB  . LEU A 28  ? 1.0087 1.1127 0.7650 -0.1840 0.2481  0.0609  6   LEU A CB  
46   C CG  . LEU A 28  ? 1.1055 1.1904 0.9117 -0.2132 0.2570  0.0775  6   LEU A CG  
47   C CD1 . LEU A 28  ? 1.2463 1.2779 1.0239 -0.2120 0.2310  0.0602  6   LEU A CD1 
48   C CD2 . LEU A 28  ? 1.0676 1.1914 0.9604 -0.2493 0.2505  0.0656  6   LEU A CD2 
49   N N   . VAL A 29  ? 1.2123 1.3385 0.8549 -0.1002 0.2436  0.0494  7   VAL A N   
50   C CA  . VAL A 29  ? 1.1544 1.2713 0.7561 -0.0708 0.2132  0.0247  7   VAL A CA  
51   C C   . VAL A 29  ? 1.1286 1.2970 0.7454 -0.0558 0.2295  0.0269  7   VAL A C   
52   O O   . VAL A 29  ? 1.1184 1.2872 0.7297 -0.0450 0.2010  0.0046  7   VAL A O   
53   C CB  . VAL A 29  ? 1.1104 1.1752 0.6257 -0.0239 0.1985  0.0206  7   VAL A CB  
54   C CG1 . VAL A 29  ? 1.1327 1.1823 0.6035 0.0163  0.1651  -0.0046 7   VAL A CG1 
55   C CG2 . VAL A 29  ? 1.0647 1.0829 0.5710 -0.0404 0.1724  0.0126  7   VAL A CG2 
56   N N   . GLN A 30  ? 1.0622 1.2772 0.7015 -0.0536 0.2740  0.0577  8   GLN A N   
57   C CA  . GLN A 30  ? 1.0928 1.3703 0.7563 -0.0414 0.2916  0.0622  8   GLN A CA  
58   C C   . GLN A 30  ? 1.0711 1.3836 0.8162 -0.0886 0.2811  0.0483  8   GLN A C   
59   O O   . GLN A 30  ? 1.0681 1.4061 0.8194 -0.0783 0.2678  0.0310  8   GLN A O   
60   C CB  . GLN A 30  ? 1.1846 1.5174 0.8590 -0.0259 0.3439  0.1081  8   GLN A CB  
61   N N   . LYS A 31  ? 1.0641 1.3757 0.8686 -0.1357 0.2827  0.0529  9   LYS A N   
62   C CA  . LYS A 31  ? 0.9805 1.3278 0.8572 -0.1735 0.2688  0.0350  9   LYS A CA  
63   C C   . LYS A 31  ? 1.0050 1.3338 0.8629 -0.1709 0.2284  0.0037  9   LYS A C   
64   O O   . LYS A 31  ? 0.9833 1.3511 0.8689 -0.1735 0.2180  -0.0090 9   LYS A O   
65   C CB  . LYS A 31  ? 0.8237 1.1638 0.7593 -0.2151 0.2702  0.0400  9   LYS A CB  
66   N N   . ALA A 32  ? 1.0406 1.3152 0.8566 -0.1659 0.2051  -0.0041 10  ALA A N   
67   C CA  . ALA A 32  ? 0.9192 1.1832 0.7272 -0.1655 0.1665  -0.0220 10  ALA A CA  
68   C C   . ALA A 32  ? 0.9257 1.1901 0.7075 -0.1366 0.1522  -0.0277 10  ALA A C   
69   O O   . ALA A 32  ? 0.9449 1.2322 0.7535 -0.1437 0.1301  -0.0354 10  ALA A O   
70   C CB  . ALA A 32  ? 0.7976 1.0075 0.5662 -0.1617 0.1446  -0.0233 10  ALA A CB  
71   N N   . LYS A 33  ? 0.9529 1.1937 0.6805 -0.0989 0.1630  -0.0234 11  LYS A N   
72   C CA  . LYS A 33  ? 0.9344 1.1677 0.6308 -0.0629 0.1429  -0.0351 11  LYS A CA  
73   C C   . LYS A 33  ? 0.8731 1.1716 0.6167 -0.0691 0.1588  -0.0349 11  LYS A C   
74   O O   . LYS A 33  ? 0.8949 1.1918 0.6361 -0.0539 0.1324  -0.0466 11  LYS A O   
75   C CB  . LYS A 33  ? 0.9613 1.1635 0.5811 -0.0089 0.1509  -0.0350 11  LYS A CB  
76   N N   . LEU A 34  ? 0.8626 1.2168 0.6555 -0.0929 0.1973  -0.0209 12  LEU A N   
77   C CA  . LEU A 34  ? 0.9699 1.3938 0.8162 -0.1016 0.2115  -0.0209 12  LEU A CA  
78   C C   . LEU A 34  ? 0.9995 1.4482 0.9024 -0.1379 0.1904  -0.0332 12  LEU A C   
79   O O   . LEU A 34  ? 1.0261 1.5075 0.9481 -0.1324 0.1782  -0.0414 12  LEU A O   
80   C CB  . LEU A 34  ? 0.9573 1.4356 0.8435 -0.1122 0.2568  0.0030  12  LEU A CB  
81   N N   . ALA A 35  ? 0.9417 1.3796 0.8684 -0.1692 0.1853  -0.0347 13  ALA A N   
82   C CA  . ALA A 35  ? 0.8564 1.3225 0.8230 -0.1908 0.1624  -0.0469 13  ALA A CA  
83   C C   . ALA A 35  ? 0.8630 1.3167 0.8092 -0.1755 0.1302  -0.0479 13  ALA A C   
84   O O   . ALA A 35  ? 0.7923 1.2927 0.7728 -0.1804 0.1186  -0.0509 13  ALA A O   
85   C CB  . ALA A 35  ? 0.7732 1.2182 0.7466 -0.2117 0.1547  -0.0504 13  ALA A CB  
86   N N   . GLU A 36  ? 0.6913 1.0825 0.5848 -0.1552 0.1125  -0.0439 14  GLU A N   
87   C CA  . GLU A 36  ? 0.8284 1.1975 0.7140 -0.1453 0.0732  -0.0406 14  GLU A CA  
88   C C   . GLU A 36  ? 0.8543 1.2472 0.7471 -0.1256 0.0697  -0.0444 14  GLU A C   
89   O O   . GLU A 36  ? 0.6851 1.0961 0.6054 -0.1298 0.0448  -0.0372 14  GLU A O   
90   C CB  . GLU A 36  ? 0.7491 1.0392 0.5811 -0.1265 0.0465  -0.0405 14  GLU A CB  
91   C CG  . GLU A 36  ? 0.8726 1.1261 0.7008 -0.1127 -0.0017 -0.0377 14  GLU A CG  
92   C CD  . GLU A 36  ? 1.1921 1.3620 0.9700 -0.0908 -0.0374 -0.0444 14  GLU A CD  
93   O OE1 . GLU A 36  ? 1.2882 1.4289 1.0132 -0.0671 -0.0190 -0.0566 14  GLU A OE1 
94   O OE2 . GLU A 36  ? 1.3231 1.4589 1.1184 -0.0963 -0.0866 -0.0351 14  GLU A OE2 
95   N N   . GLN A 37  ? 0.8607 1.2585 0.7291 -0.1005 0.0948  -0.0515 15  GLN A N   
96   C CA  . GLN A 37  ? 0.8963 1.3217 0.7675 -0.0753 0.0935  -0.0569 15  GLN A CA  
97   C C   . GLN A 37  ? 0.8602 1.3667 0.7950 -0.0983 0.1083  -0.0555 15  GLN A C   
98   O O   . GLN A 37  ? 0.8482 1.3775 0.7956 -0.0848 0.0945  -0.0570 15  GLN A O   
99   C CB  . GLN A 37  ? 0.9436 1.3717 0.7734 -0.0373 0.1212  -0.0609 15  GLN A CB  
100  C CG  . GLN A 37  ? 1.1337 1.4891 0.8933 -0.0061 0.1082  -0.0656 15  GLN A CG  
101  C CD  . GLN A 37  ? 1.4024 1.7778 1.1165 0.0420  0.1386  -0.0655 15  GLN A CD  
102  O OE1 . GLN A 37  ? 1.5100 1.9125 1.2130 0.0778  0.1387  -0.0731 15  GLN A OE1 
103  N NE2 . GLN A 37  ? 1.4579 1.8274 1.1451 0.0472  0.1664  -0.0532 15  GLN A NE2 
104  N N   . ALA A 38  ? 0.8650 1.4122 0.8394 -0.1297 0.1317  -0.0549 16  ALA A N   
105  C CA  . ALA A 38  ? 0.8957 1.5178 0.9301 -0.1494 0.1379  -0.0602 16  ALA A CA  
106  C C   . ALA A 38  ? 0.8796 1.5154 0.9340 -0.1634 0.1108  -0.0574 16  ALA A C   
107  O O   . ALA A 38  ? 0.7770 1.4787 0.8742 -0.1718 0.1113  -0.0641 16  ALA A O   
108  C CB  . ALA A 38  ? 0.9210 1.5754 0.9943 -0.1742 0.1657  -0.0642 16  ALA A CB  
109  N N   . GLU A 39  ? 0.8666 1.4493 0.8925 -0.1620 0.0859  -0.0452 17  GLU A N   
110  C CA  . GLU A 39  ? 0.7478 1.3511 0.7940 -0.1743 0.0632  -0.0313 17  GLU A CA  
111  C C   . GLU A 39  ? 0.7176 1.3726 0.7927 -0.1907 0.0757  -0.0433 17  GLU A C   
112  O O   . GLU A 39  ? 0.6332 1.3547 0.7391 -0.1900 0.0691  -0.0427 17  GLU A O   
113  C CB  . GLU A 39  ? 0.7562 1.3938 0.8247 -0.1643 0.0426  -0.0150 17  GLU A CB  
114  C CG  . GLU A 39  ? 0.9257 1.5048 0.9663 -0.1426 0.0245  -0.0112 17  GLU A CG  
115  C CD  . GLU A 39  ? 1.0212 1.6185 1.0867 -0.1344 -0.0036 0.0114  17  GLU A CD  
116  O OE1 . GLU A 39  ? 0.9955 1.6645 1.1001 -0.1437 -0.0033 0.0283  17  GLU A OE1 
117  O OE2 . GLU A 39  ? 1.0565 1.5942 1.1008 -0.1149 -0.0294 0.0135  17  GLU A OE2 
118  N N   . ARG A 40  ? 0.7094 1.3310 0.7716 -0.2010 0.0910  -0.0549 18  ARG A N   
119  C CA  . ARG A 40  ? 0.6339 1.2802 0.7157 -0.2134 0.0932  -0.0694 18  ARG A CA  
120  C C   . ARG A 40  ? 0.5966 1.1916 0.6461 -0.2165 0.0843  -0.0601 18  ARG A C   
121  O O   . ARG A 40  ? 0.6963 1.2428 0.7272 -0.2230 0.0965  -0.0656 18  ARG A O   
122  C CB  . ARG A 40  ? 0.5449 1.1965 0.6536 -0.2262 0.1152  -0.0891 18  ARG A CB  
123  C CG  . ARG A 40  ? 0.5848 1.2943 0.7315 -0.2236 0.1234  -0.0971 18  ARG A CG  
124  C CD  . ARG A 40  ? 0.5545 1.2815 0.7464 -0.2407 0.1418  -0.1085 18  ARG A CD  
125  N NE  . ARG A 40  ? 0.6023 1.3238 0.8236 -0.2584 0.1318  -0.1275 18  ARG A NE  
126  C CZ  . ARG A 40  ? 0.7182 1.4903 0.9865 -0.2621 0.1139  -0.1551 18  ARG A CZ  
127  N NH1 . ARG A 40  ? 0.7402 1.5778 1.0287 -0.2497 0.1081  -0.1631 18  ARG A NH1 
128  N NH2 . ARG A 40  ? 0.6587 1.4138 0.9511 -0.2737 0.0971  -0.1774 18  ARG A NH2 
129  N N   . TYR A 41  ? 0.5141 1.1291 0.5626 -0.2114 0.0630  -0.0418 19  TYR A N   
130  C CA  . TYR A 41  ? 0.5508 1.1237 0.5730 -0.2131 0.0508  -0.0277 19  TYR A CA  
131  C C   . TYR A 41  ? 0.6813 1.2634 0.7009 -0.2144 0.0541  -0.0433 19  TYR A C   
132  O O   . TYR A 41  ? 0.8379 1.3779 0.8315 -0.2151 0.0487  -0.0363 19  TYR A O   
133  C CB  . TYR A 41  ? 0.5146 1.1127 0.5496 -0.2101 0.0251  0.0065  19  TYR A CB  
134  C CG  . TYR A 41  ? 0.6026 1.1648 0.6352 -0.2073 0.0121  0.0196  19  TYR A CG  
135  C CD1 . TYR A 41  ? 0.7497 1.2273 0.7467 -0.2041 0.0007  0.0188  19  TYR A CD1 
136  C CD2 . TYR A 41  ? 0.6443 1.2545 0.7056 -0.2019 0.0081  0.0292  19  TYR A CD2 
137  C CE1 . TYR A 41  ? 0.7550 1.1935 0.7446 -0.1933 -0.0185 0.0235  19  TYR A CE1 
138  C CE2 . TYR A 41  ? 0.7232 1.2942 0.7804 -0.1949 -0.0080 0.0380  19  TYR A CE2 
139  C CZ  . TYR A 41  ? 0.7872 1.2706 0.8082 -0.1895 -0.0232 0.0333  19  TYR A CZ  
140  O OH  . TYR A 41  ? 0.9594 1.4005 0.9731 -0.1751 -0.0464 0.0361  19  TYR A OH  
141  N N   . ASP A 42  ? 0.7259 1.3590 0.7706 -0.2110 0.0579  -0.0671 20  ASP A N   
142  C CA  . ASP A 42  ? 0.7978 1.4207 0.8363 -0.2084 0.0556  -0.0894 20  ASP A CA  
143  C C   . ASP A 42  ? 0.8549 1.4033 0.8844 -0.2245 0.0717  -0.1009 20  ASP A C   
144  O O   . ASP A 42  ? 0.8540 1.3545 0.8597 -0.2250 0.0709  -0.1025 20  ASP A O   
145  C CB  . ASP A 42  ? 0.8825 1.5756 0.9493 -0.1941 0.0453  -0.1182 20  ASP A CB  
146  C CG  . ASP A 42  ? 1.0344 1.8150 1.1022 -0.1676 0.0307  -0.1027 20  ASP A CG  
147  O OD1 . ASP A 42  ? 1.0942 1.8892 1.1559 -0.1671 0.0282  -0.0624 20  ASP A OD1 
148  O OD2 . ASP A 42  ? 1.0807 1.9216 1.1592 -0.1444 0.0192  -0.1298 20  ASP A OD2 
149  N N   . ASP A 43  ? 0.8613 1.4059 0.9118 -0.2356 0.0878  -0.1038 21  ASP A N   
150  C CA  . ASP A 43  ? 0.8775 1.3659 0.9251 -0.2494 0.1085  -0.1003 21  ASP A CA  
151  C C   . ASP A 43  ? 1.0219 1.4493 1.0169 -0.2428 0.1154  -0.0782 21  ASP A C   
152  O O   . ASP A 43  ? 1.0977 1.4741 1.0738 -0.2465 0.1246  -0.0739 21  ASP A O   
153  C CB  . ASP A 43  ? 0.7808 1.2964 0.8617 -0.2571 0.1263  -0.0982 21  ASP A CB  
154  C CG  . ASP A 43  ? 1.0064 1.5614 1.1476 -0.2706 0.1204  -0.1218 21  ASP A CG  
155  O OD1 . ASP A 43  ? 1.1855 1.7260 1.3381 -0.2744 0.1033  -0.1414 21  ASP A OD1 
156  O OD2 . ASP A 43  ? 0.9845 1.5823 1.1626 -0.2756 0.1292  -0.1227 21  ASP A OD2 
157  N N   . MET A 44  ? 0.9631 1.3919 0.9354 -0.2312 0.1076  -0.0644 22  MET A N   
158  C CA  . MET A 44  ? 0.8643 1.2332 0.7865 -0.2200 0.1049  -0.0498 22  MET A CA  
159  C C   . MET A 44  ? 0.9026 1.2442 0.8019 -0.2191 0.0893  -0.0468 22  MET A C   
160  O O   . MET A 44  ? 0.8525 1.1375 0.7118 -0.2123 0.0933  -0.0413 22  MET A O   
161  C CB  . MET A 44  ? 0.7854 1.1577 0.6986 -0.2078 0.0877  -0.0402 22  MET A CB  
162  C CG  . MET A 44  ? 0.8478 1.1596 0.7159 -0.1943 0.0669  -0.0305 22  MET A CG  
163  S SD  . MET A 44  ? 0.9225 1.2267 0.7916 -0.1811 0.0344  -0.0219 22  MET A SD  
164  C CE  . MET A 44  ? 1.0479 1.2619 0.8506 -0.1556 0.0165  -0.0265 22  MET A CE  
165  N N   . ALA A 45  ? 0.7848 1.1730 0.7067 -0.2210 0.0727  -0.0496 23  ALA A N   
166  C CA  . ALA A 45  ? 0.7539 1.1289 0.6566 -0.2162 0.0595  -0.0460 23  ALA A CA  
167  C C   . ALA A 45  ? 0.8517 1.1887 0.7433 -0.2183 0.0724  -0.0620 23  ALA A C   
168  O O   . ALA A 45  ? 0.9414 1.2359 0.8004 -0.2123 0.0687  -0.0576 23  ALA A O   
169  C CB  . ALA A 45  ? 0.7237 1.1750 0.6529 -0.2097 0.0417  -0.0409 23  ALA A CB  
170  N N   . ALA A 46  ? 0.8341 1.1857 0.7579 -0.2271 0.0832  -0.0799 24  ALA A N   
171  C CA  . ALA A 46  ? 0.9481 1.2564 0.8724 -0.2322 0.0885  -0.0915 24  ALA A CA  
172  C C   . ALA A 46  ? 1.1297 1.3721 1.0254 -0.2365 0.1107  -0.0716 24  ALA A C   
173  O O   . ALA A 46  ? 1.2016 1.3958 1.0761 -0.2338 0.1111  -0.0694 24  ALA A O   
174  C CB  . ALA A 46  ? 0.6849 1.0216 0.6622 -0.2433 0.0858  -0.1150 24  ALA A CB  
175  N N   . CYS A 47  ? 1.1629 1.4056 1.0527 -0.2366 0.1287  -0.0560 25  CYS A N   
176  C CA  . CYS A 47  ? 1.2054 1.3984 1.0569 -0.2282 0.1504  -0.0346 25  CYS A CA  
177  C C   . CYS A 47  ? 1.2060 1.3566 0.9984 -0.2091 0.1362  -0.0297 25  CYS A C   
178  O O   . CYS A 47  ? 1.2177 1.3223 0.9801 -0.2025 0.1446  -0.0202 25  CYS A O   
179  C CB  . CYS A 47  ? 1.1797 1.3913 1.0272 -0.2196 0.1690  -0.0225 25  CYS A CB  
180  S SG  . CYS A 47  ? 1.3028 1.5712 1.2225 -0.2406 0.1887  -0.0220 25  CYS A SG  
181  N N   . MET A 48  ? 1.1657 1.3312 0.9452 -0.2003 0.1130  -0.0327 26  MET A N   
182  C CA  . MET A 48  ? 1.1196 1.2462 0.8521 -0.1841 0.0933  -0.0273 26  MET A CA  
183  C C   . MET A 48  ? 1.1360 1.2578 0.8657 -0.1862 0.0806  -0.0307 26  MET A C   
184  O O   . MET A 48  ? 1.3231 1.4075 1.0129 -0.1727 0.0690  -0.0255 26  MET A O   
185  C CB  . MET A 48  ? 1.0705 1.2115 0.8051 -0.1792 0.0642  -0.0252 26  MET A CB  
186  C CG  . MET A 48  ? 1.1661 1.3008 0.8903 -0.1670 0.0713  -0.0259 26  MET A CG  
187  S SD  . MET A 48  ? 1.2543 1.3416 0.9196 -0.1388 0.1016  -0.0215 26  MET A SD  
188  C CE  . MET A 48  ? 1.3333 1.3582 0.9375 -0.1159 0.0732  -0.0228 26  MET A CE  
189  N N   . LYS A 49  ? 0.9913 1.1507 0.7586 -0.1970 0.0795  -0.0422 27  LYS A N   
190  C CA  . LYS A 49  ? 0.9845 1.1332 0.7398 -0.1898 0.0691  -0.0486 27  LYS A CA  
191  C C   . LYS A 49  ? 1.1450 1.2313 0.8800 -0.1891 0.0876  -0.0471 27  LYS A C   
192  O O   . LYS A 49  ? 1.2723 1.3210 0.9709 -0.1760 0.0820  -0.0434 27  LYS A O   
193  C CB  . LYS A 49  ? 0.8845 1.0936 0.6773 -0.1898 0.0563  -0.0661 27  LYS A CB  
194  C CG  . LYS A 49  ? 0.7637 0.9648 0.5393 -0.1732 0.0431  -0.0775 27  LYS A CG  
195  C CD  . LYS A 49  ? 0.9838 1.2518 0.7874 -0.1607 0.0276  -0.0993 27  LYS A CD  
196  C CE  . LYS A 49  ? 0.9367 1.1953 0.7171 -0.1353 0.0120  -0.1157 27  LYS A CE  
197  N NZ  . LYS A 49  ? 0.8319 1.1357 0.6333 -0.1155 -0.0052 -0.1498 27  LYS A NZ  
198  N N   . SER A 50  ? 1.0965 1.1740 0.8581 -0.2032 0.1098  -0.0441 28  SER A N   
199  C CA  . SER A 50  ? 1.1311 1.1543 0.8857 -0.2062 0.1290  -0.0300 28  SER A CA  
200  C C   . SER A 50  ? 1.2141 1.1979 0.9104 -0.1870 0.1446  -0.0061 28  SER A C   
201  O O   . SER A 50  ? 1.2775 1.2139 0.9458 -0.1780 0.1522  0.0073  28  SER A O   
202  C CB  . SER A 50  ? 1.0852 1.1218 0.8969 -0.2293 0.1476  -0.0237 28  SER A CB  
203  O OG  . SER A 50  ? 1.1430 1.1894 1.0028 -0.2423 0.1271  -0.0491 28  SER A OG  
204  N N   . VAL A 51  ? 1.1661 1.1674 0.8413 -0.1760 0.1468  -0.0019 29  VAL A N   
205  C CA  . VAL A 51  ? 1.1770 1.1432 0.7876 -0.1471 0.1507  0.0108  29  VAL A CA  
206  C C   . VAL A 51  ? 1.3271 1.2642 0.8990 -0.1331 0.1240  0.0032  29  VAL A C   
207  O O   . VAL A 51  ? 1.4913 1.3862 1.0144 -0.1119 0.1305  0.0144  29  VAL A O   
208  C CB  . VAL A 51  ? 1.0747 1.0617 0.6724 -0.1337 0.1445  0.0064  29  VAL A CB  
209  C CG1 . VAL A 51  ? 1.0133 0.9617 0.5430 -0.0989 0.1265  0.0047  29  VAL A CG1 
210  C CG2 . VAL A 51  ? 1.1082 1.1184 0.7226 -0.1332 0.1793  0.0224  29  VAL A CG2 
211  N N   . THR A 52  ? 1.3349 1.3024 0.9301 -0.1425 0.0948  -0.0120 30  THR A N   
212  C CA  . THR A 52  ? 1.3481 1.3033 0.9159 -0.1298 0.0676  -0.0148 30  THR A CA  
213  C C   . THR A 52  ? 1.4188 1.3469 0.9743 -0.1250 0.0739  -0.0150 30  THR A C   
214  O O   . THR A 52  ? 1.5286 1.4171 1.0370 -0.1049 0.0699  -0.0090 30  THR A O   
215  C CB  . THR A 52  ? 1.2398 1.2523 0.8468 -0.1409 0.0382  -0.0199 30  THR A CB  
216  O OG1 . THR A 52  ? 1.1795 1.2016 0.7935 -0.1424 0.0228  -0.0165 30  THR A OG1 
217  C CG2 . THR A 52  ? 1.2230 1.2407 0.8164 -0.1303 0.0127  -0.0171 30  THR A CG2 
218  N N   . GLU A 53  ? 1.4403 1.3840 1.0361 -0.1400 0.0806  -0.0241 31  GLU A N   
219  C CA  . GLU A 53  ? 1.5307 1.4412 1.1145 -0.1311 0.0772  -0.0289 31  GLU A CA  
220  C C   . GLU A 53  ? 1.5215 1.3662 1.0774 -0.1256 0.1012  -0.0083 31  GLU A C   
221  O O   . GLU A 53  ? 1.4980 1.3041 1.0503 -0.1207 0.0987  -0.0090 31  GLU A O   
222  C CB  . GLU A 53  ? 1.5720 1.5086 1.2030 -0.1411 0.0675  -0.0510 31  GLU A CB  
223  C CG  . GLU A 53  ? 1.5923 1.5593 1.2760 -0.1644 0.0774  -0.0568 31  GLU A CG  
224  C CD  . GLU A 53  ? 1.6630 1.6631 1.3863 -0.1648 0.0571  -0.0869 31  GLU A CD  
225  O OE1 . GLU A 53  ? 1.7144 1.6947 1.4237 -0.1466 0.0390  -0.1030 31  GLU A OE1 
226  O OE2 . GLU A 53  ? 1.6444 1.6922 1.4087 -0.1775 0.0566  -0.0973 31  GLU A OE2 
227  N N   . GLN A 54  ? 1.4678 1.3030 1.0027 -0.1213 0.1226  0.0117  32  GLN A N   
228  C CA  . GLN A 54  ? 1.5028 1.2921 1.0043 -0.1078 0.1496  0.0412  32  GLN A CA  
229  C C   . GLN A 54  ? 1.6930 1.4498 1.1228 -0.0737 0.1397  0.0452  32  GLN A C   
230  O O   . GLN A 54  ? 1.8583 1.5842 1.2475 -0.0526 0.1624  0.0717  32  GLN A O   
231  C CB  . GLN A 54  ? 1.3945 1.2047 0.9026 -0.1090 0.1787  0.0618  32  GLN A CB  
232  C CG  . GLN A 54  ? 1.4225 1.2512 1.0042 -0.1424 0.1973  0.0728  32  GLN A CG  
233  C CD  . GLN A 54  ? 1.5211 1.3786 1.1111 -0.1397 0.2320  0.1029  32  GLN A CD  
234  O OE1 . GLN A 54  ? 1.5847 1.4472 1.1169 -0.1066 0.2418  0.1115  32  GLN A OE1 
235  N NE2 . GLN A 54  ? 1.5422 1.4213 1.2050 -0.1710 0.2481  0.1187  32  GLN A NE2 
236  N N   . GLY A 55  ? 1.7081 1.4792 1.1243 -0.0658 0.1065  0.0230  33  GLY A N   
237  C CA  . GLY A 55  ? 1.7267 1.4721 1.0832 -0.0352 0.0893  0.0229  33  GLY A CA  
238  C C   . GLY A 55  ? 1.7490 1.5002 1.0733 -0.0176 0.0772  0.0193  33  GLY A C   
239  O O   . GLY A 55  ? 1.7685 1.5223 1.0736 -0.0049 0.0425  0.0069  33  GLY A O   
240  N N   . ALA A 56  ? 1.7841 1.5380 1.1053 -0.0146 0.1028  0.0303  34  ALA A N   
241  C CA  . ALA A 56  ? 1.8322 1.5888 1.1201 0.0093  0.0939  0.0239  34  ALA A CA  
242  C C   . ALA A 56  ? 1.8672 1.6039 1.1113 0.0365  0.0486  0.0045  34  ALA A C   
243  O O   . ALA A 56  ? 1.9574 1.6610 1.1364 0.0752  0.0476  0.0077  34  ALA A O   
244  C CB  . ALA A 56  ? 1.7041 1.5016 1.0473 -0.0178 0.0911  0.0142  34  ALA A CB  
245  N N   . GLU A 57  ? 1.7103 1.4700 0.9960 0.0153  0.0093  -0.0122 35  GLU A N   
246  C CA  . GLU A 57  ? 1.6802 1.4269 0.9510 0.0317  -0.0401 -0.0306 35  GLU A CA  
247  C C   . GLU A 57  ? 1.5819 1.3339 0.8553 0.0376  -0.0341 -0.0371 35  GLU A C   
248  O O   . GLU A 57  ? 1.4796 1.2167 0.7011 0.0721  -0.0071 -0.0342 35  GLU A O   
249  C CB  . GLU A 57  ? 1.8162 1.5173 1.0119 0.0783  -0.0622 -0.0401 35  GLU A CB  
250  C CG  . GLU A 57  ? 1.9241 1.5968 1.0917 0.1079  -0.1144 -0.0658 35  GLU A CG  
251  C CD  . GLU A 57  ? 1.9610 1.6338 1.1725 0.0883  -0.1788 -0.0760 35  GLU A CD  
252  O OE1 . GLU A 57  ? 1.9575 1.6710 1.2307 0.0483  -0.1776 -0.0595 35  GLU A OE1 
253  O OE2 . GLU A 57  ? 2.0603 1.6959 1.2474 0.1153  -0.2336 -0.0994 35  GLU A OE2 
254  N N   . LEU A 58  ? 1.5629 1.3418 0.8955 0.0083  -0.0585 -0.0424 36  LEU A N   
255  C CA  . LEU A 58  ? 1.5100 1.3044 0.8571 0.0070  -0.0438 -0.0452 36  LEU A CA  
256  C C   . LEU A 58  ? 1.4688 1.2245 0.7724 0.0462  -0.0839 -0.0675 36  LEU A C   
257  O O   . LEU A 58  ? 1.4698 1.1933 0.7661 0.0556  -0.1390 -0.0818 36  LEU A O   
258  C CB  . LEU A 58  ? 1.3040 1.1474 0.7332 -0.0387 -0.0503 -0.0390 36  LEU A CB  
259  C CG  . LEU A 58  ? 1.1108 0.9974 0.5870 -0.0724 -0.0259 -0.0254 36  LEU A CG  
260  C CD1 . LEU A 58  ? 1.1926 1.1328 0.7386 -0.1041 -0.0383 -0.0204 36  LEU A CD1 
261  C CD2 . LEU A 58  ? 1.0406 0.9300 0.5081 -0.0736 0.0261  -0.0178 36  LEU A CD2 
262  N N   . SER A 59  ? 1.4534 1.2141 0.7316 0.0712  -0.0598 -0.0714 37  SER A N   
263  C CA  . SER A 59  ? 1.5098 1.2346 0.7428 0.1170  -0.1000 -0.0985 37  SER A CA  
264  C C   . SER A 59  ? 1.5587 1.2722 0.8520 0.0879  -0.1600 -0.1099 37  SER A C   
265  O O   . SER A 59  ? 1.5828 1.3315 0.9509 0.0349  -0.1599 -0.0909 37  SER A O   
266  C CB  . SER A 59  ? 1.5761 1.3264 0.7812 0.1475  -0.0589 -0.0963 37  SER A CB  
267  O OG  . SER A 59  ? 1.7548 1.5373 0.9434 0.1510  0.0063  -0.0675 37  SER A OG  
268  N N   . ASN A 60  ? 1.5000 1.6692 0.6469 -0.3353 0.0738  -0.0650 38  ASN A N   
269  C CA  . ASN A 60  ? 1.4334 1.6202 0.6339 -0.2920 0.0953  -0.0970 38  ASN A CA  
270  C C   . ASN A 60  ? 1.4857 1.7229 0.7440 -0.2754 0.1320  -0.1121 38  ASN A C   
271  O O   . ASN A 60  ? 1.4390 1.6756 0.7534 -0.2362 0.1390  -0.1269 38  ASN A O   
272  C CB  . ASN A 60  ? 1.3336 1.5304 0.5341 -0.2837 0.1087  -0.1259 38  ASN A CB  
273  C CG  . ASN A 60  ? 1.6691 1.8154 0.8306 -0.2856 0.0683  -0.1146 38  ASN A CG  
274  O OD1 . ASN A 60  ? 1.7709 1.8775 0.9303 -0.2745 0.0333  -0.0939 38  ASN A OD1 
275  N ND2 . ASN A 60  ? 1.7857 1.9333 0.9222 -0.2978 0.0697  -0.1265 38  ASN A ND2 
276  N N   . GLU A 61  ? 1.4505 1.7261 0.7085 -0.3018 0.1484  -0.1029 39  GLU A N   
277  C CA  . GLU A 61  ? 1.3240 1.6439 0.6357 -0.2884 0.1732  -0.1086 39  GLU A CA  
278  C C   . GLU A 61  ? 1.2622 1.5478 0.5621 -0.2956 0.1466  -0.0768 39  GLU A C   
279  O O   . GLU A 61  ? 1.1990 1.4939 0.5597 -0.2655 0.1541  -0.0810 39  GLU A O   
280  C CB  . GLU A 61  ? 1.3618 1.7471 0.6844 -0.3129 0.2013  -0.1142 39  GLU A CB  
281  C CG  . GLU A 61  ? 1.4327 1.8216 0.7236 -0.3589 0.1861  -0.0782 39  GLU A CG  
282  C CD  . GLU A 61  ? 1.5054 1.9757 0.8281 -0.3759 0.2173  -0.0876 39  GLU A CD  
283  O OE1 . GLU A 61  ? 1.6803 2.1684 0.9647 -0.4220 0.2130  -0.0722 39  GLU A OE1 
284  O OE2 . GLU A 61  ? 1.3814 1.8988 0.7684 -0.3434 0.2438  -0.1099 39  GLU A OE2 
285  N N   . GLU A 62  ? 1.3226 1.5548 0.5612 -0.3273 0.1081  -0.0430 40  GLU A N   
286  C CA  . GLU A 62  ? 1.3792 1.5603 0.6177 -0.3260 0.0743  -0.0128 40  GLU A CA  
287  C C   . GLU A 62  ? 1.2474 1.3808 0.5312 -0.2739 0.0526  -0.0191 40  GLU A C   
288  O O   . GLU A 62  ? 1.1960 1.3085 0.5124 -0.2546 0.0407  -0.0098 40  GLU A O   
289  C CB  . GLU A 62  ? 1.4647 1.5925 0.6199 -0.3733 0.0344  0.0242  40  GLU A CB  
290  N N   . ARG A 63  ? 1.2832 1.4061 0.5706 -0.2525 0.0496  -0.0368 41  ARG A N   
291  C CA  . ARG A 63  ? 1.2234 1.3210 0.5607 -0.2050 0.0368  -0.0474 41  ARG A CA  
292  C C   . ARG A 63  ? 1.1995 1.3397 0.6089 -0.1748 0.0708  -0.0695 41  ARG A C   
293  O O   . ARG A 63  ? 1.0793 1.2038 0.5308 -0.1460 0.0616  -0.0671 41  ARG A O   
294  C CB  . ARG A 63  ? 1.2698 1.3577 0.5932 -0.1967 0.0287  -0.0615 41  ARG A CB  
295  C CG  . ARG A 63  ? 1.1441 1.2064 0.5067 -0.1566 0.0073  -0.0669 41  ARG A CG  
296  C CD  . ARG A 63  ? 1.2106 1.2725 0.5571 -0.1559 0.0012  -0.0804 41  ARG A CD  
297  N NE  . ARG A 63  ? 1.2518 1.3557 0.6204 -0.1533 0.0408  -0.1103 41  ARG A NE  
298  C CZ  . ARG A 63  ? 1.4331 1.5445 0.7743 -0.1654 0.0467  -0.1264 41  ARG A CZ  
299  N NH1 . ARG A 63  ? 1.4808 1.5654 0.7717 -0.1833 0.0155  -0.1133 41  ARG A NH1 
300  N NH2 . ARG A 63  ? 1.4180 1.5603 0.7813 -0.1584 0.0814  -0.1562 41  ARG A NH2 
301  N N   . ASN A 64  ? 1.3242 1.5182 0.7467 -0.1802 0.1091  -0.0925 42  ASN A N   
302  C CA  . ASN A 64  ? 1.2540 1.4846 0.7435 -0.1498 0.1383  -0.1146 42  ASN A CA  
303  C C   . ASN A 64  ? 1.1946 1.4382 0.7134 -0.1495 0.1402  -0.0990 42  ASN A C   
304  O O   . ASN A 64  ? 1.2973 1.5362 0.8669 -0.1194 0.1397  -0.1021 42  ASN A O   
305  C CB  . ASN A 64  ? 1.3610 1.6444 0.8527 -0.1554 0.1758  -0.1440 42  ASN A CB  
306  C CG  . ASN A 64  ? 1.4428 1.7455 0.9978 -0.1171 0.1977  -0.1719 42  ASN A CG  
307  O OD1 . ASN A 64  ? 1.5144 1.8315 1.1183 -0.0991 0.2037  -0.1687 42  ASN A OD1 
308  N ND2 . ASN A 64  ? 1.4792 1.7785 1.0304 -0.1063 0.2073  -0.1987 42  ASN A ND2 
309  N N   . LEU A 65  ? 1.1168 1.3748 0.6001 -0.1868 0.1394  -0.0798 43  LEU A N   
310  C CA  . LEU A 65  ? 1.0388 1.3109 0.5461 -0.1923 0.1396  -0.0636 43  LEU A CA  
311  C C   . LEU A 65  ? 1.1851 1.3944 0.6963 -0.1754 0.1041  -0.0445 43  LEU A C   
312  O O   . LEU A 65  ? 1.2589 1.4741 0.8117 -0.1592 0.1059  -0.0416 43  LEU A O   
313  C CB  . LEU A 65  ? 1.0618 1.3602 0.5215 -0.2436 0.1423  -0.0442 43  LEU A CB  
314  C CG  . LEU A 65  ? 1.1920 1.5720 0.6549 -0.2603 0.1836  -0.0667 43  LEU A CG  
315  C CD1 . LEU A 65  ? 1.0832 1.4817 0.4797 -0.3198 0.1807  -0.0446 43  LEU A CD1 
316  C CD2 . LEU A 65  ? 1.2796 1.7270 0.8156 -0.2369 0.2150  -0.0850 43  LEU A CD2 
317  N N   . LEU A 66  ? 1.1522 1.3029 0.6221 -0.1762 0.0713  -0.0336 44  LEU A N   
318  C CA  . LEU A 66  ? 1.1623 1.2560 0.6349 -0.1568 0.0373  -0.0199 44  LEU A CA  
319  C C   . LEU A 66  ? 1.2068 1.3042 0.7367 -0.1113 0.0433  -0.0399 44  LEU A C   
320  O O   . LEU A 66  ? 1.1346 1.2136 0.6897 -0.0913 0.0318  -0.0360 44  LEU A O   
321  C CB  . LEU A 66  ? 1.1611 1.1929 0.5740 -0.1683 -0.0028 -0.0035 44  LEU A CB  
322  C CG  . LEU A 66  ? 1.0999 1.0736 0.5182 -0.1362 -0.0399 0.0007  44  LEU A CG  
323  C CD1 . LEU A 66  ? 1.2058 1.1515 0.6218 -0.1410 -0.0543 0.0167  44  LEU A CD1 
324  C CD2 . LEU A 66  ? 1.0885 1.0088 0.4551 -0.1412 -0.0791 0.0122  44  LEU A CD2 
325  N N   . SER A 67  ? 1.2470 1.3697 0.7954 -0.0981 0.0620  -0.0616 45  SER A N   
326  C CA  . SER A 67  ? 1.0450 1.1778 0.6468 -0.0625 0.0710  -0.0795 45  SER A CA  
327  C C   . SER A 67  ? 0.9085 1.0730 0.5592 -0.0518 0.0928  -0.0837 45  SER A C   
328  O O   . SER A 67  ? 1.0133 1.1662 0.6927 -0.0321 0.0840  -0.0806 45  SER A O   
329  C CB  . SER A 67  ? 1.0421 1.1912 0.6464 -0.0576 0.0854  -0.1008 45  SER A CB  
330  O OG  . SER A 67  ? 1.1961 1.3149 0.7590 -0.0650 0.0599  -0.0949 45  SER A OG  
331  N N   . VAL A 68  ? 0.8562 1.0648 0.5176 -0.0640 0.1209  -0.0918 46  VAL A N   
332  C CA  . VAL A 68  ? 0.7853 1.0276 0.4998 -0.0493 0.1397  -0.0975 46  VAL A CA  
333  C C   . VAL A 68  ? 0.8310 1.0602 0.5483 -0.0553 0.1240  -0.0755 46  VAL A C   
334  O O   . VAL A 68  ? 0.8597 1.0911 0.6164 -0.0359 0.1239  -0.0755 46  VAL A O   
335  C CB  . VAL A 68  ? 0.7657 1.0654 0.4951 -0.0578 0.1716  -0.1128 46  VAL A CB  
336  C CG1 . VAL A 68  ? 0.7620 1.0702 0.4727 -0.0583 0.1859  -0.1356 46  VAL A CG1 
337  C CG2 . VAL A 68  ? 0.7612 1.0938 0.4748 -0.0891 0.1769  -0.0968 46  VAL A CG2 
338  N N   . ALA A 69  ? 0.7910 1.0006 0.4615 -0.0843 0.1074  -0.0557 47  ALA A N   
339  C CA  . ALA A 69  ? 0.7756 0.9630 0.4387 -0.0945 0.0884  -0.0347 47  ALA A CA  
340  C C   . ALA A 69  ? 0.9011 1.0472 0.5786 -0.0650 0.0681  -0.0357 47  ALA A C   
341  O O   . ALA A 69  ? 0.9052 1.0632 0.6205 -0.0504 0.0728  -0.0367 47  ALA A O   
342  C CB  . ALA A 69  ? 0.8395 0.9927 0.4382 -0.1311 0.0655  -0.0126 47  ALA A CB  
343  N N   . TYR A 70  ? 0.9293 1.0316 0.5774 -0.0562 0.0451  -0.0362 48  TYR A N   
344  C CA  . TYR A 70  ? 0.9000 0.9704 0.5599 -0.0288 0.0255  -0.0391 48  TYR A CA  
345  C C   . TYR A 70  ? 0.8716 0.9733 0.5834 -0.0018 0.0442  -0.0565 48  TYR A C   
346  O O   . TYR A 70  ? 0.9095 1.0055 0.6424 0.0154  0.0382  -0.0582 48  TYR A O   
347  C CB  . TYR A 70  ? 0.8009 0.8248 0.4229 -0.0221 -0.0047 -0.0375 48  TYR A CB  
348  C CG  . TYR A 70  ? 0.8617 0.8300 0.4336 -0.0392 -0.0371 -0.0179 48  TYR A CG  
349  C CD1 . TYR A 70  ? 0.8680 0.8044 0.4410 -0.0264 -0.0552 -0.0150 48  TYR A CD1 
350  C CD2 . TYR A 70  ? 0.9208 0.8633 0.4394 -0.0695 -0.0522 -0.0025 48  TYR A CD2 
351  C CE1 . TYR A 70  ? 0.9511 0.8256 0.4743 -0.0415 -0.0889 0.0017  48  TYR A CE1 
352  C CE2 . TYR A 70  ? 0.9877 0.8683 0.4547 -0.0878 -0.0874 0.0179  48  TYR A CE2 
353  C CZ  . TYR A 70  ? 1.0698 0.9137 0.5399 -0.0725 -0.1063 0.0192  48  TYR A CZ  
354  O OH  . TYR A 70  ? 1.2545 1.0269 0.6705 -0.0898 -0.1446 0.0380  48  TYR A OH  
355  N N   . LYS A 71  ? 0.8360 0.9694 0.5659 -0.0006 0.0663  -0.0695 49  LYS A N   
356  C CA  . LYS A 71  ? 0.7935 0.9490 0.5683 0.0204  0.0808  -0.0834 49  LYS A CA  
357  C C   . LYS A 71  ? 0.8762 1.0512 0.6853 0.0233  0.0911  -0.0784 49  LYS A C   
358  O O   . LYS A 71  ? 0.8509 1.0238 0.6830 0.0379  0.0869  -0.0789 49  LYS A O   
359  C CB  . LYS A 71  ? 0.7588 0.9355 0.5410 0.0195  0.1002  -0.0991 49  LYS A CB  
360  C CG  . LYS A 71  ? 0.7965 0.9907 0.6226 0.0361  0.1148  -0.1113 49  LYS A CG  
361  C CD  . LYS A 71  ? 1.0283 1.2103 0.8604 0.0486  0.1036  -0.1175 49  LYS A CD  
362  C CE  . LYS A 71  ? 1.0845 1.2756 0.9508 0.0582  0.1146  -0.1272 49  LYS A CE  
363  N NZ  . LYS A 71  ? 1.1102 1.2957 0.9721 0.0588  0.1116  -0.1390 49  LYS A NZ  
364  N N   . ASN A 72  ? 0.9034 1.1013 0.7142 0.0071  0.1031  -0.0723 50  ASN A N   
365  C CA  . ASN A 72  ? 0.8028 1.0231 0.6465 0.0080  0.1095  -0.0652 50  ASN A CA  
366  C C   . ASN A 72  ? 0.7607 0.9533 0.5905 0.0045  0.0884  -0.0501 50  ASN A C   
367  O O   . ASN A 72  ? 0.6972 0.8947 0.5536 0.0145  0.0871  -0.0476 50  ASN A O   
368  C CB  . ASN A 72  ? 0.6174 0.8791 0.4673 -0.0097 0.1268  -0.0635 50  ASN A CB  
369  C CG  . ASN A 72  ? 0.7545 1.0506 0.6368 0.0044  0.1503  -0.0838 50  ASN A CG  
370  O OD1 . ASN A 72  ? 0.7735 1.0887 0.6997 0.0213  0.1577  -0.0886 50  ASN A OD1 
371  N ND2 . ASN A 72  ? 0.7932 1.0925 0.6515 -0.0018 0.1597  -0.0964 50  ASN A ND2 
372  N N   . VAL A 73  ? 0.7603 0.9185 0.5450 -0.0097 0.0693  -0.0405 51  VAL A N   
373  C CA  . VAL A 73  ? 0.7560 0.8780 0.5209 -0.0114 0.0463  -0.0297 51  VAL A CA  
374  C C   . VAL A 73  ? 0.8868 0.9942 0.6657 0.0164  0.0385  -0.0409 51  VAL A C   
375  O O   . VAL A 73  ? 0.9133 1.0231 0.7082 0.0222  0.0364  -0.0389 51  VAL A O   
376  C CB  . VAL A 73  ? 0.7684 0.8450 0.4771 -0.0302 0.0227  -0.0185 51  VAL A CB  
377  C CG1 . VAL A 73  ? 0.7677 0.7933 0.4514 -0.0244 -0.0056 -0.0133 51  VAL A CG1 
378  C CG2 . VAL A 73  ? 0.8303 0.9285 0.5232 -0.0659 0.0303  -0.0036 51  VAL A CG2 
379  N N   . VAL A 74  ? 0.8922 0.9880 0.6628 0.0314  0.0331  -0.0525 52  VAL A N   
380  C CA  . VAL A 74  ? 0.7487 0.8445 0.5351 0.0555  0.0281  -0.0648 52  VAL A CA  
381  C C   . VAL A 74  ? 0.6850 0.8184 0.5144 0.0610  0.0484  -0.0692 52  VAL A C   
382  O O   . VAL A 74  ? 0.7227 0.8624 0.5661 0.0706  0.0467  -0.0721 52  VAL A O   
383  C CB  . VAL A 74  ? 0.6673 0.7525 0.4402 0.0691  0.0171  -0.0759 52  VAL A CB  
384  C CG1 . VAL A 74  ? 0.6510 0.7672 0.4458 0.0703  0.0350  -0.0852 52  VAL A CG1 
385  C CG2 . VAL A 74  ? 0.7151 0.7917 0.4890 0.0927  0.0013  -0.0871 52  VAL A CG2 
386  N N   . GLY A 75  ? 0.7301 0.8866 0.5781 0.0553  0.0664  -0.0711 53  GLY A N   
387  C CA  . GLY A 75  ? 0.8362 1.0168 0.7212 0.0622  0.0802  -0.0755 53  GLY A CA  
388  C C   . GLY A 75  ? 0.8700 1.0595 0.7749 0.0600  0.0806  -0.0652 53  GLY A C   
389  O O   . GLY A 75  ? 0.8476 1.0468 0.7744 0.0657  0.0830  -0.0657 53  GLY A O   
390  N N   . ALA A 76  ? 0.8367 1.0231 0.7316 0.0482  0.0764  -0.0538 54  ALA A N   
391  C CA  . ALA A 76  ? 0.6293 0.8237 0.5396 0.0437  0.0731  -0.0425 54  ALA A CA  
392  C C   . ALA A 76  ? 0.7005 0.8766 0.5958 0.0497  0.0596  -0.0438 54  ALA A C   
393  O O   . ALA A 76  ? 0.8634 1.0512 0.7769 0.0525  0.0606  -0.0416 54  ALA A O   
394  C CB  . ALA A 76  ? 0.5514 0.7497 0.4514 0.0250  0.0703  -0.0298 54  ALA A CB  
395  N N   . ARG A 77  ? 0.6231 0.7703 0.4838 0.0524  0.0457  -0.0487 55  ARG A N   
396  C CA  . ARG A 77  ? 0.6958 0.8299 0.5427 0.0637  0.0341  -0.0569 55  ARG A CA  
397  C C   . ARG A 77  ? 0.7959 0.9559 0.6637 0.0764  0.0431  -0.0686 55  ARG A C   
398  O O   . ARG A 77  ? 0.7913 0.9618 0.6608 0.0804  0.0415  -0.0731 55  ARG A O   
399  C CB  . ARG A 77  ? 0.6605 0.7559 0.4691 0.0708  0.0151  -0.0639 55  ARG A CB  
400  C CG  . ARG A 77  ? 0.7467 0.8063 0.5246 0.0568  -0.0015 -0.0530 55  ARG A CG  
401  C CD  . ARG A 77  ? 0.8381 0.8987 0.6118 0.0333  0.0022  -0.0366 55  ARG A CD  
402  N NE  . ARG A 77  ? 1.0451 1.0686 0.7838 0.0147  -0.0173 -0.0244 55  ARG A NE  
403  C CZ  . ARG A 77  ? 1.1504 1.1686 0.8724 -0.0122 -0.0203 -0.0083 55  ARG A CZ  
404  N NH1 . ARG A 77  ? 1.0424 1.0943 0.7809 -0.0202 -0.0025 -0.0056 55  ARG A NH1 
405  N NH2 . ARG A 77  ? 1.2891 1.2690 0.9749 -0.0332 -0.0414 0.0041  55  ARG A NH2 
406  N N   . ARG A 78  ? 0.7713 0.9430 0.6509 0.0798  0.0519  -0.0743 56  ARG A N   
407  C CA  . ARG A 78  ? 0.5997 0.7970 0.4985 0.0849  0.0594  -0.0823 56  ARG A CA  
408  C C   . ARG A 78  ? 0.5200 0.7326 0.4416 0.0755  0.0668  -0.0720 56  ARG A C   
409  O O   . ARG A 78  ? 0.6540 0.8832 0.5793 0.0737  0.0665  -0.0734 56  ARG A O   
410  C CB  . ARG A 78  ? 0.6474 0.8502 0.5528 0.0861  0.0661  -0.0889 56  ARG A CB  
411  C CG  . ARG A 78  ? 0.5929 0.7826 0.4759 0.0947  0.0559  -0.0980 56  ARG A CG  
412  C CD  . ARG A 78  ? 0.5343 0.7426 0.4253 0.0985  0.0581  -0.1091 56  ARG A CD  
413  N NE  . ARG A 78  ? 0.6746 0.8830 0.5730 0.0888  0.0692  -0.1087 56  ARG A NE  
414  C CZ  . ARG A 78  ? 0.7036 0.9278 0.6164 0.0844  0.0751  -0.1141 56  ARG A CZ  
415  N NH1 . ARG A 78  ? 0.7907 1.0063 0.7053 0.0775  0.0835  -0.1165 56  ARG A NH1 
416  N NH2 . ARG A 78  ? 0.6890 0.9387 0.6119 0.0854  0.0720  -0.1186 56  ARG A NH2 
417  N N   . SER A 79  ? 0.6376 0.8468 0.5734 0.0687  0.0715  -0.0610 57  SER A N   
418  C CA  . SER A 79  ? 0.6325 0.8517 0.5925 0.0627  0.0741  -0.0504 57  SER A CA  
419  C C   . SER A 79  ? 0.7089 0.9300 0.6620 0.0558  0.0656  -0.0407 57  SER A C   
420  O O   . SER A 79  ? 0.6346 0.8652 0.5933 0.0494  0.0638  -0.0354 57  SER A O   
421  C CB  . SER A 79  ? 0.5238 0.7445 0.5054 0.0630  0.0803  -0.0451 57  SER A CB  
422  O OG  . SER A 79  ? 0.7607 0.9869 0.7672 0.0607  0.0775  -0.0335 57  SER A OG  
423  N N   . SER A 80  ? 0.6704 0.8801 0.6055 0.0539  0.0587  -0.0382 58  SER A N   
424  C CA  . SER A 80  ? 0.6424 0.8491 0.5628 0.0469  0.0491  -0.0325 58  SER A CA  
425  C C   . SER A 80  ? 0.7377 0.9529 0.6422 0.0518  0.0484  -0.0456 58  SER A C   
426  O O   . SER A 80  ? 0.8012 1.0284 0.7028 0.0429  0.0464  -0.0409 58  SER A O   
427  C CB  . SER A 80  ? 0.7942 0.9780 0.6895 0.0431  0.0390  -0.0308 58  SER A CB  
428  O OG  . SER A 80  ? 0.9618 1.1491 0.8713 0.0343  0.0409  -0.0186 58  SER A OG  
429  N N   . TRP A 81  ? 0.8782 1.0914 0.7716 0.0653  0.0493  -0.0627 59  TRP A N   
430  C CA  . TRP A 81  ? 0.8063 1.0398 0.6898 0.0733  0.0499  -0.0793 59  TRP A CA  
431  C C   . TRP A 81  ? 0.8893 1.1559 0.7908 0.0611  0.0590  -0.0743 59  TRP A C   
432  O O   . TRP A 81  ? 0.9959 1.2857 0.8888 0.0541  0.0600  -0.0775 59  TRP A O   
433  C CB  . TRP A 81  ? 0.6657 0.8964 0.5422 0.0922  0.0472  -0.0975 59  TRP A CB  
434  C CG  . TRP A 81  ? 0.6089 0.8695 0.4799 0.1056  0.0472  -0.1189 59  TRP A CG  
435  C CD1 . TRP A 81  ? 0.6878 0.9386 0.5366 0.1229  0.0370  -0.1368 59  TRP A CD1 
436  C CD2 . TRP A 81  ? 0.6212 0.9307 0.5100 0.1025  0.0577  -0.1263 59  TRP A CD2 
437  N NE1 . TRP A 81  ? 0.6986 0.9970 0.5544 0.1343  0.0428  -0.1576 59  TRP A NE1 
438  C CE2 . TRP A 81  ? 0.7062 1.0446 0.5867 0.1191  0.0560  -0.1498 59  TRP A CE2 
439  C CE3 . TRP A 81  ? 0.5970 0.9280 0.5065 0.0861  0.0670  -0.1159 59  TRP A CE3 
440  C CZ2 . TRP A 81  ? 0.7034 1.1031 0.5990 0.1174  0.0659  -0.1623 59  TRP A CZ2 
441  C CZ3 . TRP A 81  ? 0.6752 1.0566 0.5945 0.0808  0.0740  -0.1254 59  TRP A CZ3 
442  C CH2 . TRP A 81  ? 0.6489 1.0700 0.5629 0.0951  0.0746  -0.1479 59  TRP A CH2 
443  N N   . ARG A 82  ? 0.8358 1.1030 0.7583 0.0561  0.0646  -0.0665 60  ARG A N   
444  C CA  . ARG A 82  ? 0.8228 1.1111 0.7565 0.0405  0.0685  -0.0591 60  ARG A CA  
445  C C   . ARG A 82  ? 0.7507 1.0364 0.6834 0.0237  0.0630  -0.0404 60  ARG A C   
446  O O   . ARG A 82  ? 0.8160 1.1229 0.7433 0.0069  0.0630  -0.0352 60  ARG A O   
447  C CB  . ARG A 82  ? 0.7947 1.0723 0.7471 0.0384  0.0718  -0.0549 60  ARG A CB  
448  C CG  . ARG A 82  ? 0.7220 1.0040 0.6745 0.0492  0.0758  -0.0707 60  ARG A CG  
449  C CD  . ARG A 82  ? 0.7828 1.0493 0.7492 0.0442  0.0783  -0.0671 60  ARG A CD  
450  N NE  . ARG A 82  ? 0.9075 1.1561 0.8736 0.0569  0.0814  -0.0748 60  ARG A NE  
451  C CZ  . ARG A 82  ? 1.0657 1.2941 1.0429 0.0595  0.0844  -0.0706 60  ARG A CZ  
452  N NH1 . ARG A 82  ? 1.0926 1.3117 1.0859 0.0545  0.0819  -0.0588 60  ARG A NH1 
453  N NH2 . ARG A 82  ? 1.1845 1.4046 1.1565 0.0674  0.0891  -0.0790 60  ARG A NH2 
454  N N   . VAL A 83  ? 0.7255 0.9891 0.6620 0.0252  0.0570  -0.0289 61  VAL A N   
455  C CA  . VAL A 83  ? 0.7818 1.0427 0.7195 0.0098  0.0480  -0.0091 61  VAL A CA  
456  C C   . VAL A 83  ? 0.7064 0.9810 0.6152 0.0009  0.0449  -0.0131 61  VAL A C   
457  O O   . VAL A 83  ? 0.6935 0.9816 0.5935 -0.0181 0.0413  -0.0023 61  VAL A O   
458  C CB  . VAL A 83  ? 0.7539 0.9973 0.7095 0.0147  0.0424  0.0029  61  VAL A CB  
459  C CG1 . VAL A 83  ? 0.7571 1.0004 0.7088 0.0009  0.0301  0.0207  61  VAL A CG1 
460  C CG2 . VAL A 83  ? 0.8395 1.0753 0.8258 0.0204  0.0441  0.0086  61  VAL A CG2 
461  N N   . VAL A 84  ? 0.5809 0.8495 0.4707 0.0136  0.0449  -0.0294 62  VAL A N   
462  C CA  . VAL A 84  ? 0.5897 0.8665 0.4487 0.0099  0.0417  -0.0395 62  VAL A CA  
463  C C   . VAL A 84  ? 0.7569 1.0724 0.6066 0.0104  0.0517  -0.0579 62  VAL A C   
464  O O   . VAL A 84  ? 0.8470 1.1852 0.6755 -0.0021 0.0526  -0.0616 62  VAL A O   
465  C CB  . VAL A 84  ? 0.6271 0.8747 0.4665 0.0253  0.0346  -0.0527 62  VAL A CB  
466  C CG1 . VAL A 84  ? 0.6514 0.8978 0.4558 0.0230  0.0288  -0.0652 62  VAL A CG1 
467  C CG2 . VAL A 84  ? 0.7506 0.9727 0.6012 0.0184  0.0264  -0.0326 62  VAL A CG2 
468  N N   . SER A 85  ? 0.8095 1.1391 0.6743 0.0228  0.0595  -0.0700 63  SER A N   
469  C CA  . SER A 85  ? 0.8032 1.1814 0.6649 0.0229  0.0694  -0.0883 63  SER A CA  
470  C C   . SER A 85  ? 0.8186 1.2261 0.6826 -0.0084 0.0733  -0.0709 63  SER A C   
471  O O   . SER A 85  ? 0.8417 1.2975 0.6931 -0.0197 0.0811  -0.0817 63  SER A O   
472  C CB  . SER A 85  ? 0.7069 1.0936 0.5861 0.0420  0.0736  -0.1031 63  SER A CB  
473  O OG  . SER A 85  ? 0.8061 1.2475 0.6930 0.0316  0.0833  -0.1108 63  SER A OG  
474  N N   . SER A 86  ? 0.8126 1.1926 0.6915 -0.0229 0.0670  -0.0450 64  SER A N   
475  C CA  . SER A 86  ? 0.8631 1.2572 0.7388 -0.0552 0.0643  -0.0243 64  SER A CA  
476  C C   . SER A 86  ? 0.8676 1.2585 0.7209 -0.0756 0.0558  -0.0083 64  SER A C   
477  O O   . SER A 86  ? 0.8814 1.2950 0.7189 -0.1065 0.0540  0.0051  64  SER A O   
478  C CB  . SER A 86  ? 0.7849 1.1433 0.6831 -0.0597 0.0567  -0.0050 64  SER A CB  
479  O OG  . SER A 86  ? 0.7620 1.0837 0.6656 -0.0623 0.0434  0.0165  64  SER A OG  
480  N N   . ILE A 87  ? 0.7680 1.1308 0.6170 -0.0632 0.0485  -0.0069 65  ILE A N   
481  C CA  . ILE A 87  ? 0.7870 1.1494 0.6111 -0.0833 0.0392  0.0063  65  ILE A CA  
482  C C   . ILE A 87  ? 0.8591 1.2642 0.6505 -0.0881 0.0501  -0.0174 65  ILE A C   
483  O O   . ILE A 87  ? 0.8122 1.2431 0.5788 -0.1175 0.0493  -0.0082 65  ILE A O   
484  C CB  . ILE A 87  ? 0.7349 1.0597 0.5630 -0.0714 0.0276  0.0136  65  ILE A CB  
485  C CG1 . ILE A 87  ? 0.7095 1.0053 0.5711 -0.0709 0.0163  0.0389  65  ILE A CG1 
486  C CG2 . ILE A 87  ? 0.6617 0.9901 0.4560 -0.0911 0.0184  0.0203  65  ILE A CG2 
487  C CD1 . ILE A 87  ? 0.5969 0.8688 0.4705 -0.0584 0.0078  0.0439  65  ILE A CD1 
488  N N   . GLU A 88  ? 0.8292 1.2443 0.6196 -0.0590 0.0597  -0.0495 66  GLU A N   
489  C CA  . GLU A 88  ? 0.8713 1.3303 0.6355 -0.0546 0.0706  -0.0797 66  GLU A CA  
490  C C   . GLU A 88  ? 0.9748 1.4991 0.7379 -0.0772 0.0843  -0.0827 66  GLU A C   
491  O O   . GLU A 88  ? 1.0791 1.6494 0.8147 -0.0913 0.0928  -0.0965 66  GLU A O   
492  C CB  . GLU A 88  ? 0.8240 1.2747 0.5935 -0.0138 0.0737  -0.1130 66  GLU A CB  
493  C CG  . GLU A 88  ? 1.0861 1.6006 0.8546 -0.0001 0.0890  -0.1473 66  GLU A CG  
494  C CD  . GLU A 88  ? 1.2746 1.7747 1.0476 0.0443  0.0861  -0.1804 66  GLU A CD  
495  O OE1 . GLU A 88  ? 1.4213 1.9529 1.2192 0.0617  0.0925  -0.1950 66  GLU A OE1 
496  O OE2 . GLU A 88  ? 1.3375 1.7935 1.0870 0.0608  0.0750  -0.1919 66  GLU A OE2 
497  N N   . GLN A 89  ? 0.9110 1.4423 0.7007 -0.0845 0.0865  -0.0702 67  GLN A N   
498  C CA  . GLN A 89  ? 0.9871 1.5797 0.7735 -0.1144 0.0970  -0.0680 67  GLN A CA  
499  C C   . GLN A 89  ? 1.0740 1.6597 0.8376 -0.1609 0.0869  -0.0328 67  GLN A C   
500  O O   . GLN A 89  ? 1.1852 1.8274 0.9258 -0.1937 0.0951  -0.0324 67  GLN A O   
501  C CB  . GLN A 89  ? 1.0483 1.6460 0.8662 -0.1097 0.0997  -0.0665 67  GLN A CB  
502  C CG  . GLN A 89  ? 1.2330 1.8510 1.0708 -0.0689 0.1085  -0.1009 67  GLN A CG  
503  C CD  . GLN A 89  ? 1.4006 2.0266 1.2658 -0.0694 0.1098  -0.0979 67  GLN A CD  
504  O OE1 . GLN A 89  ? 1.4939 2.1185 1.3600 -0.1031 0.1062  -0.0735 67  GLN A OE1 
505  N NE2 . GLN A 89  ? 1.4236 2.0534 1.3078 -0.0336 0.1120  -0.1219 67  GLN A NE2 
506  N N   . LYS A 90  ? 0.9657 1.4860 0.7359 -0.1651 0.0679  -0.0025 68  LYS A N   
507  C CA  . LYS A 90  ? 0.9108 1.4147 0.6592 -0.2057 0.0518  0.0331  68  LYS A CA  
508  C C   . LYS A 90  ? 1.0481 1.5621 0.7597 -0.2183 0.0491  0.0321  68  LYS A C   
509  O O   . LYS A 90  ? 1.0738 1.5772 0.7611 -0.2546 0.0338  0.0622  68  LYS A O   
510  C CB  . LYS A 90  ? 0.8478 1.2822 0.6210 -0.1998 0.0305  0.0623  68  LYS A CB  
511  N N   . THR A 91  ? 1.0750 1.6046 0.7788 -0.1897 0.0608  -0.0016 69  THR A N   
512  C CA  . THR A 91  ? 0.9908 1.5206 0.6578 -0.1962 0.0573  -0.0081 69  THR A CA  
513  C C   . THR A 91  ? 1.0224 1.6260 0.6563 -0.2088 0.0775  -0.0375 69  THR A C   
514  O O   . THR A 91  ? 1.0078 1.6195 0.6072 -0.2080 0.0794  -0.0555 69  THR A O   
515  C CB  . THR A 91  ? 1.0051 1.4905 0.6819 -0.1563 0.0524  -0.0257 69  THR A CB  
516  O OG1 . THR A 91  ? 1.2149 1.6456 0.9216 -0.1508 0.0355  0.0031  69  THR A OG1 
517  C CG2 . THR A 91  ? 1.0145 1.4886 0.6528 -0.1631 0.0450  -0.0313 69  THR A CG2 
518  N N   . GLU A 92  ? 0.9405 1.6022 0.5836 -0.2224 0.0927  -0.0437 70  GLU A N   
519  C CA  . GLU A 92  ? 1.0016 1.7432 0.6253 -0.2328 0.1130  -0.0732 70  GLU A CA  
520  C C   . GLU A 92  ? 1.0133 1.7583 0.5989 -0.2771 0.1042  -0.0526 70  GLU A C   
521  O O   . GLU A 92  ? 1.0389 1.7651 0.6094 -0.3198 0.0891  -0.0099 70  GLU A O   
522  C CB  . GLU A 92  ? 1.0950 1.8900 0.7505 -0.2441 0.1238  -0.0752 70  GLU A CB  
523  C CG  . GLU A 92  ? 1.2203 2.0869 0.8747 -0.2689 0.1341  -0.0892 70  GLU A CG  
524  C CD  . GLU A 92  ? 1.3166 2.2356 1.0029 -0.2262 0.1501  -0.1374 70  GLU A CD  
525  O OE1 . GLU A 92  ? 1.2173 2.1114 0.9279 -0.1795 0.1509  -0.1565 70  GLU A OE1 
526  O OE2 . GLU A 92  ? 1.4152 2.4001 1.1020 -0.2398 0.1598  -0.1553 70  GLU A OE2 
527  N N   . GLY A 93  ? 1.0475 1.8090 0.6153 -0.2662 0.1109  -0.0818 71  GLY A N   
528  C CA  . GLY A 93  ? 1.0903 1.8577 0.6203 -0.3059 0.1040  -0.0675 71  GLY A CA  
529  C C   . GLY A 93  ? 1.1133 1.8236 0.6088 -0.3000 0.0888  -0.0630 71  GLY A C   
530  O O   . GLY A 93  ? 1.1606 1.8794 0.6240 -0.3207 0.0871  -0.0663 71  GLY A O   
531  N N   . ALA A 94  ? 1.1673 1.8223 0.6678 -0.2750 0.0767  -0.0550 72  ALA A N   
532  C CA  . ALA A 94  ? 1.1598 1.7598 0.6309 -0.2691 0.0585  -0.0500 72  ALA A CA  
533  C C   . ALA A 94  ? 1.1333 1.7196 0.6080 -0.2181 0.0673  -0.0967 72  ALA A C   
534  O O   . ALA A 94  ? 1.0834 1.6297 0.5967 -0.1844 0.0621  -0.0976 72  ALA A O   
535  C CB  . ALA A 94  ? 1.0188 1.5543 0.5185 -0.2733 0.0325  -0.0047 72  ALA A CB  
536  N N   . GLU A 95  ? 1.1622 1.7601 0.6136 -0.2080 0.0751  -0.1310 73  GLU A N   
537  C CA  . GLU A 95  ? 1.1119 1.6989 0.5679 -0.1571 0.0831  -0.1795 73  GLU A CA  
538  C C   . GLU A 95  ? 1.1406 1.6585 0.5855 -0.1352 0.0637  -0.1790 73  GLU A C   
539  O O   . GLU A 95  ? 1.2600 1.7558 0.7303 -0.0927 0.0648  -0.2025 73  GLU A O   
540  C CB  . GLU A 95  ? 1.1450 1.7468 0.5691 -0.1532 0.0907  -0.2130 73  GLU A CB  
541  N N   . LYS A 96  ? 1.0762 1.5448 0.5040 -0.1618 0.0412  -0.1445 74  LYS A N   
542  C CA  . LYS A 96  ? 1.0483 1.4411 0.4816 -0.1405 0.0204  -0.1413 74  LYS A CA  
543  C C   . LYS A 96  ? 1.1021 1.4647 0.5917 -0.1317 0.0119  -0.1084 74  LYS A C   
544  O O   . LYS A 96  ? 0.9149 1.2327 0.4199 -0.1030 0.0044  -0.1175 74  LYS A O   
545  C CB  . LYS A 96  ? 1.1016 1.4595 0.4911 -0.1708 -0.0007 -0.1243 74  LYS A CB  
546  C CG  . LYS A 96  ? 1.3023 1.6596 0.6324 -0.1618 0.0033  -0.1710 74  LYS A CG  
547  C CD  . LYS A 96  ? 1.2557 1.5716 0.5343 -0.1896 -0.0192 -0.1613 74  LYS A CD  
548  C CE  . LYS A 96  ? 1.1547 1.4628 0.4436 -0.2322 -0.0389 -0.1044 74  LYS A CE  
549  N NZ  . LYS A 96  ? 1.2512 1.5393 0.4776 -0.2622 -0.0557 -0.1053 74  LYS A NZ  
550  N N   . LYS A 97  ? 1.0805 1.4677 0.5994 -0.1542 0.0138  -0.0740 75  LYS A N   
551  C CA  . LYS A 97  ? 0.9173 1.2807 0.4900 -0.1404 0.0091  -0.0509 75  LYS A CA  
552  C C   . LYS A 97  ? 0.9478 1.3304 0.5480 -0.1067 0.0272  -0.0787 75  LYS A C   
553  O O   . LYS A 97  ? 1.0862 1.4375 0.7188 -0.0835 0.0236  -0.0757 75  LYS A O   
554  C CB  . LYS A 97  ? 0.8800 1.2537 0.4746 -0.1712 0.0015  -0.0074 75  LYS A CB  
