data_5WZF
# 
_entry.id   5WZF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.288 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5WZF         
WWPDB D_1300002638 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          5WZ4 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5WZF 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Thakur, K.G.' 1 ? 
'Deep, A.'     2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'FEBS J.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1742-4658 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            284 
_citation.language                  ? 
_citation.page_first                4066 
_citation.page_last                 4082 
_citation.title                     
;Crystal structure of Mycobacterium tuberculosis VapC20 toxin and its interactions with cognate antitoxin, VapB20, suggest a model for toxin-antitoxin assembly.
;
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1111/febs.14289 
_citation.pdbx_database_id_PubMed   28986943 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Deep, A.'     1 
primary 'Kaundal, S.'  2 
primary 'Agarwal, S.'  3 
primary 'Singh, R.'    4 
primary 'Thakur, K.G.' 5 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5WZF 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     48.810 
_cell.length_a_esd                 ? 
_cell.length_b                     59.140 
_cell.length_b_esd                 ? 
_cell.length_c                     79.290 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5WZF 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man '23S rRNA-specific endonuclease VapC20' 16072.963 1   3.1.-.- ? ? ? 
2 polymer man '23S rRNA-specific endonuclease VapC20' 16088.963 1   3.1.-.- ? ? ? 
3 water   nat water                                   18.015    261 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Ribonuclease VapC20,RNase VapC20,Toxin VapC20' 
2 'Ribonuclease VapC20,RNase VapC20,Toxin VapC20' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MGSSHHHHHHSQASIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLST
VVRVEHVTADLEEQAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
;
;MGSSHHHHHHSQASIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLST
VVRVEHVTADLEEQAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
;
A ? 
2 'polypeptide(L)' no yes 
;MGSSHHHHHHSQASIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRR(CSO)GHRAAVAAAAI
RLSTVVRVEHVTADLEEQAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
;
;MGSSHHHHHHSQASIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLST
VVRVEHVTADLEEQAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  GLN n 
1 13  ALA n 
1 14  SER n 
1 15  ILE n 
1 16  PHE n 
1 17  VAL n 
1 18  ASP n 
1 19  THR n 
1 20  SER n 
1 21  PHE n 
1 22  TRP n 
1 23  ALA n 
1 24  ALA n 
1 25  LEU n 
1 26  GLY n 
1 27  ASN n 
1 28  ALA n 
1 29  GLY n 
1 30  ASP n 
1 31  ALA n 
1 32  ARG n 
1 33  HIS n 
1 34  GLY n 
1 35  THR n 
1 36  ALA n 
1 37  LYS n 
1 38  ARG n 
1 39  LEU n 
1 40  TRP n 
1 41  ALA n 
1 42  SER n 
1 43  LYS n 
1 44  PRO n 
1 45  PRO n 
1 46  VAL n 
1 47  VAL n 
1 48  MET n 
1 49  THR n 
1 50  SER n 
1 51  ASN n 
1 52  HIS n 
1 53  VAL n 
1 54  LEU n 
1 55  GLY n 
1 56  GLU n 
1 57  THR n 
1 58  TRP n 
1 59  THR n 
1 60  LEU n 
1 61  LEU n 
1 62  ASN n 
1 63  ARG n 
1 64  ARG n 
1 65  CYS n 
1 66  GLY n 
1 67  HIS n 
1 68  ARG n 
1 69  ALA n 
1 70  ALA n 
1 71  VAL n 
1 72  ALA n 
1 73  ALA n 
1 74  ALA n 
1 75  ALA n 
1 76  ILE n 
1 77  ARG n 
1 78  LEU n 
1 79  SER n 
1 80  THR n 
1 81  VAL n 
1 82  VAL n 
1 83  ARG n 
1 84  VAL n 
1 85  GLU n 
1 86  HIS n 
1 87  VAL n 
1 88  THR n 
1 89  ALA n 
1 90  ASP n 
1 91  LEU n 
1 92  GLU n 
1 93  GLU n 
1 94  GLN n 
1 95  ALA n 
1 96  TRP n 
1 97  GLU n 
1 98  TRP n 
1 99  LEU n 
1 100 VAL n 
1 101 ARG n 
1 102 HIS n 
1 103 ASP n 
1 104 GLU n 
1 105 ARG n 
1 106 GLU n 
1 107 TYR n 
1 108 SER n 
1 109 PHE n 
1 110 VAL n 
1 111 ASP n 
1 112 ALA n 
1 113 THR n 
1 114 SER n 
1 115 PHE n 
1 116 ALA n 
1 117 VAL n 
1 118 MET n 
1 119 ARG n 
1 120 LYS n 
1 121 LYS n 
1 122 GLY n 
1 123 ILE n 
1 124 GLN n 
1 125 ASN n 
1 126 ALA n 
1 127 TYR n 
1 128 ALA n 
1 129 PHE n 
1 130 ASP n 
1 131 GLY n 
1 132 ASP n 
1 133 PHE n 
1 134 SER n 
1 135 ALA n 
1 136 ALA n 
1 137 GLY n 
1 138 PHE n 
1 139 VAL n 
1 140 GLU n 
1 141 VAL n 
1 142 ARG n 
1 143 PRO n 
1 144 GLU n 
2 1   MET n 
2 2   GLY n 
2 3   SER n 
2 4   SER n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   HIS n 
2 10  HIS n 
2 11  SER n 
2 12  GLN n 
2 13  ALA n 
2 14  SER n 
2 15  ILE n 
2 16  PHE n 
2 17  VAL n 
2 18  ASP n 
2 19  THR n 
2 20  SER n 
2 21  PHE n 
2 22  TRP n 
2 23  ALA n 
2 24  ALA n 
2 25  LEU n 
2 26  GLY n 
2 27  ASN n 
2 28  ALA n 
2 29  GLY n 
2 30  ASP n 
2 31  ALA n 
2 32  ARG n 
2 33  HIS n 
2 34  GLY n 
2 35  THR n 
2 36  ALA n 
2 37  LYS n 
2 38  ARG n 
2 39  LEU n 
2 40  TRP n 
2 41  ALA n 
2 42  SER n 
2 43  LYS n 
2 44  PRO n 
2 45  PRO n 
2 46  VAL n 
2 47  VAL n 
2 48  MET n 
2 49  THR n 
2 50  SER n 
2 51  ASN n 
2 52  HIS n 
2 53  VAL n 
2 54  LEU n 
2 55  GLY n 
2 56  GLU n 
2 57  THR n 
2 58  TRP n 
2 59  THR n 
2 60  LEU n 
2 61  LEU n 
2 62  ASN n 
2 63  ARG n 
2 64  ARG n 
2 65  CSO n 
2 66  GLY n 
2 67  HIS n 
2 68  ARG n 
2 69  ALA n 
2 70  ALA n 
2 71  VAL n 
2 72  ALA n 
2 73  ALA n 
2 74  ALA n 
2 75  ALA n 
2 76  ILE n 
2 77  ARG n 
2 78  LEU n 
2 79  SER n 
2 80  THR n 
2 81  VAL n 
2 82  VAL n 
2 83  ARG n 
2 84  VAL n 
2 85  GLU n 
2 86  HIS n 
2 87  VAL n 
2 88  THR n 
2 89  ALA n 
2 90  ASP n 
2 91  LEU n 
2 92  GLU n 
2 93  GLU n 
2 94  GLN n 
2 95  ALA n 
2 96  TRP n 
2 97  GLU n 
2 98  TRP n 
2 99  LEU n 
2 100 VAL n 
2 101 ARG n 
2 102 HIS n 
2 103 ASP n 
2 104 GLU n 
2 105 ARG n 
2 106 GLU n 
2 107 TYR n 
2 108 SER n 
2 109 PHE n 
2 110 VAL n 
2 111 ASP n 
2 112 ALA n 
2 113 THR n 
2 114 SER n 
2 115 PHE n 
2 116 ALA n 
2 117 VAL n 
2 118 MET n 
2 119 ARG n 
2 120 LYS n 
2 121 LYS n 
2 122 GLY n 
2 123 ILE n 
2 124 GLN n 
2 125 ASN n 
2 126 ALA n 
2 127 TYR n 
2 128 ALA n 
2 129 PHE n 
2 130 ASP n 
2 131 GLY n 
2 132 ASP n 
2 133 PHE n 
2 134 SER n 
2 135 ALA n 
2 136 ALA n 
2 137 GLY n 
2 138 PHE n 
2 139 VAL n 
2 140 GLU n 
2 141 VAL n 
2 142 ARG n 
2 143 PRO n 
2 144 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? 'vapC20, MT2626.1' ? 'CDC 1551 / Oshkosh' ? ? ? ? 'Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)' 
83331 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
2 1 sample ? ? ? ? ? 'vapC20, MT2626.1' ? 'CDC 1551 / Oshkosh' ? ? ? ? 'Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)' 
83331 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP VPC20_MYCTO P0DMV7 ? 1 
;IFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEEQ
AWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
;
2 
2 UNP VPC20_MYCTO P0DMV7 ? 2 
;IFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEEQ
AWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
;
2 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5WZF A 15 ? 144 ? P0DMV7 2 ? 131 ? 2 131 
2 2 5WZF B 15 ? 144 ? P0DMV7 2 ? 131 ? 2 131 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5WZF MET A 1  ? UNP P0DMV7 ? ? 'expression tag' -12 1  
1 5WZF GLY A 2  ? UNP P0DMV7 ? ? 'expression tag' -11 2  
1 5WZF SER A 3  ? UNP P0DMV7 ? ? 'expression tag' -10 3  
1 5WZF SER A 4  ? UNP P0DMV7 ? ? 'expression tag' -9  4  
1 5WZF HIS A 5  ? UNP P0DMV7 ? ? 'expression tag' -8  5  
1 5WZF HIS A 6  ? UNP P0DMV7 ? ? 'expression tag' -7  6  
1 5WZF HIS A 7  ? UNP P0DMV7 ? ? 'expression tag' -6  7  
1 5WZF HIS A 8  ? UNP P0DMV7 ? ? 'expression tag' -5  8  
1 5WZF HIS A 9  ? UNP P0DMV7 ? ? 'expression tag' -4  9  
1 5WZF HIS A 10 ? UNP P0DMV7 ? ? 'expression tag' -3  10 
1 5WZF SER A 11 ? UNP P0DMV7 ? ? 'expression tag' -2  11 
1 5WZF GLN A 12 ? UNP P0DMV7 ? ? 'expression tag' -1  12 
1 5WZF ALA A 13 ? UNP P0DMV7 ? ? 'expression tag' 0   13 
1 5WZF SER A 14 ? UNP P0DMV7 ? ? 'expression tag' 1   14 
2 5WZF MET B 1  ? UNP P0DMV7 ? ? 'expression tag' -12 15 
2 5WZF GLY B 2  ? UNP P0DMV7 ? ? 'expression tag' -11 16 
2 5WZF SER B 3  ? UNP P0DMV7 ? ? 'expression tag' -10 17 
2 5WZF SER B 4  ? UNP P0DMV7 ? ? 'expression tag' -9  18 
2 5WZF HIS B 5  ? UNP P0DMV7 ? ? 'expression tag' -8  19 
2 5WZF HIS B 6  ? UNP P0DMV7 ? ? 'expression tag' -7  20 
2 5WZF HIS B 7  ? UNP P0DMV7 ? ? 'expression tag' -6  21 
2 5WZF HIS B 8  ? UNP P0DMV7 ? ? 'expression tag' -5  22 
2 5WZF HIS B 9  ? UNP P0DMV7 ? ? 'expression tag' -4  23 
2 5WZF HIS B 10 ? UNP P0DMV7 ? ? 'expression tag' -3  24 
2 5WZF SER B 11 ? UNP P0DMV7 ? ? 'expression tag' -2  25 
2 5WZF GLN B 12 ? UNP P0DMV7 ? ? 'expression tag' -1  26 
2 5WZF ALA B 13 ? UNP P0DMV7 ? ? 'expression tag' 0   27 
2 5WZF SER B 14 ? UNP P0DMV7 ? ? 'expression tag' 1   28 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S'   137.158 
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5WZF 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            1.78 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         30.86 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M Potassium thiocyanate, 30% w/v Polyethylene glycol monomethyl ether 2000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MAR scanner 345 mm plate' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-07-18 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5WZF 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.750 
_reflns.d_resolution_low                 79.290 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       23389 
_reflns.number_obs                       23389 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.500 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.300 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.066 
_reflns.pdbx_netI_over_av_sigmaI         8.100 
_reflns.pdbx_netI_over_sigmaI            11.800 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.075 
_reflns.pdbx_Rpim_I_all                  0.035 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         100456 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.750 1.840  ? 1.400  12872 ? ? 3238 ? 95.600  ? ? ? ? 0.526 ? ? ? ? ? ? ? ? 4.000 0.526 ? ? 2.500  0.605 0.294 ? 1  1 ? ? 
1.840 1.960  ? 2.100  12594 ? ? 3182 ? 98.500  ? ? ? ? 0.347 ? ? ? ? ? ? ? ? 4.000 0.347 ? ? 3.800  0.399 0.194 ? 2  1 ? ? 
1.960 2.090  ? 3.500  12507 ? ? 3030 ? 99.600  ? ? ? ? 0.205 ? ? ? ? ? ? ? ? 4.100 0.205 ? ? 6.100  0.235 0.113 ? 3  1 ? ? 
2.090 2.260  ? 5.400  12387 ? ? 2856 ? 100.000 ? ? ? ? 0.135 ? ? ? ? ? ? ? ? 4.300 0.135 ? ? 8.800  0.153 0.071 ? 4  1 ? ? 
2.260 2.470  ? 7.000  11748 ? ? 2634 ? 99.800  ? ? ? ? 0.099 ? ? ? ? ? ? ? ? 4.500 0.099 ? ? 11.500 0.113 0.052 ? 5  1 ? ? 
2.470 2.770  ? 9.300  10753 ? ? 2374 ? 99.700  ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 4.500 0.071 ? ? 14.600 0.080 0.036 ? 6  1 ? ? 
2.770 3.200  ? 10.100 9602  ? ? 2114 ? 99.200  ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 4.500 0.061 ? ? 19.100 0.069 0.031 ? 7  1 ? ? 
3.200 3.910  ? 12.700 8120  ? ? 1773 ? 98.300  ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 4.600 0.048 ? ? 25.600 0.054 0.024 ? 8  1 ? ? 
3.910 5.530  ? 20.300 6409  ? ? 1400 ? 97.400  ? ? ? ? 0.030 ? ? ? ? ? ? ? ? 4.600 0.030 ? ? 28.200 0.033 0.015 ? 9  1 ? ? 
5.530 34.007 ? 12.400 3464  ? ? 788  ? 94.700  ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 4.400 0.033 ? ? 27.100 0.037 0.017 ? 10 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                77.530 
_refine.B_iso_mean                               25.9258 
_refine.B_iso_min                                10.260 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5WZF 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.7500 
_refine.ls_d_res_low                             34.0070 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     23350 
_refine.ls_number_reflns_R_free                  1166 
_refine.ls_number_reflns_R_work                  22184 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.1400 
_refine.ls_percent_reflns_R_free                 4.9900 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1725 
_refine.ls_R_factor_R_free                       0.1976 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1712 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 19.3600 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2400 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.7500 
_refine_hist.d_res_low                        34.0070 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             261 
_refine_hist.number_atoms_total               2309 
_refine_hist.pdbx_number_residues_total       261 
_refine_hist.pdbx_B_iso_mean_solvent          35.83 
_refine_hist.pdbx_number_atoms_protein        2048 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 2124 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.708  ? 2887 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.027  ? 313  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 372  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 13.013 ? 737  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.7500 1.8297  2759 . 162 2597 95.0000  . . . 0.3170 0.0000 0.2762 . . . . . . 8 . . . 
'X-RAY DIFFRACTION' 1.8297 1.9261  2853 . 135 2718 98.0000  . . . 0.2646 0.0000 0.2257 . . . . . . 8 . . . 
'X-RAY DIFFRACTION' 1.9261 2.0468  2911 . 148 2763 99.0000  . . . 0.2310 0.0000 0.1956 . . . . . . 8 . . . 
'X-RAY DIFFRACTION' 2.0468 2.2048  2951 . 163 2788 100.0000 . . . 0.2462 0.0000 0.1813 . . . . . . 8 . . . 
'X-RAY DIFFRACTION' 2.2048 2.4266  2934 . 152 2782 100.0000 . . . 0.1913 0.0000 0.1749 . . . . . . 8 . . . 
'X-RAY DIFFRACTION' 2.4266 2.7776  2959 . 142 2817 99.0000  . . . 0.2069 0.0000 0.1720 . . . . . . 8 . . . 
'X-RAY DIFFRACTION' 2.7776 3.4990  2968 . 126 2842 98.0000  . . . 0.1810 0.0000 0.1638 . . . . . . 8 . . . 
'X-RAY DIFFRACTION' 3.4990 34.0129 3015 . 138 2877 96.0000  . . . 0.1519 0.0000 0.1447 . . . . . . 8 . . . 
# 
_struct.entry_id                     5WZF 
_struct.title                        
'Crystal structure of Mycobacterium tuberculosis VapC20 (Rv2549c), Sarcin-Ricin loop cleaving toxin' 
_struct.pdbx_descriptor              '23S rRNA-specific endonuclease VapC20 (E.C.3.1.-.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5WZF 
_struct_keywords.text            
'VapC toxin, Toxin-antitoxin system, Sarcin-Ricin loop cleaving toxin, Pin-domain, Homodimer, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 18  ? GLY A 26  ? ASP A 5   GLY A 13  1 ? 9  
HELX_P HELX_P2  AA2 ARG A 32  ? SER A 42  ? ARG A 19  SER A 29  1 ? 11 
HELX_P HELX_P3  AA3 ASN A 51  ? CYS A 65  ? ASN A 38  CYS A 52  1 ? 15 
HELX_P HELX_P4  AA4 GLY A 66  ? ILE A 76  ? GLY A 53  ILE A 63  1 ? 11 
HELX_P HELX_P5  AA5 ARG A 77  ? SER A 79  ? ARG A 64  SER A 66  5 ? 3  
HELX_P HELX_P6  AA6 THR A 88  ? HIS A 102 ? THR A 75  HIS A 89  1 ? 15 
HELX_P HELX_P7  AA7 SER A 108 ? GLY A 122 ? SER A 95  GLY A 109 1 ? 15 
HELX_P HELX_P8  AA8 GLY A 131 ? ALA A 136 ? GLY A 118 ALA A 123 1 ? 6  
HELX_P HELX_P9  AA9 ASP B 18  ? GLY B 26  ? ASP B 5   GLY B 13  1 ? 9  
HELX_P HELX_P10 AB1 ARG B 32  ? SER B 42  ? ARG B 19  SER B 29  1 ? 11 
HELX_P HELX_P11 AB2 ASN B 51  ? CSO B 65  ? ASN B 38  CSO B 52  1 ? 15 
HELX_P HELX_P12 AB3 GLY B 66  ? ALA B 75  ? GLY B 53  ALA B 62  1 ? 10 
HELX_P HELX_P13 AB4 ILE B 76  ? SER B 79  ? ILE B 63  SER B 66  5 ? 4  
HELX_P HELX_P14 AB5 THR B 88  ? HIS B 102 ? THR B 75  HIS B 89  1 ? 15 
HELX_P HELX_P15 AB6 SER B 108 ? GLY B 122 ? SER B 95  GLY B 109 1 ? 15 
HELX_P HELX_P16 AB7 GLY B 131 ? ALA B 136 ? GLY B 118 ALA B 123 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? B ARG 64 C A ? ? 1_555 B CSO 65 N ? ? B ARG 51 B CSO 52 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale2 covale both ? B ARG 64 C B ? ? 1_555 B CSO 65 N ? ? B ARG 51 B CSO 52 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale3 covale both ? B CSO 65 C ? ? ? 1_555 B GLY 66 N ? ? B CSO 52 B GLY 53 1_555 ? ? ? ? ? ? ? 1.325 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA1 2 3 ? parallel 
AA1 3 4 ? parallel 
AA1 4 5 ? parallel 
AA2 1 2 ? parallel 
AA2 2 3 ? parallel 
AA2 3 4 ? parallel 
AA2 4 5 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 82  ? GLU A 85  ? VAL A 69  GLU A 72  
AA1 2 VAL A 47  ? SER A 50  ? VAL A 34  SER A 37  
AA1 3 ILE A 15  ? VAL A 17  ? ILE A 2   VAL A 4   
AA1 4 ASN A 125 ? TYR A 127 ? ASN A 112 TYR A 114 
AA1 5 VAL A 139 ? GLU A 140 ? VAL A 126 GLU A 127 
AA2 1 VAL B 82  ? GLU B 85  ? VAL B 69  GLU B 72  
AA2 2 VAL B 46  ? SER B 50  ? VAL B 33  SER B 37  
AA2 3 SER B 14  ? VAL B 17  ? SER B 1   VAL B 4   
AA2 4 ASN B 125 ? TYR B 127 ? ASN B 112 TYR B 114 
AA2 5 VAL B 139 ? GLU B 140 ? VAL B 126 GLU B 127 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ARG A 83  ? O ARG A 70  N VAL A 47  ? N VAL A 34  
AA1 2 3 O MET A 48  ? O MET A 35  N ILE A 15  ? N ILE A 2   
AA1 3 4 N PHE A 16  ? N PHE A 3   O TYR A 127 ? O TYR A 114 
AA1 4 5 N ALA A 126 ? N ALA A 113 O VAL A 139 ? O VAL A 126 
AA2 1 2 O ARG B 83  ? O ARG B 70  N VAL B 47  ? N VAL B 34  
AA2 2 3 O MET B 48  ? O MET B 35  N VAL B 17  ? N VAL B 4   
AA2 3 4 N PHE B 16  ? N PHE B 3   O TYR B 127 ? O TYR B 114 
AA2 4 5 N ALA B 126 ? N ALA B 113 O VAL B 139 ? O VAL B 126 
# 
_atom_sites.entry_id                    5WZF 
_atom_sites.fract_transf_matrix[1][1]   0.020488 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016909 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012612 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 14  ? 32.191  -2.814  89.428  1.00 32.94 ? 1   SER A N   1 
ATOM   2    C CA  . SER A 1 14  ? 33.194  -1.780  89.635  1.00 33.41 ? 1   SER A CA  1 
ATOM   3    C C   . SER A 1 14  ? 32.569  -0.403  89.843  1.00 28.59 ? 1   SER A C   1 
ATOM   4    O O   . SER A 1 14  ? 33.214  0.501   90.370  1.00 29.58 ? 1   SER A O   1 
ATOM   5    C CB  . SER A 1 14  ? 34.162  -1.735  88.455  1.00 36.24 ? 1   SER A CB  1 
ATOM   6    O OG  . SER A 1 14  ? 35.046  -0.636  88.573  1.00 39.32 ? 1   SER A OG  1 
ATOM   7    N N   . ILE A 1 15  ? 31.320  -0.242  89.415  1.00 25.02 ? 2   ILE A N   1 
ATOM   8    C CA  . ILE A 1 15  ? 30.578  0.991   89.670  1.00 21.04 ? 2   ILE A CA  1 
ATOM   9    C C   . ILE A 1 15  ? 29.106  0.705   89.958  1.00 19.13 ? 2   ILE A C   1 
ATOM   10   O O   . ILE A 1 15  ? 28.486  -0.127  89.296  1.00 20.71 ? 2   ILE A O   1 
ATOM   11   C CB  . ILE A 1 15  ? 30.703  1.981   88.491  1.00 30.68 ? 2   ILE A CB  1 
ATOM   12   C CG1 . ILE A 1 15  ? 32.029  2.734   88.590  1.00 32.68 ? 2   ILE A CG1 1 
ATOM   13   C CG2 . ILE A 1 15  ? 29.547  2.969   88.460  1.00 33.78 ? 2   ILE A CG2 1 
ATOM   14   C CD1 . ILE A 1 15  ? 32.148  3.874   87.647  1.00 36.43 ? 2   ILE A CD1 1 
ATOM   15   N N   . PHE A 1 16  ? 28.570  1.384   90.970  1.00 18.36 ? 3   PHE A N   1 
ATOM   16   C CA  . PHE A 1 16  ? 27.153  1.313   91.301  1.00 16.80 ? 3   PHE A CA  1 
ATOM   17   C C   . PHE A 1 16  ? 26.474  2.624   90.909  1.00 15.53 ? 3   PHE A C   1 
ATOM   18   O O   . PHE A 1 16  ? 26.999  3.704   91.174  1.00 16.05 ? 3   PHE A O   1 
ATOM   19   C CB  . PHE A 1 16  ? 26.956  1.026   92.792  1.00 17.42 ? 3   PHE A CB  1 
ATOM   20   C CG  . PHE A 1 16  ? 25.518  0.840   93.184  1.00 16.27 ? 3   PHE A CG  1 
ATOM   21   C CD1 . PHE A 1 16  ? 24.720  1.932   93.483  1.00 15.38 ? 3   PHE A CD1 1 
ATOM   22   C CD2 . PHE A 1 16  ? 24.961  -0.425  93.235  1.00 16.42 ? 3   PHE A CD2 1 
ATOM   23   C CE1 . PHE A 1 16  ? 23.396  1.767   93.825  1.00 14.64 ? 3   PHE A CE1 1 
ATOM   24   C CE2 . PHE A 1 16  ? 23.638  -0.599  93.585  1.00 16.68 ? 3   PHE A CE2 1 
ATOM   25   C CZ  . PHE A 1 16  ? 22.855  0.499   93.878  1.00 16.82 ? 3   PHE A CZ  1 
ATOM   26   N N   . VAL A 1 17  ? 25.308  2.525   90.277  1.00 14.19 ? 4   VAL A N   1 
ATOM   27   C CA  . VAL A 1 17  ? 24.618  3.701   89.769  1.00 13.31 ? 4   VAL A CA  1 
ATOM   28   C C   . VAL A 1 17  ? 23.388  4.015   90.607  1.00 13.70 ? 4   VAL A C   1 
ATOM   29   O O   . VAL A 1 17  ? 22.536  3.154   90.820  1.00 12.09 ? 4   VAL A O   1 
ATOM   30   C CB  . VAL A 1 17  ? 24.183  3.522   88.297  1.00 12.79 ? 4   VAL A CB  1 
ATOM   31   C CG1 . VAL A 1 17  ? 23.637  4.835   87.745  1.00 12.39 ? 4   VAL A CG1 1 
ATOM   32   C CG2 . VAL A 1 17  ? 25.345  3.030   87.452  1.00 13.93 ? 4   VAL A CG2 1 
ATOM   33   N N   . ASP A 1 18  ? 23.306  5.261   91.065  1.00 14.62 ? 5   ASP A N   1 
ATOM   34   C CA  . ASP A 1 18  ? 22.224  5.729   91.925  1.00 12.70 ? 5   ASP A CA  1 
ATOM   35   C C   . ASP A 1 18  ? 21.093  6.377   91.128  1.00 13.95 ? 5   ASP A C   1 
ATOM   36   O O   . ASP A 1 18  ? 21.275  6.754   89.973  1.00 13.17 ? 5   ASP A O   1 
ATOM   37   C CB  . ASP A 1 18  ? 22.775  6.733   92.946  1.00 14.04 ? 5   ASP A CB  1 
ATOM   38   C CG  . ASP A 1 18  ? 21.701  7.292   93.852  1.00 21.98 ? 5   ASP A CG  1 
ATOM   39   O OD1 . ASP A 1 18  ? 20.959  6.481   94.442  1.00 18.42 ? 5   ASP A OD1 1 
ATOM   40   O OD2 . ASP A 1 18  ? 21.582  8.533   93.955  1.00 19.00 ? 5   ASP A OD2 1 
ATOM   41   N N   . THR A 1 19  ? 19.933  6.510   91.769  1.00 14.98 ? 6   THR A N   1 
ATOM   42   C CA  . THR A 1 19  ? 18.779  7.215   91.219  1.00 15.72 ? 6   THR A CA  1 
ATOM   43   C C   . THR A 1 19  ? 19.130  8.595   90.674  1.00 15.81 ? 6   THR A C   1 
ATOM   44   O O   . THR A 1 19  ? 18.697  8.970   89.585  1.00 16.58 ? 6   THR A O   1 
ATOM   45   C CB  . THR A 1 19  ? 17.687  7.386   92.289  1.00 19.03 ? 6   THR A CB  1 
ATOM   46   O OG1 . THR A 1 19  ? 17.370  6.110   92.856  1.00 20.44 ? 6   THR A OG1 1 
ATOM   47   C CG2 . THR A 1 19  ? 16.431  8.014   91.694  1.00 19.76 ? 6   THR A CG2 1 
ATOM   48   N N   . SER A 1 20  ? 19.919  9.341   91.440  1.00 15.20 ? 7   SER A N   1 
ATOM   49   C CA  . SER A 1 20  ? 20.279  10.707  91.080  1.00 18.08 ? 7   SER A CA  1 
ATOM   50   C C   . SER A 1 20  ? 20.980  10.760  89.726  1.00 19.04 ? 7   SER A C   1 
ATOM   51   O O   . SER A 1 20  ? 20.806  11.712  88.964  1.00 19.99 ? 7   SER A O   1 
ATOM   52   C CB  . SER A 1 20  ? 21.171  11.325  92.157  1.00 19.90 ? 7   SER A CB  1 
ATOM   53   O OG  . SER A 1 20  ? 22.377  10.594  92.292  1.00 16.70 ? 7   SER A OG  1 
ATOM   54   N N   . PHE A 1 21  ? 21.768  9.732   89.428  1.00 13.74 ? 8   PHE A N   1 
ATOM   55   C CA  . PHE A 1 21  ? 22.457  9.655   88.144  1.00 13.86 ? 8   PHE A CA  1 
ATOM   56   C C   . PHE A 1 21  ? 21.503  9.251   87.022  1.00 17.79 ? 8   PHE A C   1 
ATOM   57   O O   . PHE A 1 21  ? 21.491  9.874   85.957  1.00 18.55 ? 8   PHE A O   1 
ATOM   58   C CB  . PHE A 1 21  ? 23.628  8.672   88.208  1.00 14.78 ? 8   PHE A CB  1 
ATOM   59   C CG  . PHE A 1 21  ? 24.429  8.612   86.939  1.00 14.48 ? 8   PHE A CG  1 
ATOM   60   C CD1 . PHE A 1 21  ? 24.069  7.744   85.918  1.00 14.17 ? 8   PHE A CD1 1 
ATOM   61   C CD2 . PHE A 1 21  ? 25.527  9.437   86.757  1.00 16.44 ? 8   PHE A CD2 1 
ATOM   62   C CE1 . PHE A 1 21  ? 24.793  7.694   84.745  1.00 16.74 ? 8   PHE A CE1 1 
ATOM   63   C CE2 . PHE A 1 21  ? 26.259  9.390   85.583  1.00 18.73 ? 8   PHE A CE2 1 
ATOM   64   C CZ  . PHE A 1 21  ? 25.889  8.520   84.576  1.00 19.09 ? 8   PHE A CZ  1 
ATOM   65   N N   . TRP A 1 22  ? 20.719  8.200   87.256  1.00 14.83 ? 9   TRP A N   1 
ATOM   66   C CA  . TRP A 1 22  ? 19.764  7.738   86.251  1.00 16.67 ? 9   TRP A CA  1 
ATOM   67   C C   . TRP A 1 22  ? 18.809  8.864   85.860  1.00 16.43 ? 9   TRP A C   1 
ATOM   68   O O   . TRP A 1 22  ? 18.477  9.029   84.689  1.00 16.25 ? 9   TRP A O   1 
ATOM   69   C CB  . TRP A 1 22  ? 18.950  6.548   86.754  1.00 17.84 ? 9   TRP A CB  1 
ATOM   70   C CG  . TRP A 1 22  ? 19.662  5.228   86.906  1.00 14.19 ? 9   TRP A CG  1 
ATOM   71   C CD1 . TRP A 1 22  ? 19.647  4.425   88.008  1.00 13.10 ? 9   TRP A CD1 1 
ATOM   72   C CD2 . TRP A 1 22  ? 20.450  4.540   85.920  1.00 15.86 ? 9   TRP A CD2 1 
ATOM   73   N NE1 . TRP A 1 22  ? 20.377  3.286   87.778  1.00 12.18 ? 9   TRP A NE1 1 
ATOM   74   C CE2 . TRP A 1 22  ? 20.885  3.331   86.506  1.00 10.81 ? 9   TRP A CE2 1 
ATOM   75   C CE3 . TRP A 1 22  ? 20.832  4.827   84.606  1.00 15.04 ? 9   TRP A CE3 1 
ATOM   76   C CZ2 . TRP A 1 22  ? 21.683  2.415   85.825  1.00 12.51 ? 9   TRP A CZ2 1 
ATOM   77   C CZ3 . TRP A 1 22  ? 21.628  3.915   83.931  1.00 17.34 ? 9   TRP A CZ3 1 
ATOM   78   C CH2 . TRP A 1 22  ? 22.044  2.722   84.542  1.00 16.08 ? 9   TRP A CH2 1 
ATOM   79   N N   . ALA A 1 23  ? 18.375  9.628   86.860  1.00 17.39 ? 10  ALA A N   1 
ATOM   80   C CA  . ALA A 1 23  ? 17.454  10.740  86.654  1.00 17.84 ? 10  ALA A CA  1 
ATOM   81   C C   . ALA A 1 23  ? 18.094  11.858  85.836  1.00 20.91 ? 10  ALA A C   1 
ATOM   82   O O   . ALA A 1 23  ? 17.431  12.501  85.023  1.00 23.96 ? 10  ALA A O   1 
ATOM   83   C CB  . ALA A 1 23  ? 16.967  11.279  87.997  1.00 17.86 ? 10  ALA A CB  1 
ATOM   84   N N   . ALA A 1 24  ? 19.383  12.092  86.056  1.00 18.67 ? 11  ALA A N   1 
ATOM   85   C CA  . ALA A 1 24  ? 20.105  13.117  85.308  1.00 20.88 ? 11  ALA A CA  1 
ATOM   86   C C   . ALA A 1 24  ? 20.333  12.678  83.865  1.00 21.50 ? 11  ALA A C   1 
ATOM   87   O O   . ALA A 1 24  ? 20.229  13.478  82.933  1.00 24.20 ? 11  ALA A O   1 
ATOM   88   C CB  . ALA A 1 24  ? 21.430  13.429  85.978  1.00 18.72 ? 11  ALA A CB  1 
ATOM   89   N N   . LEU A 1 25  ? 20.650  11.400  83.694  1.00 16.81 ? 12  LEU A N   1 
ATOM   90   C CA  . LEU A 1 25  ? 20.889  10.837  82.373  1.00 19.56 ? 12  LEU A CA  1 
ATOM   91   C C   . LEU A 1 25  ? 19.592  10.788  81.574  1.00 17.68 ? 12  LEU A C   1 
ATOM   92   O O   . LEU A 1 25  ? 19.574  11.095  80.382  1.00 21.68 ? 12  LEU A O   1 
ATOM   93   C CB  . LEU A 1 25  ? 21.498  9.437   82.495  1.00 20.78 ? 12  LEU A CB  1 
ATOM   94   C CG  . LEU A 1 25  ? 22.138  8.825   81.247  1.00 23.33 ? 12  LEU A CG  1 
ATOM   95   C CD1 . LEU A 1 25  ? 23.331  9.655   80.796  1.00 23.41 ? 12  LEU A CD1 1 
ATOM   96   C CD2 . LEU A 1 25  ? 22.552  7.386   81.514  1.00 21.36 ? 12  LEU A CD2 1 
ATOM   97   N N   . GLY A 1 26  ? 18.504  10.417  82.245  1.00 19.47 ? 13  GLY A N   1 
ATOM   98   C CA  . GLY A 1 26  ? 17.225  10.217  81.584  1.00 20.53 ? 13  GLY A CA  1 
ATOM   99   C C   . GLY A 1 26  ? 16.409  11.477  81.351  1.00 26.13 ? 13  GLY A C   1 
ATOM   100  O O   . GLY A 1 26  ? 15.332  11.423  80.757  1.00 31.06 ? 13  GLY A O   1 
ATOM   101  N N   . ASN A 1 27  ? 16.917  12.610  81.824  1.00 24.00 ? 14  ASN A N   1 
ATOM   102  C CA  . ASN A 1 27  ? 16.221  13.881  81.680  1.00 25.46 ? 14  ASN A CA  1 
ATOM   103  C C   . ASN A 1 27  ? 17.167  14.931  81.116  1.00 30.93 ? 14  ASN A C   1 
ATOM   104  O O   . ASN A 1 27  ? 18.008  15.465  81.835  1.00 34.93 ? 14  ASN A O   1 
ATOM   105  C CB  . ASN A 1 27  ? 15.647  14.335  83.027  1.00 25.77 ? 14  ASN A CB  1 
ATOM   106  C CG  . ASN A 1 27  ? 14.997  15.709  82.964  1.00 30.07 ? 14  ASN A CG  1 
ATOM   107  O OD1 . ASN A 1 27  ? 14.691  16.223  81.887  1.00 33.28 ? 14  ASN A OD1 1 
ATOM   108  N ND2 . ASN A 1 27  ? 14.772  16.306  84.130  1.00 31.16 ? 14  ASN A ND2 1 
ATOM   109  N N   . ALA A 1 28  ? 17.020  15.223  79.827  1.00 33.01 ? 15  ALA A N   1 
ATOM   110  C CA  . ALA A 1 28  ? 17.892  16.173  79.139  1.00 34.99 ? 15  ALA A CA  1 
ATOM   111  C C   . ALA A 1 28  ? 17.805  17.571  79.740  1.00 34.36 ? 15  ALA A C   1 
ATOM   112  O O   . ALA A 1 28  ? 18.677  18.406  79.508  1.00 39.34 ? 15  ALA A O   1 
ATOM   113  C CB  . ALA A 1 28  ? 17.553  16.219  77.654  1.00 39.27 ? 15  ALA A CB  1 
ATOM   114  N N   . GLY A 1 29  ? 16.749  17.822  80.507  1.00 35.15 ? 16  GLY A N   1 
ATOM   115  C CA  . GLY A 1 29  ? 16.570  19.104  81.159  1.00 42.32 ? 16  GLY A CA  1 
ATOM   116  C C   . GLY A 1 29  ? 17.222  19.179  82.528  1.00 45.24 ? 16  GLY A C   1 
ATOM   117  O O   . GLY A 1 29  ? 17.284  20.250  83.129  1.00 50.61 ? 16  GLY A O   1 
ATOM   118  N N   . ASP A 1 30  ? 17.702  18.044  83.027  1.00 39.05 ? 17  ASP A N   1 
ATOM   119  C CA  . ASP A 1 30  ? 18.373  18.009  84.322  1.00 36.50 ? 17  ASP A CA  1 
ATOM   120  C C   . ASP A 1 30  ? 19.656  18.828  84.271  1.00 36.53 ? 17  ASP A C   1 
ATOM   121  O O   . ASP A 1 30  ? 20.369  18.817  83.268  1.00 33.18 ? 17  ASP A O   1 
ATOM   122  C CB  . ASP A 1 30  ? 18.679  16.568  84.737  1.00 33.74 ? 17  ASP A CB  1 
ATOM   123  C CG  . ASP A 1 30  ? 19.142  16.459  86.181  1.00 33.95 ? 17  ASP A CG  1 
ATOM   124  O OD1 . ASP A 1 30  ? 20.271  16.896  86.490  1.00 35.05 ? 17  ASP A OD1 1 
ATOM   125  O OD2 . ASP A 1 30  ? 18.376  15.920  87.006  1.00 31.95 ? 17  ASP A OD2 1 
ATOM   126  N N   . ALA A 1 31  ? 19.946  19.535  85.359  1.00 38.66 ? 18  ALA A N   1 
ATOM   127  C CA  . ALA A 1 31  ? 21.117  20.399  85.418  1.00 39.74 ? 18  ALA A CA  1 
ATOM   128  C C   . ALA A 1 31  ? 22.415  19.604  85.317  1.00 36.53 ? 18  ALA A C   1 
ATOM   129  O O   . ALA A 1 31  ? 23.436  20.128  84.873  1.00 39.19 ? 18  ALA A O   1 
ATOM   130  C CB  . ALA A 1 31  ? 21.102  21.221  86.696  1.00 41.71 ? 18  ALA A CB  1 
ATOM   131  N N   . ARG A 1 32  ? 22.373  18.340  85.729  1.00 33.10 ? 19  ARG A N   1 
ATOM   132  C CA  . ARG A 1 32  ? 23.561  17.493  85.695  1.00 29.71 ? 19  ARG A CA  1 
ATOM   133  C C   . ARG A 1 32  ? 23.523  16.491  84.543  1.00 25.66 ? 19  ARG A C   1 
ATOM   134  O O   . ARG A 1 32  ? 24.289  15.530  84.527  1.00 24.10 ? 19  ARG A O   1 
ATOM   135  C CB  . ARG A 1 32  ? 23.729  16.741  87.022  1.00 35.38 ? 19  ARG A CB  1 
ATOM   136  C CG  . ARG A 1 32  ? 23.869  17.628  88.261  1.00 43.07 ? 19  ARG A CG  1 
ATOM   137  C CD  . ARG A 1 32  ? 24.634  18.918  87.977  1.00 53.91 ? 19  ARG A CD  1 
ATOM   138  N NE  . ARG A 1 32  ? 25.970  18.686  87.431  1.00 57.96 ? 19  ARG A NE  1 
ATOM   139  C CZ  . ARG A 1 32  ? 26.638  19.573  86.701  1.00 63.24 ? 19  ARG A CZ  1 
ATOM   140  N NH1 . ARG A 1 32  ? 26.097  20.753  86.427  1.00 66.64 ? 19  ARG A NH1 1 
ATOM   141  N NH2 . ARG A 1 32  ? 27.847  19.283  86.243  1.00 65.35 ? 19  ARG A NH2 1 
ATOM   142  N N   . HIS A 1 33  ? 22.632  16.718  83.583  1.00 26.10 ? 20  HIS A N   1 
ATOM   143  C CA  . HIS A 1 33  ? 22.506  15.833  82.428  1.00 24.14 ? 20  HIS A CA  1 
ATOM   144  C C   . HIS A 1 33  ? 23.808  15.744  81.633  1.00 25.51 ? 20  HIS A C   1 
ATOM   145  O O   . HIS A 1 33  ? 24.219  14.660  81.211  1.00 23.40 ? 20  HIS A O   1 
ATOM   146  C CB  . HIS A 1 33  ? 21.371  16.308  81.519  1.00 26.82 ? 20  HIS A CB  1 
ATOM   147  C CG  . HIS A 1 33  ? 21.201  15.480  80.284  1.00 30.31 ? 20  HIS A CG  1 
ATOM   148  N ND1 . HIS A 1 33  ? 20.712  14.192  80.313  1.00 28.03 ? 20  HIS A ND1 1 
ATOM   149  C CD2 . HIS A 1 33  ? 21.451  15.759  78.983  1.00 33.82 ? 20  HIS A CD2 1 
ATOM   150  C CE1 . HIS A 1 33  ? 20.671  13.711  79.084  1.00 30.77 ? 20  HIS A CE1 1 
ATOM   151  N NE2 . HIS A 1 33  ? 21.114  14.642  78.257  1.00 34.50 ? 20  HIS A NE2 1 
ATOM   152  N N   . GLY A 1 34  ? 24.448  16.891  81.431  1.00 26.92 ? 21  GLY A N   1 
ATOM   153  C CA  . GLY A 1 34  ? 25.696  16.951  80.691  1.00 29.73 ? 21  GLY A CA  1 
ATOM   154  C C   . GLY A 1 34  ? 26.799  16.154  81.360  1.00 31.05 ? 21  GLY A C   1 
ATOM   155  O O   . GLY A 1 34  ? 27.533  15.420  80.700  1.00 30.50 ? 21  GLY A O   1 
ATOM   156  N N   . THR A 1 35  ? 26.912  16.297  82.676  1.00 29.02 ? 22  THR A N   1 
ATOM   157  C CA  . THR A 1 35  ? 27.903  15.556  83.446  1.00 30.13 ? 22  THR A CA  1 
ATOM   158  C C   . THR A 1 35  ? 27.610  14.059  83.419  1.00 25.94 ? 22  THR A C   1 
ATOM   159  O O   . THR A 1 35  ? 28.522  13.237  83.294  1.00 24.51 ? 22  THR A O   1 
ATOM   160  C CB  . THR A 1 35  ? 27.953  16.045  84.907  1.00 31.61 ? 22  THR A CB  1 
ATOM   161  O OG1 . THR A 1 35  ? 28.294  17.435  84.928  1.00 37.03 ? 22  THR A OG1 1 
ATOM   162  C CG2 . THR A 1 35  ? 28.984  15.261  85.710  1.00 27.86 ? 22  THR A CG2 1 
ATOM   163  N N   . ALA A 1 36  ? 26.332  13.711  83.533  1.00 22.24 ? 23  ALA A N   1 
ATOM   164  C CA  . ALA A 1 36  ? 25.914  12.316  83.492  1.00 20.20 ? 23  ALA A CA  1 
ATOM   165  C C   . ALA A 1 36  ? 26.272  11.675  82.152  1.00 20.80 ? 23  ALA A C   1 
ATOM   166  O O   . ALA A 1 36  ? 26.730  10.535  82.108  1.00 22.47 ? 23  ALA A O   1 
ATOM   167  C CB  . ALA A 1 36  ? 24.421  12.203  83.753  1.00 21.57 ? 23  ALA A CB  1 
ATOM   168  N N   . LYS A 1 37  ? 26.068  12.412  81.064  1.00 22.30 ? 24  LYS A N   1 
ATOM   169  C CA  . LYS A 1 37  ? 26.388  11.902  79.733  1.00 23.48 ? 24  LYS A CA  1 
ATOM   170  C C   . LYS A 1 37  ? 27.881  11.628  79.572  1.00 27.34 ? 24  LYS A C   1 
ATOM   171  O O   . LYS A 1 37  ? 28.271  10.612  78.993  1.00 27.49 ? 24  LYS A O   1 
ATOM   172  C CB  . LYS A 1 37  ? 25.922  12.878  78.651  1.00 27.36 ? 24  LYS A CB  1 
ATOM   173  C CG  . LYS A 1 37  ? 24.454  12.743  78.276  1.00 33.10 ? 24  LYS A CG  1 
ATOM   174  C CD  . LYS A 1 37  ? 24.159  13.426  76.945  1.00 38.42 ? 24  LYS A CD  1 
ATOM   175  C CE  . LYS A 1 37  ? 24.431  14.922  77.012  1.00 42.42 ? 24  LYS A CE  1 
ATOM   176  N NZ  . LYS A 1 37  ? 24.122  15.606  75.723  1.00 45.05 ? 24  LYS A NZ  1 
ATOM   177  N N   . ARG A 1 38  ? 28.716  12.529  80.078  1.00 26.36 ? 25  ARG A N   1 
ATOM   178  C CA  . ARG A 1 38  ? 30.158  12.350  79.955  1.00 28.22 ? 25  ARG A CA  1 
ATOM   179  C C   . ARG A 1 38  ? 30.620  11.154  80.779  1.00 27.54 ? 25  ARG A C   1 
ATOM   180  O O   . ARG A 1 38  ? 31.449  10.365  80.329  1.00 28.43 ? 25  ARG A O   1 
ATOM   181  C CB  . ARG A 1 38  ? 30.917  13.606  80.386  1.00 30.22 ? 25  ARG A CB  1 
ATOM   182  C CG  . ARG A 1 38  ? 32.419  13.480  80.170  1.00 33.36 ? 25  ARG A CG  1 
ATOM   183  C CD  . ARG A 1 38  ? 33.173  14.763  80.460  1.00 36.56 ? 25  ARG A CD  1 
ATOM   184  N NE  . ARG A 1 38  ? 34.608  14.579  80.256  1.00 40.34 ? 25  ARG A NE  1 
ATOM   185  C CZ  . ARG A 1 38  ? 35.524  15.526  80.436  1.00 44.29 ? 25  ARG A CZ  1 
ATOM   186  N NH1 . ARG A 1 38  ? 36.804  15.259  80.223  1.00 50.30 ? 25  ARG A NH1 1 
ATOM   187  N NH2 . ARG A 1 38  ? 35.162  16.740  80.827  1.00 41.74 ? 25  ARG A NH2 1 
ATOM   188  N N   . LEU A 1 39  ? 30.073  11.025  81.984  1.00 24.87 ? 26  LEU A N   1 
ATOM   189  C CA  . LEU A 1 39  ? 30.409  9.910   82.861  1.00 23.78 ? 26  LEU A CA  1 
ATOM   190  C C   . LEU A 1 39  ? 29.962  8.588   82.258  1.00 27.09 ? 26  LEU A C   1 
ATOM   191  O O   . LEU A 1 39  ? 30.660  7.577   82.358  1.00 26.53 ? 26  LEU A O   1 
ATOM   192  C CB  . LEU A 1 39  ? 29.771  10.101  84.239  1.00 27.14 ? 26  LEU A CB  1 
ATOM   193  C CG  . LEU A 1 39  ? 30.461  11.126  85.141  1.00 27.17 ? 26  LEU A CG  1 
ATOM   194  C CD1 . LEU A 1 39  ? 29.643  11.366  86.402  1.00 23.14 ? 26  LEU A CD1 1 
ATOM   195  C CD2 . LEU A 1 39  ? 31.859  10.643  85.488  1.00 31.51 ? 26  LEU A CD2 1 
ATOM   196  N N   . TRP A 1 40  ? 28.794  8.604   81.625  1.00 23.85 ? 27  TRP A N   1 
ATOM   197  C CA  . TRP A 1 40  ? 28.246  7.406   81.008  1.00 24.01 ? 27  TRP A CA  1 
ATOM   198  C C   . TRP A 1 40  ? 29.111  6.947   79.846  1.00 25.81 ? 27  TRP A C   1 
ATOM   199  O O   . TRP A 1 40  ? 29.231  5.753   79.589  1.00 28.30 ? 27  TRP A O   1 
ATOM   200  C CB  . TRP A 1 40  ? 26.820  7.656   80.526  1.00 24.28 ? 27  TRP A CB  1 
ATOM   201  C CG  . TRP A 1 40  ? 26.053  6.401   80.249  1.00 24.81 ? 27  TRP A CG  1 
ATOM   202  C CD1 . TRP A 1 40  ? 25.548  5.995   79.048  1.00 25.67 ? 27  TRP A CD1 1 
ATOM   203  C CD2 . TRP A 1 40  ? 25.699  5.386   81.198  1.00 24.85 ? 27  TRP A CD2 1 
ATOM   204  N NE1 . TRP A 1 40  ? 24.897  4.794   79.192  1.00 26.57 ? 27  TRP A NE1 1 
ATOM   205  C CE2 . TRP A 1 40  ? 24.977  4.398   80.501  1.00 26.54 ? 27  TRP A CE2 1 
ATOM   206  C CE3 . TRP A 1 40  ? 25.922  5.219   82.568  1.00 22.81 ? 27  TRP A CE3 1 
ATOM   207  C CZ2 . TRP A 1 40  ? 24.473  3.261   81.130  1.00 26.29 ? 27  TRP A CZ2 1 
ATOM   208  C CZ3 . TRP A 1 40  ? 25.425  4.087   83.189  1.00 22.88 ? 27  TRP A CZ3 1 
ATOM   209  C CH2 . TRP A 1 40  ? 24.712  3.121   82.469  1.00 23.59 ? 27  TRP A CH2 1 
ATOM   210  N N   . ALA A 1 41  ? 29.707  7.907   79.146  1.00 26.81 ? 28  ALA A N   1 
ATOM   211  C CA  . ALA A 1 41  ? 30.563  7.610   78.004  1.00 30.17 ? 28  ALA A CA  1 
ATOM   212  C C   . ALA A 1 41  ? 31.881  6.969   78.431  1.00 37.03 ? 28  ALA A C   1 
ATOM   213  O O   . ALA A 1 41  ? 32.487  6.217   77.669  1.00 41.56 ? 28  ALA A O   1 
ATOM   214  C CB  . ALA A 1 41  ? 30.829  8.876   77.206  1.00 33.56 ? 28  ALA A CB  1 
ATOM   215  N N   . SER A 1 42  ? 32.323  7.271   79.648  1.00 38.20 ? 29  SER A N   1 
ATOM   216  C CA  . SER A 1 42  ? 33.610  6.783   80.137  1.00 43.52 ? 29  SER A CA  1 
ATOM   217  C C   . SER A 1 42  ? 33.451  5.787   81.284  1.00 43.56 ? 29  SER A C   1 
ATOM   218  O O   . SER A 1 42  ? 34.347  5.640   82.116  1.00 42.83 ? 29  SER A O   1 
ATOM   219  C CB  . SER A 1 42  ? 34.486  7.954   80.588  1.00 46.46 ? 29  SER A CB  1 
ATOM   220  O OG  . SER A 1 42  ? 33.922  8.609   81.713  1.00 46.47 ? 29  SER A OG  1 
ATOM   221  N N   . LYS A 1 43  ? 32.310  5.108   81.325  1.00 42.89 ? 30  LYS A N   1 
ATOM   222  C CA  . LYS A 1 43  ? 32.052  4.113   82.360  1.00 41.77 ? 30  LYS A CA  1 
ATOM   223  C C   . LYS A 1 43  ? 32.886  2.852   82.130  1.00 43.98 ? 30  LYS A C   1 
ATOM   224  O O   . LYS A 1 43  ? 33.237  2.533   80.992  1.00 43.96 ? 30  LYS A O   1 
ATOM   225  C CB  . LYS A 1 43  ? 30.562  3.755   82.402  1.00 37.15 ? 30  LYS A CB  1 
ATOM   226  C CG  . LYS A 1 43  ? 30.061  3.090   81.134  1.00 38.47 ? 30  LYS A CG  1 
ATOM   227  C CD  . LYS A 1 43  ? 28.595  2.704   81.224  1.00 39.22 ? 30  LYS A CD  1 
ATOM   228  C CE  . LYS A 1 43  ? 28.104  2.195   79.880  1.00 49.63 ? 30  LYS A CE  1 
ATOM   229  N NZ  . LYS A 1 43  ? 26.744  1.601   79.942  1.00 56.19 ? 30  LYS A NZ  1 
ATOM   230  N N   . PRO A 1 44  ? 33.212  2.132   83.216  1.00 40.54 ? 31  PRO A N   1 
ATOM   231  C CA  . PRO A 1 44  ? 33.906  0.844   83.135  1.00 37.39 ? 31  PRO A CA  1 
ATOM   232  C C   . PRO A 1 44  ? 32.983  -0.230  82.565  1.00 30.96 ? 31  PRO A C   1 
ATOM   233  O O   . PRO A 1 44  ? 31.777  0.001   82.483  1.00 31.32 ? 31  PRO A O   1 
ATOM   234  C CB  . PRO A 1 44  ? 34.268  0.555   84.594  1.00 40.24 ? 31  PRO A CB  1 
ATOM   235  C CG  . PRO A 1 44  ? 33.213  1.247   85.370  1.00 37.90 ? 31  PRO A CG  1 
ATOM   236  C CD  . PRO A 1 44  ? 32.946  2.516   84.611  1.00 38.27 ? 31  PRO A CD  1 
ATOM   237  N N   . PRO A 1 45  ? 33.539  -1.383  82.163  1.00 32.68 ? 32  PRO A N   1 
ATOM   238  C CA  . PRO A 1 45  ? 32.716  -2.448  81.577  1.00 33.63 ? 32  PRO A CA  1 
ATOM   239  C C   . PRO A 1 45  ? 31.651  -2.993  82.530  1.00 35.71 ? 32  PRO A C   1 
ATOM   240  O O   . PRO A 1 45  ? 30.576  -3.389  82.076  1.00 35.87 ? 32  PRO A O   1 
ATOM   241  C CB  . PRO A 1 45  ? 33.743  -3.534  81.239  1.00 34.77 ? 32  PRO A CB  1 
ATOM   242  C CG  . PRO A 1 45  ? 35.019  -2.789  81.049  1.00 40.37 ? 32  PRO A CG  1 
ATOM   243  C CD  . PRO A 1 45  ? 34.978  -1.688  82.064  1.00 38.40 ? 32  PRO A CD  1 
ATOM   244  N N   . VAL A 1 46  ? 31.943  -3.013  83.827  1.00 38.92 ? 33  VAL A N   1 
ATOM   245  C CA  . VAL A 1 46  ? 30.996  -3.538  84.807  1.00 40.12 ? 33  VAL A CA  1 
ATOM   246  C C   . VAL A 1 46  ? 30.208  -2.416  85.476  1.00 35.06 ? 33  VAL A C   1 
ATOM   247  O O   . VAL A 1 46  ? 30.778  -1.568  86.165  1.00 34.61 ? 33  VAL A O   1 
ATOM   248  C CB  . VAL A 1 46  ? 31.705  -4.374  85.890  1.00 45.64 ? 33  VAL A CB  1 
ATOM   249  C CG1 . VAL A 1 46  ? 30.699  -4.875  86.919  1.00 44.92 ? 33  VAL A CG1 1 
ATOM   250  C CG2 . VAL A 1 46  ? 32.449  -5.538  85.252  1.00 49.08 ? 33  VAL A CG2 1 
ATOM   251  N N   . VAL A 1 47  ? 28.894  -2.421  85.266  1.00 30.19 ? 34  VAL A N   1 
ATOM   252  C CA  . VAL A 1 47  ? 28.018  -1.389  85.810  1.00 26.71 ? 34  VAL A CA  1 
ATOM   253  C C   . VAL A 1 47  ? 26.814  -1.998  86.531  1.00 23.65 ? 34  VAL A C   1 
ATOM   254  O O   . VAL A 1 47  ? 26.081  -2.805  85.965  1.00 23.31 ? 34  VAL A O   1 
ATOM   255  C CB  . VAL A 1 47  ? 27.533  -0.441  84.700  1.00 27.84 ? 34  VAL A CB  1 
ATOM   256  C CG1 . VAL A 1 47  ? 26.424  0.455   85.206  1.00 22.21 ? 34  VAL A CG1 1 
ATOM   257  C CG2 . VAL A 1 47  ? 28.698  0.387   84.173  1.00 32.88 ? 34  VAL A CG2 1 
ATOM   258  N N   . MET A 1 48  ? 26.613  -1.596  87.781  1.00 17.54 ? 35  MET A N   1 
ATOM   259  C CA  . MET A 1 48  ? 25.596  -2.204  88.625  1.00 17.62 ? 35  MET A CA  1 
ATOM   260  C C   . MET A 1 48  ? 24.591  -1.181  89.144  1.00 15.09 ? 35  MET A C   1 
ATOM   261  O O   . MET A 1 48  ? 24.915  -0.016  89.329  1.00 14.64 ? 35  MET A O   1 
ATOM   262  C CB  . MET A 1 48  ? 26.270  -2.922  89.797  1.00 20.70 ? 35  MET A CB  1 
ATOM   263  C CG  . MET A 1 48  ? 25.332  -3.619  90.756  1.00 26.76 ? 35  MET A CG  1 
ATOM   264  S SD  . MET A 1 48  ? 26.230  -4.266  92.173  1.00 26.58 ? 35  MET A SD  1 
ATOM   265  C CE  . MET A 1 48  ? 27.211  -5.556  91.406  1.00 40.54 ? 35  MET A CE  1 
ATOM   266  N N   . THR A 1 49  ? 23.360  -1.627  89.366  1.00 14.40 ? 36  THR A N   1 
ATOM   267  C CA  . THR A 1 49  ? 22.379  -0.813  90.072  1.00 13.21 ? 36  THR A CA  1 
ATOM   268  C C   . THR A 1 49  ? 21.473  -1.768  90.846  1.00 13.70 ? 36  THR A C   1 
ATOM   269  O O   . THR A 1 49  ? 21.758  -2.960  90.912  1.00 14.74 ? 36  THR A O   1 
ATOM   270  C CB  . THR A 1 49  ? 21.577  0.087   89.113  1.00 13.53 ? 36  THR A CB  1 
ATOM   271  O OG1 . THR A 1 49  ? 20.858  1.071   89.869  1.00 14.02 ? 36  THR A OG1 1 
ATOM   272  C CG2 . THR A 1 49  ? 20.607  -0.739  88.268  1.00 15.22 ? 36  THR A CG2 1 
ATOM   273  N N   . SER A 1 50  ? 20.400  -1.262  91.446  1.00 13.19 ? 37  SER A N   1 
ATOM   274  C CA  . SER A 1 50  ? 19.521  -2.128  92.231  1.00 13.69 ? 37  SER A CA  1 
ATOM   275  C C   . SER A 1 50  ? 18.063  -1.981  91.820  1.00 13.41 ? 37  SER A C   1 
ATOM   276  O O   . SER A 1 50  ? 17.696  -1.025  91.136  1.00 11.66 ? 37  SER A O   1 
ATOM   277  C CB  . SER A 1 50  ? 19.652  -1.822  93.723  1.00 14.65 ? 37  SER A CB  1 
ATOM   278  O OG  . SER A 1 50  ? 18.950  -0.630  94.038  1.00 15.14 ? 37  SER A OG  1 
ATOM   279  N N   . ASN A 1 51  ? 17.235  -2.925  92.258  1.00 14.05 ? 38  ASN A N   1 
ATOM   280  C CA  . ASN A 1 51  ? 15.804  -2.853  92.003  1.00 13.93 ? 38  ASN A CA  1 
ATOM   281  C C   . ASN A 1 51  ? 15.184  -1.643  92.696  1.00 14.34 ? 38  ASN A C   1 
ATOM   282  O O   . ASN A 1 51  ? 14.326  -0.966  92.128  1.00 15.87 ? 38  ASN A O   1 
ATOM   283  C CB  . ASN A 1 51  ? 15.104  -4.149  92.443  1.00 16.16 ? 38  ASN A CB  1 
ATOM   284  C CG  . ASN A 1 51  ? 15.321  -4.477  93.916  1.00 19.14 ? 38  ASN A CG  1 
ATOM   285  O OD1 . ASN A 1 51  ? 16.405  -4.274  94.466  1.00 17.44 ? 38  ASN A OD1 1 
ATOM   286  N ND2 . ASN A 1 51  ? 14.282  -5.000  94.559  1.00 18.83 ? 38  ASN A ND2 1 
ATOM   287  N N   . HIS A 1 52  ? 15.631  -1.366  93.917  1.00 13.89 ? 39  HIS A N   1 
ATOM   288  C CA  . HIS A 1 52  ? 15.147  -0.209  94.663  1.00 14.70 ? 39  HIS A CA  1 
ATOM   289  C C   . HIS A 1 52  ? 15.487  1.103   93.952  1.00 12.42 ? 39  HIS A C   1 
ATOM   290  O O   . HIS A 1 52  ? 14.664  2.015   93.893  1.00 12.80 ? 39  HIS A O   1 
ATOM   291  C CB  . HIS A 1 52  ? 15.721  -0.206  96.085  1.00 16.63 ? 39  HIS A CB  1 
ATOM   292  C CG  . HIS A 1 52  ? 15.115  -1.240  96.982  1.00 19.44 ? 39  HIS A CG  1 
ATOM   293  N ND1 . HIS A 1 52  ? 13.913  -1.051  97.628  1.00 23.81 ? 39  HIS A ND1 1 
ATOM   294  C CD2 . HIS A 1 52  ? 15.543  -2.474  97.340  1.00 26.88 ? 39  HIS A CD2 1 
ATOM   295  C CE1 . HIS A 1 52  ? 13.627  -2.123  98.346  1.00 27.02 ? 39  HIS A CE1 1 
ATOM   296  N NE2 . HIS A 1 52  ? 14.601  -3.001  98.190  1.00 19.43 ? 39  HIS A NE2 1 
ATOM   297  N N   . VAL A 1 53  ? 16.694  1.193   93.406  1.00 11.92 ? 40  VAL A N   1 
ATOM   298  C CA  . VAL A 1 53  ? 17.104  2.390   92.677  1.00 11.20 ? 40  VAL A CA  1 
ATOM   299  C C   . VAL A 1 53  ? 16.267  2.574   91.412  1.00 10.75 ? 40  VAL A C   1 
ATOM   300  O O   . VAL A 1 53  ? 15.786  3.677   91.128  1.00 14.60 ? 40  VAL A O   1 
ATOM   301  C CB  . VAL A 1 53  ? 18.611  2.344   92.313  1.00 11.21 ? 40  VAL A CB  1 
ATOM   302  C CG1 . VAL A 1 53  ? 18.933  3.322   91.189  1.00 12.01 ? 40  VAL A CG1 1 
ATOM   303  C CG2 . VAL A 1 53  ? 19.459  2.645   93.538  1.00 12.79 ? 40  VAL A CG2 1 
ATOM   304  N N   . LEU A 1 54  ? 16.074  1.495   90.659  1.00 10.26 ? 41  LEU A N   1 
ATOM   305  C CA  . LEU A 1 54  ? 15.315  1.601   89.417  1.00 13.92 ? 41  LEU A CA  1 
ATOM   306  C C   . LEU A 1 54  ? 13.879  2.012   89.711  1.00 12.09 ? 41  LEU A C   1 
ATOM   307  O O   . LEU A 1 54  ? 13.307  2.841   89.007  1.00 12.89 ? 41  LEU A O   1 
ATOM   308  C CB  . LEU A 1 54  ? 15.349  0.287   88.635  1.00 13.78 ? 41  LEU A CB  1 
ATOM   309  C CG  . LEU A 1 54  ? 16.661  0.042   87.882  1.00 17.20 ? 41  LEU A CG  1 
ATOM   310  C CD1 . LEU A 1 54  ? 16.530  -1.166  86.958  1.00 21.89 ? 41  LEU A CD1 1 
ATOM   311  C CD2 . LEU A 1 54  ? 17.076  1.290   87.110  1.00 16.97 ? 41  LEU A CD2 1 
ATOM   312  N N   . GLY A 1 55  ? 13.314  1.451   90.774  1.00 13.91 ? 42  GLY A N   1 
ATOM   313  C CA  . GLY A 1 55  ? 11.962  1.791   91.175  1.00 13.95 ? 42  GLY A CA  1 
ATOM   314  C C   . GLY A 1 55  ? 11.832  3.259   91.530  1.00 15.91 ? 42  GLY A C   1 