555  C CG  . LYS A 97  ? 0.9723 1.3323 0.5417 -0.2066 -0.0200 0.0242  75  LYS A CG  
556  C CD  . LYS A 97  ? 0.8684 1.2219 0.4693 -0.2268 -0.0346 0.0685  75  LYS A CD  
557  N N   . GLN A 98  ? 1.0003 1.4378 0.5873 -0.1036 0.0463  -0.1071 76  GLN A N   
558  C CA  . GLN A 98  ? 0.9537 1.4153 0.5711 -0.0719 0.0609  -0.1318 76  GLN A CA  
559  C C   . GLN A 98  ? 1.0361 1.4671 0.6442 -0.0297 0.0578  -0.1697 76  GLN A C   
560  O O   . GLN A 98  ? 1.0543 1.4686 0.6916 -0.0006 0.0574  -0.1777 76  GLN A O   
561  C CB  . GLN A 98  ? 0.9342 1.4764 0.5475 -0.0846 0.0821  -0.1479 76  GLN A CB  
562  C CG  . GLN A 98  ? 0.9473 1.5250 0.5918 -0.0517 0.0963  -0.1767 76  GLN A CG  
563  C CD  . GLN A 98  ? 0.9459 1.6115 0.5930 -0.0735 0.1165  -0.1840 76  GLN A CD  
564  O OE1 . GLN A 98  ? 0.9839 1.6713 0.6599 -0.0878 0.1207  -0.1648 76  GLN A OE1 
565  N NE2 . GLN A 98  ? 0.8392 1.5365 0.4713 -0.0780 0.1232  -0.2045 76  GLN A NE2 
566  N N   . GLN A 99  ? 0.9945 1.4137 0.5582 -0.0263 0.0533  -0.1940 77  GLN A N   
567  C CA  . GLN A 99  ? 1.0006 1.3711 0.5496 0.0128  0.0428  -0.2268 77  GLN A CA  
568  C C   . GLN A 99  ? 1.0884 1.3828 0.6494 0.0158  0.0215  -0.2005 77  GLN A C   
569  O O   . GLN A 99  ? 1.0719 1.3235 0.6340 0.0473  0.0116  -0.2181 77  GLN A O   
570  C CB  . GLN A 99  ? 0.9605 1.3222 0.4541 0.0127  0.0387  -0.2567 77  GLN A CB  
571  N N   . MET A 100 ? 1.1697 1.4487 0.7394 -0.0171 0.0127  -0.1584 78  MET A N   
572  C CA  . MET A 100 ? 1.1950 1.4170 0.7798 -0.0172 -0.0047 -0.1337 78  MET A CA  
573  C C   . MET A 100 ? 1.0146 1.2449 0.6488 -0.0050 0.0028  -0.1201 78  MET A C   
574  O O   . MET A 100 ? 0.9848 1.1752 0.6280 0.0117  -0.0058 -0.1205 78  MET A O   
575  C CB  . MET A 100 ? 1.3321 1.5416 0.9111 -0.0534 -0.0182 -0.0972 78  MET A CB  
576  C CG  . MET A 100 ? 1.4068 1.5788 1.0119 -0.0576 -0.0324 -0.0687 78  MET A CG  
577  S SD  . MET A 100 ? 1.5972 1.7704 1.2019 -0.0975 -0.0493 -0.0283 78  MET A SD  
578  C CE  . MET A 100 ? 1.5942 1.8170 1.2411 -0.1081 -0.0369 -0.0037 78  MET A CE  
579  N N   . ALA A 101 ? 0.9531 1.2325 0.6145 -0.0161 0.0176  -0.1081 79  ALA A N   
580  C CA  . ALA A 101 ? 0.7961 1.0842 0.5000 -0.0044 0.0253  -0.0999 79  ALA A CA  
581  C C   . ALA A 101 ? 0.8873 1.1812 0.5938 0.0300  0.0318  -0.1338 79  ALA A C   
582  O O   . ALA A 101 ? 0.7955 1.0724 0.5260 0.0453  0.0307  -0.1309 79  ALA A O   
583  C CB  . ALA A 101 ? 0.7350 1.0680 0.4598 -0.0266 0.0362  -0.0811 79  ALA A CB  
584  N N   . ARG A 102 ? 1.0541 1.3759 0.7371 0.0434  0.0382  -0.1674 80  ARG A N   
585  C CA  . ARG A 102 ? 0.9111 1.2374 0.5996 0.0818  0.0400  -0.2016 80  ARG A CA  
586  C C   . ARG A 102 ? 0.8504 1.1014 0.5214 0.1028  0.0186  -0.2073 80  ARG A C   
587  O O   . ARG A 102 ? 0.8515 1.0835 0.5393 0.1247  0.0134  -0.2115 80  ARG A O   
588  C CB  . ARG A 102 ? 0.8969 1.2754 0.5667 0.0961  0.0513  -0.2409 80  ARG A CB  
589  C CG  . ARG A 102 ? 1.0470 1.4303 0.7276 0.1422  0.0490  -0.2782 80  ARG A CG  
590  C CD  . ARG A 102 ? 1.1853 1.6302 0.8548 0.1640  0.0613  -0.3237 80  ARG A CD  
591  N NE  . ARG A 102 ? 1.3550 1.7690 0.9795 0.1627  0.0538  -0.3400 80  ARG A NE  
592  C CZ  . ARG A 102 ? 1.5142 1.9656 1.1206 0.1307  0.0662  -0.3348 80  ARG A CZ  
593  N NH1 . ARG A 102 ? 1.5203 2.0385 1.1487 0.0969  0.0847  -0.3123 80  ARG A NH1 
594  N NH2 . ARG A 102 ? 1.5445 1.9620 1.1070 0.1301  0.0580  -0.3511 80  ARG A NH2 
595  N N   . GLU A 103 ? 0.8842 1.0895 0.5180 0.0925  0.0040  -0.2053 81  GLU A N   
596  C CA  . GLU A 103 ? 0.9778 1.1065 0.5867 0.1069  -0.0197 -0.2102 81  GLU A CA  
597  C C   . GLU A 103 ? 1.0127 1.1105 0.6445 0.0939  -0.0267 -0.1760 81  GLU A C   
598  O O   . GLU A 103 ? 1.0042 1.0535 0.6277 0.1096  -0.0419 -0.1797 81  GLU A O   
599  C CB  . GLU A 103 ? 0.9990 1.0871 0.5599 0.0925  -0.0348 -0.2143 81  GLU A CB  
600  N N   . TYR A 104 ? 0.9016 1.0278 0.5614 0.0659  -0.0167 -0.1436 82  TYR A N   
601  C CA  . TYR A 104 ? 0.8707 0.9802 0.5568 0.0562  -0.0193 -0.1158 82  TYR A CA  
602  C C   . TYR A 104 ? 0.8731 1.0028 0.5895 0.0756  -0.0084 -0.1223 82  TYR A C   
603  O O   . TYR A 104 ? 0.8867 0.9855 0.6061 0.0818  -0.0160 -0.1166 82  TYR A O   
604  C CB  . TYR A 104 ? 0.8477 0.9813 0.5567 0.0262  -0.0143 -0.0834 82  TYR A CB  
605  C CG  . TYR A 104 ? 0.9245 1.0385 0.6526 0.0131  -0.0210 -0.0568 82  TYR A CG  
606  C CD1 . TYR A 104 ? 1.0394 1.1055 0.7420 0.0103  -0.0379 -0.0555 82  TYR A CD1 
607  C CD2 . TYR A 104 ? 0.8617 1.0058 0.6311 0.0022  -0.0117 -0.0335 82  TYR A CD2 
608  C CE1 . TYR A 104 ? 0.9469 1.0070 0.6664 -0.0059 -0.0420 -0.0317 82  TYR A CE1 
609  C CE2 . TYR A 104 ? 0.8825 1.0198 0.6724 -0.0074 -0.0155 -0.0136 82  TYR A CE2 
610  C CZ  . TYR A 104 ? 0.9330 1.0339 0.6985 -0.0132 -0.0291 -0.0124 82  TYR A CZ  
611  O OH  . TYR A 104 ? 1.0016 1.1070 0.7868 -0.0270 -0.0309 0.0069  82  TYR A OH  
612  N N   . ARG A 105 ? 0.8755 1.0581 0.6111 0.0818  0.0082  -0.1332 83  ARG A N   
613  C CA  . ARG A 105 ? 0.8197 1.0246 0.5814 0.0992  0.0167  -0.1418 83  ARG A CA  
614  C C   . ARG A 105 ? 0.8762 1.0484 0.6201 0.1305  0.0028  -0.1668 83  ARG A C   
615  O O   . ARG A 105 ? 0.6920 0.8438 0.4449 0.1394  -0.0027 -0.1624 83  ARG A O   
616  C CB  . ARG A 105 ? 0.6467 0.9177 0.4259 0.0963  0.0346  -0.1511 83  ARG A CB  
617  C CG  . ARG A 105 ? 0.6164 0.9196 0.4264 0.1049  0.0443  -0.1544 83  ARG A CG  
618  C CD  . ARG A 105 ? 0.7324 1.0998 0.5481 0.1141  0.0560  -0.1797 83  ARG A CD  
619  N NE  . ARG A 105 ? 0.7910 1.1517 0.5933 0.1497  0.0471  -0.2130 83  ARG A NE  
620  C CZ  . ARG A 105 ? 1.0065 1.4045 0.7963 0.1634  0.0516  -0.2424 83  ARG A CZ  
621  N NH1 . ARG A 105 ? 1.0826 1.5311 0.8680 0.1387  0.0668  -0.2401 83  ARG A NH1 
622  N NH2 . ARG A 105 ? 1.0965 1.4802 0.8761 0.2019  0.0397  -0.2747 83  ARG A NH2 
623  N N   . GLU A 106 ? 0.9699 1.1311 0.6848 0.1476  -0.0057 -0.1933 84  GLU A N   
624  C CA  . GLU A 106 ? 1.0129 1.1315 0.7089 0.1806  -0.0251 -0.2171 84  GLU A CA  
625  C C   . GLU A 106 ? 0.9640 1.0074 0.6388 0.1707  -0.0466 -0.1958 84  GLU A C   
626  O O   . GLU A 106 ? 0.9621 0.9787 0.6376 0.1856  -0.0584 -0.1968 84  GLU A O   
627  C CB  . GLU A 106 ? 1.1284 1.2411 0.7936 0.2032  -0.0326 -0.2527 84  GLU A CB  
628  C CG  . GLU A 106 ? 1.2285 1.4276 0.9131 0.2137  -0.0098 -0.2786 84  GLU A CG  
629  C CD  . GLU A 106 ? 1.3951 1.5959 1.0521 0.2459  -0.0161 -0.3236 84  GLU A CD  
630  O OE1 . GLU A 106 ? 1.4474 1.6182 1.0667 0.2349  -0.0220 -0.3285 84  GLU A OE1 
631  O OE2 . GLU A 106 ? 1.4088 1.6473 1.0834 0.2829  -0.0144 -0.3564 84  GLU A OE2 
632  N N   . LYS A 107 ? 0.9892 1.0041 0.6463 0.1413  -0.0517 -0.1737 85  LYS A N   
633  C CA  . LYS A 107 ? 1.0319 0.9872 0.6697 0.1237  -0.0701 -0.1506 85  LYS A CA  
634  C C   . LYS A 107 ? 1.0549 1.0266 0.7233 0.1154  -0.0607 -0.1300 85  LYS A C   
635  O O   . LYS A 107 ? 0.9113 0.8405 0.5635 0.1175  -0.0763 -0.1248 85  LYS A O   
636  C CB  . LYS A 107 ? 0.9276 0.8717 0.5520 0.0901  -0.0732 -0.1289 85  LYS A CB  
637  C CG  . LYS A 107 ? 0.8935 0.7967 0.5053 0.0629  -0.0876 -0.1008 85  LYS A CG  
638  N N   . ILE A 108 ? 1.0334 1.0625 0.7415 0.1038  -0.0369 -0.1177 86  ILE A N   
639  C CA  . ILE A 108 ? 0.8587 0.9054 0.5952 0.0975  -0.0261 -0.1026 86  ILE A CA  
640  C C   . ILE A 108 ? 0.8960 0.9411 0.6343 0.1228  -0.0296 -0.1199 86  ILE A C   
641  O O   . ILE A 108 ? 0.9619 0.9865 0.6967 0.1197  -0.0351 -0.1108 86  ILE A O   
642  C CB  . ILE A 108 ? 0.8249 0.9257 0.6006 0.0844  -0.0038 -0.0904 86  ILE A CB  
643  C CG1 . ILE A 108 ? 0.8610 0.9601 0.6366 0.0596  -0.0056 -0.0697 86  ILE A CG1 
644  C CG2 . ILE A 108 ? 0.6964 0.8145 0.4997 0.0829  0.0079  -0.0820 86  ILE A CG2 
645  C CD1 . ILE A 108 ? 0.7180 0.8608 0.5279 0.0473  0.0093  -0.0560 86  ILE A CD1 
646  N N   . GLU A 109 ? 0.9951 1.0637 0.7364 0.1478  -0.0283 -0.1458 87  GLU A N   
647  C CA  . GLU A 109 ? 0.9235 1.0062 0.6762 0.1730  -0.0308 -0.1626 87  GLU A CA  
648  C C   . GLU A 109 ? 0.9938 1.0125 0.7141 0.1892  -0.0594 -0.1679 87  GLU A C   
649  O O   . GLU A 109 ? 1.0082 1.0210 0.7333 0.1951  -0.0652 -0.1648 87  GLU A O   
650  C CB  . GLU A 109 ? 0.9628 1.0945 0.7278 0.1966  -0.0236 -0.1916 87  GLU A CB  
651  C CG  . GLU A 109 ? 0.9442 1.1504 0.7466 0.1882  0.0010  -0.1916 87  GLU A CG  
652  C CD  . GLU A 109 ? 1.1223 1.3846 0.9322 0.2074  0.0083  -0.2215 87  GLU A CD  
653  O OE1 . GLU A 109 ? 1.0978 1.4226 0.9302 0.1918  0.0283  -0.2194 87  GLU A OE1 
654  O OE2 . GLU A 109 ? 1.1802 1.4243 0.9720 0.2374  -0.0066 -0.2478 87  GLU A OE2 
655  N N   . THR A 110 ? 1.0223 0.9857 0.7049 0.1929  -0.0803 -0.1733 88  THR A N   
656  C CA  . THR A 110 ? 1.1079 0.9969 0.7529 0.2032  -0.1130 -0.1736 88  THR A CA  
657  C C   . THR A 110 ? 1.1379 1.0001 0.7727 0.1708  -0.1160 -0.1413 88  THR A C   
658  O O   . THR A 110 ? 1.2658 1.0899 0.8819 0.1759  -0.1359 -0.1372 88  THR A O   
659  C CB  . THR A 110 ? 1.0863 0.9119 0.6872 0.2102  -0.1378 -0.1853 88  THR A CB  
660  O OG1 . THR A 110 ? 1.1834 1.0145 0.7789 0.1776  -0.1263 -0.1686 88  THR A OG1 
661  C CG2 . THR A 110 ? 1.0440 0.8897 0.6497 0.2527  -0.1404 -0.2255 88  THR A CG2 
662  N N   . GLU A 111 ? 1.0510 0.9333 0.6959 0.1370  -0.0984 -0.1187 89  GLU A N   
663  C CA  . GLU A 111 ? 1.0040 0.8822 0.6478 0.1070  -0.0943 -0.0919 89  GLU A CA  
664  C C   . GLU A 111 ? 0.9166 0.8321 0.5878 0.1146  -0.0800 -0.0934 89  GLU A C   
665  O O   . GLU A 111 ? 1.0082 0.8968 0.6598 0.1070  -0.0918 -0.0839 89  GLU A O   
666  C CB  . GLU A 111 ? 1.1194 1.0301 0.7823 0.0766  -0.0751 -0.0724 89  GLU A CB  
667  C CG  . GLU A 111 ? 1.2448 1.1116 0.8727 0.0516  -0.0932 -0.0581 89  GLU A CG  
668  C CD  . GLU A 111 ? 1.3067 1.2175 0.9623 0.0237  -0.0747 -0.0384 89  GLU A CD  
669  O OE1 . GLU A 111 ? 1.2613 1.1616 0.9051 0.0114  -0.0823 -0.0340 89  GLU A OE1 
670  O OE2 . GLU A 111 ? 1.3361 1.2916 1.0251 0.0153  -0.0540 -0.0286 89  GLU A OE2 
671  N N   . LEU A 112 ? 0.8754 0.8506 0.5874 0.1266  -0.0566 -0.1045 90  LEU A N   
672  C CA  . LEU A 112 ? 0.8634 0.8729 0.5997 0.1335  -0.0448 -0.1083 90  LEU A CA  
673  C C   . LEU A 112 ? 0.9141 0.8973 0.6329 0.1585  -0.0681 -0.1222 90  LEU A C   
674  O O   . LEU A 112 ? 1.1287 1.1063 0.8427 0.1543  -0.0722 -0.1160 90  LEU A O   
675  C CB  . LEU A 112 ? 0.7742 0.8458 0.5511 0.1395  -0.0209 -0.1178 90  LEU A CB  
676  C CG  . LEU A 112 ? 0.9884 1.0992 0.7934 0.1370  -0.0045 -0.1179 90  LEU A CG  
677  C CD1 . LEU A 112 ? 1.0220 1.1779 0.8589 0.1270  0.0176  -0.1152 90  LEU A CD1 
678  C CD2 . LEU A 112 ? 1.0953 1.2192 0.9039 0.1606  -0.0145 -0.1358 90  LEU A CD2 
679  N N   . ARG A 113 ? 0.8095 0.7787 0.5193 0.1862  -0.0842 -0.1427 91  ARG A N   
680  C CA  . ARG A 113 ? 0.9425 0.8872 0.6401 0.2164  -0.1104 -0.1584 91  ARG A CA  
681  C C   . ARG A 113 ? 0.9624 0.8295 0.6132 0.2052  -0.1412 -0.1413 91  ARG A C   
682  O O   . ARG A 113 ? 0.9479 0.8004 0.5909 0.2144  -0.1582 -0.1405 91  ARG A O   
683  C CB  . ARG A 113 ? 1.0467 0.9920 0.7441 0.2519  -0.1218 -0.1879 91  ARG A CB  
684  C CG  . ARG A 113 ? 1.0801 1.0743 0.8079 0.2873  -0.1235 -0.2134 91  ARG A CG  
685  C CD  . ARG A 113 ? 1.3197 1.3146 1.0451 0.3263  -0.1362 -0.2470 91  ARG A CD  
686  N NE  . ARG A 113 ? 1.3907 1.4306 1.1283 0.3175  -0.1099 -0.2560 91  ARG A NE  
687  C CZ  . ARG A 113 ? 1.3077 1.4348 1.0847 0.3121  -0.0797 -0.2629 91  ARG A CZ  
688  N NH1 . ARG A 113 ? 1.2879 1.4675 1.0980 0.3146  -0.0713 -0.2628 91  ARG A NH1 
689  N NH2 . ARG A 113 ? 1.2106 1.3700 0.9899 0.3006  -0.0601 -0.2683 91  ARG A NH2 
690  N N   . ASP A 114 ? 1.0855 0.9018 0.7018 0.1822  -0.1513 -0.1260 92  ASP A N   
691  C CA  . ASP A 114 ? 1.1822 0.9219 0.7473 0.1652  -0.1834 -0.1072 92  ASP A CA  
692  C C   . ASP A 114 ? 1.1325 0.8898 0.6966 0.1314  -0.1703 -0.0829 92  ASP A C   
693  O O   . ASP A 114 ? 1.1015 0.8136 0.6304 0.1234  -0.1953 -0.0712 92  ASP A O   
694  C CB  . ASP A 114 ? 1.3572 1.0389 0.8829 0.1449  -0.1997 -0.0966 92  ASP A CB  
695  C CG  . ASP A 114 ? 1.6549 1.3091 1.1721 0.1795  -0.2160 -0.1244 92  ASP A CG  
696  O OD1 . ASP A 114 ? 1.7468 1.4238 1.2863 0.2217  -0.2187 -0.1522 92  ASP A OD1 
697  O OD2 . ASP A 114 ? 1.7472 1.3589 1.2344 0.1646  -0.2271 -0.1201 92  ASP A OD2 
698  N N   . ILE A 115 ? 1.0101 0.8316 0.6106 0.1126  -0.1328 -0.0766 93  ILE A N   
699  C CA  . ILE A 115 ? 0.9897 0.8367 0.5937 0.0870  -0.1167 -0.0614 93  ILE A CA  
700  C C   . ILE A 115 ? 1.0835 0.9438 0.6961 0.1069  -0.1218 -0.0721 93  ILE A C   
701  O O   . ILE A 115 ? 1.1230 0.9661 0.7099 0.0902  -0.1310 -0.0600 93  ILE A O   
702  C CB  . ILE A 115 ? 0.9546 0.8665 0.6011 0.0719  -0.0777 -0.0583 93  ILE A CB  
703  C CG1 . ILE A 115 ? 0.8145 0.7194 0.4542 0.0485  -0.0743 -0.0443 93  ILE A CG1 
704  C CG2 . ILE A 115 ? 0.8517 0.7934 0.5040 0.0524  -0.0594 -0.0503 93  ILE A CG2 
705  C CD1 . ILE A 115 ? 0.7522 0.7180 0.4385 0.0430  -0.0418 -0.0441 93  ILE A CD1 
706  N N   . CYS A 116 ? 1.1515 1.0490 0.8003 0.1393  -0.1151 -0.0944 94  CYS A N   
707  C CA  . CYS A 116 ? 1.0732 0.9968 0.7379 0.1563  -0.1178 -0.1049 94  CYS A CA  
708  C C   . CYS A 116 ? 1.1335 1.0020 0.7640 0.1746  -0.1594 -0.1064 94  CYS A C   
709  O O   . CYS A 116 ? 1.2149 1.0813 0.8356 0.1710  -0.1697 -0.1012 94  CYS A O   
710  C CB  . CYS A 116 ? 0.9352 0.9209 0.6480 0.1814  -0.0999 -0.1272 94  CYS A CB  
711  S SG  . CYS A 116 ? 0.8728 0.9235 0.6267 0.1595  -0.0562 -0.1237 94  CYS A SG  
712  N N   . ASN A 117 ? 1.1373 0.9576 0.7479 0.1956  -0.1861 -0.1143 95  ASN A N   
713  C CA  . ASN A 117 ? 1.2833 1.0371 0.8570 0.2146  -0.2320 -0.1144 95  ASN A CA  
714  C C   . ASN A 117 ? 1.3530 1.0434 0.8703 0.1747  -0.2514 -0.0833 95  ASN A C   
715  O O   . ASN A 117 ? 1.4550 1.0961 0.9387 0.1789  -0.2877 -0.0754 95  ASN A O   
716  C CB  . ASN A 117 ? 1.3908 1.1027 0.9546 0.2480  -0.2560 -0.1337 95  ASN A CB  
717  C CG  . ASN A 117 ? 1.3363 1.1205 0.9532 0.2839  -0.2344 -0.1657 95  ASN A CG  
718  O OD1 . ASN A 117 ? 1.2734 1.1273 0.9317 0.2946  -0.2172 -0.1756 95  ASN A OD1 
719  N ND2 . ASN A 117 ? 1.3902 1.1622 1.0041 0.2978  -0.2338 -0.1812 95  ASN A ND2 
720  N N   . ASP A 118 ? 1.4107 1.1048 0.9167 0.1348  -0.2291 -0.0651 96  ASP A N   
721  C CA  . ASP A 118 ? 1.5117 1.1679 0.9687 0.0891  -0.2386 -0.0353 96  ASP A CA  
722  C C   . ASP A 118 ? 1.4526 1.1448 0.9132 0.0753  -0.2269 -0.0292 96  ASP A C   
723  O O   . ASP A 118 ? 1.5195 1.1654 0.9341 0.0605  -0.2566 -0.0134 96  ASP A O   
724  C CB  . ASP A 118 ? 1.6118 1.2893 1.0715 0.0534  -0.2107 -0.0220 96  ASP A CB  
725  C CG  . ASP A 118 ? 1.8926 1.5227 1.2945 0.0047  -0.2274 0.0084  96  ASP A CG  
726  O OD1 . ASP A 118 ? 2.0567 1.6075 1.4051 0.0017  -0.2718 0.0195  96  ASP A OD1 
727  O OD2 . ASP A 118 ? 1.9017 1.5753 1.3120 -0.0309 -0.1977 0.0211  96  ASP A OD2 
728  N N   . VAL A 119 ? 1.2520 1.0220 0.7637 0.0808  -0.1870 -0.0424 97  VAL A N   
729  C CA  . VAL A 119 ? 1.0960 0.9008 0.6098 0.0656  -0.1728 -0.0395 97  VAL A CA  
730  C C   . VAL A 119 ? 1.1228 0.9141 0.6330 0.0924  -0.2025 -0.0478 97  VAL A C   
731  O O   . VAL A 119 ? 1.2551 1.0274 0.7305 0.0740  -0.2183 -0.0350 97  VAL A O   
732  C CB  . VAL A 119 ? 0.9756 0.8570 0.5426 0.0656  -0.1266 -0.0526 97  VAL A CB  
733  C CG1 . VAL A 119 ? 0.9027 0.8141 0.4704 0.0551  -0.1153 -0.0549 97  VAL A CG1 
734  C CG2 . VAL A 119 ? 0.8914 0.7887 0.4612 0.0381  -0.1005 -0.0425 97  VAL A CG2 
735  N N   . LEU A 120 ? 1.1329 0.9397 0.6795 0.1353  -0.2106 -0.0697 98  LEU A N   
736  C CA  . LEU A 120 ? 1.2506 1.0583 0.8036 0.1641  -0.2383 -0.0797 98  LEU A CA  
737  C C   . LEU A 120 ? 1.4603 1.1828 0.9589 0.1685  -0.2914 -0.0659 98  LEU A C   
738  O O   . LEU A 120 ? 1.5554 1.2698 1.0480 0.1836  -0.3201 -0.0666 98  LEU A O   
739  C CB  . LEU A 120 ? 0.9906 0.8462 0.5983 0.2092  -0.2336 -0.1087 98  LEU A CB  
740  C CG  . LEU A 120 ? 0.9502 0.8876 0.6114 0.2074  -0.1879 -0.1225 98  LEU A CG  
741  C CD1 . LEU A 120 ? 0.8869 0.8544 0.5850 0.2444  -0.1861 -0.1469 98  LEU A CD1 
742  C CD2 . LEU A 120 ? 0.8715 0.8631 0.5555 0.1982  -0.1729 -0.1254 98  LEU A CD2 
743  N N   . SER A 121 ? 1.4746 1.1311 0.9308 0.1523  -0.3076 -0.0511 99  SER A N   
744  C CA  . SER A 121 ? 1.6243 1.1872 1.0174 0.1462  -0.3611 -0.0320 99  SER A CA  
745  C C   . SER A 121 ? 1.6023 1.1489 0.9452 0.0941  -0.3635 -0.0020 99  SER A C   
746  O O   . SER A 121 ? 1.7514 1.2415 1.0493 0.0899  -0.4072 0.0133  99  SER A O   
747  C CB  . SER A 121 ? 1.7719 1.2659 1.1331 0.1433  -0.3798 -0.0266 99  SER A CB  
748  O OG  . SER A 121 ? 1.9937 1.3989 1.2804 0.1082  -0.4199 0.0042  99  SER A OG  
749  N N   . LEU A 122 ? 1.4918 1.0876 0.8401 0.0542  -0.3185 0.0061  100 LEU A N   
750  C CA  . LEU A 122 ? 1.4056 1.0074 0.7134 0.0063  -0.3114 0.0276  100 LEU A CA  
751  C C   . LEU A 122 ? 1.4776 1.1157 0.8011 0.0190  -0.3119 0.0183  100 LEU A C   
752  O O   . LEU A 122 ? 1.5607 1.1690 0.8346 -0.0059 -0.3364 0.0365  100 LEU A O   
753  C CB  . LEU A 122 ? 1.3312 0.9923 0.6549 -0.0288 -0.2589 0.0297  100 LEU A CB  
754  C CG  . LEU A 122 ? 1.4343 1.0716 0.7419 -0.0518 -0.2550 0.0426  100 LEU A CG  
755  C CD1 . LEU A 122 ? 1.3962 1.0875 0.7013 -0.0978 -0.2139 0.0525  100 LEU A CD1 
756  C CD2 . LEU A 122 ? 1.6546 1.1932 0.8923 -0.0680 -0.3097 0.0669  100 LEU A CD2 
757  N N   . LEU A 123 ? 1.4320 1.1328 0.8206 0.0553  -0.2885 -0.0087 101 LEU A N   
758  C CA  . LEU A 123 ? 1.4099 1.1540 0.8153 0.0604  -0.2841 -0.0175 101 LEU A CA  
759  C C   . LEU A 123 ? 1.4864 1.1915 0.8773 0.0880  -0.3371 -0.0157 101 LEU A C   
760  O O   . LEU A 123 ? 1.4736 1.1884 0.8488 0.0769  -0.3487 -0.0104 101 LEU A O   
761  C CB  . LEU A 123 ? 1.2117 1.0349 0.6883 0.0846  -0.2447 -0.0443 101 LEU A CB  
762  C CG  . LEU A 123 ? 1.0640 0.9347 0.5634 0.0618  -0.1927 -0.0491 101 LEU A CG  
763  C CD1 . LEU A 123 ? 1.1432 1.0539 0.7019 0.0926  -0.1721 -0.0691 101 LEU A CD1 
764  C CD2 . LEU A 123 ? 1.1023 1.0144 0.6027 0.0406  -0.1694 -0.0536 101 LEU A CD2 
765  N N   . GLU A 124 ? 1.5412 1.2038 0.9385 0.1261  -0.3706 -0.0222 102 GLU A N   
766  C CA  . GLU A 124 ? 1.6063 1.2305 0.9938 0.1588  -0.4252 -0.0225 102 GLU A CA  
767  C C   . GLU A 124 ? 1.7424 1.2675 1.0489 0.1320  -0.4756 0.0095  102 GLU A C   
768  O O   . GLU A 124 ? 1.8507 1.3480 1.1348 0.1395  -0.5183 0.0187  102 GLU A O   
769  C CB  . GLU A 124 ? 1.6739 1.3012 1.1080 0.2187  -0.4405 -0.0497 102 GLU A CB  
770  C CG  . GLU A 124 ? 1.6748 1.4062 1.1878 0.2461  -0.4002 -0.0803 102 GLU A CG  
771  C CD  . GLU A 124 ? 1.6640 1.4408 1.2093 0.2734  -0.4209 -0.0918 102 GLU A CD  
772  O OE1 . GLU A 124 ? 1.8203 1.5955 1.3924 0.3244  -0.4536 -0.1102 102 GLU A OE1 
773  O OE2 . GLU A 124 ? 1.4541 1.2698 0.9984 0.2448  -0.4054 -0.0840 102 GLU A OE2 
774  N N   . LYS A 125 ? 1.7675 1.2391 1.0275 0.0977  -0.4742 0.0287  103 LYS A N   
775  C CA  . LYS A 125 ? 1.8546 1.2247 1.0320 0.0683  -0.5267 0.0617  103 LYS A CA  
776  C C   . LYS A 125 ? 1.9585 1.3331 1.0792 0.0014  -0.5141 0.0907  103 LYS A C   
777  O O   . LYS A 125 ? 2.0818 1.3881 1.1394 -0.0251 -0.5579 0.1185  103 LYS A O   
778  C CB  . LYS A 125 ? 1.7222 1.0229 0.8710 0.0629  -0.5405 0.0693  103 LYS A CB  
779  N N   . PHE A 126 ? 1.7867 1.0500 1.0205 -0.0611 -0.3250 0.2754  104 PHE A N   
780  C CA  . PHE A 126 ? 1.6927 0.9770 0.8948 -0.1332 -0.2956 0.2964  104 PHE A CA  
781  C C   . PHE A 126 ? 1.5843 0.9642 0.8070 -0.1416 -0.2617 0.2921  104 PHE A C   
782  O O   . PHE A 126 ? 1.7719 1.1596 0.9572 -0.1672 -0.2613 0.3019  104 PHE A O   
783  C CB  . PHE A 126 ? 1.5807 0.8613 0.7891 -0.1890 -0.2653 0.3031  104 PHE A CB  
784  C CG  . PHE A 126 ? 1.5752 0.7569 0.7519 -0.1933 -0.3031 0.3085  104 PHE A CG  
785  C CD1 . PHE A 126 ? 1.5876 0.7387 0.7897 -0.1610 -0.3162 0.2920  104 PHE A CD1 
786  C CD2 . PHE A 126 ? 1.6951 0.8091 0.8099 -0.2285 -0.3303 0.3285  104 PHE A CD2 
787  C CE1 . PHE A 126 ? 1.7350 0.7898 0.9019 -0.1650 -0.3551 0.2927  104 PHE A CE1 
788  C CE2 . PHE A 126 ? 1.7967 0.8140 0.8772 -0.2347 -0.3706 0.3329  104 PHE A CE2 
789  C CZ  . PHE A 126 ? 1.8891 0.8764 0.9958 -0.2025 -0.3833 0.3135  104 PHE A CZ  
790  N N   . LEU A 127 ? 1.2824 0.7617 0.6003 -0.1164 -0.2230 0.2595  105 LEU A N   
791  C CA  . LEU A 127 ? 1.2574 0.8409 0.6214 -0.1357 -0.1768 0.2434  105 LEU A CA  
792  C C   . LEU A 127 ? 1.3234 0.9454 0.6969 -0.1002 -0.1956 0.2343  105 LEU A C   
793  O O   . LEU A 127 ? 1.4385 1.0898 0.7863 -0.1293 -0.1831 0.2365  105 LEU A O   
794  C CB  . LEU A 127 ? 1.3024 0.9665 0.7610 -0.1294 -0.1334 0.2166  105 LEU A CB  
795  C CG  . LEU A 127 ? 1.3328 0.9854 0.7931 -0.1781 -0.1071 0.2244  105 LEU A CG  
796  C CD1 . LEU A 127 ? 1.1619 0.8851 0.7158 -0.1668 -0.0748 0.1999  105 LEU A CD1 
797  C CD2 . LEU A 127 ? 1.2181 0.8888 0.6397 -0.2386 -0.0778 0.2360  105 LEU A CD2 
798  N N   . ILE A 128 ? 1.3719 1.0041 0.7867 -0.0385 -0.2230 0.2209  106 ILE A N   
799  C CA  . ILE A 128 ? 1.3959 1.0740 0.8321 -0.0034 -0.2455 0.2129  106 ILE A CA  
800  C C   . ILE A 128 ? 1.5857 1.1805 0.9328 -0.0041 -0.3005 0.2402  106 ILE A C   
801  O O   . ILE A 128 ? 1.6096 1.2300 0.9344 -0.0193 -0.3084 0.2449  106 ILE A O   
802  C CB  . ILE A 128 ? 1.3670 1.0978 0.8831 0.0613  -0.2531 0.1891  106 ILE A CB  
803  C CG1 . ILE A 128 ? 1.2365 1.0557 0.8337 0.0531  -0.2002 0.1668  106 ILE A CG1 
804  C CG2 . ILE A 128 ? 1.0880 0.8664 0.6290 0.0965  -0.2832 0.1842  106 ILE A CG2 
805  C CD1 . ILE A 128 ? 1.0198 0.8818 0.6807 0.1053  -0.1986 0.1461  106 ILE A CD1 
806  N N   . PRO A 129 ? 1.5924 1.0808 0.8826 0.0118  -0.3450 0.2589  107 PRO A N   
807  C CA  . PRO A 129 ? 1.6215 1.0423 0.8505 0.0099  -0.3910 0.2787  107 PRO A CA  
808  C C   . PRO A 129 ? 1.7165 1.1224 0.8763 -0.0624 -0.3714 0.2992  107 PRO A C   
809  O O   . PRO A 129 ? 1.8845 1.2679 1.0053 -0.0670 -0.4006 0.3104  107 PRO A O   
810  C CB  . PRO A 129 ? 1.5748 0.8986 0.7865 0.0314  -0.4217 0.2811  107 PRO A CB  
811  C CG  . PRO A 129 ? 1.5213 0.8429 0.7512 0.0207  -0.3909 0.2735  107 PRO A CG  
812  C CD  . PRO A 129 ? 1.5921 1.0237 0.8872 0.0295  -0.3493 0.2547  107 PRO A CD  
813  N N   . ASN A 130 ? 1.7213 1.1417 0.8665 -0.1184 -0.3225 0.3028  108 ASN A N   
814  C CA  . ASN A 130 ? 1.8953 1.3164 0.9821 -0.1848 -0.2960 0.3155  108 ASN A CA  
815  C C   . ASN A 130 ? 1.9084 1.4218 1.0091 -0.2063 -0.2541 0.2986  108 ASN A C   
816  O O   . ASN A 130 ? 1.9824 1.5092 1.0398 -0.2584 -0.2238 0.3007  108 ASN A O   
817  C CB  . ASN A 130 ? 1.9059 1.2957 0.9737 -0.2373 -0.2662 0.3263  108 ASN A CB  
818  C CG  . ASN A 130 ? 2.0051 1.2947 1.0510 -0.2248 -0.3099 0.3408  108 ASN A CG  
819  O OD1 . ASN A 130 ? 2.0684 1.3066 1.1080 -0.1769 -0.3614 0.3421  108 ASN A OD1 
820  N ND2 . ASN A 130 ? 2.0425 1.3083 1.0828 -0.2669 -0.2905 0.3484  108 ASN A ND2 
821  N N   . ALA A 131 ? 1.7772 1.3562 0.9389 -0.1661 -0.2548 0.2782  109 ALA A N   
822  C CA  . ALA A 131 ? 1.6685 1.3432 0.8736 -0.1821 -0.2102 0.2494  109 ALA A CA  
823  C C   . ALA A 131 ? 1.7010 1.3665 0.8350 -0.1964 -0.2390 0.2575  109 ALA A C   
824  O O   . ALA A 131 ? 1.6360 1.3223 0.7990 -0.1564 -0.2780 0.2521  109 ALA A O   
825  C CB  . ALA A 131 ? 1.5506 1.3095 0.8768 -0.1341 -0.1960 0.2174  109 ALA A CB  
826  N N   . SER A 132 ? 1.7799 1.4302 0.8454 -0.2502 -0.2129 0.2625  110 SER A N   
827  C CA  . SER A 132 ? 1.7886 1.4307 0.7970 -0.2635 -0.2340 0.2639  110 SER A CA  
828  C C   . SER A 132 ? 1.6828 1.4013 0.7153 -0.2625 -0.2191 0.2333  110 SER A C   
829  O O   . SER A 132 ? 1.7113 1.4363 0.7412 -0.2406 -0.2619 0.2321  110 SER A O   
830  C CB  . SER A 132 ? 1.8763 1.4837 0.8092 -0.3205 -0.2082 0.2757  110 SER A CB  
831  O OG  . SER A 132 ? 1.8801 1.5461 0.8274 -0.3582 -0.1405 0.2525  110 SER A OG  
832  N N   . GLN A 133 ? 1.5747 1.3540 0.6405 -0.2845 -0.1606 0.2052  111 GLN A N   
833  C CA  . GLN A 133 ? 1.5085 1.3581 0.6245 -0.2770 -0.1448 0.1667  111 GLN A CA  
834  C C   . GLN A 133 ? 1.4799 1.3846 0.7235 -0.2253 -0.1555 0.1501  111 GLN A C   
835  O O   . GLN A 133 ? 1.6105 1.5076 0.9072 -0.1921 -0.1680 0.1631  111 GLN A O   
836  C CB  . GLN A 133 ? 1.4317 1.3263 0.5528 -0.3124 -0.0768 0.1329  111 GLN A CB  
837  C CG  . GLN A 133 ? 1.6664 1.5336 0.6780 -0.3623 -0.0559 0.1364  111 GLN A CG  
838  C CD  . GLN A 133 ? 1.7124 1.6293 0.7459 -0.3910 0.0166  0.1047  111 GLN A CD  
839  O OE1 . GLN A 133 ? 1.6764 1.6514 0.7807 -0.3786 0.0487  0.0663  111 GLN A OE1 
840  N NE2 . GLN A 133 ? 1.7633 1.6622 0.7507 -0.4251 0.0400  0.1164  111 GLN A NE2 
841  N N   . ALA A 134 ? 1.4185 1.3786 0.7066 -0.2217 -0.1505 0.1202  112 ALA A N   
842  C CA  . ALA A 134 ? 1.3224 1.3430 0.7268 -0.1843 -0.1576 0.1055  112 ALA A CA  
843  C C   . ALA A 134 ? 1.2788 1.3405 0.7645 -0.1848 -0.1055 0.0812  112 ALA A C   
844  O O   . ALA A 134 ? 1.1786 1.2742 0.7521 -0.1552 -0.1053 0.0813  112 ALA A O   
845  C CB  . ALA A 134 ? 1.0975 1.1518 0.5098 -0.1860 -0.1862 0.0896  112 ALA A CB  
846  N N   . GLU A 135 ? 1.4203 1.4824 0.8778 -0.2171 -0.0623 0.0593  113 GLU A N   
847  C CA  . GLU A 135 ? 1.2989 1.3938 0.8321 -0.2161 -0.0165 0.0379  113 GLU A CA  
848  C C   . GLU A 135 ? 1.1793 1.2602 0.7444 -0.2008 -0.0117 0.0613  113 GLU A C   
849  O O   . GLU A 135 ? 1.1373 1.2477 0.7876 -0.1799 -0.0019 0.0555  113 GLU A O   
850  C CB  . GLU A 135 ? 1.3973 1.4949 0.8878 -0.2503 0.0286  0.0113  113 GLU A CB  
851  C CG  . GLU A 135 ? 1.3489 1.4805 0.9172 -0.2485 0.0737  -0.0116 113 GLU A CG  
852  C CD  . GLU A 135 ? 1.6173 1.7596 1.1408 -0.2805 0.1209  -0.0358 113 GLU A CD  
853  O OE1 . GLU A 135 ? 1.7853 1.9181 1.2277 -0.3018 0.1229  -0.0510 113 GLU A OE1 
854  O OE2 . GLU A 135 ? 1.5687 1.7333 1.1371 -0.2854 0.1561  -0.0404 113 GLU A OE2 
855  N N   . SER A 136 ? 1.2279 1.2566 0.7181 -0.2133 -0.0227 0.0894  114 SER A N   
856  C CA  . SER A 136 ? 1.2142 1.2168 0.7246 -0.2013 -0.0234 0.1105  114 SER A CA  
857  C C   . SER A 136 ? 1.1845 1.1842 0.7366 -0.1552 -0.0630 0.1231  114 SER A C   
858  O O   . SER A 136 ? 1.1871 1.1988 0.8000 -0.1339 -0.0550 0.1222  114 SER A O   
859  C CB  . SER A 136 ? 1.3230 1.2619 0.7371 -0.2344 -0.0266 0.1384  114 SER A CB  
860  O OG  . SER A 136 ? 1.3345 1.2954 0.7386 -0.2753 0.0235  0.1254  114 SER A OG  
861  N N   . LYS A 137 ? 1.2395 1.2277 0.7608 -0.1380 -0.1063 0.1333  115 LYS A N   
862  C CA  . LYS A 137 ? 1.1410 1.1386 0.7093 -0.0894 -0.1413 0.1412  115 LYS A CA  
863  C C   . LYS A 137 ? 1.0611 1.1336 0.7345 -0.0690 -0.1197 0.1207  115 LYS A C   
864  O O   . LYS A 137 ? 1.1306 1.2094 0.8475 -0.0418 -0.1166 0.1224  115 LYS A O   
865  C CB  . LYS A 137 ? 1.0431 1.0354 0.5800 -0.0729 -0.1919 0.1511  115 LYS A CB  
866  N N   . VAL A 138 ? 0.9464 1.0686 0.6539 -0.0864 -0.1036 0.1011  116 VAL A N   
867  C CA  . VAL A 138 ? 0.8865 1.0710 0.6861 -0.0758 -0.0858 0.0865  116 VAL A CA  
868  C C   . VAL A 138 ? 0.9748 1.1510 0.8035 -0.0798 -0.0515 0.0834  116 VAL A C   
869  O O   . VAL A 138 ? 1.0393 1.2421 0.9230 -0.0584 -0.0480 0.0850  116 VAL A O   
870  C CB  . VAL A 138 ? 0.7726 0.9923 0.5927 -0.0993 -0.0798 0.0663  116 VAL A CB  
871  C CG1 . VAL A 138 ? 0.6762 0.9382 0.5787 -0.1004 -0.0566 0.0537  116 VAL A CG1 
872  C CG2 . VAL A 138 ? 0.7454 0.9896 0.5600 -0.0926 -0.1200 0.0699  116 VAL A CG2 
873  N N   . PHE A 139 ? 0.8414 0.9859 0.6336 -0.1086 -0.0260 0.0786  117 PHE A N   
874  C CA  . PHE A 139 ? 0.7572 0.8993 0.5838 -0.1145 0.0027  0.0754  117 PHE A CA  
875  C C   . PHE A 139 ? 0.8855 0.9996 0.7104 -0.0908 -0.0113 0.0936  117 PHE A C   
876  O O   . PHE A 139 ? 0.9397 1.0724 0.8169 -0.0781 -0.0025 0.0912  117 PHE A O   
877  C CB  . PHE A 139 ? 0.8267 0.9481 0.6137 -0.1493 0.0308  0.0691  117 PHE A CB  
878  C CG  . PHE A 139 ? 0.8712 0.9972 0.7011 -0.1572 0.0570  0.0661  117 PHE A CG  
879  C CD1 . PHE A 139 ? 1.0062 1.0921 0.8111 -0.1591 0.0506  0.0872  117 PHE A CD1 
880  C CD2 . PHE A 139 ? 0.8403 1.0058 0.7362 -0.1622 0.0822  0.0423  117 PHE A CD2 
881  C CE1 . PHE A 139 ? 0.9084 1.0006 0.7549 -0.1693 0.0696  0.0856  117 PHE A CE1 
882  C CE2 . PHE A 139 ? 0.9049 1.0783 0.8467 -0.1677 0.1003  0.0405  117 PHE A CE2 
883  C CZ  . PHE A 139 ? 0.8532 0.9936 0.7711 -0.1730 0.0944  0.0626  117 PHE A CZ  
884  N N   . TYR A 140 ? 0.8544 0.9159 0.6131 -0.0851 -0.0361 0.1116  118 TYR A N   
885  C CA  . TYR A 140 ? 0.9135 0.9354 0.6640 -0.0607 -0.0525 0.1241  118 TYR A CA  
886  C C   . TYR A 140 ? 1.0295 1.0857 0.8228 -0.0147 -0.0719 0.1197  118 TYR A C   
887  O O   . TYR A 140 ? 1.1416 1.1826 0.9458 0.0092  -0.0758 0.1200  118 TYR A O   
888  C CB  . TYR A 140 ? 1.0553 0.9972 0.7196 -0.0690 -0.0785 0.1455  118 TYR A CB  
889  C CG  . TYR A 140 ? 1.2307 1.1416 0.8507 -0.1195 -0.0551 0.1539  118 TYR A CG  
890  C CD1 . TYR A 140 ? 1.2847 1.1888 0.9285 -0.1365 -0.0336 0.1540  118 TYR A CD1 
891  C CD2 . TYR A 140 ? 1.3298 1.2200 0.8805 -0.1521 -0.0564 0.1631  118 TYR A CD2 
892  C CE1 . TYR A 140 ? 1.2967 1.1874 0.9101 -0.1848 -0.0102 0.1618  118 TYR A CE1 
893  C CE2 . TYR A 140 ? 1.3963 1.2699 0.9057 -0.2015 -0.0299 0.1708  118 TYR A CE2 
894  C CZ  . TYR A 140 ? 1.3598 1.2385 0.9060 -0.2177 -0.0056 0.1699  118 TYR A CZ  
895  O OH  . TYR A 140 ? 1.4271 1.3046 0.9426 -0.2692 0.0233  0.1773  118 TYR A OH  
896  N N   . LEU A 141 ? 1.0430 1.1508 0.8627 -0.0027 -0.0831 0.1138  119 LEU A N   
897  C CA  . LEU A 141 ? 0.9817 1.1392 0.8526 0.0381  -0.0940 0.1087  119 LEU A CA  
898  C C   . LEU A 141 ? 0.9433 1.1667 0.8845 0.0311  -0.0659 0.0986  119 LEU A C   
899  O O   . LEU A 141 ? 1.0549 1.3157 1.0315 0.0589  -0.0647 0.0953  119 LEU A O   
900  C CB  . LEU A 141 ? 0.8648 1.0594 0.7448 0.0595  -0.1248 0.1093  119 LEU A CB  
901  C CG  . LEU A 141 ? 0.8692 1.0032 0.6855 0.0776  -0.1666 0.1217  119 LEU A CG  
902  C CD1 . LEU A 141 ? 0.8499 1.0321 0.6825 0.0812  -0.1929 0.1215  119 LEU A CD1 
903  C CD2 . LEU A 141 ? 0.8719 0.9779 0.6863 0.1277  -0.1880 0.1211  119 LEU A CD2 
904  N N   . LYS A 142 ? 0.8508 1.0864 0.8099 -0.0046 -0.0442 0.0931  120 LYS A N   
905  C CA  . LYS A 142 ? 0.7166 0.9892 0.7319 -0.0129 -0.0225 0.0883  120 LYS A CA  
906  C C   . LYS A 142 ? 0.8364 1.0693 0.8399 -0.0091 -0.0122 0.0916  120 LYS A C   
907  O O   . LYS A 142 ? 0.8637 1.1194 0.8957 0.0023  -0.0062 0.0923  120 LYS A O   
908  C CB  . LYS A 142 ? 0.6118 0.8967 0.6510 -0.0466 -0.0081 0.0784  120 LYS A CB  
909  C CG  . LYS A 142 ? 0.6351 0.9127 0.7067 -0.0610 0.0123  0.0749  120 LYS A CG  
910  C CD  . LYS A 142 ? 0.6304 0.9187 0.7349 -0.0861 0.0219  0.0602  120 LYS A CD  
911  C CE  . LYS A 142 ? 0.6516 0.9199 0.7810 -0.0967 0.0389  0.0538  120 LYS A CE  
912  N NZ  . LYS A 142 ? 0.7446 0.9815 0.8379 -0.1065 0.0537  0.0469  120 LYS A NZ  
913  N N   . MET A 143 ? 0.9671 1.1407 0.9242 -0.0224 -0.0114 0.0952  121 MET A N   
914  C CA  . MET A 143 ? 0.8834 1.0148 0.8270 -0.0228 -0.0076 0.0997  121 MET A CA  
915  C C   . MET A 143 ? 0.9330 1.0479 0.8587 0.0151  -0.0256 0.1016  121 MET A C   
916  O O   . MET A 143 ? 0.9129 1.0196 0.8466 0.0216  -0.0215 0.1001  121 MET A O   
917  C CB  . MET A 143 ? 0.8229 0.8985 0.7174 -0.0493 -0.0060 0.1065  121 MET A CB  
918  C CG  . MET A 143 ? 0.8363 0.8724 0.7237 -0.0605 -0.0031 0.1120  121 MET A CG  
919  S SD  . MET A 143 ? 1.0240 1.0301 0.8812 -0.1079 0.0120  0.1190  121 MET A SD  
920  C CE  . MET A 143 ? 0.9555 0.8770 0.7563 -0.1101 -0.0134 0.1371  121 MET A CE  
921  N N   . LYS A 144 ? 0.9119 1.0215 0.8125 0.0428  -0.0478 0.1025  122 LYS A N   
922  C CA  . LYS A 144 ? 0.8363 0.9404 0.7288 0.0881  -0.0640 0.0966  122 LYS A CA  
923  C C   . LYS A 144 ? 0.8152 1.0014 0.7646 0.1023  -0.0463 0.0871  122 LYS A C   
924  O O   . LYS A 144 ? 0.9586 1.1423 0.9044 0.1227  -0.0422 0.0797  122 LYS A O   
925  C CB  . LYS A 144 ? 0.8586 0.9484 0.7252 0.1190  -0.0952 0.0978  122 LYS A CB  
926  C CG  . LYS A 144 ? 0.8318 0.8970 0.6822 0.1729  -0.1174 0.0869  122 LYS A CG  
927  C CD  . LYS A 144 ? 0.8960 0.9872 0.7553 0.2097  -0.1466 0.0843  122 LYS A CD  
928  C CE  . LYS A 144 ? 1.0697 1.1117 0.9022 0.2681  -0.1788 0.0721  122 LYS A CE  
929  N NZ  . LYS A 144 ? 1.0275 1.0969 0.8765 0.3042  -0.2132 0.0711  122 LYS A NZ  
930  N N   . GLY A 145 ? 0.7458 1.0029 0.7422 0.0879  -0.0367 0.0879  123 GLY A N   
931  C CA  . GLY A 145 ? 0.6420 0.9780 0.6901 0.0896  -0.0195 0.0850  123 GLY A CA  
932  C C   . GLY A 145 ? 0.6684 0.9900 0.7208 0.0680  -0.0020 0.0884  123 GLY A C   
933  O O   . GLY A 145 ? 0.7243 1.0736 0.7817 0.0817  0.0070  0.0854  123 GLY A O   
934  N N   . ASP A 146 ? 0.7456 1.0247 0.7939 0.0353  0.0022  0.0934  124 ASP A N   
935  C CA  . ASP A 146 ? 0.6945 0.9560 0.7526 0.0150  0.0118  0.0974  124 ASP A CA  
936  C C   . ASP A 146 ? 0.7435 0.9650 0.7627 0.0355  0.0062  0.0947  124 ASP A C   
937  O O   . ASP A 146 ? 0.7309 0.9745 0.7539 0.0399  0.0120  0.0952  124 ASP A O   
938  C CB  . ASP A 146 ? 0.6509 0.8751 0.7136 -0.0151 0.0154  0.0980  124 ASP A CB  
939  C CG  . ASP A 146 ? 0.5946 0.8529 0.6974 -0.0374 0.0223  0.0948  124 ASP A CG  
940  O OD1 . ASP A 146 ? 0.5951 0.8998 0.7312 -0.0405 0.0229  0.0978  124 ASP A OD1 
941  O OD2 . ASP A 146 ? 0.6359 0.8733 0.7349 -0.0544 0.0275  0.0882  124 ASP A OD2 
942  N N   . TYR A 147 ? 0.7761 0.9330 0.7500 0.0457  -0.0075 0.0923  125 TYR A N   
943  C CA  . TYR A 147 ? 0.7621 0.8635 0.6932 0.0608  -0.0186 0.0880  125 TYR A CA  
944  C C   . TYR A 147 ? 0.9541 1.0760 0.8665 0.1057  -0.0218 0.0736  125 TYR A C   
945  O O   . TYR A 147 ? 1.1429 1.2309 1.0217 0.1185  -0.0268 0.0654  125 TYR A O   
946  C CB  . TYR A 147 ? 0.7448 0.7648 0.6305 0.0528  -0.0362 0.0924  125 TYR A CB  
947  C CG  . TYR A 147 ? 0.8833 0.8872 0.7869 0.0076  -0.0282 0.1026  125 TYR A CG  
948  C CD1 . TYR A 147 ? 0.8156 0.8473 0.7457 -0.0173 -0.0146 0.1062  125 TYR A CD1 
949  C CD2 . TYR A 147 ? 0.9442 0.9107 0.8411 -0.0089 -0.0345 0.1054  125 TYR A CD2 
950  C CE1 . TYR A 147 ? 0.7693 0.8000 0.7245 -0.0533 -0.0028 0.1095  125 TYR A CE1 
951  C CE2 . TYR A 147 ? 0.9548 0.9222 0.8825 -0.0474 -0.0267 0.1125  125 TYR A CE2 
952  C CZ  . TYR A 147 ? 0.9118 0.9152 0.8715 -0.0676 -0.0085 0.1131  125 TYR A CZ  
953  O OH  . TYR A 147 ? 0.8573 0.8734 0.8548 -0.1011 0.0033  0.1145  125 TYR A OH  
954  N N   . TYR A 148 ? 0.8295 1.0124 0.7655 0.1302  -0.0186 0.0678  126 TYR A N   
955  C CA  . TYR A 148 ? 0.8250 1.0550 0.7602 0.1706  -0.0123 0.0509  126 TYR A CA  
956  C C   . TYR A 148 ? 0.8064 1.1084 0.7725 0.1491  0.0131  0.0564  126 TYR A C   
957  O O   . TYR A 148 ? 0.9556 1.2749 0.9003 0.1678  0.0227  0.0445  126 TYR A O   
958  C CB  . TYR A 148 ? 0.7042 0.9857 0.6629 0.2080  -0.0196 0.0411  126 TYR A CB  
959  C CG  . TYR A 148 ? 0.7488 0.9589 0.6620 0.2545  -0.0492 0.0264  126 TYR A CG  
960  C CD1 . TYR A 148 ? 0.8493 1.0249 0.7240 0.2940  -0.0540 0.0036  126 TYR A CD1 
961  C CD2 . TYR A 148 ? 0.7369 0.9069 0.6392 0.2591  -0.0761 0.0346  126 TYR A CD2 
962  C CE1 . TYR A 148 ? 0.8226 0.9187 0.6534 0.3393  -0.0875 -0.0117 126 TYR A CE1 
963  C CE2 . TYR A 148 ? 0.8087 0.8989 0.6642 0.3003  -0.1109 0.0249  126 TYR A CE2 
964  C CZ  . TYR A 148 ? 0.8563 0.9072 0.6787 0.3419  -0.1176 0.0010  126 TYR A CZ  
965  O OH  . TYR A 148 ? 0.9781 0.9369 0.7517 0.3863  -0.1574 -0.0115 126 TYR A OH  
966  N N   . ARG A 149 ? 0.7094 1.0460 0.7185 0.1086  0.0219  0.0742  127 ARG A N   
967  C CA  . ARG A 149 ? 0.6810 1.0677 0.7143 0.0795  0.0384  0.0864  127 ARG A CA  
968  C C   . ARG A 149 ? 0.8105 1.1407 0.8083 0.0650  0.0345  0.0906  127 ARG A C   
969  O O   . ARG A 149 ? 0.7759 1.1359 0.7612 0.0586  0.0449  0.0944  127 ARG A O   
970  C CB  . ARG A 149 ? 0.5049 0.9159 0.5874 0.0415  0.0391  0.1022  127 ARG A CB  
971  C CG  . ARG A 149 ? 0.4733 0.9117 0.5805 0.0044  0.0461  0.1200  127 ARG A CG  
972  C CD  . ARG A 149 ? 0.4669 0.9122 0.6187 -0.0252 0.0406  0.1284  127 ARG A CD  
973  N NE  . ARG A 149 ? 0.7103 1.1130 0.8741 -0.0555 0.0331  0.1394  127 ARG A NE  
974  C CZ  . ARG A 149 ? 0.8913 1.2350 1.0528 -0.0579 0.0255  0.1328  127 ARG A CZ  
975  N NH1 . ARG A 149 ? 0.7544 1.0698 0.8927 -0.0390 0.0253  0.1197  127 ARG A NH1 
976  N NH2 . ARG A 149 ? 1.1557 1.4707 1.3395 -0.0800 0.0168  0.1402  127 ARG A NH2 
977  N N   . TYR A 150 ? 0.7549 1.0073 0.7352 0.0557  0.0189  0.0916  128 TYR A N   
978  C CA  . TYR A 150 ? 0.6819 0.8791 0.6294 0.0446  0.0088  0.0939  128 TYR A CA  
979  C C   . TYR A 150 ? 0.8554 1.0380 0.7454 0.0785  0.0076  0.0760  128 TYR A C   
980  O O   . TYR A 150 ? 1.0454 1.2161 0.9046 0.0700  0.0060  0.0773  128 TYR A O   
981  C CB  . TYR A 150 ? 0.5754 0.7015 0.5183 0.0295  -0.0074 0.0963  128 TYR A CB  
982  C CG  . TYR A 150 ? 0.5383 0.6835 0.5362 -0.0007 -0.0021 0.1071  128 TYR A CG  
983  C CD1 . TYR A 150 ? 0.4594 0.6555 0.5008 -0.0184 0.0064  0.1169  128 TYR A CD1 
984  C CD2 . TYR A 150 ? 0.6490 0.7612 0.6515 -0.0121 -0.0054 0.1063  128 TYR A CD2 
985  C CE1 . TYR A 150 ? 0.6005 0.8080 0.6907 -0.0407 0.0091  0.1206  128 TYR A CE1 
986  C CE2 . TYR A 150 ? 0.5389 0.6746 0.5897 -0.0357 0.0037  0.1091  128 TYR A CE2 
987  C CZ  . TYR A 150 ? 0.5607 0.7412 0.6559 -0.0465 0.0097  0.1137  128 TYR A CZ  
988  O OH  . TYR A 150 ? 0.5011 0.6976 0.6416 -0.0647 0.0158  0.1109  128 TYR A OH  
989  N N   . LEU A 151 ? 0.6738 0.8532 0.5455 0.1189  0.0055  0.0572  129 LEU A N   
990  C CA  . LEU A 151 ? 0.8104 0.9756 0.6292 0.1605  0.0044  0.0319  129 LEU A CA  
991  C C   . LEU A 151 ? 0.8893 1.1509 0.7181 0.1695  0.0328  0.0259  129 LEU A C   
992  O O   . LEU A 151 ? 0.9372 1.1950 0.7166 0.1843  0.0391  0.0100  129 LEU A O   
993  C CB  . LEU A 151 ? 0.8100 0.9422 0.6134 0.2057  -0.0110 0.0128  129 LEU A CB  
994  C CG  . LEU A 151 ? 0.8352 0.8501 0.5945 0.1997  -0.0427 0.0147  129 LEU A CG  
995  C CD1 . LEU A 151 ? 0.9398 0.9066 0.6740 0.2439  -0.0657 -0.0008 129 LEU A CD1 
996  C CD2 . LEU A 151 ? 0.8073 0.7622 0.5122 0.1938  -0.0529 0.0061  129 LEU A CD2 
997  N N   . ALA A 152 ? 0.8707 1.2200 0.7595 0.1567  0.0502  0.0386  130 ALA A N   
998  C CA  . ALA A 152 ? 0.7848 1.2377 0.6902 0.1544  0.0792  0.0389  130 ALA A CA  
999  C C   . ALA A 152 ? 0.8562 1.3083 0.7430 0.1077  0.0851  0.0620  130 ALA A C   
1000 O O   . ALA A 152 ? 0.8960 1.4009 0.7542 0.1073  0.1062  0.0581  130 ALA A O   
1001 C CB  . ALA A 152 ? 0.5479 1.0885 0.5252 0.1463  0.0894  0.0495  130 ALA A CB  
1002 N N   . GLU A 153 ? 0.8546 1.2496 0.7563 0.0688  0.0659  0.0856  131 GLU A N   
1003 C CA  . GLU A 153 ? 0.7902 1.1659 0.6742 0.0276  0.0598  0.1088  131 GLU A CA  
1004 C C   . GLU A 153 ? 0.8833 1.2168 0.6894 0.0408  0.0555  0.0948  131 GLU A C   
1005 O O   . GLU A 153 ? 0.6829 1.0231 0.4568 0.0126  0.0563  0.1111  131 GLU A O   
1006 C CB  . GLU A 153 ? 0.7764 1.0896 0.6938 -0.0014 0.0353  0.1260  131 GLU A CB  
1007 C CG  . GLU A 153 ? 0.7830 1.1342 0.7689 -0.0249 0.0382  0.1418  131 GLU A CG  
1008 C CD  . GLU A 153 ? 0.7660 1.0628 0.7865 -0.0503 0.0173  0.1534  131 GLU A CD  
1009 O OE1 . GLU A 153 ? 0.6775 0.9962 0.7460 -0.0752 0.0155  0.1675  131 GLU A OE1 
1010 O OE2 . GLU A 153 ? 0.6973 0.9325 0.6991 -0.0450 0.0021  0.1464  131 GLU A OE2 
1011 N N   . VAL A 154 ? 0.9601 1.2471 0.7300 0.0828  0.0484  0.0648  132 VAL A N   
1012 C CA  . VAL A 154 ? 1.0361 1.2619 0.7258 0.0991  0.0371  0.0450  132 VAL A CA  
1013 C C   . VAL A 154 ? 1.1410 1.4034 0.7893 0.1511  0.0582  0.0068  132 VAL A C   
1014 O O   . VAL A 154 ? 1.2240 1.4656 0.7988 0.1613  0.0602  -0.0114 132 VAL A O   
1015 C CB  . VAL A 154 ? 1.1056 1.2240 0.7822 0.1004  0.0020  0.0410  132 VAL A CB  
1016 C CG1 . VAL A 154 ? 1.2665 1.3149 0.8634 0.1349  -0.0126 0.0085  132 VAL A CG1 
1017 C CG2 . VAL A 154 ? 1.1147 1.1968 0.8086 0.0514  -0.0195 0.0707  132 VAL A CG2 
1018 N N   . ALA A 155 ? 1.2422 1.5641 0.9358 0.1854  0.0738  -0.0077 133 ALA A N   
1019 C CA  . ALA A 155 ? 1.2974 1.6573 0.9658 0.2450  0.0909  -0.0496 133 ALA A CA  
1020 C C   . ALA A 155 ? 1.2397 1.7006 0.8859 0.2402  0.1304  -0.0563 133 ALA A C   
1021 O O   . ALA A 155 ? 1.1999 1.7342 0.8786 0.1929  0.1493  -0.0234 133 ALA A O   
1022 C CB  . ALA A 155 ? 1.3674 1.7775 1.1030 0.2798  0.0936  -0.0587 133 ALA A CB  
1023 N N   . ALA A 156 ? 1.2489 1.7093 0.8340 0.2882  0.1421  -0.1000 134 ALA A N   
1024 C CA  . ALA A 156 ? 1.3628 1.9265 0.9171 0.2893  0.1857  -0.1141 134 ALA A CA  
1025 C C   . ALA A 156 ? 1.5362 2.1669 1.0978 0.3658  0.2099  -0.1697 134 ALA A C   
1026 O O   . ALA A 156 ? 1.6647 2.2113 1.2029 0.4226  0.1832  -0.2067 134 ALA A O   
1027 C CB  . ALA A 156 ? 1.4453 1.9404 0.8947 0.2653  0.1783  -0.1156 134 ALA A CB  
1028 N N   . GLY A 157 ? 1.5341 2.3029 1.1419 0.3589  0.2521  -0.1705 135 GLY A N   
1029 C CA  . GLY A 157 ? 1.6607 2.4875 1.2978 0.4154  0.2688  -0.2167 135 GLY A CA  
1030 C C   . GLY A 157 ? 1.6818 2.4904 1.3761 0.4814  0.2430  -0.2433 135 GLY A C   
1031 O O   . GLY A 157 ? 1.5993 2.4363 1.3672 0.4721  0.2311  -0.2174 135 GLY A O   
1032 N N   . ASP A 158 ? 1.7834 2.5403 1.4410 0.5470  0.2314  -0.2952 136 ASP A N   
1033 C CA  . ASP A 158 ? 1.7691 2.4935 1.4663 0.6177  0.2008  -0.3276 136 ASP A CA  
1034 C C   . ASP A 158 ? 1.6332 2.3230 1.3825 0.6188  0.1674  -0.3002 136 ASP A C   
1035 O O   . ASP A 158 ? 1.5045 2.2676 1.3402 0.6348  0.1636  -0.2964 136 ASP A O   
1036 C CB  . ASP A 158 ? 1.8419 2.4275 1.4480 0.6693  0.1700  -0.3726 136 ASP A CB  
1037 C CG  . ASP A 158 ? 1.8489 2.4388 1.3777 0.6572  0.1988  -0.3956 136 ASP A CG  
1038 O OD1 . ASP A 158 ? 1.9178 2.5531 1.4512 0.6992  0.2163  -0.4379 136 ASP A OD1 
1039 O OD2 . ASP A 158 ? 1.7844 2.3323 1.2461 0.6045  0.2031  -0.3711 136 ASP A OD2 
1040 N N   . ASP A 159 ? 1.5751 2.1532 1.2702 0.5995  0.1424  -0.2809 137 ASP A N   
1041 C CA  . ASP A 159 ? 1.3782 1.8926 1.1172 0.5906  0.1019  -0.2514 137 ASP A CA  
1042 C C   . ASP A 159 ? 1.1965 1.7755 0.9989 0.5169  0.1138  -0.1955 137 ASP A C   
1043 O O   . ASP A 159 ? 1.2736 1.8208 1.1178 0.5069  0.0859  -0.1719 137 ASP A O   
1044 C CB  . ASP A 159 ? 1.3710 1.6995 1.0335 0.5821  0.0521  -0.2460 137 ASP A CB  
1045 N N   . LYS A 160 ? 1.0897 1.7534 0.8953 0.4652  0.1520  -0.1743 138 LYS A N   
1046 C CA  . LYS A 160 ? 0.8425 1.5537 0.7048 0.3956  0.1579  -0.1229 138 LYS A CA  
1047 C C   . LYS A 160 ? 0.7869 1.6037 0.7460 0.4084  0.1622  -0.1178 138 LYS A C   
1048 O O   . LYS A 160 ? 0.9281 1.7182 0.9260 0.3769  0.1399  -0.0869 138 LYS A O   
1049 C CB  . LYS A 160 ? 0.9060 1.6849 0.7508 0.3387  0.1928  -0.0996 138 LYS A CB  
1050 C CG  . LYS A 160 ? 0.8917 1.7303 0.8070 0.2767  0.1966  -0.0523 138 LYS A CG  
1051 C CD  . LYS A 160 ? 0.9278 1.7519 0.8150 0.2046  0.2025  -0.0123 138 LYS A CD  
1052 C CE  . LYS A 160 ? 0.9677 1.9060 0.9236 0.1552  0.2231  0.0212  138 LYS A CE  
1053 N NZ  . LYS A 160 ? 0.9919 1.9095 0.9205 0.0846  0.2227  0.0632  138 LYS A NZ  
1054 N N   . LYS A 161 ? 0.9779 1.9102 0.9773 0.4431  0.1877  -0.1446 139 LYS A N   
1055 C CA  . LYS A 161 ? 0.9965 2.0141 1.0882 0.4388  0.1820  -0.1343 139 LYS A CA  
1056 C C   . LYS A 161 ? 1.0064 1.9611 1.1228 0.4703  0.1397  -0.1323 139 LYS A C   
1057 O O   . LYS A 161 ? 0.7797 1.7649 0.9516 0.4363  0.1280  -0.1026 139 LYS A O   
1058 C CB  . LYS A 161 ? 0.8509 1.9494 0.9713 0.4773  0.1983  -0.1694 139 LYS A CB  
1059 N N   . GLY A 162 ? 1.1365 1.9893 1.2038 0.5318  0.1115  -0.1624 140 GLY A N   
1060 C CA  . GLY A 162 ? 1.0975 1.8639 1.1725 0.5533  0.0627  -0.1553 140 GLY A CA  
1061 C C   . GLY A 162 ? 1.0862 1.7458 1.1276 0.4870  0.0420  -0.1126 140 GLY A C   
1062 O O   . GLY A 162 ? 1.1237 1.7595 1.1911 0.4731  0.0148  -0.0913 140 GLY A O   
1063 N N   . ILE A 163 ? 1.0207 1.6176 1.0036 0.4467  0.0536  -0.1015 141 ILE A N   
1064 C CA  . ILE A 163 ? 0.9026 1.4102 0.8624 0.3858  0.0376  -0.0649 141 ILE A CA  