ATOM   315  O O   . GLY A 1 55  ? 10.871  3.922   91.144  1.00 15.37 ? 42  GLY A O   1 
ATOM   316  N N   . GLU A 1 56  ? 12.809  3.771   92.269  1.00 12.82 ? 43  GLU A N   1 
ATOM   317  C CA  . GLU A 1 56  ? 12.814  5.174   92.649  1.00 14.73 ? 43  GLU A CA  1 
ATOM   318  C C   . GLU A 1 56  ? 12.963  6.037   91.401  1.00 15.24 ? 43  GLU A C   1 
ATOM   319  O O   . GLU A 1 56  ? 12.324  7.081   91.272  1.00 16.31 ? 43  GLU A O   1 
ATOM   320  C CB  . GLU A 1 56  ? 13.942  5.455   93.642  1.00 15.42 ? 43  GLU A CB  1 
ATOM   321  C CG  . GLU A 1 56  ? 13.901  6.835   94.281  1.00 19.91 ? 43  GLU A CG  1 
ATOM   322  C CD  . GLU A 1 56  ? 15.102  7.099   95.172  1.00 31.39 ? 43  GLU A CD  1 
ATOM   323  O OE1 . GLU A 1 56  ? 16.156  6.458   94.970  1.00 31.59 ? 43  GLU A OE1 1 
ATOM   324  O OE2 . GLU A 1 56  ? 14.991  7.947   96.083  1.00 40.24 ? 43  GLU A OE2 1 
ATOM   325  N N   . THR A 1 57  ? 13.804  5.582   90.479  1.00 14.45 ? 44  THR A N   1 
ATOM   326  C CA  . THR A 1 57  ? 14.043  6.300   89.234  1.00 13.13 ? 44  THR A CA  1 
ATOM   327  C C   . THR A 1 57  ? 12.768  6.388   88.402  1.00 14.88 ? 44  THR A C   1 
ATOM   328  O O   . THR A 1 57  ? 12.439  7.458   87.876  1.00 14.22 ? 44  THR A O   1 
ATOM   329  C CB  . THR A 1 57  ? 15.157  5.628   88.420  1.00 14.01 ? 44  THR A CB  1 
ATOM   330  O OG1 . THR A 1 57  ? 16.363  5.631   89.195  1.00 13.86 ? 44  THR A OG1 1 
ATOM   331  C CG2 . THR A 1 57  ? 15.394  6.372   87.111  1.00 15.69 ? 44  THR A CG2 1 
ATOM   332  N N   . TRP A 1 58  ? 12.043  5.274   88.304  1.00 10.73 ? 45  TRP A N   1 
ATOM   333  C CA  . TRP A 1 58  ? 10.737  5.281   87.646  1.00 15.62 ? 45  TRP A CA  1 
ATOM   334  C C   . TRP A 1 58  ? 9.857   6.381   88.210  1.00 15.90 ? 45  TRP A C   1 
ATOM   335  O O   . TRP A 1 58  ? 9.314   7.201   87.472  1.00 14.90 ? 45  TRP A O   1 
ATOM   336  C CB  . TRP A 1 58  ? 10.010  3.941   87.805  1.00 14.13 ? 45  TRP A CB  1 
ATOM   337  C CG  . TRP A 1 58  ? 8.545   4.067   87.467  1.00 15.87 ? 45  TRP A CG  1 
ATOM   338  C CD1 . TRP A 1 58  ? 7.533   4.448   88.310  1.00 13.55 ? 45  TRP A CD1 1 
ATOM   339  C CD2 . TRP A 1 58  ? 7.936   3.850   86.188  1.00 13.08 ? 45  TRP A CD2 1 
ATOM   340  N NE1 . TRP A 1 58  ? 6.340   4.481   87.633  1.00 14.63 ? 45  TRP A NE1 1 
ATOM   341  C CE2 . TRP A 1 58  ? 6.558   4.114   86.330  1.00 16.51 ? 45  TRP A CE2 1 
ATOM   342  C CE3 . TRP A 1 58  ? 8.422   3.452   84.938  1.00 13.63 ? 45  TRP A CE3 1 
ATOM   343  C CZ2 . TRP A 1 58  ? 5.661   3.989   85.273  1.00 15.46 ? 45  TRP A CZ2 1 
ATOM   344  C CZ3 . TRP A 1 58  ? 7.529   3.330   83.887  1.00 14.10 ? 45  TRP A CZ3 1 
ATOM   345  C CH2 . TRP A 1 58  ? 6.163   3.595   84.063  1.00 15.31 ? 45  TRP A CH2 1 
ATOM   346  N N   . THR A 1 59  ? 9.712   6.378   89.530  1.00 14.77 ? 46  THR A N   1 
ATOM   347  C CA  . THR A 1 59  ? 8.802   7.286   90.200  1.00 15.92 ? 46  THR A CA  1 
ATOM   348  C C   . THR A 1 59  ? 9.190   8.740   89.969  1.00 17.23 ? 46  THR A C   1 
ATOM   349  O O   . THR A 1 59  ? 8.336   9.589   89.705  1.00 17.60 ? 46  THR A O   1 
ATOM   350  C CB  . THR A 1 59  ? 8.756   6.988   91.706  1.00 21.54 ? 46  THR A CB  1 
ATOM   351  O OG1 . THR A 1 59  ? 8.283   5.649   91.894  1.00 17.47 ? 46  THR A OG1 1 
ATOM   352  C CG2 . THR A 1 59  ? 7.826   7.963   92.424  1.00 19.40 ? 46  THR A CG2 1 
ATOM   353  N N   . LEU A 1 60  ? 10.485  9.015   90.051  1.00 15.51 ? 47  LEU A N   1 
ATOM   354  C CA  . LEU A 1 60  ? 10.994  10.369  89.858  1.00 19.99 ? 47  LEU A CA  1 
ATOM   355  C C   . LEU A 1 60  ? 10.752  10.857  88.427  1.00 17.29 ? 47  LEU A C   1 
ATOM   356  O O   . LEU A 1 60  ? 10.235  11.954  88.213  1.00 18.31 ? 47  LEU A O   1 
ATOM   357  C CB  . LEU A 1 60  ? 12.485  10.419  90.193  1.00 24.20 ? 47  LEU A CB  1 
ATOM   358  C CG  . LEU A 1 60  ? 13.001  11.700  90.846  1.00 33.92 ? 47  LEU A CG  1 
ATOM   359  C CD1 . LEU A 1 60  ? 12.350  11.898  92.210  1.00 34.93 ? 47  LEU A CD1 1 
ATOM   360  C CD2 . LEU A 1 60  ? 14.520  11.672  90.966  1.00 36.83 ? 47  LEU A CD2 1 
ATOM   361  N N   . LEU A 1 61  ? 11.122  10.034  87.451  1.00 14.27 ? 48  LEU A N   1 
ATOM   362  C CA  . LEU A 1 61  ? 10.992  10.420  86.051  1.00 16.24 ? 48  LEU A CA  1 
ATOM   363  C C   . LEU A 1 61  ? 9.533   10.480  85.599  1.00 17.49 ? 48  LEU A C   1 
ATOM   364  O O   . LEU A 1 61  ? 9.168   11.319  84.773  1.00 18.31 ? 48  LEU A O   1 
ATOM   365  C CB  . LEU A 1 61  ? 11.781  9.457   85.162  1.00 17.86 ? 48  LEU A CB  1 
ATOM   366  C CG  . LEU A 1 61  ? 13.306  9.589   85.226  1.00 18.10 ? 48  LEU A CG  1 
ATOM   367  C CD1 . LEU A 1 61  ? 13.977  8.510   84.387  1.00 17.00 ? 48  LEU A CD1 1 
ATOM   368  C CD2 . LEU A 1 61  ? 13.738  10.972  84.761  1.00 22.12 ? 48  LEU A CD2 1 
ATOM   369  N N   . ASN A 1 62  ? 8.704   9.587   86.133  1.00 15.59 ? 49  ASN A N   1 
ATOM   370  C CA  . ASN A 1 62  ? 7.280   9.585   85.808  1.00 16.91 ? 49  ASN A CA  1 
ATOM   371  C C   . ASN A 1 62  ? 6.640   10.887  86.277  1.00 19.88 ? 49  ASN A C   1 
ATOM   372  O O   . ASN A 1 62  ? 5.826   11.484  85.575  1.00 22.86 ? 49  ASN A O   1 
ATOM   373  C CB  . ASN A 1 62  ? 6.582   8.379   86.444  1.00 16.48 ? 49  ASN A CB  1 
ATOM   374  C CG  . ASN A 1 62  ? 5.213   8.107   85.846  1.00 17.83 ? 49  ASN A CG  1 
ATOM   375  O OD1 . ASN A 1 62  ? 4.927   8.487   84.708  1.00 19.61 ? 49  ASN A OD1 1 
ATOM   376  N ND2 . ASN A 1 62  ? 4.352   7.449   86.619  1.00 18.51 ? 49  ASN A ND2 1 
ATOM   377  N N   . ARG A 1 63  ? 7.042   11.335  87.462  1.00 19.82 ? 50  ARG A N   1 
ATOM   378  C CA  . ARG A 1 63  ? 6.531   12.575  88.032  1.00 22.33 ? 50  ARG A CA  1 
ATOM   379  C C   . ARG A 1 63  ? 7.066   13.813  87.312  1.00 24.31 ? 50  ARG A C   1 
ATOM   380  O O   . ARG A 1 63  ? 6.328   14.772  87.075  1.00 27.85 ? 50  ARG A O   1 
ATOM   381  C CB  . ARG A 1 63  ? 6.881   12.651  89.520  1.00 27.49 ? 50  ARG A CB  1 
ATOM   382  C CG  . ARG A 1 63  ? 6.497   13.962  90.187  1.00 42.57 ? 50  ARG A CG  1 
ATOM   383  C CD  . ARG A 1 63  ? 6.908   13.974  91.651  1.00 54.24 ? 50  ARG A CD  1 
ATOM   384  N NE  . ARG A 1 63  ? 6.381   12.821  92.376  1.00 61.42 ? 50  ARG A NE  1 
ATOM   385  C CZ  . ARG A 1 63  ? 7.124   11.986  93.096  1.00 62.42 ? 50  ARG A CZ  1 
ATOM   386  N NH1 . ARG A 1 63  ? 8.434   12.174  93.189  1.00 63.72 ? 50  ARG A NH1 1 
ATOM   387  N NH2 . ARG A 1 63  ? 6.558   10.963  93.722  1.00 60.97 ? 50  ARG A NH2 1 
ATOM   388  N N   . ARG A 1 64  ? 8.347   13.787  86.962  1.00 23.57 ? 51  ARG A N   1 
ATOM   389  C CA  . ARG A 1 64  ? 9.011   14.960  86.399  1.00 26.63 ? 51  ARG A CA  1 
ATOM   390  C C   . ARG A 1 64  ? 8.836   15.095  84.891  1.00 28.74 ? 51  ARG A C   1 
ATOM   391  O O   . ARG A 1 64  ? 8.725   16.203  84.373  1.00 28.01 ? 51  ARG A O   1 
ATOM   392  C CB  . ARG A 1 64  ? 10.507  14.928  86.717  1.00 27.75 ? 51  ARG A CB  1 
ATOM   393  C CG  . ARG A 1 64  ? 10.859  15.167  88.170  1.00 32.77 ? 51  ARG A CG  1 
ATOM   394  C CD  . ARG A 1 64  ? 12.361  15.086  88.363  1.00 37.52 ? 51  ARG A CD  1 
ATOM   395  N NE  . ARG A 1 64  ? 12.755  15.237  89.760  1.00 44.47 ? 51  ARG A NE  1 
ATOM   396  C CZ  . ARG A 1 64  ? 13.995  15.066  90.204  1.00 45.79 ? 51  ARG A CZ  1 
ATOM   397  N NH1 . ARG A 1 64  ? 14.963  14.734  89.359  1.00 43.33 ? 51  ARG A NH1 1 
ATOM   398  N NH2 . ARG A 1 64  ? 14.270  15.224  91.492  1.00 46.48 ? 51  ARG A NH2 1 
ATOM   399  N N   . CYS A 1 65  ? 8.833   13.973  84.183  1.00 28.67 ? 52  CYS A N   1 
ATOM   400  C CA  . CYS A 1 65  ? 8.878   14.022  82.726  1.00 27.01 ? 52  CYS A CA  1 
ATOM   401  C C   . CYS A 1 65  ? 7.700   13.308  82.072  1.00 28.09 ? 52  CYS A C   1 
ATOM   402  O O   . CYS A 1 65  ? 7.320   13.634  80.950  1.00 34.97 ? 52  CYS A O   1 
ATOM   403  C CB  . CYS A 1 65  ? 10.193  13.423  82.223  1.00 24.48 ? 52  CYS A CB  1 
ATOM   404  S SG  . CYS A 1 65  ? 11.686  14.277  82.787  1.00 31.37 ? 52  CYS A SG  1 
ATOM   405  N N   . GLY A 1 66  ? 7.128   12.332  82.767  1.00 24.61 ? 53  GLY A N   1 
ATOM   406  C CA  . GLY A 1 66  ? 5.974   11.622  82.245  1.00 27.24 ? 53  GLY A CA  1 
ATOM   407  C C   . GLY A 1 66  ? 6.220   10.149  81.986  1.00 21.46 ? 53  GLY A C   1 
ATOM   408  O O   . GLY A 1 66  ? 7.330   9.650   82.162  1.00 21.78 ? 53  GLY A O   1 
ATOM   409  N N   . HIS A 1 67  ? 5.173   9.459   81.549  1.00 21.22 ? 54  HIS A N   1 
ATOM   410  C CA  . HIS A 1 67  ? 5.194   8.006   81.417  1.00 22.03 ? 54  HIS A CA  1 
ATOM   411  C C   . HIS A 1 67  ? 6.240   7.497   80.426  1.00 21.01 ? 54  HIS A C   1 
ATOM   412  O O   . HIS A 1 67  ? 6.942   6.528   80.706  1.00 19.05 ? 54  HIS A O   1 
ATOM   413  C CB  . HIS A 1 67  ? 3.809   7.502   81.002  1.00 22.50 ? 54  HIS A CB  1 
ATOM   414  C CG  . HIS A 1 67  ? 3.693   6.011   80.980  1.00 23.35 ? 54  HIS A CG  1 
ATOM   415  N ND1 . HIS A 1 67  ? 3.923   5.264   79.845  1.00 24.35 ? 54  HIS A ND1 1 
ATOM   416  C CD2 . HIS A 1 67  ? 3.376   5.126   81.955  1.00 24.47 ? 54  HIS A CD2 1 
ATOM   417  C CE1 . HIS A 1 67  ? 3.749   3.983   80.120  1.00 26.13 ? 54  HIS A CE1 1 
ATOM   418  N NE2 . HIS A 1 67  ? 3.420   3.872   81.395  1.00 25.19 ? 54  HIS A NE2 1 
ATOM   419  N N   . ARG A 1 68  ? 6.336   8.145   79.270  1.00 24.50 ? 55  ARG A N   1 
ATOM   420  C CA  . ARG A 1 68  ? 7.256   7.700   78.227  1.00 25.84 ? 55  ARG A CA  1 
ATOM   421  C C   . ARG A 1 68  ? 8.702   7.751   78.709  1.00 27.16 ? 55  ARG A C   1 
ATOM   422  O O   . ARG A 1 68  ? 9.497   6.850   78.433  1.00 24.87 ? 55  ARG A O   1 
ATOM   423  C CB  . ARG A 1 68  ? 7.091   8.551   76.967  1.00 30.17 ? 55  ARG A CB  1 
ATOM   424  C CG  . ARG A 1 68  ? 7.155   7.759   75.673  1.00 36.65 ? 55  ARG A CG  1 
ATOM   425  C CD  . ARG A 1 68  ? 7.215   8.684   74.467  1.00 44.13 ? 55  ARG A CD  1 
ATOM   426  N NE  . ARG A 1 68  ? 8.503   9.363   74.384  1.00 50.03 ? 55  ARG A NE  1 
ATOM   427  C CZ  . ARG A 1 68  ? 9.438   9.082   73.483  1.00 53.42 ? 55  ARG A CZ  1 
ATOM   428  N NH1 . ARG A 1 68  ? 9.223   8.141   72.574  1.00 56.05 ? 55  ARG A NH1 1 
ATOM   429  N NH2 . ARG A 1 68  ? 10.586  9.747   73.484  1.00 52.56 ? 55  ARG A NH2 1 
ATOM   430  N N   . ALA A 1 69  ? 9.036   8.805   79.445  1.00 23.75 ? 56  ALA A N   1 
ATOM   431  C CA  . ALA A 1 69  ? 10.382  8.962   79.979  1.00 23.10 ? 56  ALA A CA  1 
ATOM   432  C C   . ALA A 1 69  ? 10.672  7.922   81.055  1.00 24.82 ? 56  ALA A C   1 
ATOM   433  O O   . ALA A 1 69  ? 11.792  7.421   81.169  1.00 19.78 ? 56  ALA A O   1 
ATOM   434  C CB  . ALA A 1 69  ? 10.565  10.358  80.532  1.00 23.13 ? 56  ALA A CB  1 
ATOM   435  N N   . ALA A 1 70  ? 9.653   7.603   81.844  1.00 22.33 ? 57  ALA A N   1 
ATOM   436  C CA  . ALA A 1 70  ? 9.797   6.634   82.923  1.00 17.78 ? 57  ALA A CA  1 
ATOM   437  C C   . ALA A 1 70  ? 9.968   5.217   82.374  1.00 15.25 ? 57  ALA A C   1 
ATOM   438  O O   . ALA A 1 70  ? 10.669  4.397   82.964  1.00 17.27 ? 57  ALA A O   1 
ATOM   439  C CB  . ALA A 1 70  ? 8.600   6.708   83.856  1.00 19.99 ? 57  ALA A CB  1 
ATOM   440  N N   . VAL A 1 71  ? 9.341   4.935   81.236  1.00 16.18 ? 58  VAL A N   1 
ATOM   441  C CA  . VAL A 1 71  ? 9.479   3.625   80.603  1.00 19.16 ? 58  VAL A CA  1 
ATOM   442  C C   . VAL A 1 71  ? 10.945  3.360   80.247  1.00 19.23 ? 58  VAL A C   1 
ATOM   443  O O   . VAL A 1 71  ? 11.425  2.227   80.334  1.00 16.54 ? 58  VAL A O   1 
ATOM   444  C CB  . VAL A 1 71  ? 8.585   3.514   79.353  1.00 21.36 ? 58  VAL A CB  1 
ATOM   445  C CG1 . VAL A 1 71  ? 8.937   2.282   78.531  1.00 26.73 ? 58  VAL A CG1 1 
ATOM   446  C CG2 . VAL A 1 71  ? 7.128   3.472   79.767  1.00 20.20 ? 58  VAL A CG2 1 
ATOM   447  N N   . ALA A 1 72  ? 11.660  4.419   79.881  1.00 20.42 ? 59  ALA A N   1 
ATOM   448  C CA  . ALA A 1 72  ? 13.091  4.315   79.612  1.00 21.53 ? 59  ALA A CA  1 
ATOM   449  C C   . ALA A 1 72  ? 13.833  3.770   80.828  1.00 23.22 ? 59  ALA A C   1 
ATOM   450  O O   . ALA A 1 72  ? 14.739  2.946   80.702  1.00 24.14 ? 59  ALA A O   1 
ATOM   451  C CB  . ALA A 1 72  ? 13.651  5.663   79.211  1.00 24.69 ? 59  ALA A CB  1 
ATOM   452  N N   . ALA A 1 73  ? 13.431  4.230   82.007  1.00 20.96 ? 60  ALA A N   1 
ATOM   453  C CA  . ALA A 1 73  ? 14.012  3.754   83.252  1.00 21.37 ? 60  ALA A CA  1 
ATOM   454  C C   . ALA A 1 73  ? 13.641  2.295   83.502  1.00 22.00 ? 60  ALA A C   1 
ATOM   455  O O   . ALA A 1 73  ? 14.466  1.505   83.958  1.00 20.90 ? 60  ALA A O   1 
ATOM   456  C CB  . ALA A 1 73  ? 13.559  4.625   84.411  1.00 21.94 ? 60  ALA A CB  1 
ATOM   457  N N   . ALA A 1 74  ? 12.395  1.944   83.196  1.00 19.06 ? 61  ALA A N   1 
ATOM   458  C CA  . ALA A 1 74  ? 11.927  0.575   83.356  1.00 15.54 ? 61  ALA A CA  1 
ATOM   459  C C   . ALA A 1 74  ? 12.764  -0.387  82.515  1.00 18.35 ? 61  ALA A C   1 
ATOM   460  O O   . ALA A 1 74  ? 13.069  -1.502  82.938  1.00 19.79 ? 61  ALA A O   1 
ATOM   461  C CB  . ALA A 1 74  ? 10.449  0.472   82.978  1.00 17.42 ? 61  ALA A CB  1 
ATOM   462  N N   . ALA A 1 75  ? 13.154  0.066   81.328  1.00 16.42 ? 62  ALA A N   1 
ATOM   463  C CA  . ALA A 1 75  ? 13.847  -0.784  80.370  1.00 14.93 ? 62  ALA A CA  1 
ATOM   464  C C   . ALA A 1 75  ? 15.272  -1.133  80.802  1.00 16.97 ? 62  ALA A C   1 
ATOM   465  O O   . ALA A 1 75  ? 15.865  -2.081  80.287  1.00 16.75 ? 62  ALA A O   1 
ATOM   466  C CB  . ALA A 1 75  ? 13.868  -0.118  79.022  1.00 16.10 ? 62  ALA A CB  1 
ATOM   467  N N   . ILE A 1 76  ? 15.821  -0.365  81.736  1.00 18.35 ? 63  ILE A N   1 
ATOM   468  C CA  . ILE A 1 76  ? 17.160  -0.637  82.252  1.00 18.43 ? 63  ILE A CA  1 
ATOM   469  C C   . ILE A 1 76  ? 17.222  -2.040  82.857  1.00 19.03 ? 63  ILE A C   1 
ATOM   470  O O   . ILE A 1 76  ? 18.232  -2.735  82.738  1.00 19.71 ? 63  ILE A O   1 
ATOM   471  C CB  . ILE A 1 76  ? 17.581  0.413   83.305  1.00 18.17 ? 63  ILE A CB  1 
ATOM   472  C CG1 . ILE A 1 76  ? 17.657  1.796   82.662  1.00 18.72 ? 63  ILE A CG1 1 
ATOM   473  C CG2 . ILE A 1 76  ? 18.927  0.053   83.921  1.00 18.31 ? 63  ILE A CG2 1 
ATOM   474  C CD1 . ILE A 1 76  ? 17.915  2.925   83.642  1.00 17.84 ? 63  ILE A CD1 1 
ATOM   475  N N   . ARG A 1 77  ? 16.122  -2.472  83.467  1.00 17.95 ? 64  ARG A N   1 
ATOM   476  C CA  . ARG A 1 77  ? 16.061  -3.798  84.075  1.00 17.13 ? 64  ARG A CA  1 
ATOM   477  C C   . ARG A 1 77  ? 16.252  -4.901  83.039  1.00 19.90 ? 64  ARG A C   1 
ATOM   478  O O   . ARG A 1 77  ? 16.584  -6.035  83.387  1.00 23.48 ? 64  ARG A O   1 
ATOM   479  C CB  . ARG A 1 77  ? 14.730  -3.998  84.804  1.00 18.46 ? 64  ARG A CB  1 
ATOM   480  C CG  . ARG A 1 77  ? 13.606  -4.529  83.923  1.00 17.12 ? 64  ARG A CG  1 
ATOM   481  C CD  . ARG A 1 77  ? 12.264  -4.463  84.643  1.00 15.59 ? 64  ARG A CD  1 
ATOM   482  N NE  . ARG A 1 77  ? 11.199  -5.127  83.898  1.00 16.62 ? 64  ARG A NE  1 
ATOM   483  C CZ  . ARG A 1 77  ? 10.561  -4.586  82.865  1.00 20.23 ? 64  ARG A CZ  1 
ATOM   484  N NH1 . ARG A 1 77  ? 10.883  -3.370  82.446  1.00 18.23 ? 64  ARG A NH1 1 
ATOM   485  N NH2 . ARG A 1 77  ? 9.604   -5.263  82.245  1.00 18.67 ? 64  ARG A NH2 1 
ATOM   486  N N   . LEU A 1 78  ? 16.043  -4.561  81.768  1.00 20.05 ? 65  LEU A N   1 
ATOM   487  C CA  . LEU A 1 78  ? 16.168  -5.514  80.671  1.00 20.30 ? 65  LEU A CA  1 
ATOM   488  C C   . LEU A 1 78  ? 17.572  -5.520  80.074  1.00 20.95 ? 65  LEU A C   1 
ATOM   489  O O   . LEU A 1 78  ? 17.881  -6.333  79.202  1.00 24.12 ? 65  LEU A O   1 
ATOM   490  C CB  . LEU A 1 78  ? 15.157  -5.197  79.565  1.00 24.55 ? 65  LEU A CB  1 
ATOM   491  C CG  . LEU A 1 78  ? 13.694  -4.951  79.944  1.00 24.95 ? 65  LEU A CG  1 
ATOM   492  C CD1 . LEU A 1 78  ? 12.899  -4.584  78.706  1.00 27.31 ? 65  LEU A CD1 1 
ATOM   493  C CD2 . LEU A 1 78  ? 13.095  -6.173  80.607  1.00 23.68 ? 65  LEU A CD2 1 
ATOM   494  N N   . SER A 1 79  ? 18.416  -4.607  80.540  1.00 21.13 ? 66  SER A N   1 
ATOM   495  C CA  . SER A 1 79  ? 19.737  -4.416  79.944  1.00 22.67 ? 66  SER A CA  1 
ATOM   496  C C   . SER A 1 79  ? 20.637  -5.630  80.121  1.00 19.11 ? 66  SER A C   1 
ATOM   497  O O   . SER A 1 79  ? 20.612  -6.294  81.156  1.00 19.89 ? 66  SER A O   1 
ATOM   498  C CB  . SER A 1 79  ? 20.421  -3.187  80.539  1.00 23.21 ? 66  SER A CB  1 
ATOM   499  O OG  . SER A 1 79  ? 21.714  -3.020  79.986  1.00 23.48 ? 66  SER A OG  1 
ATOM   500  N N   . THR A 1 80  ? 21.430  -5.911  79.096  1.00 20.83 ? 67  THR A N   1 
ATOM   501  C CA  . THR A 1 80  ? 22.409  -6.985  79.158  1.00 25.78 ? 67  THR A CA  1 
ATOM   502  C C   . THR A 1 80  ? 23.747  -6.468  79.676  1.00 26.92 ? 67  THR A C   1 
ATOM   503  O O   . THR A 1 80  ? 24.656  -7.249  79.957  1.00 30.74 ? 67  THR A O   1 
ATOM   504  C CB  . THR A 1 80  ? 22.622  -7.626  77.779  1.00 27.45 ? 67  THR A CB  1 
ATOM   505  O OG1 . THR A 1 80  ? 22.942  -6.600  76.831  1.00 27.90 ? 67  THR A OG1 1 
ATOM   506  C CG2 . THR A 1 80  ? 21.365  -8.369  77.320  1.00 25.08 ? 67  THR A CG2 1 
ATOM   507  N N   . VAL A 1 81  ? 23.865  -5.148  79.803  1.00 22.33 ? 68  VAL A N   1 
ATOM   508  C CA  . VAL A 1 81  ? 25.141  -4.539  80.167  1.00 25.45 ? 68  VAL A CA  1 
ATOM   509  C C   . VAL A 1 81  ? 25.073  -3.770  81.480  1.00 26.20 ? 68  VAL A C   1 
ATOM   510  O O   . VAL A 1 81  ? 26.091  -3.291  81.978  1.00 30.53 ? 68  VAL A O   1 
ATOM   511  C CB  . VAL A 1 81  ? 25.650  -3.596  79.059  1.00 30.01 ? 68  VAL A CB  1 
ATOM   512  C CG1 . VAL A 1 81  ? 25.919  -4.384  77.786  1.00 33.03 ? 68  VAL A CG1 1 
ATOM   513  C CG2 . VAL A 1 81  ? 24.649  -2.486  78.799  1.00 30.96 ? 68  VAL A CG2 1 
ATOM   514  N N   . VAL A 1 82  ? 23.873  -3.646  82.033  1.00 22.52 ? 69  VAL A N   1 
ATOM   515  C CA  . VAL A 1 82  ? 23.711  -3.139  83.389  1.00 19.86 ? 69  VAL A CA  1 
ATOM   516  C C   . VAL A 1 82  ? 23.251  -4.284  84.277  1.00 22.84 ? 69  VAL A C   1 
ATOM   517  O O   . VAL A 1 82  ? 22.247  -4.933  83.989  1.00 23.93 ? 69  VAL A O   1 
ATOM   518  C CB  . VAL A 1 82  ? 22.692  -1.979  83.467  1.00 19.06 ? 69  VAL A CB  1 
ATOM   519  C CG1 . VAL A 1 82  ? 22.552  -1.481  84.915  1.00 19.16 ? 69  VAL A CG1 1 
ATOM   520  C CG2 . VAL A 1 82  ? 23.102  -0.847  82.537  1.00 19.80 ? 69  VAL A CG2 1 
ATOM   521  N N   . ARG A 1 83  ? 23.992  -4.547  85.346  1.00 22.05 ? 70  ARG A N   1 
ATOM   522  C CA  . ARG A 1 83  ? 23.603  -5.603  86.274  1.00 24.52 ? 70  ARG A CA  1 
ATOM   523  C C   . ARG A 1 83  ? 22.662  -5.043  87.331  1.00 23.27 ? 70  ARG A C   1 
ATOM   524  O O   . ARG A 1 83  ? 23.043  -4.180  88.118  1.00 25.35 ? 70  ARG A O   1 
ATOM   525  C CB  . ARG A 1 83  ? 24.828  -6.237  86.935  1.00 29.71 ? 70  ARG A CB  1 
ATOM   526  C CG  . ARG A 1 83  ? 24.530  -7.561  87.627  1.00 39.48 ? 70  ARG A CG  1 
ATOM   527  C CD  . ARG A 1 83  ? 25.741  -8.078  88.386  1.00 49.66 ? 70  ARG A CD  1 
ATOM   528  N NE  . ARG A 1 83  ? 25.639  -9.503  88.691  1.00 56.75 ? 70  ARG A NE  1 
ATOM   529  C CZ  . ARG A 1 83  ? 26.412  -10.440 88.149  1.00 65.29 ? 70  ARG A CZ  1 
ATOM   530  N NH1 . ARG A 1 83  ? 27.346  -10.104 87.268  1.00 69.38 ? 70  ARG A NH1 1 
ATOM   531  N NH2 . ARG A 1 83  ? 26.251  -11.713 88.485  1.00 68.53 ? 70  ARG A NH2 1 
ATOM   532  N N   . VAL A 1 84  ? 21.430  -5.534  87.343  1.00 20.07 ? 71  VAL A N   1 
ATOM   533  C CA  . VAL A 1 84  ? 20.439  -5.059  88.298  1.00 18.60 ? 71  VAL A CA  1 
ATOM   534  C C   . VAL A 1 84  ? 20.314  -6.042  89.451  1.00 21.66 ? 71  VAL A C   1 
ATOM   535  O O   . VAL A 1 84  ? 19.799  -7.146  89.285  1.00 24.76 ? 71  VAL A O   1 
ATOM   536  C CB  . VAL A 1 84  ? 19.061  -4.862  87.642  1.00 20.57 ? 71  VAL A CB  1 
ATOM   537  C CG1 . VAL A 1 84  ? 18.103  -4.174  88.608  1.00 18.46 ? 71  VAL A CG1 1 
ATOM   538  C CG2 . VAL A 1 84  ? 19.200  -4.057  86.355  1.00 25.03 ? 71  VAL A CG2 1 
ATOM   539  N N   . GLU A 1 85  ? 20.794  -5.634  90.620  1.00 15.39 ? 72  GLU A N   1 
ATOM   540  C CA  . GLU A 1 85  ? 20.761  -6.487  91.798  1.00 18.33 ? 72  GLU A CA  1 
ATOM   541  C C   . GLU A 1 85  ? 19.416  -6.384  92.515  1.00 15.23 ? 72  GLU A C   1 
ATOM   542  O O   . GLU A 1 85  ? 18.940  -5.289  92.807  1.00 14.43 ? 72  GLU A O   1 
ATOM   543  C CB  . GLU A 1 85  ? 21.897  -6.115  92.757  1.00 19.19 ? 72  GLU A CB  1 
ATOM   544  C CG  . GLU A 1 85  ? 22.232  -7.180  93.785  1.00 30.50 ? 72  GLU A CG  1 
ATOM   545  C CD  . GLU A 1 85  ? 22.977  -8.361  93.186  1.00 36.10 ? 72  GLU A CD  1 
ATOM   546  O OE1 . GLU A 1 85  ? 23.516  -8.229  92.067  1.00 38.25 ? 72  GLU A OE1 1 
ATOM   547  O OE2 . GLU A 1 85  ? 23.023  -9.422  93.840  1.00 45.49 ? 72  GLU A OE2 1 
ATOM   548  N N   . HIS A 1 86  ? 18.797  -7.529  92.775  1.00 17.23 ? 73  HIS A N   1 
ATOM   549  C CA  . HIS A 1 86  ? 17.625  -7.567  93.630  1.00 18.82 ? 73  HIS A CA  1 
ATOM   550  C C   . HIS A 1 86  ? 18.102  -7.582  95.076  1.00 20.47 ? 73  HIS A C   1 
ATOM   551  O O   . HIS A 1 86  ? 18.724  -8.547  95.519  1.00 20.40 ? 73  HIS A O   1 
ATOM   552  C CB  . HIS A 1 86  ? 16.757  -8.791  93.327  1.00 18.99 ? 73  HIS A CB  1 
ATOM   553  C CG  . HIS A 1 86  ? 15.543  -8.899  94.196  1.00 21.94 ? 73  HIS A CG  1 
ATOM   554  N ND1 . HIS A 1 86  ? 14.291  -8.498  93.781  1.00 20.97 ? 73  HIS A ND1 1 
ATOM   555  C CD2 . HIS A 1 86  ? 15.389  -9.358  95.462  1.00 20.85 ? 73  HIS A CD2 1 
ATOM   556  C CE1 . HIS A 1 86  ? 13.419  -8.708  94.751  1.00 22.04 ? 73  HIS A CE1 1 
ATOM   557  N NE2 . HIS A 1 86  ? 14.060  -9.229  95.781  1.00 20.97 ? 73  HIS A NE2 1 
ATOM   558  N N   . VAL A 1 87  ? 17.835  -6.501  95.801  1.00 15.95 ? 74  VAL A N   1 
ATOM   559  C CA  . VAL A 1 87  ? 18.260  -6.412  97.190  1.00 17.09 ? 74  VAL A CA  1 
ATOM   560  C C   . VAL A 1 87  ? 17.544  -7.469  98.021  1.00 18.37 ? 74  VAL A C   1 
ATOM   561  O O   . VAL A 1 87  ? 16.314  -7.494  98.091  1.00 19.13 ? 74  VAL A O   1 
ATOM   562  C CB  . VAL A 1 87  ? 17.996  -5.015  97.777  1.00 17.65 ? 74  VAL A CB  1 
ATOM   563  C CG1 . VAL A 1 87  ? 18.478  -4.946  99.217  1.00 18.24 ? 74  VAL A CG1 1 
ATOM   564  C CG2 . VAL A 1 87  ? 18.683  -3.948  96.924  1.00 13.93 ? 74  VAL A CG2 1 
ATOM   565  N N   . THR A 1 88  ? 18.323  -8.352  98.635  1.00 15.33 ? 75  THR A N   1 
ATOM   566  C CA  . THR A 1 88  ? 17.765  -9.449  99.415  1.00 20.14 ? 75  THR A CA  1 
ATOM   567  C C   . THR A 1 88  ? 17.213  -8.946  100.741 1.00 19.66 ? 75  THR A C   1 
ATOM   568  O O   . THR A 1 88  ? 17.519  -7.833  101.168 1.00 18.45 ? 75  THR A O   1 
ATOM   569  C CB  . THR A 1 88  ? 18.813  -10.532 99.704  1.00 25.42 ? 75  THR A CB  1 
ATOM   570  O OG1 . THR A 1 88  ? 19.877  -9.962  100.476 1.00 22.68 ? 75  THR A OG1 1 
ATOM   571  C CG2 . THR A 1 88  ? 19.372  -11.114 98.405  1.00 25.72 ? 75  THR A CG2 1 
ATOM   572  N N   . ALA A 1 89  ? 16.405  -9.777  101.388 1.00 19.40 ? 76  ALA A N   1 
ATOM   573  C CA  . ALA A 1 89  ? 15.867  -9.453  102.702 1.00 22.75 ? 76  ALA A CA  1 
ATOM   574  C C   . ALA A 1 89  ? 16.992  -9.199  103.706 1.00 20.13 ? 76  ALA A C   1 
ATOM   575  O O   . ALA A 1 89  ? 16.892  -8.309  104.551 1.00 20.73 ? 76  ALA A O   1 
ATOM   576  C CB  . ALA A 1 89  ? 14.958  -10.576 103.194 1.00 25.19 ? 76  ALA A CB  1 
ATOM   577  N N   . ASP A 1 90  ? 18.063  -9.980  103.599 1.00 24.77 ? 77  ASP A N   1 
ATOM   578  C CA  . ASP A 1 90  ? 19.194  -9.858  104.516 1.00 24.32 ? 77  ASP A CA  1 
ATOM   579  C C   . ASP A 1 90  ? 19.931  -8.537  104.327 1.00 21.48 ? 77  ASP A C   1 
ATOM   580  O O   . ASP A 1 90  ? 20.343  -7.910  105.301 1.00 20.48 ? 77  ASP A O   1 
ATOM   581  C CB  . ASP A 1 90  ? 20.167  -11.028 104.341 1.00 28.88 ? 77  ASP A CB  1 
ATOM   582  C CG  . ASP A 1 90  ? 19.609  -12.335 104.872 1.00 35.13 ? 77  ASP A CG  1 
ATOM   583  O OD1 . ASP A 1 90  ? 18.759  -12.292 105.788 1.00 34.65 ? 77  ASP A OD1 1 
ATOM   584  O OD2 . ASP A 1 90  ? 20.029  -13.406 104.385 1.00 40.09 ? 77  ASP A OD2 1 
ATOM   585  N N   . LEU A 1 91  ? 20.096  -8.110  103.079 1.00 20.52 ? 78  LEU A N   1 
ATOM   586  C CA  . LEU A 1 91  ? 20.735  -6.828  102.813 1.00 21.27 ? 78  LEU A CA  1 
ATOM   587  C C   . LEU A 1 91  ? 19.857  -5.678  103.288 1.00 17.92 ? 78  LEU A C   1 
ATOM   588  O O   . LEU A 1 91  ? 20.360  -4.666  103.776 1.00 19.57 ? 78  LEU A O   1 
ATOM   589  C CB  . LEU A 1 91  ? 21.055  -6.673  101.324 1.00 25.51 ? 78  LEU A CB  1 
ATOM   590  C CG  . LEU A 1 91  ? 22.437  -7.175  100.897 1.00 33.26 ? 78  LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 91  ? 22.750  -6.769  99.469  1.00 31.97 ? 78  LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 91  ? 23.504  -6.657  101.845 1.00 40.31 ? 78  LEU A CD2 1 
ATOM   593  N N   . GLU A 1 92  ? 18.544  -5.832  103.153 1.00 16.25 ? 79  GLU A N   1 
ATOM   594  C CA  . GLU A 1 92  ? 17.625  -4.831  103.681 1.00 16.27 ? 79  GLU A CA  1 
ATOM   595  C C   . GLU A 1 92  ? 17.739  -4.752  105.204 1.00 17.74 ? 79  GLU A C   1 
ATOM   596  O O   . GLU A 1 92  ? 17.707  -3.667  105.778 1.00 16.98 ? 79  GLU A O   1 
ATOM   597  C CB  . GLU A 1 92  ? 16.181  -5.133  103.261 1.00 15.50 ? 79  GLU A CB  1 
ATOM   598  C CG  . GLU A 1 92  ? 15.903  -4.847  101.785 1.00 18.11 ? 79  GLU A CG  1 
ATOM   599  C CD  . GLU A 1 92  ? 14.448  -5.074  101.397 1.00 23.75 ? 79  GLU A CD  1 
ATOM   600  O OE1 . GLU A 1 92  ? 13.676  -5.558  102.243 1.00 26.60 ? 79  GLU A OE1 1 
ATOM   601  O OE2 . GLU A 1 92  ? 14.084  -4.766  100.246 1.00 22.13 ? 79  GLU A OE2 1 
ATOM   602  N N   . GLU A 1 93  ? 17.883  -5.900  105.857 1.00 16.84 ? 80  GLU A N   1 
ATOM   603  C CA  . GLU A 1 93  ? 18.051  -5.912  107.307 1.00 22.12 ? 80  GLU A CA  1 
ATOM   604  C C   . GLU A 1 93  ? 19.328  -5.175  107.723 1.00 16.97 ? 80  GLU A C   1 
ATOM   605  O O   . GLU A 1 93  ? 19.332  -4.436  108.709 1.00 18.30 ? 80  GLU A O   1 
ATOM   606  C CB  . GLU A 1 93  ? 18.066  -7.348  107.838 1.00 20.83 ? 80  GLU A CB  1 
ATOM   607  C CG  . GLU A 1 93  ? 18.284  -7.457  109.341 1.00 26.95 ? 80  GLU A CG  1 
ATOM   608  C CD  . GLU A 1 93  ? 17.184  -6.796  110.158 1.00 29.01 ? 80  GLU A CD  1 
ATOM   609  O OE1 . GLU A 1 93  ? 17.464  -6.401  111.310 1.00 29.26 ? 80  GLU A OE1 1 
ATOM   610  O OE2 . GLU A 1 93  ? 16.043  -6.673  109.662 1.00 24.99 ? 80  GLU A OE2 1 
ATOM   611  N N   . GLN A 1 94  ? 20.408  -5.372  106.970 1.00 17.90 ? 81  GLN A N   1 
ATOM   612  C CA  . GLN A 1 94  ? 21.653  -4.661  107.248 1.00 20.15 ? 81  GLN A CA  1 
ATOM   613  C C   . GLN A 1 94  ? 21.453  -3.163  107.058 1.00 19.40 ? 81  GLN A C   1 
ATOM   614  O O   . GLN A 1 94  ? 21.964  -2.355  107.835 1.00 19.70 ? 81  GLN A O   1 
ATOM   615  C CB  . GLN A 1 94  ? 22.790  -5.154  106.348 1.00 25.00 ? 81  GLN A CB  1 
ATOM   616  C CG  . GLN A 1 94  ? 23.167  -6.616  106.530 1.00 35.03 ? 81  GLN A CG  1 
ATOM   617  C CD  . GLN A 1 94  ? 24.291  -7.042  105.602 1.00 50.56 ? 81  GLN A CD  1 
ATOM   618  O OE1 . GLN A 1 94  ? 25.196  -6.260  105.306 1.00 54.45 ? 81  GLN A OE1 1 
ATOM   619  N NE2 . GLN A 1 94  ? 24.239  -8.287  105.137 1.00 57.33 ? 81  GLN A NE2 1 
ATOM   620  N N   . ALA A 1 95  ? 20.703  -2.800  106.020 1.00 15.08 ? 82  ALA A N   1 
ATOM   621  C CA  . ALA A 1 95  ? 20.401  -1.400  105.743 1.00 14.60 ? 82  ALA A CA  1 
ATOM   622  C C   . ALA A 1 95  ? 19.568  -0.774  106.865 1.00 15.92 ? 82  ALA A C   1 
ATOM   623  O O   . ALA A 1 95  ? 19.815  0.358   107.271 1.00 17.17 ? 82  ALA A O   1 
ATOM   624  C CB  . ALA A 1 95  ? 19.683  -1.268  104.410 1.00 13.41 ? 82  ALA A CB  1 
ATOM   625  N N   . TRP A 1 96  ? 18.587  -1.518  107.364 1.00 13.70 ? 83  TRP A N   1 
ATOM   626  C CA  . TRP A 1 96  ? 17.771  -1.049  108.481 1.00 14.09 ? 83  TRP A CA  1 
ATOM   627  C C   . TRP A 1 96  ? 18.615  -0.787  109.730 1.00 18.22 ? 83  TRP A C   1 
ATOM   628  O O   . TRP A 1 96  ? 18.494  0.259   110.369 1.00 16.57 ? 83  TRP A O   1 
ATOM   629  C CB  . TRP A 1 96  ? 16.681  -2.063  108.812 1.00 14.71 ? 83  TRP A CB  1 
ATOM   630  C CG  . TRP A 1 96  ? 15.494  -2.044  107.891 1.00 13.85 ? 83  TRP A CG  1 
ATOM   631  C CD1 . TRP A 1 96  ? 15.038  -3.074  107.120 1.00 16.09 ? 83  TRP A CD1 1 
ATOM   632  C CD2 . TRP A 1 96  ? 14.597  -0.948  107.669 1.00 19.29 ? 83  TRP A CD2 1 
ATOM   633  N NE1 . TRP A 1 96  ? 13.913  -2.684  106.428 1.00 16.72 ? 83  TRP A NE1 1 
ATOM   634  C CE2 . TRP A 1 96  ? 13.624  -1.384  106.747 1.00 18.25 ? 83  TRP A CE2 1 
ATOM   635  C CE3 . TRP A 1 96  ? 14.528  0.362   108.154 1.00 16.78 ? 83  TRP A CE3 1 
ATOM   636  C CZ2 . TRP A 1 96  ? 12.592  -0.558  106.302 1.00 17.95 ? 83  TRP A CZ2 1 
ATOM   637  C CZ3 . TRP A 1 96  ? 13.505  1.183   107.708 1.00 16.53 ? 83  TRP A CZ3 1 
ATOM   638  C CH2 . TRP A 1 96  ? 12.549  0.719   106.793 1.00 16.89 ? 83  TRP A CH2 1 
ATOM   639  N N   . GLU A 1 97  ? 19.462  -1.750  110.075 1.00 17.51 ? 84  GLU A N   1 
ATOM   640  C CA  . GLU A 1 97  ? 20.306  -1.614  111.252 1.00 21.04 ? 84  GLU A CA  1 
ATOM   641  C C   . GLU A 1 97  ? 21.258  -0.433  111.071 1.00 22.03 ? 84  GLU A C   1 
ATOM   642  O O   . GLU A 1 97  ? 21.497  0.324   112.006 1.00 19.02 ? 84  GLU A O   1 
ATOM   643  C CB  . GLU A 1 97  ? 21.068  -2.912  111.519 1.00 24.27 ? 84  GLU A CB  1 
ATOM   644  C CG  . GLU A 1 97  ? 20.149  -4.086  111.838 1.00 30.10 ? 84  GLU A CG  1 
ATOM   645  C CD  . GLU A 1 97  ? 20.898  -5.364  112.168 1.00 42.50 ? 84  GLU A CD  1 
ATOM   646  O OE1 . GLU A 1 97  ? 22.144  -5.366  112.099 1.00 46.29 ? 84  GLU A OE1 1 
ATOM   647  O OE2 . GLU A 1 97  ? 20.234  -6.371  112.497 1.00 47.52 ? 84  GLU A OE2 1 
ATOM   648  N N   . TRP A 1 98  ? 21.759  -0.263  109.851 1.00 18.45 ? 85  TRP A N   1 
ATOM   649  C CA  . TRP A 1 98  ? 22.595  0.880   109.500 1.00 19.99 ? 85  TRP A CA  1 
ATOM   650  C C   . TRP A 1 98  ? 21.853  2.214   109.681 1.00 17.36 ? 85  TRP A C   1 
ATOM   651  O O   . TRP A 1 98  ? 22.386  3.153   110.274 1.00 19.89 ? 85  TRP A O   1 
ATOM   652  C CB  . TRP A 1 98  ? 23.090  0.742   108.052 1.00 18.27 ? 85  TRP A CB  1 
ATOM   653  C CG  . TRP A 1 98  ? 24.141  1.742   107.669 1.00 21.58 ? 85  TRP A CG  1 
ATOM   654  C CD1 . TRP A 1 98  ? 25.493  1.600   107.795 1.00 27.32 ? 85  TRP A CD1 1 
ATOM   655  C CD2 . TRP A 1 98  ? 23.925  3.039   107.100 1.00 19.70 ? 85  TRP A CD2 1 
ATOM   656  N NE1 . TRP A 1 98  ? 26.132  2.728   107.337 1.00 28.20 ? 85  TRP A NE1 1 
ATOM   657  C CE2 . TRP A 1 98  ? 25.191  3.626   106.906 1.00 25.96 ? 85  TRP A CE2 1 
ATOM   658  C CE3 . TRP A 1 98  ? 22.783  3.761   106.737 1.00 20.21 ? 85  TRP A CE3 1 
ATOM   659  C CZ2 . TRP A 1 98  ? 25.347  4.902   106.366 1.00 24.32 ? 85  TRP A CZ2 1 
ATOM   660  C CZ3 . TRP A 1 98  ? 22.941  5.026   106.202 1.00 20.73 ? 85  TRP A CZ3 1 
ATOM   661  C CH2 . TRP A 1 98  ? 24.213  5.584   106.023 1.00 18.20 ? 85  TRP A CH2 1 
ATOM   662  N N   . LEU A 1 99  ? 20.626  2.287   109.167 1.00 16.92 ? 86  LEU A N   1 
ATOM   663  C CA  . LEU A 1 99  ? 19.804  3.495   109.276 1.00 15.08 ? 86  LEU A CA  1 
ATOM   664  C C   . LEU A 1 99  ? 19.552  3.896   110.719 1.00 20.60 ? 86  LEU A C   1 
ATOM   665  O O   . LEU A 1 99  ? 19.602  5.076   111.068 1.00 20.65 ? 86  LEU A O   1 
ATOM   666  C CB  . LEU A 1 99  ? 18.462  3.297   108.574 1.00 13.78 ? 86  LEU A CB  1 
ATOM   667  C CG  . LEU A 1 99  ? 18.475  3.364   107.050 1.00 14.47 ? 86  LEU A CG  1 
ATOM   668  C CD1 . LEU A 1 99  ? 17.158  2.845   106.487 1.00 13.71 ? 86  LEU A CD1 1 
ATOM   669  C CD2 . LEU A 1 99  ? 18.747  4.788   106.588 1.00 16.05 ? 86  LEU A CD2 1 
ATOM   670  N N   . VAL A 1 100 ? 19.274  2.906   111.554 1.00 16.82 ? 87  VAL A N   1 
ATOM   671  C CA  . VAL A 1 100 ? 18.986  3.166   112.955 1.00 18.15 ? 87  VAL A CA  1 
ATOM   672  C C   . VAL A 1 100 ? 20.209  3.754   113.664 1.00 23.87 ? 87  VAL A C   1 
ATOM   673  O O   . VAL A 1 100 ? 20.073  4.628   114.517 1.00 24.84 ? 87  VAL A O   1 
ATOM   674  C CB  . VAL A 1 100 ? 18.514  1.881   113.670 1.00 20.04 ? 87  VAL A CB  1 
ATOM   675  C CG1 . VAL A 1 100 ? 18.374  2.104   115.174 1.00 26.85 ? 87  VAL A CG1 1 
ATOM   676  C CG2 . VAL A 1 100 ? 17.197  1.406   113.069 1.00 18.63 ? 87  VAL A CG2 1 
ATOM   677  N N   A ARG A 1 101 ? 21.397  3.279   113.296 0.57 24.15 ? 88  ARG A N   1 
ATOM   678  N N   B ARG A 1 101 ? 21.400  3.295   113.293 0.43 24.34 ? 88  ARG A N   1 
ATOM   679  C CA  A ARG A 1 101 ? 22.632  3.745   113.922 0.57 28.70 ? 88  ARG A CA  1 
ATOM   680  C CA  B ARG A 1 101 ? 22.621  3.759   113.947 0.43 28.19 ? 88  ARG A CA  1 
ATOM   681  C C   A ARG A 1 101 ? 23.011  5.152   113.477 0.57 26.86 ? 88  ARG A C   1 
ATOM   682  C C   B ARG A 1 101 ? 23.052  5.144   113.471 0.43 26.84 ? 88  ARG A C   1 
ATOM   683  O O   A ARG A 1 101 ? 23.427  5.977   114.288 0.57 26.30 ? 88  ARG A O   1 
ATOM   684  O O   B ARG A 1 101 ? 23.538  5.951   114.261 0.43 26.57 ? 88  ARG A O   1 
ATOM   685  C CB  A ARG A 1 101 ? 23.797  2.795   113.617 0.57 32.00 ? 88  ARG A CB  1 
ATOM   686  C CB  B ARG A 1 101 ? 23.764  2.763   113.724 0.43 31.95 ? 88  ARG A CB  1 
ATOM   687  C CG  A ARG A 1 101 ? 23.667  1.402   114.209 0.57 34.45 ? 88  ARG A CG  1 
ATOM   688  C CG  B ARG A 1 101 ? 23.484  1.374   114.266 0.43 34.47 ? 88  ARG A CG  1 
ATOM   689  C CD  A ARG A 1 101 ? 25.015  0.690   114.229 0.57 37.55 ? 88  ARG A CD  1 
ATOM   690  C CD  B ARG A 1 101 ? 24.719  0.490   114.232 0.43 36.96 ? 88  ARG A CD  1 
ATOM   691  N NE  A ARG A 1 101 ? 25.802  0.951   113.026 0.57 38.04 ? 88  ARG A NE  1 
ATOM   692  N NE  B ARG A 1 101 ? 25.730  0.934   115.184 0.43 38.41 ? 88  ARG A NE  1 
ATOM   693  C CZ  A ARG A 1 101 ? 25.702  0.253   111.899 0.57 36.42 ? 88  ARG A CZ  1 
ATOM   694  C CZ  B ARG A 1 101 ? 25.767  0.562   116.460 0.43 37.70 ? 88  ARG A CZ  1 
ATOM   695  N NH1 A ARG A 1 101 ? 26.462  0.562   110.857 0.57 36.51 ? 88  ARG A NH1 1 
ATOM   696  N NH1 B ARG A 1 101 ? 24.845  -0.261  116.940 0.43 36.50 ? 88  ARG A NH1 1 
ATOM   697  N NH2 A ARG A 1 101 ? 24.843  -0.753  111.813 0.57 34.36 ? 88  ARG A NH2 1 
ATOM   698  N NH2 B ARG A 1 101 ? 26.725  1.013   117.257 0.43 37.39 ? 88  ARG A NH2 1 
ATOM   699  N N   . HIS A 1 102 ? 22.875  5.419   112.184 1.00 29.91 ? 89  HIS A N   1 
ATOM   700  C CA  . HIS A 1 102 ? 23.366  6.669   111.613 1.00 29.07 ? 89  HIS A CA  1 
ATOM   701  C C   . HIS A 1 102 ? 22.364  7.818   111.686 1.00 30.90 ? 89  HIS A C   1 
ATOM   702  O O   . HIS A 1 102 ? 21.728  8.170   110.693 1.00 31.82 ? 89  HIS A O   1 
ATOM   703  C CB  . HIS A 1 102 ? 23.801  6.436   110.169 1.00 24.37 ? 89  HIS A CB  1 
ATOM   704  C CG  . HIS A 1 102 ? 25.069  5.650   110.053 1.00 30.01 ? 89  HIS A CG  1 
ATOM   705  N ND1 . HIS A 1 102 ? 26.292  6.240   109.817 1.00 32.94 ? 89  HIS A ND1 1 
ATOM   706  C CD2 . HIS A 1 102 ? 25.308  4.322   110.170 1.00 32.16 ? 89  HIS A CD2 1 
ATOM   707  C CE1 . HIS A 1 102 ? 27.227  5.308   109.777 1.00 36.46 ? 89  HIS A CE1 1 
ATOM   708  N NE2 . HIS A 1 102 ? 26.657  4.136   109.991 1.00 34.26 ? 89  HIS A NE2 1 
ATOM   709  N N   . ASP A 1 103 ? 22.260  8.414   112.870 1.00 32.82 ? 90  ASP A N   1 
ATOM   710  C CA  . ASP A 1 103 ? 21.351  9.529   113.108 1.00 35.98 ? 90  ASP A CA  1 
ATOM   711  C C   . ASP A 1 103 ? 22.017  10.879  112.854 1.00 39.46 ? 90  ASP A C   1 
ATOM   712  O O   . ASP A 1 103 ? 21.392  11.926  113.018 1.00 43.43 ? 90  ASP A O   1 
ATOM   713  C CB  . ASP A 1 103 ? 20.822  9.484   114.543 1.00 42.66 ? 90  ASP A CB  1 
ATOM   714  C CG  . ASP A 1 103 ? 21.921  9.657   115.576 1.00 50.42 ? 90  ASP A CG  1 
ATOM   715  O OD1 . ASP A 1 103 ? 23.054  9.192   115.329 1.00 49.66 ? 90  ASP A OD1 1 
ATOM   716  O OD2 . ASP A 1 103 ? 21.654  10.262  116.636 1.00 55.82 ? 90  ASP A OD2 1 
ATOM   717  N N   . GLU A 1 104 ? 23.287  10.855  112.459 1.00 37.90 ? 91  GLU A N   1 
ATOM   718  C CA  . GLU A 1 104 ? 24.049  12.091  112.295 1.00 43.48 ? 91  GLU A CA  1 
ATOM   719  C C   . GLU A 1 104 ? 23.681  12.822  111.009 1.00 43.41 ? 91  GLU A C   1 
ATOM   720  O O   . GLU A 1 104 ? 24.048  13.980  110.817 1.00 45.24 ? 91  GLU A O   1 
ATOM   721  C CB  . GLU A 1 104 ? 25.554  11.804  112.308 1.00 45.83 ? 91  GLU A CB  1 
ATOM   722  C CG  . GLU A 1 104 ? 26.087  11.182  111.023 1.00 44.74 ? 91  GLU A CG  1 
ATOM   723  C CD  . GLU A 1 104 ? 25.884  9.680   110.962 1.00 40.69 ? 91  GLU A CD  1 
ATOM   724  O OE1 . GLU A 1 104 ? 25.483  9.090   111.985 1.00 42.66 ? 91  GLU A OE1 1 
ATOM   725  O OE2 . GLU A 1 104 ? 26.130  9.090   109.891 1.00 38.76 ? 91  GLU A OE2 1 
ATOM   726  N N   . ARG A 1 105 ? 22.953  12.141  110.132 1.00 41.17 ? 92  ARG A N   1 
ATOM   727  C CA  . ARG A 1 105 ? 22.625  12.692  108.824 1.00 37.58 ? 92  ARG A CA  1 
ATOM   728  C C   . ARG A 1 105 ? 21.329  12.073  108.305 1.00 29.89 ? 92  ARG A C   1 
ATOM   729  O O   . ARG A 1 105 ? 20.978  10.956  108.679 1.00 29.77 ? 92  ARG A O   1 
ATOM   730  C CB  . ARG A 1 105 ? 23.783  12.446  107.850 1.00 41.52 ? 92  ARG A CB  1 
ATOM   731  C CG  . ARG A 1 105 ? 23.719  13.213  106.538 1.00 44.37 ? 92  ARG A CG  1 
ATOM   732  C CD  . ARG A 1 105 ? 25.000  12.995  105.737 1.00 43.28 ? 92  ARG A CD  1 
ATOM   733  N NE  . ARG A 1 105 ? 24.876  13.427  104.348 1.00 41.52 ? 92  ARG A NE  1 
ATOM   734  C CZ  . ARG A 1 105 ? 25.421  14.533  103.852 1.00 44.24 ? 92  ARG A CZ  1 
ATOM   735  N NH1 . ARG A 1 105 ? 25.248  14.835  102.572 1.00 46.29 ? 92  ARG A NH1 1 
ATOM   736  N NH2 . ARG A 1 105 ? 26.142  15.331  104.629 1.00 48.19 ? 92  ARG A NH2 1 
ATOM   737  N N   . GLU A 1 106 ? 20.615  12.804  107.456 1.00 29.84 ? 93  GLU A N   1 
ATOM   738  C CA  . GLU A 1 106 ? 19.356  12.312  106.908 1.00 28.11 ? 93  GLU A CA  1 
ATOM   739  C C   . GLU A 1 106 ? 19.594  11.391  105.714 1.00 28.41 ? 93  GLU A C   1 
ATOM   740  O O   . GLU A 1 106 ? 19.970  11.844  104.632 1.00 30.58 ? 93  GLU A O   1 
ATOM   741  C CB  . GLU A 1 106 ? 18.456  13.479  106.502 1.00 35.06 ? 93  GLU A CB  1 
ATOM   742  C CG  . GLU A 1 106 ? 17.135  13.050  105.887 1.00 39.79 ? 93  GLU A CG  1 
ATOM   743  C CD  . GLU A 1 106 ? 16.370  14.209  105.288 1.00 47.11 ? 93  GLU A CD  1 
ATOM   744  O OE1 . GLU A 1 106 ? 16.208  15.239  105.976 1.00 46.27 ? 93  GLU A OE1 1 
ATOM   745  O OE2 . GLU A 1 106 ? 15.940  14.093  104.123 1.00 54.46 ? 93  GLU A OE2 1 
ATOM   746  N N   . TYR A 1 107 ? 19.376  10.095  105.924 1.00 22.91 ? 94  TYR A N   1 
ATOM   747  C CA  . TYR A 1 107 ? 19.572  9.092   104.881 1.00 22.56 ? 94  TYR A CA  1 
ATOM   748  C C   . TYR A 1 107 ? 18.256  8.431   104.484 1.00 21.29 ? 94  TYR A C   1 
ATOM   749  O O   . TYR A 1 107 ? 17.437  8.107   105.341 1.00 19.31 ? 94  TYR A O   1 
ATOM   750  C CB  . TYR A 1 107 ? 20.551  8.011   105.342 1.00 19.84 ? 94  TYR A CB  1 
ATOM   751  C CG  . TYR A 1 107 ? 22.001  8.444   105.408 1.00 20.76 ? 94  TYR A CG  1 
ATOM   752  C CD1 . TYR A 1 107 ? 22.742  8.640   104.250 1.00 19.08 ? 94  TYR A CD1 1 
ATOM   753  C CD2 . TYR A 1 107 ? 22.636  8.626   106.631 1.00 22.31 ? 94  TYR A CD2 1 
ATOM   754  C CE1 . TYR A 1 107 ? 24.074  9.025   104.305 1.00 20.54 ? 94  TYR A CE1 1 
ATOM   755  C CE2 . TYR A 1 107 ? 23.966  9.011   106.698 1.00 24.68 ? 94  TYR A CE2 1 
ATOM   756  C CZ  . TYR A 1 107 ? 24.680  9.209   105.534 1.00 23.94 ? 94  TYR A CZ  1 
ATOM   757  O OH  . TYR A 1 107 ? 26.003  9.588   105.597 1.00 25.81 ? 94  TYR A OH  1 
ATOM   758  N N   . SER A 1 108 ? 18.068  8.216   103.186 1.00 18.80 ? 95  SER A N   1 
ATOM   759  C CA  . SER A 1 108 ? 16.887  7.523   102.691 1.00 18.26 ? 95  SER A CA  1 
ATOM   760  C C   . SER A 1 108 ? 17.080  6.012   102.779 1.00 16.04 ? 95  SER A C   1 
ATOM   761  O O   . SER A 1 108 ? 18.208  5.526   102.887 1.00 15.09 ? 95  SER A O   1 
ATOM   762  C CB  . SER A 1 108 ? 16.585  7.932   101.246 1.00 19.56 ? 95  SER A CB  1 
ATOM   763  O OG  . SER A 1 108 ? 17.585  7.449   100.358 1.00 18.47 ? 95  SER A OG  1 
ATOM   764  N N   . PHE A 1 109 ? 15.978  5.270   102.734 1.00 16.29 ? 96  PHE A N   1 
ATOM   765  C CA  . PHE A 1 109 ? 16.045  3.814   102.741 1.00 15.09 ? 96  PHE A CA  1 
ATOM   766  C C   . PHE A 1 109 ? 16.719  3.267   101.480 1.00 16.43 ? 96  PHE A C   1 
ATOM   767  O O   . PHE A 1 109 ? 17.537  2.349   101.558 1.00 12.99 ? 96  PHE A O   1 
ATOM   768  C CB  . PHE A 1 109 ? 14.645  3.211   102.887 1.00 16.47 ? 96  PHE A CB  1 
ATOM   769  C CG  . PHE A 1 109 ? 14.617  1.715   102.757 1.00 19.65 ? 96  PHE A CG  1 
ATOM   770  C CD1 . PHE A 1 109 ? 14.997  0.909   103.815 1.00 17.76 ? 96  PHE A CD1 1 
ATOM   771  C CD2 . PHE A 1 109 ? 14.212  1.116   101.576 1.00 20.03 ? 96  PHE A CD2 1 
ATOM   772  C CE1 . PHE A 1 109 ? 14.977  -0.466  103.697 1.00 19.17 ? 96  PHE A CE1 1 
ATOM   773  C CE2 . PHE A 1 109 ? 14.187  -0.258  101.453 1.00 22.79 ? 96  PHE A CE2 1 
ATOM   774  C CZ  . PHE A 1 109 ? 14.569  -1.050  102.516 1.00 21.88 ? 96  PHE A CZ  1 
ATOM   775  N N   . VAL A 1 110 ? 16.378  3.818   100.318 1.00 16.95 ? 97  VAL A N   1 
ATOM   776  C CA  . VAL A 1 110 ? 16.989  3.343   99.077  1.00 14.72 ? 97  VAL A CA  1 
ATOM   777  C C   . VAL A 1 110 ? 18.507  3.519   99.129  1.00 17.03 ? 97  VAL A C   1 
ATOM   778  O O   . VAL A 1 110 ? 19.261  2.609   98.773  1.00 18.17 ? 97  VAL A O   1 
ATOM   779  C CB  . VAL A 1 110 ? 16.415  4.062   97.841  1.00 19.01 ? 97  VAL A CB  1 
ATOM   780  C CG1 . VAL A 1 110 ? 17.184  3.658   96.584  1.00 18.39 ? 97  VAL A CG1 1 
ATOM   781  C CG2 . VAL A 1 110 ? 14.939  3.732   97.689  1.00 21.89 ? 97  VAL A CG2 1 
ATOM   782  N N   . ASP A 1 111 ? 18.954  4.675   99.605  1.00 15.57 ? 98  ASP A N   1 
ATOM   783  C CA  . ASP A 1 111 ? 20.388  4.920   99.737  1.00 16.77 ? 98  ASP A CA  1 
ATOM   784  C C   . ASP A 1 111 ? 21.039  3.909   100.685 1.00 14.55 ? 98  ASP A C   1 
ATOM   785  O O   . ASP A 1 111 ? 22.127  3.409   100.412 1.00 16.58 ? 98  ASP A O   1 
ATOM   786  C CB  . ASP A 1 111 ? 20.646  6.350   100.217 1.00 19.67 ? 98  ASP A CB  1 
ATOM   787  C CG  . ASP A 1 111 ? 20.625  7.360   99.081  1.00 20.29 ? 98  ASP A CG  1 
ATOM   788  O OD1 . ASP A 1 111 ? 20.302  6.975   97.938  1.00 23.19 ? 98  ASP A OD1 1 
ATOM   789  O OD2 . ASP A 1 111 ? 20.928  8.543   99.331  1.00 26.77 ? 98  ASP A OD2 1 
ATOM   790  N N   . ALA A 1 112 ? 20.364  3.591   101.786 1.00 12.14 ? 99  ALA A N   1 
ATOM   791  C CA  . ALA A 1 112 ? 20.900  2.633   102.747 1.00 15.06 ? 99  ALA A CA  1 
ATOM   792  C C   . ALA A 1 112 ? 21.069  1.246   102.132 1.00 16.44 ? 99  ALA A C   1 
ATOM   793  O O   . ALA A 1 112 ? 22.049  0.558   102.409 1.00 15.13 ? 99  ALA A O   1 
ATOM   794  C CB  . ALA A 1 112 ? 20.009  2.554   103.969 1.00 15.80 ? 99  ALA A CB  1 
ATOM   795  N N   . THR A 1 113 ? 20.104  0.829   101.315 1.00 14.65 ? 100 THR A N   1 
ATOM   796  C CA  . THR A 1 113 ? 20.204  -0.457  100.630 1.00 12.01 ? 100 THR A CA  1 
ATOM   797  C C   . THR A 1 113 ? 21.308  -0.404  99.582  1.00 15.14 ? 100 THR A C   1 
ATOM   798  O O   . THR A 1 113 ? 22.016  -1.388  99.365  1.00 14.68 ? 100 THR A O   1 
ATOM   799  C CB  . THR A 1 113 ? 18.875  -0.869  99.955  1.00 15.30 ? 100 THR A CB  1 
ATOM   800  O OG1 . THR A 1 113 ? 18.517  0.088   98.950  1.00 15.77 ? 100 THR A OG1 1 
ATOM   801  C CG2 . THR A 1 113 ? 17.760  -0.966  100.985 1.00 18.01 ? 100 THR A CG2 1 
ATOM   802  N N   . SER A 1 114 ? 21.445  0.746   98.930  1.00 12.65 ? 101 SER A N   1 
ATOM   803  C CA  . SER A 1 114 ? 22.504  0.934   97.945  1.00 12.93 ? 101 SER A CA  1 
ATOM   804  C C   . SER A 1 114 ? 23.873  0.810   98.603  1.00 14.47 ? 101 SER A C   1 
ATOM   805  O O   . SER A 1 114 ? 24.768  0.153   98.067  1.00 16.06 ? 101 SER A O   1 
ATOM   806  C CB  . SER A 1 114 ? 22.378  2.292   97.248  1.00 13.87 ? 101 SER A CB  1 
ATOM   807  O OG  . SER A 1 114 ? 21.286  2.305   96.344  1.00 13.49 ? 101 SER A OG  1 
ATOM   808  N N   . PHE A 1 115 ? 24.029  1.443   99.763  1.00 13.40 ? 102 PHE A N   1 
ATOM   809  C CA  . PHE A 1 115 ? 25.279  1.358   100.519 1.00 12.47 ? 102 PHE A CA  1 
ATOM   810  C C   . PHE A 1 115 ? 25.568  -0.089  100.913 1.00 12.90 ? 102 PHE A C   1 
ATOM   811  O O   . PHE A 1 115 ? 26.706  -0.541  100.846 1.00 14.86 ? 102 PHE A O   1 
ATOM   812  C CB  . PHE A 1 115 ? 25.234  2.234   101.784 1.00 15.06 ? 102 PHE A CB  1 
ATOM   813  C CG  . PHE A 1 115 ? 24.949  3.690   101.521 1.00 14.68 ? 102 PHE A CG  1 
ATOM   814  C CD1 . PHE A 1 115 ? 25.188  4.255   100.279 1.00 15.39 ? 102 PHE A CD1 1 
ATOM   815  C CD2 . PHE A 1 115 ? 24.434  4.495   102.529 1.00 17.02 ? 102 PHE A CD2 1 
ATOM   816  C CE1 . PHE A 1 115 ? 24.918  5.593   100.042 1.00 18.26 ? 102 PHE A CE1 1 
ATOM   817  C CE2 . PHE A 1 115 ? 24.161  5.835   102.299 1.00 17.17 ? 102 PHE A CE2 1 
ATOM   818  C CZ  . PHE A 1 115 ? 24.406  6.386   101.054 1.00 15.71 ? 102 PHE A CZ  1 
ATOM   819  N N   . ALA A 1 116 ? 24.533  -0.811  101.330 1.00 15.48 ? 103 ALA A N   1 
ATOM   820  C CA  . ALA A 1 116 ? 24.696  -2.205  101.724 1.00 13.83 ? 103 ALA A CA  1 
ATOM   821  C C   . ALA A 1 116 ? 25.123  -3.069  100.540 1.00 17.42 ? 103 ALA A C   1 
ATOM   822  O O   . ALA A 1 116 ? 25.967  -3.956  100.683 1.00 20.92 ? 103 ALA A O   1 
ATOM   823  C CB  . ALA A 1 116 ? 23.404  -2.743  102.340 1.00 14.06 ? 103 ALA A CB  1 
ATOM   824  N N   . VAL A 1 117 ? 24.541  -2.812  99.372  1.00 17.15 ? 104 VAL A N   1 
ATOM   825  C CA  . VAL A 1 117 ? 24.896  -3.567  98.171  1.00 14.32 ? 104 VAL A CA  1 
ATOM   826  C C   . VAL A 1 117 ? 26.360  -3.324  97.798  1.00 15.35 ? 104 VAL A C   1 