1065 C C   . ILE A 163 ? 0.8532 1.4416 0.8764 0.3312  0.0524  -0.0320 141 ILE A C   
1066 O O   . ILE A 163 ? 0.8885 1.4251 0.9172 0.2969  0.0340  -0.0083 141 ILE A O   
1067 C CB  . ILE A 163 ? 0.8788 1.3137 0.7713 0.3595  0.0438  -0.0631 141 ILE A CB  
1068 C CG1 . ILE A 163 ? 1.0018 1.3259 0.8232 0.4067  0.0174  -0.0934 141 ILE A CG1 
1069 C CG2 . ILE A 163 ? 0.7669 1.1464 0.6577 0.2948  0.0355  -0.0263 141 ILE A CG2 
1070 C CD1 . ILE A 163 ? 1.0964 1.3649 0.8500 0.3895  0.0230  -0.0998 141 ILE A CD1 
1071 N N   . VAL A 164 ? 0.8523 1.5667 0.9212 0.3198  0.0856  -0.0308 142 VAL A N   
1072 C CA  . VAL A 164 ? 0.8429 1.6262 0.9705 0.2659  0.0940  0.0003  142 VAL A CA  
1073 C C   . VAL A 164 ? 0.9057 1.7287 1.0892 0.2853  0.0732  -0.0008 142 VAL A C   
1074 O O   . VAL A 164 ? 0.9282 1.7312 1.1320 0.2476  0.0577  0.0219  142 VAL A O   
1075 C CB  . VAL A 164 ? 0.7389 1.6422 0.8942 0.2388  0.1327  0.0075  142 VAL A CB  
1076 C CG1 . VAL A 164 ? 0.5495 1.5331 0.7752 0.1906  0.1351  0.0358  142 VAL A CG1 
1077 C CG2 . VAL A 164 ? 0.7338 1.5831 0.8289 0.2023  0.1445  0.0206  142 VAL A CG2 
1078 N N   . ASP A 165 ? 0.9350 1.8126 1.1425 0.3471  0.0699  -0.0297 143 ASP A N   
1079 C CA  . ASP A 165 ? 0.9108 1.8286 1.1731 0.3707  0.0434  -0.0312 143 ASP A CA  
1080 C C   . ASP A 165 ? 0.8237 1.6090 1.0413 0.3686  0.0012  -0.0199 143 ASP A C   
1081 O O   . ASP A 165 ? 0.7495 1.5459 0.9971 0.3519  -0.0209 -0.0046 143 ASP A O   
1082 C CB  . ASP A 165 ? 1.0592 2.0280 1.3439 0.4387  0.0415  -0.0678 143 ASP A CB  
1083 C CG  . ASP A 165 ? 1.1071 2.1941 1.4625 0.4177  0.0577  -0.0669 143 ASP A CG  
1084 O OD1 . ASP A 165 ? 1.0687 2.1999 1.4564 0.3556  0.0667  -0.0377 143 ASP A OD1 
1085 O OD2 . ASP A 165 ? 1.1345 2.2659 1.5129 0.4641  0.0599  -0.0965 143 ASP A OD2 
1086 N N   . GLN A 166 ? 0.8752 1.5350 1.0170 0.3777  -0.0103 -0.0249 144 GLN A N   
1087 C CA  . GLN A 166 ? 0.8526 1.3906 0.9473 0.3711  -0.0480 -0.0120 144 GLN A CA  
1088 C C   . GLN A 166 ? 0.9080 1.4208 1.0002 0.3019  -0.0425 0.0181  144 GLN A C   
1089 O O   . GLN A 166 ? 1.0020 1.4765 1.0864 0.2870  -0.0667 0.0315  144 GLN A O   
1090 C CB  . GLN A 166 ? 0.8376 1.2516 0.8543 0.3938  -0.0624 -0.0244 144 GLN A CB  
1091 C CG  . GLN A 166 ? 0.8954 1.2772 0.8950 0.4694  -0.0904 -0.0549 144 GLN A CG  
1092 C CD  . GLN A 166 ? 1.0972 1.3601 1.0509 0.4798  -0.1414 -0.0433 144 GLN A CD  
1093 O OE1 . GLN A 166 ? 1.2008 1.4597 1.1636 0.4458  -0.1556 -0.0172 144 GLN A OE1 
1094 N NE2 . GLN A 166 ? 1.1830 1.3415 1.0792 0.5238  -0.1711 -0.0620 144 GLN A NE2 
1095 N N   . SER A 167 ? 0.8043 1.3416 0.9031 0.2608  -0.0120 0.0274  145 SER A N   
1096 C CA  . SER A 167 ? 0.6322 1.1560 0.7404 0.2007  -0.0058 0.0507  145 SER A CA  
1097 C C   . SER A 167 ? 0.6208 1.2305 0.7893 0.1812  -0.0070 0.0597  145 SER A C   
1098 O O   . SER A 167 ? 0.5319 1.1131 0.7004 0.1469  -0.0169 0.0718  145 SER A O   
1099 C CB  . SER A 167 ? 0.5682 1.0936 0.6703 0.1684  0.0195  0.0581  145 SER A CB  
1100 O OG  . SER A 167 ? 0.5589 1.1029 0.6918 0.1165  0.0273  0.0772  145 SER A OG  
1101 N N   . GLN A 168 ? 0.6916 1.4107 0.9124 0.2007  0.0034  0.0521  146 GLN A N   
1102 C CA  . GLN A 168 ? 0.5355 1.3383 0.8173 0.1742  -0.0009 0.0630  146 GLN A CA  
1103 C C   . GLN A 168 ? 0.6225 1.4104 0.9078 0.1967  -0.0371 0.0598  146 GLN A C   
1104 O O   . GLN A 168 ? 0.6441 1.4509 0.9526 0.1637  -0.0505 0.0711  146 GLN A O   
1105 C CB  . GLN A 168 ? 0.4606 1.3991 0.8047 0.1790  0.0231  0.0595  146 GLN A CB  
1106 C CG  . GLN A 168 ? 0.6113 1.6180 1.0111 0.1331  0.0191  0.0752  146 GLN A CG  
1107 C CD  . GLN A 168 ? 0.7206 1.8083 1.1530 0.1192  0.0429  0.0734  146 GLN A CD  
1108 O OE1 . GLN A 168 ? 0.6744 1.7967 1.0992 0.1505  0.0648  0.0577  146 GLN A OE1 
1109 N NE2 . GLN A 168 ? 0.8190 1.9364 1.2849 0.0713  0.0378  0.0886  146 GLN A NE2 
1110 N N   . GLN A 169 ? 0.7533 1.5013 1.0113 0.2520  -0.0578 0.0446  147 GLN A N   
1111 C CA  . GLN A 169 ? 0.7959 1.5140 1.0458 0.2733  -0.0999 0.0456  147 GLN A CA  
1112 C C   . GLN A 169 ? 0.9199 1.5174 1.0982 0.2396  -0.1164 0.0605  147 GLN A C   
1113 O O   . GLN A 169 ? 1.0733 1.6511 1.2394 0.2326  -0.1473 0.0685  147 GLN A O   
1114 C CB  . GLN A 169 ? 0.7933 1.5012 1.0380 0.3464  -0.1228 0.0249  147 GLN A CB  
1115 N N   . ALA A 170 ? 0.8000 1.3203 0.9296 0.2179  -0.0971 0.0639  148 ALA A N   
1116 C CA  . ALA A 170 ? 0.7757 1.2055 0.8499 0.1781  -0.1029 0.0769  148 ALA A CA  
1117 C C   . ALA A 170 ? 0.7531 1.2224 0.8572 0.1276  -0.0896 0.0841  148 ALA A C   
1118 O O   . ALA A 170 ? 0.9011 1.3403 0.9795 0.1051  -0.1055 0.0894  148 ALA A O   
1119 C CB  . ALA A 170 ? 0.6901 1.0408 0.7180 0.1680  -0.0866 0.0776  148 ALA A CB  
1120 N N   . TYR A 171 ? 0.5496 1.0783 0.7005 0.1078  -0.0625 0.0842  149 TYR A N   
1121 C CA  . TYR A 171 ? 0.4723 1.0280 0.6521 0.0611  -0.0550 0.0898  149 TYR A CA  
1122 C C   . TYR A 171 ? 0.4992 1.1095 0.7085 0.0576  -0.0794 0.0905  149 TYR A C   
1123 O O   . TYR A 171 ? 0.6258 1.2141 0.8234 0.0249  -0.0885 0.0910  149 TYR A O   
1124 C CB  . TYR A 171 ? 0.4841 1.0942 0.7086 0.0415  -0.0297 0.0945  149 TYR A CB  
1125 C CG  . TYR A 171 ? 0.6392 1.1898 0.8380 0.0273  -0.0109 0.0967  149 TYR A CG  
1126 C CD1 . TYR A 171 ? 0.6346 1.1094 0.8005 0.0075  -0.0113 0.0950  149 TYR A CD1 
1127 C CD2 . TYR A 171 ? 0.6768 1.2533 0.8850 0.0331  0.0073  0.0998  149 TYR A CD2 
1128 C CE1 . TYR A 171 ? 0.7425 1.1721 0.8965 -0.0044 0.0025  0.0967  149 TYR A CE1 
1129 C CE2 . TYR A 171 ? 0.7646 1.2862 0.9500 0.0196  0.0177  0.1032  149 TYR A CE2 
1130 C CZ  . TYR A 171 ? 0.7747 1.2244 0.9387 0.0016  0.0137  0.1018  149 TYR A CZ  
1131 O OH  . TYR A 171 ? 0.7427 1.1461 0.8955 -0.0111 0.0209  0.1049  149 TYR A OH  
1132 N N   . GLN A 172 ? 0.5617 1.2482 0.8126 0.0913  -0.0909 0.0879  150 GLN A N   
1133 C CA  . GLN A 172 ? 0.6128 1.3694 0.9084 0.0823  -0.1155 0.0901  150 GLN A CA  
1134 C C   . GLN A 172 ? 0.7396 1.4351 0.9845 0.0902  -0.1531 0.0904  150 GLN A C   
1135 O O   . GLN A 172 ? 0.7521 1.4641 1.0045 0.0626  -0.1744 0.0929  150 GLN A O   
1136 C CB  . GLN A 172 ? 0.4516 1.3270 0.8208 0.1152  -0.1150 0.0861  150 GLN A CB  
1137 C CG  . GLN A 172 ? 0.4120 1.3804 0.8454 0.0984  -0.1389 0.0905  150 GLN A CG  
1138 C CD  . GLN A 172 ? 0.5860 1.5833 1.0504 0.0358  -0.1214 0.1004  150 GLN A CD  
1139 O OE1 . GLN A 172 ? 0.5617 1.5654 1.0329 0.0179  -0.0867 0.1041  150 GLN A OE1 
1140 N NE2 . GLN A 172 ? 0.5440 1.5388 1.0146 0.0015  -0.1495 0.1040  150 GLN A NE2 
1141 N N   . GLU A 173 ? 0.7542 1.3688 0.9378 0.1212  -0.1636 0.0895  151 GLU A N   
1142 C CA  . GLU A 173 ? 0.7507 1.2940 0.8696 0.1200  -0.1996 0.0953  151 GLU A CA  
1143 C C   . GLU A 173 ? 0.6766 1.1607 0.7444 0.0672  -0.1864 0.0970  151 GLU A C   
1144 O O   . GLU A 173 ? 0.7230 1.2053 0.7723 0.0431  -0.2082 0.0977  151 GLU A O   
1145 C CB  . GLU A 173 ? 0.8168 1.2790 0.8780 0.1605  -0.2170 0.0978  151 GLU A CB  
1146 C CG  . GLU A 173 ? 1.0531 1.4361 1.0381 0.1574  -0.2601 0.1101  151 GLU A CG  
1147 C CD  . GLU A 173 ? 1.2049 1.5011 1.1337 0.1981  -0.2889 0.1166  151 GLU A CD  
1148 O OE1 . GLU A 173 ? 1.3409 1.5600 1.1955 0.1905  -0.3265 0.1322  151 GLU A OE1 
1149 O OE2 . GLU A 173 ? 1.1454 1.4444 1.0975 0.2360  -0.2773 0.1063  151 GLU A OE2 
1150 N N   . ALA A 174 ? 0.6741 1.1162 0.7236 0.0495  -0.1509 0.0946  152 ALA A N   
1151 C CA  . ALA A 174 ? 0.7160 1.1150 0.7311 0.0049  -0.1332 0.0899  152 ALA A CA  
1152 C C   . ALA A 174 ? 0.6991 1.1531 0.7616 -0.0256 -0.1325 0.0823  152 ALA A C   
1153 O O   . ALA A 174 ? 0.7870 1.2106 0.8143 -0.0556 -0.1357 0.0737  152 ALA A O   
1154 C CB  . ALA A 174 ? 0.6779 1.0379 0.6853 -0.0035 -0.0979 0.0878  152 ALA A CB  
1155 N N   . PHE A 175 ? 0.5730 1.1045 0.7107 -0.0219 -0.1271 0.0845  153 PHE A N   
1156 C CA  . PHE A 175 ? 0.5846 1.1625 0.7670 -0.0565 -0.1324 0.0812  153 PHE A CA  
1157 C C   . PHE A 175 ? 0.7648 1.3619 0.9382 -0.0625 -0.1717 0.0801  153 PHE A C   
1158 O O   . PHE A 175 ? 0.8353 1.4212 1.0006 -0.0975 -0.1823 0.0713  153 PHE A O   
1159 C CB  . PHE A 175 ? 0.4169 1.0768 0.6768 -0.0584 -0.1186 0.0897  153 PHE A CB  
1160 C CG  . PHE A 175 ? 0.5082 1.2070 0.8129 -0.1018 -0.1268 0.0912  153 PHE A CG  
1161 C CD1 . PHE A 175 ? 0.4862 1.1555 0.8004 -0.1330 -0.1091 0.0908  153 PHE A CD1 
1162 C CD2 . PHE A 175 ? 0.6454 1.4081 0.9857 -0.1119 -0.1576 0.0942  153 PHE A CD2 
1163 C CE1 . PHE A 175 ? 0.5413 1.2304 0.8911 -0.1750 -0.1233 0.0931  153 PHE A CE1 
1164 C CE2 . PHE A 175 ? 0.7010 1.4933 1.0807 -0.1577 -0.1699 0.0971  153 PHE A CE2 
1165 C CZ  . PHE A 175 ? 0.7169 1.4670 1.0980 -0.1895 -0.1531 0.0968  153 PHE A CZ  
1166 N N   . GLU A 176 ? 0.7654 1.3924 0.9437 -0.0271 -0.1979 0.0874  154 GLU A N   
1167 C CA  . GLU A 176 ? 0.7687 1.4161 0.9410 -0.0307 -0.2428 0.0887  154 GLU A CA  
1168 C C   . GLU A 176 ? 0.8171 1.3692 0.8883 -0.0475 -0.2571 0.0842  154 GLU A C   
1169 O O   . GLU A 176 ? 0.9344 1.4813 0.9837 -0.0772 -0.2811 0.0778  154 GLU A O   
1170 C CB  . GLU A 176 ? 0.7790 1.4850 0.9911 0.0186  -0.2703 0.0964  154 GLU A CB  
1171 C CG  . GLU A 176 ? 0.7533 1.5774 1.0700 0.0296  -0.2546 0.0975  154 GLU A CG  
1172 C CD  . GLU A 176 ? 0.9271 1.8044 1.2827 0.0907  -0.2676 0.0967  154 GLU A CD  
1173 O OE1 . GLU A 176 ? 1.0546 1.8605 1.3519 0.1253  -0.2929 0.0975  154 GLU A OE1 
1174 O OE2 . GLU A 176 ? 0.8765 1.8584 1.3161 0.1033  -0.2503 0.0940  154 GLU A OE2 
1175 N N   . ILE A 177 ? 0.7495 1.2259 0.7540 -0.0329 -0.2428 0.0876  155 ILE A N   
1176 C CA  . ILE A 177 ? 0.7941 1.1857 0.6964 -0.0554 -0.2491 0.0856  155 ILE A CA  
1177 C C   . ILE A 177 ? 0.8304 1.2041 0.7177 -0.0983 -0.2214 0.0651  155 ILE A C   
1178 O O   . ILE A 177 ? 0.9184 1.2555 0.7394 -0.1245 -0.2340 0.0553  155 ILE A O   
1179 C CB  . ILE A 177 ? 0.8111 1.1298 0.6516 -0.0395 -0.2350 0.0962  155 ILE A CB  
1180 C CG1 . ILE A 177 ? 0.7971 1.1189 0.6491 0.0090  -0.2678 0.1122  155 ILE A CG1 
1181 C CG2 . ILE A 177 ? 0.8647 1.1039 0.5947 -0.0705 -0.2374 0.0976  155 ILE A CG2 
1182 C CD1 . ILE A 177 ? 0.8590 1.0867 0.6289 0.0184  -0.2712 0.1266  155 ILE A CD1 
1183 N N   . SER A 178 ? 0.9211 1.3180 0.8674 -0.1046 -0.1859 0.0567  156 SER A N   
1184 C CA  . SER A 178 ? 0.9032 1.2747 0.8415 -0.1371 -0.1605 0.0342  156 SER A CA  
1185 C C   . SER A 178 ? 0.8199 1.2200 0.7843 -0.1628 -0.1854 0.0219  156 SER A C   
1186 O O   . SER A 178 ? 0.8667 1.2276 0.7889 -0.1882 -0.1819 -0.0020 156 SER A O   
1187 C CB  . SER A 178 ? 0.8876 1.2648 0.8788 -0.1339 -0.1228 0.0320  156 SER A CB  
1188 O OG  . SER A 178 ? 1.0072 1.4435 1.0790 -0.1380 -0.1289 0.0377  156 SER A OG  
1189 N N   . LYS A 179 ? 0.8314 1.3020 0.8686 -0.1586 -0.2085 0.0352  157 LYS A N   
1190 C CA  . LYS A 179 ? 0.8388 1.3354 0.8974 -0.1887 -0.2405 0.0269  157 LYS A CA  
1191 C C   . LYS A 179 ? 0.9188 1.3820 0.8993 -0.1975 -0.2765 0.0195  157 LYS A C   
1192 O O   . LYS A 179 ? 1.0058 1.4415 0.9554 -0.2288 -0.2919 -0.0014 157 LYS A O   
1193 C CB  . LYS A 179 ? 0.8018 1.3957 0.9557 -0.1854 -0.2593 0.0466  157 LYS A CB  
1194 C CG  . LYS A 179 ? 0.7784 1.4054 1.0050 -0.2032 -0.2346 0.0516  157 LYS A CG  
1195 N N   . LYS A 180 ? 0.9051 1.3569 0.8413 -0.1708 -0.2911 0.0350  158 LYS A N   
1196 C CA  . LYS A 180 ? 0.9321 1.3524 0.7893 -0.1782 -0.3337 0.0358  158 LYS A CA  
1197 C C   . LYS A 180 ? 1.0035 1.3372 0.7468 -0.2005 -0.3130 0.0167  158 LYS A C   
1198 O O   . LYS A 180 ? 1.1920 1.4980 0.8762 -0.2291 -0.3335 -0.0016 158 LYS A O   
1199 C CB  . LYS A 180 ? 0.9107 1.3450 0.7653 -0.1390 -0.3635 0.0626  158 LYS A CB  
1200 C CG  . LYS A 180 ? 1.0444 1.4856 0.8670 -0.1396 -0.4285 0.0723  158 LYS A CG  
1201 C CD  . LYS A 180 ? 1.1690 1.6043 0.9819 -0.0943 -0.4594 0.0974  158 LYS A CD  
1202 C CE  . LYS A 180 ? 1.3144 1.6482 1.0175 -0.0921 -0.4397 0.1059  158 LYS A CE  
1203 N N   . GLU A 181 ? 1.0154 1.3096 0.7256 -0.1896 -0.2719 0.0195  159 GLU A N   
1204 C CA  . GLU A 181 ? 1.1311 1.3563 0.7308 -0.2098 -0.2508 0.0073  159 GLU A CA  
1205 C C   . GLU A 181 ? 1.0320 1.2397 0.6337 -0.2271 -0.1976 -0.0258 159 GLU A C   
1206 O O   . GLU A 181 ? 1.2391 1.4035 0.7548 -0.2453 -0.1729 -0.0410 159 GLU A O   
1207 C CB  . GLU A 181 ? 1.1842 1.3729 0.7327 -0.1917 -0.2490 0.0364  159 GLU A CB  
1208 C CG  . GLU A 181 ? 1.2831 1.4756 0.8179 -0.1703 -0.3110 0.0658  159 GLU A CG  
1209 C CD  . GLU A 181 ? 1.2084 1.3272 0.6121 -0.1855 -0.3361 0.0831  159 GLU A CD  
1210 N N   . MET A 182 ? 1.4199 1.5310 0.6425 0.2884  -0.3043 0.0655  160 MET A N   
1211 C CA  . MET A 182 ? 1.4042 1.5284 0.6203 0.2541  -0.2569 0.0574  160 MET A CA  
1212 C C   . MET A 182 ? 1.3399 1.5402 0.6322 0.2415  -0.2710 -0.0034 160 MET A C   
1213 O O   . MET A 182 ? 1.3577 1.6105 0.7431 0.2471  -0.3071 -0.0377 160 MET A O   
1214 C CB  . MET A 182 ? 1.2407 1.3487 0.4901 0.2296  -0.2128 0.0844  160 MET A CB  
1215 C CG  . MET A 182 ? 1.4361 1.4615 0.6266 0.2313  -0.1899 0.1437  160 MET A CG  
1216 S SD  . MET A 182 ? 1.4977 1.5155 0.7821 0.1774  -0.1300 0.1553  160 MET A SD  
1217 C CE  . MET A 182 ? 1.5589 1.4999 0.8384 0.1923  -0.1415 0.1961  160 MET A CE  
1218 N N   . GLN A 183 ? 1.3065 1.5111 0.5656 0.2217  -0.2367 -0.0160 161 GLN A N   
1219 C CA  . GLN A 183 ? 1.3506 1.6103 0.6694 0.2062  -0.2406 -0.0713 161 GLN A CA  
1220 C C   . GLN A 183 ? 1.2100 1.5017 0.6489 0.1754  -0.2186 -0.0806 161 GLN A C   
1221 O O   . GLN A 183 ? 1.2435 1.5066 0.7008 0.1586  -0.1813 -0.0427 161 GLN A O   
1222 C CB  . GLN A 183 ? 1.5178 1.7599 0.7615 0.1974  -0.2021 -0.0764 161 GLN A CB  
1223 C CG  . GLN A 183 ? 1.6030 1.8718 0.8500 0.2022  -0.2293 -0.1336 161 GLN A CG  
1224 C CD  . GLN A 183 ? 1.6985 1.9553 0.8903 0.2304  -0.2783 -0.1407 161 GLN A CD  
1225 O OE1 . GLN A 183 ? 1.8400 2.0539 0.9212 0.2454  -0.2679 -0.1121 161 GLN A OE1 
1226 N NE2 . GLN A 183 ? 1.6452 1.9440 0.9183 0.2361  -0.3302 -0.1794 161 GLN A NE2 
1227 N N   . PRO A 184 ? 1.1760 1.5165 0.7082 0.1618  -0.2371 -0.1284 162 PRO A N   
1228 C CA  . PRO A 184 ? 1.1144 1.4729 0.7638 0.1307  -0.2128 -0.1297 162 PRO A CA  
1229 C C   . PRO A 184 ? 0.9471 1.2832 0.6036 0.1038  -0.1580 -0.1136 162 PRO A C   
1230 O O   . PRO A 184 ? 0.7967 1.1390 0.5331 0.0819  -0.1381 -0.1082 162 PRO A O   
1231 C CB  . PRO A 184 ? 1.0761 1.4843 0.8095 0.1210  -0.2431 -0.1836 162 PRO A CB  
1232 C CG  . PRO A 184 ? 1.1217 1.5477 0.8022 0.1513  -0.2966 -0.2102 162 PRO A CG  
1233 C CD  . PRO A 184 ? 1.2657 1.6450 0.8044 0.1739  -0.2849 -0.1830 162 PRO A CD  
1234 N N   . THR A 185 ? 0.9841 1.2988 0.5600 0.1072  -0.1341 -0.1077 163 THR A N   
1235 C CA  . THR A 185 ? 0.9251 1.2296 0.5109 0.0864  -0.0839 -0.0974 163 THR A CA  
1236 C C   . THR A 185 ? 0.9490 1.2208 0.4943 0.0804  -0.0481 -0.0469 163 THR A C   
1237 O O   . THR A 185 ? 0.9406 1.2133 0.5121 0.0614  -0.0080 -0.0382 163 THR A O   
1238 C CB  . THR A 185 ? 0.9774 1.2882 0.5127 0.0936  -0.0733 -0.1299 163 THR A CB  
1239 O OG1 . THR A 185 ? 1.2504 1.5385 0.6669 0.1126  -0.0613 -0.1068 163 THR A OG1 
1240 C CG2 . THR A 185 ? 1.0251 1.3588 0.5830 0.1016  -0.1165 -0.1833 163 THR A CG2 
1241 N N   . HIS A 186 ? 0.9358 1.1773 0.4175 0.0968  -0.0621 -0.0150 164 HIS A N   
1242 C CA  . HIS A 186 ? 0.9874 1.1882 0.4306 0.0863  -0.0259 0.0333  164 HIS A CA  
1243 C C   . HIS A 186 ? 1.1672 1.3696 0.7029 0.0603  -0.0088 0.0431  164 HIS A C   
1244 O O   . HIS A 186 ? 1.2420 1.4533 0.8377 0.0626  -0.0349 0.0339  164 HIS A O   
1245 C CB  . HIS A 186 ? 1.0527 1.2072 0.4140 0.1110  -0.0492 0.0677  164 HIS A CB  
1246 C CG  . HIS A 186 ? 1.3744 1.4742 0.6728 0.0993  -0.0082 0.1198  164 HIS A CG  
1247 N ND1 . HIS A 186 ? 1.5286 1.5684 0.7342 0.1212  -0.0208 0.1602  164 HIS A ND1 
1248 C CD2 . HIS A 186 ? 1.4001 1.4949 0.7254 0.0661  0.0444  0.1389  164 HIS A CD2 
1249 C CE1 . HIS A 186 ? 1.5669 1.5611 0.7381 0.0982  0.0275  0.2043  164 HIS A CE1 
1250 N NE2 . HIS A 186 ? 1.4950 1.5277 0.7444 0.0632  0.0673  0.1899  164 HIS A NE2 
1251 N N   . PRO A 187 ? 1.1290 1.3299 0.6852 0.0359  0.0340  0.0573  165 PRO A N   
1252 C CA  . PRO A 187 ? 1.0776 1.2805 0.7165 0.0139  0.0431  0.0631  165 PRO A CA  
1253 C C   . PRO A 187 ? 0.9813 1.1448 0.6209 0.0181  0.0229  0.0865  165 PRO A C   
1254 O O   . PRO A 187 ? 0.7534 0.9226 0.4563 0.0113  0.0135  0.0786  165 PRO A O   
1255 C CB  . PRO A 187 ? 1.1112 1.3188 0.7583 -0.0099 0.0897  0.0781  165 PRO A CB  
1256 C CG  . PRO A 187 ? 1.0561 1.2552 0.6103 0.0004  0.1116  0.0890  165 PRO A CG  
1257 C CD  . PRO A 187 ? 0.8759 1.0861 0.3902 0.0292  0.0750  0.0597  165 PRO A CD  
1258 N N   . ILE A 188 ? 1.0926 1.2126 0.6564 0.0344  0.0138  0.1136  166 ILE A N   
1259 C CA  . ILE A 188 ? 1.0387 1.1142 0.6041 0.0435  -0.0066 0.1336  166 ILE A CA  
1260 C C   . ILE A 188 ? 0.9636 1.0668 0.5628 0.0696  -0.0488 0.1066  166 ILE A C   
1261 O O   . ILE A 188 ? 1.0843 1.1768 0.7261 0.0737  -0.0610 0.1056  166 ILE A O   
1262 C CB  . ILE A 188 ? 1.1636 1.1730 0.6340 0.0564  -0.0044 0.1755  166 ILE A CB  
1263 C CG1 . ILE A 188 ? 1.3715 1.3495 0.8270 0.0218  0.0453  0.2074  166 ILE A CG1 
1264 C CG2 . ILE A 188 ? 1.0979 1.0590 0.5706 0.0770  -0.0353 0.1891  166 ILE A CG2 
1265 C CD1 . ILE A 188 ? 1.4432 1.3851 0.9547 -0.0023 0.0530  0.2203  166 ILE A CD1 
1266 N N   . ARG A 189 ? 0.9476 1.0898 0.5334 0.0871  -0.0707 0.0810  167 ARG A N   
1267 C CA  . ARG A 189 ? 0.8451 1.0253 0.4826 0.1062  -0.1077 0.0525  167 ARG A CA  
1268 C C   . ARG A 189 ? 0.7850 1.0097 0.5140 0.0844  -0.0964 0.0246  167 ARG A C   
1269 O O   . ARG A 189 ? 0.7671 1.0121 0.5534 0.0907  -0.1099 0.0129  167 ARG A O   
1270 C CB  . ARG A 189 ? 0.8601 1.0659 0.4567 0.1323  -0.1429 0.0319  167 ARG A CB  
1271 C CG  . ARG A 189 ? 0.8233 1.0815 0.4936 0.1460  -0.1791 -0.0019 167 ARG A CG  
1272 C CD  . ARG A 189 ? 1.0306 1.3173 0.6698 0.1733  -0.2237 -0.0263 167 ARG A CD  
1273 N NE  . ARG A 189 ? 1.1576 1.5122 0.8948 0.1651  -0.2433 -0.0715 167 ARG A NE  
1274 C CZ  . ARG A 189 ? 1.1860 1.5846 0.9349 0.1841  -0.2899 -0.1064 167 ARG A CZ  
1275 N NH1 . ARG A 189 ? 1.1622 1.5431 0.8187 0.2192  -0.3265 -0.1009 167 ARG A NH1 
1276 N NH2 . ARG A 189 ? 1.2016 1.6609 1.0548 0.1674  -0.3008 -0.1465 167 ARG A NH2 
1277 N N   . LEU A 190 ? 0.7620 0.9998 0.5043 0.0612  -0.0696 0.0158  168 LEU A N   
1278 C CA  . LEU A 190 ? 0.7811 1.0462 0.6002 0.0434  -0.0592 -0.0027 168 LEU A CA  
1279 C C   . LEU A 190 ? 0.8109 1.0531 0.6546 0.0307  -0.0416 0.0162  168 LEU A C   
1280 O O   . LEU A 190 ? 0.6971 0.9530 0.5907 0.0261  -0.0410 0.0071  168 LEU A O   
1281 C CB  . LEU A 190 ? 0.6781 0.9611 0.5083 0.0290  -0.0418 -0.0211 168 LEU A CB  
1282 C CG  . LEU A 190 ? 0.6320 0.9361 0.4453 0.0358  -0.0539 -0.0512 168 LEU A CG  
1283 C CD1 . LEU A 190 ? 0.6294 0.9257 0.4013 0.0314  -0.0261 -0.0488 168 LEU A CD1 
1284 C CD2 . LEU A 190 ? 0.5396 0.8684 0.4225 0.0255  -0.0609 -0.0812 168 LEU A CD2 
1285 N N   . GLY A 191 ? 0.8313 1.0368 0.6383 0.0244  -0.0275 0.0419  169 GLY A N   
1286 C CA  . GLY A 191 ? 0.5614 0.7411 0.3905 0.0135  -0.0193 0.0544  169 GLY A CA  
1287 C C   . GLY A 191 ? 0.8277 0.9904 0.6621 0.0327  -0.0397 0.0549  169 GLY A C   
1288 O O   . GLY A 191 ? 0.8891 1.0479 0.7549 0.0293  -0.0380 0.0492  169 GLY A O   
1289 N N   . LEU A 192 ? 0.8610 1.0155 0.6627 0.0574  -0.0608 0.0592  170 LEU A N   
1290 C CA  . LEU A 192 ? 0.8332 0.9814 0.6502 0.0826  -0.0816 0.0545  170 LEU A CA  
1291 C C   . LEU A 192 ? 0.8073 1.0134 0.6884 0.0850  -0.0841 0.0263  170 LEU A C   
1292 O O   . LEU A 192 ? 0.6998 0.9078 0.6107 0.0935  -0.0826 0.0192  170 LEU A O   
1293 C CB  . LEU A 192 ? 0.8540 0.9868 0.6259 0.1140  -0.1093 0.0640  170 LEU A CB  
1294 C CG  . LEU A 192 ? 0.8094 0.9423 0.6053 0.1479  -0.1338 0.0560  170 LEU A CG  
1295 C CD1 . LEU A 192 ? 0.8960 0.9908 0.6319 0.1809  -0.1622 0.0751  170 LEU A CD1 
1296 C CD2 . LEU A 192 ? 0.8176 0.9041 0.6218 0.1433  -0.1205 0.0632  170 LEU A CD2 
1297 N N   . ALA A 193 ? 0.7663 1.0167 0.6677 0.0769  -0.0855 0.0093  171 ALA A N   
1298 C CA  . ALA A 193 ? 0.6231 0.9235 0.5900 0.0717  -0.0824 -0.0141 171 ALA A CA  
1299 C C   . ALA A 193 ? 0.6781 0.9707 0.6670 0.0529  -0.0560 -0.0110 171 ALA A C   
1300 O O   . ALA A 193 ? 0.7853 1.0966 0.8102 0.0564  -0.0478 -0.0185 171 ALA A O   
1301 C CB  . ALA A 193 ? 0.5702 0.9063 0.5531 0.0623  -0.0902 -0.0342 171 ALA A CB  
1302 N N   . LEU A 194 ? 0.8107 1.0792 0.7773 0.0351  -0.0423 -0.0007 172 LEU A N   
1303 C CA  . LEU A 194 ? 0.7204 0.9819 0.7026 0.0215  -0.0249 0.0013  172 LEU A CA  
1304 C C   . LEU A 194 ? 0.7213 0.9586 0.6945 0.0318  -0.0250 0.0061  172 LEU A C   
1305 O O   . LEU A 194 ? 0.7803 1.0283 0.7705 0.0352  -0.0157 -0.0001 172 LEU A O   
1306 C CB  . LEU A 194 ? 0.5503 0.7976 0.5181 0.0056  -0.0159 0.0087  172 LEU A CB  
1307 C CG  . LEU A 194 ? 0.5588 0.7995 0.5401 -0.0041 -0.0064 0.0103  172 LEU A CG  
1308 C CD1 . LEU A 194 ? 0.6017 0.8617 0.6096 -0.0085 0.0010  0.0017  172 LEU A CD1 
1309 C CD2 . LEU A 194 ? 0.4297 0.6598 0.4052 -0.0162 -0.0021 0.0173  172 LEU A CD2 
1310 N N   . ASN A 195 ? 0.6114 0.8121 0.5540 0.0388  -0.0345 0.0165  173 ASN A N   
1311 C CA  . ASN A 195 ? 0.4877 0.6554 0.4198 0.0493  -0.0375 0.0158  173 ASN A CA  
1312 C C   . ASN A 195 ? 0.6978 0.8836 0.6460 0.0759  -0.0418 0.0036  173 ASN A C   
1313 O O   . ASN A 195 ? 0.6939 0.8728 0.6429 0.0855  -0.0352 -0.0061 173 ASN A O   
1314 C CB  . ASN A 195 ? 0.5369 0.6505 0.4368 0.0475  -0.0460 0.0307  173 ASN A CB  
1315 C CG  . ASN A 195 ? 0.5346 0.6330 0.4337 0.0190  -0.0371 0.0384  173 ASN A CG  
1316 O OD1 . ASN A 195 ? 0.4964 0.6287 0.4140 0.0045  -0.0272 0.0352  173 ASN A OD1 
1317 N ND2 . ASN A 195 ? 0.5815 0.6285 0.4658 0.0110  -0.0409 0.0473  173 ASN A ND2 
1318 N N   . PHE A 196 ? 0.6931 0.9042 0.6533 0.0909  -0.0543 0.0015  174 PHE A N   
1319 C CA  . PHE A 196 ? 0.7032 0.9481 0.6969 0.1180  -0.0594 -0.0138 174 PHE A CA  
1320 C C   . PHE A 196 ? 0.6184 0.9130 0.6566 0.1077  -0.0352 -0.0272 174 PHE A C   
1321 O O   . PHE A 196 ? 0.5527 0.8577 0.6044 0.1231  -0.0218 -0.0373 174 PHE A O   
1322 C CB  . PHE A 196 ? 0.7898 1.0618 0.7940 0.1349  -0.0843 -0.0163 174 PHE A CB  
1323 C CG  . PHE A 196 ? 0.7885 1.0768 0.8166 0.1749  -0.1027 -0.0277 174 PHE A CG  
1324 C CD1 . PHE A 196 ? 0.8137 1.0918 0.8531 0.1941  -0.0914 -0.0369 174 PHE A CD1 
1325 C CD2 . PHE A 196 ? 0.7370 1.0531 0.7752 0.1975  -0.1341 -0.0325 174 PHE A CD2 
1326 C CE1 . PHE A 196 ? 0.7313 1.0293 0.8002 0.2364  -0.1076 -0.0510 174 PHE A CE1 
1327 C CE2 . PHE A 196 ? 0.8723 1.2095 0.9408 0.2401  -0.1557 -0.0448 174 PHE A CE2 
1328 C CZ  . PHE A 196 ? 0.7809 1.1099 0.8687 0.2599  -0.1406 -0.0540 174 PHE A CZ  
1329 N N   . SER A 197 ? 0.4886 0.8080 0.5450 0.0819  -0.0260 -0.0263 175 SER A N   
1330 C CA  . SER A 197 ? 0.4475 0.7979 0.5382 0.0674  0.0011  -0.0313 175 SER A CA  
1331 C C   . SER A 197 ? 0.6711 0.9892 0.7262 0.0686  0.0196  -0.0249 175 SER A C   
1332 O O   . SER A 197 ? 0.8324 1.1710 0.9010 0.0747  0.0431  -0.0297 175 SER A O   
1333 C CB  . SER A 197 ? 0.5547 0.9157 0.6619 0.0404  0.0049  -0.0299 175 SER A CB  
1334 O OG  . SER A 197 ? 0.7605 1.0817 0.8269 0.0283  0.0029  -0.0178 175 SER A OG  
1335 N N   . VAL A 198 ? 0.7606 1.0306 0.7698 0.0645  0.0089  -0.0161 176 VAL A N   
1336 C CA  . VAL A 198 ? 0.6610 0.9006 0.6334 0.0671  0.0170  -0.0155 176 VAL A CA  
1337 C C   . VAL A 198 ? 0.7514 0.9806 0.7102 0.0944  0.0180  -0.0289 176 VAL A C   
1338 O O   . VAL A 198 ? 0.9632 1.1896 0.8993 0.1038  0.0350  -0.0352 176 VAL A O   
1339 C CB  . VAL A 198 ? 0.5797 0.7802 0.5238 0.0537  0.0005  -0.0083 176 VAL A CB  
1340 C CG1 . VAL A 198 ? 0.5020 0.6673 0.4081 0.0617  -0.0049 -0.0160 176 VAL A CG1 
1341 C CG2 . VAL A 198 ? 0.4454 0.6587 0.4010 0.0336  0.0058  0.0007  176 VAL A CG2 
1342 N N   . PHE A 199 ? 0.6962 0.9157 0.6625 0.1112  0.0002  -0.0336 177 PHE A N   
1343 C CA  . PHE A 199 ? 0.7505 0.9607 0.7124 0.1439  -0.0002 -0.0499 177 PHE A CA  
1344 C C   . PHE A 199 ? 0.7506 1.0218 0.7509 0.1573  0.0281  -0.0619 177 PHE A C   
1345 O O   . PHE A 199 ? 0.7080 0.9769 0.6912 0.1780  0.0455  -0.0765 177 PHE A O   
1346 C CB  . PHE A 199 ? 0.7506 0.9409 0.7188 0.1626  -0.0264 -0.0480 177 PHE A CB  
1347 C CG  . PHE A 199 ? 0.7337 0.9171 0.7080 0.2029  -0.0301 -0.0662 177 PHE A CG  
1348 C CD1 . PHE A 199 ? 0.6907 0.9322 0.7177 0.2284  -0.0314 -0.0762 177 PHE A CD1 
1349 C CD2 . PHE A 199 ? 0.8194 0.9388 0.7525 0.2177  -0.0361 -0.0775 177 PHE A CD2 
1350 C CE1 . PHE A 199 ? 0.7027 0.9418 0.7427 0.2726  -0.0362 -0.0958 177 PHE A CE1 
1351 C CE2 . PHE A 199 ? 0.7936 0.9000 0.7316 0.2607  -0.0405 -0.0983 177 PHE A CE2 
1352 C CZ  . PHE A 199 ? 0.7373 0.9048 0.7293 0.2905  -0.0393 -0.1066 177 PHE A CZ  
1353 N N   . TYR A 200 ? 0.7238 1.0518 0.7792 0.1455  0.0344  -0.0587 178 TYR A N   
1354 C CA  . TYR A 200 ? 0.8681 1.2610 0.9755 0.1509  0.0664  -0.0695 178 TYR A CA  
1355 C C   . TYR A 200 ? 0.8148 1.2002 0.8891 0.1364  0.1032  -0.0614 178 TYR A C   
1356 O O   . TYR A 200 ? 0.8465 1.2512 0.9170 0.1541  0.1340  -0.0714 178 TYR A O   
1357 C CB  . TYR A 200 ? 0.8554 1.3085 1.0355 0.1336  0.0623  -0.0707 178 TYR A CB  
1358 C CG  . TYR A 200 ? 0.7561 1.2397 0.9779 0.1628  0.0322  -0.0859 178 TYR A CG  
1359 C CD1 . TYR A 200 ? 0.6104 1.1396 0.8778 0.1956  0.0427  -0.1059 178 TYR A CD1 
1360 C CD2 . TYR A 200 ? 0.7819 1.2464 0.9909 0.1626  -0.0074 -0.0802 178 TYR A CD2 
1361 C CE1 . TYR A 200 ? 0.6523 1.2081 0.9582 0.2295  0.0089  -0.1199 178 TYR A CE1 
1362 C CE2 . TYR A 200 ? 0.8557 1.3406 1.0897 0.1952  -0.0404 -0.0909 178 TYR A CE2 
1363 C CZ  . TYR A 200 ? 0.8240 1.3544 1.1093 0.2299  -0.0352 -0.1109 178 TYR A CZ  
1364 O OH  . TYR A 200 ? 0.9208 1.4716 1.2330 0.2690  -0.0739 -0.1219 178 TYR A OH  
1365 N N   . TYR A 201 ? 0.6459 0.9993 0.6880 0.1091  0.0998  -0.0431 179 TYR A N   
1366 C CA  . TYR A 201 ? 0.6663 1.0056 0.6687 0.0980  0.1297  -0.0300 179 TYR A CA  
1367 C C   . TYR A 201 ? 0.7871 1.0801 0.7122 0.1202  0.1265  -0.0375 179 TYR A C   
1368 O O   . TYR A 201 ? 0.9717 1.2698 0.8638 0.1327  0.1587  -0.0394 179 TYR A O   
1369 C CB  . TYR A 201 ? 0.6616 0.9787 0.6564 0.0690  0.1212  -0.0104 179 TYR A CB  
1370 C CG  . TYR A 201 ? 0.7324 1.0335 0.6908 0.0592  0.1516  0.0087  179 TYR A CG  
1371 C CD1 . TYR A 201 ? 0.7553 1.0825 0.7570 0.0372  0.1840  0.0219  179 TYR A CD1 
1372 C CD2 . TYR A 201 ? 0.8543 1.1093 0.7324 0.0720  0.1457  0.0140  179 TYR A CD2 
1373 C CE1 . TYR A 201 ? 0.8810 1.1803 0.8390 0.0290  0.2143  0.0465  179 TYR A CE1 
1374 C CE2 . TYR A 201 ? 0.9780 1.2111 0.8076 0.0688  0.1705  0.0355  179 TYR A CE2 
1375 C CZ  . TYR A 201 ? 1.0120 1.2631 0.8778 0.0476  0.2068  0.0550  179 TYR A CZ  
1376 O OH  . TYR A 201 ? 1.1875 1.4041 0.9947 0.0452  0.2335  0.0831  179 TYR A OH  
1377 N N   . GLU A 202 ? 0.7036 0.9501 0.5970 0.1237  0.0894  -0.0428 180 GLU A N   
1378 C CA  . GLU A 202 ? 0.9053 1.1053 0.7278 0.1390  0.0804  -0.0538 180 GLU A CA  
1379 C C   . GLU A 202 ? 0.9330 1.1186 0.7418 0.1718  0.0766  -0.0812 180 GLU A C   
1380 O O   . GLU A 202 ? 1.1523 1.3043 0.8991 0.1892  0.0751  -0.0976 180 GLU A O   
1381 C CB  . GLU A 202 ? 1.1078 1.2657 0.9103 0.1222  0.0434  -0.0492 180 GLU A CB  
1382 C CG  . GLU A 202 ? 1.2799 1.4244 1.0418 0.1114  0.0421  -0.0360 180 GLU A CG  
1383 C CD  . GLU A 202 ? 1.5376 1.6607 1.3079 0.0931  0.0067  -0.0333 180 GLU A CD  
1384 O OE1 . GLU A 202 ? 1.5924 1.6959 1.3781 0.0894  -0.0160 -0.0449 180 GLU A OE1 
1385 O OE2 . GLU A 202 ? 1.6015 1.7267 1.3661 0.0827  0.0033  -0.0187 180 GLU A OE2 
1386 N N   . ILE A 203 ? 0.9089 1.1186 0.7700 0.1856  0.0746  -0.0894 181 ILE A N   
1387 C CA  . ILE A 203 ? 0.8741 1.0597 0.7215 0.2222  0.0672  -0.1168 181 ILE A CA  
1388 C C   . ILE A 203 ? 0.8938 1.1422 0.7862 0.2494  0.1010  -0.1305 181 ILE A C   
1389 O O   . ILE A 203 ? 0.9490 1.1886 0.8213 0.2855  0.1108  -0.1573 181 ILE A O   
1390 C CB  . ILE A 203 ? 0.8380 0.9792 0.7000 0.2244  0.0274  -0.1166 181 ILE A CB  
1391 C CG1 . ILE A 203 ? 0.8220 0.9082 0.6492 0.1950  0.0008  -0.1060 181 ILE A CG1 
1392 C CG2 . ILE A 203 ? 0.8375 0.9401 0.6852 0.2650  0.0173  -0.1447 181 ILE A CG2 
1393 C CD1 . ILE A 203 ? 1.0529 1.0796 0.8246 0.2063  -0.0136 -0.1305 181 ILE A CD1 
1394 N N   . LEU A 204 ? 0.9236 1.2389 0.8840 0.2330  0.1185  -0.1165 182 LEU A N   
1395 C CA  . LEU A 204 ? 0.8386 1.2298 0.8656 0.2537  0.1503  -0.1309 182 LEU A CA  
1396 C C   . LEU A 204 ? 0.9410 1.3852 0.9825 0.2331  0.2043  -0.1193 182 LEU A C   
1397 O O   . LEU A 204 ? 1.0581 1.5750 1.1643 0.2451  0.2399  -0.1312 182 LEU A O   
1398 C CB  . LEU A 204 ? 0.8058 1.2408 0.9163 0.2528  0.1245  -0.1297 182 LEU A CB  
1399 C CG  . LEU A 204 ? 0.8131 1.2058 0.9183 0.2861  0.0801  -0.1410 182 LEU A CG  
1400 C CD1 . LEU A 204 ? 0.6357 1.0927 0.8260 0.3022  0.0625  -0.1476 182 LEU A CD1 
1401 C CD2 . LEU A 204 ? 0.7308 1.0891 0.7979 0.3281  0.0879  -0.1672 182 LEU A CD2 
1402 N N   A ASN A 205 ? 1.1412 1.5496 1.1252 0.2042  0.2126  -0.0958 183 ASN A N   
1403 N N   B ASN A 205 ? 1.1412 1.5496 1.1252 0.2042  0.2126  -0.0958 183 ASN A N   
1404 C CA  A ASN A 205 ? 1.1775 1.6160 1.1635 0.1796  0.2622  -0.0745 183 ASN A CA  
1405 C CA  B ASN A 205 ? 1.1775 1.6160 1.1635 0.1796  0.2622  -0.0745 183 ASN A CA  
1406 C C   A ASN A 205 ? 1.1059 1.6273 1.2091 0.1602  0.2831  -0.0734 183 ASN A C   
1407 C C   B ASN A 205 ? 1.1059 1.6273 1.2091 0.1602  0.2831  -0.0734 183 ASN A C   
1408 O O   A ASN A 205 ? 1.2727 1.8525 1.4180 0.1578  0.3361  -0.0741 183 ASN A O   
1409 O O   B ASN A 205 ? 1.2727 1.8525 1.4180 0.1578  0.3361  -0.0741 183 ASN A O   
1410 C CB  A ASN A 205 ? 1.3288 1.7620 1.2447 0.2047  0.3066  -0.0823 183 ASN A CB  
1411 C CB  B ASN A 205 ? 1.3288 1.7620 1.2447 0.2047  0.3066  -0.0823 183 ASN A CB  
1412 C CG  A ASN A 205 ? 1.5717 2.0179 1.4662 0.1792  0.3617  -0.0515 183 ASN A CG  
1413 C CG  B ASN A 205 ? 1.5717 2.0179 1.4662 0.1792  0.3617  -0.0515 183 ASN A CG  
1414 O OD1 A ASN A 205 ? 1.6694 2.1534 1.6375 0.1444  0.3804  -0.0318 183 ASN A OD1 
1415 O OD1 B ASN A 205 ? 1.6694 2.1534 1.6375 0.1444  0.3804  -0.0318 183 ASN A OD1 
1416 N ND2 A ASN A 205 ? 1.6374 2.0437 1.4234 0.1961  0.3857  -0.0467 183 ASN A ND2 
1417 N ND2 B ASN A 205 ? 1.6374 2.0437 1.4234 0.1961  0.3857  -0.0467 183 ASN A ND2 
1418 N N   . SER A 206 ? 0.8275 1.3587 0.9872 0.1486  0.2405  -0.0757 184 SER A N   
1419 C CA  . SER A 206 ? 0.6632 1.2664 0.9311 0.1251  0.2470  -0.0777 184 SER A CA  
1420 C C   . SER A 206 ? 0.6323 1.2060 0.8971 0.0831  0.2344  -0.0552 184 SER A C   
1421 O O   . SER A 206 ? 0.7469 1.3109 1.0280 0.0771  0.1901  -0.0591 184 SER A O   
1422 C CB  . SER A 206 ? 0.6690 1.3111 1.0025 0.1498  0.2045  -0.1024 184 SER A CB  
1423 O OG  . SER A 206 ? 0.5854 1.2473 0.9240 0.1958  0.2096  -0.1258 184 SER A OG  
1424 N N   . PRO A 207 ? 0.6803 1.2353 0.9197 0.0563  0.2736  -0.0311 185 PRO A N   
1425 C CA  . PRO A 207 ? 0.7398 1.2564 0.9727 0.0217  0.2603  -0.0110 185 PRO A CA  
1426 C C   . PRO A 207 ? 0.7283 1.2933 1.0625 -0.0042 0.2456  -0.0236 185 PRO A C   
1427 O O   . PRO A 207 ? 0.6498 1.1821 0.9758 -0.0190 0.2128  -0.0209 185 PRO A O   
1428 C CB  . PRO A 207 ? 0.8551 1.3440 1.0450 0.0041  0.3121  0.0188  185 PRO A CB  
1429 C CG  . PRO A 207 ? 0.9490 1.4377 1.0770 0.0368  0.3394  0.0150  185 PRO A CG  
1430 C CD  . PRO A 207 ? 0.8482 1.4052 1.0484 0.0609  0.3314  -0.0190 185 PRO A CD  
1431 N N   . GLU A 208 ? 0.7503 1.3965 1.1826 -0.0078 0.2661  -0.0420 186 GLU A N   
1432 C CA  . GLU A 208 ? 0.6952 1.3920 1.2316 -0.0361 0.2493  -0.0589 186 GLU A CA  
1433 C C   . GLU A 208 ? 0.5774 1.2881 1.1265 -0.0131 0.1851  -0.0842 186 GLU A C   
1434 O O   . GLU A 208 ? 0.5537 1.2544 1.1196 -0.0317 0.1524  -0.0915 186 GLU A O   
1435 C CB  . GLU A 208 ? 0.6815 1.4698 1.3325 -0.0511 0.2930  -0.0720 186 GLU A CB  
1436 N N   . LYS A 209 ? 0.4940 1.2177 1.0238 0.0299  0.1665  -0.0964 187 LYS A N   
1437 C CA  . LYS A 209 ? 0.4341 1.1469 0.9460 0.0555  0.1068  -0.1098 187 LYS A CA  
1438 C C   . LYS A 209 ? 0.6061 1.2341 1.0238 0.0476  0.0834  -0.0906 187 LYS A C   
1439 O O   . LYS A 209 ? 0.7548 1.3746 1.1685 0.0445  0.0448  -0.0971 187 LYS A O   
1440 C CB  . LYS A 209 ? 0.4162 1.1364 0.9117 0.1045  0.0950  -0.1204 187 LYS A CB  
1441 C CG  . LYS A 209 ? 0.6042 1.3495 1.1273 0.1347  0.0385  -0.1393 187 LYS A CG  
1442 C CD  . LYS A 209 ? 0.4224 1.2626 1.0488 0.1636  0.0397  -0.1679 187 LYS A CD  
1443 N N   . ALA A 210 ? 0.6852 1.2538 1.0267 0.0459  0.1062  -0.0689 188 ALA A N   
1444 C CA  . ALA A 210 ? 0.5811 1.0793 0.8452 0.0402  0.0854  -0.0531 188 ALA A CA  
1445 C C   . ALA A 210 ? 0.5840 1.0755 0.8672 0.0082  0.0799  -0.0503 188 ALA A C   
1446 O O   . ALA A 210 ? 0.7343 1.2008 0.9896 0.0079  0.0499  -0.0516 188 ALA A O   
1447 C CB  . ALA A 210 ? 0.4411 0.8882 0.6327 0.0448  0.1076  -0.0356 188 ALA A CB  
1448 N N   . CYS A 211 ? 0.5955 1.1057 0.9254 -0.0189 0.1111  -0.0469 189 CYS A N   
1449 C CA  . CYS A 211 ? 0.6416 1.1357 0.9918 -0.0480 0.1042  -0.0481 189 CYS A CA  
1450 C C   . CYS A 211 ? 0.7571 1.3011 1.1761 -0.0540 0.0731  -0.0785 189 CYS A C   
1451 O O   . CYS A 211 ? 0.7818 1.3048 1.1938 -0.0654 0.0504  -0.0878 189 CYS A O   
1452 C CB  . CYS A 211 ? 0.6679 1.1499 1.0428 -0.0779 0.1473  -0.0313 189 CYS A CB  
1453 S SG  . CYS A 211 ? 0.7248 1.1584 1.0176 -0.0674 0.1868  0.0035  189 CYS A SG  
1454 N N   . SER A 212 ? 0.8244 1.4372 1.3115 -0.0442 0.0697  -0.0977 190 SER A N   
1455 C CA  . SER A 212 ? 0.8520 1.5146 1.3988 -0.0439 0.0287  -0.1302 190 SER A CA  
1456 C C   . SER A 212 ? 0.7597 1.3899 1.2306 -0.0154 -0.0168 -0.1323 190 SER A C   
1457 O O   . SER A 212 ? 0.7431 1.3728 1.2119 -0.0207 -0.0493 -0.1507 190 SER A O   
1458 C CB  . SER A 212 ? 0.7002 1.4521 1.3432 -0.0330 0.0293  -0.1524 190 SER A CB  
1459 O OG  . SER A 212 ? 0.6477 1.4122 1.2616 0.0130  0.0002  -0.1569 190 SER A OG  
1460 N N   . LEU A 213 ? 0.6108 1.2060 1.0121 0.0126  -0.0162 -0.1127 191 LEU A N   
1461 C CA  . LEU A 213 ? 0.5506 1.1096 0.8793 0.0365  -0.0517 -0.1082 191 LEU A CA  
1462 C C   . LEU A 213 ? 0.6303 1.1354 0.9006 0.0186  -0.0503 -0.0974 191 LEU A C   
1463 O O   . LEU A 213 ? 0.7975 1.2968 1.0412 0.0222  -0.0778 -0.1078 191 LEU A O   
1464 C CB  . LEU A 213 ? 0.4833 1.0126 0.7635 0.0660  -0.0483 -0.0910 191 LEU A CB  
1465 C CG  . LEU A 213 ? 0.5456 1.0493 0.7729 0.0989  -0.0850 -0.0863 191 LEU A CG  
1466 C CD1 . LEU A 213 ? 0.5093 0.9974 0.7245 0.1290  -0.0802 -0.0795 191 LEU A CD1 
1467 C CD2 . LEU A 213 ? 0.6892 1.1304 0.8349 0.0903  -0.0909 -0.0674 191 LEU A CD2 
1468 N N   . ALA A 214 ? 0.4508 0.9192 0.7006 0.0020  -0.0187 -0.0787 192 ALA A N   
1469 C CA  . ALA A 214 ? 0.6752 1.1004 0.8833 -0.0114 -0.0167 -0.0713 192 ALA A CA  
1470 C C   . ALA A 214 ? 0.5915 1.0301 0.8371 -0.0306 -0.0258 -0.0941 192 ALA A C   
1471 O O   . ALA A 214 ? 0.7178 1.1395 0.9290 -0.0285 -0.0420 -0.1031 192 ALA A O   
1472 C CB  . ALA A 214 ? 0.7517 1.1403 0.9386 -0.0209 0.0129  -0.0493 192 ALA A CB  
1473 N N   . LYS A 215 ? 0.4127 0.8800 0.7297 -0.0508 -0.0129 -0.1054 193 LYS A N   
1474 C CA  . LYS A 215 ? 0.4840 0.9562 0.8439 -0.0731 -0.0228 -0.1311 193 LYS A CA  
1475 C C   . LYS A 215 ? 0.6046 1.1117 0.9683 -0.0598 -0.0668 -0.1638 193 LYS A C   
1476 O O   . LYS A 215 ? 0.7350 1.2257 1.0818 -0.0644 -0.0849 -0.1855 193 LYS A O   
1477 C CB  . LYS A 215 ? 0.3946 0.8898 0.8395 -0.1029 0.0039  -0.1339 193 LYS A CB  
1478 C CG  . LYS A 215 ? 0.5558 1.0374 1.0496 -0.1333 -0.0007 -0.1578 193 LYS A CG  
1479 C CD  . LYS A 215 ? 0.5185 1.0412 1.1175 -0.1663 0.0196  -0.1676 193 LYS A CD  
1480 C CE  . LYS A 215 ? 0.6746 1.2376 1.3518 -0.1851 -0.0167 -0.2173 193 LYS A CE  
1481 N NZ  . LYS A 215 ? 0.8293 1.3402 1.4723 -0.1892 -0.0422 -0.2415 193 LYS A NZ  
1482 N N   . THR A 216 ? 0.5915 1.1450 0.9722 -0.0388 -0.0867 -0.1696 194 THR A N   
1483 C CA  . THR A 216 ? 0.5943 1.1805 0.9696 -0.0193 -0.1351 -0.1986 194 THR A CA  
1484 C C   . THR A 216 ? 0.6709 1.2100 0.9383 0.0023  -0.1503 -0.1879 194 THR A C   
1485 O O   . THR A 216 ? 0.5988 1.1356 0.8381 0.0053  -0.1771 -0.2131 194 THR A O   
1486 C CB  . THR A 216 ? 0.5619 1.2037 0.9765 0.0064  -0.1536 -0.2022 194 THR A CB  
1487 O OG1 . THR A 216 ? 0.5978 1.3071 1.1315 -0.0146 -0.1489 -0.2271 194 THR A OG1 
1488 C CG2 . THR A 216 ? 0.4714 1.1238 0.8367 0.0417  -0.2060 -0.2160 194 THR A CG2 
1489 N N   . ALA A 217 ? 0.6437 1.1448 0.8500 0.0162  -0.1314 -0.1523 195 ALA A N   
1490 C CA  . ALA A 217 ? 0.6103 1.0668 0.7228 0.0293  -0.1339 -0.1368 195 ALA A CA  
1491 C C   . ALA A 217 ? 0.6766 1.1105 0.7739 0.0115  -0.1221 -0.1497 195 ALA A C   
1492 O O   . ALA A 217 ? 0.9237 1.3463 0.9626 0.0221  -0.1360 -0.1608 195 ALA A O   
1493 C CB  . ALA A 217 ? 0.4580 0.8765 0.5319 0.0346  -0.1087 -0.0994 195 ALA A CB  
1494 N N   . PHE A 218 ? 0.5580 0.9823 0.7030 -0.0124 -0.0959 -0.1484 196 PHE A N   
1495 C CA  . PHE A 218 ? 0.4599 0.8563 0.5973 -0.0251 -0.0841 -0.1601 196 PHE A CA  
1496 C C   . PHE A 218 ? 0.5845 0.9967 0.7422 -0.0299 -0.1112 -0.2040 196 PHE A C   
1497 O O   . PHE A 218 ? 0.8281 1.2243 0.9354 -0.0205 -0.1187 -0.2218 196 PHE A O   
1498 C CB  . PHE A 218 ? 0.5826 0.9579 0.7637 -0.0453 -0.0541 -0.1448 196 PHE A CB  
1499 C CG  . PHE A 218 ? 0.4752 0.8148 0.6525 -0.0530 -0.0433 -0.1543 196 PHE A CG  
1500 C CD1 . PHE A 218 ? 0.4442 0.7584 0.5765 -0.0420 -0.0283 -0.1368 196 PHE A CD1 
1501 C CD2 . PHE A 218 ? 0.4739 0.8051 0.7007 -0.0711 -0.0485 -0.1826 196 PHE A CD2 
1502 C CE1 . PHE A 218 ? 0.4630 0.7478 0.5982 -0.0426 -0.0193 -0.1478 196 PHE A CE1 
1503 C CE2 . PHE A 218 ? 0.6678 0.9574 0.8909 -0.0734 -0.0400 -0.1930 196 PHE A CE2 
1504 C CZ  . PHE A 218 ? 0.7506 1.0185 0.9268 -0.0559 -0.0256 -0.1758 196 PHE A CZ  
1505 N N   . ASP A 219 ? 0.5230 0.9687 0.7591 -0.0458 -0.1244 -0.2252 197 ASP A N   
1506 C CA  . ASP A 219 ? 0.6338 1.0932 0.9047 -0.0565 -0.1534 -0.2737 197 ASP A CA  
1507 C C   . ASP A 219 ? 0.7110 1.1933 0.9220 -0.0281 -0.1969 -0.2985 197 ASP A C   
1508 O O   . ASP A 219 ? 0.6354 1.1104 0.8246 -0.0260 -0.2203 -0.3383 197 ASP A O   
1509 C CB  . ASP A 219 ? 0.7537 1.2505 1.1361 -0.0851 -0.1551 -0.2897 197 ASP A CB  
1510 C CG  . ASP A 219 ? 0.9868 1.4487 1.4134 -0.1138 -0.1098 -0.2637 197 ASP A CG  
1511 O OD1 . ASP A 219 ? 1.1101 1.5167 1.5150 -0.1214 -0.0953 -0.2636 197 ASP A OD1 
1512 O OD2 . ASP A 219 ? 1.0507 1.5395 1.5314 -0.1258 -0.0885 -0.2438 197 ASP A OD2 
1513 N N   . GLU A 220 ? 0.6860 1.1889 0.8612 -0.0030 -0.2087 -0.2752 198 GLU A N   
1514 C CA  . GLU A 220 ? 0.7793 1.2895 0.8731 0.0300  -0.2470 -0.2861 198 GLU A CA  
1515 C C   . GLU A 220 ? 0.9569 1.4192 0.9431 0.0429  -0.2284 -0.2731 198 GLU A C   
1516 O O   . GLU A 220 ? 1.2450 1.7048 1.1546 0.0651  -0.2553 -0.2932 198 GLU A O   
1517 C CB  . GLU A 220 ? 0.7886 1.3182 0.8695 0.0557  -0.2603 -0.2573 198 GLU A CB  
1518 C CG  . GLU A 220 ? 0.9956 1.5920 1.1617 0.0617  -0.3018 -0.2869 198 GLU A CG  
1519 C CD  . GLU A 220 ? 1.0284 1.6399 1.1922 0.0905  -0.3093 -0.2576 198 GLU A CD  
1520 O OE1 . GLU A 220 ? 0.9069 1.5701 1.1143 0.1113  -0.3519 -0.2791 198 GLU A OE1 
1521 O OE2 . GLU A 220 ? 1.0354 1.6028 1.1558 0.0932  -0.2729 -0.2146 198 GLU A OE2 
1522 N N   . ALA A 221 ? 0.8472 1.2754 0.8261 0.0307  -0.1825 -0.2416 199 ALA A N   
1523 C CA  . ALA A 221 ? 0.8233 1.2179 0.7175 0.0408  -0.1585 -0.2295 199 ALA A CA  
1524 C C   . ALA A 221 ? 0.8915 1.2733 0.7885 0.0335  -0.1533 -0.2687 199 ALA A C   
1525 O O   . ALA A 221 ? 0.9534 1.3251 0.7718 0.0512  -0.1538 -0.2842 199 ALA A O   
1526 C CB  . ALA A 221 ? 0.7283 1.1003 0.6239 0.0325  -0.1173 -0.1839 199 ALA A CB  
1527 N N   . ILE A 222 ? 0.8715 1.2487 0.8531 0.0096  -0.1475 -0.2862 200 ILE A N   
1528 C CA  . ILE A 222 ? 0.9242 1.2801 0.9092 0.0060  -0.1484 -0.3288 200 ILE A CA  
1529 C C   . ILE A 222 ? 0.9548 1.3295 0.9211 0.0150  -0.1950 -0.3810 200 ILE A C   
1530 O O   . ILE A 222 ? 1.1441 1.5017 1.0628 0.0272  -0.2013 -0.4195 200 ILE A O   
1531 C CB  . ILE A 222 ? 1.0390 1.3705 1.1138 -0.0215 -0.1321 -0.3326 200 ILE A CB  
1532 C CG1 . ILE A 222 ? 1.1954 1.5507 1.3546 -0.0457 -0.1424 -0.3255 200 ILE A CG1 
1533 C CG2 . ILE A 222 ? 0.9976 1.3007 1.0705 -0.0213 -0.0907 -0.2938 200 ILE A CG2 
1534 C CD1 . ILE A 222 ? 1.2705 1.5913 1.5064 -0.0746 -0.1209 -0.3231 200 ILE A CD1 
1535 N N   . ALA A 223 ? 0.9845 1.3979 0.9891 0.0121  -0.2304 -0.3872 201 ALA A N   
1536 C CA  . ALA A 223 ? 0.9643 1.4042 0.9630 0.0210  -0.2849 -0.4417 201 ALA A CA  
1537 C C   . ALA A 223 ? 1.0440 1.4750 0.9089 0.0587  -0.3011 -0.4529 201 ALA A C   
1538 O O   . ALA A 223 ? 1.0052 1.4237 0.8437 0.0672  -0.3250 -0.4933 201 ALA A O   
1539 C CB  . ALA A 223 ? 0.8832 1.3774 0.9484 0.0182  -0.3189 -0.4395 201 ALA A CB  
1540 N N   . GLU A 224 ? 1.0789 1.4973 0.8616 0.0785  -0.2737 -0.4017 202 GLU A N   
1541 C CA  . GLU A 224 ? 1.2359 1.6382 0.8850 0.1124  -0.2776 -0.3955 202 GLU A CA  
1542 C C   . GLU A 224 ? 1.3270 1.7008 0.9160 0.1147  -0.2182 -0.3640 202 GLU A C   
1543 O O   . GLU A 224 ? 1.2767 1.6393 0.8018 0.1256  -0.1942 -0.3140 202 GLU A O   
1544 C CB  . GLU A 224 ? 1.2402 1.6492 0.8498 0.1337  -0.3020 -0.3570 202 GLU A CB  
1545 N N   . LEU A 225 ? 1.4003 1.7588 1.0245 0.1022  -0.1919 -0.3910 203 LEU A N   
1546 C CA  . LEU A 225 ? 1.2715 1.6115 0.8561 0.1067  -0.1360 -0.3714 203 LEU A CA  
1547 C C   . LEU A 225 ? 1.4640 1.7980 0.9225 0.1369  -0.1284 -0.3923 203 LEU A C   
1548 O O   . LEU A 225 ? 1.4617 1.7898 0.8881 0.1425  -0.0778 -0.3804 203 LEU A O   
1549 C CB  . LEU A 225 ? 1.0609 1.3856 0.7303 0.0901  -0.1143 -0.3948 203 LEU A CB  
1550 C CG  . LEU A 225 ? 1.0141 1.3328 0.7946 0.0619  -0.1006 -0.3663 203 LEU A CG  
1551 C CD1 . LEU A 225 ? 1.0258 1.3165 0.8675 0.0542  -0.0909 -0.3995 203 LEU A CD1 
1552 C CD2 . LEU A 225 ? 0.8395 1.1624 0.6187 0.0582  -0.0618 -0.3068 203 LEU A CD2 
1553 N N   . ASP A 226 ? 1.6069 1.9322 1.0179 0.1513  -0.1708 -0.4108 204 ASP A N   
1554 C CA  . ASP A 226 ? 1.7056 2.0075 0.9985 0.1753  -0.1585 -0.4061 204 ASP A CA  
1555 C C   . ASP A 226 ? 1.6861 1.9773 0.9003 0.1817  -0.1209 -0.3401 204 ASP A C   
1556 O O   . ASP A 226 ? 1.7571 2.0297 0.8856 0.1923  -0.0809 -0.3263 204 ASP A O   
1557 C CB  . ASP A 226 ? 1.7618 2.0592 1.0243 0.1885  -0.2176 -0.4351 204 ASP A CB  
1558 N N   . THR A 227 ? 1.6106 1.9099 0.8545 0.1739  -0.1323 -0.2994 205 THR A N   
1559 C CA  . THR A 227 ? 1.6692 1.9466 0.8440 0.1783  -0.1078 -0.2351 205 THR A CA  
1560 C C   . THR A 227 ? 1.7164 2.0001 0.9176 0.1601  -0.0469 -0.1972 205 THR A C   
1561 O O   . THR A 227 ? 1.8007 2.0690 0.9846 0.1548  -0.0328 -0.1439 205 THR A O   
1562 C CB  . THR A 227 ? 1.5560 1.8340 0.7518 0.1838  -0.1569 -0.2137 205 THR A CB  
1563 O OG1 . THR A 227 ? 1.5088 1.8136 0.8033 0.1654  -0.1552 -0.2049 205 THR A OG1 
1564 C CG2 . THR A 227 ? 1.4485 1.7409 0.6642 0.1960  -0.2199 -0.2614 205 THR A CG2 
1565 N N   . LEU A 228 ? 1.6414 1.9469 0.8915 0.1506  -0.0125 -0.2246 206 LEU A N   
1566 C CA  . LEU A 228 ? 1.4632 1.7791 0.7534 0.1318  0.0464  -0.1901 206 LEU A CA  
1567 C C   . LEU A 228 ? 1.5567 1.8605 0.7638 0.1378  0.1013  -0.1696 206 LEU A C   
1568 O O   . LEU A 228 ? 1.4598 1.7536 0.6142 0.1535  0.1053  -0.2020 206 LEU A O   
1569 C CB  . LEU A 228 ? 1.1820 1.5160 0.5894 0.1169  0.0554  -0.2214 206 LEU A CB  
1570 C CG  . LEU A 228 ? 0.9662 1.2991 0.4816 0.0954  0.0274  -0.2110 206 LEU A CG  
1571 C CD1 . LEU A 228 ? 0.9620 1.3017 0.5700 0.0862  0.0384  -0.2386 206 LEU A CD1 
1572 C CD2 . LEU A 228 ? 0.8956 1.2218 0.4280 0.0791  0.0444  -0.1529 206 LEU A CD2 
1573 N N   . SER A 229 ? 1.6256 1.9264 0.8336 0.1202  0.1455  -0.1158 207 SER A N   
1574 C CA  . SER A 229 ? 1.7699 2.0528 0.9147 0.1146  0.2034  -0.0852 207 SER A CA  