ATOM   827  O O   . VAL A 1 117 ? 27.113  -4.271  97.552  1.00 16.80 ? 104 VAL A O   1 
ATOM   828  C CB  . VAL A 1 117 ? 23.986  -3.205  96.979  1.00 15.85 ? 104 VAL A CB  1 
ATOM   829  C CG1 . VAL A 1 117 ? 24.546  -3.792  95.689  1.00 15.25 ? 104 VAL A CG1 1 
ATOM   830  C CG2 . VAL A 1 117 ? 22.563  -3.698  97.221  1.00 14.01 ? 104 VAL A CG2 1 
ATOM   831  N N   . MET A 1 118 ? 26.755  -2.054  97.771  1.00 14.51 ? 105 MET A N   1 
ATOM   832  C CA  . MET A 1 118 ? 28.129  -1.688  97.443  1.00 17.02 ? 105 MET A CA  1 
ATOM   833  C C   . MET A 1 118 ? 29.126  -2.309  98.419  1.00 17.42 ? 105 MET A C   1 
ATOM   834  O O   . MET A 1 118 ? 30.172  -2.809  98.007  1.00 19.35 ? 105 MET A O   1 
ATOM   835  C CB  . MET A 1 118 ? 28.294  -0.167  97.421  1.00 15.60 ? 105 MET A CB  1 
ATOM   836  C CG  . MET A 1 118 ? 27.485  0.516   96.331  1.00 15.82 ? 105 MET A CG  1 
ATOM   837  S SD  . MET A 1 118 ? 27.736  2.298   96.239  1.00 16.55 ? 105 MET A SD  1 
ATOM   838  C CE  . MET A 1 118 ? 29.444  2.393   95.715  1.00 18.78 ? 105 MET A CE  1 
ATOM   839  N N   . ARG A 1 119 ? 28.801  -2.286  99.708  1.00 17.59 ? 106 ARG A N   1 
ATOM   840  C CA  . ARG A 1 119 ? 29.683  -2.883  100.716 1.00 19.56 ? 106 ARG A CA  1 
ATOM   841  C C   . ARG A 1 119 ? 29.853  -4.379  100.475 1.00 21.39 ? 106 ARG A C   1 
ATOM   842  O O   . ARG A 1 119 ? 30.962  -4.911  100.529 1.00 24.14 ? 106 ARG A O   1 
ATOM   843  C CB  . ARG A 1 119 ? 29.142  -2.647  102.132 1.00 30.74 ? 106 ARG A CB  1 
ATOM   844  C CG  . ARG A 1 119 ? 29.284  -1.222  102.641 1.00 34.26 ? 106 ARG A CG  1 
ATOM   845  C CD  . ARG A 1 119 ? 29.113  -1.150  104.161 1.00 38.74 ? 106 ARG A CD  1 
ATOM   846  N NE  . ARG A 1 119 ? 27.812  -1.642  104.616 1.00 41.86 ? 106 ARG A NE  1 
ATOM   847  C CZ  . ARG A 1 119 ? 26.736  -0.877  104.781 1.00 39.94 ? 106 ARG A CZ  1 
ATOM   848  N NH1 . ARG A 1 119 ? 26.797  0.423   104.528 1.00 40.56 ? 106 ARG A NH1 1 
ATOM   849  N NH2 . ARG A 1 119 ? 25.597  -1.411  105.202 1.00 33.91 ? 106 ARG A NH2 1 
ATOM   850  N N   . LYS A 1 120 ? 28.737  -5.047  100.202 1.00 20.92 ? 107 LYS A N   1 
ATOM   851  C CA  . LYS A 1 120 ? 28.725  -6.486  99.968  1.00 22.69 ? 107 LYS A CA  1 
ATOM   852  C C   . LYS A 1 120 ? 29.508  -6.852  98.709  1.00 23.84 ? 107 LYS A C   1 
ATOM   853  O O   . LYS A 1 120 ? 30.244  -7.844  98.685  1.00 26.97 ? 107 LYS A O   1 
ATOM   854  C CB  . LYS A 1 120 ? 27.282  -6.980  99.857  1.00 29.55 ? 107 LYS A CB  1 
ATOM   855  C CG  . LYS A 1 120 ? 27.121  -8.425  99.421  1.00 34.96 ? 107 LYS A CG  1 
ATOM   856  C CD  . LYS A 1 120 ? 27.356  -9.380  100.573 1.00 42.77 ? 107 LYS A CD  1 
ATOM   857  C CE  . LYS A 1 120 ? 26.896  -10.785 100.216 1.00 52.04 ? 107 LYS A CE  1 
ATOM   858  N NZ  . LYS A 1 120 ? 25.439  -10.819 99.908  1.00 53.34 ? 107 LYS A NZ  1 
ATOM   859  N N   . LYS A 1 121 ? 29.353  -6.039  97.667  1.00 21.92 ? 108 LYS A N   1 
ATOM   860  C CA  . LYS A 1 121 ? 29.975  -6.323  96.374  1.00 24.25 ? 108 LYS A CA  1 
ATOM   861  C C   . LYS A 1 121 ? 31.410  -5.811  96.286  1.00 24.85 ? 108 LYS A C   1 
ATOM   862  O O   . LYS A 1 121 ? 32.113  -6.083  95.310  1.00 26.71 ? 108 LYS A O   1 
ATOM   863  C CB  . LYS A 1 121 ? 29.142  -5.718  95.243  1.00 25.37 ? 108 LYS A CB  1 
ATOM   864  C CG  . LYS A 1 121 ? 27.764  -6.346  95.088  1.00 28.07 ? 108 LYS A CG  1 
ATOM   865  C CD  . LYS A 1 121 ? 27.866  -7.805  94.676  1.00 34.61 ? 108 LYS A CD  1 
ATOM   866  C CE  . LYS A 1 121 ? 26.493  -8.406  94.417  1.00 36.88 ? 108 LYS A CE  1 
ATOM   867  N NZ  . LYS A 1 121 ? 26.597  -9.808  93.930  1.00 42.67 ? 108 LYS A NZ  1 
ATOM   868  N N   . GLY A 1 122 ? 31.840  -5.071  97.303  1.00 22.78 ? 109 GLY A N   1 
ATOM   869  C CA  . GLY A 1 122 ? 33.177  -4.503  97.314  1.00 23.41 ? 109 GLY A CA  1 
ATOM   870  C C   . GLY A 1 122 ? 33.351  -3.391  96.296  1.00 21.93 ? 109 GLY A C   1 
ATOM   871  O O   . GLY A 1 122 ? 34.405  -3.273  95.668  1.00 23.39 ? 109 GLY A O   1 
ATOM   872  N N   . ILE A 1 123 ? 32.309  -2.579  96.134  1.00 18.84 ? 110 ILE A N   1 
ATOM   873  C CA  . ILE A 1 123 ? 32.324  -1.439  95.222  1.00 19.33 ? 110 ILE A CA  1 
ATOM   874  C C   . ILE A 1 123 ? 32.401  -0.136  96.012  1.00 18.56 ? 110 ILE A C   1 
ATOM   875  O O   . ILE A 1 123 ? 31.660  0.052   96.976  1.00 16.67 ? 110 ILE A O   1 
ATOM   876  C CB  . ILE A 1 123 ? 31.058  -1.413  94.325  1.00 16.47 ? 110 ILE A CB  1 
ATOM   877  C CG1 . ILE A 1 123 ? 30.903  -2.739  93.575  1.00 18.95 ? 110 ILE A CG1 1 
ATOM   878  C CG2 . ILE A 1 123 ? 31.096  -0.238  93.353  1.00 16.65 ? 110 ILE A CG2 1 
ATOM   879  C CD1 . ILE A 1 123 ? 29.626  -2.831  92.754  1.00 34.09 ? 110 ILE A CD1 1 
ATOM   880  N N   . GLN A 1 124 ? 33.294  0.768   95.623  1.00 16.58 ? 111 GLN A N   1 
ATOM   881  C CA  . GLN A 1 124 ? 33.366  2.052   96.314  1.00 15.06 ? 111 GLN A CA  1 
ATOM   882  C C   . GLN A 1 124 ? 32.989  3.206   95.397  1.00 16.18 ? 111 GLN A C   1 
ATOM   883  O O   . GLN A 1 124 ? 32.543  4.253   95.857  1.00 15.89 ? 111 GLN A O   1 
ATOM   884  C CB  . GLN A 1 124 ? 34.764  2.294   96.900  1.00 17.90 ? 111 GLN A CB  1 
ATOM   885  C CG  . GLN A 1 124 ? 34.816  3.561   97.748  1.00 19.47 ? 111 GLN A CG  1 
ATOM   886  C CD  . GLN A 1 124 ? 36.135  3.778   98.447  1.00 22.56 ? 111 GLN A CD  1 
ATOM   887  O OE1 . GLN A 1 124 ? 37.181  3.307   97.996  1.00 21.59 ? 111 GLN A OE1 1 
ATOM   888  N NE2 . GLN A 1 124 ? 36.095  4.502   99.560  1.00 25.17 ? 111 GLN A NE2 1 
ATOM   889  N N   . ASN A 1 125 ? 33.165  3.010   94.095  1.00 14.70 ? 112 ASN A N   1 
ATOM   890  C CA  . ASN A 1 125 ? 32.870  4.064   93.133  1.00 14.40 ? 112 ASN A CA  1 
ATOM   891  C C   . ASN A 1 125 ? 31.398  4.073   92.746  1.00 14.08 ? 112 ASN A C   1 
ATOM   892  O O   . ASN A 1 125 ? 30.852  3.065   92.298  1.00 17.95 ? 112 ASN A O   1 
ATOM   893  C CB  . ASN A 1 125 ? 33.748  3.913   91.892  1.00 16.18 ? 112 ASN A CB  1 
ATOM   894  C CG  . ASN A 1 125 ? 35.217  4.117   92.199  1.00 18.93 ? 112 ASN A CG  1 
ATOM   895  O OD1 . ASN A 1 125 ? 35.570  4.919   93.062  1.00 19.46 ? 112 ASN A OD1 1 
ATOM   896  N ND2 . ASN A 1 125 ? 36.080  3.389   91.502  1.00 21.31 ? 112 ASN A ND2 1 
ATOM   897  N N   . ALA A 1 126 ? 30.759  5.219   92.930  1.00 13.69 ? 113 ALA A N   1 
ATOM   898  C CA  . ALA A 1 126 ? 29.351  5.345   92.606  1.00 16.44 ? 113 ALA A CA  1 
ATOM   899  C C   . ALA A 1 126 ? 29.133  6.397   91.534  1.00 18.55 ? 113 ALA A C   1 
ATOM   900  O O   . ALA A 1 126 ? 29.811  7.423   91.507  1.00 17.13 ? 113 ALA A O   1 
ATOM   901  C CB  . ALA A 1 126 ? 28.546  5.687   93.854  1.00 16.98 ? 113 ALA A CB  1 
ATOM   902  N N   . TYR A 1 127 ? 28.196  6.117   90.636  1.00 13.90 ? 114 TYR A N   1 
ATOM   903  C CA  . TYR A 1 127 ? 27.658  7.140   89.760  1.00 15.51 ? 114 TYR A CA  1 
ATOM   904  C C   . TYR A 1 127 ? 26.458  7.750   90.461  1.00 16.46 ? 114 TYR A C   1 
ATOM   905  O O   . TYR A 1 127 ? 25.382  7.154   90.502  1.00 17.19 ? 114 TYR A O   1 
ATOM   906  C CB  . TYR A 1 127 ? 27.270  6.559   88.398  1.00 16.61 ? 114 TYR A CB  1 
ATOM   907  C CG  . TYR A 1 127 ? 28.414  6.528   87.410  1.00 17.61 ? 114 TYR A CG  1 
ATOM   908  C CD1 . TYR A 1 127 ? 29.710  6.825   87.813  1.00 20.07 ? 114 TYR A CD1 1 
ATOM   909  C CD2 . TYR A 1 127 ? 28.200  6.210   86.075  1.00 23.10 ? 114 TYR A CD2 1 
ATOM   910  C CE1 . TYR A 1 127 ? 30.759  6.809   86.917  1.00 20.28 ? 114 TYR A CE1 1 
ATOM   911  C CE2 . TYR A 1 127 ? 29.249  6.188   85.170  1.00 26.82 ? 114 TYR A CE2 1 
ATOM   912  C CZ  . TYR A 1 127 ? 30.525  6.483   85.599  1.00 26.49 ? 114 TYR A CZ  1 
ATOM   913  O OH  . TYR A 1 127 ? 31.577  6.465   84.708  1.00 30.06 ? 114 TYR A OH  1 
ATOM   914  N N   . ALA A 1 128 ? 26.658  8.934   91.028  1.00 16.21 ? 115 ALA A N   1 
ATOM   915  C CA  . ALA A 1 128 ? 25.659  9.549   91.893  1.00 17.76 ? 115 ALA A CA  1 
ATOM   916  C C   . ALA A 1 128 ? 25.966  11.022  92.097  1.00 19.13 ? 115 ALA A C   1 
ATOM   917  O O   . ALA A 1 128 ? 27.108  11.450  91.951  1.00 22.13 ? 115 ALA A O   1 
ATOM   918  C CB  . ALA A 1 128 ? 25.607  8.832   93.233  1.00 16.74 ? 115 ALA A CB  1 
ATOM   919  N N   . PHE A 1 129 ? 24.948  11.797  92.444  1.00 21.41 ? 116 PHE A N   1 
ATOM   920  C CA  . PHE A 1 129 ? 25.142  13.217  92.697  1.00 24.67 ? 116 PHE A CA  1 
ATOM   921  C C   . PHE A 1 129 ? 24.658  13.619  94.091  1.00 32.88 ? 116 PHE A C   1 
ATOM   922  O O   . PHE A 1 129 ? 23.968  12.852  94.759  1.00 32.84 ? 116 PHE A O   1 
ATOM   923  C CB  . PHE A 1 129 ? 24.425  14.044  91.627  1.00 27.27 ? 116 PHE A CB  1 
ATOM   924  C CG  . PHE A 1 129 ? 24.952  13.823  90.234  1.00 27.87 ? 116 PHE A CG  1 
ATOM   925  C CD1 . PHE A 1 129 ? 26.182  14.334  89.858  1.00 26.88 ? 116 PHE A CD1 1 
ATOM   926  C CD2 . PHE A 1 129 ? 24.216  13.110  89.301  1.00 28.56 ? 116 PHE A CD2 1 
ATOM   927  C CE1 . PHE A 1 129 ? 26.672  14.139  88.579  1.00 28.72 ? 116 PHE A CE1 1 
ATOM   928  C CE2 . PHE A 1 129 ? 24.699  12.910  88.019  1.00 27.70 ? 116 PHE A CE2 1 
ATOM   929  C CZ  . PHE A 1 129 ? 25.929  13.425  87.658  1.00 28.29 ? 116 PHE A CZ  1 
ATOM   930  N N   . ASP A 1 130 ? 25.078  14.807  94.526  1.00 47.68 ? 117 ASP A N   1 
ATOM   931  C CA  . ASP A 1 130 ? 24.533  15.501  95.703  1.00 57.85 ? 117 ASP A CA  1 
ATOM   932  C C   . ASP A 1 130 ? 24.840  14.926  97.099  1.00 56.33 ? 117 ASP A C   1 
ATOM   933  O O   . ASP A 1 130 ? 24.090  15.180  98.044  1.00 59.32 ? 117 ASP A O   1 
ATOM   934  C CB  . ASP A 1 130 ? 23.012  15.643  95.556  1.00 67.56 ? 117 ASP A CB  1 
ATOM   935  C CG  . ASP A 1 130 ? 22.605  16.194  94.201  1.00 74.84 ? 117 ASP A CG  1 
ATOM   936  O OD1 . ASP A 1 130 ? 23.482  16.724  93.484  1.00 77.50 ? 117 ASP A OD1 1 
ATOM   937  O OD2 . ASP A 1 130 ? 21.406  16.110  93.858  1.00 77.53 ? 117 ASP A OD2 1 
ATOM   938  N N   . GLY A 1 131 ? 25.918  14.158  97.238  1.00 47.58 ? 118 GLY A N   1 
ATOM   939  C CA  . GLY A 1 131 ? 26.555  14.009  98.541  1.00 40.56 ? 118 GLY A CA  1 
ATOM   940  C C   . GLY A 1 131 ? 26.302  12.852  99.501  1.00 31.41 ? 118 GLY A C   1 
ATOM   941  O O   . GLY A 1 131 ? 27.158  12.577  100.343 1.00 25.98 ? 118 GLY A O   1 
ATOM   942  N N   . ASP A 1 132 ? 25.152  12.187  99.416  1.00 28.67 ? 119 ASP A N   1 
ATOM   943  C CA  . ASP A 1 132 ? 24.832  11.120  100.369 1.00 28.91 ? 119 ASP A CA  1 
ATOM   944  C C   . ASP A 1 132 ? 25.847  9.978   100.318 1.00 21.60 ? 119 ASP A C   1 
ATOM   945  O O   . ASP A 1 132 ? 26.261  9.450   101.352 1.00 21.77 ? 119 ASP A O   1 
ATOM   946  C CB  . ASP A 1 132 ? 23.428  10.566  100.113 1.00 34.30 ? 119 ASP A CB  1 
ATOM   947  C CG  . ASP A 1 132 ? 22.348  11.619  100.258 1.00 46.88 ? 119 ASP A CG  1 
ATOM   948  O OD1 . ASP A 1 132 ? 21.930  11.892  101.403 1.00 49.85 ? 119 ASP A OD1 1 
ATOM   949  O OD2 . ASP A 1 132 ? 21.911  12.169  99.226  1.00 53.72 ? 119 ASP A OD2 1 
ATOM   950  N N   . PHE A 1 133 ? 26.245  9.603   99.110  1.00 18.60 ? 120 PHE A N   1 
ATOM   951  C CA  . PHE A 1 133 ? 27.190  8.510   98.928  1.00 16.64 ? 120 PHE A CA  1 
ATOM   952  C C   . PHE A 1 133 ? 28.579  8.876   99.442  1.00 19.69 ? 120 PHE A C   1 
ATOM   953  O O   . PHE A 1 133 ? 29.255  8.050   100.059 1.00 18.26 ? 120 PHE A O   1 
ATOM   954  C CB  . PHE A 1 133 ? 27.243  8.104   97.457  1.00 16.26 ? 120 PHE A CB  1 
ATOM   955  C CG  . PHE A 1 133 ? 26.094  7.230   97.040  1.00 14.35 ? 120 PHE A CG  1 
ATOM   956  C CD1 . PHE A 1 133 ? 24.823  7.760   96.886  1.00 16.32 ? 120 PHE A CD1 1 
ATOM   957  C CD2 . PHE A 1 133 ? 26.281  5.878   96.817  1.00 16.50 ? 120 PHE A CD2 1 
ATOM   958  C CE1 . PHE A 1 133 ? 23.759  6.957   96.516  1.00 15.42 ? 120 PHE A CE1 1 
ATOM   959  C CE2 . PHE A 1 133 ? 25.222  5.069   96.444  1.00 16.36 ? 120 PHE A CE2 1 
ATOM   960  C CZ  . PHE A 1 133 ? 23.963  5.611   96.293  1.00 13.91 ? 120 PHE A CZ  1 
ATOM   961  N N   . SER A 1 134 ? 28.996  10.114  99.198  1.00 21.29 ? 121 SER A N   1 
ATOM   962  C CA  . SER A 1 134 ? 30.286  10.586  99.691  1.00 22.70 ? 121 SER A CA  1 
ATOM   963  C C   . SER A 1 134 ? 30.325  10.548  101.216 1.00 24.40 ? 121 SER A C   1 
ATOM   964  O O   . SER A 1 134 ? 31.318  10.127  101.812 1.00 26.26 ? 121 SER A O   1 
ATOM   965  C CB  . SER A 1 134 ? 30.572  12.003  99.192  1.00 26.03 ? 121 SER A CB  1 
ATOM   966  O OG  . SER A 1 134 ? 30.597  12.047  97.776  1.00 29.42 ? 121 SER A OG  1 
ATOM   967  N N   . ALA A 1 135 ? 29.233  10.984  101.839 1.00 23.13 ? 122 ALA A N   1 
ATOM   968  C CA  . ALA A 1 135 ? 29.149  11.050  103.293 1.00 25.54 ? 122 ALA A CA  1 
ATOM   969  C C   . ALA A 1 135 ? 29.189  9.660   103.920 1.00 23.76 ? 122 ALA A C   1 
ATOM   970  O O   . ALA A 1 135 ? 29.673  9.490   105.036 1.00 25.58 ? 122 ALA A O   1 
ATOM   971  C CB  . ALA A 1 135 ? 27.885  11.786  103.719 1.00 28.10 ? 122 ALA A CB  1 
ATOM   972  N N   . ALA A 1 136 ? 28.682  8.667   103.197 1.00 20.78 ? 123 ALA A N   1 
ATOM   973  C CA  . ALA A 1 136 ? 28.635  7.306   103.717 1.00 22.06 ? 123 ALA A CA  1 
ATOM   974  C C   . ALA A 1 136 ? 29.904  6.516   103.384 1.00 22.51 ? 123 ALA A C   1 
ATOM   975  O O   . ALA A 1 136 ? 29.977  5.313   103.631 1.00 22.11 ? 123 ALA A O   1 
ATOM   976  C CB  . ALA A 1 136 ? 27.409  6.584   103.186 1.00 20.51 ? 123 ALA A CB  1 
ATOM   977  N N   . GLY A 1 137 ? 30.897  7.195   102.820 1.00 21.48 ? 124 GLY A N   1 
ATOM   978  C CA  . GLY A 1 137 ? 32.207  6.600   102.622 1.00 21.96 ? 124 GLY A CA  1 
ATOM   979  C C   . GLY A 1 137 ? 32.525  6.126   101.215 1.00 23.22 ? 124 GLY A C   1 
ATOM   980  O O   . GLY A 1 137 ? 33.523  5.436   101.003 1.00 24.19 ? 124 GLY A O   1 
ATOM   981  N N   . PHE A 1 138 ? 31.688  6.487   100.249 1.00 20.78 ? 125 PHE A N   1 
ATOM   982  C CA  . PHE A 1 138 ? 31.909  6.055   98.871  1.00 16.54 ? 125 PHE A CA  1 
ATOM   983  C C   . PHE A 1 138 ? 32.447  7.207   98.037  1.00 18.93 ? 125 PHE A C   1 
ATOM   984  O O   . PHE A 1 138 ? 32.557  8.334   98.518  1.00 19.11 ? 125 PHE A O   1 
ATOM   985  C CB  . PHE A 1 138 ? 30.614  5.494   98.269  1.00 16.76 ? 125 PHE A CB  1 
ATOM   986  C CG  . PHE A 1 138 ? 30.014  4.383   99.084  1.00 18.22 ? 125 PHE A CG  1 
ATOM   987  C CD1 . PHE A 1 138 ? 30.496  3.087   98.982  1.00 16.17 ? 125 PHE A CD1 1 
ATOM   988  C CD2 . PHE A 1 138 ? 28.997  4.645   99.984  1.00 15.09 ? 125 PHE A CD2 1 
ATOM   989  C CE1 . PHE A 1 138 ? 29.954  2.068   99.748  1.00 16.60 ? 125 PHE A CE1 1 
ATOM   990  C CE2 . PHE A 1 138 ? 28.455  3.633   100.754 1.00 18.67 ? 125 PHE A CE2 1 
ATOM   991  C CZ  . PHE A 1 138 ? 28.932  2.344   100.635 1.00 17.73 ? 125 PHE A CZ  1 
ATOM   992  N N   . VAL A 1 139 ? 32.809  6.915   96.793  1.00 17.65 ? 126 VAL A N   1 
ATOM   993  C CA  . VAL A 1 139 ? 33.323  7.943   95.902  1.00 19.36 ? 126 VAL A CA  1 
ATOM   994  C C   . VAL A 1 139 ? 32.290  8.285   94.843  1.00 21.48 ? 126 VAL A C   1 
ATOM   995  O O   . VAL A 1 139 ? 31.919  7.431   94.038  1.00 17.70 ? 126 VAL A O   1 
ATOM   996  C CB  . VAL A 1 139 ? 34.619  7.504   95.201  1.00 18.96 ? 126 VAL A CB  1 
ATOM   997  C CG1 . VAL A 1 139 ? 35.047  8.551   94.182  1.00 23.88 ? 126 VAL A CG1 1 
ATOM   998  C CG2 . VAL A 1 139 ? 35.724  7.249   96.220  1.00 20.08 ? 126 VAL A CG2 1 
ATOM   999  N N   . GLU A 1 140 ? 31.827  9.531   94.847  1.00 16.16 ? 127 GLU A N   1 
ATOM   1000 C CA  . GLU A 1 140 ? 30.968  10.013  93.774  1.00 17.31 ? 127 GLU A CA  1 
ATOM   1001 C C   . GLU A 1 140 ? 31.842  10.477  92.614  1.00 18.13 ? 127 GLU A C   1 
ATOM   1002 O O   . GLU A 1 140 ? 32.361  11.593  92.611  1.00 19.54 ? 127 GLU A O   1 
ATOM   1003 C CB  . GLU A 1 140 ? 30.048  11.128  94.272  1.00 21.80 ? 127 GLU A CB  1 
ATOM   1004 C CG  . GLU A 1 140 ? 29.007  10.615  95.250  1.00 23.34 ? 127 GLU A CG  1 
ATOM   1005 C CD  . GLU A 1 140 ? 28.123  11.704  95.816  1.00 30.07 ? 127 GLU A CD  1 
ATOM   1006 O OE1 . GLU A 1 140 ? 27.910  12.724  95.132  1.00 28.53 ? 127 GLU A OE1 1 
ATOM   1007 O OE2 . GLU A 1 140 ? 27.627  11.525  96.946  1.00 37.49 ? 127 GLU A OE2 1 
ATOM   1008 N N   . VAL A 1 141 ? 32.015  9.585   91.642  1.00 19.52 ? 128 VAL A N   1 
ATOM   1009 C CA  . VAL A 1 141 ? 32.932  9.798   90.527  1.00 21.88 ? 128 VAL A CA  1 
ATOM   1010 C C   . VAL A 1 141 ? 32.570  11.041  89.721  1.00 20.64 ? 128 VAL A C   1 
ATOM   1011 O O   . VAL A 1 141 ? 31.404  11.281  89.419  1.00 20.21 ? 128 VAL A O   1 
ATOM   1012 C CB  . VAL A 1 141 ? 32.952  8.566   89.590  1.00 22.87 ? 128 VAL A CB  1 
ATOM   1013 C CG1 . VAL A 1 141 ? 33.828  8.822   88.371  1.00 21.36 ? 128 VAL A CG1 1 
ATOM   1014 C CG2 . VAL A 1 141 ? 33.432  7.336   90.344  1.00 23.45 ? 128 VAL A CG2 1 
ATOM   1015 N N   . ARG A 1 142 ? 33.581  11.840  89.403  1.00 22.24 ? 129 ARG A N   1 
ATOM   1016 C CA  . ARG A 1 142 ? 33.405  13.017  88.568  1.00 24.76 ? 129 ARG A CA  1 
ATOM   1017 C C   . ARG A 1 142 ? 34.382  12.954  87.402  1.00 29.44 ? 129 ARG A C   1 
ATOM   1018 O O   . ARG A 1 142 ? 35.421  12.302  87.502  1.00 31.70 ? 129 ARG A O   1 
ATOM   1019 C CB  . ARG A 1 142 ? 33.624  14.296  89.381  1.00 28.05 ? 129 ARG A CB  1 
ATOM   1020 C CG  . ARG A 1 142 ? 32.634  14.492  90.517  1.00 26.54 ? 129 ARG A CG  1 
ATOM   1021 C CD  . ARG A 1 142 ? 31.235  14.787  90.000  1.00 26.15 ? 129 ARG A CD  1 
ATOM   1022 N NE  . ARG A 1 142 ? 30.274  14.911  91.091  1.00 25.91 ? 129 ARG A NE  1 
ATOM   1023 C CZ  . ARG A 1 142 ? 29.485  13.926  91.508  1.00 24.06 ? 129 ARG A CZ  1 
ATOM   1024 N NH1 . ARG A 1 142 ? 29.542  12.738  90.923  1.00 23.29 ? 129 ARG A NH1 1 
ATOM   1025 N NH2 . ARG A 1 142 ? 28.640  14.126  92.513  1.00 24.19 ? 129 ARG A NH2 1 
ATOM   1026 N N   . PRO A 1 143 ? 34.044  13.614  86.282  1.00 29.35 ? 130 PRO A N   1 
ATOM   1027 C CA  . PRO A 1 143 ? 35.001  13.746  85.177  1.00 31.86 ? 130 PRO A CA  1 
ATOM   1028 C C   . PRO A 1 143 ? 36.257  14.504  85.605  1.00 35.27 ? 130 PRO A C   1 
ATOM   1029 O O   . PRO A 1 143 ? 37.349  14.168  85.146  1.00 42.65 ? 130 PRO A O   1 
ATOM   1030 C CB  . PRO A 1 143 ? 34.217  14.535  84.123  1.00 34.81 ? 130 PRO A CB  1 
ATOM   1031 C CG  . PRO A 1 143 ? 32.786  14.244  84.425  1.00 31.00 ? 130 PRO A CG  1 
ATOM   1032 C CD  . PRO A 1 143 ? 32.713  14.136  85.924  1.00 30.42 ? 130 PRO A CD  1 
ATOM   1033 N N   . ALA B 2 13  ? -11.591 -8.818  106.291 1.00 43.44 ? 0   ALA B N   1 
ATOM   1034 C CA  . ALA B 2 13  ? -10.777 -9.841  106.938 1.00 48.90 ? 0   ALA B CA  1 
ATOM   1035 C C   . ALA B 2 13  ? -9.309  -9.425  106.996 1.00 47.88 ? 0   ALA B C   1 
ATOM   1036 O O   . ALA B 2 13  ? -8.657  -9.553  108.033 1.00 50.81 ? 0   ALA B O   1 
ATOM   1037 C CB  . ALA B 2 13  ? -10.923 -11.171 106.215 1.00 53.91 ? 0   ALA B CB  1 
ATOM   1038 N N   . SER B 2 14  ? -8.793  -8.926  105.877 1.00 36.81 ? 1   SER B N   1 
ATOM   1039 C CA  . SER B 2 14  ? -7.399  -8.505  105.805 1.00 34.06 ? 1   SER B CA  1 
ATOM   1040 C C   . SER B 2 14  ? -7.257  -7.134  105.158 1.00 27.42 ? 1   SER B C   1 
ATOM   1041 O O   . SER B 2 14  ? -8.101  -6.719  104.364 1.00 24.10 ? 1   SER B O   1 
ATOM   1042 C CB  . SER B 2 14  ? -6.570  -9.528  105.028 1.00 35.85 ? 1   SER B CB  1 
ATOM   1043 O OG  . SER B 2 14  ? -7.041  -9.652  103.698 1.00 39.65 ? 1   SER B OG  1 
ATOM   1044 N N   . ILE B 2 15  ? -6.183  -6.434  105.510 1.00 21.41 ? 2   ILE B N   1 
ATOM   1045 C CA  . ILE B 2 15  ? -5.867  -5.153  104.903 1.00 18.25 ? 2   ILE B CA  1 
ATOM   1046 C C   . ILE B 2 15  ? -4.407  -5.095  104.484 1.00 16.59 ? 2   ILE B C   1 
ATOM   1047 O O   . ILE B 2 15  ? -3.558  -5.781  105.054 1.00 18.47 ? 2   ILE B O   1 
ATOM   1048 C CB  . ILE B 2 15  ? -6.147  -3.966  105.853 1.00 24.55 ? 2   ILE B CB  1 
ATOM   1049 C CG1 . ILE B 2 15  ? -5.330  -4.101  107.142 1.00 24.61 ? 2   ILE B CG1 1 
ATOM   1050 C CG2 . ILE B 2 15  ? -7.628  -3.859  106.156 1.00 24.71 ? 2   ILE B CG2 1 
ATOM   1051 C CD1 . ILE B 2 15  ? -5.346  -2.855  108.017 1.00 20.66 ? 2   ILE B CD1 1 
ATOM   1052 N N   . PHE B 2 16  ? -4.127  -4.281  103.473 1.00 14.67 ? 3   PHE B N   1 
ATOM   1053 C CA  . PHE B 2 16  ? -2.752  -3.963  103.105 1.00 15.36 ? 3   PHE B CA  1 
ATOM   1054 C C   . PHE B 2 16  ? -2.491  -2.513  103.489 1.00 16.08 ? 3   PHE B C   1 
ATOM   1055 O O   . PHE B 2 16  ? -3.291  -1.638  103.181 1.00 14.53 ? 3   PHE B O   1 
ATOM   1056 C CB  . PHE B 2 16  ? -2.506  -4.187  101.611 1.00 14.96 ? 3   PHE B CB  1 
ATOM   1057 C CG  . PHE B 2 16  ? -1.101  -3.867  101.181 1.00 13.81 ? 3   PHE B CG  1 
ATOM   1058 C CD1 . PHE B 2 16  ? -0.741  -2.572  100.844 1.00 13.76 ? 3   PHE B CD1 1 
ATOM   1059 C CD2 . PHE B 2 16  ? -0.136  -4.858  101.136 1.00 15.49 ? 3   PHE B CD2 1 
ATOM   1060 C CE1 . PHE B 2 16  ? 0.559   -2.275  100.465 1.00 13.76 ? 3   PHE B CE1 1 
ATOM   1061 C CE2 . PHE B 2 16  ? 1.163   -4.569  100.757 1.00 18.33 ? 3   PHE B CE2 1 
ATOM   1062 C CZ  . PHE B 2 16  ? 1.507   -3.272  100.425 1.00 16.54 ? 3   PHE B CZ  1 
ATOM   1063 N N   . VAL B 2 17  ? -1.376  -2.251  104.164 1.00 13.61 ? 4   VAL B N   1 
ATOM   1064 C CA  . VAL B 2 17  ? -1.144  -0.908  104.682 1.00 11.22 ? 4   VAL B CA  1 
ATOM   1065 C C   . VAL B 2 17  ? -0.137  -0.150  103.836 1.00 10.88 ? 4   VAL B C   1 
ATOM   1066 O O   . VAL B 2 17  ? 0.985   -0.607  103.630 1.00 13.62 ? 4   VAL B O   1 
ATOM   1067 C CB  . VAL B 2 17  ? -0.658  -0.931  106.142 1.00 16.02 ? 4   VAL B CB  1 
ATOM   1068 C CG1 . VAL B 2 17  ? -0.567  0.488   106.674 1.00 14.81 ? 4   VAL B CG1 1 
ATOM   1069 C CG2 . VAL B 2 17  ? -1.612  -1.752  107.004 1.00 16.92 ? 4   VAL B CG2 1 
ATOM   1070 N N   . ASP B 2 18  ? -0.555  1.020   103.362 1.00 12.82 ? 5   ASP B N   1 
ATOM   1071 C CA  . ASP B 2 18  ? 0.258   1.856   102.487 1.00 12.39 ? 5   ASP B CA  1 
ATOM   1072 C C   . ASP B 2 18  ? 1.050   2.895   103.280 1.00 15.47 ? 5   ASP B C   1 
ATOM   1073 O O   . ASP B 2 18  ? 0.710   3.211   104.421 1.00 14.71 ? 5   ASP B O   1 
ATOM   1074 C CB  . ASP B 2 18  ? -0.638  2.549   101.458 1.00 13.43 ? 5   ASP B CB  1 
ATOM   1075 C CG  . ASP B 2 18  ? 0.125   3.482   100.553 1.00 17.62 ? 5   ASP B CG  1 
ATOM   1076 O OD1 . ASP B 2 18  ? 1.111   3.028   99.936  1.00 18.67 ? 5   ASP B OD1 1 
ATOM   1077 O OD2 . ASP B 2 18  ? -0.250  4.673   100.472 1.00 15.75 ? 5   ASP B OD2 1 
ATOM   1078 N N   . THR B 2 19  ? 2.103   3.412   102.659 1.00 12.60 ? 6   THR B N   1 
ATOM   1079 C CA  . THR B 2 19  ? 2.910   4.500   103.201 1.00 15.55 ? 6   THR B CA  1 
ATOM   1080 C C   . THR B 2 19  ? 2.091   5.687   103.696 1.00 16.46 ? 6   THR B C   1 
ATOM   1081 O O   . THR B 2 19  ? 2.388   6.259   104.746 1.00 17.52 ? 6   THR B O   1 
ATOM   1082 C CB  . THR B 2 19  ? 3.897   4.998   102.136 1.00 16.86 ? 6   THR B CB  1 
ATOM   1083 O OG1 . THR B 2 19  ? 4.648   3.884   101.645 1.00 21.77 ? 6   THR B OG1 1 
ATOM   1084 C CG2 . THR B 2 19  ? 4.842   6.060   102.698 1.00 19.83 ? 6   THR B CG2 1 
ATOM   1085 N N   . SER B 2 20  ? 1.063   6.060   102.941 1.00 13.92 ? 7   SER B N   1 
ATOM   1086 C CA  . SER B 2 20  ? 0.249   7.213   103.313 1.00 14.41 ? 7   SER B CA  1 
ATOM   1087 C C   . SER B 2 20  ? -0.378  7.008   104.688 1.00 17.33 ? 7   SER B C   1 
ATOM   1088 O O   . SER B 2 20  ? -0.526  7.959   105.458 1.00 15.52 ? 7   SER B O   1 
ATOM   1089 C CB  . SER B 2 20  ? -0.831  7.479   102.260 1.00 15.59 ? 7   SER B CB  1 
ATOM   1090 O OG  . SER B 2 20  ? -1.609  6.323   102.016 1.00 16.15 ? 7   SER B OG  1 
ATOM   1091 N N   . PHE B 2 21  ? -0.720  5.764   105.008 1.00 15.39 ? 8   PHE B N   1 
ATOM   1092 C CA  . PHE B 2 21  ? -1.306  5.473   106.312 1.00 14.60 ? 8   PHE B CA  1 
ATOM   1093 C C   . PHE B 2 21  ? -0.242  5.409   107.408 1.00 13.26 ? 8   PHE B C   1 
ATOM   1094 O O   . PHE B 2 21  ? -0.420  6.000   108.474 1.00 14.30 ? 8   PHE B O   1 
ATOM   1095 C CB  . PHE B 2 21  ? -2.100  4.165   106.289 1.00 16.40 ? 8   PHE B CB  1 
ATOM   1096 C CG  . PHE B 2 21  ? -2.786  3.862   107.595 1.00 16.75 ? 8   PHE B CG  1 
ATOM   1097 C CD1 . PHE B 2 21  ? -4.062  4.340   107.848 1.00 17.60 ? 8   PHE B CD1 1 
ATOM   1098 C CD2 . PHE B 2 21  ? -2.142  3.127   108.579 1.00 17.31 ? 8   PHE B CD2 1 
ATOM   1099 C CE1 . PHE B 2 21  ? -4.687  4.080   109.052 1.00 20.28 ? 8   PHE B CE1 1 
ATOM   1100 C CE2 . PHE B 2 21  ? -2.761  2.868   109.786 1.00 20.20 ? 8   PHE B CE2 1 
ATOM   1101 C CZ  . PHE B 2 21  ? -4.035  3.343   110.022 1.00 19.76 ? 8   PHE B CZ  1 
ATOM   1102 N N   . TRP B 2 22  ? 0.848   4.688   107.153 1.00 12.73 ? 9   TRP B N   1 
ATOM   1103 C CA  . TRP B 2 22  ? 1.924   4.579   108.135 1.00 12.69 ? 9   TRP B CA  1 
ATOM   1104 C C   . TRP B 2 22  ? 2.444   5.955   108.537 1.00 13.76 ? 9   TRP B C   1 
ATOM   1105 O O   . TRP B 2 22  ? 2.709   6.216   109.712 1.00 15.52 ? 9   TRP B O   1 
ATOM   1106 C CB  . TRP B 2 22  ? 3.097   3.753   107.597 1.00 13.75 ? 9   TRP B CB  1 
ATOM   1107 C CG  . TRP B 2 22  ? 2.910   2.264   107.480 1.00 13.37 ? 9   TRP B CG  1 
ATOM   1108 C CD1 . TRP B 2 22  ? 3.228   1.497   106.398 1.00 14.58 ? 9   TRP B CD1 1 
ATOM   1109 C CD2 . TRP B 2 22  ? 2.421   1.360   108.480 1.00 15.83 ? 9   TRP B CD2 1 
ATOM   1110 N NE1 . TRP B 2 22  ? 2.953   0.177   106.651 1.00 18.94 ? 9   TRP B NE1 1 
ATOM   1111 C CE2 . TRP B 2 22  ? 2.458   0.063   107.925 1.00 17.78 ? 9   TRP B CE2 1 
ATOM   1112 C CE3 . TRP B 2 22  ? 1.945   1.517   109.786 1.00 17.23 ? 9   TRP B CE3 1 
ATOM   1113 C CZ2 . TRP B 2 22  ? 2.037   -1.065  108.625 1.00 15.92 ? 9   TRP B CZ2 1 
ATOM   1114 C CZ3 . TRP B 2 22  ? 1.525   0.395   110.480 1.00 19.19 ? 9   TRP B CZ3 1 
ATOM   1115 C CH2 . TRP B 2 22  ? 1.576   -0.879  109.898 1.00 19.32 ? 9   TRP B CH2 1 
ATOM   1116 N N   . ALA B 2 23  ? 2.602   6.826   107.544 1.00 17.96 ? 10  ALA B N   1 
ATOM   1117 C CA  . ALA B 2 23  ? 3.118   8.171   107.770 1.00 18.42 ? 10  ALA B CA  1 
ATOM   1118 C C   . ALA B 2 23  ? 2.170   8.993   108.630 1.00 18.29 ? 10  ALA B C   1 
ATOM   1119 O O   . ALA B 2 23  ? 2.607   9.767   109.479 1.00 19.01 ? 10  ALA B O   1 
ATOM   1120 C CB  . ALA B 2 23  ? 3.367   8.872   106.449 1.00 23.37 ? 10  ALA B CB  1 
ATOM   1121 N N   . ALA B 2 24  ? 0.871   8.830   108.401 1.00 15.27 ? 11  ALA B N   1 
ATOM   1122 C CA  . ALA B 2 24  ? -0.125  9.524   109.207 1.00 16.69 ? 11  ALA B CA  1 
ATOM   1123 C C   . ALA B 2 24  ? -0.148  8.980   110.633 1.00 18.25 ? 11  ALA B C   1 
ATOM   1124 O O   . ALA B 2 24  ? -0.323  9.730   111.588 1.00 18.88 ? 11  ALA B O   1 
ATOM   1125 C CB  . ALA B 2 24  ? -1.506  9.404   108.574 1.00 17.07 ? 11  ALA B CB  1 
ATOM   1126 N N   . LEU B 2 25  ? 0.022   7.671   110.773 1.00 16.33 ? 12  LEU B N   1 
ATOM   1127 C CA  . LEU B 2 25  ? -0.037  7.045   112.091 1.00 19.92 ? 12  LEU B CA  1 
ATOM   1128 C C   . LEU B 2 25  ? 1.199   7.381   112.920 1.00 19.38 ? 12  LEU B C   1 
ATOM   1129 O O   . LEU B 2 25  ? 1.106   7.602   114.129 1.00 22.20 ? 12  LEU B O   1 
ATOM   1130 C CB  . LEU B 2 25  ? -0.188  5.526   111.958 1.00 19.66 ? 12  LEU B CB  1 
ATOM   1131 C CG  . LEU B 2 25  ? -0.533  4.769   113.242 1.00 19.16 ? 12  LEU B CG  1 
ATOM   1132 C CD1 . LEU B 2 25  ? -1.895  5.207   113.766 1.00 21.22 ? 12  LEU B CD1 1 
ATOM   1133 C CD2 . LEU B 2 25  ? -0.502  3.267   113.006 1.00 22.45 ? 12  LEU B CD2 1 
ATOM   1134 N N   . GLY B 2 26  ? 2.354   7.427   112.263 1.00 20.78 ? 13  GLY B N   1 
ATOM   1135 C CA  . GLY B 2 26  ? 3.615   7.642   112.952 1.00 22.11 ? 13  GLY B CA  1 
ATOM   1136 C C   . GLY B 2 26  ? 4.019   9.098   113.094 1.00 21.26 ? 13  GLY B C   1 
ATOM   1137 O O   . GLY B 2 26  ? 5.117   9.397   113.559 1.00 22.91 ? 13  GLY B O   1 
ATOM   1138 N N   . ASN B 2 27  ? 3.134   10.003  112.691 1.00 20.73 ? 14  ASN B N   1 
ATOM   1139 C CA  . ASN B 2 27  ? 3.384   11.434  112.807 1.00 24.11 ? 14  ASN B CA  1 
ATOM   1140 C C   . ASN B 2 27  ? 2.187   12.129  113.438 1.00 26.81 ? 14  ASN B C   1 
ATOM   1141 O O   . ASN B 2 27  ? 1.166   12.332  112.785 1.00 21.31 ? 14  ASN B O   1 
ATOM   1142 C CB  . ASN B 2 27  ? 3.698   12.032  111.433 1.00 22.28 ? 14  ASN B CB  1 
ATOM   1143 C CG  . ASN B 2 27  ? 3.831   13.548  111.457 1.00 30.94 ? 14  ASN B CG  1 
ATOM   1144 O OD1 . ASN B 2 27  ? 4.036   14.161  112.507 1.00 31.79 ? 14  ASN B OD1 1 
ATOM   1145 N ND2 . ASN B 2 27  ? 3.731   14.159  110.283 1.00 33.18 ? 14  ASN B ND2 1 
ATOM   1146 N N   . ALA B 2 28  ? 2.322   12.495  114.710 1.00 30.26 ? 15  ALA B N   1 
ATOM   1147 C CA  . ALA B 2 28  ? 1.230   13.119  115.450 1.00 33.37 ? 15  ALA B CA  1 
ATOM   1148 C C   . ALA B 2 28  ? 0.858   14.480  114.869 1.00 34.84 ? 15  ALA B C   1 
ATOM   1149 O O   . ALA B 2 28  ? -0.234  14.992  115.116 1.00 36.23 ? 15  ALA B O   1 
ATOM   1150 C CB  . ALA B 2 28  ? 1.599   13.253  116.921 1.00 37.29 ? 15  ALA B CB  1 
ATOM   1151 N N   . GLY B 2 29  ? 1.770   15.060  114.097 1.00 32.61 ? 16  GLY B N   1 
ATOM   1152 C CA  . GLY B 2 29  ? 1.536   16.346  113.468 1.00 32.15 ? 16  GLY B CA  1 
ATOM   1153 C C   . GLY B 2 29  ? 0.921   16.227  112.086 1.00 33.05 ? 16  GLY B C   1 
ATOM   1154 O O   . GLY B 2 29  ? 0.684   17.234  111.419 1.00 39.23 ? 16  GLY B O   1 
ATOM   1155 N N   . ASP B 2 30  ? 0.673   14.996  111.649 1.00 28.19 ? 17  ASP B N   1 
ATOM   1156 C CA  . ASP B 2 30  ? 0.003   14.754  110.375 1.00 21.23 ? 17  ASP B CA  1 
ATOM   1157 C C   . ASP B 2 30  ? -1.474  15.115  110.505 1.00 23.60 ? 17  ASP B C   1 
ATOM   1158 O O   . ASP B 2 30  ? -2.106  14.802  111.512 1.00 24.60 ? 17  ASP B O   1 
ATOM   1159 C CB  . ASP B 2 30  ? 0.169   13.294  109.940 1.00 19.04 ? 17  ASP B CB  1 
ATOM   1160 C CG  . ASP B 2 30  ? -0.276  13.053  108.504 1.00 24.19 ? 17  ASP B CG  1 
ATOM   1161 O OD1 . ASP B 2 30  ? -1.496  13.082  108.239 1.00 21.41 ? 17  ASP B OD1 1 
ATOM   1162 O OD2 . ASP B 2 30  ? 0.594   12.818  107.642 1.00 26.72 ? 17  ASP B OD2 1 
ATOM   1163 N N   . ALA B 2 31  ? -2.019  15.777  109.490 1.00 23.79 ? 18  ALA B N   1 
ATOM   1164 C CA  . ALA B 2 31  ? -3.410  16.214  109.529 1.00 25.43 ? 18  ALA B CA  1 
ATOM   1165 C C   . ALA B 2 31  ? -4.372  15.038  109.671 1.00 21.75 ? 18  ALA B C   1 
ATOM   1166 O O   . ALA B 2 31  ? -5.462  15.182  110.224 1.00 24.86 ? 18  ALA B O   1 
ATOM   1167 C CB  . ALA B 2 31  ? -3.745  17.018  108.285 1.00 25.10 ? 18  ALA B CB  1 
ATOM   1168 N N   . ARG B 2 32  ? -3.960  13.874  109.182 1.00 21.57 ? 19  ARG B N   1 
ATOM   1169 C CA  . ARG B 2 32  ? -4.809  12.687  109.217 1.00 21.11 ? 19  ARG B CA  1 
ATOM   1170 C C   . ARG B 2 32  ? -4.437  11.734  110.354 1.00 20.38 ? 19  ARG B C   1 
ATOM   1171 O O   . ARG B 2 32  ? -4.868  10.580  110.368 1.00 20.11 ? 19  ARG B O   1 
ATOM   1172 C CB  . ARG B 2 32  ? -4.741  11.952  107.872 1.00 23.79 ? 19  ARG B CB  1 
ATOM   1173 C CG  . ARG B 2 32  ? -5.348  12.732  106.712 1.00 31.80 ? 19  ARG B CG  1 
ATOM   1174 C CD  . ARG B 2 32  ? -5.481  11.879  105.460 1.00 37.25 ? 19  ARG B CD  1 
ATOM   1175 N NE  . ARG B 2 32  ? -4.218  11.751  104.738 1.00 40.86 ? 19  ARG B NE  1 
ATOM   1176 C CZ  . ARG B 2 32  ? -4.056  12.069  103.458 1.00 42.34 ? 19  ARG B CZ  1 
ATOM   1177 N NH1 . ARG B 2 32  ? -5.081  12.533  102.756 1.00 48.81 ? 19  ARG B NH1 1 
ATOM   1178 N NH2 . ARG B 2 32  ? -2.874  11.918  102.879 1.00 41.63 ? 19  ARG B NH2 1 
ATOM   1179 N N   . HIS B 2 33  ? -3.649  12.218  111.309 1.00 19.02 ? 20  HIS B N   1 
ATOM   1180 C CA  . HIS B 2 33  ? -3.185  11.378  112.417 1.00 17.71 ? 20  HIS B CA  1 
ATOM   1181 C C   . HIS B 2 33  ? -4.340  10.819  113.246 1.00 19.41 ? 20  HIS B C   1 
ATOM   1182 O O   . HIS B 2 33  ? -4.358  9.632   113.578 1.00 18.70 ? 20  HIS B O   1 
ATOM   1183 C CB  . HIS B 2 33  ? -2.237  12.160  113.326 1.00 17.75 ? 20  HIS B CB  1 
ATOM   1184 C CG  . HIS B 2 33  ? -1.705  11.356  114.471 1.00 21.69 ? 20  HIS B CG  1 
ATOM   1185 N ND1 . HIS B 2 33  ? -0.875  10.269  114.294 1.00 19.33 ? 20  HIS B ND1 1 
ATOM   1186 C CD2 . HIS B 2 33  ? -1.900  11.468  115.806 1.00 21.09 ? 20  HIS B CD2 1 
ATOM   1187 C CE1 . HIS B 2 33  ? -0.578  9.751   115.473 1.00 18.60 ? 20  HIS B CE1 1 
ATOM   1188 N NE2 . HIS B 2 33  ? -1.184  10.462  116.407 1.00 21.87 ? 20  HIS B NE2 1 
ATOM   1189 N N   . GLY B 2 34  ? -5.296  11.678  113.582 1.00 22.31 ? 21  GLY B N   1 
ATOM   1190 C CA  . GLY B 2 34  ? -6.459  11.257  114.342 1.00 25.44 ? 21  GLY B CA  1 
ATOM   1191 C C   . GLY B 2 34  ? -7.257  10.201  113.603 1.00 25.09 ? 21  GLY B C   1 
ATOM   1192 O O   . GLY B 2 34  ? -7.656  9.192   114.181 1.00 25.12 ? 21  GLY B O   1 
ATOM   1193 N N   . THR B 2 35  ? -7.476  10.437  112.312 1.00 25.99 ? 22  THR B N   1 
ATOM   1194 C CA  . THR B 2 35  ? -8.196  9.495   111.462 1.00 24.82 ? 22  THR B CA  1 
ATOM   1195 C C   . THR B 2 35  ? -7.466  8.158   111.386 1.00 22.24 ? 22  THR B C   1 
ATOM   1196 O O   . THR B 2 35  ? -8.089  7.095   111.425 1.00 22.82 ? 22  THR B O   1 
ATOM   1197 C CB  . THR B 2 35  ? -8.382  10.055  110.039 1.00 27.48 ? 22  THR B CB  1 
ATOM   1198 O OG1 . THR B 2 35  ? -9.178  11.246  110.094 1.00 32.47 ? 22  THR B OG1 1 
ATOM   1199 C CG2 . THR B 2 35  ? -9.070  9.036   109.145 1.00 29.65 ? 22  THR B CG2 1 
ATOM   1200 N N   . ALA B 2 36  ? -6.142  8.220   111.281 1.00 20.95 ? 23  ALA B N   1 
ATOM   1201 C CA  . ALA B 2 36  ? -5.316  7.017   111.238 1.00 19.95 ? 23  ALA B CA  1 
ATOM   1202 C C   . ALA B 2 36  ? -5.453  6.195   112.519 1.00 20.01 ? 23  ALA B C   1 
ATOM   1203 O O   . ALA B 2 36  ? -5.594  4.973   112.468 1.00 19.09 ? 23  ALA B O   1 
ATOM   1204 C CB  . ALA B 2 36  ? -3.854  7.383   111.000 1.00 17.99 ? 23  ALA B CB  1 
ATOM   1205 N N   . LYS B 2 37  ? -5.412  6.866   113.667 1.00 20.80 ? 24  LYS B N   1 
ATOM   1206 C CA  . LYS B 2 37  ? -5.505  6.169   114.946 1.00 21.03 ? 24  LYS B CA  1 
ATOM   1207 C C   . LYS B 2 37  ? -6.852  5.475   115.110 1.00 23.75 ? 24  LYS B C   1 
ATOM   1208 O O   . LYS B 2 37  ? -6.924  4.371   115.648 1.00 24.50 ? 24  LYS B O   1 
ATOM   1209 C CB  . LYS B 2 37  ? -5.267  7.131   116.114 1.00 24.10 ? 24  LYS B CB  1 
ATOM   1210 C CG  . LYS B 2 37  ? -3.813  7.538   116.286 1.00 28.17 ? 24  LYS B CG  1 
ATOM   1211 C CD  . LYS B 2 37  ? -3.559  8.109   117.673 1.00 35.86 ? 24  LYS B CD  1 
ATOM   1212 C CE  . LYS B 2 37  ? -4.422  9.327   117.941 1.00 39.09 ? 24  LYS B CE  1 
ATOM   1213 N NZ  . LYS B 2 37  ? -4.112  9.933   119.265 1.00 44.11 ? 24  LYS B NZ  1 
ATOM   1214 N N   . ARG B 2 38  ? -7.916  6.120   114.642 1.00 25.15 ? 25  ARG B N   1 
ATOM   1215 C CA  . ARG B 2 38  ? -9.249  5.530   114.723 1.00 27.27 ? 25  ARG B CA  1 
ATOM   1216 C C   . ARG B 2 38  ? -9.338  4.288   113.841 1.00 26.35 ? 25  ARG B C   1 
ATOM   1217 O O   . ARG B 2 38  ? -9.885  3.263   114.250 1.00 28.11 ? 25  ARG B O   1 
ATOM   1218 C CB  . ARG B 2 38  ? -10.322 6.546   114.323 1.00 31.54 ? 25  ARG B CB  1 
ATOM   1219 C CG  . ARG B 2 38  ? -10.497 7.684   115.320 1.00 42.10 ? 25  ARG B CG  1 
ATOM   1220 C CD  . ARG B 2 38  ? -11.772 8.475   115.054 1.00 52.04 ? 25  ARG B CD  1 
ATOM   1221 N NE  . ARG B 2 38  ? -11.757 9.144   113.755 1.00 57.19 ? 25  ARG B NE  1 
ATOM   1222 C CZ  . ARG B 2 38  ? -11.239 10.349  113.541 1.00 61.66 ? 25  ARG B CZ  1 
ATOM   1223 N NH1 . ARG B 2 38  ? -10.691 11.026  114.542 1.00 62.29 ? 25  ARG B NH1 1 
ATOM   1224 N NH2 . ARG B 2 38  ? -11.270 10.881  112.326 1.00 64.19 ? 25  ARG B NH2 1 
ATOM   1225 N N   . LEU B 2 39  ? -8.792  4.383   112.633 1.00 24.18 ? 26  LEU B N   1 
ATOM   1226 C CA  . LEU B 2 39  ? -8.767  3.249   111.717 1.00 25.83 ? 26  LEU B CA  1 
ATOM   1227 C C   . LEU B 2 39  ? -7.926  2.104   112.268 1.00 27.41 ? 26  LEU B C   1 
ATOM   1228 O O   . LEU B 2 39  ? -8.288  0.936   112.135 1.00 26.23 ? 26  LEU B O   1 
ATOM   1229 C CB  . LEU B 2 39  ? -8.228  3.672   110.350 1.00 26.07 ? 26  LEU B CB  1 
ATOM   1230 C CG  . LEU B 2 39  ? -9.197  4.450   109.463 1.00 25.88 ? 26  LEU B CG  1 
ATOM   1231 C CD1 . LEU B 2 39  ? -8.473  5.020   108.251 1.00 27.49 ? 26  LEU B CD1 1 
ATOM   1232 C CD2 . LEU B 2 39  ? -10.339 3.546   109.037 1.00 26.85 ? 26  LEU B CD2 1 
ATOM   1233 N N   . TRP B 2 40  ? -6.793  2.450   112.871 1.00 25.46 ? 27  TRP B N   1 
ATOM   1234 C CA  . TRP B 2 40  ? -5.899  1.459   113.458 1.00 21.64 ? 27  TRP B CA  1 
ATOM   1235 C C   . TRP B 2 40  ? -6.601  0.675   114.561 1.00 25.96 ? 27  TRP B C   1 
ATOM   1236 O O   . TRP B 2 40  ? -6.369  -0.523  114.730 1.00 28.58 ? 27  TRP B O   1 
ATOM   1237 C CB  . TRP B 2 40  ? -4.645  2.140   114.008 1.00 21.89 ? 27  TRP B CB  1 
ATOM   1238 C CG  . TRP B 2 40  ? -3.553  1.191   114.389 1.00 25.13 ? 27  TRP B CG  1 
ATOM   1239 C CD1 . TRP B 2 40  ? -3.068  0.961   115.644 1.00 30.56 ? 27  TRP B CD1 1 
ATOM   1240 C CD2 . TRP B 2 40  ? -2.808  0.344   113.508 1.00 27.43 ? 27  TRP B CD2 1 
ATOM   1241 N NE1 . TRP B 2 40  ? -2.067  0.021   115.598 1.00 31.40 ? 27  TRP B NE1 1 
ATOM   1242 C CE2 . TRP B 2 40  ? -1.888  -0.374  114.298 1.00 28.78 ? 27  TRP B CE2 1 
ATOM   1243 C CE3 . TRP B 2 40  ? -2.830  0.121   112.127 1.00 25.19 ? 27  TRP B CE3 1 
ATOM   1244 C CZ2 . TRP B 2 40  ? -0.997  -1.296  113.754 1.00 30.45 ? 27  TRP B CZ2 1 
ATOM   1245 C CZ3 . TRP B 2 40  ? -1.946  -0.794  111.589 1.00 29.02 ? 27  TRP B CZ3 1 
ATOM   1246 C CH2 . TRP B 2 40  ? -1.042  -1.493  112.403 1.00 31.57 ? 27  TRP B CH2 1 
ATOM   1247 N N   . ALA B 2 41  ? -7.465  1.356   115.307 1.00 25.98 ? 28  ALA B N   1 
ATOM   1248 C CA  . ALA B 2 41  ? -8.164  0.734   116.425 1.00 30.32 ? 28  ALA B CA  1 
ATOM   1249 C C   . ALA B 2 41  ? -9.262  -0.219  115.959 1.00 31.46 ? 28  ALA B C   1 
ATOM   1250 O O   . ALA B 2 41  ? -9.647  -1.128  116.690 1.00 35.63 ? 28  ALA B O   1 
ATOM   1251 C CB  . ALA B 2 41  ? -8.746  1.803   117.342 1.00 31.33 ? 28  ALA B CB  1 
ATOM   1252 N N   . SER B 2 42  ? -9.763  -0.016  114.743 1.00 31.83 ? 29  SER B N   1 
ATOM   1253 C CA  . SER B 2 42  ? -10.856 -0.844  114.232 1.00 36.01 ? 29  SER B CA  1 
ATOM   1254 C C   . SER B 2 42  ? -10.395 -1.782  113.119 1.00 35.82 ? 29  SER B C   1 
ATOM   1255 O O   . SER B 2 42  ? -11.214 -2.348  112.394 1.00 33.41 ? 29  SER B O   1 
ATOM   1256 C CB  . SER B 2 42  ? -12.002 0.035   113.727 1.00 36.17 ? 29  SER B CB  1 
ATOM   1257 O OG  . SER B 2 42  ? -11.587 0.826   112.627 1.00 34.68 ? 29  SER B OG  1 
ATOM   1258 N N   . LYS B 2 43  ? -9.082  -1.950  112.991 1.00 29.59 ? 30  LYS B N   1 
ATOM   1259 C CA  . LYS B 2 43  ? -8.520  -2.795  111.944 1.00 29.51 ? 30  LYS B CA  1 
ATOM   1260 C C   . LYS B 2 43  ? -8.839  -4.272  112.182 1.00 34.11 ? 30  LYS B C   1 
ATOM   1261 O O   . LYS B 2 43  ? -9.075  -4.684  113.320 1.00 34.54 ? 30  LYS B O   1 
ATOM   1262 C CB  . LYS B 2 43  ? -7.004  -2.591  111.851 1.00 29.00 ? 30  LYS B CB  1 
ATOM   1263 C CG  . LYS B 2 43  ? -6.225  -3.137  113.033 1.00 32.68 ? 30  LYS B CG  1 
ATOM   1264 C CD  . LYS B 2 43  ? -4.741  -2.845  112.891 1.00 33.08 ? 30  LYS B CD  1 
ATOM   1265 C CE  . LYS B 2 43  ? -3.984  -3.229  114.148 1.00 34.24 ? 30  LYS B CE  1 
ATOM   1266 N NZ  . LYS B 2 43  ? -4.506  -2.502  115.340 1.00 31.92 ? 30  LYS B NZ  1 
ATOM   1267 N N   . PRO B 2 44  ? -8.860  -5.071  111.101 1.00 33.65 ? 31  PRO B N   1 
ATOM   1268 C CA  . PRO B 2 44  ? -9.053  -6.523  111.179 1.00 37.16 ? 31  PRO B CA  1 
ATOM   1269 C C   . PRO B 2 44  ? -7.810  -7.231  111.732 1.00 38.00 ? 31  PRO B C   1 
ATOM   1270 O O   . PRO B 2 44  ? -6.769  -6.588  111.870 1.00 35.62 ? 31  PRO B O   1 
ATOM   1271 C CB  . PRO B 2 44  ? -9.319  -6.912  109.720 1.00 38.17 ? 31  PRO B CB  1 
ATOM   1272 C CG  . PRO B 2 44  ? -8.615  -5.889  108.933 1.00 37.40 ? 31  PRO B CG  1 
ATOM   1273 C CD  . PRO B 2 44  ? -8.785  -4.611  109.702 1.00 36.29 ? 31  PRO B CD  1 
ATOM   1274 N N   . PRO B 2 45  ? -7.914  -8.535  112.050 1.00 41.90 ? 32  PRO B N   1 
ATOM   1275 C CA  . PRO B 2 45  ? -6.776  -9.255  112.638 1.00 43.86 ? 32  PRO B CA  1 
ATOM   1276 C C   . PRO B 2 45  ? -5.576  -9.428  111.707 1.00 47.01 ? 32  PRO B C   1 
ATOM   1277 O O   . PRO B 2 45  ? -4.444  -9.473  112.186 1.00 45.82 ? 32  PRO B O   1 
ATOM   1278 C CB  . PRO B 2 45  ? -7.372  -10.623 112.984 1.00 48.95 ? 32  PRO B CB  1 
ATOM   1279 C CG  . PRO B 2 45  ? -8.539  -10.767 112.071 1.00 49.39 ? 32  PRO B CG  1 
ATOM   1280 C CD  . PRO B 2 45  ? -9.110  -9.393  111.966 1.00 45.38 ? 32  PRO B CD  1 
ATOM   1281 N N   . VAL B 2 46  ? -5.817  -9.533  110.403 1.00 37.87 ? 33  VAL B N   1 
ATOM   1282 C CA  . VAL B 2 46  ? -4.732  -9.758  109.453 1.00 35.10 ? 33  VAL B CA  1 
ATOM   1283 C C   . VAL B 2 46  ? -4.258  -8.453  108.816 1.00 32.37 ? 33  VAL B C   1 
ATOM   1284 O O   . VAL B 2 46  ? -4.965  -7.848  108.011 1.00 31.01 ? 33  VAL B O   1 
ATOM   1285 C CB  . VAL B 2 46  ? -5.155  -10.743 108.350 1.00 35.94 ? 33  VAL B CB  1 
ATOM   1286 C CG1 . VAL B 2 46  ? -3.980  -11.047 107.439 1.00 34.76 ? 33  VAL B CG1 1 
ATOM   1287 C CG2 . VAL B 2 46  ? -5.695  -12.024 108.973 1.00 39.64 ? 33  VAL B CG2 1 
ATOM   1288 N N   . VAL B 2 47  ? -3.052  -8.030  109.184 1.00 30.58 ? 34  VAL B N   1 
ATOM   1289 C CA  . VAL B 2 47  ? -2.505  -6.758  108.728 1.00 25.48 ? 34  VAL B CA  1 
ATOM   1290 C C   . VAL B 2 47  ? -1.187  -6.947  107.982 1.00 25.30 ? 34  VAL B C   1 
ATOM   1291 O O   . VAL B 2 47  ? -0.204  -7.432  108.541 1.00 26.49 ? 34  VAL B O   1 
ATOM   1292 C CB  . VAL B 2 47  ? -2.293  -5.796  109.910 1.00 22.57 ? 34  VAL B CB  1 
ATOM   1293 C CG1 . VAL B 2 47  ? -1.703  -4.483  109.435 1.00 20.02 ? 34  VAL B CG1 1 
ATOM   1294 C CG2 . VAL B 2 47  ? -3.611  -5.559  110.626 1.00 28.66 ? 34  VAL B CG2 1 
ATOM   1295 N N   . MET B 2 48  ? -1.174  -6.553  106.714 1.00 19.50 ? 35  MET B N   1 
ATOM   1296 C CA  . MET B 2 48  ? -0.015  -6.776  105.860 1.00 17.76 ? 35  MET B CA  1 
ATOM   1297 C C   . MET B 2 48  ? 0.533   -5.467  105.301 1.00 17.25 ? 35  MET B C   1 
ATOM   1298 O O   . MET B 2 48  ? -0.208  -4.510  105.105 1.00 15.03 ? 35  MET B O   1 
ATOM   1299 C CB  . MET B 2 48  ? -0.386  -7.720  104.716 1.00 22.07 ? 35  MET B CB  1 
ATOM   1300 C CG  . MET B 2 48  ? 0.787   -8.206  103.886 1.00 28.71 ? 35  MET B CG  1 
ATOM   1301 S SD  . MET B 2 48  ? 0.245   -9.385  102.636 1.00 43.88 ? 35  MET B SD  1 
ATOM   1302 C CE  . MET B 2 48  ? -0.594  -10.597 103.656 1.00 29.77 ? 35  MET B CE  1 
ATOM   1303 N N   . THR B 2 49  ? 1.838   -5.435  105.058 1.00 16.42 ? 36  THR B N   1 
ATOM   1304 C CA  . THR B 2 49  ? 2.458   -4.338  104.330 1.00 14.26 ? 36  THR B CA  1 
ATOM   1305 C C   . THR B 2 49  ? 3.628   -4.925  103.540 1.00 16.66 ? 36  THR B C   1 
ATOM   1306 O O   . THR B 2 49  ? 3.743   -6.145  103.439 1.00 20.35 ? 36  THR B O   1 
ATOM   1307 C CB  . THR B 2 49  ? 2.915   -3.197  105.271 1.00 15.12 ? 36  THR B CB  1 
ATOM   1308 O OG1 . THR B 2 49  ? 3.237   -2.032  104.497 1.00 15.30 ? 36  THR B OG1 1 
ATOM   1309 C CG2 . THR B 2 49  ? 4.115   -3.611  106.122 1.00 16.70 ? 36  THR B CG2 1 
ATOM   1310 N N   . SER B 2 50  ? 4.477   -4.082  102.961 1.00 13.87 ? 37  SER B N   1 
ATOM   1311 C CA  . SER B 2 50  ? 5.593   -4.593  102.165 1.00 15.95 ? 37  SER B CA  1 
ATOM   1312 C C   . SER B 2 50  ? 6.915   -3.932  102.525 1.00 15.01 ? 37  SER B C   1 
ATOM   1313 O O   . SER B 2 50  ? 6.942   -2.886  103.171 1.00 12.56 ? 37  SER B O   1 
ATOM   1314 C CB  . SER B 2 50  ? 5.327   -4.403  100.671 1.00 19.49 ? 37  SER B CB  1 
ATOM   1315 O OG  . SER B 2 50  ? 5.581   -3.064  100.275 1.00 15.75 ? 37  SER B OG  1 
ATOM   1316 N N   . ASN B 2 51  ? 8.011   -4.545  102.087 1.00 14.01 ? 38  ASN B N   1 
ATOM   1317 C CA  . ASN B 2 51  ? 9.335   -3.978  102.312 1.00 16.63 ? 38  ASN B CA  1 
ATOM   1318 C C   . ASN B 2 51  ? 9.474   -2.629  101.612 1.00 17.71 ? 38  ASN B C   1 
ATOM   1319 O O   . ASN B 2 51  ? 10.059  -1.699  102.162 1.00 13.73 ? 38  ASN B O   1 
ATOM   1320 C CB  . ASN B 2 51  ? 10.427  -4.949  101.848 1.00 18.57 ? 38  ASN B CB  1 
ATOM   1321 C CG  . ASN B 2 51  ? 10.291  -5.335  100.386 1.00 20.86 ? 38  ASN B CG  1 
ATOM   1322 O OD1 . ASN B 2 51  ? 9.187   -5.540  99.883  1.00 20.40 ? 38  ASN B OD1 1 
ATOM   1323 N ND2 . ASN B 2 51  ? 11.422  -5.434  99.694  1.00 21.03 ? 38  ASN B ND2 1 
ATOM   1324 N N   . HIS B 2 52  ? 8.911   -2.510  100.410 1.00 15.16 ? 39  HIS B N   1 
ATOM   1325 C CA  . HIS B 2 52  ? 8.992   -1.250  99.679  1.00 15.82 ? 39  HIS B CA  1 
ATOM   1326 C C   . HIS B 2 52  ? 8.233   -0.144  100.407 1.00 17.01 ? 39  HIS B C   1 
ATOM   1327 O O   . HIS B 2 52  ? 8.697   0.997   100.474 1.00 14.63 ? 39  HIS B O   1 
ATOM   1328 C CB  . HIS B 2 52  ? 8.458   -1.409  98.251  1.00 16.06 ? 39  HIS B CB  1 
ATOM   1329 C CG  . HIS B 2 52  ? 9.364   -2.189  97.350  1.00 18.71 ? 39  HIS B CG  1 
ATOM   1330 N ND1 . HIS B 2 52  ? 10.547  -1.678  96.860  1.00 22.09 ? 39  HIS B ND1 1 
ATOM   1331 C CD2 . HIS B 2 52  ? 9.258   -3.440  96.842  1.00 25.15 ? 39  HIS B CD2 1 
ATOM   1332 C CE1 . HIS B 2 52  ? 11.132  -2.581  96.094  1.00 25.14 ? 39  HIS B CE1 1 
ATOM   1333 N NE2 . HIS B 2 52  ? 10.371  -3.660  96.068  1.00 23.35 ? 39  HIS B NE2 1 
ATOM   1334 N N   . VAL B 2 53  ? 7.077   -0.487  100.968 1.00 13.82 ? 40  VAL B N   1 
ATOM   1335 C CA  . VAL B 2 53  ? 6.270   0.483   101.701 1.00 12.09 ? 40  VAL B CA  1 
ATOM   1336 C C   . VAL B 2 53  ? 6.986   0.943   102.971 1.00 12.53 ? 40  VAL B C   1 
ATOM   1337 O O   . VAL B 2 53  ? 7.045   2.141   103.256 1.00 14.32 ? 40  VAL B O   1 
ATOM   1338 C CB  . VAL B 2 53  ? 4.886   -0.089  102.069 1.00 11.04 ? 40  VAL B CB  1 
ATOM   1339 C CG1 . VAL B 2 53  ? 4.243   0.729   103.187 1.00 14.40 ? 40  VAL B CG1 1 
ATOM   1340 C CG2 . VAL B 2 53  ? 3.985   -0.120  100.840 1.00 14.10 ? 40  VAL B CG2 1 
ATOM   1341 N N   . LEU B 2 54  ? 7.534   -0.006  103.726 1.00 11.67 ? 41  LEU B N   1 
ATOM   1342 C CA  . LEU B 2 54  ? 8.230   0.343   104.960 1.00 12.59 ? 41  LEU B CA  1 
ATOM   1343 C C   . LEU B 2 54  ? 9.419   1.241   104.650 1.00 15.32 ? 41  LEU B C   1 
ATOM   1344 O O   . LEU B 2 54  ? 9.685   2.203   105.367 1.00 15.81 ? 41  LEU B O   1 
ATOM   1345 C CB  . LEU B 2 54  ? 8.688   -0.907  105.713 1.00 15.82 ? 41  LEU B CB  1 
ATOM   1346 C CG  . LEU B 2 54  ? 7.598   -1.673  106.466 1.00 21.79 ? 41  LEU B CG  1 
ATOM   1347 C CD1 . LEU B 2 54  ? 8.201   -2.776  107.336 1.00 23.27 ? 41  LEU B CD1 1 
ATOM   1348 C CD2 . LEU B 2 54  ? 6.757   -0.714  107.306 1.00 21.41 ? 41  LEU B CD2 1 
ATOM   1349 N N   . GLY B 2 55  ? 10.125  0.926   103.571 1.00 15.64 ? 42  GLY B N   1 
ATOM   1350 C CA  . GLY B 2 55  ? 11.238  1.748   103.140 1.00 14.53 ? 42  GLY B CA  1 
ATOM   1351 C C   . GLY B 2 55  ? 10.802  3.161   102.806 1.00 16.49 ? 42  GLY B C   1 
ATOM   1352 O O   . GLY B 2 55  ? 11.441  4.128   103.214 1.00 16.03 ? 42  GLY B O   1 
ATOM   1353 N N   . GLU B 2 56  ? 9.703   3.279   102.067 1.00 11.58 ? 43  GLU B N   1 
ATOM   1354 C CA  . GLU B 2 56  ? 9.203   4.577   101.644 1.00 14.85 ? 43  GLU B CA  1 
ATOM   1355 C C   . GLU B 2 56  ? 8.718   5.354   102.861 1.00 13.30 ? 43  GLU B C   1 
ATOM   1356 O O   . GLU B 2 56  ? 8.846   6.576   102.926 1.00 16.23 ? 43  GLU B O   1 
ATOM   1357 C CB  . GLU B 2 56  ? 8.076   4.411   100.618 1.00 18.01 ? 43  GLU B CB  1 
ATOM   1358 C CG  . GLU B 2 56  ? 7.575   5.707   100.004 1.00 19.88 ? 43  GLU B CG  1 
ATOM   1359 C CD  . GLU B 2 56  ? 6.365   5.494   99.106  1.00 24.07 ? 43  GLU B CD  1 
ATOM   1360 O OE1 . GLU B 2 56  ? 5.596   4.547   99.356  1.00 24.58 ? 43  GLU B OE1 1 
ATOM   1361 O OE2 . GLU B 2 56  ? 6.190   6.272   98.150  1.00 28.52 ? 43  GLU B OE2 1 
ATOM   1362 N N   . THR B 2 57  ? 8.178   4.621   103.829 1.00 13.03 ? 44  THR B N   1 
ATOM   1363 C CA  . THR B 2 57  ? 7.704   5.201   105.083 1.00 15.34 ? 44  THR B CA  1 
ATOM   1364 C C   . THR B 2 57  ? 8.853   5.753   105.925 1.00 14.10 ? 44  THR B C   1 
ATOM   1365 O O   . THR B 2 57  ? 8.748   6.853   106.468 1.00 15.08 ? 44  THR B O   1 
ATOM   1366 C CB  . THR B 2 57  ? 6.914   4.165   105.901 1.00 16.38 ? 44  THR B CB  1 
ATOM   1367 O OG1 . THR B 2 57  ? 5.748   3.780   105.159 1.00 14.66 ? 44  THR B OG1 1 
ATOM   1368 C CG2 . THR B 2 57  ? 6.495   4.741   107.254 1.00 15.83 ? 44  THR B CG2 1 
ATOM   1369 N N   . TRP B 2 58  ? 9.942   4.995   106.034 1.00 12.94 ? 45  TRP B N   1 
ATOM   1370 C CA  . TRP B 2 58  ? 11.147  5.505   106.687 1.00 11.45 ? 45  TRP B CA  1 
ATOM   1371 C C   . TRP B 2 58  ? 11.554  6.849   106.097 1.00 14.48 ? 45  TRP B C   1 
ATOM   1372 O O   . TRP B 2 58  ? 11.757  7.830   106.815 1.00 14.95 ? 45  TRP B O   1 
ATOM   1373 C CB  . TRP B 2 58  ? 12.321  4.525   106.552 1.00 12.29 ? 45  TRP B CB  1 
ATOM   1374 C CG  . TRP B 2 58  ? 13.643  5.176   106.877 1.00 16.76 ? 45  TRP B CG  1 
ATOM   1375 C CD1 . TRP B 2 58  ? 14.442  5.883   106.023 1.00 15.35 ? 45  TRP B CD1 1 
ATOM   1376 C CD2 . TRP B 2 58  ? 14.294  5.208   108.152 1.00 16.01 ? 45  TRP B CD2 1 
ATOM   1377 N NE1 . TRP B 2 58  ? 15.551  6.350   106.686 1.00 17.77 ? 45  TRP B NE1 1 
ATOM   1378 C CE2 . TRP B 2 58  ? 15.485  5.948   107.994 1.00 20.20 ? 45  TRP B CE2 1 
ATOM   1379 C CE3 . TRP B 2 58  ? 13.992  4.676   109.409 1.00 17.21 ? 45  TRP B CE3 1 
ATOM   1380 C CZ2 . TRP B 2 58  ? 16.375  6.168   109.046 1.00 25.65 ? 45  TRP B CZ2 1 
ATOM   1381 C CZ3 . TRP B 2 58  ? 14.878  4.900   110.456 1.00 18.03 ? 45  TRP B CZ3 1 
ATOM   1382 C CH2 . TRP B 2 58  ? 16.053  5.638   110.265 1.00 26.04 ? 45  TRP B CH2 1 
ATOM   1383 N N   . THR B 2 59  ? 11.680  6.877   104.777 1.00 13.01 ? 46  THR B N   1 
ATOM   1384 C CA  . THR B 2 59  ? 12.214  8.039   104.089 1.00 14.74 ? 46  THR B CA  1 
ATOM   1385 C C   . THR B 2 59  ? 11.330  9.255   104.310 1.00 20.82 ? 46  THR B C   1 
ATOM   1386 O O   . THR B 2 59  ? 11.822  10.346  104.589 1.00 16.80 ? 46  THR B O   1 
ATOM   1387 C CB  . THR B 2 59  ? 12.369  7.755   102.589 1.00 17.42 ? 46  THR B CB  1 
ATOM   1388 O OG1 . THR B 2 59  ? 13.300  6.678   102.414 1.00 16.14 ? 46  THR B OG1 1 
ATOM   1389 C CG2 . THR B 2 59  ? 12.881  8.992   101.853 1.00 19.37 ? 46  THR B CG2 1 
ATOM   1390 N N   . LEU B 2 60  ? 10.021  9.049   104.216 1.00 16.58 ? 47  LEU B N   1 
ATOM   1391 C CA  . LEU B 2 60  ? 9.055   10.124  104.404 1.00 18.96 ? 47  LEU B CA  1 
ATOM   1392 C C   . LEU B 2 60  ? 9.074   10.671  105.835 1.00 19.05 ? 47  LEU B C   1 
ATOM   1393 O O   . LEU B 2 60  ? 9.127   11.884  106.042 1.00 23.97 ? 47  LEU B O   1 
ATOM   1394 C CB  . LEU B 2 60  ? 7.654   9.627   104.038 1.00 18.59 ? 47  LEU B CB  1 
ATOM   1395 C CG  . LEU B 2 60  ? 6.532   10.660  103.945 1.00 28.09 ? 47  LEU B CG  1 
ATOM   1396 C CD1 . LEU B 2 60  ? 6.918   11.787  103.010 1.00 30.69 ? 47  LEU B CD1 1 
ATOM   1397 C CD2 . LEU B 2 60  ? 5.253   9.991   103.471 1.00 31.04 ? 47  LEU B CD2 1 
ATOM   1398 N N   . LEU B 2 61  ? 9.042   9.773   106.818 1.00 18.59 ? 48  LEU B N   1 
ATOM   1399 C CA  . LEU B 2 61  ? 9.052   10.175  108.224 1.00 17.96 ? 48  LEU B CA  1 
ATOM   1400 C C   . LEU B 2 61  ? 10.385  10.804  108.639 1.00 17.64 ? 48  LEU B C   1 
ATOM   1401 O O   . LEU B 2 61  ? 10.416  11.740  109.442 1.00 21.33 ? 48  LEU B O   1 
ATOM   1402 C CB  . LEU B 2 61  ? 8.738   8.975   109.121 1.00 16.08 ? 48  LEU B CB  1 
ATOM   1403 C CG  . LEU B 2 61  ? 7.281   8.496   109.109 1.00 18.05 ? 48  LEU B CG  1 
ATOM   1404 C CD1 . LEU B 2 61  ? 7.086   7.317   110.054 1.00 16.05 ? 48  LEU B CD1 1 
ATOM   1405 C CD2 . LEU B 2 61  ? 6.354   9.636   109.481 1.00 18.29 ? 48  LEU B CD2 1 
ATOM   1406 N N   . ASN B 2 62  ? 11.482  10.291  108.091 1.00 17.44 ? 49  ASN B N   1 
ATOM   1407 C CA  . ASN B 2 62  ? 12.804  10.828  108.399 1.00 18.28 ? 49  ASN B CA  1 
ATOM   1408 C C   . ASN B 2 62  ? 12.920  12.257  107.876 1.00 20.33 ? 49  ASN B C   1 
ATOM   1409 O O   . ASN B 2 62  ? 13.538  13.118  108.505 1.00 23.05 ? 49  ASN B O   1 
ATOM   1410 C CB  . ASN B 2 62  ? 13.901  9.938   107.800 1.00 19.37 ? 49  ASN B CB  1 
ATOM   1411 C CG  . ASN B 2 62  ? 15.258  10.174  108.435 1.00 19.58 ? 49  ASN B CG  1 
ATOM   1412 O OD1 . ASN B 2 62  ? 15.349  10.635  109.569 1.00 20.67 ? 49  ASN B OD1 1 
ATOM   1413 N ND2 . ASN B 2 62  ? 16.319  9.858   107.704 1.00 20.74 ? 49  ASN B ND2 1 
ATOM   1414 N N   . ARG B 2 63  ? 12.300  12.504  106.728 1.00 22.74 ? 50  ARG B N   1 
ATOM   1415 C CA  . ARG B 2 63  ? 12.315  13.827  106.114 1.00 28.17 ? 50  ARG B CA  1 
ATOM   1416 C C   . ARG B 2 63  ? 11.396  14.810  106.830 1.00 29.08 ? 50  ARG B C   1 
ATOM   1417 O O   . ARG B 2 63  ? 11.786  15.942  107.110 1.00 31.84 ? 50  ARG B O   1 
ATOM   1418 C CB  . ARG B 2 63  ? 11.918  13.735  104.637 1.00 32.25 ? 50  ARG B CB  1 
ATOM   1419 C CG  . ARG B 2 63  ? 13.006  13.166  103.745 1.00 40.05 ? 50  ARG B CG  1 
ATOM   1420 C CD  . ARG B 2 63  ? 12.543  12.976  102.307 1.00 45.37 ? 50  ARG B CD  1 
ATOM   1421 N NE  . ARG B 2 63  ? 13.646  12.539  101.452 1.00 47.57 ? 50  ARG B NE  1 
ATOM   1422 C CZ  . ARG B 2 63  ? 13.496  11.979  100.256 1.00 46.80 ? 50  ARG B CZ  1 
ATOM   1423 N NH1 . ARG B 2 63  ? 12.281  11.773  99.766  1.00 42.63 ? 50  ARG B NH1 1 
ATOM   1424 N NH2 . ARG B 2 63  ? 14.563  11.615  99.555  1.00 47.58 ? 50  ARG B NH2 1 
ATOM   1425 N N   A ARG B 2 64  ? 10.181  14.366  107.134 0.57 29.96 ? 51  ARG B N   1 
ATOM   1426 N N   B ARG B 2 64  ? 10.174  14.376  107.118 0.43 30.10 ? 51  ARG B N   1 
ATOM   1427 C CA  A ARG B 2 64  ? 9.172   15.241  107.720 0.57 34.48 ? 51  ARG B CA  1 
ATOM   1428 C CA  B ARG B 2 64  ? 9.180   15.252  107.730 0.43 34.49 ? 51  ARG B CA  1 
ATOM   1429 C C   A ARG B 2 64  ? 9.375   15.464  109.217 0.57 38.06 ? 51  ARG B C   1 
ATOM   1430 C C   B ARG B 2 64  ? 9.435   15.479  109.214 0.43 38.11 ? 51  ARG B C   1 
ATOM   1431 O O   A ARG B 2 64  ? 9.221   16.581  109.709 0.57 40.12 ? 51  ARG B O   1 
ATOM   1432 O O   B ARG B 2 64  ? 9.370   16.609  109.697 0.43 40.23 ? 51  ARG B O   1 
ATOM   1433 C CB  A ARG B 2 64  ? 7.769   14.680  107.470 0.57 32.88 ? 51  ARG B CB  1 
ATOM   1434 C CB  B ARG B 2 64  ? 7.773   14.685  107.538 0.43 33.05 ? 51  ARG B CB  1 
ATOM   1435 C CG  A ARG B 2 64  ? 6.838   15.666  106.786 0.57 37.23 ? 51  ARG B CG  1 
ATOM   1436 C CG  B ARG B 2 64  ? 7.278   14.694  106.106 0.43 34.07 ? 51  ARG B CG  1 
ATOM   1437 C CD  A ARG B 2 64  ? 5.377   15.328  107.018 0.57 38.15 ? 51  ARG B CD  1 
ATOM   1438 C CD  B ARG B 2 64  ? 5.765   14.584  106.074 0.43 35.63 ? 51  ARG B CD  1 
ATOM   1439 N NE  A ARG B 2 64  ? 4.619   16.512  107.414 0.57 41.29 ? 51  ARG B NE  1 
ATOM   1440 N NE  B ARG B 2 64  ? 5.256   14.264  104.745 0.43 37.61 ? 51  ARG B NE  1 
ATOM   1441 C CZ  A ARG B 2 64  ? 3.298   16.622  107.331 0.57 42.06 ? 51  ARG B CZ  1 
ATOM   1442 C CZ  B ARG B 2 64  ? 4.227   13.455  104.521 0.43 38.89 ? 51  ARG B CZ  1 
ATOM   1443 N NH1 A ARG B 2 64  ? 2.574   15.616  106.859 0.57 39.80 ? 51  ARG B NH1 1 
ATOM   1444 N NH1 B ARG B 2 64  ? 3.599   12.884  105.541 0.43 37.89 ? 51  ARG B NH1 1 
ATOM   1445 N NH2 A ARG B 2 64  ? 2.699   17.740  107.716 0.57 47.82 ? 51  ARG B NH2 1 
ATOM   1446 N NH2 B ARG B 2 64  ? 3.824   13.215  103.281 0.43 40.08 ? 51  ARG B NH2 1 
HETATM 1447 N N   . CSO B 2 65  ? 9.714   14.402  109.939 1.00 21.42 ? 52  CSO B N   1 
HETATM 1448 C CA  . CSO B 2 65  ? 9.889   14.494  111.386 1.00 24.75 ? 52  CSO B CA  1 
HETATM 1449 C CB  . CSO B 2 65  ? 9.032   13.456  112.111 1.00 29.36 ? 52  CSO B CB  1 
HETATM 1450 S SG  . CSO B 2 65  ? 7.307   13.658  111.623 1.00 34.38 ? 52  CSO B SG  1 
HETATM 1451 C C   . CSO B 2 65  ? 11.333  14.423  111.865 1.00 24.27 ? 52  CSO B C   1 
HETATM 1452 O O   . CSO B 2 65  ? 11.589  14.472  113.071 1.00 32.89 ? 52  CSO B O   1 
HETATM 1453 O OD  . CSO B 2 65  ? 6.543   14.883  112.668 1.00 63.01 ? 52  CSO B OD  1 
ATOM   1454 N N   . GLY B 2 66  ? 12.067  13.426  111.392 1.00 33.43 ? 53  GLY B N   1 
ATOM   1455 C CA  . GLY B 2 66  ? 13.433  13.234  111.829 1.00 32.06 ? 53  GLY B CA  1 
ATOM   1456 C C   . GLY B 2 66  ? 13.703  11.787  112.173 1.00 28.93 ? 53  GLY B C   1 
ATOM   1457 O O   . GLY B 2 66  ? 12.832  10.932  112.020 1.00 22.30 ? 53  GLY B O   1 
ATOM   1458 N N   . HIS B 2 67  ? 14.910  11.524  112.660 1.00 26.62 ? 54  HIS B N   1 
ATOM   1459 C CA  . HIS B 2 67  ? 15.404  10.163  112.825 1.00 25.79 ? 54  HIS B CA  1 
ATOM   1460 C C   . HIS B 2 67  ? 14.597  9.327   113.821 1.00 26.26 ? 54  HIS B C   1 
ATOM   1461 O O   . HIS B 2 67  ? 14.336  8.150   113.573 1.00 24.97 ? 54  HIS B O   1 
ATOM   1462 C CB  . HIS B 2 67  ? 16.874  10.202  113.251 1.00 27.34 ? 54  HIS B CB  1 
ATOM   1463 C CG  . HIS B 2 67  ? 17.541  8.864   113.233 1.00 24.42 ? 54  HIS B CG  1 
ATOM   1464 N ND1 . HIS B 2 67  ? 17.680  8.087   114.362 1.00 24.88 ? 54  HIS B ND1 1 
ATOM   1465 C CD2 . HIS B 2 67  ? 18.096  8.159   112.219 1.00 23.57 ? 54  HIS B CD2 1 
ATOM   1466 C CE1 . HIS B 2 67  ? 18.297  6.963   114.045 1.00 27.01 ? 54  HIS B CE1 1 
ATOM   1467 N NE2 . HIS B 2 67  ? 18.560  6.981   112.751 1.00 27.26 ? 54  HIS B NE2 1 
ATOM   1468 N N   . ARG B 2 68  ? 14.197  9.931   114.936 1.00 23.97 ? 55  ARG B N   1 
ATOM   1469 C CA  . ARG B 2 68  ? 13.498  9.195   115.987 1.00 24.75 ? 55  ARG B CA  1 
ATOM   1470 C C   . ARG B 2 68  ? 12.147  8.661   115.509 1.00 23.76 ? 55  ARG B C   1 
ATOM   1471 O O   . ARG B 2 68  ? 11.820  7.496   115.726 1.00 24.57 ? 55  ARG B O   1 
ATOM   1472 C CB  . ARG B 2 68  ? 13.305  10.077  117.223 1.00 31.44 ? 55  ARG B CB  1 
ATOM   1473 C CG  . ARG B 2 68  ? 12.777  9.330   118.438 1.00 31.50 ? 55  ARG B CG  1 
ATOM   1474 C CD  . ARG B 2 68  ? 12.695  10.242  119.653 1.00 38.52 ? 55  ARG B CD  1 
ATOM   1475 N NE  . ARG B 2 68  ? 12.306  9.524   120.862 1.00 43.66 ? 55  ARG B NE  1 
ATOM   1476 C CZ  . ARG B 2 68  ? 11.050  9.376   121.269 1.00 52.05 ? 55  ARG B CZ  1 
ATOM   1477 N NH1 . ARG B 2 68  ? 10.058  9.893   120.557 1.00 52.17 ? 55  ARG B NH1 1 
ATOM   1478 N NH2 . ARG B 2 68  ? 10.784  8.708   122.387 1.00 54.96 ? 55  ARG B NH2 1 
ATOM   1479 N N   . ALA B 2 69  ? 11.365  9.516   114.861 1.00 24.38 ? 56  ALA B N   1 
ATOM   1480 C CA  . ALA B 2 69  ? 10.072  9.102   114.333 1.00 27.92 ? 56  ALA B CA  1 
ATOM   1481 C C   . ALA B 2 69  ? 10.240  8.003   113.286 1.00 25.38 ? 56  ALA B C   1 
ATOM   1482 O O   . ALA B 2 69  ? 9.439   7.069   113.212 1.00 27.46 ? 56  ALA B O   1 
ATOM   1483 C CB  . ALA B 2 69  ? 9.337   10.290  113.744 1.00 29.57 ? 56  ALA B CB  1 
ATOM   1484 N N   . ALA B 2 70  ? 11.293  8.121   112.485 1.00 21.78 ? 57  ALA B N   1 
ATOM   1485 C CA  . ALA B 2 70  ? 11.569  7.160   111.426 1.00 20.46 ? 57  ALA B CA  1 
ATOM   1486 C C   . ALA B 2 70  ? 11.936  5.798   112.014 1.00 19.41 ? 57  ALA B C   1 
ATOM   1487 O O   . ALA B 2 70  ? 11.563  4.758   111.475 1.00 16.24 ? 57  ALA B O   1 
ATOM   1488 C CB  . ALA B 2 70  ? 12.683  7.676   110.520 1.00 17.28 ? 57  ALA B CB  1 
ATOM   1489 N N   . VAL B 2 71  ? 12.648  5.809   113.136 1.00 19.08 ? 58  VAL B N   1 
ATOM   1490 C CA  . VAL B 2 71  ? 13.052  4.570   113.794 1.00 18.49 ? 58  VAL B CA  1 
ATOM   1491 C C   . VAL B 2 71  ? 11.824  3.756   114.216 1.00 19.76 ? 58  VAL B C   1 
ATOM   1492 O O   . VAL B 2 71  ? 11.833  2.523   114.176 1.00 22.29 ? 58  VAL B O   1 
ATOM   1493 C CB  . VAL B 2 71  ? 13.962  4.867   115.005 1.00 21.53 ? 58  VAL B CB  1 
ATOM   1494 C CG1 . VAL B 2 71  ? 14.083  3.661   115.913 1.00 26.60 ? 58  VAL B CG1 1 
ATOM   1495 C CG2 . VAL B 2 71  ? 15.336  5.307   114.523 1.00 19.51 ? 58  VAL B CG2 1 
ATOM   1496 N N   . ALA B 2 72  ? 10.755  4.454   114.579 1.00 20.34 ? 59  ALA B N   1 
ATOM   1497 C CA  . ALA B 2 72  ? 9.500   3.795   114.922 1.00 25.72 ? 59  ALA B CA  1 
ATOM   1498 C C   . ALA B 2 72  ? 8.973   2.967   113.751 1.00 27.67 ? 59  ALA B C   1 
ATOM   1499 O O   . ALA B 2 72  ? 8.477   1.857   113.937 1.00 28.69 ? 59  ALA B O   1 
ATOM   1500 C CB  . ALA B 2 72  ? 8.467   4.818   115.354 1.00 32.27 ? 59  ALA B CB  1 
ATOM   1501 N N   . ALA B 2 73  ? 9.094   3.510   112.543 1.00 26.90 ? 60  ALA B N   1 
ATOM   1502 C CA  . ALA B 2 73  ? 8.641   2.816   111.342 1.00 24.87 ? 60  ALA B CA  1 
ATOM   1503 C C   . ALA B 2 73  ? 9.534   1.622   111.025 1.00 23.62 ? 60  ALA B C   1 
ATOM   1504 O O   . ALA B 2 73  ? 9.059   0.583   110.564 1.00 24.75 ? 60  ALA B O   1 
ATOM   1505 C CB  . ALA B 2 73  ? 8.599   3.775   110.161 1.00 27.17 ? 60  ALA B CB  1 
ATOM   1506 N N   . ALA B 2 74  ? 10.831  1.780   111.271 1.00 21.32 ? 61  ALA B N   1 
ATOM   1507 C CA  . ALA B 2 74  ? 11.793  0.705   111.058 1.00 18.38 ? 61  ALA B CA  1 
ATOM   1508 C C   . ALA B 2 74  ? 11.434  -0.519  111.898 1.00 17.61 ? 61  ALA B C   1 
ATOM   1509 O O   . ALA B 2 74  ? 11.619  -1.658  111.472 1.00 19.50 ? 61  ALA B O   1 
ATOM   1510 C CB  . ALA B 2 74  ? 13.201  1.182   111.390 1.00 17.32 ? 61  ALA B CB  1 
ATOM   1511 N N   . ALA B 2 75  ? 10.902  -0.268  113.088 1.00 17.61 ? 62  ALA B N   1 
ATOM   1512 C CA  . ALA B 2 75  ? 10.603  -1.331  114.039 1.00 18.80 ? 62  ALA B CA  1 
ATOM   1513 C C   . ALA B 2 75  ? 9.422   -2.195  113.618 1.00 22.95 ? 62  ALA B C   1 
ATOM   1514 O O   . ALA B 2 75  ? 9.252   -3.304  114.123 1.00 23.30 ? 62  ALA B O   1 
ATOM   1515 C CB  . ALA B 2 75  ? 10.340  -0.741  115.398 1.00 20.29 ? 62  ALA B CB  1 
ATOM   1516 N N   . ILE B 2 76  ? 8.601   -1.682  112.706 1.00 21.16 ? 63  ILE B N   1 
ATOM   1517 C CA  . ILE B 2 76  ? 7.446   -2.431  112.217 1.00 20.91 ? 63  ILE B CA  1 
ATOM   1518 C C   . ILE B 2 76  ? 7.907   -3.741  111.576 1.00 21.07 ? 63  ILE B C   1 
ATOM   1519 O O   . ILE B 2 76  ? 7.210   -4.752  111.624 1.00 22.90 ? 63  ILE B O   1 
ATOM   1520 C CB  . ILE B 2 76  ? 6.623   -1.606  111.202 1.00 24.93 ? 63  ILE B CB  1 
ATOM   1521 C CG1 . ILE B 2 76  ? 6.101   -0.321  111.851 1.00 24.52 ? 63  ILE B CG1 1 
ATOM   1522 C CG2 . ILE B 2 76  ? 5.465   -2.424  110.643 1.00 25.76 ? 63  ILE B CG2 1 
ATOM   1523 C CD1 . ILE B 2 76  ? 5.354   0.590   110.892 1.00 22.41 ? 63  ILE B CD1 1 
ATOM   1524 N N   . ARG B 2 77  ? 9.104   -3.725  110.998 1.00 19.68 ? 64  ARG B N   1 
ATOM   1525 C CA  . ARG B 2 77  ? 9.664   -4.932  110.403 1.00 25.62 ? 64  ARG B CA  1 
ATOM   1526 C C   . ARG B 2 77  ? 9.915   -6.016  111.457 1.00 23.48 ? 64  ARG B C   1 
ATOM   1527 O O   . ARG B 2 77  ? 10.028  -7.193  111.121 1.00 24.05 ? 64  ARG B O   1 
ATOM   1528 C CB  . ARG B 2 77  ? 10.961  -4.613  109.662 1.00 22.56 ? 64  ARG B CB  1 
ATOM   1529 C CG  . ARG B 2 77  ? 12.204  -4.705  110.531 1.00 21.43 ? 64  ARG B CG  1 
ATOM   1530 C CD  . ARG B 2 77  ? 13.409  -4.097  109.839 1.00 19.04 ? 64  ARG B CD  1 
ATOM   1531 N NE  . ARG B 2 77  ? 14.651  -4.347  110.568 1.00 22.31 ? 64  ARG B NE  1 
ATOM   1532 C CZ  . ARG B 2 77  ? 15.070  -3.627  111.605 1.00 20.50 ? 64  ARG B CZ  1 
ATOM   1533 N NH1 . ARG B 2 77  ? 14.345  -2.606  112.042 1.00 18.86 ? 64  ARG B NH1 1 
ATOM   1534 N NH2 . ARG B 2 77  ? 16.216  -3.925  112.201 1.00 21.27 ? 64  ARG B NH2 1 
ATOM   1535 N N   . LEU B 2 78  ? 9.997   -5.617  112.726 1.00 21.83 ? 65  LEU B N   1 
ATOM   1536 C CA  . LEU B 2 78  ? 10.222  -6.559  113.821 1.00 23.70 ? 65  LEU B CA  1 
ATOM   1537 C C   . LEU B 2 78  ? 8.914   -7.103  114.390 1.00 25.83 ? 65  LEU B C   1 
ATOM   1538 O O   . LEU B 2 78  ? 8.924   -7.995  115.240 1.00 28.00 ? 65  LEU B O   1 
ATOM   1539 C CB  . LEU B 2 78  ? 11.021  -5.899  114.951 1.00 26.22 ? 65  LEU B CB  1 
ATOM   1540 C CG  . LEU B 2 78  ? 12.324  -5.181  114.591 1.00 22.83 ? 65  LEU B CG  1 
ATOM   1541 C CD1 . LEU B 2 78  ? 12.930  -4.538  115.823 1.00 25.97 ? 65  LEU B CD1 1 
ATOM   1542 C CD2 . LEU B 2 78  ? 13.307  -6.145  113.962 1.00 23.79 ? 65  LEU B CD2 1 
ATOM   1543 N N   . SER B 2 79  ? 7.791   -6.563  113.926 1.00 33.58 ? 66  SER B N   1 
ATOM   1544 C CA  . SER B 2 79  ? 6.486   -6.916  114.480 1.00 32.34 ? 66  SER B CA  1 
ATOM   1545 C C   . SER B 2 79  ? 6.137   -8.387  114.283 1.00 31.08 ? 66  SER B C   1 
ATOM   1546 O O   . SER B 2 79  ? 6.436   -8.975  113.246 1.00 26.47 ? 66  SER B O   1 
ATOM   1547 C CB  . SER B 2 79  ? 5.390   -6.047  113.861 1.00 27.37 ? 66  SER B CB  1 
ATOM   1548 O OG  . SER B 2 79  ? 4.120   -6.361  114.411 1.00 29.08 ? 66  SER B OG  1 
ATOM   1549 N N   . THR B 2 80  ? 5.510   -8.973  115.298 1.00 33.34 ? 67  THR B N   1 
ATOM   1550 C CA  . THR B 2 80  ? 4.982   -10.327 115.202 1.00 34.63 ? 67  THR B CA  1 
ATOM   1551 C C   . THR B 2 80  ? 3.514   -10.273 114.794 1.00 34.18 ? 67  THR B C   1 
ATOM   1552 O O   . THR B 2 80  ? 2.878   -11.302 114.570 1.00 38.93 ? 67  THR B O   1 
ATOM   1553 C CB  . THR B 2 80  ? 5.111   -11.088 116.533 1.00 36.59 ? 67  THR B CB  1 
ATOM   1554 O OG1 . THR B 2 80  ? 4.416   -10.367 117.557 1.00 37.28 ? 67  THR B OG1 1 
ATOM   1555 C CG2 . THR B 2 80  ? 6.576   -11.246 116.930 1.00 38.05 ? 67  THR B CG2 1 
ATOM   1556 N N   . VAL B 2 81  ? 2.989   -9.055  114.699 1.00 28.59 ? 68  VAL B N   1 
ATOM   1557 C CA  . VAL B 2 81  ? 1.574   -8.836  114.417 1.00 27.91 ? 68  VAL B CA  1 
ATOM   1558 C C   . VAL B 2 81  ? 1.347   -8.383  112.976 1.00 32.87 ? 68  VAL B C   1 
ATOM   1559 O O   . VAL B 2 81  ? 0.440   -8.864  112.294 1.00 38.71 ? 68  VAL B O   1 
ATOM   1560 C CB  . VAL B 2 81  ? 0.981   -7.793  115.386 1.00 38.00 ? 68  VAL B CB  1 
ATOM   1561 C CG1 . VAL B 2 81  ? -0.397  -7.362  114.934 1.00 43.34 ? 68  VAL B CG1 1 
ATOM   1562 C CG2 . VAL B 2 81  ? 0.929   -8.358  116.792 1.00 38.95 ? 68  VAL B CG2 1 
ATOM   1563 N N   . VAL B 2 82  ? 2.179   -7.460  112.512 1.00 25.06 ? 69  VAL B N   1 
ATOM   1564 C CA  . VAL B 2 82  ? 2.095   -6.994  111.135 1.00 23.25 ? 69  VAL B CA  1 
ATOM   1565 C C   . VAL B 2 82  ? 2.926   -7.892  110.226 1.00 27.40 ? 69  VAL B C   1 
ATOM   1566 O O   . VAL B 2 82  ? 4.109   -8.114  110.477 1.00 29.56 ? 69  VAL B O   1 
ATOM   1567 C CB  . VAL B 2 82  ? 2.572   -5.538  111.000 1.00 19.81 ? 69  VAL B CB  1 
ATOM   1568 C CG1 . VAL B 2 82  ? 2.557   -5.109  109.538 1.00 24.90 ? 69  VAL B CG1 1 
ATOM   1569 C CG2 . VAL B 2 82  ? 1.707   -4.616  111.847 1.00 20.12 ? 69  VAL B CG2 1 
ATOM   1570 N N   . ARG B 2 83  ? 2.295   -8.416  109.180 1.00 28.40 ? 70  ARG B N   1 
ATOM   1571 C CA  . ARG B 2 83  ? 2.987   -9.248  108.205 1.00 28.85 ? 70  ARG B CA  1 
ATOM   1572 C C   . ARG B 2 83  ? 3.684   -8.371  107.175 1.00 27.09 ? 70  ARG B C   1 
ATOM   1573 O O   . ARG B 2 83  ? 3.043   -7.577  106.488 1.00 24.23 ? 70  ARG B O   1 
ATOM   1574 C CB  . ARG B 2 83  ? 2.008   -10.199 107.519 1.00 33.58 ? 70  ARG B CB  1 
ATOM   1575 C CG  . ARG B 2 83  ? 1.086   -10.928 108.482 1.00 40.51 ? 70  ARG B CG  1 
ATOM   1576 C CD  . ARG B 2 83  ? 0.271   -11.996 107.773 1.00 48.40 ? 70  ARG B CD  1 
ATOM   1577 N NE  . ARG B 2 83  ? -0.706  -12.614 108.665 1.00 57.97 ? 70  ARG B NE  1 
ATOM   1578 C CZ  . ARG B 2 83  ? -1.417  -13.695 108.363 1.00 65.57 ? 70  ARG B CZ  1 
ATOM   1579 N NH1 . ARG B 2 83  ? -2.284  -14.186 109.238 1.00 69.19 ? 70  ARG B NH1 1 
ATOM   1580 N NH2 . ARG B 2 83  ? -1.258  -14.289 107.187 1.00 67.82 ? 70  ARG B NH2 1 
ATOM   1581 N N   . VAL B 2 84  ? 5.000   -8.509  107.073 1.00 26.79 ? 71  VAL B N   1 
ATOM   1582 C CA  . VAL B 2 84  ? 5.763   -7.696  106.139 1.00 25.65 ? 71  VAL B CA  1 
ATOM   1583 C C   . VAL B 2 84  ? 6.227   -8.539  104.956 1.00 27.27 ? 71  VAL B C   1 
ATOM   1584 O O   . VAL B 2 84  ? 7.136   -9.362  105.076 1.00 30.17 ? 71  VAL B O   1 
ATOM   1585 C CB  . VAL B 2 84  ? 6.977   -7.043  106.814 1.00 24.79 ? 71  VAL B CB  1 
ATOM   1586 C CG1 . VAL B 2 84  ? 7.712   -6.156  105.822 1.00 24.97 ? 71  VAL B CG1 1 
ATOM   1587 C CG2 . VAL B 2 84  ? 6.539   -6.244  108.033 1.00 26.35 ? 71  VAL B CG2 1 
ATOM   1588 N N   . GLU B 2 85  ? 5.583   -8.331  103.814 1.00 18.91 ? 72  GLU B N   1 
ATOM   1589 C CA  . GLU B 2 85  ? 5.886   -9.089  102.607 1.00 20.23 ? 72  GLU B CA  1 
ATOM   1590 C C   . GLU B 2 85  ? 7.105   -8.525  101.885 1.00 18.66 ? 72  GLU B C   1 
ATOM   1591 O O   . GLU B 2 85  ? 7.128   -7.346  101.534 1.00 17.73 ? 72  GLU B O   1 
ATOM   1592 C CB  . GLU B 2 85  ? 4.674   -9.085  101.670 1.00 27.85 ? 72  GLU B CB  1 
ATOM   1593 C CG  . GLU B 2 85  ? 4.914   -9.731  100.314 1.00 37.09 ? 72  GLU B CG  1 
ATOM   1594 C CD  . GLU B 2 85  ? 4.823   -11.245 100.359 1.00 42.51 ? 72  GLU B CD  1 
ATOM   1595 O OE1 . GLU B 2 85  ? 4.434   -11.787 101.417 1.00 43.47 ? 72  GLU B OE1 1 
ATOM   1596 O OE2 . GLU B 2 85  ? 5.131   -11.891 99.334  1.00 43.43 ? 72  GLU B OE2 1 
ATOM   1597 N N   . HIS B 2 86  ? 8.122   -9.360  101.680 1.00 20.51 ? 73  HIS B N   1 
ATOM   1598 C CA  . HIS B 2 86  ? 9.238   -8.992  100.813 1.00 20.50 ? 73  HIS B CA  1 
ATOM   1599 C C   . HIS B 2 86  ? 8.855   -9.282  99.367  1.00 16.95 ? 73  HIS B C   1 
ATOM   1600 O O   . HIS B 2 86  ? 8.702   -10.441 98.977  1.00 19.64 ? 73  HIS B O   1 
ATOM   1601 C CB  . HIS B 2 86  ? 10.516  -9.753  101.184 1.00 20.71 ? 73  HIS B CB  1 
ATOM   1602 C CG  . HIS B 2 86  ? 11.656  -9.506  100.244 1.00 23.39 ? 73  HIS B CG  1 
ATOM   1603 N ND1 . HIS B 2 86  ? 12.588  -8.511  100.447 1.00 23.14 ? 73  HIS B ND1 1 
ATOM   1604 C CD2 . HIS B 2 86  ? 11.997  -10.108 99.080  1.00 23.23 ? 73  HIS B CD2 1 
ATOM   1605 C CE1 . HIS B 2 86  ? 13.461  -8.519  99.454  1.00 20.79 ? 73  HIS B CE1 1 
ATOM   1606 N NE2 . HIS B 2 86  ? 13.125  -9.480  98.613  1.00 21.05 ? 73  HIS B NE2 1 
ATOM   1607 N N   . VAL B 2 87  ? 8.681   -8.229  98.579  1.00 13.82 ? 74  VAL B N   1 
ATOM   1608 C CA  . VAL B 2 87  ? 8.258   -8.391  97.192  1.00 15.74 ? 74  VAL B CA  1 
ATOM   1609 C C   . VAL B 2 87  ? 9.308   -9.168  96.403  1.00 16.84 ? 74  VAL B C   1 
ATOM   1610 O O   . VAL B 2 87  ? 10.460  -8.750  96.306  1.00 20.04 ? 74  VAL B O   1 
ATOM   1611 C CB  . VAL B 2 87  ? 8.002   -7.033  96.521  1.00 18.39 ? 74  VAL B CB  1 
ATOM   1612 C CG1 . VAL B 2 87  ? 7.483   -7.239  95.107  1.00 17.85 ? 74  VAL B CG1 1 
ATOM   1613 C CG2 . VAL B 2 87  ? 7.008   -6.218  97.342  1.00 17.01 ? 74  VAL B CG2 1 
ATOM   1614 N N   . THR B 2 88  ? 8.904   -10.310 95.855  1.00 17.31 ? 75  THR B N   1 
ATOM   1615 C CA  . THR B 2 88  ? 9.817   -11.174 95.115  1.00 17.71 ? 75  THR B CA  1 
ATOM   1616 C C   . THR B 2 88  ? 10.180  -10.582 93.760  1.00 15.87 ? 75  THR B C   1 
ATOM   1617 O O   . THR B 2 88  ? 9.525   -9.654  93.283  1.00 17.59 ? 75  THR B O   1 
ATOM   1618 C CB  . THR B 2 88  ? 9.209   -12.570 94.896  1.00 20.39 ? 75  THR B CB  1 
ATOM   1619 O OG1 . THR B 2 88  ? 8.081   -12.468 94.018  1.00 23.75 ? 75  THR B OG1 1 
ATOM   1620 C CG2 . THR B 2 88  ? 8.768   -13.170 96.223  1.00 23.61 ? 75  THR B CG2 1 
ATOM   1621 N N   . ALA B 2 89  ? 11.228  -11.124 93.146  1.00 17.88 ? 76  ALA B N   1 
ATOM   1622 C CA  . ALA B 2 89  ? 11.656  -10.686 91.824  1.00 17.50 ? 76  ALA B CA  1 
ATOM   1623 C C   . ALA B 2 89  ? 10.536  -10.865 90.806  1.00 17.11 ? 76  ALA B C   1 
ATOM   1624 O O   . ALA B 2 89  ? 10.316  -9.999  89.962  1.00 17.97 ? 76  ALA B O   1 
ATOM   1625 C CB  . ALA B 2 89  ? 12.897  -11.447 91.383  1.00 21.38 ? 76  ALA B CB  1 
ATOM   1626 N N   . ASP B 2 90  ? 9.833   -11.991 90.899  1.00 18.10 ? 77  ASP B N   1 
ATOM   1627 C CA  . ASP B 2 90  ? 8.705   -12.279 90.015  1.00 19.62 ? 77  ASP B CA  1 
ATOM   1628 C C   . ASP B 2 90  ? 7.600   -11.241 90.141  1.00 17.79 ? 77  ASP B C   1 
ATOM   1629 O O   . ASP B 2 90  ? 7.054   -10.778 89.141  1.00 17.96 ? 77  ASP B O   1 
ATOM   1630 C CB  . ASP B 2 90  ? 8.126   -13.667 90.305  1.00 25.78 ? 77  ASP B CB  1 
ATOM   1631 C CG  . ASP B 2 90  ? 8.953   -14.783 89.700  1.00 35.43 ? 77  ASP B CG  1 
ATOM   1632 O OD1 . ASP B 2 90  ? 9.720   -14.508 88.753  1.00 36.51 ? 77  ASP B OD1 1 
ATOM   1633 O OD2 . ASP B 2 90  ? 8.829   -15.934 90.168  1.00 43.02 ? 77  ASP B OD2 1 
ATOM   1634 N N   . LEU B 2 91  ? 7.260   -10.891 91.376  1.00 18.16 ? 78  LEU B N   1 
ATOM   1635 C CA  . LEU B 2 91  ? 6.192   -9.931  91.619  1.00 18.87 ? 78  LEU B CA  1 
ATOM   1636 C C   . LEU B 2 91  ? 6.603   -8.546  91.130  1.00 14.75 ? 78  LEU B C   1 
ATOM   1637 O O   . LEU B 2 91  ? 5.794   -7.823  90.543  1.00 14.99 ? 78  LEU B O   1 
ATOM   1638 C CB  . LEU B 2 91  ? 5.824   -9.901  93.105  1.00 21.61 ? 78  LEU B CB  1 
ATOM   1639 C CG  . LEU B 2 91  ? 4.407   -9.444  93.460  1.00 28.14 ? 78  LEU B CG  1 
ATOM   1640 C CD1 . LEU B 2 91  ? 3.371   -10.251 92.693  1.00 32.14 ? 78  LEU B CD1 1 
ATOM   1641 C CD2 . LEU B 2 91  ? 4.163   -9.566  94.953  1.00 27.94 ? 78  LEU B CD2 1 
ATOM   1642 N N   . GLU B 2 92  ? 7.866   -8.185  91.350  1.00 15.59 ? 79  GLU B N   1 
ATOM   1643 C CA  . GLU B 2 92  ? 8.387   -6.916  90.850  1.00 13.26 ? 79  GLU B CA  1 
ATOM   1644 C C   . GLU B 2 92  ? 8.302   -6.834  89.326  1.00 13.99 ? 79  GLU B C   1 
ATOM   1645 O O   . GLU B 2 92  ? 7.985   -5.783  88.776  1.00 15.38 ? 79  GLU B O   1 
ATOM   1646 C CB  . GLU B 2 92  ? 9.836   -6.703  91.302  1.00 20.60 ? 79  GLU B CB  1 
ATOM   1647 C CG  . GLU B 2 92  ? 9.960   -6.222  92.733  1.00 22.62 ? 79  GLU B CG  1 
ATOM   1648 C CD  . GLU B 2 92  ? 11.334  -5.656  93.049  1.00 19.17 ? 79  GLU B CD  1 
ATOM   1649 O OE1 . GLU B 2 92  ? 12.220  -5.711  92.174  1.00 19.85 ? 79  GLU B OE1 1 
ATOM   1650 O OE2 . GLU B 2 92  ? 11.516  -5.147  94.170  1.00 24.88 ? 79  GLU B OE2 1 
ATOM   1651 N N   . GLU B 2 93  ? 8.580   -7.940  88.645  1.00 15.70 ? 80  GLU B N   1 
ATOM   1652 C CA  . GLU B 2 93  ? 8.530   -7.937  87.188  1.00 15.64 ? 80  GLU B CA  1 
ATOM   1653 C C   . GLU B 2 93  ? 7.096   -7.714  86.710  1.00 16.09 ? 80  GLU B C   1 
ATOM   1654 O O   . GLU B 2 93  ? 6.864   -7.026  85.713  1.00 19.78 ? 80  GLU B O   1 
ATOM   1655 C CB  . GLU B 2 93  ? 9.093   -9.240  86.621  1.00 17.11 ? 80  GLU B CB  1 
ATOM   1656 C CG  . GLU B 2 93  ? 9.046   -9.335  85.102  1.00 29.87 ? 80  GLU B CG  1 
ATOM   1657 C CD  . GLU B 2 93  ? 9.889   -8.274  84.413  1.00 30.25 ? 80  GLU B CD  1 
ATOM   1658 O OE1 . GLU B 2 93  ? 10.840  -7.760  85.042  1.00 26.49 ? 80  GLU B OE1 1 
ATOM   1659 O OE2 . GLU B 2 93  ? 9.593   -7.952  83.242  1.00 30.98 ? 80  GLU B OE2 1 
ATOM   1660 N N   . GLN B 2 94  ? 6.133   -8.283  87.429  1.00 15.67 ? 81  GLN B N   1 
ATOM   1661 C CA  . GLN B 2 94  ? 4.730   -8.059  87.100  1.00 16.72 ? 81  GLN B CA  1 
ATOM   1662 C C   . GLN B 2 94  ? 4.376   -6.597  87.338  1.00 17.57 ? 81  GLN B C   1 
ATOM   1663 O O   . GLN B 2 94  ? 3.621   -6.001  86.572  1.00 16.45 ? 81  GLN B O   1 
ATOM   1664 C CB  . GLN B 2 94  ? 3.814   -8.964  87.921  1.00 18.46 ? 81  GLN B CB  1 
ATOM   1665 C CG  . GLN B 2 94  ? 2.347   -8.838  87.532  1.00 21.32 ? 81  GLN B CG  1 
ATOM   1666 C CD  . GLN B 2 94  ? 1.425   -9.591  88.465  1.00 25.21 ? 81  GLN B CD  1 
ATOM   1667 O OE1 . GLN B 2 94  ? 1.066   -9.093  89.530  1.00 28.36 ? 81  GLN B OE1 1 
ATOM   1668 N NE2 . GLN B 2 94  ? 1.036   -10.798 88.070  1.00 28.19 ? 81  GLN B NE2 1 
ATOM   1669 N N   . ALA B 2 95  ? 4.934   -6.023  88.400  1.00 17.14 ? 82  ALA B N   1 
ATOM   1670 C CA  . ALA B 2 95  ? 4.724   -4.613  88.705  1.00 16.19 ? 82  ALA B CA  1 
ATOM   1671 C C   . ALA B 2 95  ? 5.278   -3.715  87.603  1.00 12.49 ? 82  ALA B C   1 
ATOM   1672 O O   . ALA B 2 95  ? 4.661   -2.712  87.248  1.00 13.44 ? 82  ALA B O   1 
ATOM   1673 C CB  . ALA B 2 95  ? 5.359   -4.259  90.041  1.00 15.95 ? 82  ALA B CB  1 
ATOM   1674 N N   . TRP B 2 96  ? 6.440   -4.071  87.060  1.00 11.41 ? 83  TRP B N   1 
ATOM   1675 C CA  . TRP B 2 96  ? 7.030   -3.294  85.973  1.00 17.24 ? 83  TRP B CA  1 
ATOM   1676 C C   . TRP B 2 96  ? 6.173   -3.355  84.707  1.00 16.50 ? 83  TRP B C   1 
ATOM   1677 O O   . TRP B 2 96  ? 5.947   -2.332  84.052  1.00 15.05 ? 83  TRP B O   1 
ATOM   1678 C CB  . TRP B 2 96  ? 8.447   -3.783  85.651  1.00 18.97 ? 83  TRP B CB  1 
ATOM   1679 C CG  . TRP B 2 96  ? 9.521   -3.290  86.588  1.00 14.20 ? 83  TRP B CG  1 
ATOM   1680 C CD1 . TRP B 2 96  ? 10.301  -4.050  87.411  1.00 17.25 ? 83  TRP B CD1 1 
ATOM   1681 C CD2 . TRP B 2 96  ? 9.940   -1.934  86.779  1.00 12.87 ? 83  TRP B CD2 1 
ATOM   1682 N NE1 . TRP B 2 96  ? 11.176  -3.250  88.109  1.00 15.42 ? 83  TRP B NE1 1 
ATOM   1683 C CE2 . TRP B 2 96  ? 10.974  -1.946  87.740  1.00 12.93 ? 83  TRP B CE2 1 
ATOM   1684 C CE3 . TRP B 2 96  ? 9.533   -0.707  86.241  1.00 13.93 ? 83  TRP B CE3 1 
ATOM   1685 C CZ2 . TRP B 2 96  ? 11.613  -0.783  88.167  1.00 12.64 ? 83  TRP B CZ2 1 
ATOM   1686 C CZ3 . TRP B 2 96  ? 10.169  0.447   86.667  1.00 13.55 ? 83  TRP B CZ3 1 
ATOM   1687 C CH2 . TRP B 2 96  ? 11.196  0.400   87.622  1.00 14.50 ? 83  TRP B CH2 1 
ATOM   1688 N N   . GLU B 2 97  ? 5.714   -4.554  84.358  1.00 15.89 ? 84  GLU B N   1 
ATOM   1689 C CA  . GLU B 2 97  ? 4.866   -4.727  83.182  1.00 19.81 ? 84  GLU B CA  1 
ATOM   1690 C C   . GLU B 2 97  ? 3.579   -3.937  83.366  1.00 17.38 ? 84  GLU B C   1 
ATOM   1691 O O   . GLU B 2 97  ? 3.071   -3.323  82.427  1.00 18.34 ? 84  GLU B O   1 
ATOM   1692 C CB  . GLU B 2 97  ? 4.556   -6.208  82.939  1.00 23.12 ? 84  GLU B CB  1 
ATOM   1693 C CG  . GLU B 2 97  ? 5.784   -7.062  82.674  1.00 30.05 ? 84  GLU B CG  1 
ATOM   1694 C CD  . GLU B 2 97  ? 5.461   -8.539  82.562  1.00 42.88 ? 84  GLU B CD  1 
ATOM   1695 O OE1 . GLU B 2 97  ? 4.276   -8.906  82.710  1.00 49.99 ? 84  GLU B OE1 1 
ATOM   1696 O OE2 . GLU B 2 97  ? 6.395   -9.335  82.327  1.00 45.92 ? 84  GLU B OE2 1 
ATOM   1697 N N   . TRP B 2 98  ? 3.071   -3.947  84.595  1.00 15.74 ? 85  TRP B N   1 
ATOM   1698 C CA  . TRP B 2 98  ? 1.862   -3.214  84.950  1.00 18.20 ? 85  TRP B CA  1 
ATOM   1699 C C   . TRP B 2 98  ? 2.077   -1.711  84.754  1.00 18.77 ? 85  TRP B C   1 
ATOM   1700 O O   . TRP B 2 98  ? 1.245   -1.025  84.155  1.00 21.05 ? 85  TRP B O   1 
ATOM   1701 C CB  . TRP B 2 98  ? 1.472   -3.527  86.400  1.00 18.39 ? 85  TRP B CB  1 
ATOM   1702 C CG  . TRP B 2 98  ? 0.112   -3.045  86.812  1.00 19.87 ? 85  TRP B CG  1 
ATOM   1703 C CD1 . TRP B 2 98  ? -1.052  -3.759  86.790  1.00 19.90 ? 85  TRP B CD1 1 
ATOM   1704 C CD2 . TRP B 2 98  ? -0.220  -1.751  87.328  1.00 19.35 ? 85  TRP B CD2 1 
ATOM   1705 N NE1 . TRP B 2 98  ? -2.093  -2.983  87.251  1.00 25.40 ? 85  TRP B NE1 1 
ATOM   1706 C CE2 . TRP B 2 98  ? -1.608  -1.746  87.587  1.00 24.60 ? 85  TRP B CE2 1 
ATOM   1707 C CE3 . TRP B 2 98  ? 0.517   -0.590  87.585  1.00 16.64 ? 85  TRP B CE3 1 
ATOM   1708 C CZ2 . TRP B 2 98  ? -2.271  -0.628  88.093  1.00 24.51 ? 85  TRP B CZ2 1 
ATOM   1709 C CZ3 . TRP B 2 98  ? -0.145  0.521   88.083  1.00 18.18 ? 85  TRP B CZ3 1 
ATOM   1710 C CH2 . TRP B 2 98  ? -1.523  0.492   88.336  1.00 19.54 ? 85  TRP B CH2 1 
ATOM   1711 N N   . LEU B 2 99  ? 3.207   -1.214  85.255  1.00 14.41 ? 86  LEU B N   1 
ATOM   1712 C CA  . LEU B 2 99  ? 3.555   0.202   85.148  1.00 14.61 ? 86  LEU B CA  1 
ATOM   1713 C C   . LEU B 2 99  ? 3.659   0.668   83.701  1.00 16.65 ? 86  LEU B C   1 
ATOM   1714 O O   . LEU B 2 99  ? 3.173   1.744   83.350  1.00 17.04 ? 86  LEU B O   1 
ATOM   1715 C CB  . LEU B 2 99  ? 4.877   0.486   85.866  1.00 12.48 ? 86  LEU B CB  1 
ATOM   1716 C CG  . LEU B 2 99  ? 4.825   0.603   87.391  1.00 11.97 ? 86  LEU B CG  1 
ATOM   1717 C CD1 . LEU B 2 99  ? 6.238   0.636   87.970  1.00 13.03 ? 86  LEU B CD1 1 
ATOM   1718 C CD2 . LEU B 2 99  ? 4.027   1.823   87.852  1.00 13.22 ? 86  LEU B CD2 1 
ATOM   1719 N N   . VAL B 2 100 ? 4.308   -0.143  82.871  1.00 17.32 ? 87  VAL B N   1 
ATOM   1720 C CA  . VAL B 2 100 ? 4.504   0.192   81.467  1.00 17.33 ? 87  VAL B CA  1 
ATOM   1721 C C   . VAL B 2 100 ? 3.155   0.215   80.750  1.00 19.22 ? 87  VAL B C   1 
ATOM   1722 O O   . VAL B 2 100 ? 2.930   1.017   79.845  1.00 23.82 ? 87  VAL B O   1 
ATOM   1723 C CB  . VAL B 2 100 ? 5.463   -0.811  80.775  1.00 17.66 ? 87  VAL B CB  1 
ATOM   1724 C CG1 . VAL B 2 100 ? 5.508   -0.583  79.268  1.00 23.62 ? 87  VAL B CG1 1 
ATOM   1725 C CG2 . VAL B 2 100 ? 6.863   -0.714  81.373  1.00 16.37 ? 87  VAL B CG2 1 
ATOM   1726 N N   . ARG B 2 101 ? 2.247   -0.649  81.189  1.00 18.58 ? 88  ARG B N   1 
ATOM   1727 C CA  . ARG B 2 101 ? 0.944   -0.787  80.548  1.00 26.84 ? 88  ARG B CA  1 
ATOM   1728 C C   . ARG B 2 101 ? -0.051  0.301   80.966  1.00 23.78 ? 88  ARG B C   1 
ATOM   1729 O O   . ARG B 2 101 ? -0.883  0.727   80.166  1.00 28.77 ? 88  ARG B O   1 
ATOM   1730 C CB  . ARG B 2 101 ? 0.375   -2.175  80.853  1.00 34.10 ? 88  ARG B CB  1 
ATOM   1731 C CG  . ARG B 2 101 ? -0.959  -2.476  80.199  1.00 42.27 ? 88  ARG B CG  1 
ATOM   1732 C CD  . ARG B 2 101 ? -1.313  -3.956  80.298  1.00 49.27 ? 88  ARG B CD  1 
ATOM   1733 N NE  . ARG B 2 101 ? -1.460  -4.412  81.678  1.00 52.14 ? 88  ARG B NE  1 
ATOM   1734 C CZ  . ARG B 2 101 ? -0.564  -5.154  82.323  1.00 48.38 ? 88  ARG B CZ  1 
ATOM   1735 N NH1 . ARG B 2 101 ? 0.553   -5.531  81.716  1.00 50.76 ? 88  ARG B NH1 1 
ATOM   1736 N NH2 . ARG B 2 101 ? -0.787  -5.521  83.576  1.00 39.62 ? 88  ARG B NH2 1 
ATOM   1737 N N   . HIS B 2 102 ? 0.042   0.760   82.211  1.00 24.28 ? 89  HIS B N   1 
ATOM   1738 C CA  . HIS B 2 102 ? -0.951  1.687   82.749  1.00 23.08 ? 89  HIS B CA  1 
ATOM   1739 C C   . HIS B 2 102 ? -0.540  3.156   82.655  1.00 24.63 ? 89  HIS B C   1 
ATOM   1740 O O   . HIS B 2 102 ? -0.157  3.766   83.652  1.00 25.43 ? 89  HIS B O   1 
ATOM   1741 C CB  . HIS B 2 102 ? -1.262  1.332   84.205  1.00 21.37 ? 89  HIS B CB  1 
ATOM   1742 C CG  . HIS B 2 102 ? -2.194  0.171   84.352  1.00 23.44 ? 89  HIS B CG  1 
ATOM   1743 N ND1 . HIS B 2 102 ? -3.559  0.324   84.471  1.00 24.27 ? 89  HIS B ND1 1 
ATOM   1744 C CD2 . HIS B 2 102 ? -1.961  -1.163  84.380  1.00 24.06 ? 89  HIS B CD2 1 
ATOM   1745 C CE1 . HIS B 2 102 ? -4.126  -0.865  84.574  1.00 25.63 ? 89  HIS B CE1 1 
ATOM   1746 N NE2 . HIS B 2 102 ? -3.179  -1.784  84.521  1.00 27.12 ? 89  HIS B NE2 1 
ATOM   1747 N N   . ASP B 2 103 ? -0.652  3.724   81.458  1.00 26.60 ? 90  ASP B N   1 
ATOM   1748 C CA  . ASP B 2 103 ? -0.284  5.117   81.232  1.00 27.29 ? 90  ASP B CA  1 
ATOM   1749 C C   . ASP B 2 103 ? -1.447  6.093   81.436  1.00 30.00 ? 90  ASP B C   1 
ATOM   1750 O O   . ASP B 2 103 ? -1.315  7.284   81.159  1.00 33.18 ? 90  ASP B O   1 
ATOM   1751 C CB  . ASP B 2 103 ? 0.276   5.283   79.820  1.00 34.40 ? 90  ASP B CB  1 
ATOM   1752 C CG  . ASP B 2 103 ? -0.757  4.997   78.746  1.00 40.19 ? 90  ASP B CG  1 
ATOM   1753 O OD1 . ASP B 2 103 ? -1.719  4.249   79.022  1.00 39.82 ? 90  ASP B OD1 1 
ATOM   1754 O OD2 . ASP B 2 103 ? -0.605  5.520   77.624  1.00 47.61 ? 90  ASP B OD2 1 
ATOM   1755 N N   . GLU B 2 104 ? -2.579  5.593   81.923  1.00 32.27 ? 91  GLU B N   1 
ATOM   1756 C CA  . GLU B 2 104 ? -3.771  6.427   82.071  1.00 35.00 ? 91  GLU B CA  1 
ATOM   1757 C C   . GLU B 2 104 ? -3.699  7.338   83.297  1.00 34.20 ? 91  GLU B C   1 
ATOM   1758 O O   . GLU B 2 104 ? -4.466  8.292   83.414  1.00 36.91 ? 91  GLU B O   1 
ATOM   1759 C CB  . GLU B 2 104 ? -5.033  5.558   82.152  1.00 31.36 ? 91  GLU B CB  1 
ATOM   1760 C CG  . GLU B 2 104 ? -5.217  4.808   83.472  1.00 31.32 ? 91  GLU B CG  1 
ATOM   1761 C CD  . GLU B 2 104 ? -4.431  3.515   83.538  1.00 32.23 ? 91  GLU B CD  1 
ATOM   1762 O OE1 . GLU B 2 104 ? -3.723  3.197   82.559  1.00 31.00 ? 91  GLU B OE1 1 
ATOM   1763 O OE2 . GLU B 2 104 ? -4.518  2.810   84.570  1.00 30.36 ? 91  GLU B OE2 1 
ATOM   1764 N N   . ARG B 2 105 ? -2.776  7.039   84.205  1.00 29.87 ? 92  ARG B N   1 
ATOM   1765 C CA  . ARG B 2 105 ? -2.654  7.778   85.458  1.00 31.31 ? 92  ARG B CA  1 
ATOM   1766 C C   . ARG B 2 105 ? -1.242  7.628   86.016  1.00 27.09 ? 92  ARG B C   1 
ATOM   1767 O O   . ARG B 2 105 ? -0.603  6.598   85.815  1.00 27.18 ? 92  ARG B O   1 
ATOM   1768 C CB  . ARG B 2 105 ? -3.689  7.281   86.472  1.00 34.01 ? 92  ARG B CB  1 
ATOM   1769 C CG  . ARG B 2 105 ? -3.672  7.983   87.822  1.00 39.40 ? 92  ARG B CG  1 
ATOM   1770 C CD  . ARG B 2 105 ? -4.618  7.291   88.794  1.00 41.80 ? 92  ARG B CD  1 
ATOM   1771 N NE  . ARG B 2 105 ? -4.421  7.724   90.175  1.00 41.25 ? 92  ARG B NE  1 
ATOM   1772 C CZ  . ARG B 2 105 ? -5.231  8.555   90.824  1.00 44.37 ? 92  ARG B CZ  1 
ATOM   1773 N NH1 . ARG B 2 105 ? -6.308  9.048   90.225  1.00 46.60 ? 92  ARG B NH1 1 
ATOM   1774 N NH2 . ARG B 2 105 ? -4.967  8.888   92.079  1.00 48.05 ? 92  ARG B NH2 1 
ATOM   1775 N N   . GLU B 2 106 ? -0.751  8.654   86.704  1.00 27.89 ? 93  GLU B N   1 
ATOM   1776 C CA  . GLU B 2 106 ? 0.577   8.587   87.308  1.00 27.04 ? 93  GLU B CA  1 
ATOM   1777 C C   . GLU B 2 106 ? 0.596   7.632   88.495  1.00 24.71 ? 93  GLU B C   1 
ATOM   1778 O O   . GLU B 2 106 ? -0.035  7.894   89.518  1.00 28.35 ? 93  GLU B O   1 
ATOM   1779 C CB  . GLU B 2 106 ? 1.046   9.975   87.754  1.00 31.33 ? 93  GLU B CB  1 
ATOM   1780 C CG  . GLU B 2 106 ? 2.426   9.962   88.403  1.00 33.00 ? 93  GLU B CG  1 
ATOM   1781 C CD  . GLU B 2 106 ? 2.860   11.323  88.923  1.00 39.42 ? 93  GLU B CD  1 
ATOM   1782 O OE1 . GLU B 2 106 ? 2.269   12.344  88.512  1.00 36.28 ? 93  GLU B OE1 1 
ATOM   1783 O OE2 . GLU B 2 106 ? 3.800   11.369  89.745  1.00 45.98 ? 93  GLU B OE2 1 
ATOM   1784 N N   . TYR B 2 107 ? 1.318   6.524   88.354  1.00 20.35 ? 94  TYR B N   1 
ATOM   1785 C CA  . TYR B 2 107 ? 1.497   5.574   89.451  1.00 18.53 ? 94  TYR B CA  1 
ATOM   1786 C C   . TYR B 2 107 ? 2.972   5.443   89.814  1.00 20.81 ? 94  TYR B C   1 
ATOM   1787 O O   . TYR B 2 107 ? 3.830   5.422   88.931  1.00 17.73 ? 94  TYR B O   1 
ATOM   1788 C CB  . TYR B 2 107 ? 0.937   4.197   89.088  1.00 17.46 ? 94  TYR B CB  1 
ATOM   1789 C CG  . TYR B 2 107 ? -0.571  4.124   89.027  1.00 18.84 ? 94  TYR B CG  1 
ATOM   1790 C CD1 . TYR B 2 107 ? -1.331  4.138   90.190  1.00 19.98 ? 94  TYR B CD1 1 
ATOM   1791 C CD2 . TYR B 2 107 ? -1.234  4.017   87.812  1.00 21.20 ? 94  TYR B CD2 1 
ATOM   1792 C CE1 . TYR B 2 107 ? -2.712  4.065   90.143  1.00 22.16 ? 94  TYR B CE1 1 
ATOM   1793 C CE2 . TYR B 2 107 ? -2.613  3.942   87.753  1.00 21.79 ? 94  TYR B CE2 1 
ATOM   1794 C CZ  . TYR B 2 107 ? -3.348  3.965   88.920  1.00 23.22 ? 94  TYR B CZ  1 
ATOM   1795 O OH  . TYR B 2 107 ? -4.723  3.889   88.865  1.00 25.68 ? 94  TYR B OH  1 
ATOM   1796 N N   . SER B 2 108 ? 3.257   5.352   91.110  1.00 17.02 ? 95  SER B N   1 
ATOM   1797 C CA  . SER B 2 108 ? 4.621   5.144   91.582  1.00 16.73 ? 95  SER B CA  1 
ATOM   1798 C C   . SER B 2 108 ? 4.981   3.670   91.523  1.00 16.32 ? 95  SER B C   1 
ATOM   1799 O O   . SER B 2 108 ? 4.102   2.812   91.474  1.00 15.11 ? 95  SER B O   1 
ATOM   1800 C CB  . SER B 2 108 ? 4.788   5.653   93.015  1.00 22.17 ? 95  SER B CB  1 
ATOM   1801 O OG  . SER B 2 108 ? 4.201   4.751   93.939  1.00 22.10 ? 95  SER B OG  1 
ATOM   1802 N N   . PHE B 2 109 ? 6.278   3.379   91.531  1.00 17.46 ? 96  PHE B N   1 
ATOM   1803 C CA  . PHE B 2 109 ? 6.746   1.999   91.596  1.00 15.15 ? 96  PHE B CA  1 
ATOM   1804 C C   . PHE B 2 109 ? 6.258   1.283   92.856  1.00 13.58 ? 96  PHE B C   1 
ATOM   1805 O O   . PHE B 2 109 ? 5.834   0.131   92.793  1.00 15.86 ? 96  PHE B O   1 
ATOM   1806 C CB  . PHE B 2 109 ? 8.268   1.949   91.542  1.00 20.83 ? 96  PHE B CB  1 
ATOM   1807 C CG  . PHE B 2 109 ? 8.834   0.578   91.773  1.00 20.94 ? 96  PHE B CG  1 
ATOM   1808 C CD1 . PHE B 2 109 ? 8.818   -0.371  90.766  1.00 18.72 ? 96  PHE B CD1 1 
ATOM   1809 C CD2 . PHE B 2 109 ? 9.380   0.238   93.001  1.00 19.24 ? 96  PHE B CD2 1 
ATOM   1810 C CE1 . PHE B 2 109 ? 9.337   -1.634  90.977  1.00 19.61 ? 96  PHE B CE1 1 
ATOM   1811 C CE2 . PHE B 2 109 ? 9.902   -1.022  93.216  1.00 19.35 ? 96  PHE B CE2 1 
ATOM   1812 C CZ  . PHE B 2 109 ? 9.882   -1.958  92.202  1.00 18.01 ? 96  PHE B CZ  1 
ATOM   1813 N N   . VAL B 2 110 ? 6.336   1.956   94.001  1.00 13.79 ? 97  VAL B N   1 
ATOM   1814 C CA  . VAL B 2 110 ? 5.904   1.341   95.255  1.00 13.52 ? 97  VAL B CA  1 
ATOM   1815 C C   . VAL B 2 110 ? 4.419   0.979   95.197  1.00 15.95 ? 97  VAL B C   1 
ATOM   1816 O O   . VAL B 2 110 ? 4.012   -0.096  95.643  1.00 17.40 ? 97  VAL B O   1 
ATOM   1817 C CB  . VAL B 2 110 ? 6.183   2.264   96.463  1.00 15.48 ? 97  VAL B CB  1 
ATOM   1818 C CG1 . VAL B 2 110 ? 5.525   1.722   97.717  1.00 16.27 ? 97  VAL B CG1 1 
ATOM   1819 C CG2 . VAL B 2 110 ? 7.683   2.407   96.678  1.00 17.44 ? 97  VAL B CG2 1 
ATOM   1820 N N   . ASP B 2 111 ? 3.611   1.867   94.627  1.00 14.57 ? 98  ASP B N   1 
ATOM   1821 C CA  . ASP B 2 111 ? 2.189   1.577   94.461  1.00 17.36 ? 98  ASP B CA  1 
ATOM   1822 C C   . ASP B 2 111 ? 1.978   0.347   93.583  1.00 15.81 ? 98  ASP B C   1 
ATOM   1823 O O   . ASP B 2 111 ? 1.172   -0.524  93.909  1.00 15.37 ? 98  ASP B O   1 
ATOM   1824 C CB  . ASP B 2 111 ? 1.451   2.780   93.872  1.00 19.17 ? 98  ASP B CB  1 
ATOM   1825 C CG  . ASP B 2 111 ? 1.212   3.879   94.896  1.00 25.19 ? 98  ASP B CG  1 
ATOM   1826 O OD1 . ASP B 2 111 ? 1.478   3.655   96.096  1.00 27.62 ? 98  ASP B OD1 1 
ATOM   1827 O OD2 . ASP B 2 111 ? 0.741   4.963   94.498  1.00 31.05 ? 98  ASP B OD2 1 
ATOM   1828 N N   . ALA B 2 112 ? 2.712   0.266   92.478  1.00 14.29 ? 99  ALA B N   1 
ATOM   1829 C CA  . ALA B 2 112 ? 2.574   -0.867  91.572  1.00 13.72 ? 99  ALA B CA  1 
ATOM   1830 C C   . ALA B 2 112 ? 2.907   -2.183  92.274  1.00 14.90 ? 99  ALA B C   1 
ATOM   1831 O O   . ALA B 2 112 ? 2.246   -3.196  92.046  1.00 16.32 ? 99  ALA B O   1 
ATOM   1832 C CB  . ALA B 2 112 ? 3.454   -0.684  90.352  1.00 14.58 ? 99  ALA B CB  1 
ATOM   1833 N N   . THR B 2 113 ? 3.924   -2.173  93.129  1.00 13.87 ? 100 THR B N   1 
ATOM   1834 C CA  . THR B 2 113 ? 4.287   -3.391  93.846  1.00 12.10 ? 100 THR B CA  1 
ATOM   1835 C C   . THR B 2 113 ? 3.242   -3.694  94.919  1.00 11.68 ? 100 THR B C   1 
ATOM   1836 O O   . THR B 2 113 ? 2.976   -4.853  95.228  1.00 14.68 ? 100 THR B O   1 
ATOM   1837 C CB  . THR B 2 113 ? 5.691   -3.296  94.490  1.00 15.12 ? 100 THR B CB  1 
ATOM   1838 O OG1 . THR B 2 113 ? 5.728   -2.218  95.432  1.00 16.04 ? 100 THR B OG1 1 
ATOM   1839 C CG2 . THR B 2 113 ? 6.761   -3.084  93.423  1.00 13.17 ? 100 THR B CG2 1 
ATOM   1840 N N   . SER B 2 114 ? 2.645   -2.646  95.478  1.00 10.61 ? 101 SER B N   1 
ATOM   1841 C CA  . SER B 2 114 ? 1.604   -2.825  96.482  1.00 12.92 ? 101 SER B CA  1 
ATOM   1842 C C   . SER B 2 114 ? 0.385   -3.482  95.852  1.00 13.27 ? 101 SER B C   1 
ATOM   1843 O O   . SER B 2 114 ? -0.183  -4.417  96.413  1.00 11.89 ? 101 SER B O   1 
ATOM   1844 C CB  . SER B 2 114 ? 1.227   -1.489  97.117  1.00 13.49 ? 101 SER B CB  1 
ATOM   1845 O OG  . SER B 2 114 ? 2.292   -1.009  97.919  1.00 11.78 ? 101 SER B OG  1 
ATOM   1846 N N   . PHE B 2 115 ? -0.000  -2.994  94.676  1.00 15.92 ? 102 PHE B N   1 
ATOM   1847 C CA  . PHE B 2 115 ? -1.132  -3.557  93.947  1.00 16.57 ? 102 PHE B CA  1 
ATOM   1848 C C   . PHE B 2 115 ? -0.887  -5.030  93.651  1.00 17.50 ? 102 PHE B C   1 
ATOM   1849 O O   . PHE B 2 115 ? -1.790  -5.857  93.769  1.00 16.79 ? 102 PHE B O   1 
ATOM   1850 C CB  . PHE B 2 115 ? -1.380  -2.800  92.638  1.00 13.57 ? 102 PHE B CB  1 