1575 C C   . SER A 229 ? 1.7782 2.1038 0.9933 0.1050  0.2598  -0.1020 207 SER A C   
1576 O O   . SER A 229 ? 1.6507 2.0177 0.9711 0.0976  0.2577  -0.1220 207 SER A O   
1577 C CB  . SER A 229 ? 1.7914 2.0438 0.9152 0.0948  0.2217  -0.0185 207 SER A CB  
1578 O OG  . SER A 229 ? 1.7363 1.9569 0.8294 0.1056  0.1648  -0.0030 207 SER A OG  
1579 N N   . GLU A 230 ? 1.9527 2.2685 1.1095 0.1053  0.3112  -0.0940 208 GLU A N   
1580 C CA  . GLU A 230 ? 1.9785 2.3380 1.2095 0.0971  0.3696  -0.1049 208 GLU A CA  
1581 C C   . GLU A 230 ? 1.9622 2.3472 1.2849 0.0643  0.4001  -0.0617 208 GLU A C   
1582 O O   . GLU A 230 ? 1.9359 2.3723 1.3646 0.0568  0.4285  -0.0754 208 GLU A O   
1583 C CB  . GLU A 230 ? 2.0184 2.3634 1.1644 0.1023  0.4227  -0.1057 208 GLU A CB  
1584 N N   . GLU A 231 ? 1.9666 2.3151 1.2556 0.0461  0.3886  -0.0123 209 GLU A N   
1585 C CA  . GLU A 231 ? 1.8371 2.1977 1.2047 0.0114  0.4120  0.0302  209 GLU A CA  
1586 C C   . GLU A 231 ? 1.6127 1.9914 1.0607 0.0034  0.3636  0.0285  209 GLU A C   
1587 O O   . GLU A 231 ? 1.6437 2.0471 1.2014 -0.0227 0.3741  0.0369  209 GLU A O   
1588 C CB  . GLU A 231 ? 1.8859 2.1821 1.1647 -0.0075 0.4323  0.0872  209 GLU A CB  
1589 C CG  . GLU A 231 ? 1.7608 1.9968 0.9239 0.0153  0.3779  0.0974  209 GLU A CG  
1590 C CD  . GLU A 231 ? 1.6621 1.8382 0.7836 -0.0044 0.3743  0.1577  209 GLU A CD  
1591 N N   A SER A 232 ? 1.5204 1.8655 0.9322 0.0230  0.3025  0.0140  210 SER A N   
1592 N N   B SER A 232 ? 1.5195 1.8651 0.9319 0.0232  0.3025  0.0134  210 SER A N   
1593 C CA  A SER A 232 ? 1.3642 1.6938 0.8525 0.0131  0.2531  0.0162  210 SER A CA  
1594 C CA  B SER A 232 ? 1.3644 1.6940 0.8526 0.0132  0.2531  0.0160  210 SER A CA  
1595 C C   A SER A 232 ? 1.2900 1.6438 0.8520 0.0243  0.2181  -0.0325 210 SER A C   
1596 C C   B SER A 232 ? 1.2904 1.6441 0.8522 0.0244  0.2180  -0.0325 210 SER A C   
1597 O O   A SER A 232 ? 1.2190 1.5638 0.8455 0.0158  0.1840  -0.0309 210 SER A O   
1598 O O   B SER A 232 ? 1.2219 1.5667 0.8482 0.0159  0.1839  -0.0310 210 SER A O   
1599 C CB  A SER A 232 ? 1.3147 1.5914 0.7275 0.0245  0.2104  0.0397  210 SER A CB  
1600 C CB  B SER A 232 ? 1.3163 1.5930 0.7286 0.0244  0.2109  0.0399  210 SER A CB  
1601 O OG  A SER A 232 ? 1.2382 1.4790 0.6605 0.0028  0.2182  0.0878  210 SER A OG  
1602 O OG  B SER A 232 ? 1.1896 1.4667 0.5638 0.0527  0.1649  0.0019  210 SER A OG  
1603 N N   . TYR A 233 ? 1.2639 1.6422 0.8144 0.0438  0.2272  -0.0751 211 TYR A N   
1604 C CA  . TYR A 233 ? 1.0927 1.4768 0.7049 0.0538  0.1911  -0.1188 211 TYR A CA  
1605 C C   . TYR A 233 ? 1.0063 1.4072 0.7341 0.0376  0.1917  -0.1143 211 TYR A C   
1606 O O   . TYR A 233 ? 0.9107 1.2970 0.6868 0.0355  0.1550  -0.1236 211 TYR A O   
1607 C CB  . TYR A 233 ? 1.1591 1.5580 0.7404 0.0786  0.2019  -0.1689 211 TYR A CB  
1608 C CG  . TYR A 233 ? 1.4718 1.9108 1.1112 0.0824  0.2477  -0.1851 211 TYR A CG  
1609 C CD1 . TYR A 233 ? 1.6180 2.0892 1.2640 0.0694  0.3024  -0.1543 211 TYR A CD1 
1610 C CD2 . TYR A 233 ? 1.5822 2.0271 1.2757 0.0996  0.2368  -0.2324 211 TYR A CD2 
1611 C CE1 . TYR A 233 ? 1.6178 2.1397 1.3317 0.0753  0.3444  -0.1735 211 TYR A CE1 
1612 C CE2 . TYR A 233 ? 1.6595 2.1445 1.4114 0.1106  0.2759  -0.2506 211 TYR A CE2 
1613 C CZ  . TYR A 233 ? 1.6079 2.1380 1.3738 0.0994  0.3292  -0.2226 211 TYR A CZ  
1614 O OH  . TYR A 233 ? 1.5196 2.1019 1.3579 0.1126  0.3669  -0.2446 211 TYR A OH  
1615 N N   . LYS A 234 ? 1.1013 1.5332 0.8735 0.0250  0.2324  -0.0973 212 LYS A N   
1616 C CA  . LYS A 234 ? 0.9998 1.4492 0.8766 0.0125  0.2256  -0.0927 212 LYS A CA  
1617 C C   . LYS A 234 ? 0.8234 1.2416 0.7135 -0.0056 0.1941  -0.0622 212 LYS A C   
1618 O O   . LYS A 234 ? 0.8122 1.2199 0.7499 -0.0045 0.1632  -0.0694 212 LYS A O   
1619 C CB  . LYS A 234 ? 1.0407 1.5400 0.9707 0.0015  0.2726  -0.0843 212 LYS A CB  
1620 N N   . ASP A 235 ? 0.9335 1.3294 0.7720 -0.0193 0.2019  -0.0282 213 ASP A N   
1621 C CA  . ASP A 235 ? 0.8723 1.2375 0.7261 -0.0340 0.1762  -0.0019 213 ASP A CA  
1622 C C   . ASP A 235 ? 0.8515 1.1889 0.6838 -0.0204 0.1324  -0.0117 213 ASP A C   
1623 O O   . ASP A 235 ? 0.8281 1.1544 0.7016 -0.0258 0.1090  -0.0070 213 ASP A O   
1624 C CB  . ASP A 235 ? 1.1547 1.4927 0.9583 -0.0502 0.1971  0.0374  213 ASP A CB  
1625 C CG  . ASP A 235 ? 1.4345 1.8035 1.2462 -0.0662 0.2522  0.0485  213 ASP A CG  
1626 O OD1 . ASP A 235 ? 1.4847 1.8980 1.3854 -0.0785 0.2675  0.0372  213 ASP A OD1 
1627 O OD2 . ASP A 235 ? 1.5048 1.8566 1.2335 -0.0649 0.2811  0.0686  213 ASP A OD2 
1628 N N   . SER A 236 ? 0.9605 1.2915 0.7337 -0.0024 0.1205  -0.0289 214 SER A N   
1629 C CA  . SER A 236 ? 0.8735 1.1900 0.6465 0.0070  0.0788  -0.0417 214 SER A CA  
1630 C C   . SER A 236 ? 0.7573 1.0862 0.5947 0.0082  0.0658  -0.0724 214 SER A C   
1631 O O   . SER A 236 ? 0.8175 1.1383 0.6899 0.0048  0.0420  -0.0734 214 SER A O   
1632 C CB  . SER A 236 ? 0.9873 1.2944 0.6793 0.0257  0.0611  -0.0517 214 SER A CB  
1633 O OG  . SER A 236 ? 1.2005 1.5189 0.8413 0.0358  0.0852  -0.0681 214 SER A OG  
1634 N N   . THR A 237 ? 0.7859 1.1312 0.6395 0.0140  0.0843  -0.0959 215 THR A N   
1635 C CA  . THR A 237 ? 0.7286 1.0728 0.6431 0.0163  0.0747  -0.1195 215 THR A CA  
1636 C C   . THR A 237 ? 0.8916 1.2333 0.8642 0.0055  0.0729  -0.0973 215 THR A C   
1637 O O   . THR A 237 ? 0.9216 1.2475 0.9303 0.0044  0.0566  -0.1020 215 THR A O   
1638 C CB  . THR A 237 ? 0.7741 1.1342 0.6925 0.0304  0.0973  -0.1480 215 THR A CB  
1639 O OG1 . THR A 237 ? 1.0493 1.4026 0.9138 0.0436  0.0883  -0.1803 215 THR A OG1 
1640 C CG2 . THR A 237 ? 0.8199 1.1745 0.8058 0.0355  0.0937  -0.1616 215 THR A CG2 
1641 N N   . LEU A 238 ? 0.8490 1.2037 0.8286 -0.0035 0.0897  -0.0732 216 LEU A N   
1642 C CA  . LEU A 238 ? 0.7792 1.1312 0.8050 -0.0121 0.0813  -0.0562 216 LEU A CA  
1643 C C   . LEU A 238 ? 0.7932 1.1190 0.8070 -0.0170 0.0581  -0.0430 216 LEU A C   
1644 O O   . LEU A 238 ? 0.8634 1.1774 0.9043 -0.0160 0.0451  -0.0421 216 LEU A O   
1645 C CB  . LEU A 238 ? 0.8774 1.2490 0.9173 -0.0252 0.1007  -0.0379 216 LEU A CB  
1646 C CG  . LEU A 238 ? 0.9391 1.3239 1.0391 -0.0302 0.0928  -0.0332 216 LEU A CG  
1647 C CD1 . LEU A 238 ? 0.9884 1.4065 1.1379 -0.0155 0.1019  -0.0544 216 LEU A CD1 
1648 C CD2 . LEU A 238 ? 1.0179 1.4088 1.1270 -0.0520 0.1031  -0.0135 216 LEU A CD2 
1649 N N   . ILE A 239 ? 0.7791 1.0946 0.7493 -0.0194 0.0541  -0.0315 217 ILE A N   
1650 C CA  . ILE A 239 ? 0.7214 1.0194 0.6873 -0.0195 0.0340  -0.0221 217 ILE A CA  
1651 C C   . ILE A 239 ? 0.7084 1.0080 0.6924 -0.0147 0.0195  -0.0413 217 ILE A C   
1652 O O   . ILE A 239 ? 0.6648 0.9582 0.6707 -0.0168 0.0113  -0.0366 217 ILE A O   
1653 C CB  . ILE A 239 ? 0.7402 1.0237 0.6571 -0.0168 0.0295  -0.0060 217 ILE A CB  
1654 C CG1 . ILE A 239 ? 0.6650 0.9388 0.5689 -0.0286 0.0495  0.0161  217 ILE A CG1 
1655 C CG2 . ILE A 239 ? 0.6431 0.9131 0.5668 -0.0122 0.0100  0.0008  217 ILE A CG2 
1656 C CD1 . ILE A 239 ? 0.5497 0.7932 0.3949 -0.0256 0.0486  0.0391  217 ILE A CD1 
1657 N N   . MET A 240 ? 0.6402 0.9476 0.6160 -0.0095 0.0180  -0.0649 218 MET A N   
1658 C CA  . MET A 240 ? 0.6857 0.9919 0.6916 -0.0116 0.0041  -0.0853 218 MET A CA  
1659 C C   . MET A 240 ? 0.7202 1.0112 0.7695 -0.0176 0.0112  -0.0805 218 MET A C   
1660 O O   . MET A 240 ? 0.8072 1.0913 0.8847 -0.0254 0.0064  -0.0806 218 MET A O   
1661 C CB  . MET A 240 ? 0.5817 0.8924 0.5737 -0.0056 -0.0024 -0.1187 218 MET A CB  
1662 C CG  . MET A 240 ? 0.5737 0.8970 0.5214 0.0032  -0.0222 -0.1292 218 MET A CG  
1663 S SD  . MET A 240 ? 0.8194 1.1450 0.7217 0.0162  -0.0244 -0.1675 218 MET A SD  
1664 C CE  . MET A 240 ? 0.6089 0.9293 0.5750 0.0053  -0.0463 -0.2065 218 MET A CE  
1665 N N   . GLN A 241 ? 0.6942 0.9812 0.7502 -0.0132 0.0233  -0.0749 219 GLN A N   
1666 C CA  . GLN A 241 ? 0.6871 0.9539 0.7729 -0.0126 0.0248  -0.0663 219 GLN A CA  
1667 C C   . GLN A 241 ? 0.6136 0.8741 0.6959 -0.0167 0.0221  -0.0412 219 GLN A C   
1668 O O   . GLN A 241 ? 0.5442 0.7832 0.6369 -0.0186 0.0227  -0.0320 219 GLN A O   
1669 C CB  . GLN A 241 ? 0.6648 0.9366 0.7647 -0.0006 0.0322  -0.0704 219 GLN A CB  
1670 C CG  . GLN A 241 ? 0.7303 1.0065 0.8319 0.0085  0.0386  -0.0995 219 GLN A CG  
1671 C CD  . GLN A 241 ? 0.7239 1.0038 0.8550 0.0258  0.0452  -0.1071 219 GLN A CD  
1672 O OE1 . GLN A 241 ? 0.8067 1.0912 0.9579 0.0305  0.0413  -0.0897 219 GLN A OE1 
1673 N NE2 . GLN A 241 ? 0.7888 1.0679 0.9235 0.0389  0.0522  -0.1371 219 GLN A NE2 
1674 N N   . LEU A 242 ? 0.5204 0.7934 0.5834 -0.0179 0.0210  -0.0298 220 LEU A N   
1675 C CA  . LEU A 242 ? 0.6054 0.8685 0.6602 -0.0187 0.0167  -0.0130 220 LEU A CA  
1676 C C   . LEU A 242 ? 0.7213 0.9842 0.7753 -0.0212 0.0159  -0.0127 220 LEU A C   
1677 O O   . LEU A 242 ? 0.5750 0.8278 0.6251 -0.0197 0.0188  -0.0019 220 LEU A O   
1678 C CB  . LEU A 242 ? 0.5955 0.8628 0.6350 -0.0207 0.0140  -0.0043 220 LEU A CB  
1679 C CG  . LEU A 242 ? 0.6669 0.9487 0.7202 -0.0238 0.0192  -0.0059 220 LEU A CG  
1680 C CD1 . LEU A 242 ? 0.6424 0.9204 0.6840 -0.0331 0.0190  0.0044  220 LEU A CD1 
1681 C CD2 . LEU A 242 ? 0.3620 0.6443 0.4402 -0.0166 0.0121  -0.0067 220 LEU A CD2 
1682 N N   . LEU A 243 ? 0.6551 0.9332 0.7127 -0.0231 0.0116  -0.0263 221 LEU A N   
1683 C CA  . LEU A 243 ? 0.4274 0.7182 0.5052 -0.0259 0.0094  -0.0316 221 LEU A CA  
1684 C C   . LEU A 243 ? 0.5485 0.8278 0.6574 -0.0365 0.0216  -0.0311 221 LEU A C   
1685 O O   . LEU A 243 ? 0.6357 0.9153 0.7550 -0.0396 0.0333  -0.0204 221 LEU A O   
1686 C CB  . LEU A 243 ? 0.5032 0.8161 0.5831 -0.0239 -0.0055 -0.0513 221 LEU A CB  
1687 C CG  . LEU A 243 ? 0.6251 0.9435 0.6671 -0.0106 -0.0187 -0.0465 221 LEU A CG  
1688 C CD1 . LEU A 243 ? 0.7174 1.0553 0.7499 -0.0041 -0.0389 -0.0684 221 LEU A CD1 
1689 C CD2 . LEU A 243 ? 0.4588 0.7792 0.5034 -0.0020 -0.0212 -0.0348 221 LEU A CD2 
1690 N N   . ARG A 244 ? 0.5169 0.7803 0.6370 -0.0409 0.0225  -0.0409 222 ARG A N   
1691 C CA  . ARG A 244 ? 0.6173 0.8570 0.7659 -0.0528 0.0347  -0.0372 222 ARG A CA  
1692 C C   . ARG A 244 ? 0.7428 0.9488 0.8681 -0.0457 0.0454  -0.0101 222 ARG A C   
1693 O O   . ARG A 244 ? 0.8336 1.0114 0.9673 -0.0540 0.0603  0.0042  222 ARG A O   
1694 C CB  . ARG A 244 ? 0.5277 0.7524 0.6985 -0.0584 0.0287  -0.0619 222 ARG A CB  
1695 C CG  . ARG A 244 ? 0.6498 0.8349 0.8513 -0.0733 0.0418  -0.0559 222 ARG A CG  
1696 C CD  . ARG A 244 ? 0.5031 0.6607 0.7317 -0.0803 0.0353  -0.0832 222 ARG A CD  
1697 N NE  . ARG A 244 ? 0.8500 1.0015 1.0555 -0.0596 0.0249  -0.1004 222 ARG A NE  
1698 C CZ  . ARG A 244 ? 0.9899 1.0960 1.1961 -0.0480 0.0278  -0.0990 222 ARG A CZ  
1699 N NH1 . ARG A 244 ? 1.0247 1.1360 1.2180 -0.0265 0.0218  -0.1198 222 ARG A NH1 
1700 N NH2 . ARG A 244 ? 0.8703 0.9247 1.0885 -0.0558 0.0389  -0.0752 222 ARG A NH2 
1701 N N   . ASP A 245 ? 0.8005 1.0087 0.8948 -0.0311 0.0376  -0.0014 223 ASP A N   
1702 C CA  . ASP A 245 ? 0.8284 1.0102 0.8954 -0.0206 0.0393  0.0206  223 ASP A CA  
1703 C C   . ASP A 245 ? 0.8496 1.0354 0.8916 -0.0195 0.0476  0.0339  223 ASP A C   
1704 O O   . ASP A 245 ? 0.9830 1.1419 1.0006 -0.0162 0.0594  0.0531  223 ASP A O   
1705 C CB  . ASP A 245 ? 0.7605 0.9492 0.8180 -0.0067 0.0232  0.0177  223 ASP A CB  
1706 C CG  . ASP A 245 ? 0.8902 1.0700 0.9699 0.0005  0.0195  0.0076  223 ASP A CG  
1707 O OD1 . ASP A 245 ? 1.0870 1.2426 1.1821 -0.0048 0.0270  0.0036  223 ASP A OD1 
1708 O OD2 . ASP A 245 ? 0.9558 1.1551 1.0443 0.0105  0.0103  0.0005  223 ASP A OD2 
1709 N N   . ASN A 246 ? 0.7539 0.9683 0.7960 -0.0196 0.0432  0.0243  224 ASN A N   
1710 C CA  . ASN A 246 ? 0.6292 0.8497 0.6549 -0.0156 0.0539  0.0305  224 ASN A CA  
1711 C C   . ASN A 246 ? 0.8089 1.0374 0.8641 -0.0285 0.0783  0.0341  224 ASN A C   
1712 O O   . ASN A 246 ? 0.8987 1.1194 0.9347 -0.0263 0.0999  0.0482  224 ASN A O   
1713 C CB  . ASN A 246 ? 0.5021 0.7457 0.5286 -0.0099 0.0424  0.0183  224 ASN A CB  
1714 C CG  . ASN A 246 ? 0.6177 0.8467 0.6146 -0.0018 0.0252  0.0189  224 ASN A CG  
1715 O OD1 . ASN A 246 ? 0.7066 0.9169 0.6829 0.0027  0.0200  0.0255  224 ASN A OD1 
1716 N ND2 . ASN A 246 ? 0.6508 0.8862 0.6470 0.0000  0.0145  0.0123  224 ASN A ND2 
1717 N N   . LEU A 247 ? 0.8151 1.0579 0.9168 -0.0433 0.0768  0.0205  225 LEU A N   
1718 C CA  . LEU A 247 ? 0.7279 0.9806 0.8751 -0.0628 0.0992  0.0206  225 LEU A CA  
1719 C C   . LEU A 247 ? 0.8170 1.0218 0.9439 -0.0697 0.1230  0.0474  225 LEU A C   
1720 O O   . LEU A 247 ? 0.9133 1.1187 1.0397 -0.0770 0.1538  0.0639  225 LEU A O   
1721 C CB  . LEU A 247 ? 0.7567 1.0261 0.9550 -0.0775 0.0846  -0.0050 225 LEU A CB  
1722 C CG  . LEU A 247 ? 0.6571 0.9699 0.9254 -0.0967 0.0912  -0.0230 225 LEU A CG  
1723 C CD1 . LEU A 247 ? 0.5177 0.8788 0.7930 -0.0831 0.0921  -0.0264 225 LEU A CD1 
1724 C CD2 . LEU A 247 ? 0.7053 1.0317 1.0049 -0.1034 0.0627  -0.0559 225 LEU A CD2 
1725 N N   . THR A 248 ? 0.9414 1.1032 1.0497 -0.0650 0.1110  0.0534  226 THR A N   
1726 C CA  . THR A 248 ? 1.0236 1.1275 1.1051 -0.0664 0.1287  0.0828  226 THR A CA  
1727 C C   . THR A 248 ? 1.0051 1.0930 1.0180 -0.0484 0.1397  0.1092  226 THR A C   
1728 O O   . THR A 248 ? 1.1217 1.1713 1.1050 -0.0527 0.1676  0.1388  226 THR A O   
1729 C CB  . THR A 248 ? 0.9897 1.0529 1.0638 -0.0546 0.1072  0.0810  226 THR A CB  
1730 O OG1 . THR A 248 ? 0.9894 1.0709 1.1152 -0.0658 0.0946  0.0491  226 THR A OG1 
1731 C CG2 . THR A 248 ? 1.1426 1.1367 1.2000 -0.0584 0.1249  0.1108  226 THR A CG2 
1732 N N   . LEU A 249 ? 0.8839 0.9945 0.8653 -0.0282 0.1177  0.0990  227 LEU A N   
1733 C CA  . LEU A 249 ? 0.8722 0.9696 0.7848 -0.0086 0.1213  0.1144  227 LEU A CA  
1734 C C   . LEU A 249 ? 0.9507 1.0699 0.8615 -0.0162 0.1585  0.1199  227 LEU A C   
1735 O O   . LEU A 249 ? 0.9247 1.0161 0.7795 -0.0093 0.1841  0.1444  227 LEU A O   
1736 C CB  . LEU A 249 ? 0.6600 0.7789 0.5575 0.0082  0.0874  0.0942  227 LEU A CB  
1737 C CG  . LEU A 249 ? 0.7345 0.8496 0.5707 0.0281  0.0810  0.0936  227 LEU A CG  
1738 C CD1 . LEU A 249 ? 0.6893 0.7581 0.4557 0.0463  0.0767  0.1172  227 LEU A CD1 
1739 C CD2 . LEU A 249 ? 0.6421 0.7772 0.4877 0.0343  0.0484  0.0697  227 LEU A CD2 
1740 N N   . TRP A 250 ? 0.9770 1.1482 0.9480 -0.0276 0.1627  0.0970  228 TRP A N   
1741 C CA  . TRP A 250 ? 0.9053 1.1143 0.8898 -0.0286 0.1938  0.0934  228 TRP A CA  
1742 C C   . TRP A 250 ? 1.0620 1.2711 1.0784 -0.0535 0.2408  0.1129  228 TRP A C   
1743 O O   . TRP A 250 ? 1.1183 1.3541 1.1335 -0.0525 0.2783  0.1175  228 TRP A O   
1744 C CB  . TRP A 250 ? 0.7477 1.0122 0.7931 -0.0287 0.1759  0.0624  228 TRP A CB  
1745 C CG  . TRP A 250 ? 0.8223 1.0840 0.8327 -0.0056 0.1408  0.0474  228 TRP A CG  
1746 C CD1 . TRP A 250 ? 0.9371 1.1652 0.8781 0.0136  0.1280  0.0524  228 TRP A CD1 
1747 C CD2 . TRP A 250 ? 0.7725 1.0612 0.8157 -0.0013 0.1135  0.0259  228 TRP A CD2 
1748 N NE1 . TRP A 250 ? 0.8728 1.1051 0.8118 0.0244  0.0977  0.0346  228 TRP A NE1 
1749 C CE2 . TRP A 250 ? 0.8185 1.0838 0.8137 0.0165  0.0906  0.0220  228 TRP A CE2 
1750 C CE3 . TRP A 250 ? 0.7226 1.0502 0.8273 -0.0101 0.1041  0.0097  228 TRP A CE3 
1751 C CZ2 . TRP A 250 ? 0.8675 1.1393 0.8719 0.0236  0.0652  0.0087  228 TRP A CZ2 
1752 C CZ3 . TRP A 250 ? 0.7754 1.1116 0.8788 0.0028  0.0750  -0.0038 228 TRP A CZ3 
1753 C CH2 . TRP A 250 ? 0.8631 1.1678 0.9153 0.0183  0.0588  -0.0011 228 TRP A CH2 
1754 N N   . THR A 251 ? 1.0746 1.2526 1.1218 -0.0761 0.2425  0.1235  229 THR A N   
1755 C CA  . THR A 251 ? 1.0686 1.2384 1.1586 -0.1079 0.2870  0.1424  229 THR A CA  
1756 C C   . THR A 251 ? 1.2960 1.3904 1.3061 -0.1052 0.3155  0.1881  229 THR A C   
1757 O O   . THR A 251 ? 1.4390 1.4982 1.4775 -0.1344 0.3468  0.2107  229 THR A O   
1758 C CB  . THR A 251 ? 1.0265 1.1976 1.2010 -0.1369 0.2718  0.1240  229 THR A CB  
1759 O OG1 . THR A 251 ? 1.2468 1.3486 1.3822 -0.1292 0.2477  0.1353  229 THR A OG1 
1760 C CG2 . THR A 251 ? 0.7219 0.9598 0.9561 -0.1333 0.2358  0.0802  229 THR A CG2 
1761 N N   . SER A 252 ? 1.4704 1.5324 1.3802 -0.0707 0.3003  0.2018  230 SER A N   
1762 C CA  . SER A 252 ? 1.6078 1.6007 1.4226 -0.0605 0.3276  0.2473  230 SER A CA  
1763 C C   . SER A 252 ? 1.6899 1.6972 1.4190 -0.0330 0.3458  0.2518  230 SER A C   
1764 O O   . SER A 252 ? 1.5692 1.6420 1.3332 -0.0318 0.3585  0.2250  230 SER A O   
1765 C CB  . SER A 252 ? 1.3683 1.2921 1.1285 -0.0387 0.2852  0.2618  230 SER A CB  
1766 O OG  . SER A 252 ? 1.1079 1.0612 0.8685 -0.0149 0.2316  0.2287  230 SER A OG  
1767 N N   . MET B 23  ? 1.6904 1.6685 1.4192 0.2129  -0.0289 -0.3962 1   MET B N   
1768 C CA  . MET B 23  ? 1.5822 1.6251 1.3154 0.1988  -0.0182 -0.3707 1   MET B CA  
1769 C C   . MET B 23  ? 1.6837 1.7507 1.3951 0.1900  -0.0253 -0.3845 1   MET B C   
1770 O O   . MET B 23  ? 1.7136 1.7514 1.4057 0.1945  -0.0392 -0.4168 1   MET B O   
1771 C CB  . MET B 23  ? 1.3864 1.4231 1.1503 0.1689  -0.0169 -0.3379 1   MET B CB  
1772 N N   . ASP B 24  ? 1.6217 1.7414 1.3356 0.1779  -0.0167 -0.3599 2   ASP B N   
1773 C CA  . ASP B 24  ? 1.6384 1.7891 1.3318 0.1711  -0.0224 -0.3645 2   ASP B CA  
1774 C C   . ASP B 24  ? 1.5307 1.7074 1.2441 0.1463  -0.0177 -0.3291 2   ASP B C   
1775 O O   . ASP B 24  ? 1.5460 1.7378 1.2790 0.1416  -0.0045 -0.3029 2   ASP B O   
1776 C CB  . ASP B 24  ? 1.6963 1.8962 1.3558 0.1983  -0.0132 -0.3775 2   ASP B CB  
1777 C CG  . ASP B 24  ? 1.7190 1.9791 1.3832 0.1996  0.0070  -0.3444 2   ASP B CG  
1778 O OD1 . ASP B 24  ? 1.6866 1.9745 1.3515 0.1822  0.0082  -0.3211 2   ASP B OD1 
1779 O OD2 . ASP B 24  ? 1.7715 2.0519 1.4400 0.2182  0.0212  -0.3415 2   ASP B OD2 
1780 N N   . LYS B 25  ? 1.4036 1.5853 1.1120 0.1313  -0.0298 -0.3300 3   LYS B N   
1781 C CA  . LYS B 25  ? 1.2094 1.4016 0.9407 0.1082  -0.0291 -0.3005 3   LYS B CA  
1782 C C   . LYS B 25  ? 1.2981 1.5327 1.0311 0.1096  -0.0114 -0.2695 3   LYS B C   
1783 O O   . LYS B 25  ? 1.3745 1.6052 1.1334 0.0941  -0.0050 -0.2454 3   LYS B O   
1784 C CB  . LYS B 25  ? 1.1124 1.3124 0.8357 0.0981  -0.0457 -0.3078 3   LYS B CB  
1785 N N   . ASN B 26  ? 1.3665 1.6422 1.0723 0.1268  -0.0029 -0.2697 4   ASN B N   
1786 C CA  . ASN B 26  ? 1.2591 1.5749 0.9682 0.1229  0.0132  -0.2369 4   ASN B CA  
1787 C C   . ASN B 26  ? 1.0366 1.3519 0.7706 0.1202  0.0274  -0.2230 4   ASN B C   
1788 O O   . ASN B 26  ? 0.9558 1.2830 0.7076 0.1047  0.0361  -0.1950 4   ASN B O   
1789 C CB  . ASN B 26  ? 1.4355 1.8009 1.1094 0.1411  0.0212  -0.2383 4   ASN B CB  
1790 C CG  . ASN B 26  ? 1.5738 1.9628 1.2301 0.1348  0.0153  -0.2222 4   ASN B CG  
1791 O OD1 . ASN B 26  ? 1.6939 2.1048 1.3564 0.1247  0.0253  -0.1885 4   ASN B OD1 
1792 N ND2 . ASN B 26  ? 1.5244 1.9082 1.1585 0.1406  -0.0023 -0.2459 4   ASN B ND2 
1793 N N   . GLU B 27  ? 1.0679 1.3657 0.8045 0.1343  0.0279  -0.2425 5   GLU B N   
1794 C CA  . GLU B 27  ? 1.0855 1.3874 0.8454 0.1344  0.0391  -0.2304 5   GLU B CA  
1795 C C   . GLU B 27  ? 1.1652 1.4266 0.9535 0.1143  0.0330  -0.2218 5   GLU B C   
1796 O O   . GLU B 27  ? 1.1800 1.4526 0.9891 0.1035  0.0414  -0.2020 5   GLU B O   
1797 C CB  . GLU B 27  ? 1.0450 1.3478 0.7958 0.1626  0.0421  -0.2529 5   GLU B CB  
1798 N N   . LEU B 28  ? 1.2511 1.4687 1.0407 0.1079  0.0184  -0.2368 6   LEU B N   
1799 C CA  . LEU B 28  ? 1.1387 1.3229 0.9538 0.0887  0.0141  -0.2277 6   LEU B CA  
1800 C C   . LEU B 28  ? 1.0403 1.2379 0.8705 0.0676  0.0179  -0.2045 6   LEU B C   
1801 O O   . LEU B 28  ? 0.9841 1.1746 0.8348 0.0548  0.0223  -0.1910 6   LEU B O   
1802 C CB  . LEU B 28  ? 1.0873 1.2270 0.9018 0.0836  -0.0015 -0.2475 6   LEU B CB  
1803 C CG  . LEU B 28  ? 1.0034 1.1102 0.8063 0.1013  -0.0081 -0.2724 6   LEU B CG  
1804 C CD1 . LEU B 28  ? 0.9770 1.0411 0.7810 0.0889  -0.0249 -0.2907 6   LEU B CD1 
1805 C CD2 . LEU B 28  ? 0.7612 0.8530 0.5779 0.1084  -0.0016 -0.2636 6   LEU B CD2 
1806 N N   . VAL B 29  ? 1.0315 1.2474 0.8505 0.0650  0.0157  -0.1999 7   VAL B N   
1807 C CA  . VAL B 29  ? 1.0644 1.2894 0.8973 0.0488  0.0198  -0.1769 7   VAL B CA  
1808 C C   . VAL B 29  ? 1.1387 1.3911 0.9767 0.0465  0.0349  -0.1573 7   VAL B C   
1809 O O   . VAL B 29  ? 1.2337 1.4831 1.0889 0.0309  0.0395  -0.1404 7   VAL B O   
1810 C CB  . VAL B 29  ? 0.9179 1.1544 0.7378 0.0487  0.0123  -0.1736 7   VAL B CB  
1811 C CG1 . VAL B 29  ? 0.7663 0.9850 0.5795 0.0516  -0.0038 -0.1971 7   VAL B CG1 
1812 C CG2 . VAL B 29  ? 1.1907 1.4647 0.9863 0.0605  0.0198  -0.1652 7   VAL B CG2 
1813 N N   . GLN B 30  ? 1.0931 1.3744 0.9174 0.0614  0.0429  -0.1602 8   GLN B N   
1814 C CA  . GLN B 30  ? 1.0561 1.3687 0.8906 0.0565  0.0570  -0.1421 8   GLN B CA  
1815 C C   . GLN B 30  ? 0.9364 1.2369 0.7933 0.0506  0.0585  -0.1426 8   GLN B C   
1816 O O   . GLN B 30  ? 0.8873 1.1962 0.7618 0.0341  0.0645  -0.1268 8   GLN B O   
1817 C CB  . GLN B 30  ? 1.1418 1.4984 0.9579 0.0751  0.0666  -0.1447 8   GLN B CB  
1818 C CG  . GLN B 30  ? 1.2082 1.5891 1.0000 0.0783  0.0685  -0.1366 8   GLN B CG  
1819 C CD  . GLN B 30  ? 1.2764 1.6578 1.0778 0.0566  0.0720  -0.1077 8   GLN B CD  
1820 O OE1 . GLN B 30  ? 1.3343 1.7203 1.1576 0.0402  0.0802  -0.0908 8   GLN B OE1 
1821 N NE2 . GLN B 30  ? 1.2390 1.6141 1.0241 0.0567  0.0645  -0.1024 8   GLN B NE2 
1822 N N   . LYS B 31  ? 0.9017 1.1807 0.7573 0.0635  0.0520  -0.1605 9   LYS B N   
1823 C CA  . LYS B 31  ? 0.8291 1.0978 0.7029 0.0595  0.0522  -0.1582 9   LYS B CA  
1824 C C   . LYS B 31  ? 0.8724 1.1139 0.7613 0.0370  0.0481  -0.1506 9   LYS B C   
1825 O O   . LYS B 31  ? 0.8822 1.1336 0.7863 0.0240  0.0528  -0.1392 9   LYS B O   
1826 C CB  . LYS B 31  ? 0.7649 1.0100 0.6323 0.0795  0.0457  -0.1760 9   LYS B CB  
1827 N N   . ALA B 32  ? 0.8640 1.0755 0.7493 0.0323  0.0393  -0.1580 10  ALA B N   
1828 C CA  . ALA B 32  ? 0.8046 0.9956 0.7048 0.0137  0.0366  -0.1523 10  ALA B CA  
1829 C C   . ALA B 32  ? 0.7909 0.9975 0.6994 0.0003  0.0437  -0.1367 10  ALA B C   
1830 O O   . ALA B 32  ? 0.7663 0.9648 0.6889 -0.0135 0.0458  -0.1314 10  ALA B O   
1831 C CB  . ALA B 32  ? 0.7557 0.9238 0.6527 0.0120  0.0262  -0.1624 10  ALA B CB  
1832 N N   . LYS B 33  ? 0.7851 1.0117 0.6835 0.0039  0.0472  -0.1294 11  LYS B N   
1833 C CA  . LYS B 33  ? 0.7637 1.0007 0.6697 -0.0095 0.0543  -0.1119 11  LYS B CA  
1834 C C   . LYS B 33  ? 0.7211 0.9771 0.6393 -0.0187 0.0625  -0.1050 11  LYS B C   
1835 O O   . LYS B 33  ? 0.7285 0.9823 0.6583 -0.0353 0.0667  -0.0943 11  LYS B O   
1836 C CB  . LYS B 33  ? 0.6908 0.9486 0.5809 -0.0034 0.0573  -0.1015 11  LYS B CB  
1837 C CG  . LYS B 33  ? 0.7295 0.9731 0.6198 -0.0099 0.0544  -0.0892 11  LYS B CG  
1838 C CD  . LYS B 33  ? 0.8297 1.0959 0.6975 0.0007  0.0547  -0.0802 11  LYS B CD  
1839 C CE  . LYS B 33  ? 0.9607 1.2241 0.8302 -0.0092 0.0589  -0.0547 11  LYS B CE  
1840 N NZ  . LYS B 33  ? 1.0714 1.3616 0.9155 0.0010  0.0601  -0.0418 11  LYS B NZ  
1841 N N   . LEU B 34  ? 0.7329 1.0086 0.6491 -0.0073 0.0642  -0.1116 12  LEU B N   
1842 C CA  . LEU B 34  ? 0.7560 1.0586 0.6857 -0.0140 0.0700  -0.1060 12  LEU B CA  
1843 C C   . LEU B 34  ? 0.7724 1.0563 0.7134 -0.0224 0.0652  -0.1111 12  LEU B C   
1844 O O   . LEU B 34  ? 0.6986 0.9925 0.6525 -0.0390 0.0676  -0.1056 12  LEU B O   
1845 C CB  . LEU B 34  ? 0.7628 1.0983 0.6872 0.0064  0.0731  -0.1108 12  LEU B CB  
1846 C CG  . LEU B 34  ? 0.7257 1.1129 0.6525 0.0080  0.0839  -0.1003 12  LEU B CG  
1847 C CD1 . LEU B 34  ? 0.6281 1.0457 0.5581 0.0294  0.0852  -0.1081 12  LEU B CD1 
1848 C CD2 . LEU B 34  ? 0.7370 1.1393 0.6824 -0.0196 0.0891  -0.0847 12  LEU B CD2 
1849 N N   . ALA B 35  ? 0.7851 1.0437 0.7202 -0.0117 0.0582  -0.1216 13  ALA B N   
1850 C CA  . ALA B 35  ? 0.6440 0.8830 0.5859 -0.0199 0.0542  -0.1242 13  ALA B CA  
1851 C C   . ALA B 35  ? 0.7172 0.9424 0.6672 -0.0392 0.0556  -0.1217 13  ALA B C   
1852 O O   . ALA B 35  ? 0.7817 1.0064 0.7384 -0.0501 0.0557  -0.1223 13  ALA B O   
1853 C CB  . ALA B 35  ? 0.5895 0.7982 0.5240 -0.0093 0.0471  -0.1330 13  ALA B CB  
1854 N N   . GLU B 36  ? 0.6889 0.9027 0.6370 -0.0418 0.0562  -0.1197 14  GLU B N   
1855 C CA  . GLU B 36  ? 0.8187 1.0151 0.7755 -0.0558 0.0573  -0.1186 14  GLU B CA  
1856 C C   . GLU B 36  ? 0.7996 1.0082 0.7650 -0.0714 0.0625  -0.1127 14  GLU B C   
1857 O O   . GLU B 36  ? 0.7639 0.9635 0.7363 -0.0831 0.0629  -0.1179 14  GLU B O   
1858 C CB  . GLU B 36  ? 0.9037 1.0858 0.8575 -0.0520 0.0553  -0.1157 14  GLU B CB  
1859 C CG  . GLU B 36  ? 0.9607 1.1251 0.9246 -0.0626 0.0573  -0.1132 14  GLU B CG  
1860 C CD  . GLU B 36  ? 1.1889 1.3427 1.1507 -0.0560 0.0544  -0.1069 14  GLU B CD  
1861 O OE1 . GLU B 36  ? 1.3366 1.4966 1.2929 -0.0563 0.0570  -0.0938 14  GLU B OE1 
1862 O OE2 . GLU B 36  ? 1.3168 1.4599 1.2828 -0.0506 0.0495  -0.1135 14  GLU B OE2 
1863 N N   . GLN B 37  ? 0.7279 0.9598 0.6929 -0.0727 0.0668  -0.1030 15  GLN B N   
1864 C CA  . GLN B 37  ? 0.7848 1.0303 0.7611 -0.0918 0.0711  -0.0969 15  GLN B CA  
1865 C C   . GLN B 37  ? 0.7774 1.0446 0.7603 -0.0972 0.0691  -0.1039 15  GLN B C   
1866 O O   . GLN B 37  ? 0.6741 0.9437 0.6665 -0.1160 0.0693  -0.1063 15  GLN B O   
1867 C CB  . GLN B 37  ? 0.7807 1.0548 0.7570 -0.0935 0.0773  -0.0825 15  GLN B CB  
1868 C CG  . GLN B 37  ? 0.9587 1.2213 0.9239 -0.0856 0.0789  -0.0726 15  GLN B CG  
1869 C CD  . GLN B 37  ? 1.1871 1.4845 1.1512 -0.0898 0.0872  -0.0558 15  GLN B CD  
1870 O OE1 . GLN B 37  ? 1.2342 1.5415 1.2116 -0.1110 0.0921  -0.0453 15  GLN B OE1 
1871 N NE2 . GLN B 37  ? 1.3000 1.6192 1.2486 -0.0707 0.0891  -0.0542 15  GLN B NE2 
1872 N N   . ALA B 38  ? 0.6688 0.9506 0.6459 -0.0805 0.0662  -0.1075 16  ALA B N   
1873 C CA  . ALA B 38  ? 0.6075 0.9098 0.5882 -0.0806 0.0626  -0.1115 16  ALA B CA  
1874 C C   . ALA B 38  ? 0.7205 0.9972 0.6969 -0.0844 0.0586  -0.1200 16  ALA B C   
1875 O O   . ALA B 38  ? 0.6668 0.9595 0.6425 -0.0845 0.0548  -0.1219 16  ALA B O   
1876 C CB  . ALA B 38  ? 0.5078 0.8295 0.4831 -0.0574 0.0610  -0.1102 16  ALA B CB  
1877 N N   . GLU B 39  ? 0.7865 1.0291 0.7602 -0.0870 0.0595  -0.1240 17  GLU B N   
1878 C CA  . GLU B 39  ? 0.6634 0.8845 0.6338 -0.0891 0.0581  -0.1318 17  GLU B CA  
1879 C C   . GLU B 39  ? 0.6817 0.9072 0.6446 -0.0783 0.0544  -0.1306 17  GLU B C   
1880 O O   . GLU B 39  ? 0.7160 0.9439 0.6752 -0.0833 0.0535  -0.1333 17  GLU B O   
1881 C CB  . GLU B 39  ? 0.5175 0.7384 0.4917 -0.1062 0.0594  -0.1400 17  GLU B CB  
1882 C CG  . GLU B 39  ? 0.7122 0.9247 0.6950 -0.1194 0.0622  -0.1399 17  GLU B CG  
1883 C CD  . GLU B 39  ? 0.9976 1.1992 0.9829 -0.1354 0.0626  -0.1532 17  GLU B CD  
1884 O OE1 . GLU B 39  ? 1.1200 1.3074 1.1131 -0.1484 0.0642  -0.1538 17  GLU B OE1 
1885 O OE2 . GLU B 39  ? 1.0493 1.2560 1.0275 -0.1354 0.0614  -0.1630 17  GLU B OE2 
1886 N N   . ARG B 40  ? 0.6152 0.8378 0.5740 -0.0627 0.0522  -0.1266 18  ARG B N   
1887 C CA  . ARG B 40  ? 0.6252 0.8385 0.5770 -0.0518 0.0481  -0.1245 18  ARG B CA  
1888 C C   . ARG B 40  ? 0.7041 0.8874 0.6541 -0.0477 0.0467  -0.1280 18  ARG B C   
1889 O O   . ARG B 40  ? 0.7315 0.9068 0.6774 -0.0354 0.0438  -0.1297 18  ARG B O   
1890 C CB  . ARG B 40  ? 0.6135 0.8454 0.5628 -0.0353 0.0452  -0.1196 18  ARG B CB  
1891 C CG  . ARG B 40  ? 0.7498 1.0229 0.7065 -0.0402 0.0466  -0.1166 18  ARG B CG  
1892 C CD  . ARG B 40  ? 0.7784 1.0787 0.7353 -0.0234 0.0424  -0.1104 18  ARG B CD  
1893 N NE  . ARG B 40  ? 0.7116 0.9903 0.6607 -0.0001 0.0391  -0.1092 18  ARG B NE  
1894 C CZ  . ARG B 40  ? 0.7237 1.0078 0.6699 0.0157  0.0336  -0.1021 18  ARG B CZ  
1895 N NH1 . ARG B 40  ? 0.7685 1.0840 0.7179 0.0101  0.0305  -0.0952 18  ARG B NH1 
1896 N NH2 . ARG B 40  ? 0.7064 0.9620 0.6455 0.0369  0.0301  -0.1019 18  ARG B NH2 
1897 N N   . TYR B 41  ? 0.7789 0.9492 0.7322 -0.0582 0.0484  -0.1307 19  TYR B N   
1898 C CA  . TYR B 41  ? 0.8193 0.9698 0.7761 -0.0577 0.0467  -0.1347 19  TYR B CA  
1899 C C   . TYR B 41  ? 0.8868 1.0185 0.8401 -0.0525 0.0414  -0.1335 19  TYR B C   
1900 O O   . TYR B 41  ? 0.8749 0.9929 0.8308 -0.0510 0.0373  -0.1386 19  TYR B O   
1901 C CB  . TYR B 41  ? 0.6694 0.8187 0.6348 -0.0688 0.0511  -0.1384 19  TYR B CB  
1902 C CG  . TYR B 41  ? 0.6372 0.7929 0.6069 -0.0733 0.0551  -0.1414 19  TYR B CG  
1903 C CD1 . TYR B 41  ? 0.6741 0.8242 0.6472 -0.0693 0.0540  -0.1408 19  TYR B CD1 
1904 C CD2 . TYR B 41  ? 0.6079 0.7738 0.5769 -0.0822 0.0590  -0.1441 19  TYR B CD2 
1905 C CE1 . TYR B 41  ? 0.7729 0.9220 0.7501 -0.0745 0.0574  -0.1403 19  TYR B CE1 
1906 C CE2 . TYR B 41  ? 0.6168 0.7812 0.5905 -0.0886 0.0617  -0.1478 19  TYR B CE2 
1907 C CZ  . TYR B 41  ? 0.8084 0.9617 0.7870 -0.0849 0.0613  -0.1445 19  TYR B CZ  
1908 O OH  . TYR B 41  ? 0.9766 1.1215 0.9601 -0.0922 0.0639  -0.1450 19  TYR B OH  
1909 N N   . ASP B 42  ? 0.9652 1.0945 0.9125 -0.0496 0.0402  -0.1266 20  ASP B N   
1910 C CA  . ASP B 42  ? 0.9500 1.0523 0.8939 -0.0446 0.0344  -0.1245 20  ASP B CA  
1911 C C   . ASP B 42  ? 1.0047 1.0974 0.9426 -0.0280 0.0290  -0.1318 20  ASP B C   
1912 O O   . ASP B 42  ? 0.9791 1.0467 0.9159 -0.0259 0.0230  -0.1388 20  ASP B O   
1913 C CB  . ASP B 42  ? 1.0146 1.1127 0.9521 -0.0440 0.0341  -0.1115 20  ASP B CB  
1914 C CG  . ASP B 42  ? 1.2909 1.3971 1.2309 -0.0607 0.0399  -0.1047 20  ASP B CG  
1915 O OD1 . ASP B 42  ? 1.4024 1.5210 1.3506 -0.0708 0.0450  -0.1121 20  ASP B OD1 
1916 O OD2 . ASP B 42  ? 1.4346 1.5360 1.3677 -0.0625 0.0398  -0.0911 20  ASP B OD2 
1917 N N   . ASP B 43  ? 1.0683 1.1839 1.0023 -0.0165 0.0310  -0.1314 21  ASP B N   
1918 C CA  . ASP B 43  ? 0.9221 1.0389 0.8494 0.0010  0.0286  -0.1395 21  ASP B CA  
1919 C C   . ASP B 43  ? 0.7848 0.8998 0.7115 -0.0026 0.0276  -0.1489 21  ASP B C   
1920 O O   . ASP B 43  ? 0.7759 0.8737 0.6952 0.0063  0.0218  -0.1596 21  ASP B O   
1921 C CB  . ASP B 43  ? 0.8735 1.0277 0.8013 0.0101  0.0334  -0.1353 21  ASP B CB  
1922 C CG  . ASP B 43  ? 0.9509 1.1103 0.8769 0.0250  0.0311  -0.1288 21  ASP B CG  
1923 O OD1 . ASP B 43  ? 1.0827 1.2086 1.0035 0.0334  0.0255  -0.1284 21  ASP B OD1 
1924 O OD2 . ASP B 43  ? 0.9036 1.1011 0.8346 0.0284  0.0344  -0.1234 21  ASP B OD2 
1925 N N   . MET B 44  ? 0.6050 0.7365 0.5388 -0.0151 0.0324  -0.1455 22  MET B N   
1926 C CA  . MET B 44  ? 0.6759 0.8090 0.6089 -0.0167 0.0309  -0.1504 22  MET B CA  
1927 C C   . MET B 44  ? 0.8368 0.9467 0.7725 -0.0213 0.0232  -0.1583 22  MET B C   
1928 O O   . MET B 44  ? 0.8306 0.9382 0.7600 -0.0158 0.0171  -0.1669 22  MET B O   
1929 C CB  . MET B 44  ? 0.5925 0.7398 0.5344 -0.0287 0.0371  -0.1434 22  MET B CB  
1930 C CG  . MET B 44  ? 0.6051 0.7487 0.5506 -0.0318 0.0345  -0.1449 22  MET B CG  
1931 S SD  . MET B 44  ? 0.7431 0.8926 0.6999 -0.0431 0.0417  -0.1370 22  MET B SD  
1932 C CE  . MET B 44  ? 0.9708 1.1204 0.9256 -0.0371 0.0373  -0.1341 22  MET B CE  
1933 N N   . ALA B 45  ? 0.8763 0.9725 0.8211 -0.0322 0.0229  -0.1553 23  ALA B N   
1934 C CA  . ALA B 45  ? 0.7545 0.8329 0.7062 -0.0405 0.0159  -0.1613 23  ALA B CA  
1935 C C   . ALA B 45  ? 0.7239 0.7757 0.6659 -0.0324 0.0072  -0.1707 23  ALA B C   
1936 O O   . ALA B 45  ? 0.8021 0.8438 0.7445 -0.0350 -0.0016 -0.1822 23  ALA B O   
1937 C CB  . ALA B 45  ? 0.9307 1.0067 0.8950 -0.0559 0.0204  -0.1531 23  ALA B CB  
1938 N N   . ALA B 46  ? 0.7733 0.8128 0.7067 -0.0218 0.0084  -0.1672 24  ALA B N   
1939 C CA  . ALA B 46  ? 0.8242 0.8307 0.7482 -0.0116 -0.0003 -0.1782 24  ALA B CA  
1940 C C   . ALA B 46  ? 0.8163 0.8298 0.7269 0.0031  -0.0050 -0.1955 24  ALA B C   
1941 O O   . ALA B 46  ? 0.8330 0.8199 0.7371 0.0057  -0.0149 -0.2117 24  ALA B O   
1942 C CB  . ALA B 46  ? 0.7540 0.7468 0.6714 0.0024  0.0016  -0.1702 24  ALA B CB  
1943 N N   . CYS B 47  ? 0.7515 0.8007 0.6569 0.0116  0.0020  -0.1923 25  CYS B N   
1944 C CA  . CYS B 47  ? 0.9510 1.0153 0.8413 0.0243  -0.0006 -0.2052 25  CYS B CA  
1945 C C   . CYS B 47  ? 0.8840 0.9472 0.7764 0.0128  -0.0095 -0.2135 25  CYS B C   
1946 O O   . CYS B 47  ? 0.8886 0.9423 0.7681 0.0195  -0.0191 -0.2318 25  CYS B O   
1947 C CB  . CYS B 47  ? 1.0297 1.1346 0.9164 0.0310  0.0100  -0.1945 25  CYS B CB  
1948 S SG  . CYS B 47  ? 1.0762 1.1990 0.9619 0.0471  0.0193  -0.1870 25  CYS B SG  
1949 N N   . MET B 48  ? 0.7812 0.8578 0.6895 -0.0029 -0.0068 -0.2017 26  MET B N   
1950 C CA  . MET B 48  ? 0.7808 0.8653 0.6945 -0.0113 -0.0153 -0.2072 26  MET B CA  
1951 C C   . MET B 48  ? 0.9119 0.9712 0.8351 -0.0239 -0.0269 -0.2194 26  MET B C   
1952 O O   . MET B 48  ? 0.9889 1.0565 0.9144 -0.0290 -0.0378 -0.2295 26  MET B O   
1953 C CB  . MET B 48  ? 0.7486 0.8533 0.6786 -0.0208 -0.0086 -0.1917 26  MET B CB  
1954 C CG  . MET B 48  ? 0.8983 1.0247 0.8202 -0.0125 0.0011  -0.1794 26  MET B CG  
1955 S SD  . MET B 48  ? 1.0765 1.2226 0.9719 0.0049  -0.0013 -0.1841 26  MET B SD  
1956 C CE  . MET B 48  ? 1.1296 1.2827 1.0252 0.0026  -0.0162 -0.1922 26  MET B CE  
1957 N N   . LYS B 49  ? 0.8956 0.9255 0.8248 -0.0301 -0.0258 -0.2176 27  LYS B N   
1958 C CA  . LYS B 49  ? 0.9268 0.9264 0.8629 -0.0431 -0.0374 -0.2295 27  LYS B CA  
1959 C C   . LYS B 49  ? 1.0571 1.0333 0.9717 -0.0291 -0.0479 -0.2525 27  LYS B C   
1960 O O   . LYS B 49  ? 1.1284 1.0884 1.0449 -0.0392 -0.0617 -0.2698 27  LYS B O   
1961 C CB  . LYS B 49  ? 0.9187 0.8910 0.8666 -0.0550 -0.0325 -0.2163 27  LYS B CB  
1962 C CG  . LYS B 49  ? 0.8444 0.7785 0.8008 -0.0720 -0.0437 -0.2251 27  LYS B CG  
1963 C CD  . LYS B 49  ? 0.8713 0.7792 0.8371 -0.0840 -0.0375 -0.2063 27  LYS B CD  
1964 C CE  . LYS B 49  ? 0.9783 0.8424 0.9530 -0.1034 -0.0489 -0.2132 27  LYS B CE  
1965 N NZ  . LYS B 49  ? 1.0461 0.8701 1.0214 -0.1088 -0.0446 -0.1943 27  LYS B NZ  
1966 N N   . SER B 50  ? 1.1396 1.1148 1.0349 -0.0060 -0.0419 -0.2544 28  SER B N   
1967 C CA  . SER B 50  ? 1.2104 1.1663 1.0830 0.0121  -0.0500 -0.2790 28  SER B CA  
1968 C C   . SER B 50  ? 1.0846 1.0716 0.9416 0.0177  -0.0570 -0.2943 28  SER B C   
1969 O O   . SER B 50  ? 1.0815 1.0512 0.9245 0.0209  -0.0701 -0.3203 28  SER B O   
1970 C CB  . SER B 50  ? 1.2302 1.1853 1.0896 0.0374  -0.0398 -0.2755 28  SER B CB  
1971 O OG  . SER B 50  ? 1.2630 1.1764 1.1301 0.0370  -0.0398 -0.2691 28  SER B OG  
1972 N N   . VAL B 51  ? 0.9493 0.9807 0.8068 0.0192  -0.0491 -0.2787 29  VAL B N   
1973 C CA  . VAL B 51  ? 1.0556 1.1191 0.8991 0.0229  -0.0564 -0.2870 29  VAL B CA  
1974 C C   . VAL B 51  ? 1.2485 1.3077 1.1062 0.0031  -0.0725 -0.2972 29  VAL B C   
1975 O O   . VAL B 51  ? 1.3482 1.4148 1.1903 0.0058  -0.0866 -0.3183 29  VAL B O   
1976 C CB  . VAL B 51  ? 0.9379 1.0423 0.7826 0.0262  -0.0444 -0.2627 29  VAL B CB  
1977 C CG1 . VAL B 51  ? 0.7597 0.8950 0.5961 0.0260  -0.0534 -0.2637 29  VAL B CG1 
1978 C CG2 . VAL B 51  ? 0.9837 1.1033 0.8109 0.0455  -0.0312 -0.2576 29  VAL B CG2 
1979 N N   . THR B 52  ? 1.1913 1.2441 1.0789 -0.0173 -0.0708 -0.2830 30  THR B N   
1980 C CA  . THR B 52  ? 1.1402 1.1980 1.0478 -0.0379 -0.0847 -0.2901 30  THR B CA  
1981 C C   . THR B 52  ? 1.2820 1.3011 1.1860 -0.0472 -0.0996 -0.3160 30  THR B C   
1982 O O   . THR B 52  ? 1.3784 1.4074 1.2817 -0.0555 -0.1167 -0.3352 30  THR B O   
1983 C CB  . THR B 52  ? 0.9302 0.9942 0.8709 -0.0561 -0.0763 -0.2687 30  THR B CB  
1984 O OG1 . THR B 52  ? 0.7721 0.8701 0.7162 -0.0479 -0.0659 -0.2497 30  THR B OG1 
1985 C CG2 . THR B 52  ? 0.9307 1.0031 0.8977 -0.0794 -0.0895 -0.2758 30  THR B CG2 
1986 N N   . GLU B 53  ? 1.1797 1.1532 1.0808 -0.0452 -0.0945 -0.3175 31  GLU B N   
1987 C CA  . GLU B 53  ? 1.3097 1.2346 1.2081 -0.0545 -0.1086 -0.3413 31  GLU B CA  
1988 C C   . GLU B 53  ? 1.3515 1.2705 1.2172 -0.0358 -0.1204 -0.3740 31  GLU B C   
1989 O O   . GLU B 53  ? 1.3435 1.2144 1.2022 -0.0393 -0.1322 -0.3986 31  GLU B O   
1990 C CB  . GLU B 53  ? 1.4316 1.3063 1.3324 -0.0520 -0.1001 -0.3317 31  GLU B CB  
1991 C CG  . GLU B 53  ? 1.4402 1.3076 1.3708 -0.0759 -0.0925 -0.3053 31  GLU B CG  
1992 C CD  . GLU B 53  ? 1.4335 1.2557 1.3598 -0.0676 -0.0842 -0.2929 31  GLU B CD  
1993 O OE1 . GLU B 53  ? 1.4431 1.2728 1.3524 -0.0410 -0.0744 -0.2880 31  GLU B OE1 
1994 O OE2 . GLU B 53  ? 1.4239 1.2046 1.3643 -0.0875 -0.0881 -0.2871 31  GLU B OE2 
1995 N N   . GLN B 54  ? 1.3985 1.3627 1.2430 -0.0163 -0.1172 -0.3748 32  GLN B N   
1996 C CA  . GLN B 54  ? 1.4414 1.4126 1.2519 0.0012  -0.1279 -0.4053 32  GLN B CA  
1997 C C   . GLN B 54  ? 1.5921 1.5920 1.4034 -0.0138 -0.1477 -0.4213 32  GLN B C   
1998 O O   . GLN B 54  ? 1.6419 1.6501 1.4230 -0.0019 -0.1597 -0.4501 32  GLN B O   
1999 C CB  . GLN B 54  ? 1.3589 1.3698 1.1441 0.0294  -0.1130 -0.3947 32  GLN B CB  
2000 C CG  . GLN B 54  ? 1.4510 1.4382 1.2250 0.0517  -0.0987 -0.3939 32  GLN B CG  
2001 C CD  . GLN B 54  ? 1.5271 1.5607 1.2759 0.0775  -0.0854 -0.3873 32  GLN B CD  
2002 O OE1 . GLN B 54  ? 1.5423 1.6212 1.2798 0.0778  -0.0870 -0.3814 32  GLN B OE1 
2003 N NE2 . GLN B 54  ? 1.4993 1.5251 1.2401 0.0992  -0.0721 -0.3861 32  GLN B NE2 
2004 N N   . GLY B 55  ? 1.5865 1.6051 1.4315 -0.0387 -0.1519 -0.4049 33  GLY B N   
2005 C CA  . GLY B 55  ? 1.6266 1.6777 1.4797 -0.0546 -0.1722 -0.4183 33  GLY B CA  
2006 C C   . GLY B 55  ? 1.5267 1.6424 1.3723 -0.0436 -0.1739 -0.4046 33  GLY B C   
2007 O O   . GLY B 55  ? 1.5767 1.7263 1.4484 -0.0593 -0.1836 -0.3967 33  GLY B O   
2008 N N   . ALA B 56  ? 1.4307 1.5658 1.2421 -0.0164 -0.1645 -0.4001 34  ALA B N   
2009 C CA  . ALA B 56  ? 1.3322 1.5242 1.1318 -0.0047 -0.1664 -0.3846 34  ALA B CA  
2010 C C   . ALA B 56  ? 1.3326 1.5453 1.1645 -0.0104 -0.1545 -0.3474 34  ALA B C   
2011 O O   . ALA B 56  ? 1.3962 1.5853 1.2456 -0.0132 -0.1367 -0.3293 34  ALA B O   
2012 C CB  . ALA B 56  ? 1.2601 1.4670 1.0166 0.0235  -0.1555 -0.3837 34  ALA B CB  
2013 N N   . GLU B 57  ? 1.2559 1.5140 1.0945 -0.0101 -0.1653 -0.3374 35  GLU B N   
2014 C CA  . GLU B 57  ? 1.1697 1.4486 1.0359 -0.0103 -0.1551 -0.3042 35  GLU B CA  
2015 C C   . GLU B 57  ? 1.1367 1.4128 0.9848 0.0079  -0.1337 -0.2791 35  GLU B C   
2016 O O   . GLU B 57  ? 1.0683 1.3515 0.8793 0.0241  -0.1309 -0.2825 35  GLU B O   
2017 C CB  . GLU B 57  ? 0.9778 1.3073 0.8512 -0.0080 -0.1730 -0.2991 35  GLU B CB  
2018 N N   . LEU B 58  ? 1.0931 1.3600 0.9681 0.0036  -0.1183 -0.2553 36  LEU B N   
2019 C CA  . LEU B 58  ? 1.1058 1.3625 0.9719 0.0137  -0.0973 -0.2332 36  LEU B CA  
2020 C C   . LEU B 58  ? 1.0417 1.3260 0.9030 0.0260  -0.0945 -0.2062 36  LEU B C   
2021 O O   . LEU B 58  ? 0.9488 1.2547 0.8278 0.0258  -0.1048 -0.1985 36  LEU B O   
2022 C CB  . LEU B 58  ? 1.0994 1.3280 0.9948 0.0014  -0.0829 -0.2247 36  LEU B CB  
2023 C CG  . LEU B 58  ? 1.0097 1.2018 0.9086 -0.0077 -0.0768 -0.2378 36  LEU B CG  
2024 C CD1 . LEU B 58  ? 1.0160 1.1919 0.9073 -0.0142 -0.0920 -0.2666 36  LEU B CD1 
2025 C CD2 . LEU B 58  ? 0.7616 0.9438 0.6949 -0.0226 -0.0689 -0.2267 36  LEU B CD2 
2026 N N   . SER B 59  ? 0.9724 1.2551 0.8121 0.0363  -0.0798 -0.1902 37  SER B N   
2027 C CA  . SER B 59  ? 0.9515 1.2510 0.7840 0.0463  -0.0743 -0.1604 37  SER B CA  
2028 C C   . SER B 59  ? 1.1331 1.4215 1.0009 0.0409  -0.0693 -0.1425 37  SER B C   
2029 O O   . SER B 59  ? 0.9956 1.2659 0.8913 0.0291  -0.0658 -0.1513 37  SER B O   
2030 C CB  . SER B 59  ? 0.8988 1.1936 0.7115 0.0511  -0.0558 -0.1454 37  SER B CB  
2031 O OG  . SER B 59  ? 1.1129 1.4092 0.9013 0.0555  -0.0535 -0.1656 37  SER B OG  
2032 N N   . ASN B 60  ? 1.3022 1.5992 1.1667 0.0505  -0.0669 -0.1157 38  ASN B N   
2033 C CA  . ASN B 60  ? 1.4189 1.6983 1.3144 0.0480  -0.0595 -0.1005 38  ASN B CA  
2034 C C   . ASN B 60  ? 1.4674 1.7176 1.3661 0.0395  -0.0397 -0.0929 38  ASN B C   
2035 O O   . ASN B 60  ? 1.5401 1.7709 1.4642 0.0343  -0.0323 -0.0887 38  ASN B O   
2036 C CB  . ASN B 60  ? 1.5964 1.8881 1.4904 0.0627  -0.0657 -0.0744 38  ASN B CB  
2037 C CG  . ASN B 60  ? 1.7667 2.0917 1.6697 0.0711  -0.0869 -0.0817 38  ASN B CG  
2038 O OD1 . ASN B 60  ? 1.7859 2.1198 1.7094 0.0621  -0.0950 -0.1048 38  ASN B OD1 
2039 N ND2 . ASN B 60  ? 1.8609 2.2071 1.7483 0.0874  -0.0968 -0.0603 38  ASN B ND2 
2040 N N   . GLU B 61  ? 1.4297 1.6808 1.3037 0.0383  -0.0314 -0.0931 39  GLU B N   
2041 C CA  . GLU B 61  ? 1.1861 1.4175 1.0651 0.0283  -0.0150 -0.0919 39  GLU B CA  
2042 C C   . GLU B 61  ? 1.0774 1.2988 0.9652 0.0204  -0.0148 -0.1166 39  GLU B C   
2043 O O   . GLU B 61  ? 1.1396 1.3429 1.0442 0.0108  -0.0053 -0.1175 39  GLU B O   
2044 C CB  . GLU B 61  ? 1.0897 1.3343 0.9419 0.0315  -0.0053 -0.0790 39  GLU B CB  
2045 C CG  . GLU B 61  ? 1.1115 1.3491 0.9664 0.0231  0.0082  -0.0850 39  GLU B CG  
2046 C CD  . GLU B 61  ? 1.1770 1.4379 1.0087 0.0266  0.0185  -0.0727 39  GLU B CD  
2047 O OE1 . GLU B 61  ? 1.1820 1.4678 0.9872 0.0383  0.0136  -0.0720 39  GLU B OE1 
2048 O OE2 . GLU B 61  ? 1.2340 1.4927 1.0742 0.0172  0.0316  -0.0638 39  GLU B OE2 
2049 N N   . GLU B 62  ? 0.9159 1.1467 0.7918 0.0239  -0.0260 -0.1367 40  GLU B N   
2050 C CA  . GLU B 62  ? 0.8795 1.0933 0.7647 0.0159  -0.0267 -0.1575 40  GLU B CA  
2051 C C   . GLU B 62  ? 1.0184 1.2225 0.9347 0.0050  -0.0303 -0.1608 40  GLU B C   
2052 O O   . GLU B 62  ? 1.0147 1.2012 0.9440 -0.0048 -0.0254 -0.1683 40  GLU B O   
2053 C CB  . GLU B 62  ? 0.9563 1.1756 0.8217 0.0213  -0.0389 -0.1805 40  GLU B CB  
2054 C CG  . GLU B 62  ? 1.0089 1.2358 0.8442 0.0333  -0.0326 -0.1853 40  GLU B CG  
2055 N N   . ARG B 63  ? 1.1193 1.3381 1.0480 0.0078  -0.0379 -0.1533 41  ARG B N   
2056 C CA  . ARG B 63  ? 0.9532 1.1713 0.9142 -0.0002 -0.0391 -0.1549 41  ARG B CA  
2057 C C   . ARG B 63  ? 0.9726 1.1726 0.9476 -0.0051 -0.0230 -0.1449 41  ARG B C   
2058 O O   . ARG B 63  ? 0.9849 1.1767 0.9774 -0.0158 -0.0181 -0.1520 41  ARG B O   
2059 C CB  . ARG B 63  ? 0.8785 1.1222 0.8495 0.0088  -0.0513 -0.1482 41  ARG B CB  
2060 C CG  . ARG B 63  ? 0.7921 1.0482 0.7990 0.0034  -0.0545 -0.1520 41  ARG B CG  
2061 C CD  . ARG B 63  ? 0.9475 1.2388 0.9652 0.0132  -0.0715 -0.1500 41  ARG B CD  
2062 N NE  . ARG B 63  ? 1.1517 1.4515 1.1618 0.0327  -0.0739 -0.1291 41  ARG B NE  
2063 C CZ  . ARG B 63  ? 1.3503 1.6298 1.3643 0.0412  -0.0614 -0.1112 41  ARG B CZ  
2064 N NH1 . ARG B 63  ? 1.3502 1.6027 1.3745 0.0323  -0.0449 -0.1132 41  ARG B NH1 
2065 N NH2 . ARG B 63  ? 1.4846 1.7699 1.4908 0.0588  -0.0665 -0.0908 41  ARG B NH2 
2066 N N   . ASN B 64  ? 0.9389 1.1324 0.9054 0.0012  -0.0147 -0.1283 42  ASN B N   
2067 C CA  . ASN B 64  ? 0.9952 1.1705 0.9747 -0.0047 -0.0012 -0.1223 42  ASN B CA  
2068 C C   . ASN B 64  ? 0.9281 1.0922 0.9035 -0.0155 0.0072  -0.1305 42  ASN B C   
2069 O O   . ASN B 64  ? 1.0004 1.1563 0.9904 -0.0235 0.0140  -0.1347 42  ASN B O   
2070 C CB  . ASN B 64  ? 1.1978 1.3636 1.1696 0.0007  0.0049  -0.1031 42  ASN B CB  
2071 C CG  . ASN B 64  ? 1.5177 1.6873 1.4991 0.0131  -0.0020 -0.0916 42  ASN B CG  
2072 O OD1 . ASN B 64  ? 1.6393 1.8183 1.6415 0.0169  -0.0076 -0.0992 42  ASN B OD1 
2073 N ND2 . ASN B 64  ? 1.6267 1.7915 1.5937 0.0201  -0.0015 -0.0714 42  ASN B ND2 
2074 N N   . LEU B 65  ? 0.9145 1.0811 0.8692 -0.0137 0.0067  -0.1332 43  LEU B N   
2075 C CA  . LEU B 65  ? 0.9309 1.0891 0.8820 -0.0199 0.0140  -0.1385 43  LEU B CA  
2076 C C   . LEU B 65  ? 0.9965 1.1463 0.9591 -0.0275 0.0109  -0.1508 43  LEU B C   
2077 O O   . LEU B 65  ? 1.1091 1.2507 1.0771 -0.0346 0.0181  -0.1509 43  LEU B O   
2078 C CB  . LEU B 65  ? 0.8483 1.0146 0.7766 -0.0120 0.0136  -0.1407 43  LEU B CB  
2079 C CG  . LEU B 65  ? 0.8801 1.0589 0.7969 -0.0080 0.0203  -0.1249 43  LEU B CG  
2080 C CD1 . LEU B 65  ? 0.7407 0.9373 0.6331 0.0035  0.0189  -0.1289 43  LEU B CD1 
2081 C CD2 . LEU B 65  ? 0.8517 1.0259 0.7778 -0.0178 0.0319  -0.1168 43  LEU B CD2 
2082 N N   . LEU B 66  ? 0.8952 1.0485 0.8620 -0.0276 0.0000  -0.1600 44  LEU B N   
2083 C CA  . LEU B 66  ? 0.8874 1.0306 0.8657 -0.0384 -0.0019 -0.1687 44  LEU B CA  