ATOM   1851 C CG  . PHE B 2 115 ? -1.620  -1.327  92.817  1.00 15.21 ? 102 PHE B CG  1 
ATOM   1852 C CD1 . PHE B 2 115 ? -2.085  -0.820  94.024  1.00 14.21 ? 102 PHE B CD1 1 
ATOM   1853 C CD2 . PHE B 2 115 ? -1.382  -0.446  91.771  1.00 15.36 ? 102 PHE B CD2 1 
ATOM   1854 C CE1 . PHE B 2 115 ? -2.306  0.537   94.183  1.00 12.36 ? 102 PHE B CE1 1 
ATOM   1855 C CE2 . PHE B 2 115 ? -1.601  0.911   91.922  1.00 14.68 ? 102 PHE B CE2 1 
ATOM   1856 C CZ  . PHE B 2 115 ? -2.060  1.407   93.132  1.00 14.27 ? 102 PHE B CZ  1 
ATOM   1857 N N   . ALA B 2 116 ? 0.345   -5.345  93.262  1.00 15.41 ? 103 ALA B N   1 
ATOM   1858 C CA  . ALA B 2 116 ? 0.720   -6.711  92.917  1.00 16.72 ? 103 ALA B CA  1 
ATOM   1859 C C   . ALA B 2 116 ? 0.667   -7.633  94.128  1.00 16.68 ? 103 ALA B C   1 
ATOM   1860 O O   . ALA B 2 116 ? 0.278   -8.796  94.013  1.00 18.29 ? 103 ALA B O   1 
ATOM   1861 C CB  . ALA B 2 116 ? 2.110   -6.735  92.293  1.00 16.87 ? 103 ALA B CB  1 
ATOM   1862 N N   . VAL B 2 117 ? 1.065   -7.118  95.288  1.00 16.34 ? 104 VAL B N   1 
ATOM   1863 C CA  . VAL B 2 117 ? 0.999   -7.897  96.519  1.00 14.37 ? 104 VAL B CA  1 
ATOM   1864 C C   . VAL B 2 117 ? -0.456  -8.198  96.867  1.00 14.89 ? 104 VAL B C   1 
ATOM   1865 O O   . VAL B 2 117 ? -0.797  -9.325  97.228  1.00 17.36 ? 104 VAL B O   1 
ATOM   1866 C CB  . VAL B 2 117 ? 1.679   -7.168  97.704  1.00 16.46 ? 104 VAL B CB  1 
ATOM   1867 C CG1 . VAL B 2 117 ? 1.379   -7.882  99.018  1.00 17.23 ? 104 VAL B CG1 1 
ATOM   1868 C CG2 . VAL B 2 117 ? 3.188   -7.070  97.483  1.00 17.39 ? 104 VAL B CG2 1 
ATOM   1869 N N   . MET B 2 118 ? -1.317  -7.189  96.743  1.00 14.72 ? 105 MET B N   1 
ATOM   1870 C CA  . MET B 2 118 ? -2.724  -7.353  97.091  1.00 17.73 ? 105 MET B CA  1 
ATOM   1871 C C   . MET B 2 118 ? -3.409  -8.349  96.155  1.00 20.14 ? 105 MET B C   1 
ATOM   1872 O O   . MET B 2 118 ? -4.234  -9.149  96.593  1.00 22.63 ? 105 MET B O   1 
ATOM   1873 C CB  . MET B 2 118 ? -3.450  -6.002  97.065  1.00 17.40 ? 105 MET B CB  1 
ATOM   1874 C CG  . MET B 2 118 ? -2.983  -5.027  98.148  1.00 13.69 ? 105 MET B CG  1 
ATOM   1875 S SD  . MET B 2 118 ? -3.819  -3.422  98.096  1.00 16.52 ? 105 MET B SD  1 
ATOM   1876 C CE  . MET B 2 118 ? -5.480  -3.875  98.599  1.00 16.69 ? 105 MET B CE  1 
ATOM   1877 N N   . ARG B 2 119 ? -3.057  -8.305  94.872  1.00 20.11 ? 106 ARG B N   1 
ATOM   1878 C CA  . ARG B 2 119 ? -3.585  -9.270  93.915  1.00 19.96 ? 106 ARG B CA  1 
ATOM   1879 C C   . ARG B 2 119 ? -3.124  -10.680 94.272  1.00 21.57 ? 106 ARG B C   1 
ATOM   1880 O O   . ARG B 2 119 ? -3.904  -11.629 94.225  1.00 24.92 ? 106 ARG B O   1 
ATOM   1881 C CB  . ARG B 2 119 ? -3.159  -8.924  92.485  1.00 21.44 ? 106 ARG B CB  1 
ATOM   1882 C CG  . ARG B 2 119 ? -3.820  -7.683  91.904  1.00 22.62 ? 106 ARG B CG  1 
ATOM   1883 C CD  . ARG B 2 119 ? -3.657  -7.624  90.383  1.00 29.29 ? 106 ARG B CD  1 
ATOM   1884 N NE  . ARG B 2 119 ? -2.258  -7.569  89.963  1.00 29.94 ? 106 ARG B NE  1 
ATOM   1885 C CZ  . ARG B 2 119 ? -1.543  -6.450  89.874  1.00 30.00 ? 106 ARG B CZ  1 
ATOM   1886 N NH1 . ARG B 2 119 ? -2.095  -5.281  90.179  1.00 27.80 ? 106 ARG B NH1 1 
ATOM   1887 N NH2 . ARG B 2 119 ? -0.276  -6.498  89.480  1.00 24.61 ? 106 ARG B NH2 1 
ATOM   1888 N N   . LYS B 2 120 ? -1.850  -10.807 94.630  1.00 20.75 ? 107 LYS B N   1 
ATOM   1889 C CA  . LYS B 2 120 ? -1.285  -12.099 95.000  1.00 23.24 ? 107 LYS B CA  1 
ATOM   1890 C C   . LYS B 2 120 ? -1.946  -12.662 96.254  1.00 24.58 ? 107 LYS B C   1 
ATOM   1891 O O   . LYS B 2 120 ? -2.255  -13.851 96.328  1.00 29.00 ? 107 LYS B O   1 
ATOM   1892 C CB  . LYS B 2 120 ? 0.228   -11.976 95.217  1.00 26.94 ? 107 LYS B CB  1 
ATOM   1893 C CG  . LYS B 2 120 ? 0.867   -13.210 95.841  1.00 34.73 ? 107 LYS B CG  1 
ATOM   1894 C CD  . LYS B 2 120 ? 2.336   -12.981 96.174  1.00 35.58 ? 107 LYS B CD  1 
ATOM   1895 C CE  . LYS B 2 120 ? 2.939   -14.191 96.879  1.00 41.20 ? 107 LYS B CE  1 
ATOM   1896 N NZ  . LYS B 2 120 ? 4.395   -14.010 97.158  1.00 43.39 ? 107 LYS B NZ  1 
ATOM   1897 N N   . LYS B 2 121 ? -2.171  -11.795 97.235  1.00 23.37 ? 108 LYS B N   1 
ATOM   1898 C CA  . LYS B 2 121 ? -2.683  -12.222 98.531  1.00 27.43 ? 108 LYS B CA  1 
ATOM   1899 C C   . LYS B 2 121 ? -4.207  -12.209 98.605  1.00 31.01 ? 108 LYS B C   1 
ATOM   1900 O O   . LYS B 2 121 ? -4.787  -12.642 99.600  1.00 32.27 ? 108 LYS B O   1 
ATOM   1901 C CB  . LYS B 2 121 ? -2.106  -11.339 99.636  1.00 24.03 ? 108 LYS B CB  1 
ATOM   1902 C CG  . LYS B 2 121 ? -0.599  -11.445 99.778  1.00 26.29 ? 108 LYS B CG  1 
ATOM   1903 C CD  . LYS B 2 121 ? -0.192  -12.842 100.212 1.00 33.38 ? 108 LYS B CD  1 
ATOM   1904 C CE  . LYS B 2 121 ? 1.305   -12.936 100.463 1.00 41.48 ? 108 LYS B CE  1 
ATOM   1905 N NZ  . LYS B 2 121 ? 1.701   -14.292 100.947 1.00 48.20 ? 108 LYS B NZ  1 
ATOM   1906 N N   . GLY B 2 122 ? -4.853  -11.714 97.555  1.00 24.08 ? 109 GLY B N   1 
ATOM   1907 C CA  . GLY B 2 122 ? -6.305  -11.679 97.514  1.00 25.54 ? 109 GLY B CA  1 
ATOM   1908 C C   . GLY B 2 122 ? -6.878  -10.634 98.451  1.00 25.05 ? 109 GLY B C   1 
ATOM   1909 O O   . GLY B 2 122 ? -7.969  -10.798 98.997  1.00 28.06 ? 109 GLY B O   1 
ATOM   1910 N N   . ILE B 2 123 ? -6.134  -9.550  98.629  1.00 20.77 ? 110 ILE B N   1 
ATOM   1911 C CA  . ILE B 2 123 ? -6.546  -8.456  99.499  1.00 21.76 ? 110 ILE B CA  1 
ATOM   1912 C C   . ILE B 2 123 ? -7.243  -7.376  98.682  1.00 21.17 ? 110 ILE B C   1 
ATOM   1913 O O   . ILE B 2 123 ? -6.750  -6.970  97.631  1.00 22.07 ? 110 ILE B O   1 
ATOM   1914 C CB  . ILE B 2 123 ? -5.340  -7.849  100.239 1.00 21.63 ? 110 ILE B CB  1 
ATOM   1915 C CG1 . ILE B 2 123 ? -4.639  -8.923  101.076 1.00 27.49 ? 110 ILE B CG1 1 
ATOM   1916 C CG2 . ILE B 2 123 ? -5.770  -6.675  101.112 1.00 19.20 ? 110 ILE B CG2 1 
ATOM   1917 C CD1 . ILE B 2 123 ? -3.317  -8.478  101.660 1.00 28.31 ? 110 ILE B CD1 1 
ATOM   1918 N N   . GLN B 2 124 ? -8.397  -6.918  99.158  1.00 22.37 ? 111 GLN B N   1 
ATOM   1919 C CA  . GLN B 2 124 ? -9.133  -5.871  98.459  1.00 22.24 ? 111 GLN B CA  1 
ATOM   1920 C C   . GLN B 2 124 ? -9.086  -4.555  99.227  1.00 21.29 ? 111 GLN B C   1 
ATOM   1921 O O   . GLN B 2 124 ? -9.165  -3.477  98.637  1.00 22.78 ? 111 GLN B O   1 
ATOM   1922 C CB  . GLN B 2 124 ? -10.585 -6.301  98.226  1.00 28.64 ? 111 GLN B CB  1 
ATOM   1923 C CG  . GLN B 2 124 ? -11.464 -5.261  97.523  1.00 30.63 ? 111 GLN B CG  1 
ATOM   1924 C CD  . GLN B 2 124 ? -11.056 -4.981  96.077  1.00 33.23 ? 111 GLN B CD  1 
ATOM   1925 O OE1 . GLN B 2 124 ? -10.132 -5.596  95.539  1.00 31.05 ? 111 GLN B OE1 1 
ATOM   1926 N NE2 . GLN B 2 124 ? -11.756 -4.045  95.443  1.00 26.84 ? 111 GLN B NE2 1 
ATOM   1927 N N   . ASN B 2 125 ? -8.940  -4.651  100.545 1.00 19.52 ? 112 ASN B N   1 
ATOM   1928 C CA  . ASN B 2 125 ? -8.943  -3.471  101.406 1.00 20.51 ? 112 ASN B CA  1 
ATOM   1929 C C   . ASN B 2 125 ? -7.544  -2.943  101.700 1.00 20.14 ? 112 ASN B C   1 
ATOM   1930 O O   . ASN B 2 125 ? -6.656  -3.692  102.105 1.00 19.64 ? 112 ASN B O   1 
ATOM   1931 C CB  . ASN B 2 125 ? -9.654  -3.777  102.720 1.00 23.71 ? 112 ASN B CB  1 
ATOM   1932 C CG  . ASN B 2 125 ? -11.131 -4.046  102.529 1.00 29.95 ? 112 ASN B CG  1 
ATOM   1933 O OD1 . ASN B 2 125 ? -11.772 -3.460  101.657 1.00 31.45 ? 112 ASN B OD1 1 
ATOM   1934 N ND2 . ASN B 2 125 ? -11.679 -4.940  103.342 1.00 31.13 ? 112 ASN B ND2 1 
ATOM   1935 N N   . ALA B 2 126 ? -7.359  -1.644  101.507 1.00 18.03 ? 113 ALA B N   1 
ATOM   1936 C CA  . ALA B 2 126 ? -6.087  -1.017  101.822 1.00 15.48 ? 113 ALA B CA  1 
ATOM   1937 C C   . ALA B 2 126 ? -6.255  0.087   102.853 1.00 17.55 ? 113 ALA B C   1 
ATOM   1938 O O   . ALA B 2 126 ? -7.198  0.874   102.784 1.00 18.17 ? 113 ALA B O   1 
ATOM   1939 C CB  . ALA B 2 126 ? -5.442  -0.461  100.560 1.00 16.51 ? 113 ALA B CB  1 
ATOM   1940 N N   . TYR B 2 127 ? -5.344  0.142   103.819 1.00 15.37 ? 114 TYR B N   1 
ATOM   1941 C CA  . TYR B 2 127 ? -5.249  1.325   104.663 1.00 16.79 ? 114 TYR B CA  1 
ATOM   1942 C C   . TYR B 2 127 ? -4.368  2.324   103.929 1.00 18.37 ? 114 TYR B C   1 
ATOM   1943 O O   . TYR B 2 127 ? -3.148  2.187   103.890 1.00 16.38 ? 114 TYR B O   1 
ATOM   1944 C CB  . TYR B 2 127 ? -4.691  0.998   106.047 1.00 18.14 ? 114 TYR B CB  1 
ATOM   1945 C CG  . TYR B 2 127 ? -5.767  0.664   107.058 1.00 20.01 ? 114 TYR B CG  1 
ATOM   1946 C CD1 . TYR B 2 127 ? -7.030  0.268   106.645 1.00 22.74 ? 114 TYR B CD1 1 
ATOM   1947 C CD2 . TYR B 2 127 ? -5.527  0.765   108.420 1.00 24.63 ? 114 TYR B CD2 1 
ATOM   1948 C CE1 . TYR B 2 127 ? -8.019  -0.033  107.557 1.00 24.71 ? 114 TYR B CE1 1 
ATOM   1949 C CE2 . TYR B 2 127 ? -6.514  0.470   109.346 1.00 24.40 ? 114 TYR B CE2 1 
ATOM   1950 C CZ  . TYR B 2 127 ? -7.758  0.070   108.906 1.00 24.21 ? 114 TYR B CZ  1 
ATOM   1951 O OH  . TYR B 2 127 ? -8.748  -0.226  109.812 1.00 26.65 ? 114 TYR B OH  1 
ATOM   1952 N N   . ALA B 2 128 ? -5.008  3.309   103.314 1.00 19.53 ? 115 ALA B N   1 
ATOM   1953 C CA  . ALA B 2 128 ? -4.318  4.269   102.476 1.00 17.67 ? 115 ALA B CA  1 
ATOM   1954 C C   . ALA B 2 128 ? -5.179  5.498   102.315 1.00 21.83 ? 115 ALA B C   1 
ATOM   1955 O O   . ALA B 2 128 ? -6.393  5.437   102.482 1.00 18.85 ? 115 ALA B O   1 
ATOM   1956 C CB  . ALA B 2 128 ? -4.001  3.670   101.112 1.00 16.01 ? 115 ALA B CB  1 
ATOM   1957 N N   . PHE B 2 129 ? -4.539  6.610   101.984 1.00 20.47 ? 116 PHE B N   1 
ATOM   1958 C CA  . PHE B 2 129 ? -5.245  7.841   101.691 1.00 22.79 ? 116 PHE B CA  1 
ATOM   1959 C C   . PHE B 2 129 ? -4.848  8.284   100.281 1.00 28.85 ? 116 PHE B C   1 
ATOM   1960 O O   . PHE B 2 129 ? -4.046  7.616   99.628  1.00 31.56 ? 116 PHE B O   1 
ATOM   1961 C CB  . PHE B 2 129 ? -4.914  8.915   102.733 1.00 24.67 ? 116 PHE B CB  1 
ATOM   1962 C CG  . PHE B 2 129 ? -5.149  8.480   104.164 1.00 25.93 ? 116 PHE B CG  1 
ATOM   1963 C CD1 . PHE B 2 129 ? -6.437  8.328   104.660 1.00 25.03 ? 116 PHE B CD1 1 
ATOM   1964 C CD2 . PHE B 2 129 ? -4.078  8.247   105.016 1.00 28.79 ? 116 PHE B CD2 1 
ATOM   1965 C CE1 . PHE B 2 129 ? -6.650  7.935   105.974 1.00 26.73 ? 116 PHE B CE1 1 
ATOM   1966 C CE2 . PHE B 2 129 ? -4.284  7.857   106.330 1.00 30.06 ? 116 PHE B CE2 1 
ATOM   1967 C CZ  . PHE B 2 129 ? -5.569  7.701   106.811 1.00 28.46 ? 116 PHE B CZ  1 
ATOM   1968 N N   . ASP B 2 130 ? -5.439  9.381   99.811  1.00 35.55 ? 117 ASP B N   1 
ATOM   1969 C CA  . ASP B 2 130 ? -5.050  10.044  98.554  1.00 40.17 ? 117 ASP B CA  1 
ATOM   1970 C C   . ASP B 2 130 ? -5.463  9.327   97.253  1.00 33.70 ? 117 ASP B C   1 
ATOM   1971 O O   . ASP B 2 130 ? -5.156  9.806   96.160  1.00 31.35 ? 117 ASP B O   1 
ATOM   1972 C CB  . ASP B 2 130 ? -3.537  10.292  98.542  1.00 43.04 ? 117 ASP B CB  1 
ATOM   1973 C CG  . ASP B 2 130 ? -3.069  11.067  99.760  1.00 46.59 ? 117 ASP B CG  1 
ATOM   1974 O OD1 . ASP B 2 130 ? -3.825  11.941  100.238 1.00 49.54 ? 117 ASP B OD1 1 
ATOM   1975 O OD2 . ASP B 2 130 ? -1.949  10.801  100.244 1.00 46.09 ? 117 ASP B OD2 1 
ATOM   1976 N N   . GLY B 2 131 ? -6.145  8.192   97.362  1.00 26.35 ? 118 GLY B N   1 
ATOM   1977 C CA  . GLY B 2 131 ? -6.929  7.680   96.248  1.00 25.19 ? 118 GLY B CA  1 
ATOM   1978 C C   . GLY B 2 131 ? -6.276  6.903   95.116  1.00 23.86 ? 118 GLY B C   1 
ATOM   1979 O O   . GLY B 2 131 ? -6.952  6.578   94.137  1.00 20.96 ? 118 GLY B O   1 
ATOM   1980 N N   . ASP B 2 132 ? -4.988  6.592   95.223  1.00 18.50 ? 119 ASP B N   1 
ATOM   1981 C CA  . ASP B 2 132 ? -4.322  5.829   94.166  1.00 18.98 ? 119 ASP B CA  1 
ATOM   1982 C C   . ASP B 2 132 ? -4.780  4.374   94.169  1.00 19.15 ? 119 ASP B C   1 
ATOM   1983 O O   . ASP B 2 132 ? -4.951  3.768   93.115  1.00 19.19 ? 119 ASP B O   1 
ATOM   1984 C CB  . ASP B 2 132 ? -2.802  5.903   94.310  1.00 22.13 ? 119 ASP B CB  1 
ATOM   1985 C CG  . ASP B 2 132 ? -2.266  7.300   94.079  1.00 29.50 ? 119 ASP B CG  1 
ATOM   1986 O OD1 . ASP B 2 132 ? -2.775  7.994   93.174  1.00 34.13 ? 119 ASP B OD1 1 
ATOM   1987 O OD2 . ASP B 2 132 ? -1.342  7.706   94.810  1.00 35.37 ? 119 ASP B OD2 1 
ATOM   1988 N N   . PHE B 2 133 ? -4.980  3.815   95.359  1.00 17.19 ? 120 PHE B N   1 
ATOM   1989 C CA  . PHE B 2 133 ? -5.510  2.461   95.475  1.00 15.47 ? 120 PHE B CA  1 
ATOM   1990 C C   . PHE B 2 133 ? -6.956  2.385   94.972  1.00 18.40 ? 120 PHE B C   1 
ATOM   1991 O O   . PHE B 2 133 ? -7.348  1.414   94.316  1.00 17.28 ? 120 PHE B O   1 
ATOM   1992 C CB  . PHE B 2 133 ? -5.413  1.980   96.923  1.00 13.87 ? 120 PHE B CB  1 
ATOM   1993 C CG  . PHE B 2 133 ? -4.022  1.567   97.329  1.00 13.81 ? 120 PHE B CG  1 
ATOM   1994 C CD1 . PHE B 2 133 ? -3.053  2.518   97.610  1.00 16.35 ? 120 PHE B CD1 1 
ATOM   1995 C CD2 . PHE B 2 133 ? -3.687  0.228   97.430  1.00 15.90 ? 120 PHE B CD2 1 
ATOM   1996 C CE1 . PHE B 2 133 ? -1.765  2.138   97.982  1.00 17.12 ? 120 PHE B CE1 1 
ATOM   1997 C CE2 . PHE B 2 133 ? -2.408  -0.162  97.801  1.00 14.57 ? 120 PHE B CE2 1 
ATOM   1998 C CZ  . PHE B 2 133 ? -1.446  0.796   98.078  1.00 15.62 ? 120 PHE B CZ  1 
ATOM   1999 N N   . SER B 2 134 ? -7.748  3.412   95.274  1.00 18.16 ? 121 SER B N   1 
ATOM   2000 C CA  . SER B 2 134 ? -9.119  3.487   94.771  1.00 18.61 ? 121 SER B CA  1 
ATOM   2001 C C   . SER B 2 134 ? -9.142  3.523   93.247  1.00 23.87 ? 121 SER B C   1 
ATOM   2002 O O   . SER B 2 134 ? -9.966  2.863   92.616  1.00 22.75 ? 121 SER B O   1 
ATOM   2003 C CB  . SER B 2 134 ? -9.834  4.718   95.329  1.00 21.94 ? 121 SER B CB  1 
ATOM   2004 O OG  . SER B 2 134 ? -9.824  4.713   96.744  1.00 22.74 ? 121 SER B OG  1 
ATOM   2005 N N   . ALA B 2 135 ? -8.233  4.296   92.658  1.00 20.61 ? 122 ALA B N   1 
ATOM   2006 C CA  . ALA B 2 135 ? -8.162  4.400   91.205  1.00 23.25 ? 122 ALA B CA  1 
ATOM   2007 C C   . ALA B 2 135 ? -7.758  3.067   90.583  1.00 23.23 ? 122 ALA B C   1 
ATOM   2008 O O   . ALA B 2 135 ? -8.182  2.734   89.475  1.00 26.02 ? 122 ALA B O   1 
ATOM   2009 C CB  . ALA B 2 135 ? -7.191  5.496   90.791  1.00 24.31 ? 122 ALA B CB  1 
ATOM   2010 N N   . ALA B 2 136 ? -6.946  2.303   91.305  1.00 20.77 ? 123 ALA B N   1 
ATOM   2011 C CA  . ALA B 2 136 ? -6.444  1.033   90.797  1.00 21.15 ? 123 ALA B CA  1 
ATOM   2012 C C   . ALA B 2 136 ? -7.432  -0.105  91.038  1.00 23.76 ? 123 ALA B C   1 
ATOM   2013 O O   . ALA B 2 136 ? -7.184  -1.245  90.647  1.00 26.99 ? 123 ALA B O   1 
ATOM   2014 C CB  . ALA B 2 136 ? -5.098  0.702   91.425  1.00 19.32 ? 123 ALA B CB  1 
ATOM   2015 N N   . GLY B 2 137 ? -8.554  0.203   91.678  1.00 21.34 ? 124 GLY B N   1 
ATOM   2016 C CA  . GLY B 2 137 ? -9.624  -0.769  91.816  1.00 24.59 ? 124 GLY B CA  1 
ATOM   2017 C C   . GLY B 2 137 ? -9.709  -1.449  93.168  1.00 24.35 ? 124 GLY B C   1 
ATOM   2018 O O   . GLY B 2 137 ? -10.430 -2.435  93.323  1.00 26.37 ? 124 GLY B O   1 
ATOM   2019 N N   . PHE B 2 138 ? -8.975  -0.928  94.147  1.00 19.15 ? 125 PHE B N   1 
ATOM   2020 C CA  . PHE B 2 138 ? -9.036  -1.454  95.505  1.00 22.04 ? 125 PHE B CA  1 
ATOM   2021 C C   . PHE B 2 138 ? -9.880  -0.532  96.378  1.00 24.05 ? 125 PHE B C   1 
ATOM   2022 O O   . PHE B 2 138 ? -10.341 0.513   95.920  1.00 26.68 ? 125 PHE B O   1 
ATOM   2023 C CB  . PHE B 2 138 ? -7.630  -1.614  96.096  1.00 18.47 ? 125 PHE B CB  1 
ATOM   2024 C CG  . PHE B 2 138 ? -6.747  -2.546  95.314  1.00 17.78 ? 125 PHE B CG  1 
ATOM   2025 C CD1 . PHE B 2 138 ? -6.877  -3.920  95.442  1.00 18.48 ? 125 PHE B CD1 1 
ATOM   2026 C CD2 . PHE B 2 138 ? -5.793  -2.048  94.443  1.00 20.49 ? 125 PHE B CD2 1 
ATOM   2027 C CE1 . PHE B 2 138 ? -6.066  -4.782  94.720  1.00 19.11 ? 125 PHE B CE1 1 
ATOM   2028 C CE2 . PHE B 2 138 ? -4.982  -2.903  93.715  1.00 23.12 ? 125 PHE B CE2 1 
ATOM   2029 C CZ  . PHE B 2 138 ? -5.120  -4.271  93.853  1.00 18.97 ? 125 PHE B CZ  1 
ATOM   2030 N N   . VAL B 2 139 ? -10.084 -0.921  97.631  1.00 16.95 ? 126 VAL B N   1 
ATOM   2031 C CA  . VAL B 2 139 ? -10.863 -0.109  98.555  1.00 18.20 ? 126 VAL B CA  1 
ATOM   2032 C C   . VAL B 2 139 ? -9.970  0.534   99.606  1.00 18.91 ? 126 VAL B C   1 
ATOM   2033 O O   . VAL B 2 139 ? -9.297  -0.166  100.362 1.00 23.20 ? 126 VAL B O   1 
ATOM   2034 C CB  . VAL B 2 139 ? -11.942 -0.943  99.272  1.00 19.75 ? 126 VAL B CB  1 
ATOM   2035 C CG1 . VAL B 2 139 ? -12.574 -0.139  100.400 1.00 19.94 ? 126 VAL B CG1 1 
ATOM   2036 C CG2 . VAL B 2 139 ? -13.000 -1.437  98.272  1.00 21.40 ? 126 VAL B CG2 1 
ATOM   2037 N N   . GLU B 2 140 ? -9.959  1.863   99.653  1.00 18.87 ? 127 GLU B N   1 
ATOM   2038 C CA  . GLU B 2 140 ? -9.266  2.567   100.729 1.00 16.43 ? 127 GLU B CA  1 
ATOM   2039 C C   . GLU B 2 140 ? -10.236 2.737   101.887 1.00 18.29 ? 127 GLU B C   1 
ATOM   2040 O O   . GLU B 2 140 ? -11.223 3.468   101.790 1.00 18.99 ? 127 GLU B O   1 
ATOM   2041 C CB  . GLU B 2 140 ? -8.726  3.911   100.251 1.00 16.55 ? 127 GLU B CB  1 
ATOM   2042 C CG  . GLU B 2 140 ? -7.764  3.759   99.087  1.00 19.23 ? 127 GLU B CG  1 
ATOM   2043 C CD  . GLU B 2 140 ? -7.143  5.066   98.645  1.00 26.53 ? 127 GLU B CD  1 
ATOM   2044 O OE1 . GLU B 2 140 ? -7.374  6.101   99.308  1.00 23.07 ? 127 GLU B OE1 1 
ATOM   2045 O OE2 . GLU B 2 140 ? -6.413  5.046   97.630  1.00 27.55 ? 127 GLU B OE2 1 
ATOM   2046 N N   . VAL B 2 141 ? -9.957  2.031   102.975 1.00 20.04 ? 128 VAL B N   1 
ATOM   2047 C CA  . VAL B 2 141 ? -10.861 1.986   104.115 1.00 20.40 ? 128 VAL B CA  1 
ATOM   2048 C C   . VAL B 2 141 ? -10.987 3.356   104.764 1.00 23.84 ? 128 VAL B C   1 
ATOM   2049 O O   . VAL B 2 141 ? -9.994  4.061   104.948 1.00 21.91 ? 128 VAL B O   1 
ATOM   2050 C CB  . VAL B 2 141 ? -10.390 0.957   105.152 1.00 27.08 ? 128 VAL B CB  1 
ATOM   2051 C CG1 . VAL B 2 141 ? -11.363 0.884   106.321 1.00 24.47 ? 128 VAL B CG1 1 
ATOM   2052 C CG2 . VAL B 2 141 ? -10.233 -0.404  104.498 1.00 27.53 ? 128 VAL B CG2 1 
ATOM   2053 N N   . ARG B 2 142 ? -12.220 3.728   105.094 1.00 26.44 ? 129 ARG B N   1 
ATOM   2054 C CA  . ARG B 2 142 ? -12.515 5.018   105.705 1.00 28.28 ? 129 ARG B CA  1 
ATOM   2055 C C   . ARG B 2 142 ? -13.218 4.834   107.051 1.00 34.09 ? 129 ARG B C   1 
ATOM   2056 O O   . ARG B 2 142 ? -13.916 3.841   107.258 1.00 34.42 ? 129 ARG B O   1 
ATOM   2057 C CB  . ARG B 2 142 ? -13.372 5.861   104.758 1.00 32.11 ? 129 ARG B CB  1 
ATOM   2058 C CG  . ARG B 2 142 ? -12.665 6.242   103.469 1.00 27.78 ? 129 ARG B CG  1 
ATOM   2059 C CD  . ARG B 2 142 ? -11.553 7.232   103.748 1.00 32.06 ? 129 ARG B CD  1 
ATOM   2060 N NE  . ARG B 2 142 ? -10.758 7.519   102.557 1.00 33.12 ? 129 ARG B NE  1 
ATOM   2061 C CZ  . ARG B 2 142 ? -9.589  6.948   102.282 1.00 27.03 ? 129 ARG B CZ  1 
ATOM   2062 N NH1 . ARG B 2 142 ? -9.068  6.054   103.114 1.00 21.86 ? 129 ARG B NH1 1 
ATOM   2063 N NH2 . ARG B 2 142 ? -8.941  7.276   101.174 1.00 22.87 ? 129 ARG B NH2 1 
ATOM   2064 N N   . PRO B 2 143 ? -13.031 5.790   107.977 1.00 36.99 ? 130 PRO B N   1 
ATOM   2065 C CA  . PRO B 2 143 ? -13.648 5.686   109.303 1.00 42.42 ? 130 PRO B CA  1 
ATOM   2066 C C   . PRO B 2 143 ? -15.142 5.997   109.273 1.00 45.82 ? 130 PRO B C   1 
ATOM   2067 O O   . PRO B 2 143 ? -15.934 5.057   109.229 1.00 52.79 ? 130 PRO B O   1 
ATOM   2068 C CB  . PRO B 2 143 ? -12.889 6.732   110.120 1.00 46.32 ? 130 PRO B CB  1 
ATOM   2069 C CG  . PRO B 2 143 ? -12.509 7.764   109.116 1.00 45.45 ? 130 PRO B CG  1 
ATOM   2070 C CD  . PRO B 2 143 ? -12.197 7.000   107.855 1.00 41.68 ? 130 PRO B CD  1 
HETATM 2071 O O   . HOH C 3 .   ? 28.339  1.763   104.283 1.00 38.25 ? 201 HOH A O   1 
HETATM 2072 O O   . HOH C 3 .   ? 23.340  12.662  102.892 1.00 46.30 ? 202 HOH A O   1 
HETATM 2073 O O   . HOH C 3 .   ? 33.395  17.644  81.768  1.00 47.49 ? 203 HOH A O   1 
HETATM 2074 O O   . HOH C 3 .   ? 28.554  -3.762  82.960  1.00 36.72 ? 204 HOH A O   1 
HETATM 2075 O O   . HOH C 3 .   ? 23.222  11.463  96.405  1.00 42.97 ? 205 HOH A O   1 
HETATM 2076 O O   . HOH C 3 .   ? 12.649  -7.393  103.283 1.00 38.83 ? 206 HOH A O   1 
HETATM 2077 O O   . HOH C 3 .   ? 27.120  10.036  107.970 1.00 32.24 ? 207 HOH A O   1 
HETATM 2078 O O   . HOH C 3 .   ? 32.716  13.464  94.010  1.00 36.52 ? 208 HOH A O   1 
HETATM 2079 O O   . HOH C 3 .   ? 5.222   9.226   94.657  1.00 37.65 ? 209 HOH A O   1 
HETATM 2080 O O   . HOH C 3 .   ? 25.221  11.464  96.973  1.00 30.59 ? 210 HOH A O   1 
HETATM 2081 O O   . HOH C 3 .   ? 8.203   4.559   94.080  1.00 14.87 ? 211 HOH A O   1 
HETATM 2082 O O   . HOH C 3 .   ? 19.549  -6.605  83.343  1.00 28.11 ? 212 HOH A O   1 
HETATM 2083 O O   . HOH C 3 .   ? 18.248  7.241   96.029  1.00 39.06 ? 213 HOH A O   1 
HETATM 2084 O O   . HOH C 3 .   ? 17.435  8.515   98.132  1.00 29.28 ? 214 HOH A O   1 
HETATM 2085 O O   . HOH C 3 .   ? 23.521  15.692  100.407 1.00 55.00 ? 215 HOH A O   1 
HETATM 2086 O O   . HOH C 3 .   ? 14.434  8.169   98.498  1.00 42.53 ? 216 HOH A O   1 
HETATM 2087 O O   . HOH C 3 .   ? 23.438  -2.195  117.655 1.00 42.68 ? 217 HOH A O   1 
HETATM 2088 O O   . HOH C 3 .   ? 20.531  4.936   96.359  1.00 20.47 ? 218 HOH A O   1 
HETATM 2089 O O   . HOH C 3 .   ? 35.482  1.806   88.886  1.00 37.53 ? 219 HOH A O   1 
HETATM 2090 O O   . HOH C 3 .   ? 28.657  -8.735  85.631  1.00 47.68 ? 220 HOH A O   1 
HETATM 2091 O O   . HOH C 3 .   ? 18.935  9.476   108.673 1.00 25.74 ? 221 HOH A O   1 
HETATM 2092 O O   . HOH C 3 .   ? 4.123   5.686   77.353  1.00 36.89 ? 222 HOH A O   1 
HETATM 2093 O O   . HOH C 3 .   ? 19.624  0.194   96.365  1.00 13.79 ? 223 HOH A O   1 
HETATM 2094 O O   . HOH C 3 .   ? 19.878  8.737   95.858  1.00 21.02 ? 224 HOH A O   1 
HETATM 2095 O O   . HOH C 3 .   ? 34.274  9.162   100.266 1.00 43.15 ? 225 HOH A O   1 
HETATM 2096 O O   . HOH C 3 .   ? 20.108  6.910   109.105 1.00 21.97 ? 226 HOH A O   1 
HETATM 2097 O O   . HOH C 3 .   ? 22.053  -11.364 100.758 1.00 36.60 ? 227 HOH A O   1 
HETATM 2098 O O   . HOH C 3 .   ? 3.265   11.903  85.332  1.00 39.09 ? 228 HOH A O   1 
HETATM 2099 O O   . HOH C 3 .   ? 13.650  -7.740  91.370  1.00 36.58 ? 229 HOH A O   1 
HETATM 2100 O O   . HOH C 3 .   ? 20.234  9.372   101.706 1.00 28.53 ? 230 HOH A O   1 
HETATM 2101 O O   . HOH C 3 .   ? 37.671  6.203   92.193  1.00 21.98 ? 231 HOH A O   1 
HETATM 2102 O O   . HOH C 3 .   ? 14.338  -5.985  97.289  1.00 18.36 ? 232 HOH A O   1 
HETATM 2103 O O   . HOH C 3 .   ? 27.983  15.801  78.148  1.00 43.68 ? 233 HOH A O   1 
HETATM 2104 O O   . HOH C 3 .   ? 27.314  -0.874  80.638  1.00 43.61 ? 234 HOH A O   1 
HETATM 2105 O O   . HOH C 3 .   ? 14.492  -7.764  105.497 1.00 29.39 ? 235 HOH A O   1 
HETATM 2106 O O   . HOH C 3 .   ? 11.874  0.574   97.230  1.00 23.68 ? 236 HOH A O   1 
HETATM 2107 O O   . HOH C 3 .   ? 29.185  9.965   90.041  1.00 35.16 ? 237 HOH A O   1 
HETATM 2108 O O   . HOH C 3 .   ? 21.568  10.033  97.228  1.00 32.97 ? 238 HOH A O   1 
HETATM 2109 O O   . HOH C 3 .   ? 28.745  14.592  101.069 1.00 21.40 ? 239 HOH A O   1 
HETATM 2110 O O   . HOH C 3 .   ? 24.233  -2.961  109.142 1.00 29.80 ? 240 HOH A O   1 
HETATM 2111 O O   . HOH C 3 .   ? 19.412  13.961  89.467  1.00 35.51 ? 241 HOH A O   1 
HETATM 2112 O O   . HOH C 3 .   ? 23.522  0.604   104.664 1.00 16.20 ? 242 HOH A O   1 
HETATM 2113 O O   . HOH C 3 .   ? 20.706  20.139  79.891  1.00 52.41 ? 243 HOH A O   1 
HETATM 2114 O O   . HOH C 3 .   ? 19.172  -11.124 94.853  1.00 33.87 ? 244 HOH A O   1 
HETATM 2115 O O   . HOH C 3 .   ? 28.694  3.583   107.260 1.00 41.84 ? 245 HOH A O   1 
HETATM 2116 O O   . HOH C 3 .   ? 16.515  2.223   78.771  1.00 27.30 ? 246 HOH A O   1 
HETATM 2117 O O   . HOH C 3 .   ? 19.895  -9.983  92.184  1.00 28.35 ? 247 HOH A O   1 
HETATM 2118 O O   . HOH C 3 .   ? 34.649  3.057   101.815 1.00 40.43 ? 248 HOH A O   1 
HETATM 2119 O O   . HOH C 3 .   ? 27.143  9.248   76.882  1.00 28.94 ? 249 HOH A O   1 
HETATM 2120 O O   . HOH C 3 .   ? 26.626  -5.333  103.115 1.00 30.07 ? 250 HOH A O   1 
HETATM 2121 O O   . HOH C 3 .   ? 21.059  -0.426  114.655 1.00 34.18 ? 251 HOH A O   1 
HETATM 2122 O O   . HOH C 3 .   ? 21.403  -9.155  107.561 1.00 29.70 ? 252 HOH A O   1 
HETATM 2123 O O   . HOH C 3 .   ? 33.109  -3.112  100.409 1.00 22.28 ? 253 HOH A O   1 
HETATM 2124 O O   . HOH C 3 .   ? 12.084  2.070   94.990  1.00 18.06 ? 254 HOH A O   1 
HETATM 2125 O O   . HOH C 3 .   ? 16.041  14.442  86.521  1.00 27.22 ? 255 HOH A O   1 
HETATM 2126 O O   . HOH C 3 .   ? 34.153  -2.559  85.498  1.00 40.80 ? 256 HOH A O   1 
HETATM 2127 O O   . HOH C 3 .   ? 17.914  -2.200  78.366  1.00 35.11 ? 257 HOH A O   1 
HETATM 2128 O O   . HOH C 3 .   ? 2.263   9.281   84.255  1.00 26.93 ? 258 HOH A O   1 
HETATM 2129 O O   . HOH C 3 .   ? 34.233  6.106   85.575  1.00 38.28 ? 259 HOH A O   1 
HETATM 2130 O O   . HOH C 3 .   ? 17.089  -8.466  77.534  1.00 40.04 ? 260 HOH A O   1 
HETATM 2131 O O   . HOH C 3 .   ? 14.110  8.959   80.119  1.00 35.29 ? 261 HOH A O   1 
HETATM 2132 O O   . HOH C 3 .   ? 15.287  -12.072 100.179 1.00 33.87 ? 262 HOH A O   1 
HETATM 2133 O O   . HOH C 3 .   ? 39.581  15.710  80.499  1.00 39.59 ? 263 HOH A O   1 
HETATM 2134 O O   . HOH C 3 .   ? 20.898  14.104  102.845 1.00 49.93 ? 264 HOH A O   1 
HETATM 2135 O O   . HOH C 3 .   ? 34.539  11.340  82.173  1.00 38.62 ? 265 HOH A O   1 
HETATM 2136 O O   . HOH C 3 .   ? 38.805  15.297  82.983  1.00 49.13 ? 266 HOH A O   1 
HETATM 2137 O O   . HOH C 3 .   ? 27.522  16.797  102.600 1.00 40.37 ? 267 HOH A O   1 
HETATM 2138 O O   . HOH C 3 .   ? 16.072  -7.079  86.018  1.00 37.70 ? 268 HOH A O   1 
HETATM 2139 O O   . HOH C 3 .   ? 7.483   17.230  81.987  1.00 40.76 ? 269 HOH A O   1 
HETATM 2140 O O   . HOH C 3 .   ? 31.065  2.693   103.135 1.00 30.09 ? 270 HOH A O   1 
HETATM 2141 O O   . HOH C 3 .   ? 23.822  3.573   76.800  1.00 35.76 ? 271 HOH A O   1 
HETATM 2142 O O   . HOH C 3 .   ? 2.777   11.049  81.230  1.00 31.82 ? 272 HOH A O   1 
HETATM 2143 O O   . HOH C 3 .   ? 34.546  0.653   92.949  1.00 17.89 ? 273 HOH A O   1 
HETATM 2144 O O   . HOH C 3 .   ? 33.199  11.473  96.541  1.00 21.86 ? 274 HOH A O   1 
HETATM 2145 O O   . HOH C 3 .   ? 21.086  15.592  106.692 1.00 36.70 ? 275 HOH A O   1 
HETATM 2146 O O   . HOH C 3 .   ? 20.366  -7.710  85.691  1.00 24.37 ? 276 HOH A O   1 
HETATM 2147 O O   . HOH C 3 .   ? 26.099  18.960  83.627  1.00 39.39 ? 277 HOH A O   1 
HETATM 2148 O O   . HOH C 3 .   ? 21.472  14.314  75.350  1.00 39.45 ? 278 HOH A O   1 
HETATM 2149 O O   . HOH C 3 .   ? 23.534  19.704  81.694  1.00 42.16 ? 279 HOH A O   1 
HETATM 2150 O O   . HOH C 3 .   ? 5.532   8.588   89.747  1.00 21.26 ? 280 HOH A O   1 
HETATM 2151 O O   . HOH C 3 .   ? 36.232  11.240  90.629  1.00 25.55 ? 281 HOH A O   1 
HETATM 2152 O O   . HOH C 3 .   ? 7.226   11.351  79.026  1.00 28.85 ? 282 HOH A O   1 
HETATM 2153 O O   . HOH C 3 .   ? 32.368  -0.801  99.770  1.00 21.22 ? 283 HOH A O   1 
HETATM 2154 O O   . HOH C 3 .   ? 21.120  6.393   116.715 1.00 42.28 ? 284 HOH A O   1 
HETATM 2155 O O   . HOH C 3 .   ? 22.925  -7.712  83.007  1.00 43.00 ? 285 HOH A O   1 
HETATM 2156 O O   . HOH C 3 .   ? 11.742  16.302  81.175  1.00 43.68 ? 286 HOH A O   1 
HETATM 2157 O O   . HOH C 3 .   ? 36.950  9.745   86.895  1.00 39.52 ? 287 HOH A O   1 
HETATM 2158 O O   . HOH C 3 .   ? 18.235  -8.767  87.229  1.00 39.34 ? 288 HOH A O   1 
HETATM 2159 O O   . HOH C 3 .   ? 33.666  10.964  78.294  1.00 39.34 ? 289 HOH A O   1 
HETATM 2160 O O   . HOH C 3 .   ? 30.589  17.764  82.902  1.00 54.48 ? 290 HOH A O   1 
HETATM 2161 O O   . HOH C 3 .   ? 16.226  -13.605 104.569 1.00 41.65 ? 291 HOH A O   1 
HETATM 2162 O O   . HOH C 3 .   ? 23.760  -10.514 102.568 1.00 39.35 ? 292 HOH A O   1 
HETATM 2163 O O   . HOH C 3 .   ? 20.259  13.581  95.380  1.00 36.55 ? 293 HOH A O   1 
HETATM 2164 O O   . HOH C 3 .   ? 17.601  -12.888 102.339 1.00 38.98 ? 294 HOH A O   1 
HETATM 2165 O O   . HOH C 3 .   ? 9.046   -3.497  79.625  1.00 26.06 ? 295 HOH A O   1 
HETATM 2166 O O   . HOH C 3 .   ? 24.337  5.039   117.236 1.00 37.79 ? 296 HOH A O   1 
HETATM 2167 O O   . HOH C 3 .   ? 4.603   10.627  78.193  1.00 28.08 ? 297 HOH A O   1 
HETATM 2168 O O   . HOH C 3 .   ? 17.297  13.488  91.525  1.00 42.52 ? 298 HOH A O   1 
HETATM 2169 O O   . HOH C 3 .   ? 18.049  6.797   82.112  1.00 40.17 ? 299 HOH A O   1 
HETATM 2170 O O   . HOH C 3 .   ? 10.159  -1.795  79.478  1.00 17.89 ? 300 HOH A O   1 
HETATM 2171 O O   . HOH C 3 .   ? 19.483  -13.805 101.015 1.00 41.72 ? 301 HOH A O   1 
HETATM 2172 O O   . HOH C 3 .   ? 32.080  6.822   106.139 1.00 42.94 ? 302 HOH A O   1 
HETATM 2173 O O   . HOH C 3 .   ? 18.179  11.705  101.557 1.00 45.37 ? 303 HOH A O   1 
HETATM 2174 O O   . HOH C 3 .   ? 17.988  10.596  98.638  1.00 41.77 ? 304 HOH A O   1 
HETATM 2175 O O   . HOH C 3 .   ? 37.458  5.794   89.188  1.00 32.26 ? 305 HOH A O   1 
HETATM 2176 O O   . HOH C 3 .   ? 16.250  -6.919  90.218  1.00 26.00 ? 306 HOH A O   1 
HETATM 2177 O O   . HOH C 3 .   ? 27.975  -5.837  84.134  1.00 50.75 ? 307 HOH A O   1 
HETATM 2178 O O   . HOH C 3 .   ? 10.817  4.328   95.488  1.00 35.98 ? 308 HOH A O   1 
HETATM 2179 O O   . HOH C 3 .   ? 29.515  6.650   107.620 1.00 44.69 ? 309 HOH A O   1 
HETATM 2180 O O   . HOH C 3 .   ? 9.340   -7.013  78.812  1.00 47.25 ? 310 HOH A O   1 
HETATM 2181 O O   . HOH C 3 .   ? 29.222  -6.060  103.908 1.00 37.66 ? 311 HOH A O   1 
HETATM 2182 O O   . HOH C 3 .   ? 32.851  1.587   101.360 1.00 35.35 ? 312 HOH A O   1 
HETATM 2183 O O   . HOH C 3 .   ? 17.479  11.904  93.217  1.00 38.25 ? 313 HOH A O   1 
HETATM 2184 O O   . HOH C 3 .   ? 35.061  11.363  97.978  1.00 41.52 ? 314 HOH A O   1 
HETATM 2185 O O   . HOH C 3 .   ? 27.693  6.547   75.932  1.00 37.71 ? 315 HOH A O   1 
HETATM 2186 O O   . HOH C 3 .   ? 35.182  5.022   87.901  1.00 32.97 ? 316 HOH A O   1 
HETATM 2187 O O   . HOH C 3 .   ? 17.047  -12.449 95.478  1.00 40.55 ? 317 HOH A O   1 
HETATM 2188 O O   . HOH C 3 .   ? 6.288   -4.717  79.558  1.00 40.46 ? 318 HOH A O   1 
HETATM 2189 O O   . HOH C 3 .   ? 15.646  -12.586 93.448  1.00 29.40 ? 319 HOH A O   1 
HETATM 2190 O O   . HOH C 3 .   ? 18.615  0.703   78.438  1.00 33.30 ? 320 HOH A O   1 
HETATM 2191 O O   . HOH C 3 .   ? 34.307  13.104  100.461 1.00 43.61 ? 321 HOH A O   1 
HETATM 2192 O O   . HOH C 3 .   ? 16.451  -11.863 91.376  1.00 40.78 ? 322 HOH A O   1 
HETATM 2193 O O   . HOH C 3 .   ? 18.187  -11.140 87.449  1.00 52.97 ? 323 HOH A O   1 
HETATM 2194 O O   . HOH C 3 .   ? 15.898  -9.781  89.571  1.00 51.46 ? 324 HOH A O   1 
HETATM 2195 O O   . HOH C 3 .   ? 21.361  -1.618  75.135  1.00 45.25 ? 325 HOH A O   1 
HETATM 2196 O O   . HOH C 3 .   ? 19.289  5.310   80.001  1.00 42.19 ? 326 HOH A O   1 
HETATM 2197 O O   . HOH C 3 .   ? 35.107  16.071  92.544  1.00 41.46 ? 327 HOH A O   1 
HETATM 2198 O O   . HOH C 3 .   ? 34.849  -7.456  83.158  1.00 59.53 ? 328 HOH A O   1 
HETATM 2199 O O   . HOH C 3 .   ? 36.544  -7.789  85.307  1.00 56.71 ? 329 HOH A O   1 
HETATM 2200 O O   . HOH D 3 .   ? 0.742   5.863   92.548  1.00 29.50 ? 201 HOH B O   1 
HETATM 2201 O O   . HOH D 3 .   ? -2.307  12.188  105.652 1.00 39.65 ? 202 HOH B O   1 
HETATM 2202 O O   . HOH D 3 .   ? -0.359  9.566   99.331  1.00 34.38 ? 203 HOH B O   1 
HETATM 2203 O O   . HOH D 3 .   ? 0.122   6.690   96.265  1.00 31.55 ? 204 HOH B O   1 
HETATM 2204 O O   . HOH D 3 .   ? -3.637  6.117   97.888  1.00 25.03 ? 205 HOH B O   1 
HETATM 2205 O O   . HOH D 3 .   ? 8.708   -16.287 92.504  1.00 50.42 ? 206 HOH B O   1 
HETATM 2206 O O   . HOH D 3 .   ? 12.200  -7.087  86.920  1.00 40.10 ? 207 HOH B O   1 
HETATM 2207 O O   . HOH D 3 .   ? 6.857   6.572   95.831  1.00 29.00 ? 208 HOH B O   1 
HETATM 2208 O O   . HOH D 3 .   ? 7.076   -8.358  110.980 1.00 39.00 ? 209 HOH B O   1 
HETATM 2209 O O   . HOH D 3 .   ? 4.691   -2.480  98.073  1.00 15.18 ? 210 HOH B O   1 
HETATM 2210 O O   . HOH D 3 .   ? -1.755  -9.356  111.299 1.00 28.29 ? 211 HOH B O   1 
HETATM 2211 O O   . HOH D 3 .   ? -5.883  3.550   86.715  1.00 25.55 ? 212 HOH B O   1 
HETATM 2212 O O   . HOH D 3 .   ? 11.557  12.843  114.939 1.00 38.20 ? 213 HOH B O   1 
HETATM 2213 O O   . HOH D 3 .   ? 1.927   1.596   98.007  1.00 20.97 ? 214 HOH B O   1 
HETATM 2214 O O   . HOH D 3 .   ? 1.923   -8.698  83.657  1.00 35.42 ? 215 HOH B O   1 
HETATM 2215 O O   . HOH D 3 .   ? -5.970  -1.812  117.314 1.00 34.48 ? 216 HOH B O   1 
HETATM 2216 O O   . HOH D 3 .   ? 7.005   0.413   115.443 1.00 31.35 ? 217 HOH B O   1 
HETATM 2217 O O   . HOH D 3 .   ? -3.922  10.505  93.759  1.00 55.14 ? 218 HOH B O   1 
HETATM 2218 O O   . HOH D 3 .   ? 17.161  12.400  109.948 1.00 27.56 ? 219 HOH B O   1 
HETATM 2219 O O   . HOH D 3 .   ? 3.151   12.295  107.992 1.00 19.04 ? 220 HOH B O   1 
HETATM 2220 O O   . HOH D 3 .   ? 12.390  -8.726  89.154  1.00 33.31 ? 221 HOH B O   1 
HETATM 2221 O O   . HOH D 3 .   ? 3.544   -4.342  80.109  1.00 23.49 ? 222 HOH B O   1 
HETATM 2222 O O   . HOH D 3 .   ? 0.777   14.328  105.503 1.00 34.23 ? 223 HOH B O   1 
HETATM 2223 O O   . HOH D 3 .   ? 3.208   -4.173  115.481 1.00 45.09 ? 224 HOH B O   1 
HETATM 2224 O O   . HOH D 3 .   ? -1.128  -15.979 95.336  1.00 43.51 ? 225 HOH B O   1 
HETATM 2225 O O   . HOH D 3 .   ? 6.532   -12.003 86.894  1.00 21.21 ? 226 HOH B O   1 
HETATM 2226 O O   . HOH D 3 .   ? -6.456  -11.155 93.922  1.00 43.36 ? 227 HOH B O   1 
HETATM 2227 O O   . HOH D 3 .   ? 13.838  5.508   100.114 1.00 16.93 ? 228 HOH B O   1 
HETATM 2228 O O   . HOH D 3 .   ? -2.458  16.029  114.134 1.00 29.80 ? 229 HOH B O   1 
HETATM 2229 O O   . HOH D 3 .   ? 0.185   -10.273 91.730  1.00 24.48 ? 230 HOH B O   1 
HETATM 2230 O O   . HOH D 3 .   ? -4.558  -4.290  90.302  1.00 33.99 ? 231 HOH B O   1 
HETATM 2231 O O   . HOH D 3 .   ? -8.018  9.456   116.805 1.00 41.95 ? 232 HOH B O   1 
HETATM 2232 O O   . HOH D 3 .   ? -9.958  -3.649  115.885 1.00 43.11 ? 233 HOH B O   1 
HETATM 2233 O O   . HOH D 3 .   ? 1.863   -6.300  79.518  1.00 41.54 ? 234 HOH B O   1 
HETATM 2234 O O   . HOH D 3 .   ? 7.619   -3.881  116.158 1.00 26.18 ? 235 HOH B O   1 
HETATM 2235 O O   . HOH D 3 .   ? -12.422 8.281   100.598 1.00 45.01 ? 236 HOH B O   1 
HETATM 2236 O O   . HOH D 3 .   ? -11.647 1.010   93.631  1.00 24.23 ? 237 HOH B O   1 
HETATM 2237 O O   . HOH D 3 .   ? -3.451  -4.449  84.354  1.00 31.88 ? 238 HOH B O   1 
HETATM 2238 O O   . HOH D 3 .   ? 11.609  -6.457  97.104  1.00 18.57 ? 239 HOH B O   1 
HETATM 2239 O O   . HOH D 3 .   ? -0.797  10.322  119.070 1.00 38.50 ? 240 HOH B O   1 
HETATM 2240 O O   . HOH D 3 .   ? 1.852   3.230   85.378  1.00 17.32 ? 241 HOH B O   1 
HETATM 2241 O O   . HOH D 3 .   ? 5.273   -10.441 111.223 1.00 43.94 ? 242 HOH B O   1 
HETATM 2242 O O   . HOH D 3 .   ? -12.334 -2.816  91.428  1.00 37.39 ? 243 HOH B O   1 
HETATM 2243 O O   . HOH D 3 .   ? -9.411  -7.004  114.690 1.00 44.09 ? 244 HOH B O   1 
HETATM 2244 O O   . HOH D 3 .   ? 0.775   -3.783  89.831  1.00 19.12 ? 245 HOH B O   1 
HETATM 2245 O O   . HOH D 3 .   ? -7.586  8.567   87.865  1.00 37.80 ? 246 HOH B O   1 
HETATM 2246 O O   . HOH D 3 .   ? 6.939   7.546   114.397 1.00 25.69 ? 247 HOH B O   1 
HETATM 2247 O O   . HOH D 3 .   ? -10.968 -1.551  119.047 1.00 47.32 ? 248 HOH B O   1 
HETATM 2248 O O   . HOH D 3 .   ? -9.189  -7.431  101.957 1.00 25.23 ? 249 HOH B O   1 
HETATM 2249 O O   . HOH D 3 .   ? 2.984   4.724   98.550  1.00 29.50 ? 250 HOH B O   1 
HETATM 2250 O O   . HOH D 3 .   ? 2.020   5.819   85.647  1.00 22.45 ? 251 HOH B O   1 
HETATM 2251 O O   . HOH D 3 .   ? 16.732  8.312   116.929 1.00 35.03 ? 252 HOH B O   1 
HETATM 2252 O O   . HOH D 3 .   ? -9.776  4.365   87.931  1.00 29.05 ? 253 HOH B O   1 
HETATM 2253 O O   . HOH D 3 .   ? -9.231  7.902   93.338  1.00 26.24 ? 254 HOH B O   1 
HETATM 2254 O O   . HOH D 3 .   ? -4.804  -6.588  113.805 1.00 40.27 ? 255 HOH B O   1 
HETATM 2255 O O   . HOH D 3 .   ? 6.132   -11.379 96.799  1.00 33.68 ? 256 HOH B O   1 
HETATM 2256 O O   . HOH D 3 .   ? 14.590  10.427  104.434 1.00 33.77 ? 257 HOH B O   1 
HETATM 2257 O O   . HOH D 3 .   ? -5.124  3.292   117.466 1.00 27.57 ? 258 HOH B O   1 
HETATM 2258 O O   . HOH D 3 .   ? 16.177  11.860  102.381 1.00 42.63 ? 259 HOH B O   1 
HETATM 2259 O O   . HOH D 3 .   ? -2.309  -13.351 104.788 1.00 45.30 ? 260 HOH B O   1 
HETATM 2260 O O   . HOH D 3 .   ? 0.064   10.663  105.142 1.00 24.14 ? 261 HOH B O   1 
HETATM 2261 O O   . HOH D 3 .   ? -7.210  4.049   105.063 1.00 26.29 ? 262 HOH B O   1 
HETATM 2262 O O   . HOH D 3 .   ? 9.293   8.408   100.869 1.00 32.00 ? 263 HOH B O   1 
HETATM 2263 O O   . HOH D 3 .   ? 11.025  1.956   99.266  1.00 21.80 ? 264 HOH B O   1 
HETATM 2264 O O   . HOH D 3 .   ? -10.398 -5.825  105.699 1.00 36.91 ? 265 HOH B O   1 
HETATM 2265 O O   . HOH D 3 .   ? 4.608   12.155  116.307 1.00 42.30 ? 266 HOH B O   1 
HETATM 2266 O O   . HOH D 3 .   ? -5.100  14.484  113.582 1.00 36.39 ? 267 HOH B O   1 
HETATM 2267 O O   . HOH D 3 .   ? 1.174   -6.898  85.061  1.00 31.57 ? 268 HOH B O   1 
HETATM 2268 O O   . HOH D 3 .   ? -8.168  -3.232  117.861 1.00 36.40 ? 269 HOH B O   1 
HETATM 2269 O O   . HOH D 3 .   ? -13.669 -5.128  100.362 1.00 43.29 ? 270 HOH B O   1 
HETATM 2270 O O   . HOH D 3 .   ? 1.712   19.804  112.054 1.00 46.30 ? 271 HOH B O   1 
HETATM 2271 O O   . HOH D 3 .   ? 13.084  -12.815 94.496  1.00 25.64 ? 272 HOH B O   1 
HETATM 2272 O O   . HOH D 3 .   ? -14.314 2.026   104.173 1.00 34.13 ? 273 HOH B O   1 
HETATM 2273 O O   . HOH D 3 .   ? -7.096  -8.545  95.264  1.00 26.44 ? 274 HOH B O   1 
HETATM 2274 O O   . HOH D 3 .   ? -9.856  -8.367  94.869  1.00 46.52 ? 275 HOH B O   1 
HETATM 2275 O O   . HOH D 3 .   ? -12.062 13.595  111.861 1.00 44.88 ? 276 HOH B O   1 
HETATM 2276 O O   . HOH D 3 .   ? -10.191 7.193   98.138  1.00 26.74 ? 277 HOH B O   1 
HETATM 2277 O O   . HOH D 3 .   ? 0.253   10.748  102.110 1.00 39.24 ? 278 HOH B O   1 
HETATM 2278 O O   . HOH D 3 .   ? 13.365  0.769   115.905 1.00 40.13 ? 279 HOH B O   1 
HETATM 2279 O O   . HOH D 3 .   ? -7.218  13.252  111.626 1.00 28.80 ? 280 HOH B O   1 
HETATM 2280 O O   . HOH D 3 .   ? -4.994  -3.038  87.541  1.00 45.64 ? 281 HOH B O   1 
HETATM 2281 O O   . HOH D 3 .   ? 2.286   -11.373 85.485  1.00 30.18 ? 282 HOH B O   1 
HETATM 2282 O O   . HOH D 3 .   ? -11.702 11.727  108.674 1.00 49.08 ? 283 HOH B O   1 
HETATM 2283 O O   . HOH D 3 .   ? 7.975   -12.238 102.259 1.00 26.19 ? 284 HOH B O   1 
HETATM 2284 O O   . HOH D 3 .   ? -0.748  16.483  106.934 1.00 26.28 ? 285 HOH B O   1 
HETATM 2285 O O   . HOH D 3 .   ? -1.229  9.812   91.448  1.00 39.50 ? 286 HOH B O   1 
HETATM 2286 O O   . HOH D 3 .   ? 8.318   -7.961  118.125 1.00 33.33 ? 287 HOH B O   1 
HETATM 2287 O O   . HOH D 3 .   ? 13.348  -4.464  89.751  1.00 36.97 ? 288 HOH B O   1 
HETATM 2288 O O   . HOH D 3 .   ? -9.161  -5.359  92.764  1.00 42.09 ? 289 HOH B O   1 
HETATM 2289 O O   . HOH D 3 .   ? -2.209  11.140  87.341  1.00 34.80 ? 290 HOH B O   1 
HETATM 2290 O O   . HOH D 3 .   ? -7.754  -4.063  91.383  1.00 35.93 ? 291 HOH B O   1 
HETATM 2291 O O   . HOH D 3 .   ? 16.809  13.805  112.943 1.00 37.92 ? 292 HOH B O   1 
HETATM 2292 O O   . HOH D 3 .   ? -0.207  9.304   83.075  1.00 41.68 ? 293 HOH B O   1 
HETATM 2293 O O   . HOH D 3 .   ? 6.769   -15.021 98.735  1.00 46.15 ? 294 HOH B O   1 
HETATM 2294 O O   . HOH D 3 .   ? 5.390   -13.923 94.063  1.00 26.88 ? 295 HOH B O   1 
HETATM 2295 O O   . HOH D 3 .   ? 14.734  -1.188  114.730 1.00 24.66 ? 296 HOH B O   1 
HETATM 2296 O O   . HOH D 3 .   ? 10.772  -14.569 92.287  1.00 21.74 ? 297 HOH B O   1 
HETATM 2297 O O   . HOH D 3 .   ? -13.990 1.154   108.767 1.00 35.53 ? 298 HOH B O   1 
HETATM 2298 O O   . HOH D 3 .   ? -13.100 3.453   111.942 1.00 44.63 ? 299 HOH B O   1 
HETATM 2299 O O   . HOH D 3 .   ? 7.095   8.909   99.547  1.00 38.28 ? 300 HOH B O   1 
HETATM 2300 O O   . HOH D 3 .   ? 4.158   9.226   91.991  1.00 37.32 ? 301 HOH B O   1 
HETATM 2301 O O   . HOH D 3 .   ? 6.399   -10.598 108.939 1.00 40.54 ? 302 HOH B O   1 
HETATM 2302 O O   . HOH D 3 .   ? -7.427  1.307   86.773  1.00 45.25 ? 303 HOH B O   1 
HETATM 2303 O O   . HOH D 3 .   ? -6.872  11.098  93.793  1.00 40.59 ? 304 HOH B O   1 
HETATM 2304 O O   . HOH D 3 .   ? -10.381 -9.670  100.823 1.00 43.70 ? 305 HOH B O   1 
HETATM 2305 O O   . HOH D 3 .   ? -0.878  -12.052 111.864 1.00 42.66 ? 306 HOH B O   1 
HETATM 2306 O O   . HOH D 3 .   ? -0.763  -7.517  86.410  1.00 30.63 ? 307 HOH B O   1 
HETATM 2307 O O   . HOH D 3 .   ? -16.682 3.445   105.493 1.00 41.72 ? 308 HOH B O   1 
HETATM 2308 O O   . HOH D 3 .   ? 9.415   -12.870 85.882  1.00 43.51 ? 309 HOH B O   1 
HETATM 2309 O O   . HOH D 3 .   ? 4.773   -11.006 85.249  1.00 38.93 ? 310 HOH B O   1 
HETATM 2310 O O   . HOH D 3 .   ? 13.064  -12.501 96.886  1.00 47.48 ? 311 HOH B O   1 
HETATM 2311 O O   . HOH D 3 .   ? 10.228  11.640  117.511 1.00 42.20 ? 312 HOH B O   1 
HETATM 2312 O O   . HOH D 3 .   ? -13.056 -0.339  117.145 1.00 47.61 ? 313 HOH B O   1 
HETATM 2313 O O   . HOH D 3 .   ? -4.273  -6.569  81.625  1.00 54.67 ? 314 HOH B O   1 
HETATM 2314 O O   . HOH D 3 .   ? -2.872  15.049  105.183 1.00 37.22 ? 315 HOH B O   1 
HETATM 2315 O O   . HOH D 3 .   ? 1.097   9.835   80.362  1.00 48.10 ? 316 HOH B O   1 
HETATM 2316 O O   . HOH D 3 .   ? -3.645  -6.209  86.488  1.00 33.85 ? 317 HOH B O   1 
HETATM 2317 O O   . HOH D 3 .   ? 1.835   8.317   93.025  1.00 37.44 ? 318 HOH B O   1 
HETATM 2318 O O   . HOH D 3 .   ? 15.455  -12.425 97.553  1.00 41.09 ? 319 HOH B O   1 
HETATM 2319 O O   . HOH D 3 .   ? 19.103  7.106   117.869 1.00 50.82 ? 320 HOH B O   1 
HETATM 2320 O O   . HOH D 3 .   ? 2.475   7.615   99.619  1.00 37.63 ? 321 HOH B O   1 
HETATM 2321 O O   . HOH D 3 .   ? 5.626   -2.433  115.650 1.00 39.86 ? 322 HOH B O   1 
HETATM 2322 O O   . HOH D 3 .   ? -11.148 -3.159  106.954 1.00 42.98 ? 323 HOH B O   1 
HETATM 2323 O O   . HOH D 3 .   ? 2.386   9.626   101.477 1.00 33.41 ? 324 HOH B O   1 
HETATM 2324 O O   . HOH D 3 .   ? -10.176 9.587   97.237  1.00 43.01 ? 325 HOH B O   1 
HETATM 2325 O O   . HOH D 3 .   ? -7.875  5.626   86.345  1.00 44.77 ? 326 HOH B O   1 
HETATM 2326 O O   . HOH D 3 .   ? 8.651   16.874  103.999 1.00 38.60 ? 327 HOH B O   1 
HETATM 2327 O O   . HOH D 3 .   ? 1.055   10.520  97.120  1.00 45.29 ? 328 HOH B O   1 
HETATM 2328 O O   . HOH D 3 .   ? 14.842  -5.839  87.986  1.00 27.38 ? 329 HOH B O   1 
HETATM 2329 O O   . HOH D 3 .   ? 13.077  -13.139 101.328 1.00 36.69 ? 330 HOH B O   1 
HETATM 2330 O O   . HOH D 3 .   ? 3.864   3.171   113.838 1.00 45.90 ? 331 HOH B O   1 
HETATM 2331 O O   . HOH D 3 .   ? -5.620  -8.372  81.626  1.00 52.93 ? 332 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 14  ? 0.2373 0.4402 0.5742 0.0725  0.0326  0.0697  1   SER A N   
2    C CA  . SER A 14  ? 0.2270 0.4681 0.5745 0.0592  0.0279  0.0757  1   SER A CA  
3    C C   . SER A 14  ? 0.1824 0.4173 0.4866 0.0363  0.0211  0.0726  1   SER A C   
4    O O   . SER A 14  ? 0.1843 0.4455 0.4940 0.0210  0.0097  0.0798  1   SER A O   
5    C CB  . SER A 14  ? 0.2505 0.5093 0.6171 0.0644  0.0494  0.0624  1   SER A CB  
6    O OG  . SER A 14  ? 0.2750 0.5684 0.6505 0.0477  0.0456  0.0684  1   SER A OG  
7    N N   . ILE A 15  ? 0.1654 0.3612 0.4239 0.0332  0.0269  0.0597  2   ILE A N   
8    C CA  . ILE A 15  ? 0.1353 0.3152 0.3491 0.0144  0.0194  0.0548  2   ILE A CA  
9    C C   . ILE A 15  ? 0.1354 0.2797 0.3117 0.0161  0.0153  0.0502  2   ILE A C   
10   O O   . ILE A 15  ? 0.1638 0.2866 0.3364 0.0270  0.0255  0.0433  2   ILE A O   
11   C CB  . ILE A 15  ? 0.2629 0.4400 0.4627 0.0044  0.0345  0.0442  2   ILE A CB  
12   C CG1 . ILE A 15  ? 0.2655 0.4803 0.4960 -0.0074 0.0322  0.0522  2   ILE A CG1 
13   C CG2 . ILE A 15  ? 0.3285 0.4737 0.4813 -0.0077 0.0303  0.0367  2   ILE A CG2 
14   C CD1 . ILE A 15  ? 0.3186 0.5310 0.5347 -0.0225 0.0431  0.0480  2   ILE A CD1 
15   N N   . PHE A 16  ? 0.1356 0.2763 0.2859 0.0048  0.0005  0.0528  3   PHE A N   
16   C CA  . PHE A 16  ? 0.1362 0.2503 0.2518 0.0045  -0.0020 0.0486  3   PHE A CA  
17   C C   . PHE A 16  ? 0.1371 0.2329 0.2199 -0.0062 0.0009  0.0352  3   PHE A C   
18   O O   . PHE A 16  ? 0.1418 0.2458 0.2221 -0.0181 -0.0050 0.0327  3   PHE A O   
19   C CB  . PHE A 16  ? 0.1417 0.2687 0.2517 0.0019  -0.0187 0.0613  3   PHE A CB  
20   C CG  . PHE A 16  ? 0.1438 0.2511 0.2232 0.0020  -0.0189 0.0592  3   PHE A CG  
21   C CD1 . PHE A 16  ? 0.1469 0.2451 0.1925 -0.0068 -0.0200 0.0469  3   PHE A CD1 
22   C CD2 . PHE A 16  ? 0.1457 0.2436 0.2346 0.0111  -0.0173 0.0695  3   PHE A CD2 
23   C CE1 . PHE A 16  ? 0.1490 0.2354 0.1717 -0.0056 -0.0182 0.0451  3   PHE A CE1 
24   C CE2 . PHE A 16  ? 0.1613 0.2462 0.2264 0.0092  -0.0168 0.0696  3   PHE A CE2 
25   C CZ  . PHE A 16  ? 0.1748 0.2572 0.2072 0.0013  -0.0165 0.0575  3   PHE A CZ  
26   N N   . VAL A 17  ? 0.1360 0.2062 0.1971 -0.0024 0.0083  0.0274  4   VAL A N   
27   C CA  . VAL A 17  ? 0.1395 0.1910 0.1751 -0.0095 0.0109  0.0176  4   VAL A CA  
28   C C   . VAL A 17  ? 0.1562 0.1964 0.1680 -0.0102 0.0042  0.0136  4   VAL A C   
29   O O   . VAL A 17  ? 0.1386 0.1747 0.1462 -0.0038 0.0049  0.0163  4   VAL A O   
30   C CB  . VAL A 17  ? 0.1405 0.1766 0.1688 -0.0055 0.0236  0.0121  4   VAL A CB  
31   C CG1 . VAL A 17  ? 0.1480 0.1677 0.1551 -0.0132 0.0238  0.0079  4   VAL A CG1 
32   C CG2 . VAL A 17  ? 0.1422 0.1940 0.1931 -0.0023 0.0344  0.0133  4   VAL A CG2 