2084 C C   . LEU B 66  ? 0.9295 1.0788 0.9318 -0.0472 0.0038  -0.1646 44  LEU B C   
2085 O O   . LEU B 66  ? 0.8118 0.9542 0.8220 -0.0574 0.0093  -0.1651 44  LEU B O   
2086 C CB  . LEU B 66  ? 0.8493 0.9929 0.8249 -0.0393 -0.0164 -0.1821 44  LEU B CB  
2087 C CG  . LEU B 66  ? 1.0331 1.1676 1.0261 -0.0548 -0.0209 -0.1895 44  LEU B CG  
2088 C CD1 . LEU B 66  ? 1.1533 1.2628 1.1390 -0.0580 -0.0136 -0.1876 44  LEU B CD1 
2089 C CD2 . LEU B 66  ? 1.1004 1.2346 1.0916 -0.0583 -0.0371 -0.2050 44  LEU B CD2 
2090 N N   . SER B 67  ? 0.8466 1.0095 0.8593 -0.0415 0.0038  -0.1595 45  SER B N   
2091 C CA  . SER B 67  ? 0.7707 0.9399 0.8039 -0.0449 0.0121  -0.1570 45  SER B CA  
2092 C C   . SER B 67  ? 0.8685 1.0246 0.8951 -0.0484 0.0247  -0.1535 45  SER B C   
2093 O O   . SER B 67  ? 1.0390 1.1958 1.0726 -0.0573 0.0316  -0.1560 45  SER B O   
2094 C CB  . SER B 67  ? 0.9261 1.1070 0.9697 -0.0330 0.0093  -0.1517 45  SER B CB  
2095 O OG  . SER B 67  ? 1.1116 1.3131 1.1649 -0.0303 -0.0038 -0.1554 45  SER B OG  
2096 N N   . VAL B 68  ? 0.8230 0.9702 0.8354 -0.0430 0.0276  -0.1472 46  VAL B N   
2097 C CA  . VAL B 68  ? 0.7668 0.9054 0.7753 -0.0480 0.0377  -0.1452 46  VAL B CA  
2098 C C   . VAL B 68  ? 0.7844 0.9218 0.7862 -0.0559 0.0403  -0.1483 46  VAL B C   
2099 O O   . VAL B 68  ? 0.7031 0.8412 0.7075 -0.0628 0.0474  -0.1501 46  VAL B O   
2100 C CB  . VAL B 68  ? 0.8494 0.9821 0.8456 -0.0445 0.0393  -0.1363 46  VAL B CB  
2101 C CG1 . VAL B 68  ? 0.9490 1.0782 0.9400 -0.0534 0.0471  -0.1360 46  VAL B CG1 
2102 C CG2 . VAL B 68  ? 0.8213 0.9476 0.8250 -0.0379 0.0389  -0.1298 46  VAL B CG2 
2103 N N   . ALA B 69  ? 0.6866 0.8218 0.6783 -0.0537 0.0340  -0.1493 47  ALA B N   
2104 C CA  . ALA B 69  ? 0.5973 0.7266 0.5822 -0.0577 0.0351  -0.1499 47  ALA B CA  
2105 C C   . ALA B 69  ? 0.6473 0.7770 0.6435 -0.0679 0.0379  -0.1507 47  ALA B C   
2106 O O   . ALA B 69  ? 0.9167 1.0500 0.9117 -0.0733 0.0452  -0.1480 47  ALA B O   
2107 C CB  . ALA B 69  ? 0.6739 0.7947 0.6474 -0.0509 0.0268  -0.1538 47  ALA B CB  
2108 N N   . TYR B 70  ? 0.7333 0.8637 0.7407 -0.0719 0.0323  -0.1542 48  TYR B N   
2109 C CA  . TYR B 70  ? 0.7150 0.8486 0.7336 -0.0842 0.0358  -0.1521 48  TYR B CA  
2110 C C   . TYR B 70  ? 0.8237 0.9763 0.8540 -0.0872 0.0462  -0.1520 48  TYR B C   
2111 O O   . TYR B 70  ? 0.9255 1.0851 0.9572 -0.0959 0.0538  -0.1481 48  TYR B O   
2112 C CB  . TYR B 70  ? 0.6001 0.7342 0.6320 -0.0910 0.0267  -0.1565 48  TYR B CB  
2113 C CG  . TYR B 70  ? 0.6715 0.7799 0.6932 -0.0939 0.0180  -0.1582 48  TYR B CG  
2114 C CD1 . TYR B 70  ? 0.7540 0.8469 0.7749 -0.1047 0.0207  -0.1504 48  TYR B CD1 
2115 C CD2 . TYR B 70  ? 0.6324 0.7300 0.6430 -0.0843 0.0071  -0.1675 48  TYR B CD2 
2116 C CE1 . TYR B 70  ? 0.8314 0.8922 0.8435 -0.1059 0.0120  -0.1524 48  TYR B CE1 
2117 C CE2 . TYR B 70  ? 0.6497 0.7188 0.6497 -0.0844 -0.0011 -0.1732 48  TYR B CE2 
2118 C CZ  . TYR B 70  ? 0.7815 0.8291 0.7835 -0.0949 0.0010  -0.1658 48  TYR B CZ  
2119 O OH  . TYR B 70  ? 0.8284 0.8400 0.8203 -0.0933 -0.0078 -0.1717 48  TYR B OH  
2120 N N   . LYS B 71  ? 0.7070 0.8674 0.7440 -0.0788 0.0473  -0.1559 49  LYS B N   
2121 C CA  . LYS B 71  ? 0.7553 0.9305 0.8032 -0.0792 0.0575  -0.1592 49  LYS B CA  
2122 C C   . LYS B 71  ? 0.9911 1.1612 1.0233 -0.0819 0.0656  -0.1594 49  LYS B C   
2123 O O   . LYS B 71  ? 1.0601 1.2435 1.0930 -0.0877 0.0745  -0.1612 49  LYS B O   
2124 C CB  . LYS B 71  ? 0.8849 1.0652 0.9456 -0.0674 0.0562  -0.1631 49  LYS B CB  
2125 C CG  . LYS B 71  ? 1.0679 1.2625 1.1405 -0.0648 0.0677  -0.1701 49  LYS B CG  
2126 C CD  . LYS B 71  ? 1.2019 1.4070 1.2952 -0.0505 0.0654  -0.1732 49  LYS B CD  
2127 C CE  . LYS B 71  ? 1.2015 1.3996 1.2982 -0.0391 0.0741  -0.1816 49  LYS B CE  
2128 N NZ  . LYS B 71  ? 1.2390 1.4668 1.3466 -0.0440 0.0852  -0.1888 49  LYS B NZ  
2129 N N   . ASN B 72  ? 1.0796 1.2358 1.0970 -0.0789 0.0623  -0.1571 50  ASN B N   
2130 C CA  . ASN B 72  ? 0.7669 0.9235 0.7701 -0.0834 0.0668  -0.1568 50  ASN B CA  
2131 C C   . ASN B 72  ? 0.8237 0.9849 0.8191 -0.0899 0.0673  -0.1499 50  ASN B C   
2132 O O   . ASN B 72  ? 0.9889 1.1614 0.9770 -0.0953 0.0735  -0.1499 50  ASN B O   
2133 C CB  . ASN B 72  ? 0.5556 0.7038 0.5489 -0.0799 0.0625  -0.1538 50  ASN B CB  
2134 C CG  . ASN B 72  ? 0.7106 0.8520 0.7079 -0.0781 0.0645  -0.1576 50  ASN B CG  
2135 O OD1 . ASN B 72  ? 0.8280 0.9697 0.8227 -0.0837 0.0690  -0.1634 50  ASN B OD1 
2136 N ND2 . ASN B 72  ? 0.8168 0.9507 0.8191 -0.0708 0.0603  -0.1539 50  ASN B ND2 
2137 N N   . VAL B 73  ? 0.6093 0.7603 0.6048 -0.0894 0.0605  -0.1438 51  VAL B N   
2138 C CA  . VAL B 73  ? 0.7213 0.8688 0.7098 -0.0954 0.0604  -0.1343 51  VAL B CA  
2139 C C   . VAL B 73  ? 0.8322 0.9958 0.8292 -0.1061 0.0688  -0.1318 51  VAL B C   
2140 O O   . VAL B 73  ? 0.8586 1.0335 0.8450 -0.1108 0.0751  -0.1260 51  VAL B O   
2141 C CB  . VAL B 73  ? 0.7587 0.8845 0.7470 -0.0932 0.0509  -0.1311 51  VAL B CB  
2142 C CG1 . VAL B 73  ? 0.7493 0.8638 0.7334 -0.1011 0.0508  -0.1190 51  VAL B CG1 
2143 C CG2 . VAL B 73  ? 0.6506 0.7670 0.6274 -0.0802 0.0449  -0.1334 51  VAL B CG2 
2144 N N   . VAL B 74  ? 0.8949 1.0656 0.9113 -0.1095 0.0689  -0.1359 52  VAL B N   
2145 C CA  . VAL B 74  ? 0.8398 1.0345 0.8692 -0.1196 0.0783  -0.1336 52  VAL B CA  
2146 C C   . VAL B 74  ? 0.8293 1.0464 0.8557 -0.1157 0.0899  -0.1420 52  VAL B C   
2147 O O   . VAL B 74  ? 0.9431 1.1807 0.9650 -0.1228 0.1000  -0.1378 52  VAL B O   
2148 C CB  . VAL B 74  ? 0.7659 0.9702 0.8209 -0.1234 0.0744  -0.1371 52  VAL B CB  
2149 C CG1 . VAL B 74  ? 0.8598 1.0799 0.9289 -0.1113 0.0759  -0.1495 52  VAL B CG1 
2150 C CG2 . VAL B 74  ? 0.6148 0.8406 0.6832 -0.1395 0.0820  -0.1282 52  VAL B CG2 
2151 N N   . GLY B 75  ? 0.8107 1.0234 0.8388 -0.1045 0.0889  -0.1544 53  GLY B N   
2152 C CA  . GLY B 75  ? 0.8994 1.1268 0.9256 -0.0999 0.0990  -0.1667 53  GLY B CA  
2153 C C   . GLY B 75  ? 0.8864 1.1201 0.8892 -0.1051 0.1040  -0.1663 53  GLY B C   
2154 O O   . GLY B 75  ? 0.8218 1.0756 0.8202 -0.1048 0.1142  -0.1763 53  GLY B O   
2155 N N   . ALA B 76  ? 0.8079 1.0280 0.7950 -0.1081 0.0965  -0.1563 54  ALA B N   
2156 C CA  . ALA B 76  ? 0.7610 0.9930 0.7260 -0.1127 0.0989  -0.1527 54  ALA B CA  
2157 C C   . ALA B 76  ? 0.7891 1.0421 0.7492 -0.1209 0.1070  -0.1405 54  ALA B C   
2158 O O   . ALA B 76  ? 0.9000 1.1772 0.8455 -0.1236 0.1152  -0.1444 54  ALA B O   
2159 C CB  . ALA B 76  ? 0.5833 0.8006 0.5367 -0.1109 0.0884  -0.1424 54  ALA B CB  
2160 N N   . ARG B 77  ? 0.7061 0.9501 0.6766 -0.1265 0.1045  -0.1251 55  ARG B N   
2161 C CA  . ARG B 77  ? 0.8246 1.0874 0.7938 -0.1380 0.1131  -0.1097 55  ARG B CA  
2162 C C   . ARG B 77  ? 0.7580 1.0562 0.7393 -0.1397 0.1274  -0.1207 55  ARG B C   
2163 O O   . ARG B 77  ? 0.6456 0.9734 0.6153 -0.1461 0.1389  -0.1143 55  ARG B O   
2164 C CB  . ARG B 77  ? 0.7819 1.0228 0.7644 -0.1464 0.1066  -0.0937 55  ARG B CB  
2165 C CG  . ARG B 77  ? 0.7622 0.9753 0.7270 -0.1458 0.0975  -0.0763 55  ARG B CG  
2166 C CD  . ARG B 77  ? 0.8079 0.9992 0.7679 -0.1317 0.0863  -0.0866 55  ARG B CD  
2167 N NE  . ARG B 77  ? 0.8710 1.0382 0.8165 -0.1261 0.0774  -0.0723 55  ARG B NE  
2168 C CZ  . ARG B 77  ? 0.9132 1.0643 0.8556 -0.1131 0.0681  -0.0788 55  ARG B CZ  
2169 N NH1 . ARG B 77  ? 0.7688 0.9241 0.7201 -0.1077 0.0671  -0.0966 55  ARG B NH1 
2170 N NH2 . ARG B 77  ? 1.1215 1.2543 1.0522 -0.1044 0.0607  -0.0662 55  ARG B NH2 
2171 N N   . ARG B 78  ? 0.6648 0.9630 0.6681 -0.1320 0.1271  -0.1370 56  ARG B N   
2172 C CA  . ARG B 78  ? 0.6437 0.9762 0.6604 -0.1279 0.1404  -0.1505 56  ARG B CA  
2173 C C   . ARG B 78  ? 0.7432 1.0911 0.7372 -0.1214 0.1491  -0.1659 56  ARG B C   
2174 O O   . ARG B 78  ? 0.8321 1.2172 0.8227 -0.1227 0.1636  -0.1697 56  ARG B O   
2175 C CB  . ARG B 78  ? 0.6867 1.0112 0.7294 -0.1161 0.1355  -0.1642 56  ARG B CB  
2176 C CG  . ARG B 78  ? 0.7258 1.0501 0.7945 -0.1231 0.1283  -0.1536 56  ARG B CG  
2177 C CD  . ARG B 78  ? 0.7533 1.1016 0.8526 -0.1123 0.1311  -0.1657 56  ARG B CD  
2178 N NE  . ARG B 78  ? 0.7156 1.0384 0.8171 -0.0951 0.1219  -0.1776 56  ARG B NE  
2179 C CZ  . ARG B 78  ? 0.8262 1.1613 0.9455 -0.0782 0.1251  -0.1908 56  ARG B CZ  
2180 N NH1 . ARG B 78  ? 0.8651 1.2425 1.0029 -0.0739 0.1382  -0.1971 56  ARG B NH1 
2181 N NH2 . ARG B 78  ? 0.8547 1.1607 0.9737 -0.0643 0.1157  -0.1963 56  ARG B NH2 
2182 N N   . SER B 79  ? 0.8118 1.1349 0.7895 -0.1158 0.1407  -0.1758 57  SER B N   
2183 C CA  . SER B 79  ? 0.8081 1.1439 0.7656 -0.1113 0.1469  -0.1954 57  SER B CA  
2184 C C   . SER B 79  ? 0.8688 1.2310 0.7980 -0.1205 0.1518  -0.1839 57  SER B C   
2185 O O   . SER B 79  ? 0.7848 1.1790 0.6997 -0.1191 0.1637  -0.1960 57  SER B O   
2186 C CB  . SER B 79  ? 0.7199 1.0233 0.6716 -0.1068 0.1356  -0.2082 57  SER B CB  
2187 O OG  . SER B 79  ? 0.8832 1.1968 0.8132 -0.1068 0.1389  -0.2272 57  SER B OG  
2188 N N   . SER B 80  ? 0.8688 1.2187 0.7885 -0.1280 0.1426  -0.1602 58  SER B N   
2189 C CA  . SER B 80  ? 0.8145 1.1880 0.7079 -0.1356 0.1460  -0.1422 58  SER B CA  
2190 C C   . SER B 80  ? 0.6642 1.0724 0.5613 -0.1427 0.1622  -0.1314 58  SER B C   
2191 O O   . SER B 80  ? 0.8107 1.2551 0.6846 -0.1447 0.1726  -0.1320 58  SER B O   
2192 C CB  . SER B 80  ? 0.9288 1.2767 0.8174 -0.1391 0.1331  -0.1162 58  SER B CB  
2193 O OG  . SER B 80  ? 0.9024 1.2263 0.7898 -0.1323 0.1197  -0.1252 58  SER B OG  
2194 N N   . TRP B 81  ? 0.7961 1.1986 0.7227 -0.1473 0.1647  -0.1222 59  TRP B N   
2195 C CA  . TRP B 81  ? 0.8554 1.2955 0.7915 -0.1577 0.1803  -0.1088 59  TRP B CA  
2196 C C   . TRP B 81  ? 0.8618 1.3479 0.7939 -0.1496 0.1976  -0.1317 59  TRP B C   
2197 O O   . TRP B 81  ? 0.7639 1.2921 0.6792 -0.1561 0.2121  -0.1221 59  TRP B O   
2198 C CB  . TRP B 81  ? 0.8012 1.2302 0.7753 -0.1645 0.1777  -0.1011 59  TRP B CB  
2199 C CG  . TRP B 81  ? 0.8260 1.2957 0.8148 -0.1798 0.1929  -0.0840 59  TRP B CG  
2200 C CD1 . TRP B 81  ? 0.7700 1.2368 0.7582 -0.2000 0.1938  -0.0516 59  TRP B CD1 
2201 C CD2 . TRP B 81  ? 0.8452 1.3669 0.8533 -0.1765 0.2102  -0.0974 59  TRP B CD2 
2202 N NE1 . TRP B 81  ? 0.7739 1.2905 0.7803 -0.2129 0.2113  -0.0425 59  TRP B NE1 
2203 C CE2 . TRP B 81  ? 0.8304 1.3854 0.8496 -0.1975 0.2220  -0.0710 59  TRP B CE2 
2204 C CE3 . TRP B 81  ? 0.8758 1.4186 0.8936 -0.1568 0.2172  -0.1288 59  TRP B CE3 
2205 C CZ2 . TRP B 81  ? 0.8454 1.4621 0.8873 -0.1996 0.2413  -0.0753 59  TRP B CZ2 
2206 C CZ3 . TRP B 81  ? 0.8722 1.4721 0.9111 -0.1552 0.2357  -0.1347 59  TRP B CZ3 
2207 C CH2 . TRP B 81  ? 0.8266 1.4670 0.8781 -0.1766 0.2481  -0.1082 59  TRP B CH2 
2208 N N   . ARG B 82  ? 0.8604 1.3384 0.8062 -0.1342 0.1967  -0.1621 60  ARG B N   
2209 C CA  . ARG B 82  ? 0.8460 1.3622 0.7893 -0.1224 0.2128  -0.1881 60  ARG B CA  
2210 C C   . ARG B 82  ? 0.7801 1.3144 0.6811 -0.1211 0.2170  -0.1989 60  ARG B C   
2211 O O   . ARG B 82  ? 0.8675 1.4486 0.7558 -0.1176 0.2342  -0.2091 60  ARG B O   
2212 C CB  . ARG B 82  ? 0.6612 1.1534 0.6255 -0.1040 0.2085  -0.2175 60  ARG B CB  
2213 C CG  . ARG B 82  ? 0.6805 1.1606 0.6846 -0.1015 0.2031  -0.2109 60  ARG B CG  
2214 C CD  . ARG B 82  ? 0.8060 1.2568 0.8238 -0.0815 0.1971  -0.2370 60  ARG B CD  
2215 N NE  . ARG B 82  ? 0.9446 1.3499 0.9748 -0.0825 0.1790  -0.2278 60  ARG B NE  
2216 C CZ  . ARG B 82  ? 1.1070 1.4696 1.1273 -0.0765 0.1678  -0.2386 60  ARG B CZ  
2217 N NH1 . ARG B 82  ? 1.1719 1.5261 1.1711 -0.0708 0.1708  -0.2606 60  ARG B NH1 
2218 N NH2 . ARG B 82  ? 1.1166 1.4461 1.1477 -0.0776 0.1535  -0.2277 60  ARG B NH2 
2219 N N   . VAL B 83  ? 0.9029 1.4063 0.7813 -0.1237 0.2015  -0.1974 61  VAL B N   
2220 C CA  . VAL B 83  ? 1.0325 1.5572 0.8706 -0.1237 0.2025  -0.2086 61  VAL B CA  
2221 C C   . VAL B 83  ? 1.0688 1.6333 0.8828 -0.1352 0.2112  -0.1782 61  VAL B C   
2222 O O   . VAL B 83  ? 1.0146 1.6243 0.8014 -0.1336 0.2242  -0.1874 61  VAL B O   
2223 C CB  . VAL B 83  ? 0.8830 1.3702 0.7086 -0.1241 0.1825  -0.2153 61  VAL B CB  
2224 C CG1 . VAL B 83  ? 0.7491 1.2620 0.5341 -0.1298 0.1783  -0.2095 61  VAL B CG1 
2225 C CG2 . VAL B 83  ? 0.7983 1.2631 0.6318 -0.1136 0.1800  -0.2539 61  VAL B CG2 
2226 N N   . VAL B 84  ? 1.0429 1.5906 0.8663 -0.1466 0.2051  -0.1415 62  VAL B N   
2227 C CA  . VAL B 84  ? 0.9841 1.5612 0.7859 -0.1588 0.2124  -0.1067 62  VAL B CA  
2228 C C   . VAL B 84  ? 1.0352 1.6595 0.8493 -0.1652 0.2353  -0.0990 62  VAL B C   
2229 O O   . VAL B 84  ? 1.1498 1.8185 0.9369 -0.1721 0.2482  -0.0818 62  VAL B O   
2230 C CB  . VAL B 84  ? 0.8443 1.3783 0.6537 -0.1673 0.1972  -0.0722 62  VAL B CB  
2231 C CG1 . VAL B 84  ? 0.7949 1.3484 0.5843 -0.1804 0.2034  -0.0310 62  VAL B CG1 
2232 C CG2 . VAL B 84  ? 0.7512 1.2548 0.5455 -0.1587 0.1773  -0.0815 62  VAL B CG2 
2233 N N   . SER B 85  ? 0.9900 1.6116 0.8446 -0.1630 0.2409  -0.1103 63  SER B N   
2234 C CA  . SER B 85  ? 0.9409 1.6163 0.8127 -0.1689 0.2631  -0.1041 63  SER B CA  
2235 C C   . SER B 85  ? 1.1154 1.8431 0.9669 -0.1541 0.2809  -0.1357 63  SER B C   
2236 O O   . SER B 85  ? 1.2424 2.0300 1.0885 -0.1594 0.3022  -0.1259 63  SER B O   
2237 C CB  . SER B 85  ? 0.8377 1.5013 0.7610 -0.1691 0.2620  -0.1085 63  SER B CB  
2238 O OG  . SER B 85  ? 0.8961 1.6198 0.8411 -0.1666 0.2836  -0.1170 63  SER B OG  
2239 N N   . SER B 86  ? 1.0596 1.7657 0.8995 -0.1360 0.2729  -0.1742 64  SER B N   
2240 C CA  . SER B 86  ? 1.0550 1.8028 0.8731 -0.1203 0.2880  -0.2100 64  SER B CA  
2241 C C   . SER B 86  ? 1.1021 1.8751 0.8698 -0.1244 0.2879  -0.2016 64  SER B C   
2242 O O   . SER B 86  ? 1.1813 1.9886 0.9347 -0.1144 0.2975  -0.2129 64  SER B O   
2243 C CB  . SER B 86  ? 0.9528 1.6580 0.7772 -0.1015 0.2768  -0.2532 64  SER B CB  
2244 O OG  . SER B 86  ? 1.1308 1.8469 0.9203 -0.0902 0.2774  -0.2833 64  SER B OG  
2245 N N   . ILE B 87  ? 1.0106 1.7629 0.7534 -0.1365 0.2737  -0.1800 65  ILE B N   
2246 C CA  . ILE B 87  ? 1.0265 1.8032 0.7242 -0.1404 0.2703  -0.1636 65  ILE B CA  
2247 C C   . ILE B 87  ? 1.0945 1.9097 0.7901 -0.1534 0.2852  -0.1203 65  ILE B C   
2248 O O   . ILE B 87  ? 1.1039 1.9562 0.7723 -0.1503 0.2918  -0.1147 65  ILE B O   
2249 C CB  . ILE B 87  ? 1.0467 1.7923 0.7215 -0.1468 0.2492  -0.1517 65  ILE B CB  
2250 C CG1 . ILE B 87  ? 1.1284 1.8501 0.7919 -0.1358 0.2339  -0.1958 65  ILE B CG1 
2251 C CG2 . ILE B 87  ? 0.9702 1.7447 0.6058 -0.1548 0.2473  -0.1144 65  ILE B CG2 
2252 C CD1 . ILE B 87  ? 1.0738 1.7499 0.7756 -0.1265 0.2291  -0.2287 65  ILE B CD1 
2253 N N   . GLU B 88  ? 1.0692 1.8756 0.7943 -0.1696 0.2905  -0.0888 66  GLU B N   
2254 C CA  . GLU B 88  ? 1.2435 2.0802 0.9713 -0.1864 0.3038  -0.0446 66  GLU B CA  
2255 C C   . GLU B 88  ? 1.2738 2.1589 1.0147 -0.1785 0.3228  -0.0572 66  GLU B C   
2256 O O   . GLU B 88  ? 1.3405 2.2614 1.0661 -0.1867 0.3338  -0.0288 66  GLU B O   
2257 C CB  . GLU B 88  ? 1.2676 2.0695 1.0339 -0.2054 0.3000  -0.0134 66  GLU B CB  
2258 C CG  . GLU B 88  ? 1.2783 2.1200 1.0731 -0.2251 0.3206  0.0153  66  GLU B CG  
2259 C CD  . GLU B 88  ? 1.2547 2.0434 1.0895 -0.2433 0.3080  0.0431  66  GLU B CD  
2260 O OE1 . GLU B 88  ? 1.2422 2.0117 1.0661 -0.2623 0.3045  0.0871  66  GLU B OE1 
2261 O OE2 . GLU B 88  ? 1.2092 1.9743 1.0854 -0.2383 0.3011  0.0208  66  GLU B OE2 
2262 N N   . GLN B 89  ? 1.2221 2.1092 0.9899 -0.1612 0.3269  -0.0987 67  GLN B N   
2263 C CA  . GLN B 89  ? 1.1260 2.0602 0.9047 -0.1488 0.3444  -0.1147 67  GLN B CA  
2264 C C   . GLN B 89  ? 1.2476 2.2015 0.9827 -0.1316 0.3447  -0.1400 67  GLN B C   
2265 O O   . GLN B 89  ? 1.3593 2.3609 1.0827 -0.1296 0.3597  -0.1327 67  GLN B O   
2266 C CB  . GLN B 89  ? 1.0139 1.9415 0.8379 -0.1335 0.3475  -0.1480 67  GLN B CB  
2267 N N   . LYS B 90  ? 1.2828 2.2023 0.9934 -0.1210 0.3281  -0.1692 68  LYS B N   
2268 C CA  . LYS B 90  ? 1.4073 2.3435 1.0772 -0.1072 0.3258  -0.1954 68  LYS B CA  
2269 C C   . LYS B 90  ? 1.4087 2.3719 1.0347 -0.1189 0.3236  -0.1618 68  LYS B C   
2270 O O   . LYS B 90  ? 1.3856 2.3682 0.9761 -0.1088 0.3211  -0.1822 68  LYS B O   
2271 C CB  . LYS B 90  ? 1.3820 2.2716 1.0426 -0.0962 0.3066  -0.2363 68  LYS B CB  
2272 C CG  . LYS B 90  ? 1.3418 2.2023 1.0383 -0.0797 0.3081  -0.2751 68  LYS B CG  
2273 C CD  . LYS B 90  ? 1.3134 2.1357 0.9926 -0.0678 0.2925  -0.3194 68  LYS B CD  
2274 N N   . THR B 91  ? 1.3825 2.3459 1.0095 -0.1390 0.3240  -0.1116 69  THR B N   
2275 C CA  . THR B 91  ? 1.3516 2.3294 0.9369 -0.1488 0.3180  -0.0758 69  THR B CA  
2276 C C   . THR B 91  ? 1.4736 2.5007 1.0520 -0.1583 0.3377  -0.0396 69  THR B C   
2277 O O   . THR B 91  ? 1.4264 2.4656 0.9730 -0.1679 0.3349  -0.0014 69  THR B O   
2278 C CB  . THR B 91  ? 1.2551 2.1894 0.8433 -0.1631 0.3023  -0.0434 69  THR B CB  
2279 O OG1 . THR B 91  ? 1.2701 2.1668 0.8569 -0.1536 0.2835  -0.0782 69  THR B OG1 
2280 C CG2 . THR B 91  ? 1.1790 2.1215 0.7280 -0.1722 0.2945  0.0012  69  THR B CG2 
2281 N N   . GLU B 92  ? 1.6115 2.6704 1.2170 -0.1537 0.3574  -0.0524 70  GLU B N   
2282 C CA  . GLU B 92  ? 1.6709 2.7786 1.2762 -0.1652 0.3775  -0.0170 70  GLU B CA  
2283 C C   . GLU B 92  ? 1.8096 2.9563 1.3623 -0.1599 0.3795  -0.0115 70  GLU B C   
2284 O O   . GLU B 92  ? 1.9192 3.0790 1.4480 -0.1404 0.3762  -0.0537 70  GLU B O   
2285 C CB  . GLU B 92  ? 1.5793 2.7201 1.2245 -0.1573 0.3973  -0.0387 70  GLU B CB  
2286 N N   . GLY B 93  ? 1.7588 2.9210 1.2930 -0.1778 0.3839  0.0416  71  GLY B N   
2287 C CA  . GLY B 93  ? 1.6869 2.8893 1.1712 -0.1750 0.3864  0.0557  71  GLY B CA  
2288 C C   . GLY B 93  ? 1.7218 2.9000 1.1682 -0.1810 0.3666  0.0884  71  GLY B C   
2289 O O   . GLY B 93  ? 1.7540 2.9647 1.1645 -0.1853 0.3706  0.1200  71  GLY B O   
2290 N N   . ALA B 94  ? 1.6809 2.8059 1.1336 -0.1804 0.3453  0.0828  72  ALA B N   
2291 C CA  . ALA B 94  ? 1.5796 2.6801 1.0015 -0.1845 0.3254  0.1167  72  ALA B CA  
2292 C C   . ALA B 94  ? 1.5012 2.5556 0.9515 -0.2037 0.3237  0.1627  72  ALA B C   
2293 O O   . ALA B 94  ? 1.3415 2.3526 0.8209 -0.2045 0.3145  0.1479  72  ALA B O   
2294 C CB  . ALA B 94  ? 1.5335 2.6129 0.9392 -0.1691 0.3016  0.0763  72  ALA B CB  
2295 N N   . GLU B 95  ? 1.5479 2.6108 0.9902 -0.2200 0.3334  0.2184  73  GLU B N   
2296 C CA  . GLU B 95  ? 1.5371 2.5573 1.0116 -0.2420 0.3361  0.2624  73  GLU B CA  
2297 C C   . GLU B 95  ? 1.5487 2.5090 1.0214 -0.2409 0.3127  0.2756  73  GLU B C   
2298 O O   . GLU B 95  ? 1.5853 2.5022 1.0946 -0.2527 0.3107  0.2822  73  GLU B O   
2299 C CB  . GLU B 95  ? 1.5965 2.6328 1.0578 -0.2599 0.3490  0.3208  73  GLU B CB  
2300 N N   . LYS B 96  ? 1.5722 2.5322 1.0037 -0.2262 0.2940  0.2773  74  LYS B N   
2301 C CA  . LYS B 96  ? 1.4046 2.3125 0.8321 -0.2234 0.2716  0.2964  74  LYS B CA  
2302 C C   . LYS B 96  ? 1.4303 2.3181 0.8764 -0.2122 0.2594  0.2450  74  LYS B C   
2303 O O   . LYS B 96  ? 1.4237 2.2643 0.8833 -0.2141 0.2463  0.2561  74  LYS B O   
2304 C CB  . LYS B 96  ? 1.3955 2.3152 0.7744 -0.2108 0.2549  0.3214  74  LYS B CB  
2305 N N   . LYS B 97  ? 1.4434 2.3638 0.8905 -0.2004 0.2634  0.1893  75  LYS B N   
2306 C CA  . LYS B 97  ? 1.4328 2.3307 0.9028 -0.1920 0.2546  0.1396  75  LYS B CA  
2307 C C   . LYS B 97  ? 1.4213 2.2981 0.9403 -0.2031 0.2688  0.1307  75  LYS B C   
2308 O O   . LYS B 97  ? 1.4053 2.2481 0.9470 -0.2012 0.2601  0.1080  75  LYS B O   
2309 C CB  . LYS B 97  ? 1.3923 2.3236 0.8466 -0.1756 0.2523  0.0842  75  LYS B CB  
2310 N N   . GLN B 98  ? 1.4117 2.3119 0.9489 -0.2148 0.2900  0.1466  76  GLN B N   
2311 C CA  . GLN B 98  ? 1.3106 2.1968 0.8983 -0.2255 0.3017  0.1372  76  GLN B CA  
2312 C C   . GLN B 98  ? 1.2596 2.1012 0.8690 -0.2473 0.2985  0.1834  76  GLN B C   
2313 O O   . GLN B 98  ? 1.0660 1.8766 0.7112 -0.2533 0.2958  0.1707  76  GLN B O   
2314 C CB  . GLN B 98  ? 1.2131 2.1476 0.8173 -0.2280 0.3247  0.1303  76  GLN B CB  
2315 C CG  . GLN B 98  ? 1.1075 2.0351 0.7674 -0.2406 0.3362  0.1268  76  GLN B CG  
2316 C CD  . GLN B 98  ? 1.2918 2.2727 0.9707 -0.2344 0.3566  0.1045  76  GLN B CD  
2317 O OE1 . GLN B 98  ? 1.3522 2.3697 1.0298 -0.2460 0.3722  0.1336  76  GLN B OE1 
2318 N NE2 . GLN B 98  ? 1.1470 2.1320 0.8436 -0.2150 0.3565  0.0527  76  GLN B NE2 
2319 N N   . GLN B 99  ? 1.3250 2.1593 0.9131 -0.2592 0.2979  0.2372  77  GLN B N   
2320 C CA  . GLN B 99  ? 1.2960 2.0764 0.9014 -0.2793 0.2917  0.2825  77  GLN B CA  
2321 C C   . GLN B 99  ? 1.3579 2.0810 0.9646 -0.2660 0.2666  0.2691  77  GLN B C   
2322 O O   . GLN B 99  ? 1.3901 2.0467 1.0334 -0.2724 0.2547  0.2777  77  GLN B O   
2323 C CB  . GLN B 99  ? 1.2405 2.0141 0.8183 -0.2894 0.2921  0.3419  77  GLN B CB  
2324 N N   . MET B 100 ? 1.3820 2.1216 0.9563 -0.2436 0.2544  0.2407  78  MET B N   
2325 C CA  . MET B 100 ? 1.2904 1.9758 0.8707 -0.2255 0.2271  0.2219  78  MET B CA  
2326 C C   . MET B 100 ? 1.2392 1.8993 0.8620 -0.2193 0.2232  0.1713  78  MET B C   
2327 O O   . MET B 100 ? 1.2351 1.8342 0.8846 -0.2141 0.2057  0.1668  78  MET B O   
2328 C CB  . MET B 100 ? 1.3967 2.1200 0.9282 -0.2079 0.2163  0.2107  78  MET B CB  
2329 C CG  . MET B 100 ? 1.4919 2.1800 1.0278 -0.1890 0.1899  0.1844  78  MET B CG  
2330 S SD  . MET B 100 ? 1.6127 2.2773 1.1191 -0.1769 0.1661  0.2324  78  MET B SD  
2331 C CE  . MET B 100 ? 1.6165 2.3673 1.0576 -0.1714 0.1690  0.2378  78  MET B CE  
2332 N N   . ALA B 101 ? 1.1882 1.8951 0.8161 -0.2178 0.2394  0.1331  79  ALA B N   
2333 C CA  . ALA B 101 ? 1.1073 1.7915 0.7765 -0.2120 0.2376  0.0897  79  ALA B CA  
2334 C C   . ALA B 101 ? 1.0522 1.7057 0.7690 -0.2277 0.2430  0.1048  79  ALA B C   
2335 O O   . ALA B 101 ? 0.9369 1.5468 0.6879 -0.2228 0.2316  0.0834  79  ALA B O   
2336 C CB  . ALA B 101 ? 1.0334 1.7736 0.6947 -0.2033 0.2537  0.0460  79  ALA B CB  
2337 N N   . ARG B 102 ? 1.0818 1.7598 0.8016 -0.2479 0.2596  0.1418  80  ARG B N   
2338 C CA  . ARG B 102 ? 1.0047 1.6578 0.7720 -0.2668 0.2636  0.1550  80  ARG B CA  
2339 C C   . ARG B 102 ? 1.0081 1.5797 0.7912 -0.2692 0.2406  0.1724  80  ARG B C   
2340 O O   . ARG B 102 ? 0.9333 1.4690 0.7559 -0.2712 0.2327  0.1550  80  ARG B O   
2341 C CB  . ARG B 102 ? 1.0082 1.7059 0.7749 -0.2920 0.2861  0.1950  80  ARG B CB  
2342 N N   . GLU B 103 ? 1.1050 1.6480 0.8567 -0.2668 0.2293  0.2057  81  GLU B N   
2343 C CA  . GLU B 103 ? 1.2030 1.6678 0.9679 -0.2670 0.2089  0.2245  81  GLU B CA  
2344 C C   . GLU B 103 ? 1.0930 1.5196 0.8702 -0.2449 0.1893  0.1861  81  GLU B C   
2345 O O   . GLU B 103 ? 0.9944 1.3620 0.7970 -0.2458 0.1759  0.1860  81  GLU B O   
2346 C CB  . GLU B 103 ? 1.3901 1.8374 1.1175 -0.2654 0.2021  0.2708  81  GLU B CB  
2347 C CG  . GLU B 103 ? 1.5531 2.0296 1.2700 -0.2910 0.2213  0.3171  81  GLU B CG  
2348 C CD  . GLU B 103 ? 1.6807 2.1280 1.3634 -0.2902 0.2132  0.3699  81  GLU B CD  
2349 O OE1 . GLU B 103 ? 1.7547 2.2149 1.4295 -0.3134 0.2276  0.4148  81  GLU B OE1 
2350 O OE2 . GLU B 103 ? 1.6869 2.1003 1.3519 -0.2662 0.1926  0.3684  81  GLU B OE2 
2351 N N   . TYR B 104 ? 1.1183 1.5772 0.8768 -0.2262 0.1873  0.1536  82  TYR B N   
2352 C CA  . TYR B 104 ? 1.0922 1.5203 0.8643 -0.2084 0.1709  0.1180  82  TYR B CA  
2353 C C   . TYR B 104 ? 1.0150 1.4374 0.8276 -0.2122 0.1754  0.0871  82  TYR B C   
2354 O O   . TYR B 104 ? 0.9617 1.3394 0.7968 -0.2059 0.1618  0.0734  82  TYR B O   
2355 C CB  . TYR B 104 ? 1.0527 1.5167 0.7954 -0.1917 0.1673  0.0924  82  TYR B CB  
2356 C CG  . TYR B 104 ? 0.9477 1.3787 0.6971 -0.1747 0.1476  0.0690  82  TYR B CG  
2357 C CD1 . TYR B 104 ? 0.9958 1.3769 0.7512 -0.1678 0.1312  0.0881  82  TYR B CD1 
2358 C CD2 . TYR B 104 ? 0.8596 1.3091 0.6105 -0.1657 0.1463  0.0277  82  TYR B CD2 
2359 C CE1 . TYR B 104 ? 1.0074 1.3669 0.7700 -0.1521 0.1153  0.0672  82  TYR B CE1 
2360 C CE2 . TYR B 104 ? 0.9352 1.3587 0.6940 -0.1535 0.1298  0.0089  82  TYR B CE2 
2361 C CZ  . TYR B 104 ? 0.9749 1.3578 0.7398 -0.1468 0.1152  0.0292  82  TYR B CZ  
2362 O OH  . TYR B 104 ? 1.0310 1.3963 0.8048 -0.1346 0.1009  0.0114  82  TYR B OH  
2363 N N   . ARG B 105 ? 0.9599 1.4312 0.7812 -0.2204 0.1944  0.0757  83  ARG B N   
2364 C CA  . ARG B 105 ? 0.9523 1.4243 0.8140 -0.2228 0.1987  0.0501  83  ARG B CA  
2365 C C   . ARG B 105 ? 0.9649 1.3934 0.8586 -0.2383 0.1915  0.0689  83  ARG B C   
2366 O O   . ARG B 105 ? 0.9639 1.3628 0.8850 -0.2335 0.1810  0.0484  83  ARG B O   
2367 C CB  . ARG B 105 ? 1.0229 1.5611 0.8893 -0.2285 0.2221  0.0412  83  ARG B CB  
2368 C CG  . ARG B 105 ? 0.9936 1.5430 0.8999 -0.2252 0.2267  0.0121  83  ARG B CG  
2369 C CD  . ARG B 105 ? 1.0355 1.6020 0.9745 -0.2481 0.2370  0.0345  83  ARG B CD  
2370 N NE  . ARG B 105 ? 1.1325 1.7724 1.0725 -0.2524 0.2617  0.0330  83  ARG B NE  
2371 C CZ  . ARG B 105 ? 1.1204 1.7953 1.0765 -0.2763 0.2767  0.0618  83  ARG B CZ  
2372 N NH1 . ARG B 105 ? 1.1094 1.8585 1.0656 -0.2771 0.3009  0.0578  83  ARG B NH1 
2373 N NH2 . ARG B 105 ? 1.1095 1.7449 1.0816 -0.2997 0.2679  0.0937  83  ARG B NH2 
2374 N N   . GLU B 106 ? 1.0551 1.4776 0.9445 -0.2579 0.1962  0.1081  84  GLU B N   
2375 C CA  . GLU B 106 ? 1.1919 1.5667 1.1107 -0.2753 0.1877  0.1247  84  GLU B CA  
2376 C C   . GLU B 106 ? 1.2525 1.5586 1.1690 -0.2606 0.1645  0.1183  84  GLU B C   
2377 O O   . GLU B 106 ? 1.3448 1.6161 1.2899 -0.2638 0.1542  0.1051  84  GLU B O   
2378 C CB  . GLU B 106 ? 1.2335 1.6109 1.1463 -0.3010 0.1976  0.1706  84  GLU B CB  
2379 C CG  . GLU B 106 ? 1.3032 1.7562 1.2275 -0.3179 0.2227  0.1744  84  GLU B CG  
2380 C CD  . GLU B 106 ? 1.4033 1.8644 1.3300 -0.3495 0.2349  0.2215  84  GLU B CD  
2381 O OE1 . GLU B 106 ? 1.4849 1.9548 1.4517 -0.3746 0.2407  0.2263  84  GLU B OE1 
2382 O OE2 . GLU B 106 ? 1.4049 1.8656 1.2941 -0.3504 0.2383  0.2550  84  GLU B OE2 
2383 N N   . LYS B 107 ? 1.1846 1.4757 1.0675 -0.2432 0.1559  0.1262  85  LYS B N   
2384 C CA  . LYS B 107 ? 1.1376 1.3735 1.0194 -0.2253 0.1356  0.1170  85  LYS B CA  
2385 C C   . LYS B 107 ? 1.0311 1.2692 0.9321 -0.2123 0.1301  0.0756  85  LYS B C   
2386 O O   . LYS B 107 ? 1.0582 1.2546 0.9780 -0.2092 0.1180  0.0647  85  LYS B O   
2387 C CB  . LYS B 107 ? 1.1504 1.3854 0.9956 -0.2068 0.1280  0.1302  85  LYS B CB  
2388 N N   . ILE B 108 ? 0.9722 1.2573 0.8668 -0.2044 0.1387  0.0524  86  ILE B N   
2389 C CA  . ILE B 108 ? 0.8547 1.1407 0.7657 -0.1921 0.1344  0.0161  86  ILE B CA  
2390 C C   . ILE B 108 ? 0.8224 1.1030 0.7697 -0.2028 0.1360  0.0067  86  ILE B C   
2391 O O   . ILE B 108 ? 0.7545 1.0101 0.7179 -0.1945 0.1252  -0.0120 86  ILE B O   
2392 C CB  . ILE B 108 ? 0.9192 1.2528 0.8172 -0.1836 0.1446  -0.0065 86  ILE B CB  
2393 C CG1 . ILE B 108 ? 1.0147 1.3563 0.8776 -0.1727 0.1390  -0.0031 86  ILE B CG1 
2394 C CG2 . ILE B 108 ? 0.7837 1.1144 0.7032 -0.1734 0.1418  -0.0404 86  ILE B CG2 
2395 C CD1 . ILE B 108 ? 0.9478 1.3348 0.7943 -0.1673 0.1485  -0.0270 86  ILE B CD1 
2396 N N   . GLU B 109 ? 0.9832 1.2944 0.9444 -0.2212 0.1497  0.0190  87  GLU B N   
2397 C CA  . GLU B 109 ? 1.0415 1.3589 1.0406 -0.2312 0.1505  0.0078  87  GLU B CA  
2398 C C   . GLU B 109 ? 1.0510 1.3175 1.0652 -0.2442 0.1367  0.0208  87  GLU B C   
2399 O O   . GLU B 109 ? 1.1691 1.4246 1.2095 -0.2455 0.1281  0.0042  87  GLU B O   
2400 C CB  . GLU B 109 ? 1.1281 1.5058 1.1422 -0.2456 0.1707  0.0130  87  GLU B CB  
2401 C CG  . GLU B 109 ? 1.3107 1.6931 1.3361 -0.2741 0.1776  0.0455  87  GLU B CG  
2402 C CD  . GLU B 109 ? 1.4039 1.8572 1.4494 -0.2865 0.1991  0.0467  87  GLU B CD  
2403 O OE1 . GLU B 109 ? 1.3892 1.8894 1.4163 -0.2744 0.2141  0.0378  87  GLU B OE1 
2404 O OE2 . GLU B 109 ? 1.4425 1.9072 1.5236 -0.3082 0.2008  0.0547  87  GLU B OE2 
2405 N N   . THR B 110 ? 0.9213 1.1538 0.9176 -0.2521 0.1328  0.0491  88  THR B N   
2406 C CA  . THR B 110 ? 0.9056 1.0786 0.9128 -0.2610 0.1178  0.0574  88  THR B CA  
2407 C C   . THR B 110 ? 0.9511 1.0876 0.9552 -0.2380 0.1010  0.0322  88  THR B C   
2408 O O   . THR B 110 ? 0.8563 0.9667 0.8805 -0.2419 0.0900  0.0183  88  THR B O   
2409 C CB  . THR B 110 ? 0.9031 1.0415 0.8886 -0.2691 0.1168  0.0940  88  THR B CB  
2410 O OG1 . THR B 110 ? 1.0124 1.1734 1.0105 -0.2990 0.1302  0.1204  88  THR B OG1 
2411 C CG2 . THR B 110 ? 0.8727 0.9365 0.8583 -0.2644 0.0979  0.0957  88  THR B CG2 
2412 N N   . GLU B 111 ? 1.0442 1.1852 1.0238 -0.2149 0.0993  0.0247  89  GLU B N   
2413 C CA  . GLU B 111 ? 0.9893 1.1095 0.9669 -0.1935 0.0869  0.0007  89  GLU B CA  
2414 C C   . GLU B 111 ? 0.9725 1.1138 0.9744 -0.1932 0.0870  -0.0257 89  GLU B C   
2415 O O   . GLU B 111 ? 1.0109 1.1266 1.0214 -0.1861 0.0751  -0.0409 89  GLU B O   
2416 C CB  . GLU B 111 ? 1.0141 1.1507 0.9657 -0.1741 0.0879  -0.0023 89  GLU B CB  
2417 C CG  . GLU B 111 ? 1.1628 1.2691 1.0915 -0.1642 0.0799  0.0190  89  GLU B CG  
2418 C CD  . GLU B 111 ? 1.0912 1.2240 0.9962 -0.1474 0.0798  0.0169  89  GLU B CD  
2419 O OE1 . GLU B 111 ? 1.0508 1.2021 0.9582 -0.1375 0.0788  -0.0070 89  GLU B OE1 
2420 O OE2 . GLU B 111 ? 1.0363 1.1719 0.9204 -0.1453 0.0798  0.0407  89  GLU B OE2 
2421 N N   . LEU B 112 ? 1.0478 1.2375 1.0591 -0.1980 0.1004  -0.0318 90  LEU B N   
2422 C CA  . LEU B 112 ? 0.9439 1.1569 0.9802 -0.1955 0.1010  -0.0539 90  LEU B CA  
2423 C C   . LEU B 112 ? 0.9622 1.1652 1.0266 -0.2124 0.0939  -0.0530 90  LEU B C   
2424 O O   . LEU B 112 ? 1.0004 1.1961 1.0788 -0.2059 0.0835  -0.0706 90  LEU B O   
2425 C CB  . LEU B 112 ? 0.9012 1.1681 0.9426 -0.1957 0.1180  -0.0593 90  LEU B CB  
2426 C CG  . LEU B 112 ? 0.9265 1.2214 0.9873 -0.1837 0.1209  -0.0835 90  LEU B CG  
2427 C CD1 . LEU B 112 ? 0.9732 1.3137 1.0287 -0.1790 0.1385  -0.0897 90  LEU B CD1 
2428 C CD2 . LEU B 112 ? 0.9903 1.2983 1.0866 -0.1936 0.1170  -0.0871 90  LEU B CD2 
2429 N N   . ARG B 113 ? 0.8905 1.0947 0.9634 -0.2357 0.0990  -0.0320 91  ARG B N   
2430 C CA  . ARG B 113 ? 0.9208 1.1180 1.0236 -0.2565 0.0914  -0.0321 91  ARG B CA  
2431 C C   . ARG B 113 ? 0.9048 1.0451 1.0027 -0.2510 0.0715  -0.0423 91  ARG B C   
2432 O O   . ARG B 113 ? 1.0150 1.1557 1.1337 -0.2550 0.0607  -0.0588 91  ARG B O   
2433 C CB  . ARG B 113 ? 0.9814 1.1831 1.0929 -0.2861 0.1002  -0.0041 91  ARG B CB  
2434 C CG  . ARG B 113 ? 0.8713 1.1422 1.0027 -0.2984 0.1193  0.0017  91  ARG B CG  
2435 C CD  . ARG B 113 ? 1.0284 1.3031 1.1600 -0.3266 0.1303  0.0351  91  ARG B CD  
2436 N NE  . ARG B 113 ? 1.2750 1.6168 1.4052 -0.3284 0.1531  0.0439  91  ARG B NE  
2437 C CZ  . ARG B 113 ? 1.3976 1.8045 1.5590 -0.3334 0.1648  0.0334  91  ARG B CZ  
2438 N NH1 . ARG B 113 ? 1.3792 1.7947 1.5769 -0.3379 0.1543  0.0154  91  ARG B NH1 
2439 N NH2 . ARG B 113 ? 1.4358 1.9031 1.5917 -0.3321 0.1869  0.0400  91  ARG B NH2 
2440 N N   . ASP B 114 ? 1.1016 1.1966 1.1716 -0.2395 0.0660  -0.0341 92  ASP B N   
2441 C CA  . ASP B 114 ? 1.2710 1.3124 1.3348 -0.2315 0.0484  -0.0454 92  ASP B CA  
2442 C C   . ASP B 114 ? 1.1629 1.2134 1.2237 -0.2086 0.0412  -0.0719 92  ASP B C   
2443 O O   . ASP B 114 ? 1.1935 1.2209 1.2593 -0.2065 0.0273  -0.0882 92  ASP B O   
2444 C CB  . ASP B 114 ? 1.4586 1.4538 1.4948 -0.2211 0.0456  -0.0286 92  ASP B CB  
2445 C CG  . ASP B 114 ? 1.6348 1.6168 1.6710 -0.2437 0.0525  0.0029  92  ASP B CG  
2446 O OD1 . ASP B 114 ? 1.6588 1.6630 1.7192 -0.2711 0.0584  0.0102  92  ASP B OD1 
2447 O OD2 . ASP B 114 ? 1.6961 1.6484 1.7090 -0.2341 0.0520  0.0223  92  ASP B OD2 
2448 N N   . ILE B 115 ? 1.0408 1.1252 1.0934 -0.1927 0.0502  -0.0766 93  ILE B N   
2449 C CA  . ILE B 115 ? 0.9453 1.0403 0.9973 -0.1740 0.0449  -0.0977 93  ILE B CA  
2450 C C   . ILE B 115 ? 0.9269 1.0463 1.0062 -0.1822 0.0402  -0.1106 93  ILE B C   
2451 O O   . ILE B 115 ? 0.9261 1.0363 1.0061 -0.1733 0.0282  -0.1259 93  ILE B O   
2452 C CB  . ILE B 115 ? 0.8195 0.9426 0.8598 -0.1596 0.0558  -0.0991 93  ILE B CB  
2453 C CG1 . ILE B 115 ? 0.7882 0.8914 0.8018 -0.1491 0.0562  -0.0892 93  ILE B CG1 
2454 C CG2 . ILE B 115 ? 0.7595 0.8955 0.8045 -0.1448 0.0520  -0.1173 93  ILE B CG2 
2455 C CD1 . ILE B 115 ? 0.8121 0.9439 0.8138 -0.1406 0.0662  -0.0903 93  ILE B CD1 
2456 N N   . CYS B 116 ? 0.9499 1.1064 1.0517 -0.1980 0.0497  -0.1043 94  CYS B N   
2457 C CA  . CYS B 116 ? 0.8911 1.0811 1.0226 -0.2037 0.0454  -0.1158 94  CYS B CA  
2458 C C   . CYS B 116 ? 0.9455 1.1137 1.0908 -0.2217 0.0298  -0.1201 94  CYS B C   
2459 O O   . CYS B 116 ? 1.0240 1.2026 1.1815 -0.2182 0.0173  -0.1358 94  CYS B O   
2460 C CB  . CYS B 116 ? 0.7942 1.0364 0.9482 -0.2142 0.0614  -0.1081 94  CYS B CB  
2461 S SG  . CYS B 116 ? 0.8788 1.1507 1.0209 -0.1898 0.0767  -0.1142 94  CYS B SG  
2462 N N   . ASN B 117 ? 0.9097 1.0462 1.0524 -0.2415 0.0293  -0.1062 95  ASN B N   
2463 C CA  . ASN B 117 ? 0.9801 1.0857 1.1341 -0.2602 0.0131  -0.1128 95  ASN B CA  
2464 C C   . ASN B 117 ? 1.2048 1.2657 1.3348 -0.2407 -0.0026 -0.1309 95  ASN B C   
2465 O O   . ASN B 117 ? 1.3732 1.4213 1.5114 -0.2484 -0.0189 -0.1477 95  ASN B O   
2466 C CB  . ASN B 117 ? 0.9931 1.0675 1.1493 -0.2863 0.0170  -0.0910 95  ASN B CB  
2467 C CG  . ASN B 117 ? 1.0557 1.1811 1.2346 -0.3074 0.0349  -0.0707 95  ASN B CG  
2468 O OD1 . ASN B 117 ? 1.0171 1.2021 1.2218 -0.3094 0.0402  -0.0776 95  ASN B OD1 
2469 N ND2 . ASN B 117 ? 1.1329 1.2368 1.3022 -0.3218 0.0443  -0.0446 95  ASN B ND2 
2470 N N   . ASP B 118 ? 1.2318 1.2737 1.3323 -0.2157 0.0019  -0.1291 96  ASP B N   
2471 C CA  . ASP B 118 ? 1.2492 1.2611 1.3272 -0.1937 -0.0099 -0.1464 96  ASP B CA  
2472 C C   . ASP B 118 ? 1.1339 1.1796 1.2188 -0.1834 -0.0172 -0.1647 96  ASP B C   
2473 O O   . ASP B 118 ? 1.1366 1.1671 1.2157 -0.1795 -0.0322 -0.1828 96  ASP B O   
2474 C CB  . ASP B 118 ? 1.3367 1.3369 1.3876 -0.1703 -0.0015 -0.1385 96  ASP B CB  
2475 C CG  . ASP B 118 ? 1.4297 1.3943 1.4573 -0.1493 -0.0118 -0.1522 96  ASP B CG  
2476 O OD1 . ASP B 118 ? 1.4897 1.4173 1.5160 -0.1547 -0.0243 -0.1633 96  ASP B OD1 
2477 O OD2 . ASP B 118 ? 1.4657 1.4420 1.4773 -0.1277 -0.0072 -0.1537 96  ASP B OD2 
2478 N N   . VAL B 119 ? 1.0088 1.1000 1.1043 -0.1773 -0.0070 -0.1605 97  VAL B N   
2479 C CA  . VAL B 119 ? 0.9630 1.0858 1.0643 -0.1642 -0.0130 -0.1730 97  VAL B CA  
2480 C C   . VAL B 119 ? 0.9619 1.1091 1.0909 -0.1812 -0.0252 -0.1822 97  VAL B C   
2481 O O   . VAL B 119 ? 0.9255 1.0765 1.0509 -0.1743 -0.0402 -0.1974 97  VAL B O   
2482 C CB  . VAL B 119 ? 0.8677 1.0245 0.9733 -0.1519 0.0015  -0.1655 97  VAL B CB  
2483 C CG1 . VAL B 119 ? 0.7723 0.9559 0.8838 -0.1370 -0.0049 -0.1743 97  VAL B CG1 
2484 C CG2 . VAL B 119 ? 0.9052 1.0397 0.9832 -0.1369 0.0099  -0.1596 97  VAL B CG2 
2485 N N   . LEU B 120 ? 0.9868 1.1555 1.1439 -0.2045 -0.0194 -0.1730 98  LEU B N   
2486 C CA  . LEU B 120 ? 0.9265 1.1286 1.1156 -0.2226 -0.0311 -0.1814 98  LEU B CA  
2487 C C   . LEU B 120 ? 0.9624 1.1279 1.1478 -0.2387 -0.0507 -0.1958 98  LEU B C   
2488 O O   . LEU B 120 ? 0.8599 1.0520 1.0650 -0.2488 -0.0662 -0.2095 98  LEU B O   
2489 C CB  . LEU B 120 ? 0.7329 0.9738 0.9560 -0.2456 -0.0184 -0.1670 98  LEU B CB  
2490 C CG  . LEU B 120 ? 0.7622 1.0464 0.9933 -0.2310 0.0011  -0.1571 98  LEU B CG  
2491 C CD1 . LEU B 120 ? 0.6705 0.9774 0.9206 -0.2536 0.0181  -0.1396 98  LEU B CD1 
2492 C CD2 . LEU B 120 ? 0.8789 1.2153 1.1326 -0.2161 -0.0044 -0.1671 98  LEU B CD2 
2493 N N   . SER B 121 ? 0.9960 1.1016 1.1556 -0.2387 -0.0517 -0.1951 99  SER B N   
2494 C CA  . SER B 121 ? 1.1068 1.1695 1.2581 -0.2488 -0.0709 -0.2137 99  SER B CA  
2495 C C   . SER B 121 ? 1.0613 1.1193 1.1854 -0.2222 -0.0834 -0.2353 99  SER B C   
2496 O O   . SER B 121 ? 1.1605 1.2141 1.2846 -0.2291 -0.1024 -0.2572 99  SER B O   
2497 C CB  . SER B 121 ? 1.1573 1.1548 1.2929 -0.2565 -0.0673 -0.2042 99  SER B CB  
2498 O OG  . SER B 121 ? 1.1769 1.1805 1.3380 -0.2857 -0.0576 -0.1828 99  SER B OG  
2499 N N   . LEU B 122 ? 0.9302 0.9919 1.0306 -0.1932 -0.0730 -0.2296 100 LEU B N   
2500 C CA  . LEU B 122 ? 0.9197 0.9912 0.9974 -0.1693 -0.0822 -0.2454 100 LEU B CA  
2501 C C   . LEU B 122 ? 0.8892 1.0153 0.9869 -0.1714 -0.0923 -0.2517 100 LEU B C   
2502 O O   . LEU B 122 ? 0.9472 1.0807 1.0320 -0.1640 -0.1085 -0.2699 100 LEU B O   
2503 C CB  . LEU B 122 ? 0.8822 0.9532 0.9362 -0.1421 -0.0677 -0.2342 100 LEU B CB  
2504 C CG  . LEU B 122 ? 0.8706 0.8960 0.9016 -0.1326 -0.0596 -0.2291 100 LEU B CG  
2505 C CD1 . LEU B 122 ? 0.8388 0.8720 0.8444 -0.1050 -0.0531 -0.2281 100 LEU B CD1 
2506 C CD2 . LEU B 122 ? 0.7626 0.7394 0.7818 -0.1378 -0.0732 -0.2469 100 LEU B CD2 
2507 N N   . LEU B 123 ? 0.9061 1.0742 1.0348 -0.1797 -0.0834 -0.2374 101 LEU B N   
2508 C CA  . LEU B 123 ? 0.8861 1.1095 1.0350 -0.1760 -0.0931 -0.2417 101 LEU B CA  
2509 C C   . LEU B 123 ? 0.9762 1.2164 1.1490 -0.2017 -0.1129 -0.2573 101 LEU B C   
2510 O O   . LEU B 123 ? 0.8770 1.1498 1.0512 -0.1955 -0.1301 -0.2699 101 LEU B O   
2511 C CB  . LEU B 123 ? 0.7077 0.9737 0.8838 -0.1723 -0.0774 -0.2242 101 LEU B CB  
2512 C CG  . LEU B 123 ? 0.7993 1.0613 0.9569 -0.1460 -0.0615 -0.2119 101 LEU B CG  
2513 C CD1 . LEU B 123 ? 0.8091 1.0867 0.9869 -0.1513 -0.0417 -0.1974 101 LEU B CD1 
2514 C CD2 . LEU B 123 ? 0.8315 1.1231 0.9852 -0.1226 -0.0692 -0.2130 101 LEU B CD2 
2515 N N   . GLU B 124 ? 0.9343 1.1518 1.1243 -0.2314 -0.1124 -0.2566 102 GLU B N   
2516 C CA  . GLU B 124 ? 0.9608 1.1953 1.1768 -0.2600 -0.1323 -0.2722 102 GLU B CA  
2517 C C   . GLU B 124 ? 1.2046 1.3942 1.3913 -0.2608 -0.1527 -0.2990 102 GLU B C   
2518 O O   . GLU B 124 ? 1.4646 1.6793 1.6622 -0.2730 -0.1745 -0.3191 102 GLU B O   
2519 C CB  . GLU B 124 ? 0.9013 1.1322 1.1514 -0.2965 -0.1244 -0.2596 102 GLU B CB  
2520 N N   . LYS B 125 ? 1.1896 1.3168 1.3393 -0.2465 -0.1470 -0.3019 103 LYS B N   
2521 C CA  . LYS B 125 ? 1.1644 1.2479 1.2868 -0.2461 -0.1658 -0.3309 103 LYS B CA  
2522 C C   . LYS B 125 ? 1.1746 1.2694 1.2583 -0.2114 -0.1716 -0.3449 103 LYS B C   
2523 O O   . LYS B 125 ? 1.2794 1.3648 1.3443 -0.2109 -0.1914 -0.3735 103 LYS B O   
2524 C CB  . LYS B 125 ? 1.1414 1.1472 1.2496 -0.2531 -0.1597 -0.3298 103 LYS B CB  
2525 C CG  . LYS B 125 ? 1.1527 1.1067 1.2171 -0.2293 -0.1670 -0.3530 103 LYS B CG  
2526 C CD  . LYS B 125 ? 1.1249 1.0013 1.1773 -0.2314 -0.1606 -0.3494 103 LYS B CD  
2527 C CE  . LYS B 125 ? 1.1457 0.9681 1.1968 -0.2528 -0.1822 -0.3795 103 LYS B CE  
2528 N NZ  . LYS B 125 ? 1.2470 0.9851 1.2775 -0.2443 -0.1795 -0.3824 103 LYS B NZ  
2529 N N   . PHE B 126 ? 1.1185 1.2377 1.1906 -0.1843 -0.1558 -0.3258 104 PHE B N   
2530 C CA  . PHE B 126 ? 1.1079 1.2363 1.1421 -0.1528 -0.1583 -0.3337 104 PHE B CA  
2531 C C   . PHE B 126 ? 1.1071 1.2954 1.1476 -0.1366 -0.1560 -0.3185 104 PHE B C   
2532 O O   . PHE B 126 ? 1.1503 1.3676 1.1732 -0.1236 -0.1700 -0.3295 104 PHE B O   
2533 C CB  . PHE B 126 ? 1.1063 1.1948 1.1108 -0.1308 -0.1407 -0.3250 104 PHE B CB  
2534 C CG  . PHE B 126 ? 1.1182 1.1432 1.1097 -0.1367 -0.1424 -0.3389 104 PHE B CG  
2535 C CD1 . PHE B 126 ? 0.8877 0.8779 0.8908 -0.1450 -0.1279 -0.3206 104 PHE B CD1 
2536 C CD2 . PHE B 126 ? 1.2036 1.2026 1.1684 -0.1305 -0.1584 -0.3701 104 PHE B CD2 
2537 C CE1 . PHE B 126 ? 0.9410 0.8689 0.9321 -0.1472 -0.1299 -0.3302 104 PHE B CE1 
2538 C CE2 . PHE B 126 ? 1.2043 1.1382 1.1573 -0.1324 -0.1602 -0.3839 104 PHE B CE2 
2539 C CZ  . PHE B 126 ? 1.1194 1.0161 1.0866 -0.1404 -0.1461 -0.3622 104 PHE B CZ  
2540 N N   . LEU B 127 ? 1.0850 1.2905 1.1482 -0.1355 -0.1386 -0.2932 105 LEU B N   
2541 C CA  . LEU B 127 ? 1.0447 1.2897 1.1068 -0.1135 -0.1326 -0.2767 105 LEU B CA  
2542 C C   . LEU B 127 ? 0.9966 1.2988 1.0875 -0.1178 -0.1468 -0.2771 105 LEU B C   
2543 O O   . LEU B 127 ? 0.9898 1.3220 1.0666 -0.0989 -0.1564 -0.2761 105 LEU B O   
2544 C CB  . LEU B 127 ? 0.9245 1.1606 0.9954 -0.1077 -0.1087 -0.2535 105 LEU B CB  
2545 C CG  . LEU B 127 ? 0.8518 1.0446 0.8887 -0.0949 -0.0972 -0.2517 105 LEU B CG  
2546 C CD1 . LEU B 127 ? 0.8496 1.0326 0.8923 -0.0913 -0.0757 -0.2318 105 LEU B CD1 
2547 C CD2 . LEU B 127 ? 0.8356 1.0362 0.8386 -0.0717 -0.1022 -0.2553 105 LEU B CD2 
2548 N N   . ILE B 128 ? 1.0249 1.3470 1.1566 -0.1417 -0.1483 -0.2765 106 ILE B N   
2549 C CA  . ILE B 128 ? 1.0166 1.4017 1.1823 -0.1459 -0.1621 -0.2769 106 ILE B CA  
2550 C C   . ILE B 128 ? 1.0726 1.4741 1.2280 -0.1531 -0.1901 -0.3013 106 ILE B C   
2551 O O   . ILE B 128 ? 1.0826 1.5281 1.2335 -0.1354 -0.2033 -0.3005 106 ILE B O   
2552 C CB  . ILE B 128 ? 0.9056 1.3149 1.1204 -0.1717 -0.1548 -0.2700 106 ILE B CB  
2553 C CG1 . ILE B 128 ? 0.9026 1.3097 1.1271 -0.1604 -0.1281 -0.2474 106 ILE B CG1 
2554 C CG2 . ILE B 128 ? 0.7543 1.2343 1.0076 -0.1790 -0.1724 -0.2746 106 ILE B CG2 
2555 C CD1 . ILE B 128 ? 0.8967 1.3190 1.1608 -0.1872 -0.1160 -0.2401 106 ILE B CD1 
2556 N N   . PRO B 129 ? 1.1061 1.4723 1.2547 -0.1769 -0.2010 -0.3235 107 PRO B N   
2557 C CA  . PRO B 129 ? 1.1137 1.4984 1.2520 -0.1846 -0.2298 -0.3512 107 PRO B CA  
2558 C C   . PRO B 129 ? 1.1047 1.4933 1.1941 -0.1538 -0.2383 -0.3588 107 PRO B C   
2559 O O   . PRO B 129 ? 1.1704 1.6023 1.2552 -0.1521 -0.2617 -0.3733 107 PRO B O   
2560 C CB  . PRO B 129 ? 1.1412 1.4685 1.2771 -0.2140 -0.2355 -0.3732 107 PRO B CB  
2561 C CG  . PRO B 129 ? 1.1095 1.3824 1.2384 -0.2113 -0.2101 -0.3562 107 PRO B CG  
2562 C CD  . PRO B 129 ? 1.0928 1.3997 1.2423 -0.1976 -0.1895 -0.3252 107 PRO B CD  
2563 N N   . ASN B 130 ? 1.0835 1.4347 1.1368 -0.1302 -0.2204 -0.3484 108 ASN B N   
2564 C CA  . ASN B 130 ? 1.1497 1.5088 1.1563 -0.1021 -0.2256 -0.3523 108 ASN B CA  
2565 C C   . ASN B 130 ? 1.1602 1.5562 1.1660 -0.0761 -0.2161 -0.3218 108 ASN B C   
2566 O O   . ASN B 130 ? 1.1220 1.5210 1.0888 -0.0522 -0.2143 -0.3160 108 ASN B O   
2567 C CB  . ASN B 130 ? 1.1466 1.4480 1.1132 -0.0916 -0.2132 -0.3613 108 ASN B CB  
2568 C CG  . ASN B 130 ? 1.3236 1.5772 1.2899 -0.1141 -0.2220 -0.3906 108 ASN B CG  
2569 O OD1 . ASN B 130 ? 1.5039 1.7667 1.4987 -0.1411 -0.2384 -0.4051 108 ASN B OD1 
2570 N ND2 . ASN B 130 ? 1.3185 1.5213 1.2538 -0.1028 -0.2118 -0.3994 108 ASN B ND2 
2571 N N   . ALA B 131 ? 1.2057 1.6296 1.2537 -0.0800 -0.2099 -0.3022 109 ALA B N   
2572 C CA  . ALA B 131 ? 1.1781 1.6322 1.2303 -0.0552 -0.2024 -0.2742 109 ALA B CA  
2573 C C   . ALA B 131 ? 1.2073 1.7192 1.2571 -0.0450 -0.2276 -0.2776 109 ALA B C   
2574 O O   . ALA B 131 ? 1.2919 1.8484 1.3792 -0.0572 -0.2427 -0.2833 109 ALA B O   
2575 C CB  . ALA B 131 ? 1.1084 1.5713 1.2063 -0.0608 -0.1869 -0.2567 109 ALA B CB  
2576 N N   A SER B 132 ? 1.1629 1.6792 1.1681 -0.0225 -0.2324 -0.2726 110 SER B N   
2577 N N   B SER B 132 ? 1.1651 1.6812 1.1703 -0.0226 -0.2323 -0.2727 110 SER B N   
2578 C CA  A SER B 132 ? 1.1310 1.7024 1.1241 -0.0117 -0.2584 -0.2767 110 SER B CA  
2579 C CA  B SER B 132 ? 1.1306 1.7016 1.1235 -0.0116 -0.2582 -0.2766 110 SER B CA  
2580 C C   A SER B 132 ? 1.1509 1.7694 1.1753 0.0056  -0.2617 -0.2491 110 SER B C   
2581 C C   B SER B 132 ? 1.1497 1.7677 1.1744 0.0053  -0.2615 -0.2491 110 SER B C   
2582 O O   A SER B 132 ? 1.1876 1.8600 1.2427 -0.0001 -0.2824 -0.2557 110 SER B O   
2583 O O   B SER B 132 ? 1.1904 1.8619 1.2466 -0.0008 -0.2819 -0.2559 110 SER B O   
2584 C CB  A SER B 132 ? 1.0839 1.6477 1.0166 0.0082  -0.2597 -0.2764 110 SER B CB  
2585 C CB  B SER B 132 ? 1.0829 1.6463 1.0157 0.0086  -0.2592 -0.2757 110 SER B CB  
2586 O OG  A SER B 132 ? 1.0324 1.6521 0.9487 0.0255  -0.2811 -0.2691 110 SER B OG  
2587 O OG  B SER B 132 ? 1.0598 1.5691 0.9708 0.0127  -0.2335 -0.2684 110 SER B OG  
2588 N N   . GLN B 133 ? 1.1822 1.7809 1.2010 0.0269  -0.2420 -0.2185 111 GLN B N   
2589 C CA  . GLN B 133 ? 1.2368 1.8705 1.2755 0.0508  -0.2449 -0.1901 111 GLN B CA  
2590 C C   . GLN B 133 ? 1.0675 1.7024 1.1609 0.0460  -0.2313 -0.1829 111 GLN B C   
2591 O O   . GLN B 133 ? 1.0471 1.6611 1.1625 0.0219  -0.2206 -0.1984 111 GLN B O   
2592 C CB  . GLN B 133 ? 1.4071 2.0143 1.4062 0.0757  -0.2322 -0.1615 111 GLN B CB  
2593 C CG  . GLN B 133 ? 1.4880 2.1062 1.4317 0.0823  -0.2451 -0.1674 111 GLN B CG  
2594 C CD  . GLN B 133 ? 1.5234 2.0980 1.4262 0.0916  -0.2237 -0.1501 111 GLN B CD  
2595 O OE1 . GLN B 133 ? 1.4651 2.0208 1.3702 0.1064  -0.2090 -0.1184 111 GLN B OE1 
2596 N NE2 . GLN B 133 ? 1.5809 2.1400 1.4464 0.0828  -0.2220 -0.1718 111 GLN B NE2 
2597 N N   . ALA B 134 ? 1.2971 1.5206 1.0280 -0.0261 -0.2009 -0.2403 112 ALA B N   
2598 C CA  . ALA B 134 ? 1.1100 1.3683 0.9379 -0.0359 -0.2045 -0.2164 112 ALA B CA  
2599 C C   . ALA B 134 ? 1.1929 1.4908 1.0541 -0.0433 -0.1524 -0.2034 112 ALA B C   
2600 O O   . ALA B 134 ? 1.2466 1.5750 1.1893 -0.0494 -0.1470 -0.1937 112 ALA B O   
2601 C CB  . ALA B 134 ? 1.0087 1.2483 0.8336 -0.0381 -0.2377 -0.1947 112 ALA B CB  
2602 N N   . GLU B 135 ? 1.2513 1.5469 1.0504 -0.0441 -0.1144 -0.2022 113 GLU B N   
2603 C CA  . GLU B 135 ? 1.1666 1.4977 1.0015 -0.0510 -0.0687 -0.1925 113 GLU B CA  
2604 C C   . GLU B 135 ? 1.1563 1.5125 1.0545 -0.0484 -0.0605 -0.2107 113 GLU B C   
2605 O O   . GLU B 135 ? 0.9858 1.3657 0.9494 -0.0544 -0.0500 -0.1984 113 GLU B O   
2606 C CB  . GLU B 135 ? 1.1074 1.4340 0.8698 -0.0538 -0.0286 -0.1934 113 GLU B CB  
2607 N N   . SER B 136 ? 1.3055 1.6502 1.1805 -0.0384 -0.0697 -0.2411 114 SER B N   
2608 C CA  . SER B 136 ? 1.2475 1.6081 1.1777 -0.0347 -0.0683 -0.2609 114 SER B CA  
2609 C C   . SER B 136 ? 1.1182 1.4763 1.1134 -0.0401 -0.1053 -0.2536 114 SER B C   
2610 O O   . SER B 136 ? 1.0746 1.4488 1.1291 -0.0460 -0.0979 -0.2491 114 SER B O   
2611 C CB  . SER B 136 ? 1.2768 1.6236 1.1618 -0.0198 -0.0687 -0.2981 114 SER B CB  
2612 O OG  . SER B 136 ? 1.4231 1.7872 1.2745 -0.0175 -0.0215 -0.3063 114 SER B OG  
2613 N N   . LYS B 137 ? 1.1477 1.4834 1.1327 -0.0395 -0.1458 -0.2516 115 LYS B N   
2614 C CA  . LYS B 137 ? 1.1870 1.5241 1.2407 -0.0478 -0.1793 -0.2439 115 LYS B CA  
2615 C C   . LYS B 137 ? 1.1487 1.5142 1.2643 -0.0607 -0.1597 -0.2150 115 LYS B C   
2616 O O   . LYS B 137 ? 1.1021 1.4767 1.2756 -0.0698 -0.1621 -0.2108 115 LYS B O   
2617 C CB  . LYS B 137 ? 1.2432 1.5548 1.2829 -0.0460 -0.2266 -0.2435 115 LYS B CB  
2618 N N   . VAL B 138 ? 1.0743 1.4485 1.1733 -0.0618 -0.1416 -0.1949 116 VAL B N   
2619 C CA  . VAL B 138 ? 1.0088 1.4069 1.1574 -0.0704 -0.1197 -0.1703 116 VAL B CA  
2620 C C   . VAL B 138 ? 1.0209 1.4300 1.1810 -0.0726 -0.0855 -0.1727 116 VAL B C   
2621 O O   . VAL B 138 ? 1.0807 1.4987 1.2898 -0.0805 -0.0787 -0.1632 116 VAL B O   
2622 C CB  . VAL B 138 ? 1.0368 1.4349 1.1576 -0.0684 -0.1126 -0.1512 116 VAL B CB  
2623 C CG1 . VAL B 138 ? 0.9040 1.3218 1.0550 -0.0730 -0.0804 -0.1311 116 VAL B CG1 
2624 C CG2 . VAL B 138 ? 1.1463 1.5369 1.2846 -0.0673 -0.1519 -0.1446 116 VAL B CG2 
2625 N N   . PHE B 139 ? 0.9720 1.3792 1.0870 -0.0662 -0.0636 -0.1854 117 PHE B N   
2626 C CA  . PHE B 139 ? 0.8350 1.2530 0.9676 -0.0673 -0.0348 -0.1887 117 PHE B CA  
2627 C C   . PHE B 139 ? 0.8463 1.2580 1.0190 -0.0688 -0.0492 -0.2032 117 PHE B C   
2628 O O   . PHE B 139 ? 0.9258 1.3383 1.1349 -0.0759 -0.0416 -0.1923 117 PHE B O   
2629 C CB  . PHE B 139 ? 0.8529 1.2750 0.9399 -0.0605 -0.0099 -0.2042 117 PHE B CB  
2630 C CG  . PHE B 139 ? 0.8566 1.2926 0.9711 -0.0609 0.0166  -0.2097 117 PHE B CG  
2631 C CD1 . PHE B 139 ? 0.8157 1.2504 0.9562 -0.0548 0.0103  -0.2354 117 PHE B CD1 
2632 C CD2 . PHE B 139 ? 0.8109 1.2571 0.9272 -0.0668 0.0428  -0.1898 117 PHE B CD2 
2633 C CE1 . PHE B 139 ? 0.6797 1.1245 0.8512 -0.0540 0.0289  -0.2418 117 PHE B CE1 
2634 C CE2 . PHE B 139 ? 0.7392 1.1955 0.8856 -0.0672 0.0617  -0.1952 117 PHE B CE2 
2635 C CZ  . PHE B 139 ? 0.6588 1.1150 0.8345 -0.0605 0.0544  -0.2217 117 PHE B CZ  
2636 N N   . TYR B 140 ? 0.7938 1.1923 0.9546 -0.0623 -0.0736 -0.2276 118 TYR B N   
2637 C CA  . TYR B 140 ? 0.7745 1.1601 0.9689 -0.0638 -0.0919 -0.2424 118 TYR B CA  
2638 C C   . TYR B 140 ? 0.8124 1.1911 1.0509 -0.0791 -0.1123 -0.2229 118 TYR B C   
2639 O O   . TYR B 140 ? 0.8026 1.1669 1.0689 -0.0860 -0.1217 -0.2258 118 TYR B O   
2640 C CB  . TYR B 140 ? 0.8310 1.2001 1.0001 -0.0511 -0.1163 -0.2756 118 TYR B CB  
2641 C CG  . TYR B 140 ? 1.0239 1.4014 1.1574 -0.0355 -0.0924 -0.3017 118 TYR B CG  
2642 C CD1 . TYR B 140 ? 1.1165 1.5024 1.2762 -0.0306 -0.0761 -0.3166 118 TYR B CD1 
2643 C CD2 . TYR B 140 ? 1.2685 1.6433 1.3422 -0.0257 -0.0873 -0.3132 118 TYR B CD2 
2644 C CE1 . TYR B 140 ? 1.2213 1.6228 1.3607 -0.0163 -0.0506 -0.3428 118 TYR B CE1 
2645 C CE2 . TYR B 140 ? 1.4273 1.8132 1.4681 -0.0128 -0.0584 -0.3379 118 TYR B CE2 
2646 C CZ  . TYR B 140 ? 1.3860 1.7901 1.4662 -0.0081 -0.0383 -0.3531 118 TYR B CZ  
2647 O OH  . TYR B 140 ? 1.4930 1.9159 1.5527 0.0044  -0.0062 -0.3793 118 TYR B OH  
2648 N N   . LEU B 141 ? 0.8775 1.2650 1.1251 -0.0852 -0.1197 -0.2035 119 LEU B N   
2649 C CA  . LEU B 141 ? 0.8645 1.2533 1.1636 -0.1014 -0.1308 -0.1851 119 LEU B CA  
2650 C C   . LEU B 141 ? 0.8070 1.2089 1.1265 -0.1091 -0.0988 -0.1608 119 LEU B C   
2651 O O   . LEU B 141 ? 0.9052 1.3030 1.2595 -0.1234 -0.0973 -0.1482 119 LEU B O   
2652 C CB  . LEU B 141 ? 0.8005 1.1961 1.1186 -0.1049 -0.1574 -0.1775 119 LEU B CB  
2653 C CG  . LEU B 141 ? 0.8276 1.2028 1.1344 -0.1006 -0.2004 -0.1977 119 LEU B CG  
2654 C CD1 . LEU B 141 ? 0.8523 1.2332 1.1684 -0.0997 -0.2250 -0.1895 119 LEU B CD1 
2655 C CD2 . LEU B 141 ? 0.8864 1.2459 1.2325 -0.1144 -0.2241 -0.2016 119 LEU B CD2 
2656 N N   . LYS B 142 ? 0.7247 1.1374 1.0182 -0.1007 -0.0728 -0.1544 120 LYS B N   
2657 C CA  . LYS B 142 ? 0.6751 1.0910 0.9791 -0.1050 -0.0446 -0.1361 120 LYS B CA  
2658 C C   . LYS B 142 ? 0.6895 1.0846 0.9922 -0.1073 -0.0393 -0.1451 120 LYS B C   
2659 O O   . LYS B 142 ? 0.7695 1.1517 1.0868 -0.1166 -0.0301 -0.1319 120 LYS B O   
2660 C CB  . LYS B 142 ? 0.6059 1.0332 0.8816 -0.0960 -0.0243 -0.1275 120 LYS B CB  
2661 C CG  . LYS B 142 ? 0.5720 0.9931 0.8380 -0.0946 0.0005  -0.1224 120 LYS B CG  
2662 C CD  . LYS B 142 ? 0.6825 1.1129 0.9239 -0.0888 0.0162  -0.1097 120 LYS B CD  
2663 C CE  . LYS B 142 ? 0.7412 1.1660 0.9686 -0.0868 0.0361  -0.1110 120 LYS B CE  
2664 N NZ  . LYS B 142 ? 0.7479 1.1557 0.9962 -0.0909 0.0413  -0.1051 120 LYS B NZ  
2665 N N   . MET B 143 ? 0.7466 1.1351 1.0305 -0.0982 -0.0464 -0.1690 121 MET B N   
2666 C CA  . MET B 143 ? 0.7681 1.1348 1.0578 -0.0981 -0.0497 -0.1821 121 MET B CA  
2667 C C   . MET B 143 ? 0.7840 1.1242 1.0945 -0.1113 -0.0734 -0.1803 121 MET B C   
2668 O O   . MET B 143 ? 0.8304 1.1435 1.1451 -0.1186 -0.0731 -0.1751 121 MET B O   
2669 C CB  . MET B 143 ? 0.7394 1.1100 1.0138 -0.0836 -0.0546 -0.2127 121 MET B CB  
2670 C CG  . MET B 143 ? 0.8235 1.1767 1.1110 -0.0792 -0.0579 -0.2295 121 MET B CG  
2671 S SD  . MET B 143 ? 0.9358 1.3116 1.2129 -0.0599 -0.0463 -0.2635 121 MET B SD  
2672 C CE  . MET B 143 ? 0.9735 1.3205 1.2750 -0.0517 -0.0794 -0.2967 121 MET B CE  
2673 N N   . LYS B 144 ? 0.7370 1.0796 1.0581 -0.1164 -0.0962 -0.1828 122 LYS B N   
2674 C CA  . LYS B 144 ? 0.7440 1.0618 1.0876 -0.1335 -0.1186 -0.1772 122 LYS B CA  
2675 C C   . LYS B 144 ? 0.8237 1.1409 1.1833 -0.1507 -0.0967 -0.1473 122 LYS B C   
2676 O O   . LYS B 144 ? 0.9553 1.2396 1.3143 -0.1643 -0.0992 -0.1399 122 LYS B O   
2677 C CB  . LYS B 144 ? 0.7613 1.0848 1.1190 -0.1363 -0.1489 -0.1841 122 LYS B CB  
2678 C CG  . LYS B 144 ? 0.7085 1.0010 1.0881 -0.1540 -0.1807 -0.1843 122 LYS B CG  
2679 C CD  . LYS B 144 ? 0.6258 0.9279 1.0325 -0.1622 -0.2081 -0.1817 122 LYS B CD  
2680 C CE  . LYS B 144 ? 0.7258 0.9903 1.1464 -0.1763 -0.2485 -0.1895 122 LYS B CE  
2681 N NZ  . LYS B 144 ? 0.7595 1.0291 1.2115 -0.1852 -0.2828 -0.1884 122 LYS B NZ  
2682 N N   . GLY B 145 ? 0.6871 1.0366 1.0567 -0.1492 -0.0753 -0.1307 123 GLY B N   
2683 C CA  . GLY B 145 ? 0.6983 1.0512 1.0829 -0.1617 -0.0498 -0.1055 123 GLY B CA  
2684 C C   . GLY B 145 ? 0.7676 1.0919 1.1229 -0.1604 -0.0301 -0.1001 123 GLY B C   
2685 O O   . GLY B 145 ? 0.8195 1.1172 1.1715 -0.1755 -0.0214 -0.0864 123 GLY B O   
2686 N N   . ASP B 146 ? 0.7587 1.0845 1.0902 -0.1436 -0.0243 -0.1108 124 ASP B N   
2687 C CA  . ASP B 146 ? 0.6353 0.9312 0.9429 -0.1406 -0.0127 -0.1083 124 ASP B CA  
2688 C C   . ASP B 146 ? 0.6473 0.8954 0.9464 -0.1508 -0.0334 -0.1152 124 ASP B C   
2689 O O   . ASP B 146 ? 0.6476 0.8586 0.9287 -0.1614 -0.0263 -0.1009 124 ASP B O   
2690 C CB  . ASP B 146 ? 0.4962 0.8062 0.7919 -0.1233 -0.0080 -0.1219 124 ASP B CB  
2691 C CG  . ASP B 146 ? 0.6606 1.0021 0.9522 -0.1158 0.0135  -0.1089 124 ASP B CG  
2692 O OD1 . ASP B 146 ? 0.7607 1.1047 1.0562 -0.1202 0.0280  -0.0895 124 ASP B OD1 
2693 O OD2 . ASP B 146 ? 0.6893 1.0507 0.9720 -0.1055 0.0167  -0.1182 124 ASP B OD2 
2694 N N   . TYR B 147 ? 0.6551 0.8974 0.9611 -0.1466 -0.0612 -0.1381 125 TYR B N   
2695 C CA  . TYR B 147 ? 0.6861 0.8774 0.9835 -0.1536 -0.0879 -0.1477 125 TYR B CA  
2696 C C   . TYR B 147 ? 0.8241 0.9873 1.1227 -0.1782 -0.0977 -0.1308 125 TYR B C   
2697 O O   . TYR B 147 ? 1.0100 1.1191 1.2912 -0.1886 -0.1188 -0.1317 125 TYR B O   
2698 C CB  . TYR B 147 ? 0.6380 0.8321 0.9452 -0.1386 -0.1155 -0.1808 125 TYR B CB  
2699 C CG  . TYR B 147 ? 0.7591 0.9659 1.0658 -0.1189 -0.1050 -0.1976 125 TYR B CG  
2700 C CD1 . TYR B 147 ? 0.7488 1.0041 1.0574 -0.1069 -0.0800 -0.1996 125 TYR B CD1 
2701 C CD2 . TYR B 147 ? 0.6580 0.8264 0.9644 -0.1138 -0.1216 -0.2105 125 TYR B CD2 
2702 C CE1 . TYR B 147 ? 0.7573 1.0279 1.0705 -0.0930 -0.0669 -0.2123 125 TYR B CE1 
2703 C CE2 . TYR B 147 ? 0.7648 0.9514 1.0840 -0.0971 -0.1115 -0.2261 125 TYR B CE2 
2704 C CZ  . TYR B 147 ? 0.7922 1.0326 1.1162 -0.0880 -0.0815 -0.2261 125 TYR B CZ  
2705 O OH  . TYR B 147 ? 0.6453 0.9080 0.9863 -0.0753 -0.0676 -0.2392 125 TYR B OH  
2706 N N   . TYR B 148 ? 0.7997 0.9961 1.1208 -0.1891 -0.0857 -0.1156 126 TYR B N   
2707 C CA  . TYR B 148 ? 0.8529 1.0245 1.1773 -0.2164 -0.0838 -0.0942 126 TYR B CA  
2708 C C   . TYR B 148 ? 0.7430 0.9023 1.0440 -0.2237 -0.0464 -0.0704 126 TYR B C   
2709 O O   . TYR B 148 ? 0.7140 0.8257 0.9894 -0.2440 -0.0439 -0.0558 126 TYR B O   
2710 C CB  . TYR B 148 ? 0.7738 0.9852 1.1428 -0.2274 -0.0887 -0.0884 126 TYR B CB  
2711 C CG  . TYR B 148 ? 0.7581 0.9515 1.1408 -0.2335 -0.1329 -0.1044 126 TYR B CG  
2712 C CD1 . TYR B 148 ? 0.7339 0.8719 1.1035 -0.2545 -0.1567 -0.1005 126 TYR B CD1 
2713 C CD2 . TYR B 148 ? 0.7760 1.0010 1.1781 -0.2180 -0.1538 -0.1237 126 TYR B CD2 
2714 C CE1 . TYR B 148 ? 0.7545 0.8713 1.1363 -0.2590 -0.2022 -0.1162 126 TYR B CE1 
2715 C CE2 . TYR B 148 ? 0.7608 0.9641 1.1710 -0.2209 -0.1976 -0.1408 126 TYR B CE2 
2716 C CZ  . TYR B 148 ? 0.7553 0.9059 1.1585 -0.2410 -0.2225 -0.1373 126 TYR B CZ  
2717 O OH  . TYR B 148 ? 0.7209 0.8458 1.1315 -0.2425 -0.2702 -0.1554 126 TYR B OH  
2718 N N   . ARG B 149 ? 0.6188 0.8133 0.9206 -0.2070 -0.0190 -0.0670 127 ARG B N   
2719 C CA  . ARG B 149 ? 0.6271 0.8056 0.9006 -0.2079 0.0138  -0.0491 127 ARG B CA  
2720 C C   . ARG B 149 ? 0.8297 0.9418 1.0526 -0.2066 0.0028  -0.0519 127 ARG B C   
2721 O O   . ARG B 149 ? 1.0062 1.0757 1.1909 -0.2179 0.0195  -0.0354 127 ARG B O   
2722 C CB  . ARG B 149 ? 0.6287 0.8519 0.9117 -0.1867 0.0350  -0.0492 127 ARG B CB  
2723 C CG  . ARG B 149 ? 0.6673 0.8704 0.9163 -0.1800 0.0628  -0.0363 127 ARG B CG  
2724 C CD  . ARG B 149 ? 0.7206 0.9776 0.9962 -0.1662 0.0823  -0.0323 127 ARG B CD  
2725 N NE  . ARG B 149 ? 0.7300 1.0034 1.0030 -0.1474 0.0712  -0.0445 127 ARG B NE  
2726 C CZ  . ARG B 149 ? 0.7451 0.9921 0.9879 -0.1364 0.0702  -0.0476 127 ARG B CZ  
2727 N NH1 . ARG B 149 ? 0.8485 1.0445 1.0542 -0.1392 0.0762  -0.0400 127 ARG B NH1 
2728 N NH2 . ARG B 149 ? 0.5770 0.8475 0.8257 -0.1235 0.0633  -0.0576 127 ARG B NH2 
2729 N N   . TYR B 150 ? 0.8702 0.9719 1.0914 -0.1915 -0.0240 -0.0736 128 TYR B N   
2730 C CA  . TYR B 150 ? 0.8711 0.9069 1.0542 -0.1901 -0.0436 -0.0791 128 TYR B CA  
2731 C C   . TYR B 150 ? 0.9023 0.8767 1.0585 -0.2144 -0.0622 -0.0703 128 TYR B C   
2732 O O   . TYR B 150 ? 1.0610 0.9707 1.1663 -0.2234 -0.0616 -0.0580 128 TYR B O   
2733 C CB  . TYR B 150 ? 0.7528 0.7983 0.9568 -0.1705 -0.0708 -0.1080 128 TYR B CB  
2734 C CG  . TYR B 150 ? 0.6511 0.7528 0.8757 -0.1508 -0.0502 -0.1141 128 TYR B CG  
2735 C CD1 . TYR B 150 ? 0.6365 0.7737 0.8897 -0.1352 -0.0612 -0.1389 128 TYR B CD1 
2736 C CD2 . TYR B 150 ? 0.6143 0.7299 0.8259 -0.1483 -0.0194 -0.0950 128 TYR B CD2 
2737 C CE1 . TYR B 150 ? 0.7136 0.8970 0.9783 -0.1218 -0.0401 -0.1409 128 TYR B CE1 
2738 C CE2 . TYR B 150 ? 0.7228 0.8822 0.9486 -0.1333 -0.0039 -0.0978 128 TYR B CE2 
2739 C CZ  . TYR B 150 ? 0.6624 0.8547 0.9130 -0.1220 -0.0135 -0.1189 128 TYR B CZ  
2740 O OH  . TYR B 150 ? 0.7450 0.9758 1.0022 -0.1111 0.0046  -0.1176 128 TYR B OH  
2741 N N   . LEU B 151 ? 0.8004 0.7893 0.9848 -0.2271 -0.0787 -0.0739 129 LEU B N   
2742 C CA  . LEU B 151 ? 0.9462 0.8766 1.1066 -0.2546 -0.0974 -0.0625 129 LEU B CA  
2743 C C   . LEU B 151 ? 1.1670 1.0899 1.3059 -0.2785 -0.0579 -0.0313 129 LEU B C   
2744 O O   . LEU B 151 ? 1.3987 1.2532 1.4897 -0.3016 -0.0624 -0.0160 129 LEU B O   
2745 C CB  . LEU B 151 ? 0.8315 0.7812 1.0322 -0.2622 -0.1271 -0.0741 129 LEU B CB  
2746 C CG  . LEU B 151 ? 0.8718 0.7995 1.0804 -0.2465 -0.1756 -0.1055 129 LEU B CG  
2747 C CD1 . LEU B 151 ? 0.8720 0.8123 1.1131 -0.2574 -0.2028 -0.1123 129 LEU B CD1 
2748 C CD2 . LEU B 151 ? 1.0527 0.8932 1.2146 -0.2516 -0.2059 -0.1080 129 LEU B CD2 
2749 N N   . ALA B 152 ? 1.0815 1.0725 1.2550 -0.2740 -0.0195 -0.0222 130 ALA B N   
2750 C CA  . ALA B 152 ? 1.0887 1.0816 1.2497 -0.2929 0.0239  0.0037  130 ALA B CA  
2751 C C   . ALA B 152 ? 1.1524 1.0939 1.2456 -0.2860 0.0452  0.0125  130 ALA B C   
2752 O O   . ALA B 152 ? 1.2440 1.1429 1.2922 -0.3071 0.0698  0.0327  130 ALA B O   
2753 C CB  . ALA B 152 ? 1.0041 1.0849 1.2289 -0.2855 0.0539  0.0067  130 ALA B CB  
2754 N N   . GLU B 153 ? 1.1797 1.1206 1.2618 -0.2580 0.0354  -0.0021 131 GLU B N   
2755 C CA  . GLU B 153 ? 1.1976 1.0814 1.2146 -0.2493 0.0456  0.0039  131 GLU B CA  
2756 C C   . GLU B 153 ? 1.2971 1.0807 1.2421 -0.2688 0.0248  0.0121  131 GLU B C   
2757 O O   . GLU B 153 ? 1.2852 1.0094 1.1614 -0.2697 0.0399  0.0237  131 GLU B O   
2758 C CB  . GLU B 153 ? 1.0314 0.9258 1.0579 -0.2197 0.0264  -0.0150 131 GLU B CB  
2759 C CG  . GLU B 153 ? 1.0238 0.9928 1.0895 -0.2005 0.0546  -0.0158 131 GLU B CG  
2760 C CD  . GLU B 153 ? 1.0136 0.9854 1.0810 -0.1763 0.0405  -0.0292 131 GLU B CD  
2761 O OE1 . GLU B 153 ? 0.9499 0.8915 1.0163 -0.1722 0.0059  -0.0447 131 GLU B OE1 
2762 O OE2 . GLU B 153 ? 1.0379 1.0395 1.1092 -0.1620 0.0632  -0.0242 131 GLU B OE2 
2763 N N   . VAL B 154 ? 1.2896 1.0457 1.2424 -0.2837 -0.0130 0.0058  132 VAL B N   
2764 C CA  . VAL B 154 ? 1.3597 1.0124 1.2433 -0.3001 -0.0449 0.0106  132 VAL B CA  
2765 C C   . VAL B 154 ? 1.4093 1.0334 1.2788 -0.3379 -0.0434 0.0296  132 VAL B C   
2766 O O   . VAL B 154 ? 1.5062 1.0360 1.2985 -0.3594 -0.0550 0.0439  132 VAL B O   
2767 C CB  . VAL B 154 ? 1.3772 1.0060 1.2785 -0.2816 -0.1029 -0.0175 132 VAL B CB  
2768 C CG1 . VAL B 154 ? 1.4741 1.1214 1.4228 -0.2903 -0.1362 -0.0304 132 VAL B CG1 
2769 C CG2 . VAL B 154 ? 1.4723 1.0033 1.3057 -0.2770 -0.1347 -0.0202 132 VAL B CG2 
2770 N N   . ALA B 155 ? 1.3876 1.0871 1.3278 -0.3480 -0.0304 0.0314  133 ALA B N   
2771 C CA  . ALA B 155 ? 1.4092 1.0877 1.3520 -0.3851 -0.0364 0.0476  133 ALA B CA  
2772 C C   . ALA B 155 ? 1.6189 1.2658 1.5091 -0.4152 0.0127  0.0791  133 ALA B C   
2773 O O   . ALA B 155 ? 1.5504 1.2411 1.4448 -0.4067 0.0647  0.0871  133 ALA B O   
2774 C CB  . ALA B 155 ? 1.2210 0.9914 1.2582 -0.3861 -0.0350 0.0412  133 ALA B CB  
2775 N N   . ALA B 156 ? 1.8209 1.3909 1.6618 -0.4514 -0.0039 0.0966  134 ALA B N   
2776 C CA  . ALA B 156 ? 1.8952 1.4267 1.6794 -0.4878 0.0434  0.1287  134 ALA B CA  
2777 C C   . ALA B 156 ? 2.0147 1.5410 1.8266 -0.5312 0.0342  0.1465  134 ALA B C   
2778 O O   . ALA B 156 ? 1.9859 1.5784 1.8878 -0.5294 0.0121  0.1354  134 ALA B O   
2779 C CB  . ALA B 156 ? 1.9049 1.3128 1.5627 -0.4924 0.0329  0.1377  134 ALA B CB  
2780 N N   . GLY B 157 ? 2.1391 1.5789 1.8678 -0.5709 0.0469  0.1743  135 GLY B N   
2781 C CA  . GLY B 157 ? 2.1615 1.5855 1.9094 -0.6177 0.0371  0.1953  135 GLY B CA  
2782 C C   . GLY B 157 ? 2.1118 1.6592 1.9768 -0.6265 0.0802  0.2005  135 GLY B C   
2783 O O   . GLY B 157 ? 2.1201 1.7371 2.0131 -0.6162 0.1433  0.2042  135 GLY B O   
2784 N N   . ASP B 158 ? 2.0760 1.6520 2.0154 -0.6415 0.0407  0.1973  136 ASP B N   
2785 C CA  . ASP B 158 ? 1.9575 1.6433 2.0149 -0.6527 0.0691  0.2020  136 ASP B CA  
2786 C C   . ASP B 158 ? 1.8359 1.5980 1.9818 -0.6122 0.0296  0.1691  136 ASP B C   
2787 O O   . ASP B 158 ? 1.7160 1.5635 1.9627 -0.6169 0.0372  0.1684  136 ASP B O   
2788 C CB  . ASP B 158 ? 1.9527 1.6090 2.0264 -0.7089 0.0588  0.2294  136 ASP B CB  
2789 C CG  . ASP B 158 ? 2.0241 1.5822 1.9864 -0.7324 0.0804  0.2554  136 ASP B CG  
2790 O OD1 . ASP B 158 ? 2.0108 1.5501 1.9043 -0.7250 0.1310  0.2626  136 ASP B OD1 
2791 O OD2 . ASP B 158 ? 2.0565 1.5549 1.9960 -0.7551 0.0457  0.2672  136 ASP B OD2 
2792 N N   . ASP B 159 ? 1.7857 1.5167 1.8949 -0.5730 -0.0122 0.1416  137 ASP B N   
2793 C CA  . ASP B 159 ? 1.6454 1.4322 1.8194 -0.5359 -0.0526 0.1093  137 ASP B CA  
2794 C C   . ASP B 159 ? 1.3955 1.2608 1.6017 -0.4953 -0.0182 0.0936  137 ASP B C   
2795 O O   . ASP B 159 ? 1.3236 1.2405 1.5817 -0.4660 -0.0441 0.0689  137 ASP B O   
2796 C CB  . ASP B 159 ? 1.7770 1.4869 1.9006 -0.5177 -0.1195 0.0859  137 ASP B CB  
2797 C CG  . ASP B 159 ? 2.0430 1.6573 2.1203 -0.5567 -0.1604 0.1014  137 ASP B CG  
2798 O OD1 . ASP B 159 ? 2.0794 1.6881 2.1951 -0.5615 -0.2130 0.0896  137 ASP B OD1 
2799 O OD2 . ASP B 159 ? 2.2000 1.7388 2.1968 -0.5833 -0.1418 0.1258  137 ASP B OD2 
2800 N N   . LYS B 160 ? 1.3456 1.2146 1.5152 -0.4926 0.0375  0.1068  138 LYS B N   
2801 C CA  . LYS B 160 ? 1.2434 1.1816 1.4415 -0.4548 0.0677  0.0931  138 LYS B CA  
2802 C C   . LYS B 160 ? 1.1885 1.2287 1.4927 -0.4511 0.0800  0.0896  138 LYS B C   
2803 O O   . LYS B 160 ? 0.9824 1.0731 1.3256 -0.4182 0.0643  0.0682  138 LYS B O   
2804 C CB  . LYS B 160 ? 1.0366 0.9562 1.1762 -0.4543 0.1248  0.1084  138 LYS B CB  
2805 C CG  . LYS B 160 ? 0.9764 0.9467 1.1284 -0.4111 0.1440  0.0918  138 LYS B CG  
2806 C CD  . LYS B 160 ? 1.0113 0.9379 1.0837 -0.4033 0.1844  0.1010  138 LYS B CD  
2807 N N   . LYS B 161 ? 1.3511 1.4207 1.7020 -0.4859 0.1102  0.1114  139 LYS B N   
2808 C CA  . LYS B 161 ? 1.2135 1.3792 1.6738 -0.4861 0.1238  0.1106  139 LYS B CA  
2809 C C   . LYS B 161 ? 1.1798 1.3747 1.6919 -0.4659 0.0659  0.0870  139 LYS B C   
2810 O O   . LYS B 161 ? 1.1036 1.3658 1.6712 -0.4393 0.0677  0.0734  139 LYS B O   
2811 C CB  . LYS B 161 ? 1.1230 1.2996 1.6275 -0.5348 0.1494  0.1374  139 LYS B CB  
2812 N N   . GLY B 162 ? 1.2650 1.4032 1.7526 -0.4772 0.0122  0.0811  140 GLY B N   
2813 C CA  . GLY B 162 ? 1.2135 1.3725 1.7418 -0.4579 -0.0427 0.0569  140 GLY B CA  
2814 C C   . GLY B 162 ? 1.0968 1.2574 1.5900 -0.4126 -0.0584 0.0291  140 GLY B C   
2815 O O   . GLY B 162 ? 1.0545 1.2611 1.5875 -0.3887 -0.0783 0.0104  140 GLY B O   
2816 N N   . ILE B 163 ? 1.1367 1.2446 1.5541 -0.4015 -0.0507 0.0265  141 ILE B N   
2817 C CA  . ILE B 163 ? 1.0423 1.1545 1.4324 -0.3615 -0.0618 0.0016  141 ILE B CA  
2818 C C   . ILE B 163 ? 1.0184 1.1988 1.4370 -0.3388 -0.0234 0.0013  141 ILE B C   
2819 O O   . ILE B 163 ? 1.0160 1.2264 1.4430 -0.3091 -0.0364 -0.0187 141 ILE B O   
2820 C CB  . ILE B 163 ? 0.9357 0.9732 1.2460 -0.3570 -0.0657 0.0000  141 ILE B CB  
2821 C CG1 . ILE B 163 ? 0.8956 0.8610 1.1780 -0.3726 -0.1164 -0.0062 141 ILE B CG1 
2822 C CG2 . ILE B 163 ? 0.9227 0.9744 1.2145 -0.3187 -0.0649 -0.0210 141 ILE B CG2 
2823 C CD1 . ILE B 163 ? 1.0323 0.9120 1.2360 -0.3762 -0.1232 -0.0022 141 ILE B CD1 
2824 N N   . VAL B 164 ? 0.9710 1.1762 1.4046 -0.3522 0.0241  0.0226  142 VAL B N   
2825 C CA  . VAL B 164 ? 0.8913 1.1531 1.3471 -0.3282 0.0579  0.0210  142 VAL B CA  
2826 C C   . VAL B 164 ? 0.9444 1.2750 1.4785 -0.3195 0.0435  0.0126  142 VAL B C   
2827 O O   . VAL B 164 ? 1.0318 1.3930 1.5712 -0.2905 0.0381  -0.0013 142 VAL B O   
2828 C CB  . VAL B 164 ? 0.8071 1.0740 1.2552 -0.3412 0.1136  0.0423  142 VAL B CB  
2829 C CG1 . VAL B 164 ? 0.6577 0.9914 1.1482 -0.3165 0.1420  0.0386  142 VAL B CG1 
2830 C CG2 . VAL B 164 ? 1.0089 1.2007 1.3642 -0.3416 0.1254  0.0480  142 VAL B CG2 
2831 N N   . ASP B 165 ? 0.9075 1.2596 1.5023 -0.3456 0.0351  0.0218  143 ASP B N   
2832 C CA  . ASP B 165 ? 1.0255 1.4382 1.6957 -0.3360 0.0162  0.0132  143 ASP B CA  
2833 C C   . ASP B 165 ? 0.9813 1.3789 1.6327 -0.3156 -0.0362 -0.0106 143 ASP B C   
2834 O O   . ASP B 165 ? 0.9321 1.3671 1.6107 -0.2944 -0.0509 -0.0227 143 ASP B O   
2835 C CB  . ASP B 165 ? 1.0818 1.5280 1.8354 -0.3689 0.0202  0.0291  143 ASP B CB  
2836 C CG  . ASP B 165 ? 1.1789 1.5860 1.9374 -0.3957 -0.0236 0.0304  143 ASP B CG  
2837 O OD1 . ASP B 165 ? 1.2546 1.6074 1.9528 -0.3874 -0.0592 0.0167  143 ASP B OD1 
2838 O OD2 . ASP B 165 ? 1.1924 1.6246 2.0219 -0.4260 -0.0225 0.0449  143 ASP B OD2 
2839 N N   . GLN B 166 ? 0.9837 1.3240 1.5843 -0.3196 -0.0650 -0.0195 144 GLN B N   
2840 C CA  . GLN B 166 ? 0.9388 1.2704 1.5222 -0.2965 -0.1084 -0.0456 144 GLN B CA  
2841 C C   . GLN B 166 ? 0.8197 1.1611 1.3614 -0.2634 -0.0936 -0.0590 144 GLN B C   
2842 O O   . GLN B 166 ? 0.7830 1.1418 1.3234 -0.2420 -0.1144 -0.0767 144 GLN B O   
2843 C CB  . GLN B 166 ? 0.9285 1.2002 1.4777 -0.3053 -0.1475 -0.0567 144 GLN B CB  
2844 C CG  . GLN B 166 ? 0.9988 1.2685 1.5347 -0.2788 -0.1881 -0.0869 144 GLN B CG  
2845 C CD  . GLN B 166 ? 1.1180 1.3481 1.6576 -0.2898 -0.2396 -0.0990 144 GLN B CD  
2846 O OE1 . GLN B 166 ? 1.1736 1.3632 1.7103 -0.3163 -0.2487 -0.0864 144 GLN B OE1 
2847 N NE2 . GLN B 166 ? 1.0745 1.3109 1.6158 -0.2700 -0.2759 -0.1233 144 GLN B NE2 
2848 N N   . SER B 167 ? 0.7992 1.1282 1.3054 -0.2600 -0.0576 -0.0493 145 SER B N   
2849 C CA  . SER B 167 ? 0.8714 1.2153 1.3485 -0.2318 -0.0411 -0.0576 145 SER B CA  
2850 C C   . SER B 167 ? 0.9188 1.3181 1.4367 -0.2213 -0.0266 -0.0524 145 SER B C   
2851 O O   . SER B 167 ? 0.9256 1.3409 1.4284 -0.1987 -0.0310 -0.0631 145 SER B O   
2852 C CB  . SER B 167 ? 0.8892 1.2017 1.3205 -0.2309 -0.0110 -0.0480 145 SER B CB  
2853 O OG  . SER B 167 ? 0.9513 1.2901 1.3740 -0.2102 0.0137  -0.0465 145 SER B OG  
2854 N N   . GLN B 168 ? 0.9268 1.3545 1.4970 -0.2378 -0.0088 -0.0360 146 GLN B N   
2855 C CA  . GLN B 168 ? 0.9574 1.4371 1.5743 -0.2256 0.0008  -0.0333 146 GLN B CA  
2856 C C   . GLN B 168 ? 1.0180 1.5179 1.6706 -0.2203 -0.0416 -0.0457 146 GLN B C   
2857 O O   . GLN B 168 ? 1.0275 1.5524 1.6886 -0.2010 -0.0485 -0.0511 146 GLN B O   
2858 C CB  . GLN B 168 ? 0.9827 1.4926 1.6544 -0.2430 0.0358  -0.0150 146 GLN B CB  
2859 C CG  . GLN B 168 ? 0.9968 1.5599 1.7206 -0.2268 0.0483  -0.0142 146 GLN B CG  
2860 C CD  . GLN B 168 ? 1.0357 1.6343 1.8198 -0.2422 0.0888  0.0005  146 GLN B CD  
2861 O OE1 . GLN B 168 ? 0.9994 1.5823 1.7848 -0.2692 0.1082  0.0126  146 GLN B OE1 
2862 N NE2 . GLN B 168 ? 1.0699 1.7152 1.9037 -0.2252 0.1023  -0.0009 146 GLN B NE2 
2863 N N   . GLN B 169 ? 0.9959 1.4778 1.6633 -0.2367 -0.0745 -0.0507 147 GLN B N   
2864 C CA  . GLN B 169 ? 0.9237 1.4149 1.6163 -0.2303 -0.1200 -0.0642 147 GLN B CA  
2865 C C   . GLN B 169 ? 0.9779 1.4458 1.6029 -0.2046 -0.1405 -0.0853 147 GLN B C   
2866 O O   . GLN B 169 ? 1.0049 1.4813 1.6313 -0.1908 -0.1686 -0.0960 147 GLN B O   
2867 C CB  . GLN B 169 ? 0.9093 1.3828 1.6355 -0.2552 -0.1525 -0.0638 147 GLN B CB  
2868 N N   . ALA B 170 ? 0.9133 1.3506 1.4787 -0.1982 -0.1265 -0.0918 148 ALA B N   
2869 C CA  . ALA B 170 ? 0.7185 1.1430 1.2254 -0.1743 -0.1340 -0.1109 148 ALA B CA  
2870 C C   . ALA B 170 ? 0.6364 1.0857 1.1305 -0.1580 -0.1102 -0.1042 148 ALA B C   
2871 O O   . ALA B 170 ? 0.7103 1.1628 1.1798 -0.1425 -0.1257 -0.1143 148 ALA B O   
2872 C CB  . ALA B 170 ? 0.6405 1.0309 1.1022 -0.1721 -0.1257 -0.1204 148 ALA B CB  
2873 N N   . TYR B 171 ? 0.4885 0.9491 0.9917 -0.1612 -0.0741 -0.0873 149 TYR B N   
2874 C CA  . TYR B 171 ? 0.6404 1.1203 1.1330 -0.1457 -0.0545 -0.0804 149 TYR B CA  
2875 C C   . TYR B 171 ? 0.7499 1.2580 1.2833 -0.1408 -0.0743 -0.0785 149 TYR B C   
2876 O O   . TYR B 171 ? 0.8130 1.3224 1.3189 -0.1250 -0.0835 -0.0822 149 TYR B O   
2877 C CB  . TYR B 171 ? 0.6708 1.1545 1.1705 -0.1499 -0.0158 -0.0639 149 TYR B CB  
2878 C CG  . TYR B 171 ? 0.8094 1.2608 1.2577 -0.1475 0.0030  -0.0646 149 TYR B CG  
2879 C CD1 . TYR B 171 ? 0.8401 1.2786 1.2422 -0.1333 -0.0011 -0.0759 149 TYR B CD1 
2880 C CD2 . TYR B 171 ? 0.9098 1.3418 1.3563 -0.1604 0.0247  -0.0538 149 TYR B CD2 
2881 C CE1 . TYR B 171 ? 0.8587 1.2700 1.2261 -0.1312 0.0127  -0.0773 149 TYR B CE1 
2882 C CE2 . TYR B 171 ? 0.9654 1.3613 1.3657 -0.1575 0.0350  -0.0550 149 TYR B CE2 
2883 C CZ  . TYR B 171 ? 0.9091 1.2967 1.2758 -0.1425 0.0274  -0.0672 149 TYR B CZ  
2884 O OH  . TYR B 171 ? 0.8409 1.1943 1.1732 -0.1400 0.0345  -0.0689 149 TYR B OH  
2885 N N   . GLN B 172 ? 0.8014 1.3302 1.4025 -0.1555 -0.0833 -0.0722 150 GLN B N   
2886 C CA  . GLN B 172 ? 0.8098 1.3690 1.4634 -0.1495 -0.1016 -0.0701 150 GLN B CA  
2887 C C   . GLN B 172 ? 0.7963 1.3382 1.4271 -0.1408 -0.1494 -0.0852 150 GLN B C   
2888 O O   . GLN B 172 ? 0.8348 1.3828 1.4658 -0.1269 -0.1683 -0.0867 150 GLN B O   
2889 C CB  . GLN B 172 ? 0.8365 1.4290 1.5813 -0.1690 -0.0963 -0.0597 150 GLN B CB  
2890 C CG  . GLN B 172 ? 0.7244 1.3575 1.5433 -0.1612 -0.1100 -0.0577 150 GLN B CG  
2891 C CD  . GLN B 172 ? 0.7247 1.3865 1.5655 -0.1511 -0.0689 -0.0483 150 GLN B CD  
2892 O OE1 . GLN B 172 ? 0.6935 1.3633 1.5423 -0.1619 -0.0256 -0.0383 150 GLN B OE1 
2893 N NE2 . GLN B 172 ? 0.7126 1.3825 1.5535 -0.1292 -0.0840 -0.0520 150 GLN B NE2 
2894 N N   . GLU B 173 ? 0.7012 1.2145 1.3020 -0.1467 -0.1706 -0.0977 151 GLU B N   
2895 C CA  . GLU B 173 ? 0.8328 1.3217 1.3958 -0.1356 -0.2141 -0.1148 151 GLU B CA  
2896 C C   . GLU B 173 ? 0.8888 1.3607 1.3710 -0.1161 -0.2041 -0.1210 151 GLU B C   
2897 O O   . GLU B 173 ? 0.9586 1.4228 1.4185 -0.1043 -0.2274 -0.1237 151 GLU B O   
2898 C CB  . GLU B 173 ? 0.8466 1.3060 1.3917 -0.1434 -0.2370 -0.1297 151 GLU B CB  
2899 C CG  . GLU B 173 ? 0.9888 1.4176 1.4895 -0.1307 -0.2830 -0.1502 151 GLU B CG  
2900 C CD  . GLU B 173 ? 1.1274 1.5255 1.6160 -0.1364 -0.3098 -0.1672 151 GLU B CD  
2901 O OE1 . GLU B 173 ? 1.0973 1.4969 1.6150 -0.1525 -0.2953 -0.1610 151 GLU B OE1 
2902 O OE2 . GLU B 173 ? 1.2182 1.5853 1.6641 -0.1245 -0.3479 -0.1872 151 GLU B OE2 
2903 N N   . ALA B 174 ? 0.8498 1.3138 1.2891 -0.1140 -0.1698 -0.1217 152 ALA B N   
2904 C CA  . ALA B 174 ? 0.8745 1.3267 1.2442 -0.0996 -0.1544 -0.1250 152 ALA B CA  
2905 C C   . ALA B 174 ? 0.9028 1.3696 1.2800 -0.0927 -0.1467 -0.1092 152 ALA B C   
2906 O O   . ALA B 174 ? 0.9424 1.3934 1.2660 -0.0821 -0.1552 -0.1109 152 ALA B O   
2907 C CB  . ALA B 174 ? 0.7460 1.1925 1.0890 -0.1007 -0.1198 -0.1272 152 ALA B CB  
2908 N N   . PHE B 175 ? 0.7977 1.2917 1.2374 -0.0984 -0.1302 -0.0943 153 PHE B N   
2909 C CA  . PHE B 175 ? 0.7695 1.2777 1.2236 -0.0889 -0.1248 -0.0820 153 PHE B CA  
2910 C C   . PHE B 175 ? 0.8514 1.3553 1.3155 -0.0814 -0.1687 -0.0858 153 PHE B C   
2911 O O   . PHE B 175 ? 0.8250 1.3153 1.2519 -0.0697 -0.1779 -0.0818 153 PHE B O   
2912 C CB  . PHE B 175 ? 0.8013 1.3410 1.3245 -0.0950 -0.0972 -0.0695 153 PHE B CB  
2913 C CG  . PHE B 175 ? 0.8820 1.4371 1.4243 -0.0819 -0.0896 -0.0598 153 PHE B CG  
2914 C CD1 . PHE B 175 ? 0.8737 1.4486 1.4729 -0.0756 -0.1180 -0.0604 153 PHE B CD1 
2915 C CD2 . PHE B 175 ? 0.9359 1.4823 1.4410 -0.0746 -0.0593 -0.0517 153 PHE B CD2 
2916 C CE1 . PHE B 175 ? 0.8687 1.4554 1.4881 -0.0608 -0.1153 -0.0544 153 PHE B CE1 
2917 C CE2 . PHE B 175 ? 0.8975 1.4531 1.4179 -0.0606 -0.0566 -0.0445 153 PHE B CE2 
2918 C CZ  . PHE B 175 ? 0.8816 1.4576 1.4591 -0.0530 -0.0843 -0.0465 153 PHE B CZ  
2919 N N   . GLU B 176 ? 0.9208 1.4310 1.4342 -0.0887 -0.2001 -0.0928 154 GLU B N   
2920 C CA  . GLU B 176 ? 1.0031 1.5062 1.5347 -0.0814 -0.2487 -0.0970 154 GLU B CA  
2921 C C   . GLU B 176 ? 0.9701 1.4246 1.4016 -0.0712 -0.2751 -0.1073 154 GLU B C   
2922 O O   . GLU B 176 ? 1.0639 1.4986 1.4689 -0.0603 -0.3027 -0.1052 154 GLU B O   
2923 C CB  . GLU B 176 ? 1.1070 1.6259 1.7177 -0.0937 -0.2783 -0.1021 154 GLU B CB  
2924 C CG  . GLU B 176 ? 1.2029 1.7716 1.9153 -0.1065 -0.2501 -0.0906 154 GLU B CG  
2925 C CD  . GLU B 176 ? 1.3366 1.9188 2.1233 -0.1248 -0.2748 -0.0935 154 GLU B CD  
2926 O OE1 . GLU B 176 ? 1.4533 2.0015 2.2058 -0.1260 -0.3147 -0.1057 154 GLU B OE1 
2927 O OE2 . GLU B 176 ? 1.3042 1.9297 2.1823 -0.1384 -0.2538 -0.0836 154 GLU B OE2 
2928 N N   . ILE B 177 ? 0.8075 1.2395 1.1798 -0.0742 -0.2671 -0.1192 155 ILE B N   
2929 C CA  . ILE B 177 ? 0.8361 1.2236 1.1060 -0.0647 -0.2818 -0.1304 155 ILE B CA  
2930 C C   . ILE B 177 ? 0.9798 1.3590 1.1910 -0.0585 -0.2546 -0.1184 155 ILE B C   
2931 O O   . ILE B 177 ? 1.0529 1.3947 1.1885 -0.0515 -0.2735 -0.1196 155 ILE B O   
2932 C CB  . ILE B 177 ? 0.7906 1.1629 1.0169 -0.0669 -0.2711 -0.1485 155 ILE B CB  
2933 C CG1 . ILE B 177 ? 0.8191 1.1921 1.0994 -0.0741 -0.3034 -0.1596 155 ILE B CG1 
2934 C CG2 . ILE B 177 ? 0.8452 1.1740 0.9652 -0.0566 -0.2811 -0.1619 155 ILE B CG2 
2935 C CD1 . ILE B 177 ? 0.7840 1.1703 1.0888 -0.0836 -0.2773 -0.1649 155 ILE B CD1 
2936 N N   . SER B 178 ? 0.9700 1.3778 1.2098 -0.0621 -0.2119 -0.1060 156 SER B N   
2937 C CA  . SER B 178 ? 0.9973 1.3961 1.1850 -0.0582 -0.1858 -0.0939 156 SER B CA  
2938 C C   . SER B 178 ? 1.0706 1.4634 1.2703 -0.0505 -0.2092 -0.0808 156 SER B C   
2939 O O   . SER B 178 ? 1.1346 1.4950 1.2633 -0.0466 -0.2160 -0.0743 156 SER B O   
2940 C CB  . SER B 178 ? 0.9342 1.3591 1.1501 -0.0633 -0.1395 -0.0860 156 SER B CB  
2941 O OG  . SER B 178 ? 1.0061 1.4380 1.2324 -0.0701 -0.1253 -0.0985 156 SER B OG  
2942 N N   . LYS B 179 ? 1.0327 1.4566 1.3237 -0.0488 -0.2204 -0.0768 157 LYS B N   
2943 C CA  . LYS B 179 ? 0.8586 1.2790 1.1753 -0.0382 -0.2504 -0.0694 157 LYS B CA  
2944 C C   . LYS B 179 ? 0.8895 1.2656 1.1565 -0.0330 -0.3047 -0.0763 157 LYS B C   
2945 O O   . LYS B 179 ? 0.8319 1.1786 1.0660 -0.0242 -0.3313 -0.0692 157 LYS B O   
2946 C CB  . LYS B 179 ? 0.7918 1.2610 1.2272 -0.0374 -0.2500 -0.0685 157 LYS B CB  
2947 N N   . LYS B 180 ? 0.9186 1.2823 1.1737 -0.0378 -0.3255 -0.0905 158 LYS B N   
2948 C CA  . LYS B 180 ? 1.0040 1.3165 1.2013 -0.0323 -0.3801 -0.0993 158 LYS B CA  
2949 C C   . LYS B 180 ? 1.1619 1.4217 1.2231 -0.0323 -0.3698 -0.1004 158 LYS B C   
2950 O O   . LYS B 180 ? 1.1709 1.3835 1.1621 -0.0271 -0.3969 -0.0940 158 LYS B O   
2951 C CB  . LYS B 180 ? 0.9805 1.2969 1.2206 -0.0366 -0.4099 -0.1152 158 LYS B CB  
2952 C CG  . LYS B 180 ? 1.0877 1.3469 1.2770 -0.0293 -0.4759 -0.1260 158 LYS B CG  
2953 N N   . GLU B 181 ? 1.2702 1.5373 1.2933 -0.0388 -0.3287 -0.1081 159 GLU B N   
2954 C CA  . GLU B 181 ? 1.3913 1.6137 1.2936 -0.0392 -0.3183 -0.1155 159 GLU B CA  
2955 C C   . GLU B 181 ? 1.4350 1.6597 1.2834 -0.0449 -0.2676 -0.1023 159 GLU B C   
2956 O O   . GLU B 181 ? 1.4884 1.6819 1.2402 -0.0475 -0.2510 -0.1076 159 GLU B O   
2957 C CB  . GLU B 181 ? 1.3284 1.5538 1.2222 -0.0401 -0.3112 -0.1383 159 GLU B CB  
2958 N N   . MET B 182 ? 1.3965 1.6554 1.3025 -0.0472 -0.2424 -0.0858 160 MET B N   
2959 C CA  . MET B 182 ? 1.3226 1.5825 1.1854 -0.0538 -0.1987 -0.0724 160 MET B CA  
2960 C C   . MET B 182 ? 1.2674 1.5251 1.1511 -0.0514 -0.2060 -0.0509 160 MET B C   
2961 O O   . MET B 182 ? 1.3802 1.6587 1.3431 -0.0437 -0.2279 -0.0485 160 MET B O   
2962 C CB  . MET B 182 ? 1.2688 1.5721 1.1771 -0.0590 -0.1508 -0.0771 160 MET B CB  
2963 C CG  . MET B 182 ? 1.3319 1.6405 1.2273 -0.0599 -0.1401 -0.0999 160 MET B CG  
2964 S SD  . MET B 182 ? 1.3801 1.7299 1.3223 -0.0655 -0.0883 -0.1025 160 MET B SD  
2965 C CE  . MET B 182 ? 1.3584 1.7161 1.3276 -0.0624 -0.1001 -0.1303 160 MET B CE  
2966 N N   . GLN B 183 ? 1.1688 1.4025 0.9826 -0.0587 -0.1843 -0.0353 161 GLN B N   
2967 C CA  . GLN B 183 ? 1.2432 1.4640 1.0598 -0.0569 -0.1925 -0.0144 161 GLN B CA  
2968 C C   . GLN B 183 ? 1.2633 1.5279 1.1526 -0.0562 -0.1571 -0.0080 161 GLN B C   
2969 O O   . GLN B 183 ? 1.2439 1.5374 1.1513 -0.0623 -0.1190 -0.0150 161 GLN B O   
2970 C CB  . GLN B 183 ? 1.3590 1.5296 1.0658 -0.0685 -0.1867 0.0008  161 GLN B CB  
2971 C CG  . GLN B 183 ? 1.4387 1.6110 1.0846 -0.0816 -0.1441 -0.0068 161 GLN B CG  
2972 C CD  . GLN B 183 ? 1.6334 1.7579 1.1704 -0.0971 -0.1323 0.0105  161 GLN B CD  
2973 O OE1 . GLN B 183 ? 1.7267 1.7966 1.2020 -0.0979 -0.1697 0.0241  161 GLN B OE1 
2974 N NE2 . GLN B 183 ? 1.6665 1.8101 1.1811 -0.1106 -0.0809 0.0103  161 GLN B NE2 
2975 N N   . PRO B 184 ? 1.2137 1.4794 1.1431 -0.0473 -0.1715 0.0038  162 PRO B N   
2976 C CA  . PRO B 184 ? 1.1406 1.4443 1.1405 -0.0432 -0.1421 0.0068  162 PRO B CA  
2977 C C   . PRO B 184 ? 1.0884 1.3911 1.0560 -0.0543 -0.1017 0.0162  162 PRO B C   
2978 O O   . PRO B 184 ? 1.1108 1.4381 1.1274 -0.0514 -0.0777 0.0172  162 PRO B O   
2979 C CB  . PRO B 184 ? 1.1060 1.4003 1.1379 -0.0287 -0.1709 0.0158  162 PRO B CB  
2980 C CG  . PRO B 184 ? 1.1014 1.3423 1.0575 -0.0304 -0.2090 0.0243  162 PRO B CG  
2981 C CD  . PRO B 184 ? 1.1473 1.3756 1.0582 -0.0384 -0.2181 0.0130  162 PRO B CD  
2982 N N   . THR B 185 ? 1.0418 1.3146 0.9288 -0.0674 -0.0940 0.0235  163 THR B N   
2983 C CA  . THR B 185 ? 1.0963 1.3716 0.9603 -0.0803 -0.0560 0.0322  163 THR B CA  
2984 C C   . THR B 185 ? 1.1479 1.4463 1.0062 -0.0893 -0.0239 0.0162  163 THR B C   
2985 O O   . THR B 185 ? 1.2578 1.5678 1.1189 -0.0985 0.0082  0.0194  163 THR B O   
2986 C CB  . THR B 185 ? 1.2391 1.4697 1.0249 -0.0923 -0.0621 0.0535  163 THR B CB  
2987 O OG1 . THR B 185 ? 1.4085 1.6157 1.1165 -0.1039 -0.0607 0.0501  163 THR B OG1 
2988 C CG2 . THR B 185 ? 1.2529 1.4528 1.0395 -0.0811 -0.1032 0.0666  163 THR B CG2 
2989 N N   . HIS B 186 ? 1.1338 1.4375 0.9875 -0.0857 -0.0349 -0.0023 164 HIS B N   
2990 C CA  . HIS B 186 ? 1.0851 1.4073 0.9309 -0.0911 -0.0078 -0.0210 164 HIS B CA  
2991 C C   . HIS B 186 ? 1.0603 1.4179 0.9769 -0.0899 0.0173  -0.0269 164 HIS B C   
2992 O O   . HIS B 186 ? 0.8124 1.1841 0.7883 -0.0817 0.0064  -0.0277 164 HIS B O   
2993 C CB  . HIS B 186 ? 1.0028 1.3219 0.8428 -0.0838 -0.0319 -0.0412 164 HIS B CB  
2994 C CG  . HIS B 186 ? 1.1628 1.4892 0.9735 -0.0868 -0.0099 -0.0627 164 HIS B CG  
2995 N ND1 . HIS B 186 ? 1.1439 1.5034 1.0069 -0.0856 0.0131  -0.0785 164 HIS B ND1 
2996 C CD2 . HIS B 186 ? 1.2745 1.5762 1.0064 -0.0892 -0.0083 -0.0730 164 HIS B CD2 
2997 C CE1 . HIS B 186 ? 1.1513 1.5106 0.9773 -0.0854 0.0270  -0.0994 164 HIS B CE1 
2998 N NE2 . HIS B 186 ? 1.2321 1.5577 0.9765 -0.0875 0.0172  -0.0969 164 HIS B NE2 
2999 N N   . PRO B 187 ? 1.0889 1.4585 0.9998 -0.0985 0.0505  -0.0305 165 PRO B N   
3000 C CA  . PRO B 187 ? 0.9797 1.3729 0.9536 -0.0969 0.0675  -0.0355 165 PRO B CA  
3001 C C   . PRO B 187 ? 0.9167 1.3256 0.9376 -0.0887 0.0569  -0.0542 165 PRO B C   
3002 O O   . PRO B 187 ? 0.8976 1.3143 0.9670 -0.0858 0.0590  -0.0525 165 PRO B O   
3003 C CB  . PRO B 187 ? 0.9079 1.3128 0.8686 -0.1069 0.0999  -0.0422 165 PRO B CB  
3004 C CG  . PRO B 187 ? 0.9813 1.3739 0.8716 -0.1129 0.1048  -0.0455 165 PRO B CG  
3005 C CD  . PRO B 187 ? 1.0247 1.3858 0.8750 -0.1109 0.0742  -0.0288 165 PRO B CD  
3006 N N   . ILE B 188 ? 0.9075 1.3156 0.9103 -0.0856 0.0437  -0.0712 166 ILE B N   
3007 C CA  . ILE B 188 ? 0.8543 1.2737 0.9021 -0.0806 0.0310  -0.0877 166 ILE B CA  
3008 C C   . ILE B 188 ? 0.9209 1.3403 1.0052 -0.0767 0.0065  -0.0774 166 ILE B C   
3009 O O   . ILE B 188 ? 0.9610 1.3916 1.0959 -0.0765 0.0033  -0.0814 166 ILE B O   
3010 C CB  . ILE B 188 ? 0.8594 1.2752 0.8775 -0.0776 0.0228  -0.1117 166 ILE B CB  
3011 C CG1 . ILE B 188 ? 0.9665 1.3925 0.9683 -0.0795 0.0533  -0.1269 166 ILE B CG1 
3012 C CG2 . ILE B 188 ? 0.7510 1.1728 0.8160 -0.0741 0.0031  -0.1263 166 ILE B CG2 
3013 C CD1 . ILE B 188 ? 1.0743 1.4973 1.0469 -0.0730 0.0489  -0.1557 166 ILE B CD1 
3014 N N   . ARG B 189 ? 0.9281 1.3345 0.9899 -0.0741 -0.0114 -0.0643 167 ARG B N   
3015 C CA  . ARG B 189 ? 0.8451 1.2589 0.9561 -0.0687 -0.0322 -0.0567 167 ARG B CA  
3016 C C   . ARG B 189 ? 0.7266 1.1489 0.8727 -0.0668 -0.0145 -0.0421 167 ARG B C   
3017 O O   . ARG B 189 ? 0.8137 1.2520 1.0145 -0.0642 -0.0157 -0.0412 167 ARG B O   
3018 C CB  . ARG B 189 ? 0.9555 1.3500 1.0384 -0.0637 -0.0648 -0.0509 167 ARG B CB  
3019 C CG  . ARG B 189 ? 0.9622 1.3712 1.1100 -0.0564 -0.0863 -0.0455 167 ARG B CG  
3020 C CD  . ARG B 189 ? 1.1484 1.5352 1.2757 -0.0497 -0.1269 -0.0426 167 ARG B CD  
3021 N NE  . ARG B 189 ? 1.1948 1.5939 1.3773 -0.0400 -0.1386 -0.0331 167 ARG B NE  
3022 C CZ  . ARG B 189 ? 1.1391 1.5232 1.3272 -0.0311 -0.1786 -0.0310 167 ARG B CZ  
3023 N NH1 . ARG B 189 ? 1.0564 1.4059 1.1885 -0.0321 -0.2122 -0.0359 167 ARG B NH1 
3024 N NH2 . ARG B 189 ? 1.1209 1.5213 1.3685 -0.0197 -0.1863 -0.0257 167 ARG B NH2 
3025 N N   . LEU B 190 ? 0.8287 1.2393 0.9436 -0.0688 0.0031  -0.0310 168 LEU B N   
3026 C CA  . LEU B 190 ? 0.8458 1.2575 0.9883 -0.0654 0.0176  -0.0195 168 LEU B CA  
3027 C C   . LEU B 190 ? 0.8675 1.2870 1.0363 -0.0695 0.0381  -0.0275 168 LEU B C   
3028 O O   . LEU B 190 ? 0.8647 1.2829 1.0602 -0.0661 0.0475  -0.0218 168 LEU B O   
3029 C CB  . LEU B 190 ? 0.8112 1.2023 0.9139 -0.0672 0.0244  -0.0040 168 LEU B CB  
3030 C CG  . LEU B 190 ? 0.8745 1.2443 0.9411 -0.0642 0.0029  0.0093  168 LEU B CG  
3031 C CD1 . LEU B 190 ? 0.8552 1.2053 0.8619 -0.0768 0.0133  0.0183  168 LEU B CD1 
3032 C CD2 . LEU B 190 ? 0.9640 1.3268 1.0557 -0.0526 -0.0040 0.0208  168 LEU B CD2 
3033 N N   . GLY B 191 ? 0.8064 1.2293 0.9639 -0.0758 0.0440  -0.0418 169 GLY B N   
3034 C CA  . GLY B 191 ? 0.7371 1.1618 0.9214 -0.0788 0.0545  -0.0516 169 GLY B CA  
3035 C C   . GLY B 191 ? 0.7678 1.2001 0.9907 -0.0793 0.0449  -0.0559 169 GLY B C   
3036 O O   . GLY B 191 ? 0.7769 1.2026 1.0216 -0.0814 0.0540  -0.0532 169 GLY B O   
3037 N N   . LEU B 192 ? 0.7418 1.1844 0.9718 -0.0787 0.0254  -0.0613 170 LEU B N   
3038 C CA  . LEU B 192 ? 0.7602 1.2136 1.0358 -0.0823 0.0156  -0.0636 170 LEU B CA  
3039 C C   . LEU B 192 ? 0.6470 1.1092 0.9559 -0.0792 0.0249  -0.0488 170 LEU B C   
3040 O O   . LEU B 192 ? 0.5124 0.9782 0.8534 -0.0851 0.0355  -0.0466 170 LEU B O   
3041 C CB  . LEU B 192 ? 0.8443 1.3044 1.1238 -0.0820 -0.0125 -0.0727 170 LEU B CB  
3042 C CG  . LEU B 192 ? 0.8417 1.3147 1.1756 -0.0891 -0.0267 -0.0755 170 LEU B CG  
3043 C CD1 . LEU B 192 ? 0.7781 1.2453 1.1310 -0.0995 -0.0125 -0.0775 170 LEU B CD1 
3044 C CD2 . LEU B 192 ? 0.9276 1.3972 1.2557 -0.0889 -0.0597 -0.0889 170 LEU B CD2 
3045 N N   . ALA B 193 ? 0.5720 1.0348 0.8705 -0.0698 0.0221  -0.0391 171 ALA B N   
3046 C CA  . ALA B 193 ? 0.5880 1.0591 0.9178 -0.0627 0.0324  -0.0287 171 ALA B CA  
3047 C C   . ALA B 193 ? 0.6274 1.0821 0.9471 -0.0638 0.0589  -0.0235 171 ALA B C   
3048 O O   . ALA B 193 ? 0.7198 1.1801 1.0684 -0.0649 0.0744  -0.0207 171 ALA B O   
3049 C CB  . ALA B 193 ? 0.6937 1.1597 1.0067 -0.0507 0.0194  -0.0209 171 ALA B CB  
3050 N N   . LEU B 194 ? 0.7326 1.1649 1.0107 -0.0644 0.0645  -0.0223 172 LEU B N   
3051 C CA  . LEU B 194 ? 0.6972 1.1054 0.9619 -0.0641 0.0825  -0.0176 172 LEU B CA  
3052 C C   . LEU B 194 ? 0.6864 1.0877 0.9650 -0.0742 0.0905  -0.0235 172 LEU B C   
3053 O O   . LEU B 194 ? 0.7797 1.1658 1.0593 -0.0739 0.1058  -0.0178 172 LEU B O   
3054 C CB  . LEU B 194 ? 0.6731 1.0621 0.9021 -0.0652 0.0824  -0.0169 172 LEU B CB  
3055 C CG  . LEU B 194 ? 0.6816 1.0394 0.8970 -0.0645 0.0933  -0.0131 172 LEU B CG  
3056 C CD1 . LEU B 194 ? 0.7005 1.0442 0.9056 -0.0525 0.0969  -0.0004 172 LEU B CD1 
3057 C CD2 . LEU B 194 ? 0.6132 0.9598 0.8127 -0.0701 0.0912  -0.0182 172 LEU B CD2 
3058 N N   . ASN B 195 ? 0.6498 1.0568 0.9332 -0.0833 0.0793  -0.0351 173 ASN B N   
3059 C CA  . ASN B 195 ? 0.7447 1.1373 1.0368 -0.0945 0.0807  -0.0404 173 ASN B CA  
3060 C C   . ASN B 195 ? 0.7547 1.1640 1.0839 -0.1021 0.0850  -0.0357 173 ASN B C   
3061 O O   . ASN B 195 ? 0.7723 1.1628 1.1020 -0.1117 0.0968  -0.0314 173 ASN B O   
3062 C CB  . ASN B 195 ? 0.8318 1.2237 1.1198 -0.0994 0.0638  -0.0568 173 ASN B CB  
3063 C CG  . ASN B 195 ? 0.8241 1.1985 1.0869 -0.0955 0.0651  -0.0638 173 ASN B CG  
3064 O OD1 . ASN B 195 ? 0.9082 1.2762 1.1550 -0.0894 0.0746  -0.0551 173 ASN B OD1 
3065 N ND2 . ASN B 195 ? 0.6504 1.0171 0.9147 -0.0989 0.0537  -0.0806 173 ASN B ND2 
3066 N N   . PHE B 196 ? 0.8021 1.2444 1.1631 -0.0997 0.0740  -0.0366 174 PHE B N   
3067 C CA  . PHE B 196 ? 0.7069 1.1732 1.1182 -0.1076 0.0783  -0.0323 174 PHE B CA  
3068 C C   . PHE B 196 ? 0.6421 1.1113 1.0631 -0.1020 0.1069  -0.0213 174 PHE B C   
3069 O O   . PHE B 196 ? 0.5702 1.0373 1.0071 -0.1135 0.1271  -0.0158 174 PHE B O   
3070 C CB  . PHE B 196 ? 0.7380 1.2359 1.1839 -0.1033 0.0542  -0.0370 174 PHE B CB  
3071 C CG  . PHE B 196 ? 0.8608 1.3819 1.3646 -0.1169 0.0458  -0.0377 174 PHE B CG  
3072 C CD1 . PHE B 196 ? 0.9608 1.4747 1.4797 -0.1343 0.0634  -0.0325 174 PHE B CD1 
3073 C CD2 . PHE B 196 ? 0.8935 1.4396 1.4358 -0.1139 0.0182  -0.0426 174 PHE B CD2 
3074 C CE1 . PHE B 196 ? 0.9777 1.5145 1.5557 -0.1508 0.0565  -0.0307 174 PHE B CE1 
3075 C CE2 . PHE B 196 ? 0.8631 1.4319 1.4681 -0.1280 0.0074  -0.0428 174 PHE B CE2 
3076 C CZ  . PHE B 196 ? 0.8643 1.4312 1.4902 -0.1475 0.0280  -0.0363 174 PHE B CZ  
3077 N N   . SER B 197 ? 0.5947 1.0639 0.9997 -0.0846 0.1096  -0.0182 175 SER B N   
3078 C CA  . SER B 197 ? 0.6620 1.1272 1.0664 -0.0741 0.1349  -0.0110 175 SER B CA  
3079 C C   . SER B 197 ? 0.7623 1.1880 1.1287 -0.0822 0.1573  -0.0066 175 SER B C   
3080 O O   . SER B 197 ? 0.7393 1.1649 1.1145 -0.0836 0.1844  -0.0019 175 SER B O   
3081 C CB  . SER B 197 ? 0.7851 1.2417 1.1636 -0.0551 0.1254  -0.0089 175 SER B CB  
3082 O OG  . SER B 197 ? 1.0590 1.4951 1.4166 -0.0426 0.1451  -0.0038 175 SER B OG  
3083 N N   . VAL B 198 ? 0.9259 1.3163 1.2500 -0.0882 0.1458  -0.0093 176 VAL B N   
3084 C CA  . VAL B 198 ? 0.8510 1.1936 1.1343 -0.0962 0.1579  -0.0060 176 VAL B CA  
3085 C C   . VAL B 198 ? 0.8325 1.1740 1.1328 -0.1173 0.1647  -0.0045 176 VAL B C   
3086 O O   . VAL B 198 ? 0.9249 1.2335 1.1983 -0.1255 0.1853  0.0026  176 VAL B O   
3087 C CB  . VAL B 198 ? 0.7368 1.0451 0.9823 -0.0948 0.1387  -0.0116 176 VAL B CB  
3088 C CG1 . VAL B 198 ? 0.7531 1.0088 0.9631 -0.1060 0.1389  -0.0113 176 VAL B CG1 
3089 C CG2 . VAL B 198 ? 0.7470 1.0436 0.9686 -0.0779 0.1385  -0.0078 176 VAL B CG2 
3090 N N   . PHE B 199 ? 0.8274 1.1990 1.1671 -0.1274 0.1464  -0.0104 177 PHE B N   
3091 C CA  . PHE B 199 ? 0.8118 1.1841 1.1747 -0.1498 0.1498  -0.0072 177 PHE B CA  
3092 C C   . PHE B 199 ? 0.9215 1.3181 1.3165 -0.1550 0.1836  0.0032  177 PHE B C   
3093 O O   . PHE B 199 ? 1.0216 1.3935 1.4013 -0.1727 0.2047  0.0121  177 PHE B O   
3094 C CB  . PHE B 199 ? 0.6704 1.0731 1.0753 -0.1568 0.1207  -0.0161 177 PHE B CB  
3095 C CG  . PHE B 199 ? 0.6293 1.0324 1.0640 -0.1818 0.1190  -0.0116 177 PHE B CG  
3096 C CD1 . PHE B 199 ? 0.7438 1.0989 1.1440 -0.1976 0.1072  -0.0123 177 PHE B CD1 
3097 C CD2 . PHE B 199 ? 0.5404 0.9898 1.0414 -0.1905 0.1258  -0.0066 177 PHE B CD2 
3098 C CE1 . PHE B 199 ? 0.7731 1.1225 1.1977 -0.2239 0.1025  -0.0059 177 PHE B CE1 
3099 C CE2 . PHE B 199 ? 0.5125 0.9623 1.0455 -0.2173 0.1234  -0.0004 177 PHE B CE2 
3100 C CZ  . PHE B 199 ? 0.5901 0.9880 1.0814 -0.2350 0.1122  0.0011  177 PHE B CZ  
3101 N N   . TYR B 200 ? 0.8763 1.3200 1.3155 -0.1397 0.1894  0.0017  178 TYR B N   
3102 C CA  . TYR B 200 ? 0.8526 1.3287 1.3349 -0.1407 0.2239  0.0077  178 TYR B CA  
3103 C C   . TYR B 200 ? 0.9137 1.3491 1.3391 -0.1362 0.2595  0.0142  178 TYR B C   