33   N N   . ASP A 18  ? 0.1738 0.2090 0.1725 -0.0184 -0.0014 0.0064  5   ASP A N   
34   C CA  . ASP A 18  ? 0.1590 0.1870 0.1365 -0.0180 -0.0055 -0.0015 5   ASP A CA  
35   C C   . ASP A 18  ? 0.1870 0.1909 0.1523 -0.0141 0.0001  -0.0087 5   ASP A C   
36   O O   . ASP A 18  ? 0.1800 0.1716 0.1488 -0.0155 0.0044  -0.0071 5   ASP A O   
37   C CB  . ASP A 18  ? 0.1760 0.2105 0.1470 -0.0280 -0.0154 -0.0101 5   ASP A CB  
38   C CG  . ASP A 18  ? 0.2861 0.3150 0.2341 -0.0262 -0.0169 -0.0235 5   ASP A CG  
39   O OD1 . ASP A 18  ? 0.2397 0.2812 0.1792 -0.0202 -0.0148 -0.0188 5   ASP A OD1 
40   O OD2 . ASP A 18  ? 0.2566 0.2682 0.1971 -0.0305 -0.0191 -0.0387 5   ASP A OD2 
41   N N   . THR A 19  ? 0.2051 0.2067 0.1574 -0.0093 -0.0001 -0.0150 6   THR A N   
42   C CA  . THR A 19  ? 0.2227 0.2059 0.1685 -0.0038 0.0032  -0.0214 6   THR A CA  
43   C C   . THR A 19  ? 0.2307 0.1921 0.1778 -0.0083 0.0008  -0.0268 6   THR A C   
44   O O   . THR A 19  ? 0.2451 0.1910 0.1937 -0.0059 0.0027  -0.0222 6   THR A O   
45   C CB  . THR A 19  ? 0.2654 0.2563 0.2011 0.0018  0.0042  -0.0303 6   THR A CB  
46   O OG1 . THR A 19  ? 0.2762 0.2887 0.2117 0.0031  0.0060  -0.0208 6   THR A OG1 
47   C CG2 . THR A 19  ? 0.2790 0.2555 0.2163 0.0105  0.0075  -0.0350 6   THR A CG2 
48   N N   . SER A 20  ? 0.2234 0.1839 0.1703 -0.0163 -0.0049 -0.0352 7   SER A N   
49   C CA  . SER A 20  ? 0.2664 0.2023 0.2182 -0.0232 -0.0088 -0.0406 7   SER A CA  
50   C C   . SER A 20  ? 0.2770 0.2074 0.2391 -0.0296 -0.0061 -0.0249 7   SER A C   
51   O O   . SER A 20  ? 0.2956 0.2028 0.2610 -0.0320 -0.0070 -0.0208 7   SER A O   
52   C CB  . SER A 20  ? 0.2886 0.2277 0.2397 -0.0346 -0.0172 -0.0532 7   SER A CB  
53   O OG  . SER A 20  ? 0.2366 0.2017 0.1963 -0.0434 -0.0202 -0.0430 7   SER A OG  
54   N N   . PHE A 21  ? 0.2002 0.1534 0.1684 -0.0319 -0.0023 -0.0152 8   PHE A N   
55   C CA  . PHE A 21  ? 0.1983 0.1541 0.1742 -0.0371 0.0040  -0.0025 8   PHE A CA  
56   C C   . PHE A 21  ? 0.2542 0.2027 0.2190 -0.0288 0.0102  0.0032  8   PHE A C   
57   O O   . PHE A 21  ? 0.2686 0.2064 0.2300 -0.0333 0.0122  0.0122  8   PHE A O   
58   C CB  . PHE A 21  ? 0.1954 0.1801 0.1860 -0.0394 0.0078  0.0028  8   PHE A CB  
59   C CG  . PHE A 21  ? 0.1856 0.1795 0.1850 -0.0445 0.0178  0.0131  8   PHE A CG  
60   C CD1 . PHE A 21  ? 0.1831 0.1807 0.1746 -0.0364 0.0281  0.0153  8   PHE A CD1 
61   C CD2 . PHE A 21  ? 0.2030 0.2038 0.2178 -0.0589 0.0172  0.0196  8   PHE A CD2 
62   C CE1 . PHE A 21  ? 0.2104 0.2207 0.2050 -0.0409 0.0397  0.0222  8   PHE A CE1 
63   C CE2 . PHE A 21  ? 0.2246 0.2401 0.2469 -0.0644 0.0292  0.0304  8   PHE A CE2 
64   C CZ  . PHE A 21  ? 0.2313 0.2527 0.2414 -0.0546 0.0414  0.0309  8   PHE A CZ  
65   N N   . TRP A 22  ? 0.2161 0.1720 0.1753 -0.0187 0.0119  -0.0004 9   TRP A N   
66   C CA  . TRP A 22  ? 0.2444 0.1958 0.1934 -0.0128 0.0150  0.0029  9   TRP A CA  
67   C C   . TRP A 22  ? 0.2498 0.1816 0.1927 -0.0111 0.0098  0.0056  9   TRP A C   
68   O O   . TRP A 22  ? 0.2519 0.1792 0.1865 -0.0121 0.0101  0.0143  9   TRP A O   
69   C CB  . TRP A 22  ? 0.2565 0.2164 0.2049 -0.0048 0.0152  -0.0015 9   TRP A CB  
70   C CG  . TRP A 22  ? 0.2024 0.1766 0.1601 -0.0036 0.0196  -0.0012 9   TRP A CG  
71   C CD1 . TRP A 22  ? 0.1826 0.1669 0.1485 -0.0006 0.0172  -0.0008 9   TRP A CD1 
72   C CD2 . TRP A 22  ? 0.2204 0.2002 0.1820 -0.0042 0.0274  -0.0006 9   TRP A CD2 
73   N NE1 . TRP A 22  ? 0.1639 0.1559 0.1431 0.0017  0.0213  0.0016  9   TRP A NE1 
74   C CE2 . TRP A 22  ? 0.1479 0.1374 0.1254 0.0006  0.0287  -0.0009 9   TRP A CE2 
75   C CE3 . TRP A 22  ? 0.2130 0.1925 0.1661 -0.0080 0.0342  0.0004  9   TRP A CE3 
76   C CZ2 . TRP A 22  ? 0.1635 0.1592 0.1527 0.0042  0.0373  -0.0036 9   TRP A CZ2 
77   C CZ3 . TRP A 22  ? 0.2364 0.2267 0.1958 -0.0059 0.0445  -0.0037 9   TRP A CZ3 
78   C CH2 . TRP A 22  ? 0.2116 0.2084 0.1910 0.0014  0.0463  -0.0074 9   TRP A CH2 
79   N N   . ALA A 23  ? 0.2639 0.1856 0.2112 -0.0077 0.0047  -0.0023 10  ALA A N   
80   C CA  . ALA A 23  ? 0.2759 0.1768 0.2252 -0.0024 -0.0004 -0.0014 10  ALA A CA  
81   C C   . ALA A 23  ? 0.3200 0.2015 0.2729 -0.0116 -0.0035 0.0102  10  ALA A C   
82   O O   . ALA A 23  ? 0.3632 0.2305 0.3166 -0.0086 -0.0078 0.0215  10  ALA A O   
83   C CB  . ALA A 23  ? 0.2763 0.1716 0.2305 0.0043  -0.0024 -0.0178 10  ALA A CB  
84   N N   . ALA A 24  ? 0.2894 0.1725 0.2473 -0.0239 -0.0022 0.0102  11  ALA A N   
85   C CA  . ALA A 24  ? 0.3205 0.1881 0.2848 -0.0365 -0.0043 0.0242  11  ALA A CA  
86   C C   . ALA A 24  ? 0.3273 0.2090 0.2806 -0.0414 0.0020  0.0428  11  ALA A C   
87   O O   . ALA A 24  ? 0.3665 0.2350 0.3179 -0.0470 -0.0008 0.0607  11  ALA A O   
88   C CB  . ALA A 24  ? 0.2877 0.1594 0.2642 -0.0504 -0.0052 0.0192  11  ALA A CB  
89   N N   . LEU A 25  ? 0.2615 0.1700 0.2073 -0.0392 0.0105  0.0384  12  LEU A N   
90   C CA  . LEU A 25  ? 0.2955 0.2206 0.2269 -0.0429 0.0189  0.0489  12  LEU A CA  
91   C C   . LEU A 25  ? 0.2796 0.1983 0.1939 -0.0360 0.0136  0.0549  12  LEU A C   
92   O O   . LEU A 25  ? 0.3341 0.2559 0.2335 -0.0424 0.0143  0.0707  12  LEU A O   
93   C CB  . LEU A 25  ? 0.3022 0.2529 0.2346 -0.0394 0.0291  0.0377  12  LEU A CB  
94   C CG  . LEU A 25  ? 0.3311 0.3033 0.2521 -0.0437 0.0423  0.0419  12  LEU A CG  
95   C CD1 . LEU A 25  ? 0.3258 0.3081 0.2554 -0.0581 0.0489  0.0562  12  LEU A CD1 
96   C CD2 . LEU A 25  ? 0.2978 0.2876 0.2261 -0.0353 0.0509  0.0268  12  LEU A CD2 
97   N N   . GLY A 26  ? 0.3031 0.2169 0.2198 -0.0240 0.0076  0.0440  13  GLY A N   
98   C CA  . GLY A 26  ? 0.3199 0.2342 0.2259 -0.0174 0.0010  0.0484  13  GLY A CA  
99   C C   . GLY A 26  ? 0.3952 0.2899 0.3079 -0.0137 -0.0104 0.0625  13  GLY A C   
100  O O   . GLY A 26  ? 0.4580 0.3564 0.3657 -0.0082 -0.0184 0.0698  13  GLY A O   
101  N N   . ASN A 27  ? 0.3703 0.2437 0.2980 -0.0169 -0.0125 0.0662  14  ASN A N   
102  C CA  . ASN A 27  ? 0.3928 0.2406 0.3341 -0.0118 -0.0234 0.0791  14  ASN A CA  
103  C C   . ASN A 27  ? 0.4667 0.2969 0.4115 -0.0263 -0.0248 0.0987  14  ASN A C   
104  O O   . ASN A 27  ? 0.5176 0.3333 0.4762 -0.0334 -0.0228 0.0911  14  ASN A O   
105  C CB  . ASN A 27  ? 0.3950 0.2264 0.3577 0.0013  -0.0258 0.0596  14  ASN A CB  
106  C CG  . ASN A 27  ? 0.4529 0.2525 0.4371 0.0096  -0.0361 0.0690  14  ASN A CG  
107  O OD1 . ASN A 27  ? 0.4960 0.2884 0.4803 0.0080  -0.0443 0.0945  14  ASN A OD1 
108  N ND2 . ASN A 27  ? 0.4669 0.2475 0.4696 0.0190  -0.0359 0.0483  14  ASN A ND2 
109  N N   . ALA A 28  ? 0.4962 0.3298 0.4282 -0.0326 -0.0292 0.1253  15  ALA A N   
110  C CA  . ALA A 28  ? 0.5237 0.3477 0.4581 -0.0481 -0.0288 0.1481  15  ALA A CA  
111  C C   . ALA A 28  ? 0.5176 0.3050 0.4829 -0.0444 -0.0363 0.1477  15  ALA A C   
112  O O   . ALA A 28  ? 0.5807 0.3590 0.5549 -0.0572 -0.0341 0.1575  15  ALA A O   
113  C CB  . ALA A 28  ? 0.5779 0.4225 0.4917 -0.0505 -0.0302 0.1691  15  ALA A CB  
114  N N   . GLY A 29  ? 0.5284 0.2965 0.5106 -0.0266 -0.0440 0.1345  16  GLY A N   
115  C CA  . GLY A 29  ? 0.6214 0.3549 0.6316 -0.0201 -0.0488 0.1269  16  GLY A CA  
116  C C   . GLY A 29  ? 0.6598 0.3777 0.6813 -0.0233 -0.0451 0.0984  16  GLY A C   
117  O O   . GLY A 29  ? 0.7309 0.4205 0.7716 -0.0215 -0.0476 0.0873  16  GLY A O   
118  N N   . ASP A 30  ? 0.5796 0.3168 0.5872 -0.0283 -0.0398 0.0852  17  ASP A N   
119  C CA  . ASP A 30  ? 0.5463 0.2808 0.5596 -0.0323 -0.0363 0.0565  17  ASP A CA  
120  C C   . ASP A 30  ? 0.5476 0.2680 0.5724 -0.0539 -0.0376 0.0636  17  ASP A C   
121  O O   . ASP A 30  ? 0.5019 0.2374 0.5216 -0.0681 -0.0337 0.0877  17  ASP A O   
122  C CB  . ASP A 30  ? 0.5038 0.2799 0.4981 -0.0317 -0.0264 0.0423  17  ASP A CB  
123  C CG  . ASP A 30  ? 0.5047 0.2831 0.5020 -0.0329 -0.0253 0.0140  17  ASP A CG  
124  O OD1 . ASP A 30  ? 0.5179 0.2909 0.5231 -0.0495 -0.0275 0.0117  17  ASP A OD1 
125  O OD2 . ASP A 30  ? 0.4776 0.2673 0.4692 -0.0188 -0.0227 -0.0047 17  ASP A OD2 
126  N N   . ALA A 31  ? 0.5767 0.2773 0.6148 -0.0557 -0.0404 0.0397  18  ALA A N   
127  C CA  . ALA A 31  ? 0.5894 0.2802 0.6403 -0.0759 -0.0418 0.0427  18  ALA A CA  
128  C C   . ALA A 31  ? 0.5391 0.2629 0.5860 -0.0956 -0.0376 0.0493  18  ALA A C   
129  O O   . ALA A 31  ? 0.5676 0.2964 0.6252 -0.1136 -0.0361 0.0636  18  ALA A O   
130  C CB  . ALA A 31  ? 0.6198 0.2849 0.6802 -0.0741 -0.0462 0.0113  18  ALA A CB  
131  N N   . ARG A 32  ? 0.4913 0.2427 0.5236 -0.0904 -0.0339 0.0387  19  ARG A N   
132  C CA  . ARG A 32  ? 0.4351 0.2281 0.4656 -0.1032 -0.0266 0.0424  19  ARG A CA  
133  C C   . ARG A 32  ? 0.3781 0.2040 0.3929 -0.0986 -0.0143 0.0614  19  ARG A C   
134  O O   . ARG A 32  ? 0.3465 0.2096 0.3595 -0.1014 -0.0056 0.0602  19  ARG A O   
135  C CB  . ARG A 32  ? 0.5016 0.3158 0.5268 -0.0975 -0.0275 0.0151  19  ARG A CB  
136  C CG  . ARG A 32  ? 0.6046 0.3933 0.6386 -0.1039 -0.0394 -0.0097 19  ARG A CG  
137  C CD  . ARG A 32  ? 0.7434 0.5048 0.8002 -0.1248 -0.0467 -0.0010 19  ARG A CD  
138  N NE  . ARG A 32  ? 0.7794 0.5730 0.8499 -0.1447 -0.0428 0.0188  19  ARG A NE  
139  C CZ  . ARG A 32  ? 0.8427 0.6309 0.9293 -0.1581 -0.0403 0.0369  19  ARG A CZ  
140  N NH1 . ARG A 32  ? 0.8978 0.6459 0.9882 -0.1551 -0.0433 0.0395  19  ARG A NH1 
141  N NH2 . ARG A 32  ? 0.8527 0.6774 0.9529 -0.1737 -0.0343 0.0530  19  ARG A NH2 
142  N N   . HIS A 33  ? 0.3916 0.2042 0.3960 -0.0911 -0.0144 0.0779  20  HIS A N   
143  C CA  . HIS A 33  ? 0.3637 0.2057 0.3477 -0.0880 -0.0042 0.0929  20  HIS A CA  
144  C C   . HIS A 33  ? 0.3709 0.2405 0.3577 -0.1068 0.0066  0.1108  20  HIS A C   
145  O O   . HIS A 33  ? 0.3360 0.2417 0.3115 -0.1045 0.0193  0.1082  20  HIS A O   
146  C CB  . HIS A 33  ? 0.4074 0.2307 0.3808 -0.0804 -0.0103 0.1110  20  HIS A CB  
147  C CG  . HIS A 33  ? 0.4504 0.3037 0.3975 -0.0797 -0.0021 0.1248  20  HIS A CG  
148  N ND1 . HIS A 33  ? 0.4194 0.2960 0.3497 -0.0672 0.0036  0.1084  20  HIS A ND1 
149  C CD2 . HIS A 33  ? 0.4947 0.3613 0.4290 -0.0885 0.0022  0.1483  20  HIS A CD2 
150  C CE1 . HIS A 33  ? 0.4548 0.3531 0.3611 -0.0708 0.0096  0.1213  20  HIS A CE1 
151  N NE2 . HIS A 33  ? 0.5032 0.3982 0.4094 -0.0836 0.0093  0.1460  20  HIS A NE2 
152  N N   . GLY A 34  ? 0.3877 0.2430 0.3922 -0.1221 0.0031  0.1250  21  GLY A N   
153  C CA  . GLY A 34  ? 0.4106 0.2974 0.4217 -0.1366 0.0150  0.1388  21  GLY A CA  
154  C C   . GLY A 34  ? 0.4111 0.3314 0.4374 -0.1436 0.0222  0.1267  21  GLY A C   
155  O O   . GLY A 34  ? 0.3915 0.3520 0.4151 -0.1452 0.0377  0.1315  21  GLY A O   
156  N N   . THR A 35  ? 0.3847 0.2904 0.4277 -0.1462 0.0107  0.1089  22  THR A N   
157  C CA  . THR A 35  ? 0.3815 0.3218 0.4414 -0.1501 0.0136  0.0964  22  THR A CA  
158  C C   . THR A 35  ? 0.3242 0.2933 0.3681 -0.1294 0.0241  0.0842  22  THR A C   
159  O O   . THR A 35  ? 0.2885 0.2977 0.3449 -0.1296 0.0352  0.0845  22  THR A O   
160  C CB  . THR A 35  ? 0.4028 0.3222 0.4760 -0.1534 -0.0034 0.0749  22  THR A CB  
161  O OG1 . THR A 35  ? 0.4754 0.3667 0.5648 -0.1687 -0.0121 0.0798  22  THR A OG1 
162  C CG2 . THR A 35  ? 0.3358 0.2964 0.4263 -0.1562 -0.0034 0.0646  22  THR A CG2 
163  N N   . ALA A 36  ? 0.2920 0.2403 0.3126 -0.1114 0.0206  0.0739  23  ALA A N   
164  C CA  . ALA A 36  ? 0.2643 0.2326 0.2707 -0.0934 0.0286  0.0629  23  ALA A CA  
165  C C   . ALA A 36  ? 0.2662 0.2615 0.2627 -0.0935 0.0457  0.0737  23  ALA A C   
166  O O   . ALA A 36  ? 0.2765 0.2999 0.2774 -0.0852 0.0562  0.0653  23  ALA A O   
167  C CB  . ALA A 36  ? 0.2969 0.2391 0.2834 -0.0778 0.0213  0.0533  23  ALA A CB  
168  N N   . LYS A 37  ? 0.2924 0.2796 0.2754 -0.1027 0.0483  0.0924  24  LYS A N   
169  C CA  . LYS A 37  ? 0.3033 0.3193 0.2697 -0.1049 0.0654  0.1021  24  LYS A CA  
170  C C   . LYS A 37  ? 0.3306 0.3873 0.3208 -0.1144 0.0811  0.1056  24  LYS A C   
171  O O   . LYS A 37  ? 0.3240 0.4110 0.3093 -0.1056 0.0976  0.0968  24  LYS A O   
172  C CB  . LYS A 37  ? 0.3637 0.3649 0.3110 -0.1134 0.0625  0.1246  24  LYS A CB  
173  C CG  . LYS A 37  ? 0.4531 0.4334 0.3712 -0.1026 0.0533  0.1247  24  LYS A CG  
174  C CD  . LYS A 37  ? 0.5268 0.5062 0.4266 -0.1052 0.0524  0.1436  24  LYS A CD  
175  C CE  . LYS A 37  ? 0.5789 0.5340 0.4989 -0.1162 0.0430  0.1626  24  LYS A CE  
176  N NZ  . LYS A 37  ? 0.6181 0.5730 0.5206 -0.1197 0.0411  0.1841  24  LYS A NZ  
177  N N   . ARG A 38  ? 0.3091 0.3643 0.3282 -0.1287 0.0749  0.1140  25  ARG A N   
178  C CA  . ARG A 38  ? 0.3103 0.4040 0.3579 -0.1344 0.0871  0.1153  25  ARG A CA  
179  C C   . ARG A 38  ? 0.2848 0.4075 0.3542 -0.1238 0.0912  0.0993  25  ARG A C   
180  O O   . ARG A 38  ? 0.2798 0.4383 0.3623 -0.1163 0.1079  0.0945  25  ARG A O   
181  C CB  . ARG A 38  ? 0.3298 0.4139 0.4045 -0.1532 0.0765  0.1258  25  ARG A CB  
182  C CG  . ARG A 38  ? 0.3452 0.4720 0.4504 -0.1606 0.0890  0.1293  25  ARG A CG  
183  C CD  . ARG A 38  ? 0.3804 0.4982 0.5105 -0.1816 0.0787  0.1404  25  ARG A CD  
184  N NE  . ARG A 38  ? 0.4028 0.5659 0.5642 -0.1886 0.0908  0.1442  25  ARG A NE  
185  C CZ  . ARG A 38  ? 0.4422 0.6098 0.6308 -0.2080 0.0850  0.1538  25  ARG A CZ  
186  N NH1 . ARG A 38  ? 0.4931 0.7064 0.7116 -0.2131 0.0971  0.1573  25  ARG A NH1 
187  N NH2 . ARG A 38  ? 0.4240 0.5500 0.6120 -0.2218 0.0674  0.1588  25  ARG A NH2 
188  N N   . LEU A 39  ? 0.2576 0.3577 0.3296 -0.1169 0.0741  0.0866  26  LEU A N   
189  C CA  . LEU A 39  ? 0.2313 0.3506 0.3217 -0.1021 0.0728  0.0714  26  LEU A CA  
190  C C   . LEU A 39  ? 0.2760 0.4031 0.3503 -0.0815 0.0867  0.0601  26  LEU A C   
191  O O   . LEU A 39  ? 0.2513 0.4078 0.3489 -0.0704 0.0962  0.0535  26  LEU A O   
192  C CB  . LEU A 39  ? 0.2844 0.3755 0.3714 -0.0987 0.0513  0.0603  26  LEU A CB  
193  C CG  . LEU A 39  ? 0.2776 0.3675 0.3874 -0.1177 0.0357  0.0632  26  LEU A CG  
194  C CD1 . LEU A 39  ? 0.2413 0.3012 0.3366 -0.1134 0.0168  0.0480  26  LEU A CD1 
195  C CD2 . LEU A 39  ? 0.3033 0.4409 0.4530 -0.1222 0.0381  0.0673  26  LEU A CD2 
196  N N   . TRP A 40  ? 0.2561 0.3564 0.2937 -0.0765 0.0868  0.0576  27  TRP A N   
197  C CA  . TRP A 40  ? 0.2637 0.3661 0.2826 -0.0601 0.0973  0.0442  27  TRP A CA  
198  C C   . TRP A 40  ? 0.2736 0.4118 0.2952 -0.0601 0.1211  0.0442  27  TRP A C   
199  O O   . TRP A 40  ? 0.2999 0.4504 0.3250 -0.0449 0.1328  0.0282  27  TRP A O   
200  C CB  . TRP A 40  ? 0.2905 0.3611 0.2708 -0.0584 0.0898  0.0437  27  TRP A CB  
201  C CG  . TRP A 40  ? 0.3047 0.3698 0.2684 -0.0429 0.0932  0.0266  27  TRP A CG  
202  C CD1 . TRP A 40  ? 0.3249 0.3921 0.2584 -0.0413 0.1020  0.0213  27  TRP A CD1 
203  C CD2 . TRP A 40  ? 0.3037 0.3601 0.2803 -0.0293 0.0866  0.0133  27  TRP A CD2 
204  N NE1 . TRP A 40  ? 0.3411 0.3983 0.2701 -0.0280 0.1005  0.0029  27  TRP A NE1 
205  C CE2 . TRP A 40  ? 0.3339 0.3837 0.2907 -0.0204 0.0917  -0.0002 27  TRP A CE2 
206  C CE3 . TRP A 40  ? 0.2702 0.3250 0.2716 -0.0254 0.0760  0.0129  27  TRP A CE3 
207  C CZ2 . TRP A 40  ? 0.3315 0.3699 0.2975 -0.0084 0.0867  -0.0123 27  TRP A CZ2 
208  C CZ3 . TRP A 40  ? 0.2717 0.3188 0.2788 -0.0128 0.0717  0.0035  27  TRP A CZ3 
209  C CH2 . TRP A 40  ? 0.2890 0.3264 0.2809 -0.0046 0.0773  -0.0082 27  TRP A CH2 
210  N N   . ALA A 41  ? 0.2809 0.4357 0.3020 -0.0775 0.1289  0.0619  28  ALA A N   
211  C CA  . ALA A 41  ? 0.3148 0.4951 0.3363 -0.0743 0.1491  0.0606  28  ALA A CA  
212  C C   . ALA A 41  ? 0.3748 0.5899 0.4424 -0.0676 0.1602  0.0540  28  ALA A C   
213  O O   . ALA A 41  ? 0.4236 0.6595 0.4959 -0.0567 0.1795  0.0440  28  ALA A O   
214  C CB  . ALA A 41  ? 0.3627 0.5400 0.3726 -0.0920 0.1494  0.0815  28  ALA A CB  
215  N N   . SER A 42  ? 0.3759 0.5973 0.4784 -0.0736 0.1466  0.0596  29  SER A N   
216  C CA  . SER A 42  ? 0.4152 0.6722 0.5660 -0.0688 0.1516  0.0566  29  SER A CA  
217  C C   . SER A 42  ? 0.4068 0.6667 0.5818 -0.0520 0.1413  0.0473  29  SER A C   
218  O O   . SER A 42  ? 0.3762 0.6590 0.5922 -0.0511 0.1333  0.0507  29  SER A O   
219  C CB  . SER A 42  ? 0.4404 0.7079 0.6171 -0.0900 0.1410  0.0731  29  SER A CB  
220  O OG  . SER A 42  ? 0.4489 0.6918 0.6250 -0.0997 0.1167  0.0788  29  SER A OG  
221  N N   . LYS A 43  ? 0.4173 0.6479 0.5645 -0.0384 0.1383  0.0358  30  LYS A N   
222  C CA  . LYS A 43  ? 0.4018 0.6201 0.5653 -0.0212 0.1257  0.0269  30  LYS A CA  
223  C C   . LYS A 43  ? 0.4073 0.6552 0.6086 -0.0009 0.1423  0.0174  30  LYS A C   
224  O O   . LYS A 43  ? 0.4054 0.6679 0.5971 0.0034  0.1604  0.0062  30  LYS A O   
225  C CB  . LYS A 43  ? 0.3720 0.5452 0.4943 -0.0144 0.1165  0.0165  30  LYS A CB  
226  C CG  . LYS A 43  ? 0.4001 0.5665 0.4951 -0.0058 0.1342  0.0014  30  LYS A CG  
227  C CD  . LYS A 43  ? 0.4345 0.5605 0.4953 -0.0011 0.1226  -0.0078 30  LYS A CD  
228  C CE  . LYS A 43  ? 0.5783 0.6998 0.6074 0.0027  0.1374  -0.0234 30  LYS A CE  
229  N NZ  . LYS A 43  ? 0.6813 0.7683 0.6853 0.0076  0.1260  -0.0342 30  LYS A NZ  
230  N N   . PRO A 44  ? 0.3501 0.6031 0.5871 0.0111  0.1296  0.0198  31  PRO A N   
231  C CA  . PRO A 44  ? 0.2950 0.5621 0.5637 0.0328  0.1361  0.0097  31  PRO A CA  
232  C C   . PRO A 44  ? 0.2329 0.4660 0.4775 0.0493  0.1437  -0.0097 31  PRO A C   
233  O O   . PRO A 44  ? 0.2603 0.4610 0.4687 0.0436  0.1410  -0.0134 31  PRO A O   
234  C CB  . PRO A 44  ? 0.3165 0.5909 0.6216 0.0369  0.1139  0.0242  31  PRO A CB  
235  C CG  . PRO A 44  ? 0.3064 0.5529 0.5806 0.0235  0.0958  0.0318  31  PRO A CG  
236  C CD  . PRO A 44  ? 0.3250 0.5651 0.5639 0.0034  0.1021  0.0312  31  PRO A CD  
237  N N   . PRO A 45  ? 0.2460 0.4852 0.5104 0.0686  0.1520  -0.0229 32  PRO A N   
238  C CA  . PRO A 45  ? 0.2776 0.4810 0.5193 0.0822  0.1568  -0.0432 32  PRO A CA  
239  C C   . PRO A 45  ? 0.3177 0.4812 0.5578 0.0855  0.1395  -0.0397 32  PRO A C   
240  O O   . PRO A 45  ? 0.3418 0.4712 0.5498 0.0856  0.1400  -0.0537 32  PRO A O   
241  C CB  . PRO A 45  ? 0.2752 0.4954 0.5507 0.1029  0.1662  -0.0536 32  PRO A CB  
242  C CG  . PRO A 45  ? 0.3207 0.5934 0.6198 0.0970  0.1750  -0.0440 32  PRO A CG  
243  C CD  . PRO A 45  ? 0.2907 0.5713 0.5970 0.0775  0.1589  -0.0215 32  PRO A CD  
244  N N   . VAL A 46  ? 0.3450 0.5158 0.6180 0.0866  0.1229  -0.0198 33  VAL A N   
245  C CA  . VAL A 46  ? 0.3706 0.5103 0.6435 0.0892  0.1057  -0.0114 33  VAL A CA  
246  C C   . VAL A 46  ? 0.3195 0.4530 0.5598 0.0701  0.0911  0.0013  33  VAL A C   
247  O O   . VAL A 46  ? 0.3027 0.4610 0.5512 0.0594  0.0809  0.0165  33  VAL A O   
248  C CB  . VAL A 46  ? 0.4234 0.5714 0.7395 0.1004  0.0903  0.0056  33  VAL A CB  
249  C CG1 . VAL A 46  ? 0.4253 0.5447 0.7366 0.1000  0.0719  0.0190  33  VAL A CG1 
250  C CG2 . VAL A 46  ? 0.4594 0.6057 0.7996 0.1186  0.1008  -0.0080 33  VAL A CG2 
251  N N   . VAL A 47  ? 0.2831 0.3818 0.4820 0.0642  0.0872  -0.0068 34  VAL A N   
252  C CA  . VAL A 47  ? 0.2552 0.3431 0.4168 0.0474  0.0730  0.0014  34  VAL A CA  
253  C C   . VAL A 47  ? 0.2303 0.2899 0.3785 0.0483  0.0597  0.0050  34  VAL A C   
254  O O   . VAL A 47  ? 0.2367 0.2720 0.3771 0.0537  0.0643  -0.0067 34  VAL A O   
255  C CB  . VAL A 47  ? 0.2848 0.3659 0.4070 0.0361  0.0825  -0.0090 34  VAL A CB  
256  C CG1 . VAL A 47  ? 0.2310 0.2937 0.3192 0.0236  0.0683  -0.0033 34  VAL A CG1 
257  C CG2 . VAL A 47  ? 0.3341 0.4470 0.4682 0.0296  0.0937  -0.0056 34  VAL A CG2 
258  N N   . MET A 48  ? 0.1521 0.2173 0.2970 0.0413  0.0434  0.0206  35  MET A N   
259  C CA  . MET A 48  ? 0.1615 0.2095 0.2984 0.0414  0.0318  0.0287  35  MET A CA  
260  C C   . MET A 48  ? 0.1436 0.1864 0.2433 0.0286  0.0238  0.0297  35  MET A C   
261  O O   . MET A 48  ? 0.1380 0.1925 0.2258 0.0199  0.0212  0.0291  35  MET A O   
262  C CB  . MET A 48  ? 0.1840 0.2483 0.3540 0.0475  0.0199  0.0492  35  MET A CB  
263  C CG  . MET A 48  ? 0.2669 0.3188 0.4313 0.0460  0.0083  0.0636  35  MET A CG  
264  S SD  . MET A 48  ? 0.2442 0.3226 0.4430 0.0505  -0.0086 0.0940  35  MET A SD  
265  C CE  . MET A 48  ? 0.4045 0.4757 0.6602 0.0717  0.0001  0.0930  35  MET A CE  
266  N N   . THR A 49  ? 0.1457 0.1706 0.2307 0.0275  0.0203  0.0303  36  THR A N   
267  C CA  . THR A 49  ? 0.1400 0.1650 0.1970 0.0186  0.0134  0.0323  36  THR A CA  
268  C C   . THR A 49  ? 0.1469 0.1670 0.2066 0.0190  0.0076  0.0439  36  THR A C   
269  O O   . THR A 49  ? 0.1535 0.1682 0.2384 0.0251  0.0064  0.0528  36  THR A O   
270  C CB  . THR A 49  ? 0.1573 0.1685 0.1883 0.0143  0.0192  0.0182  36  THR A CB  
271  O OG1 . THR A 49  ? 0.1692 0.1835 0.1799 0.0084  0.0135  0.0185  36  THR A OG1 
272  C CG2 . THR A 49  ? 0.1862 0.1785 0.2136 0.0167  0.0232  0.0113  36  THR A CG2 
273  N N   . SER A 50  ? 0.1471 0.1697 0.1843 0.0128  0.0045  0.0450  37  SER A N   
274  C CA  . SER A 50  ? 0.1519 0.1762 0.1921 0.0106  0.0004  0.0593  37  SER A CA  
275  C C   . SER A 50  ? 0.1562 0.1711 0.1822 0.0069  0.0042  0.0517  37  SER A C   
276  O O   . SER A 50  ? 0.1410 0.1509 0.1513 0.0067  0.0079  0.0369  37  SER A O   
277  C CB  . SER A 50  ? 0.1587 0.2092 0.1887 0.0058  -0.0071 0.0734  37  SER A CB  
278  O OG  . SER A 50  ? 0.1718 0.2299 0.1738 0.0015  -0.0047 0.0612  37  SER A OG  
279  N N   . ASN A 51  ? 0.1614 0.1760 0.1965 0.0033  0.0021  0.0646  38  ASN A N   
280  C CA  . ASN A 51  ? 0.1627 0.1761 0.1905 -0.0017 0.0044  0.0607  38  ASN A CA  
281  C C   . ASN A 51  ? 0.1681 0.2030 0.1738 -0.0028 0.0071  0.0565  38  ASN A C   
282  O O   . ASN A 51  ? 0.1907 0.2238 0.1886 -0.0020 0.0100  0.0448  38  ASN A O   
283  C CB  . ASN A 51  ? 0.1851 0.1969 0.2320 -0.0082 0.0014  0.0790  38  ASN A CB  
284  C CG  . ASN A 51  ? 0.2148 0.2496 0.2628 -0.0117 -0.0021 0.1037  38  ASN A CG  
285  O OD1 . ASN A 51  ? 0.1910 0.2349 0.2365 -0.0077 -0.0056 0.1093  38  ASN A OD1 
286  N ND2 . ASN A 51  ? 0.2049 0.2532 0.2572 -0.0207 -0.0016 0.1205  38  ASN A ND2 
287  N N   . HIS A 52  ? 0.1586 0.2143 0.1547 -0.0040 0.0053  0.0652  39  HIS A N   
288  C CA  . HIS A 52  ? 0.1699 0.2451 0.1437 -0.0040 0.0090  0.0561  39  HIS A CA  
289  C C   . HIS A 52  ? 0.1490 0.2101 0.1127 0.0009  0.0103  0.0347  39  HIS A C   
290  O O   . HIS A 52  ? 0.1563 0.2190 0.1112 0.0040  0.0146  0.0226  39  HIS A O   
291  C CB  . HIS A 52  ? 0.1900 0.2910 0.1509 -0.0080 0.0053  0.0671  39  HIS A CB  
292  C CG  . HIS A 52  ? 0.2173 0.3394 0.1820 -0.0145 0.0054  0.0913  39  HIS A CG  
293  N ND1 . HIS A 52  ? 0.2684 0.4147 0.2218 -0.0177 0.0139  0.0926  39  HIS A ND1 
294  C CD2 . HIS A 52  ? 0.3055 0.4288 0.2870 -0.0186 -0.0014 0.1175  39  HIS A CD2 
295  C CE1 . HIS A 52  ? 0.3009 0.4626 0.2631 -0.0254 0.0121  0.1180  39  HIS A CE1 
296  N NE2 . HIS A 52  ? 0.2043 0.3504 0.1837 -0.0261 0.0020  0.1343  39  HIS A NE2 
297  N N   . VAL A 53  ? 0.1453 0.1935 0.1142 0.0017  0.0068  0.0320  40  VAL A N   
298  C CA  . VAL A 53  ? 0.1432 0.1775 0.1051 0.0035  0.0076  0.0165  40  VAL A CA  
299  C C   . VAL A 53  ? 0.1425 0.1600 0.1061 0.0065  0.0111  0.0101  40  VAL A C   
300  O O   . VAL A 53  ? 0.1961 0.2070 0.1518 0.0089  0.0120  0.0006  40  VAL A O   
301  C CB  . VAL A 53  ? 0.1412 0.1718 0.1128 0.0021  0.0047  0.0180  40  VAL A CB  
302  C CG1 . VAL A 53  ? 0.1577 0.1719 0.1265 0.0019  0.0074  0.0072  40  VAL A CG1 
303  C CG2 . VAL A 53  ? 0.1563 0.2062 0.1235 -0.0024 -0.0022 0.0213  40  VAL A CG2 
304  N N   . LEU A 54  ? 0.1351 0.1450 0.1096 0.0062  0.0115  0.0151  41  LEU A N   
305  C CA  . LEU A 54  ? 0.1862 0.1837 0.1589 0.0068  0.0122  0.0089  41  LEU A CA  
306  C C   . LEU A 54  ? 0.1602 0.1675 0.1316 0.0081  0.0119  0.0086  41  LEU A C   
307  O O   . LEU A 54  ? 0.1735 0.1756 0.1407 0.0109  0.0107  0.0033  41  LEU A O   
308  C CB  . LEU A 54  ? 0.1843 0.1716 0.1675 0.0048  0.0120  0.0100  41  LEU A CB  
309  C CG  . LEU A 54  ? 0.2301 0.2076 0.2159 0.0066  0.0154  0.0048  41  LEU A CG  
310  C CD1 . LEU A 54  ? 0.2915 0.2552 0.2851 0.0060  0.0165  -0.0014 41  LEU A CD1 
311  C CD2 . LEU A 54  ? 0.2329 0.2079 0.2038 0.0065  0.0177  -0.0017 41  LEU A CD2 
312  N N   . GLY A 55  ? 0.1756 0.2002 0.1528 0.0063  0.0133  0.0166  42  GLY A N   
313  C CA  . GLY A 55  ? 0.1691 0.2112 0.1496 0.0082  0.0159  0.0167  42  GLY A CA  
314  C C   . GLY A 55  ? 0.1963 0.2410 0.1672 0.0161  0.0189  0.0049  42  GLY A C   
315  O O   . GLY A 55  ? 0.1865 0.2338 0.1636 0.0221  0.0195  0.0003  42  GLY A O   
316  N N   . GLU A 56  ? 0.1617 0.2051 0.1203 0.0161  0.0196  -0.0002 43  GLU A N   
317  C CA  . GLU A 56  ? 0.1901 0.2294 0.1401 0.0222  0.0216  -0.0151 43  GLU A CA  
318  C C   . GLU A 56  ? 0.2041 0.2174 0.1575 0.0255  0.0173  -0.0195 43  GLU A C   
319  O O   . GLU A 56  ? 0.2186 0.2251 0.1762 0.0335  0.0180  -0.0277 43  GLU A O   
320  C CB  . GLU A 56  ? 0.2025 0.2453 0.1380 0.0177  0.0200  -0.0204 43  GLU A CB  
321  C CG  . GLU A 56  ? 0.2643 0.3028 0.1895 0.0222  0.0220  -0.0403 43  GLU A CG  
322  C CD  . GLU A 56  ? 0.4135 0.4557 0.3234 0.0141  0.0169  -0.0467 43  GLU A CD  
323  O OE1 . GLU A 56  ? 0.4150 0.4573 0.3280 0.0066  0.0106  -0.0346 43  GLU A OE1 
324  O OE2 . GLU A 56  ? 0.5287 0.5755 0.4249 0.0156  0.0190  -0.0653 43  GLU A OE2 
325  N N   . THR A 57  ? 0.1987 0.1988 0.1517 0.0198  0.0135  -0.0131 44  THR A N   
326  C CA  . THR A 57  ? 0.1889 0.1688 0.1412 0.0200  0.0101  -0.0129 44  THR A CA  
327  C C   . THR A 57  ? 0.2086 0.1892 0.1676 0.0249  0.0073  -0.0092 44  THR A C   
328  O O   . THR A 57  ? 0.2034 0.1720 0.1649 0.0299  0.0039  -0.0093 44  THR A O   
329  C CB  . THR A 57  ? 0.2031 0.1768 0.1525 0.0129  0.0099  -0.0077 44  THR A CB  
330  O OG1 . THR A 57  ? 0.2000 0.1775 0.1492 0.0090  0.0107  -0.0091 44  THR A OG1 
331  C CG2 . THR A 57  ? 0.2311 0.1897 0.1754 0.0111  0.0079  -0.0050 44  THR A CG2 
332  N N   . TRP A 58  ? 0.1493 0.1441 0.1144 0.0228  0.0072  -0.0043 45  TRP A N   
333  C CA  . TRP A 58  ? 0.2051 0.2080 0.1803 0.0258  0.0025  -0.0004 45  TRP A CA  
334  C C   . TRP A 58  ? 0.2022 0.2125 0.1893 0.0375  0.0042  -0.0042 45  TRP A C   
335  O O   . TRP A 58  ? 0.1892 0.1932 0.1836 0.0439  -0.0017 -0.0012 45  TRP A O   
336  C CB  . TRP A 58  ? 0.1771 0.1974 0.1624 0.0198  0.0022  0.0044  45  TRP A CB  
337  C CG  . TRP A 58  ? 0.1876 0.2256 0.1898 0.0228  -0.0026 0.0085  45  TRP A CG  
338  C CD1 . TRP A 58  ? 0.1444 0.2061 0.1643 0.0306  0.0024  0.0088  45  TRP A CD1 
339  C CD2 . TRP A 58  ? 0.1514 0.1896 0.1558 0.0183  -0.0136 0.0125  45  TRP A CD2 
340  N NE1 . TRP A 58  ? 0.1465 0.2242 0.1852 0.0320  -0.0052 0.0145  45  TRP A NE1 
341  C CE2 . TRP A 58  ? 0.1786 0.2420 0.2068 0.0236  -0.0168 0.0174  45  TRP A CE2 
342  C CE3 . TRP A 58  ? 0.1689 0.1923 0.1567 0.0101  -0.0209 0.0115  45  TRP A CE3 
343  C CZ2 . TRP A 58  ? 0.1586 0.2329 0.1959 0.0197  -0.0301 0.0235  45  TRP A CZ2 
344  C CZ3 . TRP A 58  ? 0.1709 0.2036 0.1612 0.0056  -0.0333 0.0153  45  TRP A CZ3 
345  C CH2 . TRP A 58  ? 0.1693 0.2273 0.1850 0.0098  -0.0393 0.0223  45  TRP A CH2 
346  N N   . THR A 59  ? 0.1823 0.2074 0.1717 0.0409  0.0126  -0.0107 46  THR A N   
347  C CA  . THR A 59  ? 0.1885 0.2254 0.1908 0.0538  0.0180  -0.0189 46  THR A CA  
348  C C   . THR A 59  ? 0.2143 0.2239 0.2163 0.0624  0.0154  -0.0277 46  THR A C   
349  O O   . THR A 59  ? 0.2134 0.2213 0.2340 0.0751  0.0138  -0.0291 46  THR A O   
350  C CB  . THR A 59  ? 0.2539 0.3143 0.2505 0.0538  0.0294  -0.0264 46  THR A CB  
351  O OG1 . THR A 59  ? 0.1922 0.2772 0.1944 0.0448  0.0311  -0.0134 46  THR A OG1 
352  C CG2 . THR A 59  ? 0.2176 0.2927 0.2267 0.0691  0.0385  -0.0403 46  THR A CG2 
353  N N   . LEU A 60  ? 0.2054 0.1935 0.1905 0.0551  0.0139  -0.0318 47  LEU A N   
354  C CA  . LEU A 60  ? 0.2718 0.2298 0.2577 0.0590  0.0104  -0.0388 47  LEU A CA  
355  C C   . LEU A 60  ? 0.2405 0.1812 0.2353 0.0605  0.0008  -0.0237 47  LEU A C   
356  O O   . LEU A 60  ? 0.2533 0.1783 0.2642 0.0716  -0.0028 -0.0243 47  LEU A O   
357  C CB  . LEU A 60  ? 0.3353 0.2800 0.3043 0.0467  0.0095  -0.0433 47  LEU A CB  
358  C CG  . LEU A 60  ? 0.4660 0.3881 0.4347 0.0483  0.0089  -0.0601 47  LEU A CG  
359  C CD1 . LEU A 60  ? 0.4742 0.4123 0.4408 0.0575  0.0173  -0.0810 47  LEU A CD1 
360  C CD2 . LEU A 60  ? 0.5098 0.4234 0.4663 0.0328  0.0051  -0.0600 47  LEU A CD2 
361  N N   . LEU A 61  ? 0.2046 0.1488 0.1888 0.0499  -0.0036 -0.0102 48  LEU A N   
362  C CA  . LEU A 61  ? 0.2333 0.1661 0.2175 0.0482  -0.0130 0.0055  48  LEU A CA  
363  C C   . LEU A 61  ? 0.2380 0.1858 0.2405 0.0585  -0.0197 0.0135  48  LEU A C   
364  O O   . LEU A 61  ? 0.2493 0.1859 0.2604 0.0634  -0.0292 0.0263  48  LEU A O   
365  C CB  . LEU A 61  ? 0.2593 0.1960 0.2233 0.0343  -0.0136 0.0129  48  LEU A CB  
366  C CG  . LEU A 61  ? 0.2706 0.1945 0.2224 0.0244  -0.0089 0.0108  48  LEU A CG  
367  C CD1 . LEU A 61  ? 0.2589 0.1919 0.1952 0.0143  -0.0062 0.0145  48  LEU A CD1 
368  C CD2 . LEU A 61  ? 0.3288 0.2284 0.2834 0.0230  -0.0134 0.0190  48  LEU A CD2 
369  N N   . ASN A 62  ? 0.2019 0.1773 0.2130 0.0606  -0.0158 0.0089  49  ASN A N   
370  C CA  . ASN A 62  ? 0.2035 0.2009 0.2381 0.0694  -0.0220 0.0164  49  ASN A CA  
371  C C   . ASN A 62  ? 0.2343 0.2256 0.2956 0.0886  -0.0207 0.0122  49  ASN A C   
372  O O   . ASN A 62  ? 0.2640 0.2579 0.3466 0.0983  -0.0311 0.0247  49  ASN A O   
373  C CB  . ASN A 62  ? 0.1845 0.2145 0.2271 0.0655  -0.0162 0.0127  49  ASN A CB  
374  C CG  . ASN A 62  ? 0.1843 0.2422 0.2511 0.0681  -0.0257 0.0236  49  ASN A CG  
375  O OD1 . ASN A 62  ? 0.2076 0.2615 0.2761 0.0682  -0.0399 0.0358  49  ASN A OD1 
376  N ND2 . ASN A 62  ? 0.1756 0.2657 0.2619 0.0687  -0.0187 0.0211  49  ASN A ND2 
377  N N   . ARG A 63  ? 0.2367 0.2193 0.2970 0.0945  -0.0087 -0.0061 50  ARG A N   
378  C CA  . ARG A 63  ? 0.2639 0.2359 0.3487 0.1139  -0.0047 -0.0175 50  ARG A CA  
379  C C   . ARG A 63  ? 0.3017 0.2314 0.3906 0.1170  -0.0150 -0.0100 50  ARG A C   
380  O O   . ARG A 63  ? 0.3397 0.2594 0.4589 0.1341  -0.0202 -0.0059 50  ARG A O   
381  C CB  . ARG A 63  ? 0.3313 0.3066 0.4066 0.1165  0.0109  -0.0431 50  ARG A CB  
382  C CG  . ARG A 63  ? 0.5206 0.4796 0.6173 0.1364  0.0171  -0.0631 50  ARG A CG  
383  C CD  . ARG A 63  ? 0.6724 0.6381 0.7504 0.1357  0.0320  -0.0913 50  ARG A CD  
384  N NE  . ARG A 63  ? 0.7499 0.7637 0.8202 0.1317  0.0434  -0.0913 50  ARG A NE  
385  C CZ  . ARG A 63  ? 0.7683 0.7954 0.8079 0.1158  0.0481  -0.0941 50  ARG A CZ  
386  N NH1 . ARG A 63  ? 0.8023 0.8014 0.8173 0.1032  0.0422  -0.0988 50  ARG A NH1 
387  N NH2 . ARG A 63  ? 0.7366 0.8067 0.7734 0.1118  0.0577  -0.0893 50  ARG A NH2 
388  N N   . ARG A 64  ? 0.3090 0.2152 0.3714 0.1004  -0.0179 -0.0061 51  ARG A N   
389  C CA  . ARG A 64  ? 0.3603 0.2260 0.4258 0.0989  -0.0262 0.0023  51  ARG A CA  
390  C C   . ARG A 64  ? 0.3880 0.2501 0.4539 0.0944  -0.0408 0.0328  51  ARG A C   
391  O O   . ARG A 64  ? 0.3818 0.2169 0.4656 0.1009  -0.0502 0.0467  51  ARG A O   
392  C CB  . ARG A 64  ? 0.3887 0.2363 0.4292 0.0813  -0.0223 -0.0056 51  ARG A CB  
393  C CG  . ARG A 64  ? 0.4546 0.2977 0.4927 0.0838  -0.0122 -0.0349 51  ARG A CG  
394  C CD  . ARG A 64  ? 0.5259 0.3568 0.5428 0.0644  -0.0121 -0.0383 51  ARG A CD  
395  N NE  . ARG A 64  ? 0.6163 0.4477 0.6256 0.0637  -0.0054 -0.0659 51  ARG A NE  
396  C CZ  . ARG A 64  ? 0.6390 0.4691 0.6319 0.0474  -0.0059 -0.0720 51  ARG A CZ  
397  N NH1 . ARG A 64  ? 0.6105 0.4393 0.5966 0.0321  -0.0102 -0.0530 51  ARG A NH1 
398  N NH2 . ARG A 64  ? 0.6495 0.4837 0.6328 0.0463  -0.0020 -0.0972 51  ARG A NH2 
399  N N   . CYS A 65  ? 0.3853 0.2735 0.4306 0.0823  -0.0433 0.0436  52  CYS A N   
400  C CA  . CYS A 65  ? 0.3683 0.2561 0.4020 0.0735  -0.0565 0.0704  52  CYS A CA  
401  C C   . CYS A 65  ? 0.3689 0.2907 0.4078 0.0763  -0.0660 0.0810  52  CYS A C   
402  O O   . CYS A 65  ? 0.4552 0.3800 0.4934 0.0749  -0.0810 0.1047  52  CYS A O   
403  C CB  . CYS A 65  ? 0.3489 0.2342 0.3472 0.0528  -0.0518 0.0725  52  CYS A CB  
404  S SG  . CYS A 65  ? 0.4488 0.2998 0.4436 0.0443  -0.0441 0.0654  52  CYS A SG  
405  N N   . GLY A 66  ? 0.3139 0.2629 0.3581 0.0783  -0.0588 0.0656  53  GLY A N   
406  C CA  . GLY A 66  ? 0.3326 0.3157 0.3868 0.0785  -0.0686 0.0739  53  GLY A CA  
407  C C   . GLY A 66  ? 0.2619 0.2632 0.2902 0.0608  -0.0664 0.0672  53  GLY A C   
408  O O   . GLY A 66  ? 0.2788 0.2670 0.2817 0.0501  -0.0567 0.0573  53  GLY A O   
409  N N   . HIS A 67  ? 0.2454 0.2767 0.2839 0.0579  -0.0765 0.0725  54  HIS A N   
410  C CA  . HIS A 67  ? 0.2559 0.3027 0.2784 0.0419  -0.0753 0.0633  54  HIS A CA  
411  C C   . HIS A 67  ? 0.2618 0.2938 0.2427 0.0256  -0.0770 0.0621  54  HIS A C   
412  O O   . HIS A 67  ? 0.2441 0.2701 0.2095 0.0164  -0.0669 0.0479  54  HIS A O   
413  C CB  . HIS A 67  ? 0.2428 0.3247 0.2876 0.0396  -0.0898 0.0708  54  HIS A CB  
414  C CG  . HIS A 67  ? 0.2522 0.3469 0.2882 0.0224  -0.0895 0.0599  54  HIS A CG  
415  N ND1 . HIS A 67  ? 0.2752 0.3684 0.2817 0.0052  -0.1006 0.0579  54  HIS A ND1 
416  C CD2 . HIS A 67  ? 0.2562 0.3637 0.3097 0.0190  -0.0795 0.0507  54  HIS A CD2 
417  C CE1 . HIS A 67  ? 0.2946 0.3943 0.3040 -0.0073 -0.0982 0.0458  54  HIS A CE1 
418  N NE2 . HIS A 67  ? 0.2700 0.3786 0.3087 0.0001  -0.0860 0.0440  54  HIS A NE2 
419  N N   . ARG A 68  ? 0.3128 0.3409 0.2770 0.0227  -0.0892 0.0778  55  ARG A N   
420  C CA  . ARG A 68  ? 0.3461 0.3675 0.2684 0.0073  -0.0892 0.0765  55  ARG A CA  
421  C C   . ARG A 68  ? 0.3753 0.3731 0.2834 0.0057  -0.0707 0.0664  55  ARG A C   
422  O O   . ARG A 68  ? 0.3548 0.3506 0.2397 -0.0044 -0.0622 0.0533  55  ARG A O   
423  C CB  . ARG A 68  ? 0.4050 0.4304 0.3110 0.0044  -0.1051 0.1003  55  ARG A CB  
424  C CG  . ARG A 68  ? 0.4951 0.5365 0.3609 -0.0132 -0.1139 0.0984  55  ARG A CG  
425  C CD  . ARG A 68  ? 0.5946 0.6370 0.4452 -0.0146 -0.1193 0.1170  55  ARG A CD  
426  N NE  . ARG A 68  ? 0.6816 0.7032 0.5161 -0.0162 -0.1057 0.1235  55  ARG A NE  
427  C CZ  . ARG A 68  ? 0.7357 0.7597 0.5343 -0.0280 -0.0960 0.1188  55  ARG A CZ  
428  N NH1 . ARG A 68  ? 0.7718 0.8139 0.5441 -0.0378 -0.0989 0.1052  55  ARG A NH1 
429  N NH2 . ARG A 68  ? 0.7321 0.7411 0.5237 -0.0299 -0.0832 0.1265  55  ARG A NH2 
430  N N   . ALA A 69  ? 0.3323 0.3126 0.2576 0.0161  -0.0650 0.0712  56  ALA A N   
431  C CA  . ALA A 69  ? 0.3333 0.2943 0.2502 0.0136  -0.0501 0.0630  56  ALA A CA  
432  C C   . ALA A 69  ? 0.3518 0.3165 0.2749 0.0136  -0.0382 0.0430  56  ALA A C   
433  O O   . ALA A 69  ? 0.2940 0.2531 0.2044 0.0072  -0.0278 0.0345  56  ALA A O   
434  C CB  . ALA A 69  ? 0.3345 0.2743 0.2702 0.0230  -0.0498 0.0708  56  ALA A CB  
435  N N   . ALA A 70  ? 0.3086 0.2859 0.2540 0.0209  -0.0397 0.0379  57  ALA A N   
436  C CA  . ALA A 70  ? 0.2466 0.2299 0.1992 0.0201  -0.0298 0.0243  57  ALA A CA  
437  C C   . ALA A 70  ? 0.2169 0.2060 0.1565 0.0086  -0.0299 0.0177  57  ALA A C   
438  O O   . ALA A 70  ? 0.2441 0.2291 0.1829 0.0056  -0.0210 0.0091  57  ALA A O   
439  C CB  . ALA A 70  ? 0.2597 0.2602 0.2396 0.0296  -0.0299 0.0233  57  ALA A CB  
440  N N   . VAL A 71  ? 0.2290 0.2267 0.1591 0.0022  -0.0411 0.0213  58  VAL A N   
441  C CA  . VAL A 71  ? 0.2709 0.2700 0.1869 -0.0095 -0.0421 0.0102  58  VAL A CA  
442  C C   . VAL A 71  ? 0.2841 0.2684 0.1782 -0.0129 -0.0305 0.0017  58  VAL A C   
443  O O   . VAL A 71  ? 0.2523 0.2309 0.1455 -0.0169 -0.0241 -0.0116 58  VAL A O   
444  C CB  . VAL A 71  ? 0.2984 0.3112 0.2022 -0.0175 -0.0585 0.0139  58  VAL A CB  
445  C CG1 . VAL A 71  ? 0.3753 0.3840 0.2565 -0.0304 -0.0586 -0.0033 58  VAL A CG1 
446  C CG2 . VAL A 71  ? 0.2667 0.3002 0.2006 -0.0154 -0.0696 0.0208  58  VAL A CG2 
447  N N   . ALA A 72  ? 0.3053 0.2839 0.1868 -0.0108 -0.0273 0.0104  59  ALA A N   
448  C CA  . ALA A 72  ? 0.3267 0.2978 0.1934 -0.0137 -0.0144 0.0048  59  ALA A CA  
449  C C   . ALA A 72  ? 0.3439 0.3089 0.2296 -0.0092 -0.0037 -0.0033 59  ALA A C   
450  O O   . ALA A 72  ? 0.3571 0.3201 0.2401 -0.0108 0.0057  -0.0138 59  ALA A O   
451  C CB  . ALA A 72  ? 0.3711 0.3382 0.2287 -0.0141 -0.0137 0.0202  59  ALA A CB  
452  N N   . ALA A 73  ? 0.3089 0.2732 0.2144 -0.0027 -0.0054 0.0014  60  ALA A N   
453  C CA  . ALA A 73  ? 0.3094 0.2726 0.2302 0.0005  0.0018  -0.0031 60  ALA A CA  
454  C C   . ALA A 73  ? 0.3133 0.2791 0.2435 -0.0017 0.0017  -0.0097 60  ALA A C   
455  O O   . ALA A 73  ? 0.2979 0.2604 0.2359 -0.0012 0.0080  -0.0136 60  ALA A O   
456  C CB  . ALA A 73  ? 0.3116 0.2767 0.2454 0.0069  0.0002  0.0011  60  ALA A CB  
457  N N   . ALA A 74  ? 0.2730 0.2449 0.2063 -0.0047 -0.0066 -0.0093 61  ALA A N   
458  C CA  . ALA A 74  ? 0.2245 0.1961 0.1697 -0.0100 -0.0087 -0.0144 61  ALA A CA  
459  C C   . ALA A 74  ? 0.2679 0.2258 0.2034 -0.0139 -0.0045 -0.0279 61  ALA A C   
460  O O   . ALA A 74  ? 0.2842 0.2329 0.2347 -0.0146 -0.0015 -0.0324 61  ALA A O   
461  C CB  . ALA A 74  ? 0.2423 0.2260 0.1936 -0.0152 -0.0203 -0.0117 61  ALA A CB  
462  N N   . ALA A 75  ? 0.2518 0.2091 0.1632 -0.0157 -0.0036 -0.0337 62  ALA A N   
463  C CA  . ALA A 75  ? 0.2403 0.1889 0.1382 -0.0188 0.0024  -0.0510 62  ALA A CA  
464  C C   . ALA A 75  ? 0.2644 0.2068 0.1736 -0.0114 0.0166  -0.0552 62  ALA A C   
465  O O   . ALA A 75  ? 0.2644 0.1981 0.1741 -0.0103 0.0238  -0.0717 62  ALA A O   
466  C CB  . ALA A 75  ? 0.2633 0.2201 0.1282 -0.0238 0.0008  -0.0534 62  ALA A CB  
467  N N   . ILE A 76  ? 0.2762 0.2244 0.1965 -0.0060 0.0199  -0.0417 63  ILE A N   
468  C CA  . ILE A 76  ? 0.2720 0.2202 0.2080 0.0005  0.0304  -0.0421 63  ILE A CA  
469  C C   . ILE A 76  ? 0.2748 0.2121 0.2361 0.0040  0.0304  -0.0465 63  ILE A C   
470  O O   . ILE A 76  ? 0.2802 0.2135 0.2553 0.0104  0.0391  -0.0541 63  ILE A O   
471  C CB  . ILE A 76  ? 0.2631 0.2201 0.2071 0.0028  0.0296  -0.0274 63  ILE A CB  
472  C CG1 . ILE A 76  ? 0.2750 0.2366 0.1996 -0.0010 0.0296  -0.0220 63  ILE A CG1 
473  C CG2 . ILE A 76  ? 0.2563 0.2186 0.2207 0.0081  0.0368  -0.0257 63  ILE A CG2 
474  C CD1 . ILE A 76  ? 0.2606 0.2249 0.1924 -0.0004 0.0269  -0.0116 63  ILE A CD1 
475  N N   . ARG A 77  ? 0.2595 0.1925 0.2300 0.0000  0.0208  -0.0403 64  ARG A N   
476  C CA  . ARG A 77  ? 0.2447 0.1648 0.2414 0.0008  0.0189  -0.0392 64  ARG A CA  
477  C C   . ARG A 77  ? 0.2857 0.1858 0.2845 0.0006  0.0221  -0.0607 64  ARG A C   
478  O O   . ARG A 77  ? 0.3279 0.2112 0.3532 0.0044  0.0229  -0.0625 64  ARG A O   
479  C CB  . ARG A 77  ? 0.2575 0.1811 0.2627 -0.0069 0.0089  -0.0270 64  ARG A CB  
480  C CG  . ARG A 77  ? 0.2449 0.1604 0.2451 -0.0170 0.0011  -0.0381 64  ARG A CG  
481  C CD  . ARG A 77  ? 0.2173 0.1467 0.2284 -0.0249 -0.0074 -0.0232 64  ARG A CD  
482  N NE  . ARG A 77  ? 0.2312 0.1550 0.2454 -0.0372 -0.0173 -0.0321 64  ARG A NE  
483  C CZ  . ARG A 77  ? 0.2806 0.2130 0.2749 -0.0421 -0.0241 -0.0414 64  ARG A CZ  
484  N NH1 . ARG A 77  ? 0.2593 0.2032 0.2304 -0.0350 -0.0211 -0.0408 64  ARG A NH1 
485  N NH2 . ARG A 77  ? 0.2603 0.1899 0.2592 -0.0554 -0.0357 -0.0496 64  ARG A NH2 
486  N N   . LEU A 78  ? 0.2965 0.1983 0.2670 -0.0038 0.0235  -0.0771 65  LEU A N   
487  C CA  . LEU A 78  ? 0.3076 0.1925 0.2714 -0.0053 0.0272  -0.1037 65  LEU A CA  
488  C C   . LEU A 78  ? 0.3158 0.2044 0.2760 0.0055  0.0444  -0.1177 65  LEU A C   
489  O O   . LEU A 78  ? 0.3613 0.2380 0.3172 0.0078  0.0511  -0.1425 65  LEU A O   
490  C CB  . LEU A 78  ? 0.3708 0.2610 0.3011 -0.0177 0.0184  -0.1147 65  LEU A CB  
491  C CG  . LEU A 78  ? 0.3726 0.2698 0.3057 -0.0285 0.0015  -0.1003 65  LEU A CG  
492  C CD1 . LEU A 78  ? 0.4101 0.3176 0.3101 -0.0394 -0.0081 -0.1105 65  LEU A CD1 
493  C CD2 . LEU A 78  ? 0.3520 0.2305 0.3172 -0.0340 -0.0059 -0.0999 65  LEU A CD2 
494  N N   . SER A 79  ? 0.3501 0.2457 0.2068 -0.0160 0.0244  -0.0308 66  SER A N   
495  C CA  . SER A 79  ? 0.3668 0.2780 0.2167 -0.0020 0.0401  -0.0327 66  SER A CA  
496  C C   . SER A 79  ? 0.3299 0.2304 0.1658 0.0189  0.0458  -0.0406 66  SER A C   
497  O O   . SER A 79  ? 0.3401 0.2319 0.1839 0.0233  0.0414  -0.0409 66  SER A O   
498  C CB  . SER A 79  ? 0.3492 0.3009 0.2318 -0.0074 0.0504  -0.0249 66  SER A CB  
499  O OG  . SER A 79  ? 0.3456 0.3216 0.2250 0.0019  0.0668  -0.0270 66  SER A OG  
500  N N   . THR A 80  ? 0.3602 0.2599 0.1713 0.0343  0.0561  -0.0467 67  THR A N   
501  C CA  . THR A 80  ? 0.4306 0.3240 0.2249 0.0615  0.0634  -0.0549 67  THR A CA  
502  C C   . THR A 80  ? 0.4139 0.3674 0.2415 0.0732  0.0784  -0.0524 67  THR A C   
503  O O   . THR A 80  ? 0.4607 0.4238 0.2834 0.1000  0.0843  -0.0582 67  THR A O   
504  C CB  . THR A 80  ? 0.4771 0.3417 0.2243 0.0765  0.0680  -0.0647 67  THR A CB  
505  O OG1 . THR A 80  ? 0.4714 0.3670 0.2215 0.0693  0.0790  -0.0611 67  THR A OG1 
506  C CG2 . THR A 80  ? 0.4802 0.2830 0.1897 0.0649  0.0510  -0.0704 67  THR A CG2 
507  N N   . VAL A 81  ? 0.3320 0.3254 0.1909 0.0532  0.0840  -0.0443 68  VAL A N   
508  C CA  . VAL A 81  ? 0.3402 0.3961 0.2305 0.0563  0.0986  -0.0428 68  VAL A CA  
509  C C   . VAL A 81  ? 0.3279 0.4098 0.2579 0.0397  0.0938  -0.0360 68  VAL A C   
510  O O   . VAL A 81  ? 0.3552 0.4909 0.3139 0.0388  0.1029  -0.0358 68  VAL A O   
511  C CB  . VAL A 81  ? 0.3908 0.4729 0.2765 0.0445  0.1143  -0.0402 68  VAL A CB  
512  C CG1 . VAL A 81  ? 0.4484 0.5125 0.2939 0.0652  0.1217  -0.0482 68  VAL A CG1 
513  C CG2 . VAL A 81  ? 0.4119 0.4700 0.2943 0.0165  0.1082  -0.0310 68  VAL A CG2 
514  N N   . VAL A 82  ? 0.2924 0.3398 0.2234 0.0260  0.0795  -0.0314 69  VAL A N   
515  C CA  . VAL A 82  ? 0.2428 0.3067 0.2050 0.0153  0.0735  -0.0265 69  VAL A CA  
516  C C   . VAL A 82  ? 0.2920 0.3280 0.2480 0.0284  0.0622  -0.0283 69  VAL A C   
517  O O   . VAL A 82  ? 0.3289 0.3192 0.2611 0.0264  0.0530  -0.0290 69  VAL A O   
518  C CB  . VAL A 82  ? 0.2352 0.2856 0.2035 -0.0094 0.0677  -0.0188 69  VAL A CB  
519  C CG1 . VAL A 82  ? 0.2220 0.2875 0.2185 -0.0178 0.0622  -0.0152 69  VAL A CG1 
520  C CG2 . VAL A 82  ? 0.2418 0.3054 0.2050 -0.0230 0.0792  -0.0154 69  VAL A CG2 
521  N N   . ARG A 83  ? 0.2668 0.3297 0.2412 0.0406  0.0626  -0.0290 70  ARG A N   
522  C CA  . ARG A 83  ? 0.3124 0.3437 0.2754 0.0532  0.0529  -0.0289 70  ARG A CA  
523  C C   . ARG A 83  ? 0.2924 0.3183 0.2735 0.0329  0.0443  -0.0218 70  ARG A C   
524  O O   . ARG A 83  ? 0.2970 0.3600 0.3063 0.0254  0.0457  -0.0193 70  ARG A O   
525  C CB  . ARG A 83  ? 0.3669 0.4273 0.3348 0.0819  0.0562  -0.0326 70  ARG A CB  
526  C CG  . ARG A 83  ? 0.5168 0.5280 0.4553 0.1016  0.0478  -0.0324 70  ARG A CG  
527  C CD  . ARG A 83  ? 0.6334 0.6770 0.5764 0.1345  0.0492  -0.0350 70  ARG A CD  
528  N NE  . ARG A 83  ? 0.7582 0.7416 0.6565 0.1616  0.0437  -0.0358 70  ARG A NE  
529  C CZ  . ARG A 83  ? 0.8799 0.8508 0.7502 0.1908  0.0454  -0.0403 70  ARG A CZ  
530  N NH1 . ARG A 83  ? 0.9095 0.9300 0.7966 0.1956  0.0526  -0.0445 70  ARG A NH1 
531  N NH2 . ARG A 83  ? 0.9570 0.8645 0.7824 0.2076  0.0381  -0.0379 70  ARG A NH2 
532  N N   . VAL A 84  ? 0.2726 0.2541 0.2360 0.0231  0.0357  -0.0195 71  VAL A N   
533  C CA  . VAL A 84  ? 0.2491 0.2290 0.2285 0.0054  0.0288  -0.0131 71  VAL A CA  
534  C C   . VAL A 84  ? 0.2984 0.2566 0.2679 0.0138  0.0241  -0.0108 71  VAL A C   
535  O O   . VAL A 84  ? 0.3629 0.2756 0.3022 0.0151  0.0201  -0.0116 71  VAL A O   
536  C CB  . VAL A 84  ? 0.2841 0.2419 0.2555 -0.0136 0.0225  -0.0115 71  VAL A CB  
537  C CG1 . VAL A 84  ? 0.2464 0.2160 0.2390 -0.0285 0.0176  -0.0053 71  VAL A CG1 
538  C CG2 . VAL A 84  ? 0.3378 0.3061 0.3070 -0.0175 0.0266  -0.0133 71  VAL A CG2 
539  N N   . GLU A 85  ? 0.2025 0.1892 0.1928 0.0180  0.0245  -0.0078 72  GLU A N   
540  C CA  . GLU A 85  ? 0.2505 0.2174 0.2284 0.0279  0.0205  -0.0042 72  GLU A CA  
541  C C   . GLU A 85  ? 0.2162 0.1662 0.1961 0.0066  0.0160  0.0024  72  GLU A C   
542  O O   . GLU A 85  ? 0.1887 0.1659 0.1938 -0.0077 0.0159  0.0046  72  GLU A O   
543  C CB  . GLU A 85  ? 0.2406 0.2504 0.2381 0.0432  0.0217  -0.0047 72  GLU A CB  
544  C CG  . GLU A 85  ? 0.3985 0.3867 0.3738 0.0649  0.0178  -0.0017 72  GLU A CG  
545  C CD  . GLU A 85  ? 0.4890 0.4509 0.4319 0.0942  0.0192  -0.0060 72  GLU A CD  
546  O OE1 . GLU A 85  ? 0.5096 0.4879 0.4557 0.1004  0.0244  -0.0126 72  GLU A OE1 
547  O OE2 . GLU A 85  ? 0.6325 0.5537 0.5421 0.1125  0.0156  -0.0024 72  GLU A OE2 
548  N N   . HIS A 86  ? 0.2671 0.1705 0.2172 0.0044  0.0131  0.0055  73  HIS A N   
549  C CA  . HIS A 86  ? 0.2899 0.1838 0.2416 -0.0155 0.0108  0.0124  73  HIS A CA  
550  C C   . HIS A 86  ? 0.3067 0.2101 0.2608 -0.0037 0.0114  0.0177  73  HIS A C   
551  O O   . HIS A 86  ? 0.3251 0.1991 0.2508 0.0151  0.0109  0.0194  73  HIS A O   
552  C CB  . HIS A 86  ? 0.3223 0.1613 0.2380 -0.0293 0.0084  0.0137  73  HIS A CB  
553  C CG  . HIS A 86  ? 0.3601 0.1956 0.2780 -0.0534 0.0081  0.0211  73  HIS A CG  
554  N ND1 . HIS A 86  ? 0.3359 0.1903 0.2706 -0.0795 0.0059  0.0209  73  HIS A ND1 
555  C CD2 . HIS A 86  ? 0.3558 0.1756 0.2606 -0.0545 0.0103  0.0292  73  HIS A CD2 
556  C CE1 . HIS A 86  ? 0.3432 0.2097 0.2846 -0.0896 0.0074  0.0262  73  HIS A CE1 
557  N NE2 . HIS A 86  ? 0.3472 0.1840 0.2657 -0.0806 0.0109  0.0327  73  HIS A NE2 
558  N N   . VAL A 87  ? 0.2270 0.1688 0.2104 -0.0118 0.0119  0.0198  74  VAL A N   
559  C CA  . VAL A 87  ? 0.2368 0.1907 0.2218 -0.0015 0.0115  0.0238  74  VAL A CA  
560  C C   . VAL A 87  ? 0.2770 0.1895 0.2316 -0.0068 0.0120  0.0324  74  VAL A C   
561  O O   . VAL A 87  ? 0.2887 0.1939 0.2441 -0.0297 0.0138  0.0365  74  VAL A O   
562  C CB  . VAL A 87  ? 0.2196 0.2153 0.2358 -0.0109 0.0120  0.0231  74  VAL A CB  
563  C CG1 . VAL A 87  ? 0.2238 0.2312 0.2378 -0.0000 0.0105  0.0259  74  VAL A CG1 
564  C CG2 . VAL A 87  ? 0.1544 0.1814 0.1934 -0.0105 0.0127  0.0156  74  VAL A CG2 
565  N N   . THR A 88  ? 0.2568 0.1433 0.1826 0.0147  0.0106  0.0354  75  THR A N   
566  C CA  . THR A 88  ? 0.3482 0.1829 0.2340 0.0106  0.0120  0.0450  75  THR A CA  
567  C C   . THR A 88  ? 0.3320 0.1874 0.2276 0.0010  0.0143  0.0521  75  THR A C   
568  O O   . THR A 88  ? 0.2894 0.1944 0.2173 0.0051  0.0130  0.0484  75  THR A O   
569  C CB  . THR A 88  ? 0.4426 0.2369 0.2865 0.0428  0.0092  0.0469  75  THR A CB  
570  O OG1 . THR A 88  ? 0.3866 0.2265 0.2485 0.0678  0.0053  0.0450  75  THR A OG1 
571  C CG2 . THR A 88  ? 0.4598 0.2299 0.2876 0.0567  0.0081  0.0391  75  THR A CG2 
572  N N   . ALA A 89  ? 0.3533 0.1671 0.2167 -0.0130 0.0184  0.0621  76  ALA A N   
573  C CA  . ALA A 89  ? 0.3902 0.2191 0.2551 -0.0208 0.0226  0.0699  76  ALA A CA  
574  C C   . ALA A 89  ? 0.3530 0.1981 0.2136 0.0094  0.0178  0.0701  76  ALA A C   
575  O O   . ALA A 89  ? 0.3407 0.2249 0.2218 0.0087  0.0183  0.0698  76  ALA A O   
576  C CB  . ALA A 89  ? 0.4514 0.2292 0.2765 -0.0408 0.0289  0.0808  76  ALA A CB  
577  N N   . ASP A 90  ? 0.4309 0.2473 0.2628 0.0375  0.0124  0.0698  77  ASP A N   
578  C CA  . ASP A 90  ? 0.4204 0.2570 0.2465 0.0691  0.0057  0.0694  77  ASP A CA  
579  C C   . ASP A 90  ? 0.3431 0.2528 0.2203 0.0743  0.0006  0.0570  77  ASP A C   
580  O O   . ASP A 90  ? 0.3155 0.2599 0.2028 0.0824  -0.0037 0.0555  77  ASP A O   
581  C CB  . ASP A 90  ? 0.5071 0.3001 0.2901 0.1029  0.0006  0.0711  77  ASP A CB  
582  C CG  . ASP A 90  ? 0.6284 0.3493 0.3572 0.0977  0.0050  0.0807  77  ASP A CG  
583  O OD1 . ASP A 90  ? 0.6268 0.3409 0.3488 0.0771  0.0103  0.0888  77  ASP A OD1 
584  O OD2 . ASP A 90  ? 0.7147 0.3950 0.4135 0.1114  0.0040  0.0763  77  ASP A OD2 
585  N N   . LEU A 91  ? 0.3148 0.2449 0.2202 0.0677  0.0011  0.0481  78  LEU A N   
586  C CA  . LEU A 91  ? 0.2889 0.2810 0.2382 0.0662  -0.0018 0.0372  78  LEU A CA  
587  C C   . LEU A 91  ? 0.2311 0.2460 0.2037 0.0425  0.0012  0.0366  78  LEU A C   
588  O O   . LEU A 91  ? 0.2318 0.2867 0.2252 0.0430  -0.0023 0.0300  78  LEU A O   
589  C CB  . LEU A 91  ? 0.3333 0.3354 0.3005 0.0634  -0.0000 0.0294  78  LEU A CB  
590  C CG  . LEU A 91  ? 0.4276 0.4454 0.3907 0.0928  -0.0038 0.0237  78  LEU A CG  
591  C CD1 . LEU A 91  ? 0.3973 0.4352 0.3823 0.0866  0.0001  0.0155  78  LEU A CD1 
592  C CD2 . LEU A 91  ? 0.4941 0.5645 0.4728 0.1087  -0.0108 0.0192  78  LEU A CD2 
593  N N   . GLU A 92  ? 0.2200 0.2103 0.1871 0.0220  0.0077  0.0428  79  GLU A N   
594  C CA  . GLU A 92  ? 0.2072 0.2191 0.1920 0.0054  0.0115  0.0428  79  GLU A CA  
595  C C   . GLU A 92  ? 0.2291 0.2460 0.1990 0.0141  0.0105  0.0467  79  GLU A C   
596  O O   . GLU A 92  ? 0.2048 0.2504 0.1898 0.0118  0.0097  0.0413  79  GLU A O   
597  C CB  . GLU A 92  ? 0.2036 0.1983 0.1868 -0.0165 0.0185  0.0486  79  GLU A CB  
598  C CG  . GLU A 92  ? 0.2287 0.2285 0.2309 -0.0267 0.0181  0.0430  79  GLU A CG  
599  C CD  . GLU A 92  ? 0.3009 0.2960 0.3056 -0.0490 0.0229  0.0472  79  GLU A CD  
600  O OE1 . GLU A 92  ? 0.3442 0.3311 0.3355 -0.0589 0.0281  0.0551  79  GLU A OE1 
601  O OE2 . GLU A 92  ? 0.2727 0.2758 0.2923 -0.0571 0.0214  0.0427  79  GLU A OE2 
602  N N   . GLU A 93  ? 0.2408 0.2241 0.1751 0.0250  0.0104  0.0559  80  GLU A N   
603  C CA  . GLU A 93  ? 0.3140 0.2988 0.2276 0.0359  0.0089  0.0605  80  GLU A CA  
604  C C   . GLU A 93  ? 0.2307 0.2557 0.1586 0.0541  -0.0020 0.0501  80  GLU A C   
605  O O   . GLU A 93  ? 0.2398 0.2863 0.1691 0.0544  -0.0040 0.0471  80  GLU A O   
606  C CB  . GLU A 93  ? 0.3315 0.2638 0.1960 0.0467  0.0103  0.0735  80  GLU A CB  
607  C CG  . GLU A 93  ? 0.4199 0.3488 0.2552 0.0609  0.0083  0.0800  80  GLU A CG  
608  C CD  . GLU A 93  ? 0.4395 0.3830 0.2798 0.0417  0.0176  0.0832  80  GLU A CD  
609  O OE1 . GLU A 93  ? 0.4415 0.4001 0.2702 0.0531  0.0145  0.0829  80  GLU A OE1 
610  O OE2 . GLU A 93  ? 0.3836 0.3272 0.2386 0.0168  0.0278  0.0853  80  GLU A OE2 
611  N N   . GLN A 94  ? 0.2348 0.2727 0.1726 0.0680  -0.0087 0.0437  81  GLN A N   
612  C CA  . GLN A 94  ? 0.2405 0.3277 0.1975 0.0803  -0.0189 0.0325  81  GLN A CA  
613  C C   . GLN A 94  ? 0.2090 0.3292 0.1991 0.0582  -0.0177 0.0219  81  GLN A C   
614  O O   . GLN A 94  ? 0.2005 0.3510 0.1969 0.0581  -0.0243 0.0141  81  GLN A O   
615  C CB  . GLN A 94  ? 0.2937 0.3970 0.2590 0.0983  -0.0238 0.0273  81  GLN A CB  
616  C CG  . GLN A 94  ? 0.4464 0.5127 0.3720 0.1278  -0.0266 0.0362  81  GLN A CG  
617  C CD  . GLN A 94  ? 0.6331 0.7207 0.5673 0.1501  -0.0305 0.0295  81  GLN A CD  
618  O OE1 . GLN A 94  ? 0.6498 0.7994 0.6198 0.1499  -0.0349 0.0179  81  GLN A OE1 
619  N NE2 . GLN A 94  ? 0.7480 0.7835 0.6469 0.1683  -0.0280 0.0364  81  GLN A NE2 
620  N N   . ALA A 95  ? 0.1522 0.2622 0.1585 0.0400  -0.0100 0.0215  82  ALA A N   
621  C CA  . ALA A 95  ? 0.1325 0.2607 0.1615 0.0215  -0.0079 0.0131  82  ALA A CA  
622  C C   . ALA A 95  ? 0.1544 0.2778 0.1728 0.0164  -0.0056 0.0141  82  ALA A C   
623  O O   . ALA A 95  ? 0.1628 0.3025 0.1870 0.0103  -0.0087 0.0047  82  ALA A O   
624  C CB  . ALA A 95  ? 0.1177 0.2322 0.1596 0.0082  -0.0010 0.0143  82  ALA A CB  
625  N N   . TRP A 96  ? 0.1406 0.2398 0.1400 0.0177  0.0008  0.0251  83  TRP A N   
626  C CA  . TRP A 96  ? 0.1502 0.2483 0.1370 0.0156  0.0053  0.0270  83  TRP A CA  
627  C C   . TRP A 96  ? 0.2032 0.3147 0.1745 0.0276  -0.0033 0.0220  83  TRP A C   
628  O O   . TRP A 96  ? 0.1793 0.3013 0.1492 0.0245  -0.0044 0.0139  83  TRP A O   
629  C CB  . TRP A 96  ? 0.1724 0.2466 0.1401 0.0123  0.0149  0.0410  83  TRP A CB  
630  C CG  . TRP A 96  ? 0.1571 0.2285 0.1406 -0.0037 0.0237  0.0442  83  TRP A CG  
631  C CD1 . TRP A 96  ? 0.1934 0.2443 0.1736 -0.0130 0.0275  0.0520  83  TRP A CD1 
632  C CD2 . TRP A 96  ? 0.2137 0.3038 0.2154 -0.0110 0.0286  0.0391  83  TRP A CD2 
633  N NE1 . TRP A 96  ? 0.1908 0.2542 0.1902 -0.0275 0.0335  0.0516  83  TRP A NE1 
634  C CE2 . TRP A 96  ? 0.1972 0.2859 0.2104 -0.0239 0.0344  0.0443  83  TRP A CE2 
635  C CE3 . TRP A 96  ? 0.1757 0.2808 0.1811 -0.0063 0.0281  0.0300  83  TRP A CE3 
636  C CZ2 . TRP A 96  ? 0.1805 0.2898 0.2119 -0.0288 0.0389  0.0413  83  TRP A CZ2 
637  C CZ3 . TRP A 96  ? 0.1645 0.2806 0.1831 -0.0095 0.0337  0.0273  83  TRP A CZ3 
638  C CH2 . TRP A 96  ? 0.1623 0.2842 0.1954 -0.0190 0.0387  0.0333  83  TRP A CH2 
639  N N   . GLU A 97  ? 0.2001 0.3093 0.1558 0.0433  -0.0102 0.0263  84  GLU A N   
640  C CA  . GLU A 97  ? 0.2445 0.3709 0.1839 0.0574  -0.0208 0.0217  84  GLU A CA  
641  C C   . GLU A 97  ? 0.2364 0.4007 0.1999 0.0503  -0.0306 0.0047  84  GLU A C   
642  O O   . GLU A 97  ? 0.1966 0.3747 0.1513 0.0492  -0.0368 -0.0039 84  GLU A O   
643  C CB  . GLU A 97  ? 0.2963 0.4131 0.2127 0.0806  -0.0275 0.0300  84  GLU A CB  
644  C CG  . GLU A 97  ? 0.3981 0.4662 0.2794 0.0838  -0.0174 0.0476  84  GLU A CG  
645  C CD  . GLU A 97  ? 0.5745 0.6195 0.4209 0.1106  -0.0242 0.0567  84  GLU A CD  
646  O OE1 . GLU A 97  ? 0.6095 0.6853 0.4640 0.1304  -0.0374 0.0487  84  GLU A OE1 
647  O OE2 . GLU A 97  ? 0.6672 0.6629 0.4755 0.1121  -0.0161 0.0718  84  GLU A OE2 
648  N N   . TRP A 98  ? 0.1774 0.3556 0.1682 0.0426  -0.0310 -0.0004 85  TRP A N   
649  C CA  . TRP A 98  ? 0.1784 0.3893 0.1919 0.0284  -0.0373 -0.0156 85  TRP A CA  
650  C C   . TRP A 98  ? 0.1509 0.3467 0.1619 0.0099  -0.0327 -0.0228 85  TRP A C   
651  O O   . TRP A 98  ? 0.1794 0.3896 0.1867 0.0010  -0.0402 -0.0352 85  TRP A O   
652  C CB  . TRP A 98  ? 0.1439 0.3669 0.1832 0.0225  -0.0346 -0.0170 85  TRP A CB  
653  C CG  . TRP A 98  ? 0.1660 0.4270 0.2272 0.0060  -0.0400 -0.0312 85  TRP A CG  
654  C CD1 . TRP A 98  ? 0.2278 0.5160 0.2944 0.0108  -0.0445 -0.0367 85  TRP A CD1 
655  C CD2 . TRP A 98  ? 0.1443 0.3920 0.2121 -0.0196 -0.0345 -0.0384 85  TRP A CD2 
656  N NE1 . TRP A 98  ? 0.2325 0.5287 0.3102 -0.0125 -0.0419 -0.0460 85  TRP A NE1 
657  C CE2 . TRP A 98  ? 0.2151 0.4810 0.2903 -0.0307 -0.0359 -0.0466 85  TRP A CE2 
658  C CE3 . TRP A 98  ? 0.1647 0.3769 0.2262 -0.0313 -0.0265 -0.0368 85  TRP A CE3 
659  C CZ2 . TRP A 98  ? 0.1988 0.4506 0.2745 -0.0548 -0.0314 -0.0528 85  TRP A CZ2 
660  C CZ3 . TRP A 98  ? 0.1736 0.3771 0.2370 -0.0536 -0.0243 -0.0455 85  TRP A CZ3 
661  C CH2 . TRP A 98  ? 0.1362 0.3523 0.2031 -0.0648 -0.0260 -0.0518 85  TRP A CH2 
662  N N   . LEU A 99  ? 0.1554 0.3218 0.1659 0.0051  -0.0211 -0.0157 86  LEU A N   
663  C CA  . LEU A 99  ? 0.1401 0.2888 0.1442 -0.0051 -0.0158 -0.0213 86  LEU A CA  
664  C C   . LEU A 99  ? 0.2201 0.3644 0.1982 0.0015  -0.0181 -0.0254 86  LEU A C   
665  O O   . LEU A 99  ? 0.2271 0.3634 0.1942 -0.0062 -0.0205 -0.0372 86  LEU A O   
666  C CB  . LEU A 99  ? 0.1288 0.2572 0.1374 -0.0053 -0.0039 -0.0116 86  LEU A CB  
667  C CG  . LEU A 99  ? 0.1318 0.2571 0.1609 -0.0144 -0.0011 -0.0107 86  LEU A CG  
668  C CD1 . LEU A 99  ? 0.1248 0.2382 0.1579 -0.0128 0.0080  -0.0003 86  LEU A CD1 
669  C CD2 . LEU A 99  ? 0.1543 0.2716 0.1838 -0.0268 -0.0024 -0.0218 86  LEU A CD2 
670  N N   . VAL A 100 ? 0.1774 0.3213 0.1402 0.0156  -0.0167 -0.0154 87  VAL A N   
671  C CA  . VAL A 100 ? 0.2054 0.3449 0.1393 0.0238  -0.0175 -0.0176 87  VAL A CA  
672  C C   . VAL A 100 ? 0.2744 0.4329 0.1997 0.0222  -0.0329 -0.0321 87  VAL A C   
673  O O   . VAL A 100 ? 0.2965 0.4472 0.2000 0.0208  -0.0353 -0.0422 87  VAL A O   
674  C CB  . VAL A 100 ? 0.2382 0.3704 0.1527 0.0376  -0.0121 -0.0017 87  VAL A CB  
675  C CG1 . VAL A 100 ? 0.3365 0.4665 0.2171 0.0475  -0.0134 -0.0038 87  VAL A CG1 
676  C CG2 . VAL A 100 ? 0.2228 0.3402 0.1447 0.0327  0.0036  0.0108  87  VAL A CG2 
677  N N   A ARG A 101 ? 0.2633 0.4493 0.2051 0.0226  -0.0437 -0.0343 88  ARG A N   
678  N N   B ARG A 101 ? 0.2657 0.4517 0.2075 0.0224  -0.0437 -0.0345 88  ARG A N   
679  C CA  A ARG A 101 ? 0.3113 0.5289 0.2503 0.0193  -0.0600 -0.0487 88  ARG A CA  
680  C CA  B ARG A 101 ? 0.3052 0.5224 0.2436 0.0193  -0.0601 -0.0488 88  ARG A CA  
681  C C   A ARG A 101 ? 0.2843 0.5033 0.2328 -0.0067 -0.0631 -0.0655 88  ARG A C   
682  C C   B ARG A 101 ? 0.2834 0.5037 0.2325 -0.0069 -0.0635 -0.0657 88  ARG A C   
683  O O   A ARG A 101 ? 0.2820 0.5040 0.2133 -0.0156 -0.0722 -0.0793 88  ARG A O   
684  O O   B ARG A 101 ? 0.2836 0.5085 0.2173 -0.0161 -0.0728 -0.0794 88  ARG A O   
685  C CB  A ARG A 101 ? 0.3343 0.5909 0.2909 0.0306  -0.0702 -0.0461 88  ARG A CB  
686  C CB  B ARG A 101 ? 0.3349 0.5904 0.2887 0.0320  -0.0704 -0.0457 88  ARG A CB  
687  C CG  A ARG A 101 ? 0.3752 0.6232 0.3107 0.0587  -0.0704 -0.0306 88  ARG A CG  
688  C CG  B ARG A 101 ? 0.3785 0.6207 0.3105 0.0592  -0.0688 -0.0291 88  ARG A CG  
689  C CD  A ARG A 101 ? 0.4009 0.6763 0.3494 0.0725  -0.0780 -0.0314 88  ARG A CD  
690  C CD  B ARG A 101 ? 0.3986 0.6647 0.3411 0.0757  -0.0760 -0.0274 88  ARG A CD  
691  N NE  A ARG A 101 ? 0.3866 0.6877 0.3710 0.0598  -0.0765 -0.0382 88  ARG A NE  
692  N NE  B ARG A 101 ? 0.4086 0.7011 0.3499 0.0757  -0.0867 -0.0386 88  ARG A NE  
693  C CZ  A ARG A 101 ? 0.3636 0.6590 0.3610 0.0653  -0.0699 -0.0306 88  ARG A CZ  
694  C CZ  B ARG A 101 ? 0.4117 0.6968 0.3239 0.0920  -0.0922 -0.0353 88  ARG A CZ  
695  N NH1 A ARG A 101 ? 0.3480 0.6654 0.3738 0.0531  -0.0667 -0.0372 88  ARG A NH1 
696  N NH1 B ARG A 101 ? 0.4197 0.6673 0.2998 0.1079  -0.0857 -0.0203 88  ARG A NH1 
697  N NH2 A ARG A 101 ? 0.3548 0.6183 0.3324 0.0818  -0.0654 -0.0157 88  ARG A NH2 
698  N NH2 B ARG A 101 ? 0.3979 0.7114 0.3113 0.0905  -0.1033 -0.0464 88  ARG A NH2 
699  N N   . HIS A 102 ? 0.3391 0.5548 0.2426 -0.0572 -0.0310 -0.0928 89  HIS A N   
700  C CA  . HIS A 102 ? 0.3106 0.5234 0.2703 -0.0702 -0.0293 -0.1223 89  HIS A CA  
701  C C   . HIS A 102 ? 0.3333 0.5211 0.3195 -0.0812 -0.0090 -0.1527 89  HIS A C   
702  O O   . HIS A 102 ? 0.3502 0.4929 0.3660 -0.0761 0.0022  -0.1422 89  HIS A O   
703  C CB  . HIS A 102 ? 0.2511 0.4325 0.2423 -0.0639 -0.0304 -0.0959 89  HIS A CB  
704  C CG  . HIS A 102 ? 0.3131 0.5275 0.2996 -0.0542 -0.0496 -0.0810 89  HIS A CG  
705  N ND1 . HIS A 102 ? 0.3269 0.5734 0.3514 -0.0650 -0.0567 -0.1028 89  HIS A ND1 
706  C CD2 . HIS A 102 ? 0.3495 0.5705 0.3020 -0.0333 -0.0613 -0.0492 89  HIS A CD2 
707  C CE1 . HIS A 102 ? 0.3618 0.6437 0.3797 -0.0480 -0.0751 -0.0870 89  HIS A CE1 
708  N NE2 . HIS A 102 ? 0.3559 0.6174 0.3285 -0.0259 -0.0788 -0.0523 89  HIS A NE2 
709  N N   . ASP A 103 ? 0.3504 0.5716 0.3251 -0.0932 -0.0055 -0.1925 90  ASP A N   
710  C CA  . ASP A 103 ? 0.3876 0.5880 0.3913 -0.1005 0.0155  -0.2276 90  ASP A CA  
711  C C   . ASP A 103 ? 0.4208 0.6009 0.4775 -0.1120 0.0234  -0.2547 90  ASP A C   
712  O O   . ASP A 103 ? 0.4696 0.6238 0.5566 -0.1137 0.0418  -0.2798 90  ASP A O   
713  C CB  . ASP A 103 ? 0.4702 0.7084 0.4424 -0.1025 0.0226  -0.2427 90  ASP A CB  
714  C CG  . ASP A 103 ? 0.5558 0.8446 0.5155 -0.1089 0.0099  -0.2573 90  ASP A CG  
715  O OD1 . ASP A 103 ? 0.5420 0.8491 0.4959 -0.1047 -0.0094 -0.2413 90  ASP A OD1 
716  O OD2 . ASP A 103 ? 0.6153 0.9310 0.5746 -0.1170 0.0191  -0.2871 90  ASP A OD2 
717  N N   . GLU A 104 ? 0.3930 0.5844 0.4626 -0.1191 0.0125  -0.2485 91  GLU A N   
718  C CA  . GLU A 104 ? 0.4540 0.6290 0.5690 -0.1349 0.0258  -0.2738 91  GLU A CA  
719  C C   . GLU A 104 ? 0.4681 0.5629 0.6184 -0.1347 0.0438  -0.2614 91  GLU A C   
720  O O   . GLU A 104 ? 0.4916 0.5520 0.6755 -0.1465 0.0626  -0.2774 91  GLU A O   
721  C CB  . GLU A 104 ? 0.4668 0.6882 0.5866 -0.1425 0.0119  -0.2736 91  GLU A CB  
722  C CG  . GLU A 104 ? 0.4566 0.6586 0.5846 -0.1391 0.0047  -0.2396 91  GLU A CG  
723  C CD  . GLU A 104 ? 0.4100 0.6385 0.4976 -0.1191 -0.0184 -0.2054 91  GLU A CD  
724  O OE1 . GLU A 104 ? 0.4379 0.6990 0.4839 -0.1080 -0.0287 -0.2044 91  GLU A OE1 
725  O OE2 . GLU A 104 ? 0.3875 0.6020 0.4832 -0.1145 -0.0231 -0.1771 91  GLU A OE2 
726  N N   . ARG A 105 ? 0.4534 0.5171 0.5937 -0.1203 0.0393  -0.2307 92  ARG A N   
727  C CA  . ARG A 105 ? 0.4253 0.4148 0.5876 -0.1089 0.0531  -0.2019 92  ARG A CA  
728  C C   . ARG A 105 ? 0.3387 0.3144 0.4828 -0.0771 0.0477  -0.1678 92  ARG A C   
729  O O   . ARG A 105 ? 0.3325 0.3515 0.4472 -0.0701 0.0348  -0.1563 92  ARG A O   
730  C CB  . ARG A 105 ? 0.4751 0.4593 0.6431 -0.1194 0.0510  -0.1764 92  ARG A CB  
731  C CG  . ARG A 105 ? 0.5325 0.4376 0.7157 -0.1148 0.0705  -0.1483 92  ARG A CG  
732  C CD  . ARG A 105 ? 0.5142 0.4268 0.7035 -0.1340 0.0741  -0.1329 92  ARG A CD  
733  N NE  . ARG A 105 ? 0.5173 0.3592 0.7009 -0.1252 0.0911  -0.0922 92  ARG A NE  
734  C CZ  . ARG A 105 ? 0.5655 0.3612 0.7541 -0.1358 0.1134  -0.0876 92  ARG A CZ  
735  N NH1 . ARG A 105 ? 0.6177 0.3565 0.7845 -0.1221 0.1244  -0.0441 92  ARG A NH1 
736  N NH2 . ARG A 105 ? 0.6029 0.4133 0.8149 -0.1596 0.1247  -0.1263 92  ARG A NH2 
737  N N   . GLU A 106 ? 0.3517 0.2680 0.5139 -0.0576 0.0587  -0.1527 93  GLU A N   
738  C CA  . GLU A 106 ? 0.3322 0.2493 0.4866 -0.0261 0.0514  -0.1280 93  GLU A CA  
739  C C   . GLU A 106 ? 0.3417 0.2625 0.4752 -0.0169 0.0388  -0.0831 93  GLU A C   
740  O O   . GLU A 106 ? 0.3832 0.2606 0.5180 -0.0108 0.0431  -0.0570 93  GLU A O   
741  C CB  . GLU A 106 ? 0.4295 0.2908 0.6117 0.0004  0.0634  -0.1310 93  GLU A CB  
742  C CG  . GLU A 106 ? 0.4837 0.3618 0.6665 0.0367  0.0522  -0.1116 93  GLU A CG  
743  C CD  . GLU A 106 ? 0.5866 0.4082 0.7951 0.0740  0.0586  -0.1051 93  GLU A CD  
744  O OE1 . GLU A 106 ? 0.5779 0.3657 0.8144 0.0752  0.0754  -0.1381 93  GLU A OE1 
745  O OE2 . GLU A 106 ? 0.6865 0.4974 0.8856 0.1048  0.0466  -0.0678 93  GLU A OE2 
746  N N   . TYR A 107 ? 0.2634 0.2324 0.3749 -0.0175 0.0268  -0.0752 94  TYR A N   
747  C CA  . TYR A 107 ? 0.2617 0.2393 0.3560 -0.0111 0.0167  -0.0415 94  TYR A CA  
748  C C   . TYR A 107 ? 0.2391 0.2379 0.3321 0.0080  0.0114  -0.0349 94  TYR A C   
749  O O   . TYR A 107 ? 0.2041 0.2307 0.2989 0.0060  0.0150  -0.0550 94  TYR A O   
750  C CB  . TYR A 107 ? 0.2230 0.2336 0.2970 -0.0279 0.0093  -0.0384 94  TYR A CB  
751  C CG  . TYR A 107 ? 0.2325 0.2417 0.3146 -0.0456 0.0102  -0.0443 94  TYR A CG  
752  C CD1 . TYR A 107 ? 0.2159 0.2039 0.3052 -0.0481 0.0143  -0.0249 94  TYR A CD1 
753  C CD2 . TYR A 107 ? 0.2419 0.2812 0.3246 -0.0617 0.0078  -0.0730 94  TYR A CD2 
754  C CE1 . TYR A 107 ? 0.2264 0.2226 0.3316 -0.0692 0.0193  -0.0363 94  TYR A CE1 
755  C CE2 . TYR A 107 ? 0.2612 0.3155 0.3608 -0.0801 0.0077  -0.0869 94  TYR A CE2 
756  C CZ  . TYR A 107 ? 0.2540 0.2867 0.3689 -0.0854 0.0150  -0.0698 94  TYR A CZ  
757  O OH  . TYR A 107 ? 0.2615 0.3177 0.4013 -0.1084 0.0189  -0.0895 94  TYR A OH  
758  N N   . SER A 108 ? 0.2108 0.2034 0.3003 0.0237  0.0046  -0.0102 95  SER A N   
759  C CA  . SER A 108 ? 0.1910 0.2181 0.2846 0.0389  -0.0024 -0.0103 95  SER A CA  
760  C C   . SER A 108 ? 0.1590 0.2144 0.2362 0.0211  -0.0028 -0.0085 95  SER A C   
761  O O   . SER A 108 ? 0.1558 0.2011 0.2163 0.0070  -0.0024 0.0021  95  SER A O   
762  C CB  . SER A 108 ? 0.2115 0.2288 0.3030 0.0656  -0.0121 0.0126  95  SER A CB  
763  O OG  . SER A 108 ? 0.2087 0.2167 0.2765 0.0564  -0.0137 0.0360  95  SER A OG  
764  N N   . PHE A 109 ? 0.1472 0.2382 0.2336 0.0223  -0.0017 -0.0214 96  PHE A N   
765  C CA  . PHE A 109 ? 0.1317 0.2365 0.2049 0.0044  0.0039  -0.0206 96  PHE A CA  
766  C C   . PHE A 109 ? 0.1536 0.2538 0.2167 0.0076  -0.0039 -0.0028 96  PHE A C   
767  O O   . PHE A 109 ? 0.1195 0.2069 0.1671 -0.0047 0.0004  0.0059  96  PHE A O   
768  C CB  . PHE A 109 ? 0.1291 0.2743 0.2224 -0.0013 0.0127  -0.0453 96  PHE A CB  
769  C CG  . PHE A 109 ? 0.1716 0.3199 0.2553 -0.0227 0.0244  -0.0467 96  PHE A CG  
770  C CD1 . PHE A 109 ? 0.1653 0.2869 0.2228 -0.0430 0.0414  -0.0402 96  PHE A CD1 
771  C CD2 . PHE A 109 ? 0.1624 0.3379 0.2606 -0.0212 0.0195  -0.0550 96  PHE A CD2 
772  C CE1 . PHE A 109 ? 0.1911 0.2984 0.2389 -0.0608 0.0568  -0.0384 96  PHE A CE1 
773  C CE2 . PHE A 109 ? 0.2004 0.3706 0.2949 -0.0439 0.0352  -0.0620 96  PHE A CE2 
774  C CZ  . PHE A 109 ? 0.2108 0.3395 0.2811 -0.0634 0.0556  -0.0520 96  PHE A CZ  
775  N N   . VAL A 110 ? 0.1542 0.2664 0.2236 0.0271  -0.0151 0.0028  97  VAL A N   
776  C CA  . VAL A 110 ? 0.1301 0.2448 0.1844 0.0291  -0.0203 0.0168  97  VAL A CA  
777  C C   . VAL A 110 ? 0.1766 0.2556 0.2149 0.0205  -0.0160 0.0360  97  VAL A C   
778  O O   . VAL A 110 ? 0.1932 0.2736 0.2238 0.0110  -0.0125 0.0388  97  VAL A O   
779  C CB  . VAL A 110 ? 0.1791 0.3132 0.2300 0.0558  -0.0345 0.0253  97  VAL A CB  
780  C CG1 . VAL A 110 ? 0.1788 0.3158 0.2043 0.0552  -0.0366 0.0403  97  VAL A CG1 
781  C CG2 . VAL A 110 ? 0.1881 0.3800 0.2635 0.0655  -0.0425 -0.0015 97  VAL A CG2 
782  N N   . ASP A 111 ? 0.1672 0.2176 0.2068 0.0228  -0.0142 0.0435  98  ASP A N   
783  C CA  . ASP A 111 ? 0.1913 0.2199 0.2258 0.0101  -0.0085 0.0529  98  ASP A CA  
784  C C   . ASP A 111 ? 0.1595 0.1993 0.1940 -0.0036 -0.0075 0.0442  98  ASP A C   
785  O O   . ASP A 111 ? 0.1843 0.2282 0.2174 -0.0088 -0.0066 0.0495  98  ASP A O   
786  C CB  . ASP A 111 ? 0.2359 0.2323 0.2790 0.0091  -0.0028 0.0529  98  ASP A CB  
787  C CG  . ASP A 111 ? 0.2579 0.2221 0.2910 0.0222  0.0014  0.0749  98  ASP A CG  
788  O OD1 . ASP A 111 ? 0.2960 0.2740 0.3110 0.0354  -0.0043 0.0900  98  ASP A OD1 
789  O OD2 . ASP A 111 ? 0.3514 0.2742 0.3916 0.0191  0.0121  0.0770  98  ASP A OD2 
790  N N   . ALA A 112 ? 0.1270 0.1730 0.1611 -0.0066 -0.0067 0.0320  99  ALA A N   
791  C CA  . ALA A 112 ? 0.1671 0.2166 0.1887 -0.0138 -0.0058 0.0315  99  ALA A CA  
792  C C   . ALA A 112 ? 0.1868 0.2355 0.2025 -0.0125 -0.0030 0.0389  99  ALA A C   
793  O O   . ALA A 112 ? 0.1734 0.2189 0.1825 -0.0099 -0.0050 0.0464  99  ALA A O   
794  C CB  . ALA A 112 ? 0.1783 0.2314 0.1906 -0.0190 -0.0001 0.0201  99  ALA A CB  
795  N N   . THR A 113 ? 0.1599 0.2153 0.1814 -0.0126 0.0013  0.0328  100 THR A N   
796  C CA  . THR A 113 ? 0.1273 0.1805 0.1485 -0.0151 0.0077  0.0313  100 THR A CA  
797  C C   . THR A 113 ? 0.1641 0.2226 0.1885 -0.0089 0.0034  0.0380  100 THR A C   
798  O O   . THR A 113 ? 0.1602 0.2117 0.1859 -0.0073 0.0081  0.0383  100 THR A O   
799  C CB  . THR A 113 ? 0.1583 0.2320 0.1910 -0.0210 0.0133  0.0125  100 THR A CB  
800  O OG1 . THR A 113 ? 0.1533 0.2539 0.1920 -0.0096 0.0013  0.0110  100 THR A OG1 
801  C CG2 . THR A 113 ? 0.1910 0.2666 0.2267 -0.0317 0.0235  0.0007  100 THR A CG2 
802  N N   . SER A 114 ? 0.1293 0.1969 0.1546 -0.0049 -0.0023 0.0434  101 SER A N   
803  C CA  . SER A 114 ? 0.1311 0.2048 0.1555 -0.0040 -0.0005 0.0505  101 SER A CA  
804  C C   . SER A 114 ? 0.1477 0.2199 0.1822 -0.0064 0.0001  0.0526  101 SER A C   
805  O O   . SER A 114 ? 0.1614 0.2451 0.2038 -0.0047 0.0042  0.0498  101 SER A O   
806  C CB  . SER A 114 ? 0.1475 0.2169 0.1628 -0.0006 -0.0014 0.0626  101 SER A CB  
807  O OG  . SER A 114 ? 0.1413 0.2264 0.1449 0.0097  -0.0066 0.0619  101 SER A OG  
808  N N   . PHE A 115 ? 0.1350 0.2017 0.1723 -0.0089 -0.0049 0.0527  102 PHE A N   
809  C CA  . PHE A 115 ? 0.1144 0.1961 0.1633 -0.0088 -0.0098 0.0495  102 PHE A CA  
810  C C   . PHE A 115 ? 0.1212 0.2028 0.1661 0.0048  -0.0131 0.0521  102 PHE A C   
811  O O   . PHE A 115 ? 0.1344 0.2357 0.1946 0.0139  -0.0165 0.0499  102 PHE A O   
812  C CB  . PHE A 115 ? 0.1468 0.2304 0.1951 -0.0146 -0.0159 0.0426  102 PHE A CB  
813  C CG  . PHE A 115 ? 0.1444 0.2134 0.2000 -0.0261 -0.0090 0.0387  102 PHE A CG  
814  C CD1 . PHE A 115 ? 0.1559 0.2135 0.2155 -0.0310 0.0016  0.0472  102 PHE A CD1 
815  C CD2 . PHE A 115 ? 0.1767 0.2383 0.2316 -0.0309 -0.0102 0.0274  102 PHE A CD2 
816  C CE1 . PHE A 115 ? 0.2017 0.2297 0.2624 -0.0377 0.0111  0.0503  102 PHE A CE1 
817  C CE2 . PHE A 115 ? 0.1839 0.2200 0.2486 -0.0380 -0.0010 0.0234  102 PHE A CE2 
818  C CZ  . PHE A 115 ? 0.1722 0.1858 0.2389 -0.0402 0.0099  0.0378  102 PHE A CZ  
819  N N   . ALA A 116 ? 0.1681 0.2256 0.1946 0.0069  -0.0096 0.0561  103 ALA A N   
820  C CA  . ALA A 116 ? 0.1573 0.1943 0.1740 0.0195  -0.0066 0.0636  103 ALA A CA  
821  C C   . ALA A 116 ? 0.1978 0.2328 0.2315 0.0250  0.0018  0.0572  103 ALA A C   
822  O O   . ALA A 116 ? 0.2421 0.2704 0.2823 0.0430  0.0009  0.0612  103 ALA A O   
823  C CB  . ALA A 116 ? 0.1781 0.1838 0.1722 0.0116  0.0046  0.0669  103 ALA A CB  
824  N N   . VAL A 117 ? 0.1892 0.2335 0.2291 0.0129  0.0091  0.0459  104 VAL A N   
825  C CA  . VAL A 117 ? 0.1466 0.1976 0.1997 0.0148  0.0187  0.0330  104 VAL A CA  
826  C C   . VAL A 117 ? 0.1436 0.2236 0.2161 0.0234  0.0159  0.0313  104 VAL A C   
827  O O   . VAL A 117 ? 0.1562 0.2365 0.2457 0.0370  0.0211  0.0235  104 VAL A O   
828  C CB  . VAL A 117 ? 0.1617 0.2313 0.2094 0.0017  0.0231  0.0205  104 VAL A CB  
829  C CG1 . VAL A 117 ? 0.1444 0.2338 0.2011 0.0022  0.0328  0.0036  104 VAL A CG1 
830  C CG2 . VAL A 117 ? 0.1445 0.2007 0.1870 -0.0079 0.0283  0.0104  104 VAL A CG2 
831  N N   . MET A 118 ? 0.1245 0.2279 0.1990 0.0146  0.0108  0.0357  105 MET A N   
832  C CA  . MET A 118 ? 0.1365 0.2751 0.2353 0.0146  0.0129  0.0291  105 MET A CA  
833  C C   . MET A 118 ? 0.1291 0.2831 0.2497 0.0351  0.0014  0.0269  105 MET A C   
834  O O   . MET A 118 ? 0.1339 0.3178 0.2835 0.0464  0.0048  0.0145  105 MET A O   
835  C CB  . MET A 118 ? 0.1157 0.2641 0.2131 -0.0041 0.0146  0.0337  105 MET A CB  
836  C CG  . MET A 118 ? 0.1319 0.2656 0.2036 -0.0157 0.0247  0.0423  105 MET A CG  
837  S SD  . MET A 118 ? 0.1467 0.2683 0.2137 -0.0351 0.0341  0.0534  105 MET A SD  
838  C CE  . MET A 118 ? 0.1510 0.3130 0.2493 -0.0507 0.0523  0.0394  105 MET A CE  
839  N N   . ARG A 119 ? 0.1413 0.2804 0.2467 0.0430  -0.0125 0.0381  106 ARG A N   
840  C CA  . ARG A 119 ? 0.1571 0.3139 0.2720 0.0697  -0.0285 0.0412  106 ARG A CA  
841  C C   . ARG A 119 ? 0.1884 0.3176 0.3067 0.0970  -0.0235 0.0457  106 ARG A C   
842  O O   . ARG A 119 ? 0.2040 0.3626 0.3505 0.1236  -0.0312 0.0397  106 ARG A O   
843  C CB  . ARG A 119 ? 0.3144 0.4568 0.3969 0.0730  -0.0423 0.0553  106 ARG A CB  
844  C CG  . ARG A 119 ? 0.3456 0.5223 0.4339 0.0521  -0.0496 0.0433  106 ARG A CG  
845  C CD  . ARG A 119 ? 0.4103 0.5926 0.4692 0.0617  -0.0664 0.0501  106 ARG A CD  
846  N NE  . ARG A 119 ? 0.4825 0.6099 0.4980 0.0608  -0.0578 0.0689  106 ARG A NE  
847  C CZ  . ARG A 119 ? 0.4686 0.5785 0.4704 0.0384  -0.0488 0.0645  106 ARG A CZ  
848  N NH1 . ARG A 119 ? 0.4625 0.5927 0.4861 0.0184  -0.0474 0.0463  106 ARG A NH1 
849  N NH2 . ARG A 119 ? 0.4163 0.4864 0.3855 0.0360  -0.0381 0.0769  106 ARG A NH2 
850  N N   . LYS A 120 ? 0.2087 0.2826 0.3035 0.0902  -0.0090 0.0522  107 LYS A N   
851  C CA  . LYS A 120 ? 0.2450 0.2747 0.3424 0.1101  0.0031  0.0534  107 LYS A CA  
852  C C   . LYS A 120 ? 0.2373 0.2952 0.3734 0.1146  0.0140  0.0282  107 LYS A C   
853  O O   . LYS A 120 ? 0.2732 0.3206 0.4309 0.1449  0.0162  0.0246  107 LYS A O   
854  C CB  . LYS A 120 ? 0.3594 0.3326 0.4308 0.0896  0.0217  0.0553  107 LYS A CB  
855  C CG  . LYS A 120 ? 0.4435 0.3623 0.5224 0.0987  0.0432  0.0477  107 LYS A CG  
856  C CD  . LYS A 120 ? 0.5700 0.4280 0.6272 0.1293  0.0434  0.0774  107 LYS A CD  
857  C CE  . LYS A 120 ? 0.7124 0.4923 0.7725 0.1298  0.0739  0.0707  107 LYS A CE  
858  N NZ  . LYS A 120 ? 0.7399 0.4973 0.7895 0.0858  0.0964  0.0542  107 LYS A NZ  
859  N N   . LYS A 121 ? 0.1993 0.2921 0.3415 0.0871  0.0219  0.0116  108 LYS A N   
860  C CA  . LYS A 121 ? 0.2093 0.3331 0.3788 0.0849  0.0371  -0.0145 108 LYS A CA  
861  C C   . LYS A 121 ? 0.1834 0.3712 0.3897 0.0932  0.0320  -0.0249 108 LYS A C   
862  O O   . LYS A 121 ? 0.1863 0.4084 0.4203 0.0937  0.0468  -0.0490 108 LYS A O   
863  C CB  . LYS A 121 ? 0.2270 0.3614 0.3754 0.0536  0.0490  -0.0242 108 LYS A CB  
864  C CG  . LYS A 121 ? 0.2827 0.3752 0.4087 0.0433  0.0562  -0.0284 108 LYS A CG  
865  C CD  . LYS A 121 ? 0.3682 0.4332 0.5137 0.0543  0.0734  -0.0518 108 LYS A CD  
866  C CE  . LYS A 121 ? 0.4126 0.4452 0.5437 0.0349  0.0854  -0.0665 108 LYS A CE  
867  N NZ  . LYS A 121 ? 0.4890 0.4892 0.6432 0.0399  0.1080  -0.0967 108 LYS A NZ  
868  N N   . GLY A 122 ? 0.3359 0.2331 0.2964 0.0775  -0.0535 0.0292  109 GLY A N   
869  C CA  . GLY A 122 ? 0.3070 0.2655 0.3171 0.1045  -0.0410 0.0285  109 GLY A CA  
870  C C   . GLY A 122 ? 0.2770 0.2630 0.2931 0.0951  -0.0249 0.0085  109 GLY A C   
871  O O   . GLY A 122 ? 0.2812 0.2883 0.3193 0.1181  -0.0048 0.0029  109 GLY A O   
872  N N   . ILE A 123 ? 0.2424 0.2321 0.2416 0.0628  -0.0326 0.0018  110 ILE A N   
873  C CA  . ILE A 123 ? 0.2401 0.2515 0.2427 0.0504  -0.0210 -0.0109 110 ILE A CA  
874  C C   . ILE A 123 ? 0.1993 0.2701 0.2357 0.0367  -0.0281 -0.0081 110 ILE A C   
875  O O   . ILE A 123 ? 0.1729 0.2525 0.2078 0.0241  -0.0418 -0.0020 110 ILE A O   
876  C CB  . ILE A 123 ? 0.2327 0.2020 0.1910 0.0255  -0.0241 -0.0158 110 ILE A CB  
877  C CG1 . ILE A 123 ? 0.3063 0.2007 0.2131 0.0286  -0.0192 -0.0229 110 ILE A CG1 
878  C CG2 . ILE A 123 ? 0.2265 0.2177 0.1884 0.0143  -0.0137 -0.0222 110 ILE A CG2 
879  C CD1 . ILE A 123 ? 0.5264 0.3851 0.3839 -0.0062 -0.0293 -0.0237 110 ILE A CD1 
880  N N   . GLN A 124 ? 0.1535 0.2613 0.2150 0.0366  -0.0169 -0.0134 111 GLN A N   
881  C CA  . GLN A 124 ? 0.1156 0.2605 0.1962 0.0175  -0.0227 -0.0146 111 GLN A CA  
882  C C   . GLN A 124 ? 0.1364 0.2699 0.2087 0.0018  -0.0130 -0.0211 111 GLN A C   
883  O O   . GLN A 124 ? 0.1325 0.2661 0.2051 -0.0132 -0.0157 -0.0236 111 GLN A O   
884  C CB  . GLN A 124 ? 0.1193 0.3229 0.2379 0.0196  -0.0245 -0.0094 111 GLN A CB  
885  C CG  . GLN A 124 ? 0.1301 0.3571 0.2525 -0.0091 -0.0332 -0.0146 111 GLN A CG  
886  C CD  . GLN A 124 ? 0.1453 0.4199 0.2921 -0.0178 -0.0402 -0.0057 111 GLN A CD  
887  O OE1 . GLN A 124 ? 0.1116 0.4207 0.2882 -0.0026 -0.0340 0.0052  111 GLN A OE1 
888  N NE2 . GLN A 124 ? 0.1862 0.4555 0.3145 -0.0413 -0.0504 -0.0102 111 GLN A NE2 
889  N N   . ASN A 125 ? 0.1267 0.2450 0.1867 0.0062  0.0001  -0.0230 112 ASN A N   
890  C CA  . ASN A 125 ? 0.1288 0.2388 0.1797 -0.0096 0.0077  -0.0225 112 ASN A CA  
891  C C   . ASN A 125 ? 0.1449 0.2215 0.1686 -0.0171 -0.0001 -0.0162 112 ASN A C   
892  O O   . ASN A 125 ? 0.2115 0.2633 0.2072 -0.0154 -0.0040 -0.0155 112 ASN A O   
893  C CB  . ASN A 125 ? 0.1503 0.2686 0.1960 -0.0058 0.0263  -0.0249 112 ASN A CB  
894  C CG  . ASN A 125 ? 0.1538 0.3262 0.2393 -0.0008 0.0354  -0.0239 112 ASN A CG  
895  O OD1 . ASN A 125 ? 0.1426 0.3434 0.2535 -0.0153 0.0260  -0.0209 112 ASN A OD1 
896  N ND2 . ASN A 125 ? 0.1772 0.3661 0.2664 0.0187  0.0549  -0.0258 112 ASN A ND2 
897  N N   . ALA A 126 ? 0.1375 0.2132 0.1693 -0.0261 -0.0024 -0.0096 113 ALA A N   
898  C CA  . ALA A 126 ? 0.1806 0.2432 0.2007 -0.0295 -0.0098 0.0045  113 ALA A CA  
899  C C   . ALA A 126 ? 0.2101 0.2668 0.2279 -0.0380 -0.0048 0.0181  113 ALA A C   
900  O O   . ALA A 126 ? 0.1888 0.2432 0.2190 -0.0419 0.0043  0.0161  113 ALA A O   
901  C CB  . ALA A 126 ? 0.1803 0.2490 0.2156 -0.0233 -0.0138 0.0068  113 ALA A CB  
902  N N   . TYR A 127 ? 0.1582 0.2127 0.1572 -0.0456 -0.0133 0.0351  114 TYR A N   
903  C CA  . TYR A 127 ? 0.1776 0.2328 0.1788 -0.0516 -0.0141 0.0590  114 TYR A CA  
904  C C   . TYR A 127 ? 0.1769 0.2416 0.2070 -0.0376 -0.0182 0.0774  114 TYR A C   
905  O O   . TYR A 127 ? 0.1785 0.2648 0.2097 -0.0391 -0.0308 0.0930  114 TYR A O   
906  C CB  . TYR A 127 ? 0.2036 0.2609 0.1666 -0.0711 -0.0237 0.0722  114 TYR A CB  
907  C CG  . TYR A 127 ? 0.2288 0.2770 0.1633 -0.0821 -0.0105 0.0606  114 TYR A CG  
908  C CD1 . TYR A 127 ? 0.2535 0.3032 0.2060 -0.0739 0.0068  0.0420  114 TYR A CD1 
909  C CD2 . TYR A 127 ? 0.3149 0.3601 0.2028 -0.1037 -0.0147 0.0700  114 TYR A CD2 
910  C CE1 . TYR A 127 ? 0.2606 0.3158 0.1940 -0.0824 0.0228  0.0349  114 TYR A CE1 
911  C CE2 . TYR A 127 ? 0.3734 0.4142 0.2314 -0.1124 0.0032  0.0585  114 TYR A CE2 
912  C CZ  . TYR A 127 ? 0.3574 0.4065 0.2425 -0.0994 0.0236  0.0418  114 TYR A CZ  
913  O OH  . TYR A 127 ? 0.4071 0.4655 0.2695 -0.1065 0.0452  0.0336  114 TYR A OH  
914  N N   . ALA A 128 ? 0.1722 0.2197 0.2240 -0.0250 -0.0054 0.0754  115 ALA A N   
915  C CA  . ALA A 128 ? 0.1830 0.2313 0.2607 -0.0030 0.0007  0.0852  115 ALA A CA  
916  C C   . ALA A 128 ? 0.2119 0.2167 0.2981 0.0074  0.0178  0.0837  115 ALA A C   
917  O O   . ALA A 128 ? 0.2633 0.2416 0.3360 -0.0086 0.0227  0.0681  115 ALA A O   
918  C CB  . ALA A 128 ? 0.1661 0.2252 0.2447 0.0028  0.0021  0.0633  115 ALA A CB  
919  N N   . PHE A 129 ? 0.2363 0.2325 0.3447 0.0341  0.0285  0.1012  116 PHE A N   
920  C CA  . PHE A 129 ? 0.2982 0.2321 0.4070 0.0474  0.0484  0.0981  116 PHE A CA  
921  C C   . PHE A 129 ? 0.4097 0.3190 0.5207 0.0729  0.0703  0.0773  116 PHE A C   
922  O O   . PHE A 129 ? 0.3904 0.3451 0.5123 0.0840  0.0698  0.0755  116 PHE A O   
923  C CB  . PHE A 129 ? 0.3266 0.2536 0.4558 0.0631  0.0479  0.1431  116 PHE A CB  
924  C CG  . PHE A 129 ? 0.3334 0.2772 0.4484 0.0337  0.0294  0.1629  116 PHE A CG  
925  C CD1 . PHE A 129 ? 0.3422 0.2459 0.4330 0.0079  0.0331  0.1493  116 PHE A CD1 
926  C CD2 . PHE A 129 ? 0.3203 0.3231 0.4415 0.0273  0.0089  0.1954  116 PHE A CD2 
927  C CE1 . PHE A 129 ? 0.3645 0.2882 0.4385 -0.0185 0.0211  0.1670  116 PHE A CE1 
928  C CE2 . PHE A 129 ? 0.3142 0.3285 0.4098 -0.0023 -0.0052 0.2097  116 PHE A CE2 
929  C CZ  . PHE A 129 ? 0.3424 0.3178 0.4148 -0.0226 0.0033  0.1953  116 PHE A CZ  
930  N N   . ASP A 130 ? 0.6290 0.4613 0.7215 0.0769  0.0904  0.0597  117 ASP A N   
931  C CA  . ASP A 130 ? 0.7765 0.5619 0.8598 0.1057  0.1197  0.0397  117 ASP A CA  
932  C C   . ASP A 130 ? 0.7636 0.5585 0.8182 0.0938  0.1245  -0.0016 117 ASP A C   
933  O O   . ASP A 130 ? 0.8073 0.5898 0.8568 0.1217  0.1494  -0.0134 117 ASP A O   
934  C CB  . ASP A 130 ? 0.8733 0.6929 1.0010 0.1549  0.1333  0.0770  117 ASP A CB  
935  C CG  . ASP A 130 ? 0.9539 0.7822 1.1076 0.1617  0.1212  0.1226  117 ASP A CG  
936  O OD1 . ASP A 130 ? 1.0104 0.7884 1.1457 0.1392  0.1142  0.1248  117 ASP A OD1 
937  O OD2 . ASP A 130 ? 0.9555 0.8464 1.1440 0.1827  0.1174  0.1558  117 ASP A OD2 
938  N N   . GLY A 131 ? 0.6499 0.4711 0.6867 0.0549  0.1027  -0.0206 118 GLY A N   
939  C CA  . GLY A 131 ? 0.5776 0.3866 0.5767 0.0342  0.1055  -0.0595 118 GLY A CA  
940  C C   . GLY A 131 ? 0.4423 0.3122 0.4388 0.0333  0.0980  -0.0683 118 GLY A C   
941  O O   . GLY A 131 ? 0.3824 0.2554 0.3492 0.0053  0.0891  -0.0933 118 GLY A O   
942  N N   . ASP A 132 ? 0.3802 0.3021 0.4070 0.0595  0.0996  -0.0445 119 ASP A N   
943  C CA  . ASP A 132 ? 0.3672 0.3425 0.3887 0.0561  0.0938  -0.0489 119 ASP A CA  
944  C C   . ASP A 132 ? 0.2651 0.2744 0.2814 0.0251  0.0631  -0.0513 119 ASP A C   
945  O O   . ASP A 132 ? 0.2695 0.2950 0.2628 0.0098  0.0567  -0.0665 119 ASP A O   
946  C CB  . ASP A 132 ? 0.4035 0.4366 0.4633 0.0819  0.0968  -0.0154 119 ASP A CB  
947  C CG  . ASP A 132 ? 0.5629 0.5785 0.6396 0.1227  0.1312  -0.0068 119 ASP A CG  
948  O OD1 . ASP A 132 ? 0.6097 0.6182 0.6662 0.1378  0.1584  -0.0260 119 ASP A OD1 
949  O OD2 . ASP A 132 ? 0.6404 0.6508 0.7498 0.1419  0.1328  0.0211  119 ASP A OD2 
950  N N   . PHE A 133 ? 0.2168 0.2369 0.2530 0.0179  0.0460  -0.0343 120 PHE A N   
951  C CA  . PHE A 133 ? 0.1831 0.2307 0.2183 -0.0016 0.0232  -0.0347 120 PHE A CA  
952  C C   . PHE A 133 ? 0.2316 0.2667 0.2496 -0.0242 0.0191  -0.0570 120 PHE A C   
953  O O   . PHE A 133 ? 0.2049 0.2702 0.2188 -0.0357 0.0046  -0.0606 120 PHE A O   
954  C CB  . PHE A 133 ? 0.1704 0.2256 0.2219 -0.0022 0.0129  -0.0151 120 PHE A CB  
955  C CG  . PHE A 133 ? 0.1335 0.2167 0.1950 0.0051  0.0046  0.0084  120 PHE A CG  
956  C CD1 . PHE A 133 ? 0.1491 0.2428 0.2281 0.0213  0.0137  0.0281  120 PHE A CD1 
957  C CD2 . PHE A 133 ? 0.1583 0.2568 0.2117 -0.0051 -0.0121 0.0130  120 PHE A CD2 
958  C CE1 . PHE A 133 ? 0.1210 0.2533 0.2116 0.0198  0.0021  0.0544  120 PHE A CE1 
959  C CE2 . PHE A 133 ? 0.1500 0.2677 0.2041 -0.0088 -0.0227 0.0341  120 PHE A CE2 
960  C CZ  . PHE A 133 ? 0.1044 0.2457 0.1783 -0.0001 -0.0176 0.0559  120 PHE A CZ  
961  N N   . SER A 134 ? 0.2692 0.2616 0.2780 -0.0329 0.0300  -0.0677 121 SER A N   
962  C CA  . SER A 134 ? 0.2960 0.2800 0.2866 -0.0640 0.0239  -0.0866 121 SER A CA  
963  C C   . SER A 134 ? 0.3281 0.3139 0.2852 -0.0765 0.0234  -0.1075 121 SER A C   
964  O O   . SER A 134 ? 0.3416 0.3631 0.2930 -0.1012 0.0053  -0.1119 121 SER A O   
965  C CB  . SER A 134 ? 0.3625 0.2859 0.3406 -0.0766 0.0366  -0.0935 121 SER A CB  
966  O OG  . SER A 134 ? 0.3954 0.3226 0.3998 -0.0696 0.0356  -0.0708 121 SER A OG  
967  N N   . ALA A 135 ? 0.3300 0.2835 0.2654 -0.0584 0.0441  -0.1176 122 ALA A N   
968  C CA  . ALA A 135 ? 0.3769 0.3255 0.2679 -0.0708 0.0497  -0.1407 122 ALA A CA  
969  C C   . ALA A 135 ? 0.3284 0.3465 0.2279 -0.0734 0.0293  -0.1269 122 ALA A C   
970  O O   . ALA A 135 ? 0.3574 0.3918 0.2227 -0.0978 0.0197  -0.1393 122 ALA A O   
971  C CB  . ALA A 135 ? 0.4319 0.3341 0.3017 -0.0420 0.0845  -0.1528 122 ALA A CB  
972  N N   . ALA A 136 ? 0.2652 0.3195 0.2047 -0.0518 0.0211  -0.0996 123 ALA A N   
973  C CA  . ALA A 136 ? 0.2625 0.3676 0.2080 -0.0528 0.0026  -0.0829 123 ALA A CA  
974  C C   . ALA A 136 ? 0.2509 0.3872 0.2172 -0.0646 -0.0233 -0.0709 123 ALA A C   
975  O O   . ALA A 136 ? 0.2322 0.4002 0.2077 -0.0608 -0.0394 -0.0526 123 ALA A O   
976  C CB  . ALA A 136 ? 0.2295 0.3504 0.1993 -0.0296 0.0065  -0.0597 123 ALA A CB  
977  N N   . GLY A 137 ? 0.2380 0.3649 0.2131 -0.0774 -0.0253 -0.0787 124 GLY A N   
978  C CA  . GLY A 137 ? 0.2235 0.3876 0.2232 -0.0841 -0.0433 -0.0646 124 GLY A CA  
979  C C   . GLY A 137 ? 0.2248 0.3973 0.2603 -0.0683 -0.0432 -0.0520 124 GLY A C   
980  O O   . GLY A 137 ? 0.2214 0.4188 0.2788 -0.0609 -0.0505 -0.0369 124 GLY A O   
981  N N   . PHE A 138 ? 0.2049 0.3431 0.2415 -0.0560 -0.0291 -0.0529 125 PHE A N   
982  C CA  . PHE A 138 ? 0.1443 0.2826 0.2014 -0.0437 -0.0264 -0.0419 125 PHE A CA  
983  C C   . PHE A 138 ? 0.1776 0.3017 0.2399 -0.0565 -0.0163 -0.0468 125 PHE A C   
984  O O   . PHE A 138 ? 0.1915 0.2944 0.2401 -0.0746 -0.0119 -0.0589 125 PHE A O   
985  C CB  . PHE A 138 ? 0.1563 0.2735 0.2071 -0.0276 -0.0232 -0.0318 125 PHE A CB  
986  C CG  . PHE A 138 ? 0.1741 0.3015 0.2168 -0.0216 -0.0335 -0.0238 125 PHE A CG  
987  C CD1 . PHE A 138 ? 0.1447 0.2789 0.1906 -0.0139 -0.0438 -0.0143 125 PHE A CD1 
988  C CD2 . PHE A 138 ? 0.1385 0.2660 0.1688 -0.0228 -0.0301 -0.0245 125 PHE A CD2 
989  C CE1 . PHE A 138 ? 0.1535 0.2889 0.1883 -0.0122 -0.0547 -0.0030 125 PHE A CE1 
990  C CE2 . PHE A 138 ? 0.1820 0.3238 0.2034 -0.0225 -0.0396 -0.0133 125 PHE A CE2 
991  C CZ  . PHE A 138 ? 0.1694 0.3124 0.1920 -0.0197 -0.0540 -0.0013 125 PHE A CZ  
992  N N   . VAL A 139 ? 0.1551 0.2852 0.2305 -0.0498 -0.0115 -0.0379 126 VAL A N   
993  C CA  . VAL A 139 ? 0.1784 0.2993 0.2578 -0.0647 -0.0020 -0.0370 126 VAL A CA  
994  C C   . VAL A 139 ? 0.2212 0.3057 0.2891 -0.0562 0.0060  -0.0278 126 VAL A C   
995  O O   . VAL A 139 ? 0.1736 0.2617 0.2371 -0.0441 0.0056  -0.0196 126 VAL A O   
996  C CB  . VAL A 139 ? 0.1506 0.3169 0.2529 -0.0665 0.0013  -0.0305 126 VAL A CB  
997  C CG1 . VAL A 139 ? 0.2152 0.3740 0.3180 -0.0857 0.0123  -0.0254 126 VAL A CG1 
998  C CG2 . VAL A 139 ? 0.1396 0.3591 0.2642 -0.0757 -0.0097 -0.0306 126 VAL A CG2 
999  N N   . GLU A 140 ? 0.1693 0.2157 0.2290 -0.0636 0.0127  -0.0276 127 GLU A N   
1000 C CA  . GLU A 140 ? 0.1939 0.2142 0.2497 -0.0561 0.0184  -0.0101 127 GLU A CA  
1001 C C   . GLU A 140 ? 0.2026 0.2270 0.2591 -0.0736 0.0233  -0.0007 127 GLU A C   
1002 O O   . GLU A 140 ? 0.2292 0.2294 0.2837 -0.0925 0.0287  -0.0008 127 GLU A O   
1003 C CB  . GLU A 140 ? 0.2678 0.2419 0.3187 -0.0474 0.0270  -0.0089 127 GLU A CB  
1004 C CG  . GLU A 140 ? 0.2846 0.2663 0.3361 -0.0270 0.0268  -0.0132 127 GLU A CG  
1005 C CD  . GLU A 140 ? 0.3857 0.3236 0.4333 -0.0103 0.0435  -0.0144 127 GLU A CD  
1006 O OE1 . GLU A 140 ? 0.3783 0.2772 0.4284 -0.0053 0.0526  -0.0006 127 GLU A OE1 
1007 O OE2 . GLU A 140 ? 0.4811 0.4218 0.5214 0.0001  0.0497  -0.0277 127 GLU A OE2 
1008 N N   . VAL A 141 ? 0.2126 0.2637 0.2655 -0.0700 0.0230  0.0064  128 VAL A N   
1009 C CA  . VAL A 141 ? 0.2376 0.3059 0.2880 -0.0855 0.0319  0.0140  128 VAL A CA  
1010 C C   . VAL A 141 ? 0.2358 0.2713 0.2769 -0.0990 0.0351  0.0346  128 VAL A C   
1011 O O   . VAL A 141 ? 0.2412 0.2519 0.2749 -0.0882 0.0301  0.0506  128 VAL A O   
1012 C CB  . VAL A 141 ? 0.2493 0.3373 0.2824 -0.0758 0.0355  0.0140  128 VAL A CB  
1013 C CG1 . VAL A 141 ? 0.2266 0.3347 0.2504 -0.0907 0.0504  0.0216  128 VAL A CG1 
1014 C CG2 . VAL A 141 ? 0.2459 0.3562 0.2890 -0.0587 0.0346  -0.0027 128 VAL A CG2 
1015 N N   . ARG A 142 ? 0.2533 0.2933 0.2984 -0.1237 0.0426  0.0389  129 ARG A N   
1016 C CA  . ARG A 142 ? 0.3006 0.3057 0.3344 -0.1404 0.0459  0.0630  129 ARG A CA  
1017 C C   . ARG A 142 ? 0.3488 0.3939 0.3759 -0.1623 0.0561  0.0746  129 ARG A C   
1018 O O   . ARG A 142 ? 0.3554 0.4533 0.3959 -0.1658 0.0638  0.0611  129 ARG A O   
1019 C CB  . ARG A 142 ? 0.3589 0.3122 0.3949 -0.1574 0.0467  0.0591  129 ARG A CB  
1020 C CG  . ARG A 142 ? 0.3554 0.2627 0.3904 -0.1336 0.0441  0.0457  129 ARG A CG  
1021 C CD  . ARG A 142 ? 0.3615 0.2368 0.3954 -0.1058 0.0441  0.0706  129 ARG A CD  
1022 N NE  . ARG A 142 ? 0.3673 0.2116 0.4057 -0.0777 0.0477  0.0589  129 ARG A NE  
1023 C CZ  . ARG A 142 ? 0.3282 0.2091 0.3769 -0.0538 0.0425  0.0543  129 ARG A CZ  
1024 N NH1 . ARG A 142 ? 0.2995 0.2357 0.3498 -0.0559 0.0320  0.0580  129 ARG A NH1 
1025 N NH2 . ARG A 142 ? 0.3360 0.1942 0.3889 -0.0294 0.0501  0.0453  129 ARG A NH2 
1026 N N   . PRO A 143 ? 0.3608 0.3856 0.3690 -0.1701 0.0567  0.1007  130 PRO A N   
1027 C CA  . PRO A 143 ? 0.3849 0.4420 0.3836 -0.1843 0.0666  0.1079  130 PRO A CA  
1028 C C   . PRO A 143 ? 0.4174 0.4856 0.4372 -0.2057 0.0710  0.1029  130 PRO A C   
1029 O O   . PRO A 143 ? 0.4905 0.6123 0.5175 -0.2127 0.0815  0.1000  130 PRO A O   
1030 C CB  . PRO A 143 ? 0.4415 0.4638 0.4173 -0.1869 0.0609  0.1376  130 PRO A CB  
1031 C CG  . PRO A 143 ? 0.4028 0.3996 0.3755 -0.1655 0.0481  0.1453  130 PRO A CG  
1032 C CD  . PRO A 143 ? 0.3927 0.3732 0.3899 -0.1583 0.0472  0.1260  130 PRO A CD  
1033 N N   . ALA B 13  ? 0.5513 0.5360 0.5633 -0.2535 0.0975  0.0311  0   ALA B N   
1034 C CA  . ALA B 13  ? 0.6780 0.5670 0.6131 -0.2678 0.0773  0.0598  0   ALA B CA  
1035 C C   . ALA B 13  ? 0.6926 0.5387 0.5878 -0.2350 0.0550  0.0694  0   ALA B C   
1036 O O   . ALA B 13  ? 0.7679 0.5647 0.5978 -0.2362 0.0473  0.0873  0   ALA B O   
1037 C CB  . ALA B 13  ? 0.7562 0.5924 0.6999 -0.2827 0.0501  0.0634  0   ALA B CB  
1038 N N   . SER B 14  ? 0.5326 0.3991 0.4668 -0.2074 0.0422  0.0552  1   SER B N   
1039 C CA  . SER B 14  ? 0.5160 0.3532 0.4251 -0.1709 0.0200  0.0582  1   SER B CA  
1040 C C   . SER B 14  ? 0.3881 0.3063 0.3473 -0.1343 0.0335  0.0385  1   SER B C   
1041 O O   . SER B 14  ? 0.3081 0.2862 0.3213 -0.1325 0.0441  0.0218  1   SER B O   
1042 C CB  . SER B 14  ? 0.5580 0.3382 0.4661 -0.1463 -0.0257 0.0512  1   SER B CB  
1043 O OG  . SER B 14  ? 0.5711 0.3976 0.5379 -0.1346 -0.0298 0.0268  1   SER B OG  
1044 N N   . ILE B 15  ? 0.3206 0.2335 0.2594 -0.1067 0.0280  0.0410  2   ILE B N   
1045 C CA  . ILE B 15  ? 0.2490 0.2199 0.2244 -0.0767 0.0350  0.0276  2   ILE B CA  
1046 C C   . ILE B 15  ? 0.2352 0.1914 0.2036 -0.0451 0.0124  0.0216  2   ILE B C   
1047 O O   . ILE B 15  ? 0.2870 0.1916 0.2232 -0.0396 -0.0085 0.0255  2   ILE B O   
1048 C CB  . ILE B 15  ? 0.3195 0.3211 0.2924 -0.0802 0.0601  0.0288  2   ILE B CB  
1049 C CG1 . ILE B 15  ? 0.3566 0.3091 0.2692 -0.0843 0.0563  0.0428  2   ILE B CG1 
1050 C CG2 . ILE B 15  ? 0.2983 0.3421 0.2984 -0.1084 0.0873  0.0203  2   ILE B CG2 
1051 C CD1 . ILE B 15  ? 0.2976 0.2808 0.2068 -0.0800 0.0761  0.0371  2   ILE B CD1 
1052 N N   . PHE B 16  ? 0.1858 0.1875 0.1843 -0.0265 0.0144  0.0101  3   PHE B N   
1053 C CA  . PHE B 16  ? 0.1916 0.2013 0.1907 -0.0045 0.0045  -0.0004 3   PHE B CA  
1054 C C   . PHE B 16  ? 0.1916 0.2254 0.1940 -0.0008 0.0189  0.0057  3   PHE B C   
1055 O O   . PHE B 16  ? 0.1586 0.2173 0.1761 -0.0053 0.0295  0.0103  3   PHE B O   
1056 C CB  . PHE B 16  ? 0.1700 0.2106 0.1880 0.0043  -0.0018 -0.0184 3   PHE B CB  
1057 C CG  . PHE B 16  ? 0.1449 0.2111 0.1689 0.0189  -0.0036 -0.0363 3   PHE B CG  
1058 C CD1 . PHE B 16  ? 0.1328 0.2324 0.1577 0.0145  0.0120  -0.0305 3   PHE B CD1 
1059 C CD2 . PHE B 16  ? 0.1661 0.2232 0.1993 0.0351  -0.0230 -0.0623 3   PHE B CD2 
1060 C CE1 . PHE B 16  ? 0.1187 0.2511 0.1529 0.0183  0.0165  -0.0493 3   PHE B CE1 
1061 C CE2 . PHE B 16  ? 0.1815 0.2803 0.2345 0.0467  -0.0210 -0.0891 3   PHE B CE2 
1062 C CZ  . PHE B 16  ? 0.1450 0.2857 0.1980 0.0343  0.0030  -0.0819 3   PHE B CZ  
1063 N N   . VAL B 17  ? 0.1671 0.1902 0.1597 0.0093  0.0132  0.0025  4   VAL B N   
1064 C CA  . VAL B 17  ? 0.1308 0.1685 0.1269 0.0108  0.0235  0.0069  4   VAL B CA  
1065 C C   . VAL B 17  ? 0.1099 0.1785 0.1249 0.0153  0.0243  -0.0020 4   VAL B C   
1066 O O   . VAL B 17  ? 0.1385 0.2169 0.1622 0.0232  0.0162  -0.0192 4   VAL B O   
1067 C CB  . VAL B 17  ? 0.2110 0.2175 0.1802 0.0141  0.0171  0.0089  4   VAL B CB  
1068 C CG1 . VAL B 17  ? 0.1875 0.2102 0.1648 0.0159  0.0267  0.0085  4   VAL B CG1 
1069 C CG2 . VAL B 17  ? 0.2459 0.2178 0.1792 -0.0022 0.0204  0.0213  4   VAL B CG2 
1070 N N   . ASP B 18  ? 0.1275 0.2103 0.1495 0.0081  0.0323  0.0076  5   ASP B N   
1071 C CA  . ASP B 18  ? 0.1136 0.2173 0.1398 -0.0007 0.0357  0.0074  5   ASP B CA  
1072 C C   . ASP B 18  ? 0.1512 0.2508 0.1858 -0.0018 0.0359  0.0066  5   ASP B C   
1073 O O   . ASP B 18  ? 0.1481 0.2282 0.1824 0.0069  0.0324  0.0077  5   ASP B O   
1074 C CB  . ASP B 18  ? 0.1306 0.2324 0.1474 -0.0107 0.0335  0.0234  5   ASP B CB  
1075 C CG  . ASP B 18  ? 0.1865 0.2953 0.1877 -0.0308 0.0365  0.0321  5   ASP B CG  
1076 O OD1 . ASP B 18  ? 0.1904 0.3313 0.1879 -0.0418 0.0483  0.0183  5   ASP B OD1 
1077 O OD2 . ASP B 18  ? 0.1746 0.2564 0.1675 -0.0378 0.0261  0.0503  5   ASP B OD2 
1078 N N   . THR B 19  ? 0.1050 0.2274 0.1464 -0.0164 0.0418  0.0014  6   THR B N   
1079 C CA  . THR B 19  ? 0.1384 0.2591 0.1932 -0.0247 0.0413  -0.0001 6   THR B CA  
1080 C C   . THR B 19  ? 0.1642 0.2472 0.2141 -0.0237 0.0317  0.0172  6   THR B C   
1081 O O   . THR B 19  ? 0.1776 0.2486 0.2396 -0.0159 0.0252  0.0093  6   THR B O   
1082 C CB  . THR B 19  ? 0.1434 0.2966 0.2007 -0.0554 0.0552  -0.0027 6   THR B CB  
1083 O OG1 . THR B 19  ? 0.1885 0.3808 0.2579 -0.0499 0.0615  -0.0300 6   THR B OG1 
1084 C CG2 . THR B 19  ? 0.1733 0.3278 0.2525 -0.0701 0.0549  -0.0078 6   THR B CG2 
1085 N N   . SER B 20  ? 0.1432 0.2076 0.1782 -0.0281 0.0258  0.0355  7   SER B N   
1086 C CA  . SER B 20  ? 0.1591 0.1881 0.2002 -0.0211 0.0086  0.0438  7   SER B CA  
1087 C C   . SER B 20  ? 0.1894 0.2210 0.2480 0.0032  0.0093  0.0255  7   SER B C   
1088 O O   . SER B 20  ? 0.1671 0.1823 0.2404 0.0120  -0.0009 0.0168  7   SER B O   
1089 C CB  . SER B 20  ? 0.1856 0.1943 0.2123 -0.0227 -0.0073 0.0607  7   SER B CB  
1090 O OG  . SER B 20  ? 0.1844 0.2168 0.2123 -0.0120 -0.0004 0.0541  7   SER B OG  
1091 N N   . PHE B 21  ? 0.1607 0.2109 0.2130 0.0104  0.0212  0.0185  8   PHE B N   
1092 C CA  . PHE B 21  ? 0.1500 0.2026 0.2020 0.0221  0.0276  0.0045  8   PHE B CA  