3104 O O   . TYR B 200 ? 0.9850 1.4222 1.4182 -0.1498 0.2948  0.0215  178 TYR B O   
3105 C CB  . TYR B 200 ? 0.8139 1.3416 1.3523 -0.1198 0.2161  0.0015  178 TYR B CB  
3106 C CG  . TYR B 200 ? 0.8914 1.4661 1.5054 -0.1293 0.1923  -0.0026 178 TYR B CG  
3107 C CD1 . TYR B 200 ? 0.9691 1.5658 1.6063 -0.1136 0.1579  -0.0105 178 TYR B CD1 
3108 C CD2 . TYR B 200 ? 0.9024 1.4943 1.5620 -0.1553 0.2017  0.0025  178 TYR B CD2 
3109 C CE1 . TYR B 200 ? 1.0443 1.6758 1.7459 -0.1213 0.1302  -0.0151 178 TYR B CE1 
3110 C CE2 . TYR B 200 ? 0.9708 1.6024 1.7032 -0.1644 0.1749  -0.0013 178 TYR B CE2 
3111 C CZ  . TYR B 200 ? 1.0037 1.6540 1.7567 -0.1461 0.1379  -0.0110 178 TYR B CZ  
3112 O OH  . TYR B 200 ? 0.9585 1.6404 1.7792 -0.1540 0.1055  -0.0156 178 TYR B OH  
3113 N N   . TYR B 201 ? 0.8711 1.2666 1.2364 -0.1183 0.2510  0.0120  179 TYR B N   
3114 C CA  . TYR B 201 ? 0.9506 1.3006 1.2562 -0.1101 0.2792  0.0166  179 TYR B CA  
3115 C C   . TYR B 201 ? 0.9996 1.2876 1.2446 -0.1317 0.2857  0.0239  179 TYR B C   
3116 O O   . TYR B 201 ? 0.9793 1.2498 1.2034 -0.1425 0.3214  0.0314  179 TYR B O   
3117 C CB  . TYR B 201 ? 0.9048 1.2278 1.1691 -0.0856 0.2614  0.0127  179 TYR B CB  
3118 C CG  . TYR B 201 ? 0.9311 1.2115 1.1406 -0.0706 0.2862  0.0150  179 TYR B CG  
3119 C CD1 . TYR B 201 ? 0.9602 1.1674 1.0925 -0.0774 0.2889  0.0196  179 TYR B CD1 
3120 C CD2 . TYR B 201 ? 0.9480 1.2565 1.1810 -0.0479 0.3036  0.0109  179 TYR B CD2 
3121 C CE1 . TYR B 201 ? 1.1641 1.3241 1.2370 -0.0621 0.3092  0.0206  179 TYR B CE1 
3122 C CE2 . TYR B 201 ? 1.0536 1.3198 1.2324 -0.0312 0.3257  0.0104  179 TYR B CE2 
3123 C CZ  . TYR B 201 ? 1.1718 1.3624 1.2672 -0.0384 0.3290  0.0156  179 TYR B CZ  
3124 O OH  . TYR B 201 ? 1.2239 1.3651 1.2571 -0.0202 0.3487  0.0140  179 TYR B OH  
3125 N N   . GLU B 202 ? 0.9531 1.2057 1.1690 -0.1387 0.2516  0.0211  180 GLU B N   
3126 C CA  . GLU B 202 ? 0.9944 1.1741 1.1432 -0.1544 0.2486  0.0264  180 GLU B CA  
3127 C C   . GLU B 202 ? 1.0661 1.2436 1.2318 -0.1845 0.2452  0.0316  180 GLU B C   
3128 O O   . GLU B 202 ? 1.2371 1.3489 1.3443 -0.2007 0.2435  0.0381  180 GLU B O   
3129 C CB  . GLU B 202 ? 0.8254 0.9607 0.9346 -0.1444 0.2117  0.0188  180 GLU B CB  
3130 N N   . ILE B 203 ? 0.9253 1.1652 1.1654 -0.1932 0.2401  0.0295  181 ILE B N   
3131 C CA  . ILE B 203 ? 0.9271 1.1598 1.1837 -0.2232 0.2319  0.0351  181 ILE B CA  
3132 C C   . ILE B 203 ? 1.0347 1.3213 1.3544 -0.2393 0.2657  0.0445  181 ILE B C   
3133 O O   . ILE B 203 ? 1.2089 1.4798 1.5299 -0.2694 0.2754  0.0559  181 ILE B O   
3134 C CB  . ILE B 203 ? 0.8505 1.0974 1.1380 -0.2238 0.1855  0.0226  181 ILE B CB  
3135 C CG1 . ILE B 203 ? 0.8141 1.0111 1.0481 -0.2102 0.1558  0.0118  181 ILE B CG1 
3136 C CG2 . ILE B 203 ? 0.8310 1.0652 1.1356 -0.2549 0.1722  0.0283  181 ILE B CG2 
3137 C CD1 . ILE B 203 ? 0.9102 1.0310 1.0877 -0.2280 0.1406  0.0153  181 ILE B CD1 
3138 N N   . LEU B 204 ? 1.0088 1.3594 1.3860 -0.2208 0.2820  0.0399  182 LEU B N   
3139 C CA  . LEU B 204 ? 0.9582 1.3705 1.4137 -0.2330 0.3128  0.0456  182 LEU B CA  
3140 C C   . LEU B 204 ? 0.9675 1.3918 1.4166 -0.2218 0.3656  0.0489  182 LEU B C   
3141 O O   . LEU B 204 ? 0.9398 1.4219 1.4621 -0.2296 0.3968  0.0514  182 LEU B O   
3142 C CB  . LEU B 204 ? 0.8152 1.2968 1.3593 -0.2214 0.2850  0.0350  182 LEU B CB  
3143 C CG  . LEU B 204 ? 0.7330 1.2151 1.3034 -0.2392 0.2413  0.0324  182 LEU B CG  
3144 C CD1 . LEU B 204 ? 0.5759 1.1268 1.2432 -0.2359 0.2227  0.0259  182 LEU B CD1 
3145 C CD2 . LEU B 204 ? 0.7312 1.1779 1.2848 -0.2755 0.2511  0.0460  182 LEU B CD2 
3146 N N   . ASN B 205 ? 1.0682 1.4387 1.4341 -0.2036 0.3759  0.0477  183 ASN B N   
3147 C CA  . ASN B 205 ? 1.0471 1.4193 1.3932 -0.1861 0.4219  0.0470  183 ASN B CA  
3148 C C   . ASN B 205 ? 0.9826 1.4401 1.4256 -0.1667 0.4371  0.0372  183 ASN B C   
3149 O O   . ASN B 205 ? 1.1087 1.5902 1.5698 -0.1624 0.4858  0.0367  183 ASN B O   
3150 C CB  . ASN B 205 ? 1.1092 1.4490 1.4143 -0.2129 0.4705  0.0607  183 ASN B CB  
3151 C CG  . ASN B 205 ? 1.3150 1.5511 1.4995 -0.2230 0.4600  0.0689  183 ASN B CG  
3152 O OD1 . ASN B 205 ? 1.3588 1.5505 1.4953 -0.2063 0.4196  0.0625  183 ASN B OD1 
3153 N ND2 . ASN B 205 ? 1.4378 1.6323 1.5732 -0.2519 0.4954  0.0835  183 ASN B ND2 
3154 N N   . SER B 206 ? 0.8179 1.3167 1.3181 -0.1526 0.3953  0.0280  184 SER B N   
3155 C CA  . SER B 206 ? 0.8756 1.4448 1.4622 -0.1301 0.3963  0.0171  184 SER B CA  
3156 C C   . SER B 206 ? 0.9249 1.4769 1.4773 -0.0955 0.3711  0.0079  184 SER B C   
3157 O O   . SER B 206 ? 0.9260 1.4918 1.4996 -0.0876 0.3275  0.0031  184 SER B O   
3158 C CB  . SER B 206 ? 0.9180 1.5435 1.5973 -0.1417 0.3630  0.0144  184 SER B CB  
3159 O OG  . SER B 206 ? 0.9959 1.6362 1.7129 -0.1767 0.3778  0.0242  184 SER B OG  
3160 N N   . PRO B 207 ? 0.9066 1.4252 1.4029 -0.0750 0.3959  0.0055  185 PRO B N   
3161 C CA  . PRO B 207 ? 0.9203 1.4183 1.3845 -0.0444 0.3678  -0.0014 185 PRO B CA  
3162 C C   . PRO B 207 ? 0.9343 1.4918 1.4798 -0.0241 0.3458  -0.0116 185 PRO B C   
3163 O O   . PRO B 207 ? 1.0232 1.5659 1.5492 -0.0090 0.3075  -0.0136 185 PRO B O   
3164 C CB  . PRO B 207 ? 0.9277 1.3813 1.3256 -0.0270 0.4027  -0.0032 185 PRO B CB  
3165 C CG  . PRO B 207 ? 0.9625 1.3845 1.3182 -0.0539 0.4382  0.0065  185 PRO B CG  
3166 C CD  . PRO B 207 ? 0.9240 1.4084 1.3672 -0.0804 0.4467  0.0101  185 PRO B CD  
3167 N N   . GLU B 208 ? 0.8793 1.5022 1.5176 -0.0250 0.3662  -0.0175 186 GLU B N   
3168 C CA  . GLU B 208 ? 0.8452 1.5168 1.5589 -0.0010 0.3410  -0.0293 186 GLU B CA  
3169 C C   . GLU B 208 ? 0.7724 1.4607 1.5200 -0.0103 0.2884  -0.0281 186 GLU B C   
3170 O O   . GLU B 208 ? 0.6826 1.3670 1.4292 0.0094  0.2500  -0.0329 186 GLU B O   
3171 C CB  . GLU B 208 ? 0.8192 1.5578 1.6304 0.0048  0.3795  -0.0393 186 GLU B CB  
3172 C CG  . GLU B 208 ? 0.8717 1.5900 1.6384 0.0105  0.4386  -0.0407 186 GLU B CG  
3173 C CD  . GLU B 208 ? 1.0371 1.8133 1.8772 0.0177  0.4696  -0.0501 186 GLU B CD  
3174 O OE1 . GLU B 208 ? 1.1151 1.9341 2.0277 0.0446  0.4496  -0.0649 186 GLU B OE1 
3175 O OE2 . GLU B 208 ? 1.1013 1.8749 1.9194 -0.0027 0.5090  -0.0422 186 GLU B OE2 
3176 N N   . LYS B 209 ? 0.7745 1.4754 1.5458 -0.0401 0.2840  -0.0216 187 LYS B N   
3177 C CA  . LYS B 209 ? 0.7083 1.4080 1.4853 -0.0480 0.2329  -0.0213 187 LYS B CA  
3178 C C   . LYS B 209 ? 0.7682 1.4078 1.4465 -0.0435 0.2102  -0.0172 187 LYS B C   
3179 O O   . LYS B 209 ? 0.7443 1.3768 1.4104 -0.0343 0.1708  -0.0198 187 LYS B O   
3180 C CB  . LYS B 209 ? 0.4528 1.1694 1.2672 -0.0800 0.2307  -0.0162 187 LYS B CB  
3181 N N   . ALA B 210 ? 0.8305 1.4243 1.4376 -0.0508 0.2350  -0.0107 188 ALA B N   
3182 C CA  . ALA B 210 ? 0.7126 1.2524 1.2366 -0.0485 0.2156  -0.0074 188 ALA B CA  
3183 C C   . ALA B 210 ? 0.7145 1.2411 1.2140 -0.0222 0.1992  -0.0097 188 ALA B C   
3184 O O   . ALA B 210 ? 0.8370 1.3437 1.3021 -0.0206 0.1692  -0.0084 188 ALA B O   
3185 C CB  . ALA B 210 ? 0.7270 1.2172 1.1862 -0.0591 0.2424  -0.0011 188 ALA B CB  
3186 N N   . CYS B 211 ? 0.6433 1.1772 1.1563 -0.0016 0.2195  -0.0132 189 CYS B N   
3187 C CA  . CYS B 211 ? 0.7232 1.2383 1.2112 0.0228  0.1974  -0.0147 189 CYS B CA  
3188 C C   . CYS B 211 ? 0.9417 1.4925 1.4850 0.0332  0.1635  -0.0201 189 CYS B C   
3189 O O   . CYS B 211 ? 1.1130 1.6398 1.6222 0.0416  0.1312  -0.0170 189 CYS B O   
3190 C CB  . CYS B 211 ? 0.7396 1.2383 1.2111 0.0456  0.2236  -0.0189 189 CYS B CB  
3191 S SG  . CYS B 211 ? 0.9718 1.4204 1.3729 0.0374  0.2648  -0.0143 189 CYS B SG  
3192 N N   . SER B 212 ? 0.9566 1.5607 1.5838 0.0311  0.1676  -0.0271 190 SER B N   
3193 C CA  . SER B 212 ? 0.9762 1.6071 1.6548 0.0407  0.1270  -0.0328 190 SER B CA  
3194 C C   . SER B 212 ? 0.8703 1.4797 1.5090 0.0252  0.0904  -0.0271 190 SER B C   
3195 O O   . SER B 212 ? 0.9569 1.5505 1.5766 0.0347  0.0525  -0.0265 190 SER B O   
3196 C CB  . SER B 212 ? 1.0437 1.7376 1.8298 0.0392  0.1359  -0.0421 190 SER B CB  
3197 O OG  . SER B 212 ? 1.1115 1.8219 1.9228 0.0133  0.1250  -0.0391 190 SER B OG  
3198 N N   . LEU B 213 ? 0.6789 1.2807 1.2949 0.0017  0.1019  -0.0229 191 LEU B N   
3199 C CA  . LEU B 213 ? 0.6850 1.2694 1.2654 -0.0112 0.0709  -0.0212 191 LEU B CA  
3200 C C   . LEU B 213 ? 0.6805 1.2191 1.1783 -0.0066 0.0612  -0.0149 191 LEU B C   
3201 O O   . LEU B 213 ? 0.7334 1.2590 1.2057 -0.0038 0.0296  -0.0139 191 LEU B O   
3202 C CB  . LEU B 213 ? 0.4276 1.0164 1.0130 -0.0354 0.0837  -0.0211 191 LEU B CB  
3203 C CG  . LEU B 213 ? 0.6184 1.1825 1.1558 -0.0504 0.0671  -0.0219 191 LEU B CG  
3204 C CD1 . LEU B 213 ? 0.6150 1.1756 1.1396 -0.0456 0.0270  -0.0260 191 LEU B CD1 
3205 C CD2 . LEU B 213 ? 0.4824 1.0643 1.0611 -0.0708 0.0756  -0.0237 191 LEU B CD2 
3206 N N   . ALA B 214 ? 0.6429 1.1540 1.0978 -0.0061 0.0873  -0.0099 192 ALA B N   
3207 C CA  . ALA B 214 ? 0.5765 1.0465 0.9640 -0.0024 0.0791  -0.0030 192 ALA B CA  
3208 C C   . ALA B 214 ? 0.6735 1.1341 1.0552 0.0166  0.0575  0.0000  192 ALA B C   
3209 O O   . ALA B 214 ? 0.7063 1.1424 1.0438 0.0147  0.0356  0.0064  192 ALA B O   
3210 C CB  . ALA B 214 ? 0.4592 0.8988 0.8103 -0.0036 0.1062  0.0007  192 ALA B CB  
3211 N N   . LYS B 215 ? 0.7134 1.1904 1.1372 0.0351  0.0642  -0.0048 193 LYS B N   
3212 C CA  . LYS B 215 ? 0.7866 1.2482 1.2040 0.0554  0.0383  -0.0034 193 LYS B CA  
3213 C C   . LYS B 215 ? 0.8380 1.3059 1.2659 0.0540  -0.0026 -0.0036 193 LYS B C   
3214 O O   . LYS B 215 ? 0.9412 1.3751 1.3241 0.0582  -0.0310 0.0042  193 LYS B O   
3215 C CB  . LYS B 215 ? 0.7845 1.2652 1.2514 0.0792  0.0525  -0.0129 193 LYS B CB  
3216 C CG  . LYS B 215 ? 0.9201 1.3766 1.3759 0.1023  0.0202  -0.0127 193 LYS B CG  
3217 C CD  . LYS B 215 ? 0.9153 1.3628 1.3785 0.1285  0.0374  -0.0203 193 LYS B CD  
3218 C CE  . LYS B 215 ? 0.7767 1.2335 1.2854 0.1550  0.0041  -0.0303 193 LYS B CE  
3219 N NZ  . LYS B 215 ? 0.7489 1.1750 1.2219 0.1484  -0.0467 -0.0194 193 LYS B NZ  
3220 N N   . THR B 216 ? 0.7281 1.2333 1.2109 0.0471  -0.0090 -0.0116 194 THR B N   
3221 C CA  . THR B 216 ? 0.6762 1.1783 1.1616 0.0466  -0.0531 -0.0127 194 THR B CA  
3222 C C   . THR B 216 ? 0.6605 1.1271 1.0653 0.0289  -0.0644 -0.0039 194 THR B C   
3223 O O   . THR B 216 ? 0.6145 1.0482 0.9724 0.0308  -0.0963 0.0025  194 THR B O   
3224 C CB  . THR B 216 ? 0.6905 1.2387 1.2585 0.0432  -0.0610 -0.0239 194 THR B CB  
3225 O OG1 . THR B 216 ? 0.7000 1.2807 1.3481 0.0639  -0.0625 -0.0333 194 THR B OG1 
3226 C CG2 . THR B 216 ? 0.6623 1.1964 1.2141 0.0367  -0.1065 -0.0250 194 THR B CG2 
3227 N N   . ALA B 217 ? 0.7821 1.2526 1.1679 0.0115  -0.0379 -0.0040 195 ALA B N   
3228 C CA  . ALA B 217 ? 0.8487 1.2913 1.1639 -0.0036 -0.0405 0.0013  195 ALA B CA  
3229 C C   . ALA B 217 ? 0.8238 1.2281 1.0779 -0.0012 -0.0428 0.0142  195 ALA B C   
3230 O O   . ALA B 217 ? 0.7659 1.1444 0.9634 -0.0099 -0.0581 0.0206  195 ALA B O   
3231 C CB  . ALA B 217 ? 0.8448 1.2965 1.1576 -0.0181 -0.0102 -0.0028 195 ALA B CB  
3232 N N   . PHE B 218 ? 0.7787 1.1758 1.0398 0.0092  -0.0270 0.0185  196 PHE B N   
3233 C CA  . PHE B 218 ? 0.7967 1.1544 1.0050 0.0108  -0.0334 0.0318  196 PHE B CA  
3234 C C   . PHE B 218 ? 0.9222 1.2573 1.1138 0.0202  -0.0726 0.0377  196 PHE B C   
3235 O O   . PHE B 218 ? 1.0159 1.3191 1.1477 0.0087  -0.0884 0.0493  196 PHE B O   
3236 C CB  . PHE B 218 ? 0.6613 1.0103 0.8800 0.0229  -0.0132 0.0329  196 PHE B CB  
3237 C CG  . PHE B 218 ? 0.6944 0.9997 0.8627 0.0237  -0.0224 0.0469  196 PHE B CG  
3238 C CD1 . PHE B 218 ? 0.7068 0.9883 0.8691 0.0404  -0.0495 0.0518  196 PHE B CD1 
3239 C CD2 . PHE B 218 ? 0.7853 1.0725 0.9172 0.0075  -0.0073 0.0547  196 PHE B CD2 
3240 C CE1 . PHE B 218 ? 0.7222 0.9590 0.8380 0.0392  -0.0617 0.0663  196 PHE B CE1 
3241 C CE2 . PHE B 218 ? 0.7757 1.0231 0.8679 0.0054  -0.0175 0.0692  196 PHE B CE2 
3242 C CZ  . PHE B 218 ? 0.7132 0.9336 0.7944 0.0202  -0.0450 0.0761  196 PHE B CZ  
3243 N N   . ASP B 219 ? 0.9518 1.3022 1.1964 0.0406  -0.0890 0.0295  197 ASP B N   
3244 C CA  . ASP B 219 ? 1.0282 1.3500 1.2605 0.0537  -0.1320 0.0338  197 ASP B CA  
3245 C C   . ASP B 219 ? 0.9524 1.2600 1.1554 0.0434  -0.1665 0.0356  197 ASP B C   
3246 O O   . ASP B 219 ? 0.7682 1.0294 0.9159 0.0424  -0.2003 0.0470  197 ASP B O   
3247 C CB  . ASP B 219 ? 1.1360 1.4840 1.4453 0.0809  -0.1400 0.0199  197 ASP B CB  
3248 C CG  . ASP B 219 ? 1.2451 1.5929 1.5654 0.0950  -0.1104 0.0180  197 ASP B CG  
3249 O OD1 . ASP B 219 ? 1.3043 1.6079 1.5680 0.0948  -0.1156 0.0303  197 ASP B OD1 
3250 O OD2 . ASP B 219 ? 1.2771 1.6658 1.6601 0.1054  -0.0825 0.0045  197 ASP B OD2 
3251 N N   . GLU B 220 ? 0.8101 1.1491 1.0416 0.0350  -0.1614 0.0250  198 GLU B N   
3252 C CA  . GLU B 220 ? 0.9256 1.2420 1.1155 0.0254  -0.1946 0.0258  198 GLU B CA  
3253 C C   . GLU B 220 ? 1.0491 1.3282 1.1424 0.0040  -0.1833 0.0393  198 GLU B C   
3254 O O   . GLU B 220 ? 0.8826 1.1225 0.9125 -0.0032 -0.2125 0.0453  198 GLU B O   
3255 C CB  . GLU B 220 ? 0.8559 1.2118 1.1007 0.0221  -0.1943 0.0102  198 GLU B CB  
3256 N N   . ALA B 221 ? 1.1850 1.4737 1.2661 -0.0063 -0.1417 0.0438  199 ALA B N   
3257 C CA  . ALA B 221 ? 1.0810 1.3444 1.0864 -0.0270 -0.1245 0.0551  199 ALA B CA  
3258 C C   . ALA B 221 ? 1.0587 1.2764 1.0105 -0.0303 -0.1370 0.0754  199 ALA B C   
3259 O O   . ALA B 221 ? 1.0120 1.1965 0.8900 -0.0481 -0.1389 0.0880  199 ALA B O   
3260 C CB  . ALA B 221 ? 0.8955 1.1885 0.9210 -0.0359 -0.0803 0.0497  199 ALA B CB  
3261 N N   . ILE B 222 ? 1.0792 1.2924 1.0642 -0.0143 -0.1437 0.0790  200 ILE B N   
3262 C CA  . ILE B 222 ? 1.2372 1.3999 1.1732 -0.0155 -0.1661 0.0981  200 ILE B CA  
3263 C C   . ILE B 222 ? 1.3964 1.5193 1.2981 -0.0102 -0.2166 0.1027  200 ILE B C   
3264 O O   . ILE B 222 ? 1.5638 1.6334 1.3910 -0.0239 -0.2361 0.1222  200 ILE B O   
3265 C CB  . ILE B 222 ? 1.1959 1.3591 1.1736 0.0038  -0.1635 0.0975  200 ILE B CB  
3266 C CG1 . ILE B 222 ? 1.0477 1.2256 1.0306 -0.0064 -0.1219 0.0995  200 ILE B CG1 
3267 C CG2 . ILE B 222 ? 1.3739 1.4804 1.3101 0.0089  -0.2016 0.1139  200 ILE B CG2 
3268 C CD1 . ILE B 222 ? 0.9631 1.1171 0.9507 0.0055  -0.1240 0.1059  200 ILE B CD1 
3269 N N   . ALA B 223 ? 1.3817 1.5261 1.3361 0.0077  -0.2407 0.0859  201 ALA B N   
3270 C CA  . ALA B 223 ? 1.3412 1.4440 1.2701 0.0158  -0.2969 0.0880  201 ALA B CA  
3271 C C   . ALA B 223 ? 1.4081 1.4624 1.2339 -0.0089 -0.3083 0.1019  201 ALA B C   
3272 O O   . ALA B 223 ? 1.3516 1.3447 1.1161 -0.0103 -0.3534 0.1141  201 ALA B O   
3273 C CB  . ALA B 223 ? 1.2586 1.4009 1.2708 0.0352  -0.3173 0.0656  201 ALA B CB  
3274 N N   . GLU B 224 ? 1.4260 1.5033 1.2274 -0.0283 -0.2671 0.0998  202 GLU B N   
3275 C CA  . GLU B 224 ? 1.4838 1.5249 1.1904 -0.0506 -0.2671 0.1076  202 GLU B CA  
3276 C C   . GLU B 224 ? 1.4510 1.4975 1.1136 -0.0753 -0.2158 0.1197  202 GLU B C   
3277 O O   . GLU B 224 ? 1.5014 1.5730 1.1515 -0.0867 -0.1832 0.1099  202 GLU B O   
3278 C CB  . GLU B 224 ? 1.5247 1.5940 1.2509 -0.0478 -0.2667 0.0867  202 GLU B CB  
3279 C CG  . GLU B 224 ? 1.7661 1.8226 1.5215 -0.0296 -0.3216 0.0751  202 GLU B CG  
3280 C CD  . GLU B 224 ? 1.9678 2.0421 1.7256 -0.0320 -0.3214 0.0572  202 GLU B CD  
3281 O OE1 . GLU B 224 ? 1.9935 2.0964 1.7411 -0.0448 -0.2749 0.0522  202 GLU B OE1 
3282 O OE2 . GLU B 224 ? 2.0735 2.1301 1.8436 -0.0208 -0.3703 0.0475  202 GLU B OE2 
3283 N N   . LEU B 225 ? 1.3895 1.4128 1.0326 -0.0836 -0.2097 0.1397  203 LEU B N   
3284 C CA  . LEU B 225 ? 1.4075 1.4364 1.0122 -0.1101 -0.1632 0.1513  203 LEU B CA  
3285 C C   . LEU B 225 ? 1.5570 1.5364 1.0520 -0.1360 -0.1640 0.1671  203 LEU B C   
3286 O O   . LEU B 225 ? 1.4502 1.4366 0.9128 -0.1603 -0.1222 0.1765  203 LEU B O   
3287 C CB  . LEU B 225 ? 1.2843 1.3087 0.9108 -0.1138 -0.1523 0.1672  203 LEU B CB  
3288 C CG  . LEU B 225 ? 1.2154 1.2902 0.9359 -0.0946 -0.1329 0.1516  203 LEU B CG  
3289 C CD1 . LEU B 225 ? 1.2578 1.3151 0.9858 -0.0985 -0.1283 0.1678  203 LEU B CD1 
3290 C CD2 . LEU B 225 ? 1.1327 1.2621 0.8895 -0.0990 -0.0906 0.1328  203 LEU B CD2 
3291 N N   . ASP B 226 ? 1.8070 1.7351 1.2452 -0.1314 -0.2106 0.1697  204 ASP B N   
3292 C CA  . ASP B 226 ? 1.9249 1.7996 1.2459 -0.1547 -0.2119 0.1816  204 ASP B CA  
3293 C C   . ASP B 226 ? 1.8263 1.7398 1.1355 -0.1625 -0.1677 0.1625  204 ASP B C   
3294 O O   . ASP B 226 ? 1.7808 1.6720 1.0046 -0.1874 -0.1379 0.1719  204 ASP B O   
3295 C CB  . ASP B 226 ? 2.0476 1.8564 1.3162 -0.1431 -0.2792 0.1834  204 ASP B CB  
3296 C CG  . ASP B 226 ? 2.0308 1.8748 1.3971 -0.1090 -0.3147 0.1576  204 ASP B CG  
3297 O OD1 . ASP B 226 ? 1.9692 1.8844 1.4216 -0.0984 -0.2829 0.1370  204 ASP B OD1 
3298 O OD2 . ASP B 226 ? 2.0639 1.8633 1.4233 -0.0937 -0.3758 0.1582  204 ASP B OD2 
3299 N N   . THR B 227 ? 1.8016 1.7712 1.1943 -0.1417 -0.1627 0.1353  205 THR B N   
3300 C CA  . THR B 227 ? 1.8860 1.8860 1.2710 -0.1433 -0.1338 0.1129  205 THR B CA  
3301 C C   . THR B 227 ? 1.8511 1.9130 1.2874 -0.1518 -0.0731 0.1043  205 THR B C   
3302 O O   . THR B 227 ? 1.8580 1.9597 1.3278 -0.1446 -0.0538 0.0800  205 THR B O   
3303 C CB  . THR B 227 ? 1.9061 1.9251 1.3496 -0.1184 -0.1688 0.0889  205 THR B CB  
3304 O OG1 . THR B 227 ? 1.9573 1.9850 1.3693 -0.1201 -0.1537 0.0683  205 THR B OG1 
3305 C CG2 . THR B 227 ? 1.7491 1.8301 1.3178 -0.1010 -0.1611 0.0780  205 THR B CG2 
3306 N N   . LEU B 228 ? 1.7866 1.8544 1.2328 -0.1664 -0.0473 0.1229  206 LEU B N   
3307 C CA  . LEU B 228 ? 1.5688 1.6890 1.0586 -0.1761 0.0064  0.1144  206 LEU B CA  
3308 C C   . LEU B 228 ? 1.6910 1.8014 1.1018 -0.2009 0.0454  0.1179  206 LEU B C   
3309 O O   . LEU B 228 ? 1.6233 1.6835 0.9485 -0.2212 0.0420  0.1418  206 LEU B O   
3310 C CB  . LEU B 228 ? 1.3051 1.4394 0.8521 -0.1798 0.0161  0.1299  206 LEU B CB  
3311 C CG  . LEU B 228 ? 1.1529 1.3232 0.7974 -0.1555 0.0056  0.1158  206 LEU B CG  
3312 C CD1 . LEU B 228 ? 1.1692 1.3404 0.8526 -0.1590 0.0120  0.1315  206 LEU B CD1 
3313 C CD2 . LEU B 228 ? 0.9336 1.1552 0.6285 -0.1479 0.0318  0.0876  206 LEU B CD2 
3314 N N   . SER B 229 ? 1.7896 1.9477 1.2301 -0.1994 0.0837  0.0934  207 SER B N   
3315 C CA  . SER B 229 ? 1.8856 2.0483 1.2658 -0.2187 0.1293  0.0885  207 SER B CA  
3316 C C   . SER B 229 ? 1.9786 2.1777 1.4036 -0.2387 0.1751  0.0991  207 SER B C   
3317 O O   . SER B 229 ? 1.9162 2.1425 1.4269 -0.2327 0.1712  0.1022  207 SER B O   
3318 C CB  . SER B 229 ? 1.8103 2.0039 1.2030 -0.2026 0.1417  0.0521  207 SER B CB  
3319 O OG  . SER B 229 ? 1.8483 2.0638 1.2092 -0.2165 0.1948  0.0401  207 SER B OG  
3320 N N   . GLU B 230 ? 2.1035 2.3005 1.4678 -0.2635 0.2187  0.1047  208 GLU B N   
3321 C CA  . GLU B 230 ? 2.0683 2.3020 1.4779 -0.2863 0.2644  0.1152  208 GLU B CA  
3322 C C   . GLU B 230 ? 1.9958 2.3018 1.5154 -0.2732 0.2924  0.0852  208 GLU B C   
3323 O O   . GLU B 230 ? 2.0604 2.3970 1.6488 -0.2850 0.3123  0.0934  208 GLU B O   
3324 C CB  . GLU B 230 ? 2.0961 2.3143 1.4149 -0.3174 0.3100  0.1268  208 GLU B CB  
3325 N N   . GLU B 231 ? 1.8809 2.2102 1.4193 -0.2494 0.2900  0.0509  209 GLU B N   
3326 C CA  . GLU B 231 ? 1.6940 2.0836 1.3329 -0.2358 0.3095  0.0216  209 GLU B CA  
3327 C C   . GLU B 231 ? 1.7430 2.1382 1.4572 -0.2124 0.2690  0.0151  209 GLU B C   
3328 O O   . GLU B 231 ? 1.7841 2.2178 1.5843 -0.2049 0.2781  -0.0003 209 GLU B O   
3329 C CB  . GLU B 231 ? 1.5897 2.0019 1.2072 -0.2244 0.3339  -0.0149 209 GLU B CB  
3330 N N   . SER B 232 ? 1.7448 2.1011 1.4295 -0.2012 0.2248  0.0263  210 SER B N   
3331 C CA  . SER B 232 ? 1.5572 1.9203 1.3067 -0.1793 0.1917  0.0179  210 SER B CA  
3332 C C   . SER B 232 ? 1.3951 1.7352 1.1658 -0.1789 0.1651  0.0441  210 SER B C   
3333 O O   . SER B 232 ? 1.3825 1.7297 1.2082 -0.1620 0.1442  0.0380  210 SER B O   
3334 C CB  . SER B 232 ? 1.5646 1.9113 1.2844 -0.1620 0.1613  0.0027  210 SER B CB  
3335 O OG  . SER B 232 ? 1.5619 1.8626 1.2262 -0.1625 0.1271  0.0236  210 SER B OG  
3336 N N   . TYR B 233 ? 1.3718 1.6816 1.0980 -0.1970 0.1652  0.0727  211 TYR B N   
3337 C CA  . TYR B 233 ? 1.3232 1.6061 1.0670 -0.1927 0.1347  0.0947  211 TYR B CA  
3338 C C   . TYR B 233 ? 1.3657 1.6734 1.1903 -0.1888 0.1431  0.0921  211 TYR B C   
3339 O O   . TYR B 233 ? 1.3870 1.6819 1.2429 -0.1737 0.1175  0.0967  211 TYR B O   
3340 C CB  . TYR B 233 ? 1.2377 1.4742 0.9112 -0.2135 0.1267  0.1266  211 TYR B CB  
3341 C CG  . TYR B 233 ? 1.3919 1.6333 1.0746 -0.2395 0.1549  0.1453  211 TYR B CG  
3342 C CD1 . TYR B 233 ? 1.5222 1.8057 1.2258 -0.2548 0.2018  0.1334  211 TYR B CD1 
3343 C CD2 . TYR B 233 ? 1.3707 1.5741 1.0440 -0.2490 0.1329  0.1743  211 TYR B CD2 
3344 N N   . LYS B 234 ? 1.3196 1.6609 1.1790 -0.2007 0.1777  0.0830  212 LYS B N   
3345 C CA  . LYS B 234 ? 1.1623 1.5225 1.0991 -0.1949 0.1798  0.0767  212 LYS B CA  
3346 C C   . LYS B 234 ? 1.0293 1.4024 1.0082 -0.1703 0.1651  0.0531  212 LYS B C   
3347 O O   . LYS B 234 ? 0.9442 1.3057 0.9591 -0.1588 0.1474  0.0558  212 LYS B O   
3348 C CB  . LYS B 234 ? 1.1232 1.5201 1.0967 -0.2117 0.2173  0.0681  212 LYS B CB  
3349 N N   . ASP B 235 ? 1.0167 1.4102 0.9881 -0.1629 0.1722  0.0301  213 ASP B N   
3350 C CA  . ASP B 235 ? 1.0767 1.4814 1.0880 -0.1437 0.1588  0.0090  213 ASP B CA  
3351 C C   . ASP B 235 ? 0.9603 1.3418 0.9591 -0.1303 0.1285  0.0176  213 ASP B C   
3352 O O   . ASP B 235 ? 0.8297 1.2128 0.8671 -0.1174 0.1170  0.0102  213 ASP B O   
3353 C CB  . ASP B 235 ? 1.2959 1.7253 1.3030 -0.1397 0.1712  -0.0187 213 ASP B CB  
3354 C CG  . ASP B 235 ? 1.4573 1.9136 1.4682 -0.1523 0.2063  -0.0296 213 ASP B CG  
3355 O OD1 . ASP B 235 ? 1.5454 2.0167 1.6082 -0.1574 0.2182  -0.0303 213 ASP B OD1 
3356 O OD2 . ASP B 235 ? 1.4466 1.9083 1.4094 -0.1565 0.2219  -0.0387 213 ASP B OD2 
3357 N N   . SER B 236 ? 0.9100 1.2690 0.8560 -0.1334 0.1151  0.0327  214 SER B N   
3358 C CA  . SER B 236 ? 0.8303 1.1726 0.7752 -0.1189 0.0848  0.0376  214 SER B CA  
3359 C C   . SER B 236 ? 0.7852 1.1071 0.7480 -0.1130 0.0717  0.0551  214 SER B C   
3360 O O   . SER B 236 ? 0.7817 1.1046 0.7775 -0.0972 0.0583  0.0510  214 SER B O   
3361 C CB  . SER B 236 ? 1.0328 1.3525 0.9154 -0.1220 0.0677  0.0445  214 SER B CB  
3362 O OG  . SER B 236 ? 1.2008 1.5333 1.0617 -0.1233 0.0752  0.0254  214 SER B OG  
3363 N N   . THR B 237 ? 0.6940 0.9967 0.6364 -0.1256 0.0764  0.0739  215 THR B N   
3364 C CA  . THR B 237 ? 0.6710 0.9497 0.6293 -0.1179 0.0616  0.0881  215 THR B CA  
3365 C C   . THR B 237 ? 0.7876 1.0773 0.7976 -0.1097 0.0710  0.0772  215 THR B C   
3366 O O   . THR B 237 ? 0.9407 1.2124 0.9655 -0.0952 0.0577  0.0805  215 THR B O   
3367 C CB  . THR B 237 ? 0.8092 1.0588 0.7331 -0.1352 0.0593  0.1124  215 THR B CB  
3368 O OG1 . THR B 237 ? 0.9235 1.1931 0.8517 -0.1561 0.0887  0.1116  215 THR B OG1 
3369 C CG2 . THR B 237 ? 0.8721 1.0927 0.7357 -0.1396 0.0386  0.1267  215 THR B CG2 
3370 N N   . LEU B 238 ? 0.7765 1.0909 0.8114 -0.1178 0.0921  0.0634  216 LEU B N   
3371 C CA  . LEU B 238 ? 0.8842 1.1988 0.9618 -0.1096 0.0942  0.0529  216 LEU B CA  
3372 C C   . LEU B 238 ? 0.8240 1.1411 0.9161 -0.0924 0.0860  0.0415  216 LEU B C   
3373 O O   . LEU B 238 ? 0.8114 1.1082 0.9149 -0.0812 0.0792  0.0437  216 LEU B O   
3374 C CB  . LEU B 238 ? 0.8834 1.2234 0.9906 -0.1193 0.1133  0.0369  216 LEU B CB  
3375 N N   . ILE B 239 ? 0.7718 1.1114 0.8617 -0.0909 0.0869  0.0297  217 ILE B N   
3376 C CA  . ILE B 239 ? 0.6553 1.0021 0.7666 -0.0787 0.0805  0.0199  217 ILE B CA  
3377 C C   . ILE B 239 ? 0.7132 1.0449 0.8218 -0.0659 0.0669  0.0315  217 ILE B C   
3378 O O   . ILE B 239 ? 0.6775 1.0063 0.8082 -0.0553 0.0682  0.0282  217 ILE B O   
3379 C CB  . ILE B 239 ? 0.6119 0.9826 0.7215 -0.0809 0.0784  0.0062  217 ILE B CB  
3380 C CG1 . ILE B 239 ? 0.7133 1.0991 0.8237 -0.0905 0.0927  -0.0087 217 ILE B CG1 
3381 C CG2 . ILE B 239 ? 0.5502 0.9303 0.6910 -0.0720 0.0717  -0.0020 217 ILE B CG2 
3382 C CD1 . ILE B 239 ? 0.5168 0.9197 0.6159 -0.0915 0.0898  -0.0245 217 ILE B CD1 
3383 N N   . MET B 240 ? 0.7519 1.0719 0.8319 -0.0665 0.0540  0.0445  218 MET B N   
3384 C CA  . MET B 240 ? 0.6604 0.9648 0.7416 -0.0515 0.0371  0.0529  218 MET B CA  
3385 C C   . MET B 240 ? 0.6695 0.9495 0.7568 -0.0425 0.0400  0.0585  218 MET B C   
3386 O O   . MET B 240 ? 0.8202 1.0942 0.9215 -0.0253 0.0343  0.0573  218 MET B O   
3387 C CB  . MET B 240 ? 0.7933 1.0783 0.8354 -0.0551 0.0172  0.0669  218 MET B CB  
3388 C CG  . MET B 240 ? 0.9124 1.2109 0.9465 -0.0556 0.0039  0.0604  218 MET B CG  
3389 S SD  . MET B 240 ? 1.0215 1.2851 0.9869 -0.0686 -0.0143 0.0787  218 MET B SD  
3390 C CE  . MET B 240 ? 0.9030 1.1376 0.8775 -0.0488 -0.0446 0.0894  218 MET B CE  
3391 N N   . GLN B 241 ? 0.7471 1.0113 0.8244 -0.0530 0.0475  0.0637  219 GLN B N   
3392 C CA  . GLN B 241 ? 0.5470 0.7796 0.6251 -0.0442 0.0458  0.0678  219 GLN B CA  
3393 C C   . GLN B 241 ? 0.6512 0.8872 0.7504 -0.0362 0.0588  0.0540  219 GLN B C   
3394 O O   . GLN B 241 ? 0.6918 0.9038 0.7871 -0.0211 0.0581  0.0539  219 GLN B O   
3395 C CB  . GLN B 241 ? 0.7228 0.9377 0.7922 -0.0593 0.0460  0.0769  219 GLN B CB  
3396 C CG  . GLN B 241 ? 0.7601 0.9672 0.8041 -0.0731 0.0372  0.0939  219 GLN B CG  
3397 C CD  . GLN B 241 ? 0.9056 1.0907 0.9513 -0.0864 0.0356  0.1050  219 GLN B CD  
3398 O OE1 . GLN B 241 ? 0.9156 1.0912 0.9830 -0.0835 0.0381  0.0975  219 GLN B OE1 
3399 N NE2 . GLN B 241 ? 0.9151 1.0890 0.9379 -0.1029 0.0295  0.1234  219 GLN B NE2 
3400 N N   . LEU B 242 ? 0.5651 0.8260 0.6814 -0.0463 0.0705  0.0420  220 LEU B N   
3401 C CA  . LEU B 242 ? 0.6786 0.9372 0.8093 -0.0420 0.0805  0.0309  220 LEU B CA  
3402 C C   . LEU B 242 ? 0.8103 1.0880 0.9568 -0.0320 0.0856  0.0269  220 LEU B C   
3403 O O   . LEU B 242 ? 0.9672 1.2352 1.1186 -0.0272 0.0967  0.0222  220 LEU B O   
3404 C CB  . LEU B 242 ? 0.6889 0.9640 0.8349 -0.0547 0.0865  0.0181  220 LEU B CB  
3405 C CG  . LEU B 242 ? 0.7263 1.0013 0.8762 -0.0664 0.0857  0.0149  220 LEU B CG  
3406 C CD1 . LEU B 242 ? 0.7251 1.0211 0.8946 -0.0726 0.0901  -0.0026 220 LEU B CD1 
3407 C CD2 . LEU B 242 ? 0.6568 0.8919 0.8023 -0.0650 0.0788  0.0192  220 LEU B CD2 
3408 N N   . LEU B 243 ? 0.7201 1.0242 0.8760 -0.0303 0.0775  0.0281  221 LEU B N   
3409 C CA  . LEU B 243 ? 0.6868 1.0111 0.8698 -0.0188 0.0788  0.0243  221 LEU B CA  
3410 C C   . LEU B 243 ? 0.7182 1.0196 0.8957 -0.0006 0.0816  0.0284  221 LEU B C   
3411 O O   . LEU B 243 ? 0.7763 1.0839 0.9725 0.0075  0.0980  0.0226  221 LEU B O   
3412 C CB  . LEU B 243 ? 0.6746 1.0217 0.8665 -0.0181 0.0607  0.0251  221 LEU B CB  
3413 C CG  . LEU B 243 ? 0.6274 1.0000 0.8291 -0.0312 0.0577  0.0166  221 LEU B CG  
3414 C CD1 . LEU B 243 ? 0.6702 1.0476 0.8604 -0.0299 0.0343  0.0197  221 LEU B CD1 
3415 C CD2 . LEU B 243 ? 0.5201 0.9169 0.7641 -0.0320 0.0680  0.0067  221 LEU B CD2 
3416 N N   . ARG B 244 ? 0.6008 0.8736 0.7507 0.0056  0.0667  0.0382  222 ARG B N   
3417 C CA  . ARG B 244 ? 0.7775 1.0263 0.9209 0.0266  0.0650  0.0395  222 ARG B CA  
3418 C C   . ARG B 244 ? 0.8909 1.0998 1.0075 0.0299  0.0771  0.0391  222 ARG B C   
3419 O O   . ARG B 244 ? 0.9111 1.0976 1.0176 0.0489  0.0823  0.0361  222 ARG B O   
3420 C CB  . ARG B 244 ? 0.7394 0.9671 0.8629 0.0333  0.0375  0.0502  222 ARG B CB  
3421 C CG  . ARG B 244 ? 0.8344 1.0284 0.9455 0.0568  0.0309  0.0501  222 ARG B CG  
3422 C CD  . ARG B 244 ? 0.7930 0.9601 0.8847 0.0647  -0.0009 0.0604  222 ARG B CD  
3423 N NE  . ARG B 244 ? 0.9430 1.0931 1.0051 0.0426  -0.0166 0.0765  222 ARG B NE  
3424 C CZ  . ARG B 244 ? 1.1783 1.2830 1.2077 0.0394  -0.0324 0.0896  222 ARG B CZ  
3425 N NH1 . ARG B 244 ? 0.9295 0.9966 0.9468 0.0596  -0.0377 0.0865  222 ARG B NH1 
3426 N NH2 . ARG B 244 ? 1.4021 1.4973 1.4097 0.0154  -0.0421 0.1055  222 ARG B NH2 
3427 N N   . ASP B 245 ? 0.9321 1.1309 1.0378 0.0132  0.0818  0.0393  223 ASP B N   
3428 C CA  . ASP B 245 ? 1.0177 1.1737 1.0969 0.0161  0.0897  0.0371  223 ASP B CA  
3429 C C   . ASP B 245 ? 1.0268 1.1942 1.1156 0.0154  0.1138  0.0280  223 ASP B C   
3430 O O   . ASP B 245 ? 1.1087 1.2418 1.1708 0.0262  0.1261  0.0257  223 ASP B O   
3431 C CB  . ASP B 245 ? 1.0961 1.2320 1.1650 -0.0002 0.0796  0.0397  223 ASP B CB  
3432 C CG  . ASP B 245 ? 1.2260 1.3367 1.2805 -0.0009 0.0587  0.0510  223 ASP B CG  
3433 O OD1 . ASP B 245 ? 1.3305 1.4315 1.3748 0.0117  0.0484  0.0578  223 ASP B OD1 
3434 O OD2 . ASP B 245 ? 1.3207 1.4219 1.3784 -0.0147 0.0512  0.0529  223 ASP B OD2 
3435 N N   . ASN B 246 ? 0.8784 1.0899 1.0009 0.0020  0.1206  0.0233  224 ASN B N   
3436 C CA  . ASN B 246 ? 0.8079 1.0351 0.9466 -0.0011 0.1431  0.0171  224 ASN B CA  
3437 C C   . ASN B 246 ? 0.8228 1.0678 0.9800 0.0168  0.1576  0.0149  224 ASN B C   
3438 O O   . ASN B 246 ? 0.8579 1.0953 1.0100 0.0200  0.1829  0.0117  224 ASN B O   
3439 C CB  . ASN B 246 ? 0.8027 1.0730 0.9781 -0.0181 0.1415  0.0125  224 ASN B CB  
3440 C CG  . ASN B 246 ? 0.8056 1.0562 0.9661 -0.0342 0.1346  0.0093  224 ASN B CG  
3441 O OD1 . ASN B 246 ? 0.7665 0.9704 0.8928 -0.0343 0.1335  0.0105  224 ASN B OD1 
3442 N ND2 . ASN B 246 ? 0.8214 1.1043 1.0077 -0.0463 0.1271  0.0034  224 ASN B ND2 
3443 N N   . LEU B 247 ? 0.7934 1.0594 0.9706 0.0288  0.1420  0.0161  225 LEU B N   
3444 C CA  . LEU B 247 ? 0.8011 1.0822 1.0013 0.0506  0.1508  0.0109  225 LEU B CA  
3445 C C   . LEU B 247 ? 0.7666 0.9968 0.9208 0.0691  0.1599  0.0101  225 LEU B C   
3446 O O   . LEU B 247 ? 0.8639 1.0937 1.0187 0.0789  0.1889  0.0030  225 LEU B O   
3447 C CB  . LEU B 247 ? 0.8977 1.2005 1.1224 0.0595  0.1226  0.0125  225 LEU B CB  
3448 C CG  . LEU B 247 ? 0.8559 1.2147 1.1399 0.0529  0.1191  0.0072  225 LEU B CG  
3449 C CD1 . LEU B 247 ? 0.9279 1.2930 1.2191 0.0585  0.0838  0.0106  225 LEU B CD1 
3450 C CD2 . LEU B 247 ? 0.7974 1.1899 1.1319 0.0648  0.1450  -0.0032 225 LEU B CD2 
3451 N N   . THR B 248 ? 0.8162 1.0002 0.9277 0.0729  0.1360  0.0174  226 THR B N   
3452 C CA  . THR B 248 ? 0.9807 1.1070 1.0430 0.0921  0.1365  0.0162  226 THR B CA  
3453 C C   . THR B 248 ? 1.0401 1.1302 1.0627 0.0875  0.1618  0.0130  226 THR B C   
3454 O O   . THR B 248 ? 1.0286 1.0873 1.0192 0.1064  0.1792  0.0063  226 THR B O   
3455 C CB  . THR B 248 ? 0.9727 1.0548 1.0014 0.0904  0.1022  0.0269  226 THR B CB  
3456 O OG1 . THR B 248 ? 0.9976 1.1062 1.0528 0.0911  0.0787  0.0325  226 THR B OG1 
3457 C CG2 . THR B 248 ? 0.8500 0.8662 0.8267 0.1121  0.0956  0.0250  226 THR B CG2 
3458 N N   . LEU B 249 ? 1.0507 1.1396 1.0696 0.0633  0.1631  0.0167  227 LEU B N   
3459 C CA  . LEU B 249 ? 1.0182 1.0666 0.9951 0.0562  0.1830  0.0148  227 LEU B CA  
3460 C C   . LEU B 249 ? 1.1078 1.1884 1.1040 0.0583  0.2230  0.0084  227 LEU B C   
3461 O O   . LEU B 249 ? 1.2537 1.2947 1.2035 0.0675  0.2474  0.0050  227 LEU B O   
3462 C CB  . LEU B 249 ? 0.9764 1.0221 0.9561 0.0304  0.1714  0.0182  227 LEU B CB  
3463 C CG  . LEU B 249 ? 1.0312 1.0441 0.9777 0.0165  0.1891  0.0171  227 LEU B CG  
3464 C CD1 . LEU B 249 ? 1.1281 1.0593 0.9976 0.0289  0.1906  0.0172  227 LEU B CD1 
3465 C CD2 . LEU B 249 ? 1.0371 1.0484 0.9942 -0.0057 0.1701  0.0176  227 LEU B CD2 
3466 N N   . TRP B 250 ? 1.0406 1.1921 1.1053 0.0496  0.2305  0.0066  228 TRP B N   
3467 C CA  . TRP B 250 ? 1.0514 1.2413 1.1492 0.0434  0.2678  0.0024  228 TRP B CA  
3468 C C   . TRP B 250 ? 1.1137 1.3193 1.2253 0.0689  0.2949  -0.0069 228 TRP B C   
3469 O O   . TRP B 250 ? 1.1647 1.3881 1.2880 0.0648  0.3353  -0.0106 228 TRP B O   
3470 C CB  . TRP B 250 ? 1.0044 1.2628 1.1764 0.0270  0.2608  0.0025  228 TRP B CB  
3471 C CG  . TRP B 250 ? 1.0327 1.2809 1.1953 0.0012  0.2441  0.0077  228 TRP B CG  
3472 C CD1 . TRP B 250 ? 1.0586 1.2484 1.1631 -0.0107 0.2401  0.0115  228 TRP B CD1 
3473 C CD2 . TRP B 250 ? 0.9721 1.2666 1.1849 -0.0136 0.2262  0.0071  228 TRP B CD2 
3474 N NE1 . TRP B 250 ? 0.9805 1.1823 1.1025 -0.0308 0.2214  0.0120  228 TRP B NE1 
3475 C CE2 . TRP B 250 ? 0.9358 1.2008 1.1205 -0.0328 0.2142  0.0092  228 TRP B CE2 
3476 C CE3 . TRP B 250 ? 0.8383 1.1915 1.1146 -0.0111 0.2157  0.0037  228 TRP B CE3 
3477 C CZ2 . TRP B 250 ? 0.9164 1.2107 1.1330 -0.0480 0.1961  0.0066  228 TRP B CZ2 
3478 C CZ3 . TRP B 250 ? 0.7648 1.1421 1.0664 -0.0274 0.1963  0.0028  228 TRP B CZ3 
3479 C CH2 . TRP B 250 ? 0.9024 1.2514 1.1735 -0.0451 0.1884  0.0037  228 TRP B CH2 
3480 N N   . THR B 251 ? 1.1374 1.3382 1.2511 0.0944  0.2743  -0.0113 229 THR B N   
3481 C CA  . THR B 251 ? 1.2581 1.4738 1.3894 0.1235  0.2960  -0.0242 229 THR B CA  
3482 C C   . THR B 251 ? 1.4053 1.5454 1.4533 0.1455  0.3014  -0.0283 229 THR B C   
3483 O O   . THR B 251 ? 1.4550 1.5974 1.5086 0.1755  0.3127  -0.0415 229 THR B O   
3484 C CB  . THR B 251 ? 1.1952 1.4542 1.3884 0.1405  0.2659  -0.0291 229 THR B CB  
3485 O OG1 . THR B 251 ? 1.3001 1.5083 1.4469 0.1505  0.2251  -0.0229 229 THR B OG1 
3486 C CG2 . THR B 251 ? 0.9791 1.2985 1.2401 0.1181  0.2515  -0.0242 229 THR B CG2 
3487 N N   . SER B 252 ? 1.5023 1.5729 1.4744 0.1333  0.2906  -0.0194 230 SER B N   
3488 C CA  . SER B 252 ? 1.5624 1.5512 1.4466 0.1526  0.2941  -0.0235 230 SER B CA  
3489 C C   . SER B 252 ? 1.5791 1.5176 1.3965 0.1343  0.3206  -0.0191 230 SER B C   
3490 O O   . SER B 252 ? 1.5990 1.5683 1.4312 0.1239  0.3652  -0.0216 230 SER B O   
3491 C CB  . SER B 252 ? 1.5976 1.5301 1.4438 0.1595  0.2425  -0.0167 230 SER B CB  
3492 N N   . TRP C 2   ? 1.2767 1.5215 1.3497 0.2260  -0.1974 0.1597  332 TRP C N   
3493 C CA  . TRP C 2   ? 1.2272 1.5463 1.3619 0.1931  -0.2037 0.1395  332 TRP C CA  
3494 C C   . TRP C 2   ? 1.3379 1.5844 1.4214 0.1633  -0.1611 0.1271  332 TRP C C   
3495 O O   . TRP C 2   ? 1.4888 1.6365 1.4745 0.1556  -0.1438 0.1269  332 TRP C O   
3496 C CB  . TRP C 2   ? 0.9779 1.4013 1.2437 0.2169  -0.2004 0.1374  332 TRP C CB  
3497 N N   . ARG C 3   ? 1.2300 1.5184 1.3734 0.1467  -0.1449 0.1151  333 ARG C N   
3498 C CA  . ARG C 3   ? 1.1426 1.3575 1.2383 0.1192  -0.1150 0.1022  333 ARG C CA  
3499 C C   . ARG C 3   ? 1.0413 1.2726 1.2029 0.1317  -0.0870 0.0976  333 ARG C C   
3500 O O   . ARG C 3   ? 0.9917 1.3049 1.2357 0.1526  -0.0911 0.1020  333 ARG C O   
3501 C CB  . ARG C 3   ? 1.1528 1.3720 1.2071 0.0646  -0.1400 0.0893  333 ARG C CB  
3502 C CG  . ARG C 3   ? 1.2482 1.5822 1.3819 0.0412  -0.1675 0.0840  333 ARG C CG  
3503 C CD  . ARG C 3   ? 1.4145 1.7518 1.5214 -0.0180 -0.1872 0.0683  333 ARG C CD  
3504 N NE  . ARG C 3   ? 1.5658 1.8313 1.6297 -0.0481 -0.1575 0.0614  333 ARG C NE  
3505 C CZ  . ARG C 3   ? 1.5822 1.7395 1.5574 -0.0552 -0.1481 0.0560  333 ARG C CZ  
3506 N NH1 . ARG C 3   ? 1.5315 1.6390 1.4420 -0.0386 -0.1595 0.0572  333 ARG C NH1 
3507 N NH2 . ARG C 3   ? 1.6291 1.7228 1.5750 -0.0801 -0.1285 0.0476  333 ARG C NH2 
3508 N N   . SER C 4   ? 1.0399 1.1864 1.1615 0.1212  -0.0617 0.0860  334 SER C N   
3509 C CA  . SER C 4   ? 0.9626 1.1015 1.1284 0.1354  -0.0424 0.0799  334 SER C CA  
3510 C C   . SER C 4   ? 0.8543 1.0485 1.0360 0.0970  -0.0522 0.0773  334 SER C C   
3511 O O   . SER C 4   ? 0.7052 0.8854 0.8393 0.0475  -0.0631 0.0716  334 SER C O   
3512 C CB  . SER C 4   ? 1.0268 1.0506 1.1478 0.1379  -0.0207 0.0637  334 SER C CB  
3513 O OG  . SER C 4   ? 1.0678 1.0419 1.1796 0.1681  -0.0017 0.0620  334 SER C OG  
3514 N N   . MET C 5   ? 0.7056 0.9595 0.9541 0.1194  -0.0452 0.0802  335 MET C N   
3515 C CA  . MET C 5   ? 0.5113 0.8194 0.7785 0.0861  -0.0425 0.0773  335 MET C CA  
3516 C C   . MET C 5   ? 0.5684 0.7847 0.7805 0.0698  -0.0268 0.0710  335 MET C C   
3517 O O   . MET C 5   ? 0.6230 0.7582 0.8213 0.1057  -0.0200 0.0661  335 MET C O   
3518 C CB  . MET C 5   ? 0.5536 0.9653 0.9113 0.1185  -0.0401 0.0800  335 MET C CB  
3519 C CG  . MET C 5   ? 0.7595 1.2818 1.1840 0.1249  -0.0640 0.0823  335 MET C CG  
3520 S SD  . MET C 5   ? 1.0618 1.6665 1.5017 0.0586  -0.0817 0.0713  335 MET C SD  
3521 C CE  . MET C 5   ? 1.1777 1.7585 1.5869 0.0080  -0.0456 0.0642  335 MET C CE  
3522 N N   . TPO C 6   ? 0.5483 0.7747 0.7320 0.0152  -0.0230 0.0694  336 TPO C N   
3523 C CA  . TPO C 6   ? 0.6703 0.8013 0.7843 -0.0097 -0.0124 0.0666  336 TPO C CA  
3524 C CB  . TPO C 6   ? 0.6615 0.6900 0.6962 -0.0442 -0.0249 0.0603  336 TPO C CB  
3525 C CG2 . TPO C 6   ? 0.7176 0.6678 0.7444 0.0051  -0.0297 0.0515  336 TPO C CG2 
3526 O OG1 . TPO C 6   ? 0.6763 0.7560 0.7162 -0.0782 -0.0385 0.0596  336 TPO C OG1 
3527 P P   . TPO C 6   ? 0.8163 0.8128 0.7763 -0.1376 -0.0489 0.0528  336 TPO C P   
3528 O O1P . TPO C 6   ? 0.8283 0.7210 0.7248 -0.1548 -0.0392 0.0531  336 TPO C O1P 
3529 O O2P . TPO C 6   ? 0.7966 0.8782 0.7800 -0.1981 -0.0570 0.0523  336 TPO C O2P 
3530 O O3P . TPO C 6   ? 1.2975 1.2292 1.2209 -0.1213 -0.0632 0.0428  336 TPO C O3P 
3531 C C   . TPO C 6   ? 0.7416 0.9260 0.8581 -0.0549 0.0059  0.0694  336 TPO C C   
3532 O O   . TPO C 6   ? 0.8541 1.1503 1.0301 -0.0794 0.0084  0.0681  336 TPO C O   
3533 N N   . VAL C 7   ? 0.9124 1.0131 0.9647 -0.0648 0.0190  0.0709  337 VAL C N   
3534 C CA  . VAL C 7   ? 1.0021 1.1338 1.0383 -0.1096 0.0469  0.0744  337 VAL C CA  
3535 C C   . VAL C 7   ? 1.1584 1.1476 1.0751 -0.1476 0.0505  0.0791  337 VAL C C   
3536 O O   . VAL C 7   ? 1.3131 1.1810 1.1711 -0.1164 0.0302  0.0768  337 VAL C O   
3537 C CB  . VAL C 7   ? 0.6712 0.8635 0.7538 -0.0678 0.0662  0.0734  337 VAL C CB  
3538 C CG1 . VAL C 7   ? 0.5639 0.8987 0.7689 -0.0292 0.0602  0.0682  337 VAL C CG1 
3539 C CG2 . VAL C 7   ? 0.7499 0.8273 0.7802 -0.0136 0.0547  0.0729  337 VAL C CG2 
3540 N N   . VAL C 8   ? 1.2944 1.2951 1.1788 -0.2153 0.0758  0.0838  338 VAL C N   
3541 C CA  . VAL C 8   ? 1.4936 1.3565 1.2540 -0.2552 0.0848  0.0925  338 VAL C CA  
3542 C C   . VAL C 8   ? 1.5921 1.4938 1.3438 -0.2641 0.1274  0.0969  338 VAL C C   
3543 O O   . VAL C 8   ? 1.8258 1.7252 1.5359 -0.3320 0.1633  0.1027  338 VAL C O   
3544 C CB  . VAL C 8   ? 1.6388 1.4686 1.3594 -0.3319 0.0833  0.0950  338 VAL C CB  
3545 C CG1 . VAL C 8   ? 1.5312 1.5172 1.3508 -0.3793 0.1078  0.0890  338 VAL C CG1 
3546 C CG2 . VAL C 8   ? 1.8169 1.4913 1.3986 -0.3787 0.0919  0.1073  338 VAL C CG2 
3547 N N   . PRO C 9   ? 1.3493 1.2774 1.1336 -0.1977 0.1269  0.0928  339 PRO C N   
3548 C CA  . PRO C 9   ? 1.1196 1.1838 0.9823 -0.1928 0.1643  0.0866  339 PRO C CA  
3549 C C   . PRO C 9   ? 1.3649 1.4355 1.1775 -0.2672 0.2171  0.0902  339 PRO C C   
3550 O O   . PRO C 9   ? 1.6647 1.6104 1.3496 -0.2827 0.2337  0.1005  339 PRO C O   
3551 C CB  . PRO C 9   ? 0.9201 0.9439 0.7710 -0.1153 0.1522  0.0837  339 PRO C CB  
3552 C CG  . PRO C 9   ? 1.1760 1.0134 0.9023 -0.1035 0.1214  0.0901  339 PRO C CG  
3553 C CD  . PRO C 9   ? 1.2612 1.0633 0.9835 -0.1351 0.0966  0.0919  339 PRO C CD  
3554 N N   . TYR C 10  ? 1.3610 1.5664 1.2695 -0.3167 0.2421  0.0804  340 TYR C N   
3555 C CA  . TYR C 10  ? 1.3781 1.6174 1.2704 -0.3893 0.3035  0.0776  340 TYR C CA  
3556 C C   . TYR C 10  ? 1.3146 1.5768 1.1932 -0.3593 0.3424  0.0721  340 TYR C C   
3557 O O   . TYR C 10  ? 1.2447 1.6273 1.2353 -0.3042 0.3365  0.0563  340 TYR C O   
3558 C CB  . TYR C 10  ? 1.3887 1.7957 1.4271 -0.4337 0.3181  0.0577  340 TYR C CB  
3559 C CG  . TYR C 10  ? 1.3933 1.8146 1.4779 -0.4464 0.2698  0.0560  340 TYR C CG  
3560 C CD1 . TYR C 10  ? 1.4481 1.7357 1.4287 -0.4862 0.2513  0.0708  340 TYR C CD1 
3561 C CD2 . TYR C 10  ? 1.2773 1.8437 1.5064 -0.4211 0.2415  0.0373  340 TYR C CD2 
3562 C CE1 . TYR C 10  ? 1.3893 1.6906 1.4085 -0.4976 0.2083  0.0658  340 TYR C CE1 
3563 C CE2 . TYR C 10  ? 1.1982 1.7704 1.4558 -0.4326 0.1966  0.0345  340 TYR C CE2 
3564 C CZ  . TYR C 10  ? 1.3197 1.7617 1.4726 -0.4708 0.1821  0.0480  340 TYR C CZ  
3565 O OH  . TYR C 10  ? 1.4483 1.8937 1.6241 -0.4807 0.1374  0.0423  340 TYR C OH  
3566 N N   . LEU C 11  ? 1.4430 1.5801 1.1757 -0.3941 0.3793  0.0850  341 LEU C N   
3567 C CA  . LEU C 11  ? 1.5498 1.6816 1.2359 -0.3699 0.4192  0.0801  341 LEU C CA  
3568 C C   . LEU C 11  ? 1.4184 1.5928 1.0861 -0.4541 0.5027  0.0740  341 LEU C C   
3569 O O   . LEU C 11  ? 1.5438 1.6249 1.1167 -0.5293 0.5266  0.0893  341 LEU C O   
3570 C CB  . LEU C 11  ? 1.5968 1.5243 1.1057 -0.3312 0.3902  0.0987  341 LEU C CB  
3571 C CG  . LEU C 11  ? 1.4681 1.3349 0.9890 -0.2436 0.3135  0.0995  341 LEU C CG  
3572 C CD1 . LEU C 11  ? 1.6093 1.3047 0.9809 -0.1977 0.2922  0.1063  341 LEU C CD1 
3573 C CD2 . LEU C 11  ? 1.2774 1.3135 0.9757 -0.1791 0.2953  0.0806  341 LEU C CD2 
3574 N N   . TRP D 2   ? 1.1714 1.6138 1.5390 -0.2529 -0.4684 -0.3454 332 TRP D N   
3575 C CA  . TRP D 2   ? 1.1379 1.5351 1.5597 -0.1944 -0.4503 -0.3561 332 TRP D CA  
3576 C C   . TRP D 2   ? 1.2060 1.5713 1.6274 -0.1298 -0.3939 -0.4133 332 TRP D C   
3577 O O   . TRP D 2   ? 1.2361 1.5465 1.5895 -0.1148 -0.3623 -0.4646 332 TRP D O   
3578 C CB  . TRP D 2   ? 1.1140 1.4125 1.4944 -0.1968 -0.4626 -0.3808 332 TRP D CB  
3579 N N   . ARG D 3   ? 1.1245 1.5333 1.6331 -0.0933 -0.3792 -0.3964 333 ARG D N   
3580 C CA  . ARG D 3   ? 1.0104 1.4139 1.5301 -0.0444 -0.3262 -0.4462 333 ARG D CA  
3581 C C   . ARG D 3   ? 1.0267 1.3334 1.5264 -0.0014 -0.3079 -0.4819 333 ARG D C   
3582 O O   . ARG D 3   ? 1.1112 1.3675 1.6041 -0.0055 -0.3366 -0.4658 333 ARG D O   
3583 C CB  . ARG D 3   ? 0.9558 1.4347 1.5390 -0.0259 -0.2697 -0.3542 333 ARG D CB  
3584 C CG  . ARG D 3   ? 1.0394 1.6235 1.6425 -0.0585 -0.2660 -0.2998 333 ARG D CG  
3585 C CD  . ARG D 3   ? 1.1167 1.7641 1.7967 -0.0342 -0.1985 -0.1778 333 ARG D CD  
3586 N NE  . ARG D 3   ? 1.2055 1.7802 1.8986 0.0211  -0.1350 -0.1717 333 ARG D NE  
3587 C CZ  . ARG D 3   ? 1.2293 1.7638 1.9083 0.0628  -0.0632 -0.2092 333 ARG D CZ  
3588 N NH1 . ARG D 3   ? 1.2906 1.8545 1.9534 0.0609  -0.0454 -0.2512 333 ARG D NH1 
3589 N NH2 . ARG D 3   ? 1.1716 1.6357 1.8485 0.1025  -0.0088 -0.2051 333 ARG D NH2 
3590 N N   . SER D 4   ? 0.9264 1.2140 1.4158 0.0366  -0.2572 -0.5227 334 SER D N   
3591 C CA  . SER D 4   ? 0.9577 1.1797 1.4317 0.0712  -0.2345 -0.5332 334 SER D CA  
3592 C C   . SER D 4   ? 0.9622 1.1875 1.4819 0.0798  -0.2230 -0.4790 334 SER D C   
3593 O O   . SER D 4   ? 0.8624 1.1308 1.4094 0.0896  -0.1674 -0.4088 334 SER D O   
3594 C CB  . SER D 4   ? 1.0415 1.2586 1.4822 0.0947  -0.1753 -0.5409 334 SER D CB  
3595 O OG  . SER D 4   ? 1.0192 1.2429 1.4257 0.0891  -0.1706 -0.5371 334 SER D OG  
3596 N N   . MET D 5   ? 0.9397 1.1198 1.4616 0.0832  -0.2538 -0.4739 335 MET D N   
3597 C CA  . MET D 5   ? 0.8136 0.9916 1.3604 0.0982  -0.2229 -0.3873 335 MET D CA  
3598 C C   . MET D 5   ? 0.7785 0.9017 1.2829 0.1309  -0.1621 -0.4056 335 MET D C   
3599 O O   . MET D 5   ? 0.8004 0.8782 1.2599 0.1364  -0.1723 -0.4850 335 MET D O   
3600 C CB  . MET D 5   ? 0.8022 0.9704 1.3784 0.0792  -0.2899 -0.3577 335 MET D CB  
3601 C CG  . MET D 5   ? 0.9702 1.1884 1.5815 0.0374  -0.3475 -0.3320 335 MET D CG  
3602 S SD  . MET D 5   ? 1.1295 1.3794 1.8070 0.0186  -0.3809 -0.2150 335 MET D SD  
3603 C CE  . MET D 5   ? 1.0043 1.2786 1.7046 0.0614  -0.2809 -0.1193 335 MET D CE  
3604 N N   . TPO D 6   ? 0.6802 0.8091 1.1993 0.1493  -0.0966 -0.3286 336 TPO D N   
3605 C CA  . TPO D 6   ? 0.8302 0.9039 1.2979 0.1749  -0.0216 -0.3421 336 TPO D CA  
3606 C CB  . TPO D 6   ? 0.7457 0.8222 1.2029 0.1889  0.0536  -0.3594 336 TPO D CB  
3607 C CG2 . TPO D 6   ? 0.8445 0.9179 1.2709 0.1780  0.0182  -0.4560 336 TPO D CG2 
3608 O OG1 . TPO D 6   ? 0.6820 0.8266 1.2129 0.1899  0.0779  -0.2728 336 TPO D OG1 
3609 P P   . TPO D 6   ? 0.7512 0.8963 1.2991 0.2152  0.1862  -0.2412 336 TPO D P   
3610 O O1P . TPO D 6   ? 0.7412 0.9124 1.2831 0.2062  0.1752  -0.3002 336 TPO D O1P 
3611 O O2P . TPO D 6   ? 0.6795 0.8987 1.3285 0.2229  0.2231  -0.1062 336 TPO D O2P 
3612 O O3P . TPO D 6   ? 0.8145 0.8682 1.2999 0.2402  0.2782  -0.2644 336 TPO D O3P 
3613 C C   . TPO D 6   ? 0.9252 0.9932 1.4120 0.1894  0.0223  -0.2527 336 TPO D C   
3614 O O   . TPO D 6   ? 1.0150 1.1355 1.5709 0.1849  0.0106  -0.1662 336 TPO D O   
3615 N N   . VAL D 7   ? 0.9890 0.9954 1.4124 0.2037  0.0746  -0.2707 337 VAL D N   
3616 C CA  . VAL D 7   ? 0.9629 0.9572 1.3936 0.2187  0.1241  -0.1911 337 VAL D CA  
3617 C C   . VAL D 7   ? 1.0560 0.9946 1.4353 0.2416  0.2416  -0.1887 337 VAL D C   
3618 O O   . VAL D 7   ? 1.0301 0.9585 1.4053 0.2505  0.2986  -0.2147 337 VAL D O   
3619 C CB  . VAL D 7   ? 0.9564 0.9273 1.3555 0.2072  0.0655  -0.1991 337 VAL D CB  
3620 C CG1 . VAL D 7   ? 0.8173 0.8383 1.2888 0.1881  -0.0340 -0.1707 337 VAL D CG1 
3621 C CG2 . VAL D 7   ? 0.8899 0.8075 1.1992 0.1957  0.0467  -0.2982 337 VAL D CG2 
3622 N N   . VAL D 8   ? 1.1473 1.0508 1.4920 0.2496  0.2781  -0.1525 338 VAL D N   
3623 C CA  . VAL D 8   ? 1.3215 1.1514 1.5903 0.2648  0.3881  -0.1572 338 VAL D CA  
3624 C C   . VAL D 8   ? 1.5090 1.3265 1.7482 0.2629  0.3794  -0.1146 338 VAL D C   
3625 O O   . VAL D 8   ? 1.6061 1.4310 1.8855 0.2855  0.4434  -0.0265 338 VAL D O   
3626 C CB  . VAL D 8   ? 1.2972 1.1288 1.6251 0.2959  0.5005  -0.0939 338 VAL D CB  
3627 C CG1 . VAL D 8   ? 1.1462 1.0666 1.6080 0.3102  0.4866  0.0288  338 VAL D CG1 
3628 C CG2 . VAL D 8   ? 1.3981 1.1432 1.6389 0.3035  0.6113  -0.0952 338 VAL D CG2 
3629 N N   . PRO D 9   ? 1.6990 1.5005 1.8715 0.2369  0.3055  -0.1702 339 PRO D N   
3630 C CA  . PRO D 9   ? 1.9012 1.7141 2.0668 0.2302  0.2670  -0.1230 339 PRO D CA  
3631 C C   . PRO D 9   ? 2.0659 1.9189 2.3132 0.2517  0.2925  -0.0054 339 PRO D C   
3632 O O   . PRO D 9   ? 2.1351 2.0356 2.4406 0.2419  0.2083  0.0374  339 PRO D O   
3633 C CB  . PRO D 9   ? 2.0428 1.7810 2.0680 0.2164  0.3248  -0.1758 339 PRO D CB  
3634 C CG  . PRO D 9   ? 1.9815 1.6838 1.9475 0.1996  0.3232  -0.2796 339 PRO D CG  
3635 C CD  . PRO D 9   ? 1.7938 1.5429 1.8634 0.2145  0.2994  -0.2756 339 PRO D CD  
3636 N N   . TYR D 10  ? 2.0319 1.8661 2.2914 0.2805  0.4074  0.0508  340 TYR D N   
3637 C CA  . TYR D 10  ? 1.9538 1.8200 2.2813 0.3034  0.4492  0.1677  340 TYR D CA  
3638 C C   . TYR D 10  ? 2.0094 1.8532 2.2630 0.2924  0.4367  0.1750  340 TYR D C   
3639 O O   . TYR D 10  ? 1.9773 1.8684 2.2718 0.2756  0.3357  0.1999  340 TYR D O   
3640 C CB  . TYR D 10  ? 1.7844 1.7459 2.2565 0.3022  0.3690  0.2528  340 TYR D CB  
3641 C CG  . TYR D 10  ? 1.7263 1.7341 2.2939 0.3151  0.3972  0.2932  340 TYR D CG  
3642 C CD1 . TYR D 10  ? 1.6472 1.7433 2.3295 0.3006  0.3152  0.3576  340 TYR D CD1 
3643 C CD2 . TYR D 10  ? 1.7289 1.6939 2.2720 0.3369  0.5035  0.2693  340 TYR D CD2 
3644 C CE1 . TYR D 10  ? 1.5633 1.7144 2.3297 0.3051  0.3349  0.4014  340 TYR D CE1 
3645 C CE2 . TYR D 10  ? 1.6232 1.6412 2.2626 0.3475  0.5264  0.3153  340 TYR D CE2 
3646 C CZ  . TYR D 10  ? 1.5381 1.6543 2.2874 0.3307  0.4406  0.3839  340 TYR D CZ  
3647 O OH  . TYR D 10  ? 1.4679 1.6476 2.3092 0.3351  0.4607  0.4364  340 TYR D OH  
3648 N N   . LEU D 11  ? 2.0285 1.7990 2.1721 0.2989  0.5406  0.1543  341 LEU D N   
3649 C CA  . LEU D 11  ? 1.9680 1.7183 2.0232 0.2837  0.5376  0.1604  341 LEU D CA  
3650 C C   . LEU D 11  ? 1.9265 1.7169 2.0579 0.3111  0.5769  0.2849  341 LEU D C   
3651 O O   . LEU D 11  ? 2.0268 1.8055 2.0923 0.3043  0.5930  0.3084  341 LEU D O   
3652 C CB  . LEU D 11  ? 2.0608 1.7119 1.9475 0.2697  0.6334  0.0801  341 LEU D CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -21 ?   ?   ?   A . n 
A 1 2   SER 2   -20 ?   ?   ?   A . n 
A 1 3   TYR 3   -19 ?   ?   ?   A . n 
A 1 4   TYR 4   -18 ?   ?   ?   A . n 
A 1 5   HIS 5   -17 ?   ?   ?   A . n 
A 1 6   HIS 6   -16 ?   ?   ?   A . n 
A 1 7   HIS 7   -15 ?   ?   ?   A . n 
A 1 8   HIS 8   -14 ?   ?   ?   A . n 
A 1 9   HIS 9   -13 ?   ?   ?   A . n 
A 1 10  HIS 10  -12 ?   ?   ?   A . n 
A 1 11  LEU 11  -11 ?   ?   ?   A . n 
A 1 12  GLU 12  -10 ?   ?   ?   A . n 
A 1 13  SER 13  -9  ?   ?   ?   A . n 
A 1 14  THR 14  -8  ?   ?   ?   A . n 
A 1 15  SER 15  -7  ?   ?   ?   A . n 
A 1 16  LEU 16  -6  ?   ?   ?   A . n 
A 1 17  TYR 17  -5  ?   ?   ?   A . n 
A 1 18  LYS 18  -4  ?   ?   ?   A . n 
A 1 19  LYS 19  -3  ?   ?   ?   A . n 
A 1 20  ALA 20  -2  ?   ?   ?   A . n 
A 1 21  GLY 21  -1  ?   ?   ?   A . n 
A 1 22  LEU 22  0   0   LEU LEU A . n 
A 1 23  MET 23  1   1   MET MET A . n 
A 1 24  ASP 24  2   2   ASP ASP A . n 
A 1 25  LYS 25  3   3   LYS LYS A . n 
A 1 26  ASN 26  4   4   ASN ASN A . n 
A 1 27  GLU 27  5   5   GLU GLU A . n 
A 1 28  LEU 28  6   6   LEU LEU A . n 
A 1 29  VAL 29  7   7   VAL VAL A . n 
A 1 30  GLN 30  8   8   GLN GLN A . n 
A 1 31  LYS 31  9   9   LYS LYS A . n 
A 1 32  ALA 32  10  10  ALA ALA A . n 
A 1 33  LYS 33  11  11  LYS LYS A . n 
A 1 34  LEU 34  12  12  LEU LEU A . n 
A 1 35  ALA 35  13  13  ALA ALA A . n 
A 1 36  GLU 36  14  14  GLU GLU A . n 
A 1 37  GLN 37  15  15  GLN GLN A . n 
A 1 38  ALA 38  16  16  ALA ALA A . n 
A 1 39  GLU 39  17  17  GLU GLU A . n 
A 1 40  ARG 40  18  18  ARG ARG A . n 
A 1 41  TYR 41  19  19  TYR TYR A . n 
A 1 42  ASP 42  20  20  ASP ASP A . n 
A 1 43  ASP 43  21  21  ASP ASP A . n 
A 1 44  MET 44  22  22  MET MET A . n 
A 1 45  ALA 45  23  23  ALA ALA A . n 
A 1 46  ALA 46  24  24  ALA ALA A . n 
A 1 47  CYS 47  25  25  CYS CYS A . n 
A 1 48  MET 48  26  26  MET MET A . n 
A 1 49  LYS 49  27  27  LYS LYS A . n 
A 1 50  SER 50  28  28  SER SER A . n 
A 1 51  VAL 51  29  29  VAL VAL A . n 
A 1 52  THR 52  30  30  THR THR A . n 
A 1 53  GLU 53  31  31  GLU GLU A . n 
A 1 54  GLN 54  32  32  GLN GLN A . n 
A 1 55  GLY 55  33  33  GLY GLY A . n 
A 1 56  ALA 56  34  34  ALA ALA A . n 
A 1 57  GLU 57  35  35  GLU GLU A . n 
A 1 58  LEU 58  36  36  LEU LEU A . n 
A 1 59  SER 59  37  37  SER SER A . n 
A 1 60  ASN 60  38  38  ASN ASN A . n 
A 1 61  GLU 61  39  39  GLU GLU A . n 
A 1 62  GLU 62  40  40  GLU GLU A . n 
A 1 63  ARG 63  41  41  ARG ARG A . n 
A 1 64  ASN 64  42  42  ASN ASN A . n 
A 1 65  LEU 65  43  43  LEU LEU A . n 
A 1 66  LEU 66  44  44  LEU LEU A . n 
A 1 67  SER 67  45  45  SER SER A . n 
A 1 68  VAL 68  46  46  VAL VAL A . n 
A 1 69  ALA 69  47  47  ALA ALA A . n 
A 1 70  TYR 70  48  48  TYR TYR A . n 
A 1 71  LYS 71  49  49  LYS LYS A . n 
A 1 72  ASN 72  50  50  ASN ASN A . n 
A 1 73  VAL 73  51  51  VAL VAL A . n 
A 1 74  VAL 74  52  52  VAL VAL A . n 
A 1 75  GLY 75  53  53  GLY GLY A . n 
A 1 76  ALA 76  54  54  ALA ALA A . n 
A 1 77  ARG 77  55  55  ARG ARG A . n 
A 1 78  ARG 78  56  56  ARG ARG A . n 
A 1 79  SER 79  57  57  SER SER A . n 
A 1 80  SER 80  58  58  SER SER A . n 
A 1 81  TRP 81  59  59  TRP TRP A . n 
A 1 82  ARG 82  60  60  ARG ARG A . n 
A 1 83  VAL 83  61  61  VAL VAL A . n 
A 1 84  VAL 84  62  62  VAL VAL A . n 
A 1 85  SER 85  63  63  SER SER A . n 
A 1 86  SER 86  64  64  SER SER A . n 
A 1 87  ILE 87  65  65  ILE ILE A . n 
A 1 88  GLU 88  66  66  GLU GLU A . n 
A 1 89  GLN 89  67  67  GLN GLN A . n 
A 1 90  LYS 90  68  68  LYS LYS A . n 
A 1 91  THR 91  69  69  THR THR A . n 
A 1 92  GLU 92  70  70  GLU GLU A . n 
A 1 93  GLY 93  71  71  GLY GLY A . n 
A 1 94  ALA 94  72  72  ALA ALA A . n 
A 1 95  GLU 95  73  73  GLU GLU A . n 
A 1 96  LYS 96  74  74  LYS LYS A . n 
A 1 97  LYS 97  75  75  LYS LYS A . n 
A 1 98  GLN 98  76  76  GLN GLN A . n 
A 1 99  GLN 99  77  77  GLN GLN A . n 
A 1 100 MET 100 78  78  MET MET A . n 
A 1 101 ALA 101 79  79  ALA ALA A . n 
A 1 102 ARG 102 80  80  ARG ARG A . n 
A 1 103 GLU 103 81  81  GLU GLU A . n 
A 1 104 TYR 104 82  82  TYR TYR A . n 
A 1 105 ARG 105 83  83  ARG ARG A . n 
A 1 106 GLU 106 84  84  GLU GLU A . n 
A 1 107 LYS 107 85  85  LYS LYS A . n 
A 1 108 ILE 108 86  86  ILE ILE A . n 
A 1 109 GLU 109 87  87  GLU GLU A . n 
A 1 110 THR 110 88  88  THR THR A . n 
A 1 111 GLU 111 89  89  GLU GLU A . n 
A 1 112 LEU 112 90  90  LEU LEU A . n 
A 1 113 ARG 113 91  91  ARG ARG A . n 
A 1 114 ASP 114 92  92  ASP ASP A . n 
A 1 115 ILE 115 93  93  ILE ILE A . n 
A 1 116 CYS 116 94  94  CYS CYS A . n 
A 1 117 ASN 117 95  95  ASN ASN A . n 
A 1 118 ASP 118 96  96  ASP ASP A . n 
A 1 119 VAL 119 97  97  VAL VAL A . n 
A 1 120 LEU 120 98  98  LEU LEU A . n 
A 1 121 SER 121 99  99  SER SER A . n 
A 1 122 LEU 122 100 100 LEU LEU A . n 
A 1 123 LEU 123 101 101 LEU LEU A . n 
A 1 124 GLU 124 102 102 GLU GLU A . n 
A 1 125 LYS 125 103 103 LYS LYS A . n 
A 1 126 PHE 126 104 104 PHE PHE A . n 
A 1 127 LEU 127 105 105 LEU LEU A . n 
A 1 128 ILE 128 106 106 ILE ILE A . n 
A 1 129 PRO 129 107 107 PRO PRO A . n 
A 1 130 ASN 130 108 108 ASN ASN A . n 
A 1 131 ALA 131 109 109 ALA ALA A . n 
A 1 132 SER 132 110 110 SER SER A . n 
A 1 133 GLN 133 111 111 GLN GLN A . n 
A 1 134 ALA 134 112 112 ALA ALA A . n 
A 1 135 GLU 135 113 113 GLU GLU A . n 
A 1 136 SER 136 114 114 SER SER A . n 
A 1 137 LYS 137 115 115 LYS LYS A . n 
A 1 138 VAL 138 116 116 VAL VAL A . n 
A 1 139 PHE 139 117 117 PHE PHE A . n 
A 1 140 TYR 140 118 118 TYR TYR A . n 
A 1 141 LEU 141 119 119 LEU LEU A . n 
A 1 142 LYS 142 120 120 LYS LYS A . n 
A 1 143 MET 143 121 121 MET MET A . n 
A 1 144 LYS 144 122 122 LYS LYS A . n 
A 1 145 GLY 145 123 123 GLY GLY A . n 
A 1 146 ASP 146 124 124 ASP ASP A . n 
A 1 147 TYR 147 125 125 TYR TYR A . n 
A 1 148 TYR 148 126 126 TYR TYR A . n 
A 1 149 ARG 149 127 127 ARG ARG A . n 
A 1 150 TYR 150 128 128 TYR TYR A . n 
A 1 151 LEU 151 129 129 LEU LEU A . n 
A 1 152 ALA 152 130 130 ALA ALA A . n 
A 1 153 GLU 153 131 131 GLU GLU A . n 
A 1 154 VAL 154 132 132 VAL VAL A . n 
A 1 155 ALA 155 133 133 ALA ALA A . n 
A 1 156 ALA 156 134 134 ALA ALA A . n 
A 1 157 GLY 157 135 135 GLY GLY A . n 
A 1 158 ASP 158 136 136 ASP ASP A . n 
A 1 159 ASP 159 137 137 ASP ASP A . n 
A 1 160 LYS 160 138 138 LYS LYS A . n 
A 1 161 LYS 161 139 139 LYS LYS A . n 
A 1 162 GLY 162 140 140 GLY GLY A . n 
A 1 163 ILE 163 141 141 ILE ILE A . n 
A 1 164 VAL 164 142 142 VAL VAL A . n 
A 1 165 ASP 165 143 143 ASP ASP A . n 
A 1 166 GLN 166 144 144 GLN GLN A . n 
A 1 167 SER 167 145 145 SER SER A . n 
A 1 168 GLN 168 146 146 GLN GLN A . n 
A 1 169 GLN 169 147 147 GLN GLN A . n 
A 1 170 ALA 170 148 148 ALA ALA A . n 
A 1 171 TYR 171 149 149 TYR TYR A . n 
A 1 172 GLN 172 150 150 GLN GLN A . n 
A 1 173 GLU 173 151 151 GLU GLU A . n 
A 1 174 ALA 174 152 152 ALA ALA A . n 
A 1 175 PHE 175 153 153 PHE PHE A . n 
A 1 176 GLU 176 154 154 GLU GLU A . n 
A 1 177 ILE 177 155 155 ILE ILE A . n 
A 1 178 SER 178 156 156 SER SER A . n 
A 1 179 LYS 179 157 157 LYS LYS A . n 
A 1 180 LYS 180 158 158 LYS LYS A . n 
A 1 181 GLU 181 159 159 GLU GLU A . n 
A 1 182 MET 182 160 160 MET MET A . n 
A 1 183 GLN 183 161 161 GLN GLN A . n 
A 1 184 PRO 184 162 162 PRO PRO A . n 
A 1 185 THR 185 163 163 THR THR A . n 
A 1 186 HIS 186 164 164 HIS HIS A . n 
A 1 187 PRO 187 165 165 PRO PRO A . n 
A 1 188 ILE 188 166 166 ILE ILE A . n 
A 1 189 ARG 189 167 167 ARG ARG A . n 
A 1 190 LEU 190 168 168 LEU LEU A . n 
A 1 191 GLY 191 169 169 GLY GLY A . n 
A 1 192 LEU 192 170 170 LEU LEU A . n 
A 1 193 ALA 193 171 171 ALA ALA A . n 
A 1 194 LEU 194 172 172 LEU LEU A . n 
A 1 195 ASN 195 173 173 ASN ASN A . n 
A 1 196 PHE 196 174 174 PHE PHE A . n 
A 1 197 SER 197 175 175 SER SER A . n 
A 1 198 VAL 198 176 176 VAL VAL A . n 
A 1 199 PHE 199 177 177 PHE PHE A . n 
A 1 200 TYR 200 178 178 TYR TYR A . n 
A 1 201 TYR 201 179 179 TYR TYR A . n 
A 1 202 GLU 202 180 180 GLU GLU A . n 
A 1 203 ILE 203 181 181 ILE ILE A . n 
A 1 204 LEU 204 182 182 LEU LEU A . n 
A 1 205 ASN 205 183 183 ASN ASN A . n 
A 1 206 SER 206 184 184 SER SER A . n 
A 1 207 PRO 207 185 185 PRO PRO A . n 
A 1 208 GLU 208 186 186 GLU GLU A . n 
A 1 209 LYS 209 187 187 LYS LYS A . n 
A 1 210 ALA 210 188 188 ALA ALA A . n 
A 1 211 CYS 211 189 189 CYS CYS A . n 
A 1 212 SER 212 190 190 SER SER A . n 
A 1 213 LEU 213 191 191 LEU LEU A . n 
A 1 214 ALA 214 192 192 ALA ALA A . n 
A 1 215 LYS 215 193 193 LYS LYS A . n 
A 1 216 THR 216 194 194 THR THR A . n 
A 1 217 ALA 217 195 195 ALA ALA A . n 
A 1 218 PHE 218 196 196 PHE PHE A . n 
A 1 219 ASP 219 197 197 ASP ASP A . n 
A 1 220 GLU 220 198 198 GLU GLU A . n 
A 1 221 ALA 221 199 199 ALA ALA A . n 
A 1 222 ILE 222 200 200 ILE ILE A . n 
A 1 223 ALA 223 201 201 ALA ALA A . n 
A 1 224 GLU 224 202 202 GLU GLU A . n 
A 1 225 LEU 225 203 203 LEU LEU A . n 
A 1 226 ASP 226 204 204 ASP ASP A . n 
A 1 227 THR 227 205 205 THR THR A . n 
A 1 228 LEU 228 206 206 LEU LEU A . n 
A 1 229 SER 229 207 207 SER SER A . n 
A 1 230 GLU 230 208 208 GLU GLU A . n 
A 1 231 GLU 231 209 209 GLU GLU A . n 
A 1 232 SER 232 210 210 SER SER A . n 
A 1 233 TYR 233 211 211 TYR TYR A . n 
A 1 234 LYS 234 212 212 LYS LYS A . n 
A 1 235 ASP 235 213 213 ASP ASP A . n 
A 1 236 SER 236 214 214 SER SER A . n 
A 1 237 THR 237 215 215 THR THR A . n 
A 1 238 LEU 238 216 216 LEU LEU A . n 
A 1 239 ILE 239 217 217 ILE ILE A . n 
A 1 240 MET 240 218 218 MET MET A . n 
A 1 241 GLN 241 219 219 GLN GLN A . n 
A 1 242 LEU 242 220 220 LEU LEU A . n 
A 1 243 LEU 243 221 221 LEU LEU A . n 
A 1 244 ARG 244 222 222 ARG ARG A . n 
A 1 245 ASP 245 223 223 ASP ASP A . n 
A 1 246 ASN 246 224 224 ASN ASN A . n 
A 1 247 LEU 247 225 225 LEU LEU A . n 
A 1 248 THR 248 226 226 THR THR A . n 
A 1 249 LEU 249 227 227 LEU LEU A . n 
A 1 250 TRP 250 228 228 TRP TRP A . n 
A 1 251 THR 251 229 229 THR THR A . n 
A 1 252 SER 252 230 230 SER SER A . n 
A 1 253 ASP 253 231 ?   ?   ?   A . n 
A 1 254 THR 254 232 ?   ?   ?   A . n 
A 1 255 GLN 255 233 ?   ?   ?   A . n 
A 1 256 GLY 256 234 ?   ?   ?   A . n 
A 1 257 ASP 257 235 ?   ?   ?   A . n 
A 1 258 GLU 258 236 ?   ?   ?   A . n 
A 1 259 ALA 259 237 ?   ?   ?   A . n 
A 1 260 GLU 260 238 ?   ?   ?   A . n 
A 1 261 ALA 261 239 ?   ?   ?   A . n 
A 1 262 GLY 262 240 ?   ?   ?   A . n 
A 1 263 GLU 263 241 ?   ?   ?   A . n 
A 1 264 GLY 264 242 ?   ?   ?   A . n 
A 1 265 GLY 265 243 ?   ?   ?   A . n 
A 1 266 GLU 266 244 ?   ?   ?   A . n 
A 1 267 ASN 267 245 ?   ?   ?   A . n 
B 1 1   MET 1   -21 ?   ?   ?   B . n 
B 1 2   SER 2   -20 ?   ?   ?   B . n 
B 1 3   TYR 3   -19 ?   ?   ?   B . n 
B 1 4   TYR 4   -18 ?   ?   ?   B . n 
B 1 5   HIS 5   -17 ?   ?   ?   B . n 
B 1 6   HIS 6   -16 ?   ?   ?   B . n 
B 1 7   HIS 7   -15 ?   ?   ?   B . n 
B 1 8   HIS 8   -14 ?   ?   ?   B . n 
B 1 9   HIS 9   -13 ?   ?   ?   B . n 
B 1 10  HIS 10  -12 ?   ?   ?   B . n 
B 1 11  LEU 11  -11 ?   ?   ?   B . n 
B 1 12  GLU 12  -10 ?   ?   ?   B . n 
B 1 13  SER 13  -9  ?   ?   ?   B . n 
B 1 14  THR 14  -8  ?   ?   ?   B . n 
B 1 15  SER 15  -7  ?   ?   ?   B . n 
B 1 16  LEU 16  -6  ?   ?   ?   B . n 
B 1 17  TYR 17  -5  ?   ?   ?   B . n 
B 1 18  LYS 18  -4  ?   ?   ?   B . n 
B 1 19  LYS 19  -3  ?   ?   ?   B . n 
B 1 20  ALA 20  -2  ?   ?   ?   B . n 
B 1 21  GLY 21  -1  ?   ?   ?   B . n 
B 1 22  LEU 22  0   ?   ?   ?   B . n 
B 1 23  MET 23  1   1   MET MET B . n 
B 1 24  ASP 24  2   2   ASP ASP B . n 
B 1 25  LYS 25  3   3   LYS LYS B . n 
B 1 26  ASN 26  4   4   ASN ASN B . n 
B 1 27  GLU 27  5   5   GLU GLU B . n 
B 1 28  LEU 28  6   6   LEU LEU B . n 
B 1 29  VAL 29  7   7   VAL VAL B . n 
B 1 30  GLN 30  8   8   GLN GLN B . n 
B 1 31  LYS 31  9   9   LYS LYS B . n 
B 1 32  ALA 32  10  10  ALA ALA B . n 
B 1 33  LYS 33  11  11  LYS LYS B . n 
B 1 34  LEU 34  12  12  LEU LEU B . n 
B 1 35  ALA 35  13  13  ALA ALA B . n 
B 1 36  GLU 36  14  14  GLU GLU B . n 
B 1 37  GLN 37  15  15  GLN GLN B . n 
B 1 38  ALA 38  16  16  ALA ALA B . n 
B 1 39  GLU 39  17  17  GLU GLU B . n 
B 1 40  ARG 40  18  18  ARG ARG B . n 
B 1 41  TYR 41  19  19  TYR TYR B . n 
B 1 42  ASP 42  20  20  ASP ASP B . n 
B 1 43  ASP 43  21  21  ASP ASP B . n 
B 1 44  MET 44  22  22  MET MET B . n 
B 1 45  ALA 45  23  23  ALA ALA B . n 
B 1 46  ALA 46  24  24  ALA ALA B . n 
B 1 47  CYS 47  25  25  CYS CYS B . n 
B 1 48  MET 48  26  26  MET MET B . n 
B 1 49  LYS 49  27  27  LYS LYS B . n 
B 1 50  SER 50  28  28  SER SER B . n 
B 1 51  VAL 51  29  29  VAL VAL B . n 
B 1 52  THR 52  30  30  THR THR B . n 
B 1 53  GLU 53  31  31  GLU GLU B . n 
B 1 54  GLN 54  32  32  GLN GLN B . n 
B 1 55  GLY 55  33  33  GLY GLY B . n 
B 1 56  ALA 56  34  34  ALA ALA B . n 
B 1 57  GLU 57  35  35  GLU GLU B . n 
B 1 58  LEU 58  36  36  LEU LEU B . n 
B 1 59  SER 59  37  37  SER SER B . n 
B 1 60  ASN 60  38  38  ASN ASN B . n 
B 1 61  GLU 61  39  39  GLU GLU B . n 
B 1 62  GLU 62  40  40  GLU GLU B . n 
B 1 63  ARG 63  41  41  ARG ARG B . n 
B 1 64  ASN 64  42  42  ASN ASN B . n 
B 1 65  LEU 65  43  43  LEU LEU B . n 
B 1 66  LEU 66  44  44  LEU LEU B . n 
B 1 67  SER 67  45  45  SER SER B . n 
B 1 68  VAL 68  46  46  VAL VAL B . n 
B 1 69  ALA 69  47  47  ALA ALA B . n 
B 1 70  TYR 70  48  48  TYR TYR B . n 
B 1 71  LYS 71  49  49  LYS LYS B . n 
B 1 72  ASN 72  50  50  ASN ASN B . n 
B 1 73  VAL 73  51  51  VAL VAL B . n 
B 1 74  VAL 74  52  52  VAL VAL B . n 
B 1 75  GLY 75  53  53  GLY GLY B . n 
B 1 76  ALA 76  54  54  ALA ALA B . n 
B 1 77  ARG 77  55  55  ARG ARG B . n 
B 1 78  ARG 78  56  56  ARG ARG B . n 
B 1 79  SER 79  57  57  SER SER B . n 
B 1 80  SER 80  58  58  SER SER B . n 
B 1 81  TRP 81  59  59  TRP TRP B . n 
B 1 82  ARG 82  60  60  ARG ARG B . n 
B 1 83  VAL 83  61  61  VAL VAL B . n 
B 1 84  VAL 84  62  62  VAL VAL B . n 
B 1 85  SER 85  63  63  SER SER B . n 
B 1 86  SER 86  64  64  SER SER B . n 
B 1 87  ILE 87  65  65  ILE ILE B . n 
B 1 88  GLU 88  66  66  GLU GLU B . n 
B 1 89  GLN 89  67  67  GLN GLN B . n 
B 1 90  LYS 90  68  68  LYS LYS B . n 
B 1 91  THR 91  69  69  THR THR B . n 
B 1 92  GLU 92  70  70  GLU GLU B . n 
B 1 93  GLY 93  71  71  GLY GLY B . n 
B 1 94  ALA 94  72  72  ALA ALA B . n 
B 1 95  GLU 95  73  73  GLU GLU B . n 
B 1 96  LYS 96  74  74  LYS LYS B . n 
B 1 97  LYS 97  75  75  LYS LYS B . n 
B 1 98  GLN 98  76  76  GLN GLN B . n 
B 1 99  GLN 99  77  77  GLN GLN B . n 
B 1 100 MET 100 78  78  MET MET B . n 
B 1 101 ALA 101 79  79  ALA ALA B . n 
B 1 102 ARG 102 80  80  ARG ARG B . n 
B 1 103 GLU 103 81  81  GLU GLU B . n 
B 1 104 TYR 104 82  82  TYR TYR B . n 
B 1 105 ARG 105 83  83  ARG ARG B . n 
B 1 106 GLU 106 84  84  GLU GLU B . n 
B 1 107 LYS 107 85  85  LYS LYS B . n 
B 1 108 ILE 108 86  86  ILE ILE B . n 
B 1 109 GLU 109 87  87  GLU GLU B . n 
B 1 110 THR 110 88  88  THR THR B . n 
B 1 111 GLU 111 89  89  GLU GLU B . n 
B 1 112 LEU 112 90  90  LEU LEU B . n 
B 1 113 ARG 113 91  91  ARG ARG B . n 
B 1 114 ASP 114 92  92  ASP ASP B . n 
B 1 115 ILE 115 93  93  ILE ILE B . n 
B 1 116 CYS 116 94  94  CYS CYS B . n 
B 1 117 ASN 117 95  95  ASN ASN B . n 
B 1 118 ASP 118 96  96  ASP ASP B . n 
B 1 119 VAL 119 97  97  VAL VAL B . n 
B 1 120 LEU 120 98  98  LEU LEU B . n 
B 1 121 SER 121 99  99  SER SER B . n 
B 1 122 LEU 122 100 100 LEU LEU B . n 
B 1 123 LEU 123 101 101 LEU LEU B . n 
B 1 124 GLU 124 102 102 GLU GLU B . n 
B 1 125 LYS 125 103 103 LYS LYS B . n 
B 1 126 PHE 126 104 104 PHE PHE B . n 
B 1 127 LEU 127 105 105 LEU LEU B . n 
B 1 128 ILE 128 106 106 ILE ILE B . n 
B 1 129 PRO 129 107 107 PRO PRO B . n 
B 1 130 ASN 130 108 108 ASN ASN B . n 
B 1 131 ALA 131 109 109 ALA ALA B . n 
B 1 132 SER 132 110 110 SER SER B . n 
B 1 133 GLN 133 111 111 GLN GLN B . n 
B 1 134 ALA 134 112 112 ALA ALA B . n 
B 1 135 GLU 135 113 113 GLU GLU B . n 
B 1 136 SER 136 114 114 SER SER B . n 
B 1 137 LYS 137 115 115 LYS LYS B . n 
B 1 138 VAL 138 116 116 VAL VAL B . n 
B 1 139 PHE 139 117 117 PHE PHE B . n 
B 1 140 TYR 140 118 118 TYR TYR B . n 
B 1 141 LEU 141 119 119 LEU LEU B . n 
B 1 142 LYS 142 120 120 LYS LYS B . n 
B 1 143 MET 143 121 121 MET MET B . n 
B 1 144 LYS 144 122 122 LYS LYS B . n 
B 1 145 GLY 145 123 123 GLY GLY B . n 
B 1 146 ASP 146 124 124 ASP ASP B . n 
B 1 147 TYR 147 125 125 TYR TYR B . n 
B 1 148 TYR 148 126 126 TYR TYR B . n 
B 1 149 ARG 149 127 127 ARG ARG B . n 
B 1 150 TYR 150 128 128 TYR TYR B . n 
B 1 151 LEU 151 129 129 LEU LEU B . n 
B 1 152 ALA 152 130 130 ALA ALA B . n 
B 1 153 GLU 153 131 131 GLU GLU B . n 
B 1 154 VAL 154 132 132 VAL VAL B . n 
B 1 155 ALA 155 133 133 ALA ALA B . n 
B 1 156 ALA 156 134 134 ALA ALA B . n 
B 1 157 GLY 157 135 135 GLY GLY B . n 
B 1 158 ASP 158 136 136 ASP ASP B . n 
B 1 159 ASP 159 137 137 ASP ASP B . n 
B 1 160 LYS 160 138 138 LYS LYS B . n 
B 1 161 LYS 161 139 139 LYS LYS B . n 
B 1 162 GLY 162 140 140 GLY GLY B . n 
B 1 163 ILE 163 141 141 ILE ILE B . n 
B 1 164 VAL 164 142 142 VAL VAL B . n 
B 1 165 ASP 165 143 143 ASP ASP B . n 
B 1 166 GLN 166 144 144 GLN GLN B . n 
B 1 167 SER 167 145 145 SER SER B . n 
B 1 168 GLN 168 146 146 GLN GLN B . n 
B 1 169 GLN 169 147 147 GLN GLN B . n 
B 1 170 ALA 170 148 148 ALA ALA B . n 
B 1 171 TYR 171 149 149 TYR TYR B . n 
B 1 172 GLN 172 150 150 GLN GLN B . n 
B 1 173 GLU 173 151 151 GLU GLU B . n 
B 1 174 ALA 174 152 152 ALA ALA B . n 
B 1 175 PHE 175 153 153 PHE PHE B . n 
B 1 176 GLU 176 154 154 GLU GLU B . n 
B 1 177 ILE 177 155 155 ILE ILE B . n 
B 1 178 SER 178 156 156 SER SER B . n 
B 1 179 LYS 179 157 157 LYS LYS B . n 
B 1 180 LYS 180 158 158 LYS LYS B . n 
B 1 181 GLU 181 159 159 GLU GLU B . n 
B 1 182 MET 182 160 160 MET MET B . n 
B 1 183 GLN 183 161 161 GLN GLN B . n 
B 1 184 PRO 184 162 162 PRO PRO B . n 
B 1 185 THR 185 163 163 THR THR B . n 
B 1 186 HIS 186 164 164 HIS HIS B . n 
B 1 187 PRO 187 165 165 PRO PRO B . n 
B 1 188 ILE 188 166 166 ILE ILE B . n 
B 1 189 ARG 189 167 167 ARG ARG B . n 
B 1 190 LEU 190 168 168 LEU LEU B . n 
B 1 191 GLY 191 169 169 GLY GLY B . n 
B 1 192 LEU 192 170 170 LEU LEU B . n 
B 1 193 ALA 193 171 171 ALA ALA B . n 
B 1 194 LEU 194 172 172 LEU LEU B . n 
B 1 195 ASN 195 173 173 ASN ASN B . n 
B 1 196 PHE 196 174 174 PHE PHE B . n 
B 1 197 SER 197 175 175 SER SER B . n 
B 1 198 VAL 198 176 176 VAL VAL B . n 
B 1 199 PHE 199 177 177 PHE PHE B . n 
B 1 200 TYR 200 178 178 TYR TYR B . n 
B 1 201 TYR 201 179 179 TYR TYR B . n 
B 1 202 GLU 202 180 180 GLU GLU B . n 
B 1 203 ILE 203 181 181 ILE ILE B . n 
B 1 204 LEU 204 182 182 LEU LEU B . n 
B 1 205 ASN 205 183 183 ASN ASN B . n 
B 1 206 SER 206 184 184 SER SER B . n 
B 1 207 PRO 207 185 185 PRO PRO B . n 
B 1 208 GLU 208 186 186 GLU GLU B . n 
B 1 209 LYS 209 187 187 LYS LYS B . n 
B 1 210 ALA 210 188 188 ALA ALA B . n 
B 1 211 CYS 211 189 189 CYS CYS B . n 
B 1 212 SER 212 190 190 SER SER B . n 
B 1 213 LEU 213 191 191 LEU LEU B . n 
B 1 214 ALA 214 192 192 ALA ALA B . n 
B 1 215 LYS 215 193 193 LYS LYS B . n 
B 1 216 THR 216 194 194 THR THR B . n 
B 1 217 ALA 217 195 195 ALA ALA B . n 
B 1 218 PHE 218 196 196 PHE PHE B . n 
B 1 219 ASP 219 197 197 ASP ASP B . n 
B 1 220 GLU 220 198 198 GLU GLU B . n 
B 1 221 ALA 221 199 199 ALA ALA B . n 
B 1 222 ILE 222 200 200 ILE ILE B . n 
B 1 223 ALA 223 201 201 ALA ALA B . n 
B 1 224 GLU 224 202 202 GLU GLU B . n 
B 1 225 LEU 225 203 203 LEU LEU B . n 
B 1 226 ASP 226 204 204 ASP ASP B . n 
B 1 227 THR 227 205 205 THR THR B . n 
B 1 228 LEU 228 206 206 LEU LEU B . n 
B 1 229 SER 229 207 207 SER SER B . n 
B 1 230 GLU 230 208 208 GLU GLU B . n 
B 1 231 GLU 231 209 209 GLU GLU B . n 
B 1 232 SER 232 210 210 SER SER B . n 
B 1 233 TYR 233 211 211 TYR TYR B . n 
B 1 234 LYS 234 212 212 LYS LYS B . n 
B 1 235 ASP 235 213 213 ASP ASP B . n 
B 1 236 SER 236 214 214 SER SER B . n 
B 1 237 THR 237 215 215 THR THR B . n 
B 1 238 LEU 238 216 216 LEU LEU B . n 
B 1 239 ILE 239 217 217 ILE ILE B . n 
B 1 240 MET 240 218 218 MET MET B . n 
B 1 241 GLN 241 219 219 GLN GLN B . n 
B 1 242 LEU 242 220 220 LEU LEU B . n 
B 1 243 LEU 243 221 221 LEU LEU B . n 
B 1 244 ARG 244 222 222 ARG ARG B . n 
B 1 245 ASP 245 223 223 ASP ASP B . n 
B 1 246 ASN 246 224 224 ASN ASN B . n 
B 1 247 LEU 247 225 225 LEU LEU B . n 
B 1 248 THR 248 226 226 THR THR B . n 
B 1 249 LEU 249 227 227 LEU LEU B . n 
B 1 250 TRP 250 228 228 TRP TRP B . n 
B 1 251 THR 251 229 229 THR THR B . n 
B 1 252 SER 252 230 230 SER SER B . n 
B 1 253 ASP 253 231 ?   ?   ?   B . n 
B 1 254 THR 254 232 ?   ?   ?   B . n 
B 1 255 GLN 255 233 ?   ?   ?   B . n 
B 1 256 GLY 256 234 ?   ?   ?   B . n 
B 1 257 ASP 257 235 ?   ?   ?   B . n 
B 1 258 GLU 258 236 ?   ?   ?   B . n 
B 1 259 ALA 259 237 ?   ?   ?   B . n 
B 1 260 GLU 260 238 ?   ?   ?   B . n 
B 1 261 ALA 261 239 ?   ?   ?   B . n 
B 1 262 GLY 262 240 ?   ?   ?   B . n 
B 1 263 GLU 263 241 ?   ?   ?   B . n 
B 1 264 GLY 264 242 ?   ?   ?   B . n 
B 1 265 GLY 265 243 ?   ?   ?   B . n 
B 1 266 GLU 266 244 ?   ?   ?   B . n 
B 1 267 ASN 267 245 ?   ?   ?   B . n 
C 2 1   ARG 1   331 ?   ?   ?   C . n 
C 2 2   TRP 2   332 332 TRP TRP C . n 
C 2 3   ARG 3   333 333 ARG ARG C . n 
C 2 4   SER 4   334 334 SER SER C . n 
C 2 5   MET 5   335 335 MET MET C . n 
C 2 6   TPO 6   336 336 TPO TPO C . n 
C 2 7   VAL 7   337 337 VAL VAL C . n 
C 2 8   VAL 8   338 338 VAL VAL C . n 
C 2 9   PRO 9   339 339 PRO PRO C . n 
C 2 10  TYR 10  340 340 TYR TYR C . n 
C 2 11  LEU 11  341 341 LEU LEU C . n 
C 2 12  GLU 12  342 ?   ?   ?   C . n 
C 2 13  ASP 13  343 ?   ?   ?   C . n 
D 2 1   ARG 1   331 ?   ?   ?   D . n 
D 2 2   TRP 2   332 332 TRP TRP D . n 
D 2 3   ARG 3   333 333 ARG ARG D . n 
D 2 4   SER 4   334 334 SER SER D . n 
D 2 5   MET 5   335 335 MET MET D . n 
D 2 6   TPO 6   336 336 TPO TPO D . n 
D 2 7   VAL 7   337 337 VAL VAL D . n 
D 2 8   VAL 8   338 338 VAL VAL D . n 
D 2 9   PRO 9   339 339 PRO PRO D . n 
D 2 10  TYR 10  340 340 TYR TYR D . n 
D 2 11  LEU 11  341 341 LEU LEU D . n 
D 2 12  GLU 12  342 ?   ?   ?   D . n 
D 2 13  ASP 13  343 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1 301 8  HOH HOH A . 
E 3 HOH 2 302 9  HOH HOH A . 
E 3 HOH 3 303 19 HOH HOH A . 
E 3 HOH 4 304 3  HOH HOH A . 
E 3 HOH 5 305 2  HOH HOH A . 
E 3 HOH 6 306 14 HOH HOH A . 
F 3 HOH 1 301 1  HOH HOH B . 
F 3 HOH 2 302 12 HOH HOH B . 
F 3 HOH 3 303 10 HOH HOH B . 
F 3 HOH 4 304 13 HOH HOH B . 
F 3 HOH 5 305 5  HOH HOH B . 
F 3 HOH 6 306 17 HOH HOH B . 
F 3 HOH 7 307 16 HOH HOH B . 
F 3 HOH 8 308 6  HOH HOH B . 
F 3 HOH 9 309 18 HOH HOH B . 
G 3 HOH 1 401 11 HOH HOH C . 
H 3 HOH 1 401 7  HOH HOH D . 
H 3 HOH 2 402 4  HOH HOH D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 C TPO 6 C TPO 336 ? THR 'modified residue' 
2 D TPO 6 D TPO 336 ? THR 'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4660  ? 
1 MORE         -33   ? 
1 'SSA (A^2)'  22290 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2017-04-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 69.8213 96.2012 -14.0374 0.8110 0.9716 0.5679 -0.1803 0.1463  -0.0184 8.0876 3.6364 5.5612 -4.8158 
3.8071  -2.0687 0.5784  0.2064  0.4978  -1.0963 -0.3988 -0.5482 -0.1412 0.6389  -0.1566 
'X-RAY DIFFRACTION' 2 ? refined 60.1927 91.2207 4.5511   0.6033 0.7233 0.4201 0.1111  0.0113  -0.0990 3.6053 2.8330 6.0598 1.7381  
2.4842  0.4063  -0.3101 -0.1715 0.1603  -0.1023 -0.2264 0.0869  -0.8436 -0.3267 0.5091  
'X-RAY DIFFRACTION' 3 ? refined 48.9876 89.9798 -9.6709  0.5292 0.8011 0.5187 0.1039  -0.0633 0.0890  5.5592 6.4331 7.4845 1.6101  
3.4631  0.5054  -0.5048 -0.0295 0.2653  -0.5217 0.1474  0.6667  -1.2572 -1.3196 0.2990  
'X-RAY DIFFRACTION' 4 ? refined 50.6783 73.4574 -11.0719 0.4062 0.7362 0.4337 0.0030  -0.0359 -0.0468 6.8448 8.4775 6.6916 -1.9620 
0.3849  1.8028  0.0216  0.7134  -0.4286 -0.5974 -0.2710 0.6314  -0.2487 -0.5516 0.2431  
'X-RAY DIFFRACTION' 5 ? refined 82.6669 93.4696 8.5290   0.5508 0.6765 0.5741 -0.1111 0.0437  -0.1358 4.5590 2.1530 4.4688 -0.3389 
0.3354  -0.1457 -0.1847 0.2433  0.3858  -0.0327 0.1321  -0.4330 -0.4462 0.3171  -0.0204 
'X-RAY DIFFRACTION' 6 ? refined 97.4100 80.5571 12.2014  0.4231 0.8781 0.7555 -0.0833 0.0526  -0.0399 2.2112 6.9855 3.0490 0.0515  
2.5373  0.8423  -0.1322 -0.4026 0.2798  0.1978  -0.0140 -0.8704 0.0224  0.4713  0.1193  
'X-RAY DIFFRACTION' 7 ? refined 58.8254 79.2209 -6.5364  0.6103 0.8957 0.7734 -0.0900 0.0133  0.0683  3.1733 9.9110 2.7332 -0.2426 
1.8911  3.8300  -0.0047 0.0113  0.0836  -0.3471 0.0701  -1.0719 -1.7921 2.2574  -0.2704 
'X-RAY DIFFRACTION' 8 ? refined 88.4725 79.6046 8.6240   0.7358 0.8494 1.2867 0.1892  0.0238  -0.1629 8.4283 6.3366 4.4148 3.3149  
-2.6632 -5.3100 1.0712  0.2646  -0.0450 0.9319  1.7561  1.4368  -0.2243 -0.9481 -2.0481 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'chain A and (resid 1 through 37 )'    
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'chain A and (resid 38 through 103 )'  
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 'chain A and (resid 104 through 159 )' 
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 'chain A and (resid 160 through 230 )' 
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? 'chain B and (resid 1 through 111 )'   
'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? 'chain B and (resid 112 through 230 )' 
'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? 'chain C and (resid 332 through 341 )' 
'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? 'chain D and (resid 332 through 341 )' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(1.11.1_2575: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                    2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                    3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .                    4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A ILE 106 ? ? N  A PRO 107 ? ? CD A PRO 107 ? ? 102.16 128.40 -26.24 2.10 Y 
2 1 CD B LYS 49  ? ? CE B LYS 49  ? ? NZ B LYS 49  ? ? 97.68  111.70 -14.02 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 34  ? ? 7.27    -106.86 
2  1 GLU A 35  ? ? 118.97  115.09  
3  1 SER A 37  ? ? -59.98  174.88  
4  1 PHE A 104 ? ? -131.23 -48.46  
5  1 ASN A 108 ? ? -87.95  -97.08  
6  1 ALA A 109 ? ? 46.39   71.74   
7  1 ASP A 136 ? ? -26.44  -59.60  
8  1 GLU B 31  ? ? -68.44  6.49    
9  1 SER B 37  ? ? -59.10  172.90  
10 1 ALA B 134 ? ? -134.54 -145.08 
11 1 SER B 184 ? ? -110.44 78.06   
12 1 VAL C 338 ? ? -112.93 59.84   
13 1 PRO C 339 ? ? -45.75  108.29  
14 1 VAL D 337 ? ? -130.70 -153.48 
15 1 VAL D 338 ? ? -174.05 74.16   
16 1 PRO D 339 ? ? 9.99    -49.83  
17 1 TYR D 340 ? ? 59.60   88.60   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   VAL 
_pdbx_validate_peptide_omega.auth_asym_id_1   C 
_pdbx_validate_peptide_omega.auth_seq_id_1    338 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   C 
_pdbx_validate_peptide_omega.auth_seq_id_2    339 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -138.25 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      B 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       309 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   7.18 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LEU 0   ? CG  ? A LEU 22  CG  
2   1 Y 1 A LEU 0   ? CD1 ? A LEU 22  CD1 
3   1 Y 1 A LEU 0   ? CD2 ? A LEU 22  CD2 
4   1 Y 1 A LYS 3   ? CD  ? A LYS 25  CD  
5   1 Y 1 A LYS 3   ? CE  ? A LYS 25  CE  
6   1 Y 1 A LYS 3   ? NZ  ? A LYS 25  NZ  
7   1 Y 1 A GLU 5   ? CG  ? A GLU 27  CG  
8   1 Y 1 A GLU 5   ? CD  ? A GLU 27  CD  
9   1 Y 1 A GLU 5   ? OE1 ? A GLU 27  OE1 
10  1 Y 1 A GLU 5   ? OE2 ? A GLU 27  OE2 
11  1 Y 1 A GLN 8   ? CG  ? A GLN 30  CG  
12  1 Y 1 A GLN 8   ? CD  ? A GLN 30  CD  
13  1 Y 1 A GLN 8   ? OE1 ? A GLN 30  OE1 
14  1 Y 1 A GLN 8   ? NE2 ? A GLN 30  NE2 
15  1 Y 1 A LYS 9   ? CG  ? A LYS 31  CG  
16  1 Y 1 A LYS 9   ? CD  ? A LYS 31  CD  
17  1 Y 1 A LYS 9   ? CE  ? A LYS 31  CE  
18  1 Y 1 A LYS 9   ? NZ  ? A LYS 31  NZ  
19  1 Y 1 A LYS 11  ? CG  ? A LYS 33  CG  
20  1 Y 1 A LYS 11  ? CD  ? A LYS 33  CD  
21  1 Y 1 A LYS 11  ? CE  ? A LYS 33  CE  
22  1 Y 1 A LYS 11  ? NZ  ? A LYS 33  NZ  
23  1 Y 1 A LEU 12  ? CG  ? A LEU 34  CG  
24  1 Y 1 A LEU 12  ? CD1 ? A LEU 34  CD1 
25  1 Y 1 A LEU 12  ? CD2 ? A LEU 34  CD2 
26  1 Y 1 A GLU 40  ? CG  ? A GLU 62  CG  
27  1 Y 1 A GLU 40  ? CD  ? A GLU 62  CD  
28  1 Y 1 A GLU 40  ? OE1 ? A GLU 62  OE1 
29  1 Y 1 A GLU 40  ? OE2 ? A GLU 62  OE2 
30  1 Y 1 A LYS 68  ? CG  ? A LYS 90  CG  
31  1 Y 1 A LYS 68  ? CD  ? A LYS 90  CD  
32  1 Y 1 A LYS 68  ? CE  ? A LYS 90  CE  
33  1 Y 1 A LYS 68  ? NZ  ? A LYS 90  NZ  
34  1 Y 1 A GLU 73  ? CG  ? A GLU 95  CG  
35  1 Y 1 A GLU 73  ? CD  ? A GLU 95  CD  
36  1 Y 1 A GLU 73  ? OE1 ? A GLU 95  OE1 
37  1 Y 1 A GLU 73  ? OE2 ? A GLU 95  OE2 
38  1 Y 1 A LYS 75  ? CE  ? A LYS 97  CE  
39  1 Y 1 A LYS 75  ? NZ  ? A LYS 97  NZ  
40  1 Y 1 A GLN 77  ? CG  ? A GLN 99  CG  
41  1 Y 1 A GLN 77  ? CD  ? A GLN 99  CD  
42  1 Y 1 A GLN 77  ? OE1 ? A GLN 99  OE1 
43  1 Y 1 A GLN 77  ? NE2 ? A GLN 99  NE2 
44  1 Y 1 A GLU 81  ? CG  ? A GLU 103 CG  
45  1 Y 1 A GLU 81  ? CD  ? A GLU 103 CD  
46  1 Y 1 A GLU 81  ? OE1 ? A GLU 103 OE1 
47  1 Y 1 A GLU 81  ? OE2 ? A GLU 103 OE2 
48  1 Y 1 A LYS 85  ? CD  ? A LYS 107 CD  
49  1 Y 1 A LYS 85  ? CE  ? A LYS 107 CE  
50  1 Y 1 A LYS 85  ? NZ  ? A LYS 107 NZ  
51  1 Y 1 A LYS 103 ? CG  ? A LYS 125 CG  
52  1 Y 1 A LYS 103 ? CD  ? A LYS 125 CD  
53  1 Y 1 A LYS 103 ? CE  ? A LYS 125 CE  
54  1 Y 1 A LYS 103 ? NZ  ? A LYS 125 NZ  
55  1 Y 1 A LYS 115 ? CG  ? A LYS 137 CG  
56  1 Y 1 A LYS 115 ? CD  ? A LYS 137 CD  
57  1 Y 1 A LYS 115 ? CE  ? A LYS 137 CE  
58  1 Y 1 A LYS 115 ? NZ  ? A LYS 137 NZ  
59  1 Y 1 A ASP 137 ? CG  ? A ASP 159 CG  
60  1 Y 1 A ASP 137 ? OD1 ? A ASP 159 OD1 
61  1 Y 1 A ASP 137 ? OD2 ? A ASP 159 OD2 
62  1 Y 1 A LYS 139 ? CG  ? A LYS 161 CG  
63  1 Y 1 A LYS 139 ? CD  ? A LYS 161 CD  
64  1 Y 1 A LYS 139 ? CE  ? A LYS 161 CE  
65  1 Y 1 A LYS 139 ? NZ  ? A LYS 161 NZ  
66  1 Y 1 A GLN 147 ? CG  ? A GLN 169 CG  
67  1 Y 1 A GLN 147 ? CD  ? A GLN 169 CD  
68  1 Y 1 A GLN 147 ? OE1 ? A GLN 169 OE1 
69  1 Y 1 A GLN 147 ? NE2 ? A GLN 169 NE2 
70  1 Y 1 A LYS 157 ? CD  ? A LYS 179 CD  
71  1 Y 1 A LYS 157 ? CE  ? A LYS 179 CE  
72  1 Y 1 A LYS 157 ? NZ  ? A LYS 179 NZ  
73  1 Y 1 A LYS 158 ? NZ  ? A LYS 180 NZ  
74  1 Y 1 A GLU 159 ? OE1 ? A GLU 181 OE1 
75  1 Y 1 A GLU 159 ? OE2 ? A GLU 181 OE2 
76  1 Y 1 A GLU 186 ? CG  ? A GLU 208 CG  
77  1 Y 1 A GLU 186 ? CD  ? A GLU 208 CD  
78  1 Y 1 A GLU 186 ? OE1 ? A GLU 208 OE1 
79  1 Y 1 A GLU 186 ? OE2 ? A GLU 208 OE2 
80  1 Y 1 A LYS 187 ? CE  ? A LYS 209 CE  
81  1 Y 1 A LYS 187 ? NZ  ? A LYS 209 NZ  
82  1 Y 1 A GLU 202 ? CG  ? A GLU 224 CG  
83  1 Y 1 A GLU 202 ? CD  ? A GLU 224 CD  
84  1 Y 1 A GLU 202 ? OE1 ? A GLU 224 OE1 
85  1 Y 1 A GLU 202 ? OE2 ? A GLU 224 OE2 
86  1 Y 1 A ASP 204 ? CG  ? A ASP 226 CG  
87  1 Y 1 A ASP 204 ? OD1 ? A ASP 226 OD1 
88  1 Y 1 A ASP 204 ? OD2 ? A ASP 226 OD2 
89  1 Y 1 A GLU 208 ? CG  ? A GLU 230 CG  
90  1 Y 1 A GLU 208 ? CD  ? A GLU 230 CD  
91  1 Y 1 A GLU 208 ? OE1 ? A GLU 230 OE1 
92  1 Y 1 A GLU 208 ? OE2 ? A GLU 230 OE2 
93  1 Y 1 A GLU 209 ? OE1 ? A GLU 231 OE1 
94  1 Y 1 A GLU 209 ? OE2 ? A GLU 231 OE2 
95  1 Y 1 A LYS 212 ? CG  ? A LYS 234 CG  
96  1 Y 1 A LYS 212 ? CD  ? A LYS 234 CD  
97  1 Y 1 A LYS 212 ? CE  ? A LYS 234 CE  
98  1 Y 1 A LYS 212 ? NZ  ? A LYS 234 NZ  
99  1 Y 1 B MET 1   ? CG  ? B MET 23  CG  
100 1 Y 1 B MET 1   ? SD  ? B MET 23  SD  
101 1 Y 1 B MET 1   ? CE  ? B MET 23  CE  
102 1 Y 1 B LYS 3   ? CG  ? B LYS 25  CG  
103 1 Y 1 B LYS 3   ? CD  ? B LYS 25  CD  
104 1 Y 1 B LYS 3   ? CE  ? B LYS 25  CE  
105 1 Y 1 B LYS 3   ? NZ  ? B LYS 25  NZ  
106 1 Y 1 B GLU 5   ? CG  ? B GLU 27  CG  
107 1 Y 1 B GLU 5   ? CD  ? B GLU 27  CD  
108 1 Y 1 B GLU 5   ? OE1 ? B GLU 27  OE1 
109 1 Y 1 B GLU 5   ? OE2 ? B GLU 27  OE2 
110 1 Y 1 B LYS 9   ? CG  ? B LYS 31  CG  
111 1 Y 1 B LYS 9   ? CD  ? B LYS 31  CD  
112 1 Y 1 B LYS 9   ? CE  ? B LYS 31  CE  
113 1 Y 1 B LYS 9   ? NZ  ? B LYS 31  NZ  
114 1 Y 1 B GLU 35  ? CG  ? B GLU 57  CG  
115 1 Y 1 B GLU 35  ? CD  ? B GLU 57  CD  
116 1 Y 1 B GLU 35  ? OE1 ? B GLU 57  OE1 
117 1 Y 1 B GLU 35  ? OE2 ? B GLU 57  OE2 
118 1 Y 1 B GLU 40  ? CD  ? B GLU 62  CD  
119 1 Y 1 B GLU 40  ? OE1 ? B GLU 62  OE1 
120 1 Y 1 B GLU 40  ? OE2 ? B GLU 62  OE2 
121 1 Y 1 B GLN 67  ? CG  ? B GLN 89  CG  
122 1 Y 1 B GLN 67  ? CD  ? B GLN 89  CD  
123 1 Y 1 B GLN 67  ? OE1 ? B GLN 89  OE1 
124 1 Y 1 B GLN 67  ? NE2 ? B GLN 89  NE2 
125 1 Y 1 B LYS 68  ? CE  ? B LYS 90  CE  
126 1 Y 1 B LYS 68  ? NZ  ? B LYS 90  NZ  
127 1 Y 1 B GLU 70  ? CG  ? B GLU 92  CG  
128 1 Y 1 B GLU 70  ? CD  ? B GLU 92  CD  
129 1 Y 1 B GLU 70  ? OE1 ? B GLU 92  OE1 
130 1 Y 1 B GLU 70  ? OE2 ? B GLU 92  OE2 
131 1 Y 1 B GLU 73  ? CG  ? B GLU 95  CG  
132 1 Y 1 B GLU 73  ? CD  ? B GLU 95  CD  
133 1 Y 1 B GLU 73  ? OE1 ? B GLU 95  OE1 
134 1 Y 1 B GLU 73  ? OE2 ? B GLU 95  OE2 
135 1 Y 1 B LYS 74  ? CG  ? B LYS 96  CG  
136 1 Y 1 B LYS 74  ? CD  ? B LYS 96  CD  
137 1 Y 1 B LYS 74  ? CE  ? B LYS 96  CE  
138 1 Y 1 B LYS 74  ? NZ  ? B LYS 96  NZ  
139 1 Y 1 B LYS 75  ? CG  ? B LYS 97  CG  
140 1 Y 1 B LYS 75  ? CD  ? B LYS 97  CD  
141 1 Y 1 B LYS 75  ? CE  ? B LYS 97  CE  
142 1 Y 1 B LYS 75  ? NZ  ? B LYS 97  NZ  
143 1 Y 1 B GLN 77  ? CG  ? B GLN 99  CG  
144 1 Y 1 B GLN 77  ? CD  ? B GLN 99  CD  
145 1 Y 1 B GLN 77  ? OE1 ? B GLN 99  OE1 
146 1 Y 1 B GLN 77  ? NE2 ? B GLN 99  NE2 
147 1 Y 1 B ARG 80  ? CG  ? B ARG 102 CG  
148 1 Y 1 B ARG 80  ? CD  ? B ARG 102 CD  
149 1 Y 1 B ARG 80  ? NE  ? B ARG 102 NE  
150 1 Y 1 B ARG 80  ? CZ  ? B ARG 102 CZ  
151 1 Y 1 B ARG 80  ? NH1 ? B ARG 102 NH1 
152 1 Y 1 B ARG 80  ? NH2 ? B ARG 102 NH2 
153 1 Y 1 B LYS 85  ? CG  ? B LYS 107 CG  
154 1 Y 1 B LYS 85  ? CD  ? B LYS 107 CD  
155 1 Y 1 B LYS 85  ? CE  ? B LYS 107 CE  
156 1 Y 1 B LYS 85  ? NZ  ? B LYS 107 NZ  
157 1 Y 1 B GLU 102 ? CG  ? B GLU 124 CG  
158 1 Y 1 B GLU 102 ? CD  ? B GLU 124 CD  
159 1 Y 1 B GLU 102 ? OE1 ? B GLU 124 OE1 
160 1 Y 1 B GLU 102 ? OE2 ? B GLU 124 OE2 
161 1 Y 1 B GLU 113 ? CG  ? B GLU 135 CG  
162 1 Y 1 B GLU 113 ? CD  ? B GLU 135 CD  
163 1 Y 1 B GLU 113 ? OE1 ? B GLU 135 OE1 
164 1 Y 1 B GLU 113 ? OE2 ? B GLU 135 OE2 
165 1 Y 1 B LYS 115 ? CG  ? B LYS 137 CG  
166 1 Y 1 B LYS 115 ? CD  ? B LYS 137 CD  
167 1 Y 1 B LYS 115 ? CE  ? B LYS 137 CE  
168 1 Y 1 B LYS 115 ? NZ  ? B LYS 137 NZ  
169 1 Y 1 B LYS 138 ? CE  ? B LYS 160 CE  
170 1 Y 1 B LYS 138 ? NZ  ? B LYS 160 NZ  
171 1 Y 1 B LYS 139 ? CG  ? B LYS 161 CG  
172 1 Y 1 B LYS 139 ? CD  ? B LYS 161 CD  
173 1 Y 1 B LYS 139 ? CE  ? B LYS 161 CE  
174 1 Y 1 B LYS 139 ? NZ  ? B LYS 161 NZ  
175 1 Y 1 B GLN 147 ? CG  ? B GLN 169 CG  
176 1 Y 1 B GLN 147 ? CD  ? B GLN 169 CD  
177 1 Y 1 B GLN 147 ? OE1 ? B GLN 169 OE1 
178 1 Y 1 B GLN 147 ? NE2 ? B GLN 169 NE2 
179 1 Y 1 B LYS 157 ? CG  ? B LYS 179 CG  
180 1 Y 1 B LYS 157 ? CD  ? B LYS 179 CD  
181 1 Y 1 B LYS 157 ? CE  ? B LYS 179 CE  
182 1 Y 1 B LYS 157 ? NZ  ? B LYS 179 NZ  
183 1 Y 1 B LYS 158 ? CD  ? B LYS 180 CD  
184 1 Y 1 B LYS 158 ? CE  ? B LYS 180 CE  
185 1 Y 1 B LYS 158 ? NZ  ? B LYS 180 NZ  
186 1 Y 1 B GLU 159 ? CG  ? B GLU 181 CG  
187 1 Y 1 B GLU 159 ? CD  ? B GLU 181 CD  
188 1 Y 1 B GLU 159 ? OE1 ? B GLU 181 OE1 
189 1 Y 1 B GLU 159 ? OE2 ? B GLU 181 OE2 
190 1 Y 1 B GLU 180 ? CG  ? B GLU 202 CG  
191 1 Y 1 B GLU 180 ? CD  ? B GLU 202 CD  
192 1 Y 1 B GLU 180 ? OE1 ? B GLU 202 OE1 
193 1 Y 1 B GLU 180 ? OE2 ? B GLU 202 OE2 
194 1 Y 1 B LYS 187 ? CG  ? B LYS 209 CG  
195 1 Y 1 B LYS 187 ? CD  ? B LYS 209 CD  
196 1 Y 1 B LYS 187 ? CE  ? B LYS 209 CE  
197 1 Y 1 B LYS 187 ? NZ  ? B LYS 209 NZ  
198 1 Y 1 B GLU 198 ? CG  ? B GLU 220 CG  
199 1 Y 1 B GLU 198 ? CD  ? B GLU 220 CD  
200 1 Y 1 B GLU 198 ? OE1 ? B GLU 220 OE1 
201 1 Y 1 B GLU 198 ? OE2 ? B GLU 220 OE2 
202 1 Y 1 B GLU 208 ? CG  ? B GLU 230 CG  
203 1 Y 1 B GLU 208 ? CD  ? B GLU 230 CD  
204 1 Y 1 B GLU 208 ? OE1 ? B GLU 230 OE1 
205 1 Y 1 B GLU 208 ? OE2 ? B GLU 230 OE2 
206 1 Y 1 B GLU 209 ? CG  ? B GLU 231 CG  
207 1 Y 1 B GLU 209 ? CD  ? B GLU 231 CD  
208 1 Y 1 B GLU 209 ? OE1 ? B GLU 231 OE1 
209 1 Y 1 B GLU 209 ? OE2 ? B GLU 231 OE2 
210 1 Y 1 B TYR 211 ? CE1 ? B TYR 233 CE1 
211 1 Y 1 B TYR 211 ? CE2 ? B TYR 233 CE2 
212 1 Y 1 B TYR 211 ? CZ  ? B TYR 233 CZ  
213 1 Y 1 B TYR 211 ? OH  ? B TYR 233 OH  
214 1 Y 1 B LYS 212 ? CG  ? B LYS 234 CG  
215 1 Y 1 B LYS 212 ? CD  ? B LYS 234 CD  
216 1 Y 1 B LYS 212 ? CE  ? B LYS 234 CE  
217 1 Y 1 B LYS 212 ? NZ  ? B LYS 234 NZ  
218 1 Y 1 B LEU 216 ? CG  ? B LEU 238 CG  
219 1 Y 1 B LEU 216 ? CD1 ? B LEU 238 CD1 
220 1 Y 1 B LEU 216 ? CD2 ? B LEU 238 CD2 
221 1 Y 1 B SER 230 ? OG  ? B SER 252 OG  
222 1 Y 1 C TRP 332 ? CG  ? C TRP 2   CG  
223 1 Y 1 C TRP 332 ? CD1 ? C TRP 2   CD1 
224 1 Y 1 C TRP 332 ? CD2 ? C TRP 2   CD2 
225 1 Y 1 C TRP 332 ? NE1 ? C TRP 2   NE1 
226 1 Y 1 C TRP 332 ? CE2 ? C TRP 2   CE2 
227 1 Y 1 C TRP 332 ? CE3 ? C TRP 2   CE3 
228 1 Y 1 C TRP 332 ? CZ2 ? C TRP 2   CZ2 
229 1 Y 1 C TRP 332 ? CZ3 ? C TRP 2   CZ3 
230 1 Y 1 C TRP 332 ? CH2 ? C TRP 2   CH2 
231 1 Y 1 D TRP 332 ? CG  ? D TRP 2   CG  
232 1 Y 1 D TRP 332 ? CD1 ? D TRP 2   CD1 
233 1 Y 1 D TRP 332 ? CD2 ? D TRP 2   CD2 
234 1 Y 1 D TRP 332 ? NE1 ? D TRP 2   NE1 
235 1 Y 1 D TRP 332 ? CE2 ? D TRP 2   CE2 
236 1 Y 1 D TRP 332 ? CE3 ? D TRP 2   CE3 
237 1 Y 1 D TRP 332 ? CZ2 ? D TRP 2   CZ2 
238 1 Y 1 D TRP 332 ? CZ3 ? D TRP 2   CZ3 
239 1 Y 1 D TRP 332 ? CH2 ? D TRP 2   CH2 
240 1 Y 1 D LEU 341 ? CG  ? D LEU 11  CG  
241 1 Y 1 D LEU 341 ? CD1 ? D LEU 11  CD1 
242 1 Y 1 D LEU 341 ? CD2 ? D LEU 11  CD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -21 ? A MET 1   
2  1 Y 1 A SER -20 ? A SER 2   
3  1 Y 1 A TYR -19 ? A TYR 3   
4  1 Y 1 A TYR -18 ? A TYR 4   
5  1 Y 1 A HIS -17 ? A HIS 5   
6  1 Y 1 A HIS -16 ? A HIS 6   
7  1 Y 1 A HIS -15 ? A HIS 7   
8  1 Y 1 A HIS -14 ? A HIS 8   
9  1 Y 1 A HIS -13 ? A HIS 9   
10 1 Y 1 A HIS -12 ? A HIS 10  
11 1 Y 1 A LEU -11 ? A LEU 11  
12 1 Y 1 A GLU -10 ? A GLU 12  
13 1 Y 1 A SER -9  ? A SER 13  
14 1 Y 1 A THR -8  ? A THR 14  
15 1 Y 1 A SER -7  ? A SER 15  
16 1 Y 1 A LEU -6  ? A LEU 16  
17 1 Y 1 A TYR -5  ? A TYR 17  
18 1 Y 1 A LYS -4  ? A LYS 18  
19 1 Y 1 A LYS -3  ? A LYS 19  
20 1 Y 1 A ALA -2  ? A ALA 20  
21 1 Y 1 A GLY -1  ? A GLY 21  
22 1 Y 1 A ASP 231 ? A ASP 253 
23 1 Y 1 A THR 232 ? A THR 254 
24 1 Y 1 A GLN 233 ? A GLN 255 
25 1 Y 1 A GLY 234 ? A GLY 256 
26 1 Y 1 A ASP 235 ? A ASP 257 
27 1 Y 1 A GLU 236 ? A GLU 258 
28 1 Y 1 A ALA 237 ? A ALA 259 
29 1 Y 1 A GLU 238 ? A GLU 260 
30 1 Y 1 A ALA 239 ? A ALA 261 
31 1 Y 1 A GLY 240 ? A GLY 262 
32 1 Y 1 A GLU 241 ? A GLU 263 
33 1 Y 1 A GLY 242 ? A GLY 264 
34 1 Y 1 A GLY 243 ? A GLY 265 
35 1 Y 1 A GLU 244 ? A GLU 266 
36 1 Y 1 A ASN 245 ? A ASN 267 
37 1 Y 1 B MET -21 ? B MET 1   
38 1 Y 1 B SER -20 ? B SER 2   
39 1 Y 1 B TYR -19 ? B TYR 3   
40 1 Y 1 B TYR -18 ? B TYR 4   
41 1 Y 1 B HIS -17 ? B HIS 5   
42 1 Y 1 B HIS -16 ? B HIS 6   
43 1 Y 1 B HIS -15 ? B HIS 7   
44 1 Y 1 B HIS -14 ? B HIS 8   
45 1 Y 1 B HIS -13 ? B HIS 9   
46 1 Y 1 B HIS -12 ? B HIS 10  
47 1 Y 1 B LEU -11 ? B LEU 11  
48 1 Y 1 B GLU -10 ? B GLU 12  
49 1 Y 1 B SER -9  ? B SER 13  
50 1 Y 1 B THR -8  ? B THR 14  
51 1 Y 1 B SER -7  ? B SER 15  
52 1 Y 1 B LEU -6  ? B LEU 16  
53 1 Y 1 B TYR -5  ? B TYR 17  
54 1 Y 1 B LYS -4  ? B LYS 18  
55 1 Y 1 B LYS -3  ? B LYS 19  
56 1 Y 1 B ALA -2  ? B ALA 20  
57 1 Y 1 B GLY -1  ? B GLY 21  
58 1 Y 1 B LEU 0   ? B LEU 22  
59 1 Y 1 B ASP 231 ? B ASP 253 
60 1 Y 1 B THR 232 ? B THR 254 
61 1 Y 1 B GLN 233 ? B GLN 255 
62 1 Y 1 B GLY 234 ? B GLY 256 
63 1 Y 1 B ASP 235 ? B ASP 257 
64 1 Y 1 B GLU 236 ? B GLU 258 
65 1 Y 1 B ALA 237 ? B ALA 259 
66 1 Y 1 B GLU 238 ? B GLU 260 
67 1 Y 1 B ALA 239 ? B ALA 261 
68 1 Y 1 B GLY 240 ? B GLY 262 
69 1 Y 1 B GLU 241 ? B GLU 263 
70 1 Y 1 B GLY 242 ? B GLY 264 
71 1 Y 1 B GLY 243 ? B GLY 265 
72 1 Y 1 B GLU 244 ? B GLU 266 
73 1 Y 1 B ASN 245 ? B ASN 267 
74 1 Y 1 C ARG 331 ? C ARG 1   
75 1 Y 1 C GLU 342 ? C GLU 12  
76 1 Y 1 C ASP 343 ? C ASP 13  
77 1 Y 1 D ARG 331 ? D ARG 1   
78 1 Y 1 D GLU 342 ? D GLU 12  
79 1 Y 1 D ASP 343 ? D ASP 13  
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#