1093 C C   . PHE B 21  ? 0.1397 0.1856 0.1785 0.0256  0.0269  -0.0052 8   PHE B C   
1094 O O   . PHE B 21  ? 0.1550 0.1960 0.1922 0.0331  0.0259  -0.0182 8   PHE B O   
1095 C CB  . PHE B 21  ? 0.1731 0.2363 0.2139 0.0193  0.0385  0.0054  8   PHE B CB  
1096 C CG  . PHE B 21  ? 0.1804 0.2474 0.2087 0.0188  0.0513  -0.0059 8   PHE B CG  
1097 C CD1 . PHE B 21  ? 0.1743 0.2657 0.2286 0.0207  0.0597  -0.0210 8   PHE B CD1 
1098 C CD2 . PHE B 21  ? 0.2072 0.2547 0.1956 0.0151  0.0529  -0.0046 8   PHE B CD2 
1099 C CE1 . PHE B 21  ? 0.2080 0.3154 0.2472 0.0122  0.0798  -0.0362 8   PHE B CE1 
1100 C CE2 . PHE B 21  ? 0.2544 0.3008 0.2121 0.0058  0.0671  -0.0112 8   PHE B CE2 
1101 C CZ  . PHE B 21  ? 0.2288 0.3109 0.2111 0.0010  0.0857  -0.0278 8   PHE B CZ  
1102 N N   . TRP B 22  ? 0.1341 0.1833 0.1663 0.0228  0.0242  -0.0050 9   TRP B N   
1103 C CA  . TRP B 22  ? 0.1383 0.1806 0.1633 0.0304  0.0139  -0.0183 9   TRP B CA  
1104 C C   . TRP B 22  ? 0.1456 0.1863 0.1910 0.0298  0.0071  -0.0272 9   TRP B C   
1105 O O   . TRP B 22  ? 0.1754 0.2049 0.2095 0.0395  -0.0018 -0.0405 9   TRP B O   
1106 C CB  . TRP B 22  ? 0.1426 0.2001 0.1796 0.0317  0.0064  -0.0275 9   TRP B CB  
1107 C CG  . TRP B 22  ? 0.1481 0.1942 0.1659 0.0386  0.0004  -0.0268 9   TRP B CG  
1108 C CD1 . TRP B 22  ? 0.1507 0.2178 0.1855 0.0380  0.0008  -0.0340 9   TRP B CD1 
1109 C CD2 . TRP B 22  ? 0.2073 0.2130 0.1812 0.0440  -0.0099 -0.0199 9   TRP B CD2 
1110 N NE1 . TRP B 22  ? 0.2234 0.2607 0.2356 0.0470  -0.0134 -0.0335 9   TRP B NE1 
1111 C CE2 . TRP B 22  ? 0.2371 0.2313 0.2071 0.0474  -0.0204 -0.0207 9   TRP B CE2 
1112 C CE3 . TRP B 22  ? 0.2491 0.2254 0.1801 0.0422  -0.0107 -0.0138 9   TRP B CE3 
1113 C CZ2 . TRP B 22  ? 0.2466 0.1887 0.1695 0.0461  -0.0356 -0.0095 9   TRP B CZ2 
1114 C CZ3 . TRP B 22  ? 0.3071 0.2390 0.1831 0.0364  -0.0195 -0.0017 9   TRP B CZ3 
1115 C CH2 . TRP B 22  ? 0.3178 0.2269 0.1892 0.0371  -0.0338 0.0034  9   TRP B CH2 
1116 N N   . ALA B 23  ? 0.1893 0.2350 0.2579 0.0154  0.0086  -0.0189 10  ALA B N   
1117 C CA  . ALA B 23  ? 0.1923 0.2259 0.2816 0.0081  -0.0017 -0.0240 10  ALA B CA  
1118 C C   . ALA B 23  ? 0.1981 0.2091 0.2876 0.0235  -0.0105 -0.0325 10  ALA B C   
1119 O O   . ALA B 23  ? 0.2072 0.2076 0.3074 0.0292  -0.0225 -0.0496 10  ALA B O   
1120 C CB  . ALA B 23  ? 0.2538 0.2832 0.3511 -0.0194 0.0001  -0.0054 10  ALA B CB  
1121 N N   . ALA B 24  ? 0.1617 0.1721 0.2465 0.0313  -0.0056 -0.0274 11  ALA B N   
1122 C CA  . ALA B 24  ? 0.1769 0.1834 0.2737 0.0486  -0.0109 -0.0478 11  ALA B CA  
1123 C C   . ALA B 24  ? 0.2004 0.2221 0.2708 0.0579  0.0008  -0.0687 11  ALA B C   
1124 O O   . ALA B 24  ? 0.2066 0.2283 0.2826 0.0697  -0.0046 -0.0949 11  ALA B O   
1125 C CB  . ALA B 24  ? 0.1741 0.1900 0.2844 0.0545  -0.0089 -0.0453 11  ALA B CB  
1126 N N   . LEU B 25  ? 0.1854 0.2143 0.2207 0.0513  0.0136  -0.0578 12  LEU B N   
1127 C CA  . LEU B 25  ? 0.2469 0.2749 0.2351 0.0529  0.0211  -0.0688 12  LEU B CA  
1128 C C   . LEU B 25  ? 0.2504 0.2616 0.2244 0.0602  0.0015  -0.0808 12  LEU B C   
1129 O O   . LEU B 25  ? 0.2982 0.3059 0.2393 0.0655  0.0005  -0.0998 12  LEU B O   
1130 C CB  . LEU B 25  ? 0.2592 0.2799 0.2077 0.0414  0.0303  -0.0489 12  LEU B CB  
1131 C CG  . LEU B 25  ? 0.2803 0.2870 0.1607 0.0319  0.0392  -0.0506 12  LEU B CG  
1132 C CD1 . LEU B 25  ? 0.2938 0.3357 0.1767 0.0238  0.0673  -0.0700 12  LEU B CD1 
1133 C CD2 . LEU B 25  ? 0.3447 0.3232 0.1852 0.0189  0.0366  -0.0260 12  LEU B CD2 
1134 N N   . GLY B 26  ? 0.2397 0.2593 0.2905 0.0478  -0.0163 -0.0729 13  GLY B N   
1135 C CA  . GLY B 26  ? 0.2381 0.2829 0.3192 0.0575  -0.0318 -0.0939 13  GLY B CA  
1136 C C   . GLY B 26  ? 0.2164 0.2584 0.3331 0.0478  -0.0520 -0.1174 13  GLY B C   
1137 O O   . GLY B 26  ? 0.2151 0.2794 0.3759 0.0492  -0.0721 -0.1391 13  GLY B O   
1138 N N   . ASN B 27  ? 0.2227 0.2370 0.3277 0.0380  -0.0487 -0.1133 14  ASN B N   
1139 C CA  . ASN B 27  ? 0.2594 0.2578 0.3989 0.0288  -0.0653 -0.1342 14  ASN B CA  
1140 C C   . ASN B 27  ? 0.3160 0.2928 0.4100 0.0488  -0.0747 -0.1393 14  ASN B C   
1141 O O   . ASN B 27  ? 0.2600 0.2188 0.3308 0.0436  -0.0564 -0.1164 14  ASN B O   
1142 C CB  . ASN B 27  ? 0.2290 0.2082 0.4093 -0.0014 -0.0412 -0.1168 14  ASN B CB  
1143 C CG  . ASN B 27  ? 0.3326 0.2854 0.5575 -0.0132 -0.0515 -0.1314 14  ASN B CG  
1144 O OD1 . ASN B 27  ? 0.3400 0.2922 0.5758 -0.0028 -0.0834 -0.1615 14  ASN B OD1 
1145 N ND2 . ASN B 27  ? 0.3626 0.2915 0.6067 -0.0304 -0.0229 -0.1062 14  ASN B ND2 
1146 N N   . ALA B 28  ? 0.3642 0.3438 0.4418 0.0770  -0.1048 -0.1697 15  ALA B N   
1147 C CA  . ALA B 28  ? 0.4270 0.3891 0.4518 0.1057  -0.1091 -0.1686 15  ALA B CA  
1148 C C   . ALA B 28  ? 0.4524 0.3760 0.4953 0.0875  -0.1053 -0.1694 15  ALA B C   
1149 O O   . ALA B 28  ? 0.4903 0.3949 0.4916 0.1075  -0.0986 -0.1605 15  ALA B O   
1150 C CB  . ALA B 28  ? 0.4801 0.4580 0.4788 0.1413  -0.1393 -0.1894 15  ALA B CB  
1151 N N   . GLY B 29  ? 0.4055 0.3197 0.5140 0.0528  -0.1046 -0.1745 16  GLY B N   
1152 C CA  . GLY B 29  ? 0.4043 0.2803 0.5368 0.0360  -0.0947 -0.1692 16  GLY B CA  
1153 C C   . GLY B 29  ? 0.4210 0.2793 0.5555 0.0203  -0.0609 -0.1373 16  GLY B C   
1154 O O   . GLY B 29  ? 0.5042 0.3303 0.6560 0.0102  -0.0458 -0.1243 16  GLY B O   
1155 N N   . ASP B 30  ? 0.3581 0.2467 0.4664 0.0199  -0.0457 -0.1141 17  ASP B N   
1156 C CA  . ASP B 30  ? 0.2771 0.1629 0.3667 0.0101  -0.0179 -0.0777 17  ASP B CA  
1157 C C   . ASP B 30  ? 0.3246 0.2020 0.3700 0.0296  -0.0160 -0.0630 17  ASP B C   
1158 O O   . ASP B 30  ? 0.3425 0.2334 0.3590 0.0531  -0.0268 -0.0684 17  ASP B O   
1159 C CB  . ASP B 30  ? 0.2452 0.1592 0.3191 0.0051  -0.0098 -0.0647 17  ASP B CB  
1160 C CG  . ASP B 30  ? 0.3205 0.2259 0.3728 -0.0033 0.0108  -0.0369 17  ASP B CG  
1161 O OD1 . ASP B 30  ? 0.2966 0.2006 0.3163 0.0046  0.0094  -0.0222 17  ASP B OD1 
1162 O OD2 . ASP B 30  ? 0.3489 0.2513 0.4152 -0.0132 0.0275  -0.0293 17  ASP B OD2 
1163 N N   . ALA B 31  ? 0.3348 0.1933 0.3758 0.0251  0.0010  -0.0397 18  ALA B N   
1164 C CA  . ALA B 31  ? 0.3673 0.2232 0.3760 0.0450  0.0034  -0.0218 18  ALA B CA  
1165 C C   . ALA B 31  ? 0.3152 0.2105 0.3006 0.0531  -0.0013 -0.0055 18  ALA B C   
1166 O O   . ALA B 31  ? 0.3553 0.2628 0.3266 0.0749  -0.0020 0.0070  18  ALA B O   
1167 C CB  . ALA B 31  ? 0.3708 0.2051 0.3778 0.0418  0.0224  0.0041  18  ALA B CB  
1168 N N   . ARG B 32  ? 0.3060 0.2193 0.2944 0.0366  -0.0024 -0.0039 19  ARG B N   
1169 C CA  . ARG B 32  ? 0.2918 0.2357 0.2747 0.0375  -0.0084 0.0107  19  ARG B CA  
1170 C C   . ARG B 32  ? 0.2744 0.2363 0.2636 0.0450  -0.0118 0.0011  19  ARG B C   
1171 O O   . ARG B 32  ? 0.2617 0.2432 0.2591 0.0411  -0.0129 0.0134  19  ARG B O   
1172 C CB  . ARG B 32  ? 0.3291 0.2714 0.3033 0.0194  -0.0105 0.0170  19  ARG B CB  
1173 C CG  . ARG B 32  ? 0.4403 0.3721 0.3958 0.0225  -0.0090 0.0328  19  ARG B CG  
1174 C CD  . ARG B 32  ? 0.5180 0.4489 0.4486 0.0150  -0.0197 0.0346  19  ARG B CD  
1175 N NE  . ARG B 32  ? 0.5789 0.4843 0.4894 0.0115  -0.0042 0.0262  19  ARG B NE  
1176 C CZ  . ARG B 32  ? 0.6169 0.5033 0.4884 0.0219  0.0047  0.0358  19  ARG B CZ  
1177 N NH1 . ARG B 32  ? 0.7063 0.5966 0.5515 0.0356  -0.0065 0.0502  19  ARG B NH1 
1178 N NH2 . ARG B 32  ? 0.6192 0.4857 0.4768 0.0242  0.0267  0.0347  19  ARG B NH2 
1179 N N   . HIS B 33  ? 0.2280 0.2635 0.2312 0.0975  -0.0732 0.0029  20  HIS B N   
1180 C CA  . HIS B 33  ? 0.2274 0.2598 0.1857 0.0969  -0.0412 -0.0106 20  HIS B CA  
1181 C C   . HIS B 33  ? 0.2335 0.2873 0.2167 0.1006  -0.0105 -0.0278 20  HIS B C   
1182 O O   . HIS B 33  ? 0.2318 0.2918 0.1867 0.0898  0.0079  -0.0249 20  HIS B O   
1183 C CB  . HIS B 33  ? 0.2477 0.2537 0.1729 0.1017  -0.0394 -0.0206 20  HIS B CB  
1184 C CG  . HIS B 33  ? 0.3166 0.3179 0.1898 0.0953  -0.0175 -0.0260 20  HIS B CG  
1185 N ND1 . HIS B 33  ? 0.2971 0.2980 0.1392 0.0860  -0.0201 -0.0089 20  HIS B ND1 
1186 C CD2 . HIS B 33  ? 0.3194 0.3154 0.1667 0.0932  0.0050  -0.0451 20  HIS B CD2 
1187 C CE1 . HIS B 33  ? 0.2992 0.2925 0.1149 0.0759  -0.0075 -0.0086 20  HIS B CE1 
1188 N NE2 . HIS B 33  ? 0.3480 0.3387 0.1444 0.0798  0.0080  -0.0303 20  HIS B NE2 
1189 N N   . GLY B 34  ? 0.2466 0.3116 0.2896 0.1146  -0.0039 -0.0465 21  GLY B N   
1190 C CA  . GLY B 34  ? 0.2644 0.3595 0.3427 0.1153  0.0314  -0.0683 21  GLY B CA  
1191 C C   . GLY B 34  ? 0.2404 0.3665 0.3463 0.1039  0.0286  -0.0533 21  GLY B C   
1192 O O   . GLY B 34  ? 0.2419 0.3826 0.3298 0.0902  0.0576  -0.0579 21  GLY B O   
1193 N N   . THR B 35  ? 0.2368 0.3703 0.3805 0.1040  -0.0093 -0.0331 22  THR B N   
1194 C CA  . THR B 35  ? 0.2057 0.3670 0.3704 0.0873  -0.0192 -0.0193 22  THR B CA  
1195 C C   . THR B 35  ? 0.2037 0.3482 0.2931 0.0669  -0.0069 -0.0118 22  THR B C   
1196 O O   . THR B 35  ? 0.2035 0.3645 0.2989 0.0520  0.0086  -0.0131 22  THR B O   
1197 C CB  . THR B 35  ? 0.2269 0.3934 0.4238 0.0818  -0.0697 0.0055  22  THR B CB  
1198 O OG1 . THR B 35  ? 0.2545 0.4349 0.5445 0.1037  -0.0876 0.0030  22  THR B OG1 
1199 C CG2 . THR B 35  ? 0.2425 0.4367 0.4473 0.0565  -0.0820 0.0172  22  THR B CG2 
1200 N N   . ALA B 36  ? 0.2185 0.3300 0.2475 0.0663  -0.0143 -0.0050 23  ALA B N   
1201 C CA  . ALA B 36  ? 0.2298 0.3224 0.2059 0.0530  -0.0037 -0.0006 23  ALA B CA  
1202 C C   . ALA B 36  ? 0.2389 0.3250 0.1963 0.0511  0.0272  -0.0054 23  ALA B C   
1203 O O   . ALA B 36  ? 0.2319 0.3129 0.1805 0.0368  0.0373  -0.0009 23  ALA B O   
1204 C CB  . ALA B 36  ? 0.2272 0.2945 0.1618 0.0558  -0.0157 0.0049  23  ALA B CB  
1205 N N   . LYS B 37  ? 0.2535 0.3363 0.2003 0.0606  0.0414  -0.0143 24  LYS B N   
1206 C CA  . LYS B 37  ? 0.2706 0.3464 0.1820 0.0493  0.0687  -0.0147 24  LYS B CA  
1207 C C   . LYS B 37  ? 0.2840 0.3891 0.2294 0.0347  0.0925  -0.0202 24  LYS B C   
1208 O O   . LYS B 37  ? 0.3069 0.4011 0.2227 0.0153  0.1071  -0.0087 24  LYS B O   
1209 C CB  . LYS B 37  ? 0.3207 0.3906 0.2043 0.0541  0.0818  -0.0299 24  LYS B CB  
1210 C CG  . LYS B 37  ? 0.3985 0.4370 0.2350 0.0595  0.0599  -0.0201 24  LYS B CG  
1211 C CD  . LYS B 37  ? 0.5155 0.5429 0.3041 0.0501  0.0739  -0.0330 24  LYS B CD  
1212 C CE  . LYS B 37  ? 0.5386 0.5835 0.3632 0.0610  0.0948  -0.0696 24  LYS B CE  
1213 N NZ  . LYS B 37  ? 0.6251 0.6502 0.4009 0.0419  0.1099  -0.0881 24  LYS B NZ  
1214 N N   . ARG B 38  ? 0.2662 0.4085 0.2808 0.0425  0.0932  -0.0348 25  ARG B N   
1215 C CA  . ARG B 38  ? 0.2635 0.4449 0.3278 0.0279  0.1148  -0.0417 25  ARG B CA  
1216 C C   . ARG B 38  ? 0.2552 0.4300 0.3160 0.0092  0.1007  -0.0240 25  ARG B C   
1217 O O   . ARG B 38  ? 0.2772 0.4570 0.3338 -0.0135 0.1217  -0.0202 25  ARG B O   
1218 C CB  . ARG B 38  ? 0.2701 0.4970 0.4313 0.0443  0.1103  -0.0592 25  ARG B CB  
1219 C CG  . ARG B 38  ? 0.3930 0.6296 0.5769 0.0610  0.1366  -0.0892 25  ARG B CG  
1220 C CD  . ARG B 38  ? 0.4600 0.7484 0.7689 0.0779  0.1392  -0.1102 25  ARG B CD  
1221 N NE  . ARG B 38  ? 0.5077 0.7937 0.8715 0.0955  0.0847  -0.0902 25  ARG B NE  
1222 C CZ  . ARG B 38  ? 0.5683 0.8277 0.9466 0.1186  0.0596  -0.0911 25  ARG B CZ  
1223 N NH1 . ARG B 38  ? 0.5984 0.8294 0.9388 0.1276  0.0851  -0.1148 25  ARG B NH1 
1224 N NH2 . ARG B 38  ? 0.5874 0.8435 1.0080 0.1259  0.0058  -0.0645 25  ARG B NH2 
1225 N N   . LEU B 39  ? 0.2329 0.3943 0.2915 0.0139  0.0672  -0.0154 26  LEU B N   
1226 C CA  . LEU B 39  ? 0.2608 0.4111 0.3097 -0.0067 0.0563  -0.0078 26  LEU B CA  
1227 C C   . LEU B 39  ? 0.3134 0.4186 0.3095 -0.0156 0.0703  0.0004  26  LEU B C   
1228 O O   . LEU B 39  ? 0.3011 0.3960 0.2997 -0.0365 0.0780  0.0033  26  LEU B O   
1229 C CB  . LEU B 39  ? 0.2680 0.4129 0.3099 -0.0063 0.0228  -0.0050 26  LEU B CB  
1230 C CG  . LEU B 39  ? 0.2335 0.4187 0.3312 -0.0093 -0.0059 -0.0018 26  LEU B CG  
1231 C CD1 . LEU B 39  ? 0.2678 0.4410 0.3357 -0.0152 -0.0401 0.0072  26  LEU B CD1 
1232 C CD2 . LEU B 39  ? 0.2240 0.4380 0.3582 -0.0352 -0.0063 -0.0033 26  LEU B CD2 
1233 N N   . TRP B 40  ? 0.3117 0.3885 0.2672 -0.0005 0.0692  0.0061  27  TRP B N   
1234 C CA  . TRP B 40  ? 0.2902 0.3239 0.2082 -0.0053 0.0731  0.0205  27  TRP B CA  
1235 C C   . TRP B 40  ? 0.3506 0.3797 0.2562 -0.0260 0.0948  0.0326  27  TRP B C   
1236 O O   . TRP B 40  ? 0.3989 0.3927 0.2942 -0.0402 0.0947  0.0483  27  TRP B O   
1237 C CB  . TRP B 40  ? 0.3109 0.3254 0.1953 0.0127  0.0625  0.0271  27  TRP B CB  
1238 C CG  . TRP B 40  ? 0.3722 0.3451 0.2374 0.0125  0.0543  0.0455  27  TRP B CG  
1239 C CD1 . TRP B 40  ? 0.4608 0.4108 0.2897 0.0078  0.0512  0.0682  27  TRP B CD1 
1240 C CD2 . TRP B 40  ? 0.4013 0.3509 0.2902 0.0158  0.0460  0.0424  27  TRP B CD2 
1241 N NE1 . TRP B 40  ? 0.4799 0.3931 0.3199 0.0120  0.0347  0.0856  27  TRP B NE1 
1242 C CE2 . TRP B 40  ? 0.4325 0.3453 0.3155 0.0194  0.0357  0.0655  27  TRP B CE2 
1243 C CE3 . TRP B 40  ? 0.3620 0.3187 0.2763 0.0127  0.0468  0.0202  27  TRP B CE3 
1244 C CZ2 . TRP B 40  ? 0.4506 0.3344 0.3720 0.0273  0.0287  0.0635  27  TRP B CZ2 
1245 C CZ3 . TRP B 40  ? 0.4124 0.3409 0.3494 0.0153  0.0469  0.0119  27  TRP B CZ3 
1246 C CH2 . TRP B 40  ? 0.4522 0.3450 0.4022 0.0261  0.0392  0.0317  27  TRP B CH2 
1247 N N   . ALA B 41  ? 0.3376 0.4015 0.2480 -0.0303 0.1151  0.0239  28  ALA B N   
1248 C CA  . ALA B 41  ? 0.3984 0.4660 0.2877 -0.0581 0.1428  0.0330  28  ALA B CA  
1249 C C   . ALA B 41  ? 0.3933 0.4777 0.3241 -0.0820 0.1535  0.0330  28  ALA B C   
1250 O O   . ALA B 41  ? 0.4578 0.5296 0.3665 -0.1122 0.1706  0.0495  28  ALA B O   
1251 C CB  . ALA B 41  ? 0.3994 0.5054 0.2857 -0.0580 0.1706  0.0123  28  ALA B CB  
1252 N N   . SER B 42  ? 0.3702 0.4820 0.3571 -0.0739 0.1401  0.0176  29  SER B N   
1253 C CA  . SER B 42  ? 0.4013 0.5350 0.4321 -0.0999 0.1460  0.0152  29  SER B CA  
1254 C C   . SER B 42  ? 0.4127 0.5076 0.4408 -0.1072 0.1230  0.0174  29  SER B C   
1255 O O   . SER B 42  ? 0.3645 0.4767 0.4284 -0.1289 0.1194  0.0103  29  SER B O   
1256 C CB  . SER B 42  ? 0.3551 0.5580 0.4613 -0.0940 0.1458  -0.0043 29  SER B CB  
1257 O OG  . SER B 42  ? 0.3301 0.5360 0.4516 -0.0715 0.1118  -0.0097 29  SER B OG  
1258 N N   . LYS B 43  ? 0.3629 0.4080 0.3532 -0.0911 0.1094  0.0234  30  LYS B N   
1259 C CA  . LYS B 43  ? 0.3737 0.3815 0.3658 -0.0963 0.0957  0.0149  30  LYS B CA  
1260 C C   . LYS B 43  ? 0.4436 0.4112 0.4410 -0.1242 0.1049  0.0242  30  LYS B C   
1261 O O   . LYS B 43  ? 0.4588 0.4125 0.4412 -0.1368 0.1175  0.0481  30  LYS B O   
1262 C CB  . LYS B 43  ? 0.3876 0.3593 0.3550 -0.0704 0.0844  0.0155  30  LYS B CB  
1263 C CG  . LYS B 43  ? 0.4569 0.3835 0.4014 -0.0648 0.0857  0.0421  30  LYS B CG  
1264 C CD  . LYS B 43  ? 0.4716 0.3752 0.4100 -0.0378 0.0712  0.0416  30  LYS B CD  
1265 C CE  . LYS B 43  ? 0.5056 0.3713 0.4240 -0.0329 0.0619  0.0756  30  LYS B CE  
1266 N NZ  . LYS B 43  ? 0.4830 0.3726 0.3572 -0.0420 0.0688  0.0929  30  LYS B NZ  
1267 N N   . PRO B 44  ? 0.4394 0.3857 0.4537 -0.1393 0.0989  0.0047  31  PRO B N   
1268 C CA  . PRO B 44  ? 0.4971 0.3919 0.5231 -0.1654 0.1051  0.0088  31  PRO B CA  
1269 C C   . PRO B 44  ? 0.5336 0.3572 0.5528 -0.1486 0.1010  0.0252  31  PRO B C   
1270 O O   . PRO B 44  ? 0.5081 0.3300 0.5152 -0.1177 0.0931  0.0275  31  PRO B O   
1271 C CB  . PRO B 44  ? 0.5037 0.4009 0.5457 -0.1846 0.0993  -0.0277 31  PRO B CB  
1272 C CG  . PRO B 44  ? 0.4909 0.4138 0.5163 -0.1621 0.0889  -0.0459 31  PRO B CG  
1273 C CD  . PRO B 44  ? 0.4635 0.4333 0.4821 -0.1393 0.0856  -0.0241 31  PRO B CD  
1274 N N   . PRO B 45  ? 0.5974 0.3623 0.6324 -0.1695 0.1024  0.0391  32  PRO B N   
1275 C CA  . PRO B 45  ? 0.6424 0.3361 0.6879 -0.1527 0.0902  0.0627  32  PRO B CA  
1276 C C   . PRO B 45  ? 0.6799 0.3452 0.7609 -0.1242 0.0862  0.0282  32  PRO B C   
1277 O O   . PRO B 45  ? 0.6695 0.3044 0.7668 -0.0963 0.0728  0.0458  32  PRO B O   
1278 C CB  . PRO B 45  ? 0.7199 0.3560 0.7839 -0.1876 0.0908  0.0827  32  PRO B CB  
1279 C CG  . PRO B 45  ? 0.7105 0.3810 0.7852 -0.2185 0.1052  0.0484  32  PRO B CG  
1280 C CD  . PRO B 45  ? 0.6377 0.3981 0.6883 -0.2116 0.1113  0.0394  32  PRO B CD  
1281 N N   . VAL B 46  ? 0.5237 0.4876 0.4275 -0.2273 0.1580  -0.0179 33  VAL B N   
1282 C CA  . VAL B 46  ? 0.4986 0.4364 0.3985 -0.2085 0.1341  -0.0030 33  VAL B CA  
1283 C C   . VAL B 46  ? 0.4339 0.4228 0.3731 -0.1809 0.1217  -0.0080 33  VAL B C   
1284 O O   . VAL B 46  ? 0.3732 0.4282 0.3769 -0.1753 0.1188  -0.0279 33  VAL B O   
1285 C CB  . VAL B 46  ? 0.5012 0.4365 0.4279 -0.2216 0.1307  -0.0143 33  VAL B CB  
1286 C CG1 . VAL B 46  ? 0.5013 0.3999 0.4194 -0.2056 0.1096  -0.0051 33  VAL B CG1 
1287 C CG2 . VAL B 46  ? 0.5763 0.4618 0.4680 -0.2501 0.1452  -0.0101 33  VAL B CG2 
1288 N N   . VAL B 47  ? 0.4340 0.3919 0.3361 -0.1584 0.1072  0.0111  34  VAL B N   
1289 C CA  . VAL B 47  ? 0.3447 0.3442 0.2792 -0.1230 0.0896  0.0071  34  VAL B CA  
1290 C C   . VAL B 47  ? 0.3552 0.3266 0.2796 -0.0946 0.0617  0.0186  34  VAL B C   
1291 O O   . VAL B 47  ? 0.4014 0.3204 0.2848 -0.0875 0.0514  0.0359  34  VAL B O   
1292 C CB  . VAL B 47  ? 0.3138 0.3178 0.2260 -0.1201 0.1000  0.0091  34  VAL B CB  
1293 C CG1 . VAL B 47  ? 0.2586 0.2969 0.2051 -0.0859 0.0826  0.0050  34  VAL B CG1 
1294 C CG2 . VAL B 47  ? 0.3727 0.4098 0.3063 -0.1437 0.1293  -0.0119 34  VAL B CG2 
1295 N N   . MET B 48  ? 0.2564 0.2646 0.2198 -0.0802 0.0487  0.0079  35  MET B N   
1296 C CA  . MET B 48  ? 0.2422 0.2318 0.2007 -0.0607 0.0311  0.0101  35  MET B CA  
1297 C C   . MET B 48  ? 0.2177 0.2428 0.1946 -0.0383 0.0190  0.0094  35  MET B C   
1298 O O   . MET B 48  ? 0.1668 0.2334 0.1708 -0.0372 0.0179  0.0058  35  MET B O   
1299 C CB  . MET B 48  ? 0.2937 0.2820 0.2631 -0.0747 0.0304  -0.0043 35  MET B CB  
1300 C CG  . MET B 48  ? 0.3877 0.3515 0.3519 -0.0611 0.0220  -0.0108 35  MET B CG  
1301 S SD  . MET B 48  ? 0.5795 0.5380 0.5498 -0.0854 0.0270  -0.0356 35  MET B SD  
1302 C CE  . MET B 48  ? 0.4206 0.3313 0.3793 -0.1111 0.0413  -0.0294 35  MET B CE  
1303 N N   . THR B 49  ? 0.2165 0.2234 0.1841 -0.0211 0.0097  0.0123  36  THR B N   
1304 C CA  . THR B 49  ? 0.1762 0.2099 0.1558 -0.0071 0.0016  0.0106  36  THR B CA  
1305 C C   . THR B 49  ? 0.2124 0.2307 0.1899 -0.0011 -0.0001 0.0010  36  THR B C   
1306 O O   . THR B 49  ? 0.2692 0.2594 0.2445 -0.0059 0.0034  -0.0067 36  THR B O   
1307 C CB  . THR B 49  ? 0.1853 0.2244 0.1649 0.0063  -0.0003 0.0190  36  THR B CB  
1308 O OG1 . THR B 49  ? 0.1754 0.2380 0.1681 0.0140  -0.0064 0.0188  36  THR B OG1 
1309 C CG2 . THR B 49  ? 0.2211 0.2291 0.1844 0.0167  -0.0058 0.0243  36  THR B CG2 
1310 N N   . SER B 50  ? 0.1699 0.2051 0.1521 0.0070  -0.0023 -0.0020 37  SER B N   
1311 C CA  . SER B 50  ? 0.1959 0.2257 0.1845 0.0090  0.0037  -0.0195 37  SER B CA  
1312 C C   . SER B 50  ? 0.1765 0.2126 0.1814 0.0244  0.0025  -0.0209 37  SER B C   
1313 O O   . SER B 50  ? 0.1428 0.1883 0.1461 0.0302  -0.0036 -0.0078 37  SER B O   
1314 C CB  . SER B 50  ? 0.2392 0.2894 0.2120 -0.0101 0.0092  -0.0310 37  SER B CB  
1315 O OG  . SER B 50  ? 0.1885 0.2583 0.1514 -0.0118 0.0058  -0.0211 37  SER B OG  
1316 N N   . ASN B 51  ? 0.1567 0.1905 0.1851 0.0299  0.0099  -0.0417 38  ASN B N   
1317 C CA  . ASN B 51  ? 0.1747 0.2246 0.2325 0.0422  0.0099  -0.0499 38  ASN B CA  
1318 C C   . ASN B 51  ? 0.1848 0.2615 0.2267 0.0274  0.0196  -0.0485 38  ASN B C   
1319 O O   . ASN B 51  ? 0.1270 0.2147 0.1800 0.0333  0.0150  -0.0428 38  ASN B O   
1320 C CB  . ASN B 51  ? 0.1843 0.2343 0.2870 0.0507  0.0197  -0.0805 38  ASN B CB  
1321 C CG  . ASN B 51  ? 0.2141 0.2734 0.3051 0.0282  0.0455  -0.1074 38  ASN B CG  
1322 O OD1 . ASN B 51  ? 0.2247 0.2748 0.2755 0.0106  0.0469  -0.1008 38  ASN B OD1 
1323 N ND2 . ASN B 51  ? 0.1972 0.2782 0.3235 0.0251  0.0661  -0.1402 38  ASN B ND2 
1324 N N   . HIS B 52  ? 0.1609 0.2434 0.1716 0.0054  0.0302  -0.0518 39  HIS B N   
1325 C CA  . HIS B 52  ? 0.1741 0.2692 0.1579 -0.0123 0.0351  -0.0434 39  HIS B CA  
1326 C C   . HIS B 52  ? 0.1936 0.2832 0.1696 -0.0043 0.0170  -0.0144 39  HIS B C   
1327 O O   . HIS B 52  ? 0.1629 0.2546 0.1385 -0.0070 0.0178  -0.0069 39  HIS B O   
1328 C CB  . HIS B 52  ? 0.1918 0.2882 0.1303 -0.0408 0.0426  -0.0479 39  HIS B CB  
1329 C CG  . HIS B 52  ? 0.2215 0.3269 0.1627 -0.0570 0.0705  -0.0846 39  HIS B CG  
1330 N ND1 . HIS B 52  ? 0.2574 0.3739 0.2079 -0.0693 0.0896  -0.0987 39  HIS B ND1 
1331 C CD2 . HIS B 52  ? 0.3033 0.4043 0.2481 -0.0634 0.0820  -0.1112 39  HIS B CD2 
1332 C CE1 . HIS B 52  ? 0.2902 0.4089 0.2562 -0.0802 0.1069  -0.1283 39  HIS B CE1 
1333 N NE2 . HIS B 52  ? 0.2717 0.3800 0.2355 -0.0759 0.1028  -0.1358 39  HIS B NE2 
1334 N N   . VAL B 53  ? 0.1558 0.2382 0.1311 0.0036  0.0040  -0.0025 40  VAL B N   
1335 C CA  . VAL B 53  ? 0.1326 0.2140 0.1128 0.0120  -0.0081 0.0162  40  VAL B CA  
1336 C C   . VAL B 53  ? 0.1331 0.2113 0.1318 0.0261  -0.0075 0.0149  40  VAL B C   
1337 O O   . VAL B 53  ? 0.1543 0.2321 0.1577 0.0279  -0.0097 0.0216  40  VAL B O   
1338 C CB  . VAL B 53  ? 0.1173 0.2001 0.1019 0.0134  -0.0153 0.0211  40  VAL B CB  
1339 C CG1 . VAL B 53  ? 0.1528 0.2380 0.1562 0.0243  -0.0188 0.0289  40  VAL B CG1 
1340 C CG2 . VAL B 53  ? 0.1575 0.2505 0.1278 -0.0013 -0.0253 0.0259  40  VAL B CG2 
1341 N N   . LEU B 54  ? 0.1212 0.1932 0.1291 0.0350  -0.0077 0.0065  41  LEU B N   
1342 C CA  . LEU B 54  ? 0.1305 0.2001 0.1479 0.0456  -0.0142 0.0062  41  LEU B CA  
1343 C C   . LEU B 54  ? 0.1543 0.2387 0.1891 0.0435  -0.0103 -0.0029 41  LEU B C   
1344 O O   . LEU B 54  ? 0.1587 0.2451 0.1972 0.0446  -0.0136 -0.0019 41  LEU B O   
1345 C CB  . LEU B 54  ? 0.1753 0.2295 0.1964 0.0555  -0.0240 0.0042  41  LEU B CB  
1346 C CG  . LEU B 54  ? 0.2673 0.2982 0.2625 0.0523  -0.0270 0.0163  41  LEU B CG  
1347 C CD1 . LEU B 54  ? 0.2973 0.2995 0.2872 0.0611  -0.0434 0.0221  41  LEU B CD1 
1348 C CD2 . LEU B 54  ? 0.2665 0.3018 0.2451 0.0460  -0.0229 0.0225  41  LEU B CD2 
1349 N N   . GLY B 55  ? 0.1512 0.2468 0.1964 0.0361  0.0008  -0.0159 42  GLY B N   
1350 C CA  . GLY B 55  ? 0.1257 0.2385 0.1878 0.0263  0.0118  -0.0278 42  GLY B CA  
1351 C C   . GLY B 55  ? 0.1617 0.2646 0.2003 0.0126  0.0149  -0.0127 42  GLY B C   
1352 O O   . GLY B 55  ? 0.1506 0.2565 0.2020 0.0088  0.0165  -0.0157 42  GLY B O   
1353 N N   . GLU B 56  ? 0.1144 0.2034 0.1223 0.0052  0.0124  0.0038  43  GLU B N   
1354 C CA  . GLU B 56  ? 0.1680 0.2392 0.1570 -0.0046 0.0082  0.0231  43  GLU B CA  
1355 C C   . GLU B 56  ? 0.1446 0.2068 0.1537 0.0113  -0.0015 0.0283  43  GLU B C   
1356 O O   . GLU B 56  ? 0.1860 0.2320 0.1985 0.0068  -0.0016 0.0347  43  GLU B O   
1357 C CB  . GLU B 56  ? 0.2216 0.2834 0.1794 -0.0127 -0.0022 0.0406  43  GLU B CB  
1358 C CG  . GLU B 56  ? 0.2606 0.2967 0.1981 -0.0218 -0.0153 0.0666  43  GLU B CG  
1359 C CD  . GLU B 56  ? 0.3233 0.3549 0.2363 -0.0262 -0.0370 0.0858  43  GLU B CD  
1360 O OE1 . GLU B 56  ? 0.3185 0.3691 0.2463 -0.0159 -0.0426 0.0780  43  GLU B OE1 
1361 O OE2 . GLU B 56  ? 0.3983 0.4051 0.2800 -0.0407 -0.0488 0.1055  43  GLU B OE2 
1362 N N   . THR B 57  ? 0.1355 0.2046 0.1548 0.0263  -0.0067 0.0233  44  THR B N   
1363 C CA  . THR B 57  ? 0.1622 0.2264 0.1943 0.0362  -0.0094 0.0207  44  THR B CA  
1364 C C   . THR B 57  ? 0.1427 0.2094 0.1837 0.0345  -0.0069 0.0071  44  THR B C   
1365 O O   . THR B 57  ? 0.1556 0.2119 0.2053 0.0336  -0.0047 0.0030  44  THR B O   
1366 C CB  . THR B 57  ? 0.1754 0.2443 0.2028 0.0434  -0.0109 0.0181  44  THR B CB  
1367 O OG1 . THR B 57  ? 0.1523 0.2244 0.1805 0.0426  -0.0136 0.0270  44  THR B OG1 
1368 C CG2 . THR B 57  ? 0.1682 0.2340 0.1992 0.0462  -0.0066 0.0094  44  THR B CG2 
1369 N N   . TRP B 58  ? 0.1213 0.2031 0.1673 0.0344  -0.0088 -0.0028 45  TRP B N   
1370 C CA  . TRP B 58  ? 0.0928 0.1862 0.1562 0.0309  -0.0114 -0.0176 45  TRP B CA  
1371 C C   . TRP B 58  ? 0.1307 0.2169 0.2024 0.0156  0.0001  -0.0194 45  TRP B C   
1372 O O   . TRP B 58  ? 0.1368 0.2160 0.2153 0.0109  0.0002  -0.0276 45  TRP B O   
1373 C CB  . TRP B 58  ? 0.0875 0.2048 0.1749 0.0350  -0.0171 -0.0299 45  TRP B CB  
1374 C CG  . TRP B 58  ? 0.1254 0.2658 0.2456 0.0276  -0.0190 -0.0484 45  TRP B CG  
1375 C CD1 . TRP B 58  ? 0.0958 0.2499 0.2376 0.0098  -0.0009 -0.0600 45  TRP B CD1 
1376 C CD2 . TRP B 58  ? 0.1077 0.2611 0.2396 0.0329  -0.0407 -0.0583 45  TRP B CD2 
1377 N NE1 . TRP B 58  ? 0.1061 0.2859 0.2833 0.0045  -0.0081 -0.0797 45  TRP B NE1 
1378 C CE2 . TRP B 58  ? 0.1382 0.3193 0.3101 0.0198  -0.0359 -0.0787 45  TRP B CE2 
1379 C CE3 . TRP B 58  ? 0.1347 0.2780 0.2410 0.0428  -0.0646 -0.0513 45  TRP B CE3 
1380 C CZ2 . TRP B 58  ? 0.1968 0.3937 0.3842 0.0189  -0.0563 -0.0913 45  TRP B CZ2 
1381 C CZ3 . TRP B 58  ? 0.1389 0.2946 0.2516 0.0399  -0.0859 -0.0610 45  TRP B CZ3 
1382 C CH2 . TRP B 58  ? 0.2173 0.4000 0.3721 0.0295  -0.0826 -0.0806 45  TRP B CH2 
1383 N N   . THR B 59  ? 0.1154 0.1987 0.1802 0.0036  0.0109  -0.0122 46  THR B N   
1384 C CA  . THR B 59  ? 0.1425 0.2122 0.2053 -0.0182 0.0234  -0.0103 46  THR B CA  
1385 C C   . THR B 59  ? 0.2349 0.2666 0.2898 -0.0165 0.0183  0.0049  46  THR B C   
1386 O O   . THR B 59  ? 0.1857 0.2015 0.2512 -0.0281 0.0239  -0.0011 46  THR B O   
1387 C CB  . THR B 59  ? 0.1854 0.2532 0.2234 -0.0375 0.0367  -0.0025 46  THR B CB  
1388 O OG1 . THR B 59  ? 0.1489 0.2546 0.2100 -0.0383 0.0469  -0.0263 46  THR B OG1 
1389 C CG2 . THR B 59  ? 0.2239 0.2670 0.2449 -0.0675 0.0510  0.0053  46  THR B CG2 
1390 N N   . LEU B 60  ? 0.1886 0.2071 0.2340 -0.0017 0.0075  0.0210  47  LEU B N   
1391 C CA  . LEU B 60  ? 0.2262 0.2122 0.2819 0.0064  0.0004  0.0322  47  LEU B CA  
1392 C C   . LEU B 60  ? 0.2188 0.2055 0.2994 0.0143  0.0049  0.0091  47  LEU B C   
1393 O O   . LEU B 60  ? 0.2858 0.2433 0.3817 0.0101  0.0085  0.0054  47  LEU B O   
1394 C CB  . LEU B 60  ? 0.2212 0.2080 0.2770 0.0218  -0.0133 0.0478  47  LEU B CB  
1395 C CG  . LEU B 60  ? 0.3426 0.3001 0.4246 0.0347  -0.0265 0.0612  47  LEU B CG  
1396 C CD1 . LEU B 60  ? 0.3959 0.3077 0.4623 0.0203  -0.0337 0.0847  47  LEU B CD1 
1397 C CD2 . LEU B 60  ? 0.3722 0.3451 0.4621 0.0474  -0.0429 0.0737  47  LEU B CD2 
1398 N N   . LEU B 61  ? 0.2044 0.2190 0.2830 0.0224  0.0049  -0.0064 48  LEU B N   
1399 C CA  . LEU B 61  ? 0.1935 0.2103 0.2788 0.0233  0.0096  -0.0301 48  LEU B CA  
1400 C C   . LEU B 61  ? 0.1871 0.2068 0.2765 0.0074  0.0118  -0.0475 48  LEU B C   
1401 O O   . LEU B 61  ? 0.2352 0.2417 0.3335 0.0014  0.0180  -0.0670 48  LEU B O   
1402 C CB  . LEU B 61  ? 0.1691 0.2080 0.2338 0.0290  0.0062  -0.0361 48  LEU B CB  
1403 C CG  . LEU B 61  ? 0.1931 0.2326 0.2603 0.0394  0.0102  -0.0296 48  LEU B CG  
1404 C CD1 . LEU B 61  ? 0.1739 0.2263 0.2098 0.0367  0.0099  -0.0338 48  LEU B CD1 
1405 C CD2 . LEU B 61  ? 0.1903 0.2159 0.2888 0.0442  0.0218  -0.0433 48  LEU B CD2 
1406 N N   . ASN B 62  ? 0.1775 0.2181 0.2671 -0.0009 0.0084  -0.0455 49  ASN B N   
1407 C CA  . ASN B 62  ? 0.1779 0.2325 0.2840 -0.0179 0.0097  -0.0650 49  ASN B CA  
1408 C C   . ASN B 62  ? 0.2124 0.2313 0.3288 -0.0350 0.0235  -0.0641 49  ASN B C   
1409 O O   . ASN B 62  ? 0.2435 0.2584 0.3738 -0.0498 0.0275  -0.0854 49  ASN B O   
1410 C CB  . ASN B 62  ? 0.1745 0.2658 0.2956 -0.0219 0.0069  -0.0677 49  ASN B CB  
1411 C CG  . ASN B 62  ? 0.1559 0.2802 0.3078 -0.0343 0.0005  -0.0940 49  ASN B CG  
1412 O OD1 . ASN B 62  ? 0.1707 0.2954 0.3194 -0.0373 -0.0097 -0.1090 49  ASN B OD1 
1413 N ND2 . ASN B 62  ? 0.1489 0.3054 0.3338 -0.0441 0.0073  -0.1037 49  ASN B ND2 
1414 N N   . ARG B 63  ? 0.2567 0.2450 0.3625 -0.0349 0.0279  -0.0380 50  ARG B N   
1415 C CA  . ARG B 63  ? 0.3413 0.2805 0.4485 -0.0513 0.0360  -0.0270 50  ARG B CA  
1416 C C   . ARG B 63  ? 0.3597 0.2599 0.4851 -0.0385 0.0342  -0.0330 50  ARG B C   
1417 O O   . ARG B 63  ? 0.4005 0.2687 0.5407 -0.0531 0.0425  -0.0455 50  ARG B O   
1418 C CB  . ARG B 63  ? 0.4109 0.3247 0.4895 -0.0573 0.0340  0.0081  50  ARG B CB  
1419 C CG  . ARG B 63  ? 0.5064 0.4475 0.5678 -0.0825 0.0477  0.0069  50  ARG B CG  
1420 C CD  . ARG B 63  ? 0.5970 0.5136 0.6134 -0.0937 0.0461  0.0396  50  ARG B CD  
1421 N NE  . ARG B 63  ? 0.6220 0.5644 0.6212 -0.1251 0.0689  0.0300  50  ARG B NE  
1422 C CZ  . ARG B 63  ? 0.6276 0.5686 0.5821 -0.1405 0.0740  0.0454  50  ARG B CZ  
1423 N NH1 . ARG B 63  ? 0.5940 0.5099 0.5161 -0.1261 0.0513  0.0750  50  ARG B NH1 
1424 N NH2 . ARG B 63  ? 0.6309 0.6003 0.5768 -0.1723 0.1029  0.0268  50  ARG B NH2 
1425 N N   A ARG B 64  ? 0.3677 0.2722 0.4983 -0.0130 0.0263  -0.0286 51  ARG B N   
1426 N N   B ARG B 64  ? 0.3697 0.2736 0.5004 -0.0130 0.0262  -0.0282 51  ARG B N   
1427 C CA  A ARG B 64  ? 0.4249 0.2981 0.5870 0.0022  0.0282  -0.0392 51  ARG B CA  
1428 C CA  B ARG B 64  ? 0.4251 0.2981 0.5873 0.0020  0.0284  -0.0396 51  ARG B CA  
1429 C C   A ARG B 64  ? 0.4619 0.3513 0.6329 -0.0020 0.0412  -0.0816 51  ARG B C   
1430 C C   B ARG B 64  ? 0.4628 0.3521 0.6331 -0.0030 0.0413  -0.0818 51  ARG B C   
1431 O O   A ARG B 64  ? 0.4902 0.3461 0.6879 -0.0046 0.0513  -0.1027 51  ARG B O   
1432 O O   B ARG B 64  ? 0.4923 0.3482 0.6880 -0.0074 0.0515  -0.1030 51  ARG B O   
1433 C CB  A ARG B 64  ? 0.3976 0.2791 0.5728 0.0281  0.0180  -0.0247 51  ARG B CB  
1434 C CB  B ARG B 64  ? 0.3992 0.2815 0.5751 0.0281  0.0187  -0.0265 51  ARG B CB  
1435 C CG  A ARG B 64  ? 0.4571 0.2897 0.6679 0.0432  0.0054  -0.0044 51  ARG B CG  
1436 C CG  B ARG B 64  ? 0.4223 0.2808 0.5916 0.0335  -0.0005 0.0146  51  ARG B CG  
1437 C CD  A ARG B 64  ? 0.4494 0.3073 0.6929 0.0682  -0.0007 -0.0088 51  ARG B CD  
1438 C CD  B ARG B 64  ? 0.4276 0.2904 0.6359 0.0610  -0.0131 0.0199  51  ARG B CD  
1439 N NE  A ARG B 64  ? 0.4823 0.3218 0.7648 0.0779  0.0013  -0.0229 51  ARG B NE  
1440 N NE  B ARG B 64  ? 0.4611 0.3184 0.6495 0.0635  -0.0379 0.0581  51  ARG B NE  
1441 C CZ  A ARG B 64  ? 0.4754 0.3303 0.7923 0.0953  -0.0075 -0.0225 51  ARG B CZ  
1442 C CZ  B ARG B 64  ? 0.4642 0.3582 0.6552 0.0748  -0.0477 0.0605  51  ARG B CZ  
1443 N NH1 A ARG B 64  ? 0.4377 0.3264 0.7482 0.1019  -0.0189 -0.0090 51  ARG B NH1 
1444 N NH1 B ARG B 64  ? 0.4306 0.3631 0.6461 0.0842  -0.0331 0.0321  51  ARG B NH1 
1445 N NH2 A ARG B 64  ? 0.5391 0.3762 0.9015 0.1046  -0.0043 -0.0383 51  ARG B NH2 
1446 N NH2 B ARG B 64  ? 0.4898 0.3805 0.6525 0.0711  -0.0693 0.0889  51  ARG B NH2 
1454 N N   . GLY B 66  ? 0.4397 0.3358 0.4946 0.0127  0.0206  -0.0853 53  GLY B N   
1455 C CA  . GLY B 66  ? 0.4321 0.3352 0.4509 -0.0101 0.0129  -0.0971 53  GLY B CA  
1456 C C   . GLY B 66  ? 0.3823 0.3324 0.3844 -0.0117 0.0108  -0.0914 53  GLY B C   
1457 O O   . GLY B 66  ? 0.2869 0.2591 0.3014 0.0015  0.0159  -0.0793 53  GLY B O   
1458 N N   . HIS B 67  ? 0.3559 0.3208 0.3347 -0.0288 0.0014  -0.0984 54  HIS B N   
1459 C CA  . HIS B 67  ? 0.3347 0.3410 0.3044 -0.0296 -0.0042 -0.0871 54  HIS B CA  
1460 C C   . HIS B 67  ? 0.3424 0.3622 0.2933 -0.0174 0.0066  -0.0909 54  HIS B C   
1461 O O   . HIS B 67  ? 0.3165 0.3594 0.2728 -0.0104 0.0073  -0.0744 54  HIS B O   
1462 C CB  . HIS B 67  ? 0.3516 0.3751 0.3120 -0.0491 -0.0195 -0.0915 54  HIS B CB  
1463 C CG  . HIS B 67  ? 0.2991 0.3643 0.2643 -0.0463 -0.0262 -0.0748 54  HIS B CG  
1464 N ND1 . HIS B 67  ? 0.3063 0.3912 0.2478 -0.0441 -0.0324 -0.0757 54  HIS B ND1 
1465 C CD2 . HIS B 67  ? 0.2736 0.3594 0.2625 -0.0437 -0.0255 -0.0563 54  HIS B CD2 
1466 C CE1 . HIS B 67  ? 0.3173 0.4330 0.2759 -0.0381 -0.0373 -0.0565 54  HIS B CE1 
1467 N NE2 . HIS B 67  ? 0.3107 0.4269 0.2983 -0.0369 -0.0307 -0.0471 54  HIS B NE2 
1468 N N   . ARG B 68  ? 0.3285 0.3288 0.2533 -0.0165 0.0177  -0.1132 55  ARG B N   
1469 C CA  . ARG B 68  ? 0.3435 0.3555 0.2415 -0.0084 0.0329  -0.1164 55  ARG B CA  
1470 C C   . ARG B 68  ? 0.3149 0.3390 0.2489 0.0093  0.0499  -0.1015 55  ARG B C   
1471 O O   . ARG B 68  ? 0.3183 0.3665 0.2488 0.0118  0.0533  -0.0866 55  ARG B O   
1472 C CB  . ARG B 68  ? 0.4534 0.4340 0.3070 -0.0119 0.0477  -0.1476 55  ARG B CB  
1473 C CG  . ARG B 68  ? 0.4658 0.4568 0.2743 -0.0088 0.0654  -0.1510 55  ARG B CG  
1474 C CD  . ARG B 68  ? 0.5883 0.5399 0.3355 -0.0154 0.0821  -0.1866 55  ARG B CD  
1475 N NE  . ARG B 68  ? 0.6674 0.6267 0.3649 -0.0134 0.0953  -0.1811 55  ARG B NE  
1476 C CZ  . ARG B 68  ? 0.7703 0.7315 0.4758 0.0044  0.1315  -0.1801 55  ARG B CZ  
1477 N NH1 . ARG B 68  ? 0.7517 0.7110 0.5194 0.0234  0.1563  -0.1839 55  ARG B NH1 
1478 N NH2 . ARG B 68  ? 0.8204 0.7893 0.4786 0.0037  0.1417  -0.1722 55  ARG B NH2 
1479 N N   . ALA B 69  ? 0.3156 0.3226 0.2882 0.0203  0.0579  -0.1029 56  ALA B N   
1480 C CA  . ALA B 69  ? 0.3388 0.3641 0.3580 0.0348  0.0675  -0.0856 56  ALA B CA  
1481 C C   . ALA B 69  ? 0.2949 0.3423 0.3271 0.0279  0.0470  -0.0599 56  ALA B C   
1482 O O   . ALA B 69  ? 0.3077 0.3776 0.3580 0.0304  0.0509  -0.0455 56  ALA B O   
1483 C CB  . ALA B 69  ? 0.3516 0.3553 0.4165 0.0486  0.0722  -0.0867 56  ALA B CB  
1484 N N   . ALA B 70  ? 0.2560 0.2940 0.2773 0.0173  0.0279  -0.0556 57  ALA B N   
1485 C CA  . ALA B 70  ? 0.2354 0.2837 0.2583 0.0110  0.0134  -0.0368 57  ALA B CA  
1486 C C   . ALA B 70  ? 0.2234 0.2898 0.2244 0.0085  0.0154  -0.0325 57  ALA B C   
1487 O O   . ALA B 70  ? 0.1797 0.2517 0.1855 0.0072  0.0117  -0.0190 57  ALA B O   
1488 C CB  . ALA B 70  ? 0.2028 0.2369 0.2171 0.0009  0.0015  -0.0348 57  ALA B CB  
1489 N N   . VAL B 71  ? 0.2264 0.2976 0.2009 0.0064  0.0187  -0.0431 58  VAL B N   
1490 C CA  . VAL B 71  ? 0.2211 0.3069 0.1745 0.0057  0.0175  -0.0343 58  VAL B CA  
1491 C C   . VAL B 71  ? 0.2335 0.3260 0.1912 0.0097  0.0311  -0.0249 58  VAL B C   
1492 O O   . VAL B 71  ? 0.2658 0.3620 0.2192 0.0085  0.0289  -0.0098 58  VAL B O   
1493 C CB  . VAL B 71  ? 0.2692 0.3597 0.1892 0.0001  0.0125  -0.0448 58  VAL B CB  
1494 C CG1 . VAL B 71  ? 0.3379 0.4406 0.2322 0.0011  0.0115  -0.0312 58  VAL B CG1 
1495 C CG2 . VAL B 71  ? 0.2392 0.3345 0.1676 -0.0077 -0.0045 -0.0467 58  VAL B CG2 
1496 N N   . ALA B 72  ? 0.2359 0.3288 0.2082 0.0145  0.0474  -0.0329 59  ALA B N   
1497 C CA  . ALA B 72  ? 0.2929 0.4005 0.2840 0.0167  0.0643  -0.0222 59  ALA B CA  
1498 C C   . ALA B 72  ? 0.3049 0.4171 0.3293 0.0117  0.0510  -0.0037 59  ALA B C   
1499 O O   . ALA B 72  ? 0.3143 0.4340 0.3418 0.0055  0.0549  0.0105  59  ALA B O   
1500 C CB  . ALA B 72  ? 0.3659 0.4773 0.3829 0.0268  0.0876  -0.0343 59  ALA B CB  
1501 N N   . ALA B 73  ? 0.2922 0.3949 0.3349 0.0113  0.0342  -0.0036 60  ALA B N   
1502 C CA  . ALA B 73  ? 0.2619 0.3615 0.3216 0.0024  0.0172  0.0108  60  ALA B CA  
1503 C C   . ALA B 73  ? 0.2633 0.3459 0.2882 -0.0047 0.0098  0.0146  60  ALA B C   
1504 O O   . ALA B 73  ? 0.2795 0.3546 0.3064 -0.0145 0.0034  0.0245  60  ALA B O   
1505 C CB  . ALA B 73  ? 0.2898 0.3786 0.3641 0.0024  0.0006  0.0116  60  ALA B CB  
1506 N N   . ALA B 74  ? 0.2455 0.3212 0.2434 -0.0000 0.0105  0.0067  61  ALA B N   
1507 C CA  . ALA B 74  ? 0.2201 0.2827 0.1957 -0.0001 0.0077  0.0108  61  ALA B CA  
1508 C C   . ALA B 74  ? 0.2126 0.2746 0.1817 -0.0008 0.0141  0.0224  61  ALA B C   
1509 O O   . ALA B 74  ? 0.2467 0.2873 0.2070 -0.0030 0.0118  0.0295  61  ALA B O   
1510 C CB  . ALA B 74  ? 0.2079 0.2774 0.1728 0.0060  0.0070  0.0040  61  ALA B CB  
1511 N N   . ALA B 75  ? 0.2067 0.2866 0.1760 0.0003  0.0247  0.0240  62  ALA B N   
1512 C CA  . ALA B 75  ? 0.2263 0.3056 0.1825 -0.0024 0.0332  0.0388  62  ALA B CA  
1513 C C   . ALA B 75  ? 0.2735 0.3464 0.2519 -0.0147 0.0358  0.0510  62  ALA B C   
1514 O O   . ALA B 75  ? 0.2851 0.3467 0.2536 -0.0204 0.0407  0.0667  62  ALA B O   
1515 C CB  . ALA B 75  ? 0.2447 0.3422 0.1839 -0.0006 0.0482  0.0355  62  ALA B CB  
1516 N N   . ILE B 76  ? 0.2378 0.3178 0.2482 -0.0208 0.0296  0.0465  63  ILE B N   
1517 C CA  . ILE B 76  ? 0.2255 0.3049 0.2642 -0.0378 0.0249  0.0586  63  ILE B CA  
1518 C C   . ILE B 76  ? 0.2502 0.2874 0.2630 -0.0472 0.0137  0.0628  63  ILE B C   
1519 O O   . ILE B 76  ? 0.2743 0.2996 0.2961 -0.0636 0.0133  0.0752  63  ILE B O   
1520 C CB  . ILE B 76  ? 0.2583 0.3532 0.3357 -0.0429 0.0102  0.0558  63  ILE B CB  
1521 C CG1 . ILE B 76  ? 0.2300 0.3603 0.3412 -0.0291 0.0257  0.0514  63  ILE B CG1 
1522 C CG2 . ILE B 76  ? 0.2569 0.3551 0.3668 -0.0657 -0.0029 0.0698  63  ILE B CG2 
1523 C CD1 . ILE B 76  ? 0.1832 0.3286 0.3397 -0.0286 0.0089  0.0535  63  ILE B CD1 
1524 N N   . ARG B 77  ? 0.2508 0.2632 0.2338 -0.0369 0.0077  0.0521  64  ARG B N   
1525 C CA  . ARG B 77  ? 0.3502 0.3160 0.3073 -0.0398 0.0042  0.0519  64  ARG B CA  
1526 C C   . ARG B 77  ? 0.3307 0.2823 0.2792 -0.0354 0.0144  0.0680  64  ARG B C   
1527 O O   . ARG B 77  ? 0.3574 0.2640 0.2924 -0.0404 0.0135  0.0720  64  ARG B O   
1528 C CB  . ARG B 77  ? 0.3241 0.2743 0.2590 -0.0254 0.0042  0.0378  64  ARG B CB  
1529 C CG  . ARG B 77  ? 0.3075 0.2675 0.2391 -0.0042 0.0133  0.0422  64  ARG B CG  
1530 C CD  . ARG B 77  ? 0.2775 0.2407 0.2052 0.0080  0.0157  0.0298  64  ARG B CD  
1531 N NE  . ARG B 77  ? 0.3117 0.2882 0.2478 0.0272  0.0199  0.0373  64  ARG B NE  
1532 C CZ  . ARG B 77  ? 0.2729 0.2878 0.2183 0.0322  0.0144  0.0423  64  ARG B CZ  
1533 N NH1 . ARG B 77  ? 0.2452 0.2820 0.1892 0.0221  0.0112  0.0368  64  ARG B NH1 
1534 N NH2 . ARG B 77  ? 0.2739 0.3037 0.2305 0.0472  0.0113  0.0525  64  ARG B NH2 
1535 N N   . LEU B 78  ? 0.2985 0.2821 0.2488 -0.0270 0.0237  0.0774  65  LEU B N   
1536 C CA  . LEU B 78  ? 0.3315 0.3031 0.2661 -0.0240 0.0307  0.0984  65  LEU B CA  
1537 C C   . LEU B 78  ? 0.3529 0.3287 0.2998 -0.0446 0.0410  0.1156  65  LEU B C   
1538 O O   . LEU B 78  ? 0.3912 0.3504 0.3222 -0.0475 0.0479  0.1378  65  LEU B O   
1539 C CB  . LEU B 78  ? 0.3597 0.3603 0.2761 -0.0090 0.0328  0.1015  65  LEU B CB  
1540 C CG  . LEU B 78  ? 0.3138 0.3250 0.2288 0.0078  0.0227  0.0872  65  LEU B CG  
1541 C CD1 . LEU B 78  ? 0.3508 0.3909 0.2452 0.0140  0.0193  0.0909  65  LEU B CD1 
1542 C CD2 . LEU B 78  ? 0.3356 0.3146 0.2537 0.0208  0.0178  0.0920  65  LEU B CD2 
1543 N N   . SER B 79  ? 0.4575 0.5235 0.2949 0.1854  -0.0104 -0.0554 66  SER B N   
1544 C CA  . SER B 79  ? 0.4611 0.4981 0.2697 0.1787  0.0091  -0.0297 66  SER B CA  
1545 C C   . SER B 79  ? 0.4860 0.4534 0.2415 0.1811  0.0341  0.0071  66  SER B C   
1546 O O   . SER B 79  ? 0.4377 0.3704 0.1977 0.1654  0.0373  0.0145  66  SER B O   
1547 C CB  . SER B 79  ? 0.3810 0.4184 0.2406 0.1365  0.0127  -0.0329 66  SER B CB  
1548 O OG  . SER B 79  ? 0.4171 0.4332 0.2548 0.1281  0.0315  -0.0136 66  SER B OG  
1549 N N   . THR B 80  ? 0.5381 0.4833 0.2453 0.2015  0.0568  0.0287  67  THR B N   
1550 C CA  . THR B 80  ? 0.5942 0.4635 0.2582 0.1993  0.0951  0.0623  67  THR B CA  
1551 C C   . THR B 80  ? 0.5858 0.4312 0.2818 0.1509  0.1149  0.0646  67  THR B C   
1552 O O   . THR B 80  ? 0.6709 0.4569 0.3514 0.1347  0.1518  0.0816  67  THR B O   
1553 C CB  . THR B 80  ? 0.6414 0.4942 0.2547 0.2470  0.1146  0.0844  67  THR B CB  
1554 O OG1 . THR B 80  ? 0.6370 0.5255 0.2540 0.2535  0.1112  0.0792  67  THR B OG1 
1555 C CG2 . THR B 80  ? 0.6507 0.5411 0.2540 0.2946  0.0916  0.0767  67  THR B CG2 
1556 N N   . VAL B 81  ? 0.4821 0.3774 0.2267 0.1286  0.0934  0.0437  68  VAL B N   
1557 C CA  . VAL B 81  ? 0.4642 0.3559 0.2404 0.0894  0.1074  0.0418  68  VAL B CA  
1558 C C   . VAL B 81  ? 0.5024 0.4134 0.3329 0.0528  0.0921  0.0261  68  VAL B C   
1559 O O   . VAL B 81  ? 0.5753 0.4722 0.4234 0.0216  0.1089  0.0244  68  VAL B O   
1560 C CB  . VAL B 81  ? 0.5741 0.5084 0.3613 0.0957  0.0993  0.0336  68  VAL B CB  
1561 C CG1 . VAL B 81  ? 0.6244 0.5693 0.4531 0.0562  0.1068  0.0271  68  VAL B CG1 
1562 C CG2 . VAL B 81  ? 0.6125 0.5269 0.3405 0.1328  0.1210  0.0523  68  VAL B CG2 
1563 N N   . VAL B 82  ? 0.3820 0.3297 0.2406 0.0593  0.0635  0.0119  69  VAL B N   
1564 C CA  . VAL B 82  ? 0.3390 0.3038 0.2408 0.0359  0.0521  0.0024  69  VAL B CA  
1565 C C   . VAL B 82  ? 0.4052 0.3404 0.2954 0.0351  0.0516  0.0060  69  VAL B C   
1566 O O   . VAL B 82  ? 0.4426 0.3684 0.3122 0.0588  0.0433  0.0069  69  VAL B O   
1567 C CB  . VAL B 82  ? 0.2680 0.2755 0.2092 0.0430  0.0329  -0.0129 69  VAL B CB  
1568 C CG1 . VAL B 82  ? 0.3173 0.3355 0.2934 0.0289  0.0278  -0.0152 69  VAL B CG1 
1569 C CG2 . VAL B 82  ? 0.2572 0.2934 0.2140 0.0419  0.0359  -0.0179 69  VAL B CG2 
1570 N N   . ARG B 83  ? 0.4154 0.3434 0.3204 0.0089  0.0604  0.0042  70  ARG B N   
1571 C CA  . ARG B 83  ? 0.4312 0.3346 0.3305 0.0044  0.0609  0.0045  70  ARG B CA  
1572 C C   . ARG B 83  ? 0.3888 0.3225 0.3180 0.0084  0.0375  -0.0030 70  ARG B C   
1573 O O   . ARG B 83  ? 0.3297 0.3003 0.2905 -0.0006 0.0318  -0.0089 70  ARG B O   
1574 C CB  . ARG B 83  ? 0.4917 0.3840 0.4004 -0.0265 0.0829  -0.0032 70  ARG B CB  
1575 C CG  . ARG B 83  ? 0.5955 0.4570 0.4868 -0.0363 0.1163  0.0008  70  ARG B CG  
1576 C CD  . ARG B 83  ? 0.6935 0.5418 0.6036 -0.0711 0.1458  -0.0169 70  ARG B CD  
1577 N NE  . ARG B 83  ? 0.8275 0.6446 0.7306 -0.0846 0.1861  -0.0167 70  ARG B NE  
1578 C CZ  . ARG B 83  ? 0.9264 0.7180 0.8470 -0.1164 0.2271  -0.0355 70  ARG B CZ  
1579 N NH1 . ARG B 83  ? 0.9849 0.7427 0.9015 -0.1278 0.2700  -0.0348 70  ARG B NH1 
1580 N NH2 . ARG B 83  ? 0.9435 0.7440 0.8893 -0.1378 0.2291  -0.0583 70  ARG B NH2 
1581 N N   . VAL B 84  ? 0.3939 0.3121 0.3118 0.0259  0.0277  -0.0018 71  VAL B N   
1582 C CA  . VAL B 84  ? 0.3629 0.3013 0.3102 0.0306  0.0126  -0.0089 71  VAL B CA  
1583 C C   . VAL B 84  ? 0.3918 0.3104 0.3340 0.0231  0.0125  -0.0072 71  VAL B C   
1584 O O   . VAL B 84  ? 0.4472 0.3345 0.3644 0.0324  0.0130  -0.0039 71  VAL B O   
1585 C CB  . VAL B 84  ? 0.3473 0.2950 0.2996 0.0536  0.0018  -0.0187 71  VAL B CB  
1586 C CG1 . VAL B 84  ? 0.3323 0.2936 0.3228 0.0550  -0.0034 -0.0277 71  VAL B CG1 
1587 C CG2 . VAL B 84  ? 0.3561 0.3297 0.3153 0.0611  0.0024  -0.0261 71  VAL B CG2 
1588 N N   . GLU B 85  ? 0.2707 0.2131 0.2347 0.0100  0.0122  -0.0102 72  GLU B N   
1589 C CA  . GLU B 85  ? 0.2904 0.2254 0.2529 0.0021  0.0117  -0.0132 72  GLU B CA  
1590 C C   . GLU B 85  ? 0.2675 0.2007 0.2406 0.0185  0.0010  -0.0109 72  GLU B C   
1591 O O   . GLU B 85  ? 0.2397 0.1970 0.2371 0.0295  -0.0008 -0.0091 72  GLU B O   
1592 C CB  . GLU B 85  ? 0.3661 0.3449 0.3473 -0.0127 0.0144  -0.0231 72  GLU B CB  
1593 C CG  . GLU B 85  ? 0.4785 0.4675 0.4631 -0.0184 0.0119  -0.0322 72  GLU B CG  
1594 C CD  . GLU B 85  ? 0.5621 0.5185 0.5344 -0.0418 0.0276  -0.0446 72  GLU B CD  
1595 O OE1 . GLU B 85  ? 0.5891 0.5137 0.5488 -0.0522 0.0449  -0.0431 72  GLU B OE1 
1596 O OE2 . GLU B 85  ? 0.5715 0.5315 0.5470 -0.0487 0.0274  -0.0557 72  GLU B OE2 
1597 N N   . HIS B 86  ? 0.3076 0.2082 0.2636 0.0213  -0.0009 -0.0105 73  HIS B N   
1598 C CA  . HIS B 86  ? 0.3043 0.2023 0.2724 0.0330  -0.0082 -0.0110 73  HIS B CA  
1599 C C   . HIS B 86  ? 0.2517 0.1664 0.2258 0.0254  -0.0078 -0.0116 73  HIS B C   
1600 O O   . HIS B 86  ? 0.2947 0.1969 0.2546 0.0111  -0.0044 -0.0172 73  HIS B O   
1601 C CB  . HIS B 86  ? 0.3254 0.1889 0.2726 0.0426  -0.0120 -0.0119 73  HIS B CB  
1602 C CG  . HIS B 86  ? 0.3558 0.2153 0.3175 0.0511  -0.0175 -0.0151 73  HIS B CG  
1603 N ND1 . HIS B 86  ? 0.3353 0.2175 0.3265 0.0584  -0.0164 -0.0222 73  HIS B ND1 
1604 C CD2 . HIS B 86  ? 0.3590 0.2069 0.3166 0.0465  -0.0179 -0.0131 73  HIS B CD2 
1605 C CE1 . HIS B 86  ? 0.2998 0.1873 0.3029 0.0543  -0.0111 -0.0197 73  HIS B CE1 
1606 N NE2 . HIS B 86  ? 0.3144 0.1860 0.2995 0.0494  -0.0146 -0.0137 73  HIS B NE2 
1607 N N   . VAL B 87  ? 0.1951 0.1401 0.1901 0.0378  -0.0073 -0.0072 74  VAL B N   
1608 C CA  . VAL B 87  ? 0.2084 0.1850 0.2048 0.0407  -0.0079 -0.0080 74  VAL B CA  
1609 C C   . VAL B 87  ? 0.2340 0.1852 0.2207 0.0403  -0.0116 -0.0102 74  VAL B C   
1610 O O   . VAL B 87  ? 0.2814 0.2063 0.2735 0.0531  -0.0107 -0.0039 74  VAL B O   
1611 C CB  . VAL B 87  ? 0.2260 0.2342 0.2384 0.0671  -0.0004 0.0051  74  VAL B CB  
1612 C CG1 . VAL B 87  ? 0.2054 0.2612 0.2115 0.0796  -0.0027 0.0041  74  VAL B CG1 
1613 C CG2 . VAL B 87  ? 0.1977 0.2281 0.2206 0.0688  0.0050  0.0082  74  VAL B CG2 
1614 N N   . THR B 88  ? 0.2399 0.2005 0.2173 0.0235  -0.0128 -0.0235 75  THR B N   
1615 C CA  . THR B 88  ? 0.2564 0.1922 0.2243 0.0203  -0.0147 -0.0277 75  THR B CA  
1616 C C   . THR B 88  ? 0.2220 0.1856 0.1955 0.0424  -0.0179 -0.0217 75  THR B C   
1617 O O   . THR B 88  ? 0.2262 0.2347 0.2073 0.0617  -0.0162 -0.0150 75  THR B O   
1618 C CB  . THR B 88  ? 0.2910 0.2294 0.2543 -0.0071 -0.0077 -0.0495 75  THR B CB  
1619 O OG1 . THR B 88  ? 0.3044 0.3147 0.2831 -0.0101 -0.0098 -0.0686 75  THR B OG1 
1620 C CG2 . THR B 88  ? 0.3464 0.2496 0.3010 -0.0250 0.0057  -0.0510 75  THR B CG2 
1621 N N   . ALA B 89  ? 0.1727 0.2381 0.2685 0.0450  0.0977  0.0342  76  ALA B N   
1622 C CA  . ALA B 89  ? 0.1820 0.2278 0.2552 0.0473  0.1023  0.0204  76  ALA B CA  
1623 C C   . ALA B 89  ? 0.1990 0.1909 0.2602 0.0360  0.0978  -0.0010 76  ALA B C   
1624 O O   . ALA B 89  ? 0.2171 0.2060 0.2597 0.0266  0.0846  -0.0167 76  ALA B O   
1625 C CB  . ALA B 89  ? 0.2441 0.2734 0.2949 0.0682  0.1166  0.0318  76  ALA B CB  
1626 N N   . ASP B 90  ? 0.2245 0.1710 0.2921 0.0301  0.0958  0.0001  77  ASP B N   
1627 C CA  . ASP B 90  ? 0.2671 0.1583 0.3199 0.0062  0.0715  -0.0194 77  ASP B CA  
1628 C C   . ASP B 90  ? 0.2203 0.1566 0.2990 -0.0166 0.0506  -0.0193 77  ASP B C   
1629 O O   . ASP B 90  ? 0.2356 0.1548 0.2920 -0.0302 0.0317  -0.0371 77  ASP B O   
1630 C CB  . ASP B 90  ? 0.3575 0.1949 0.4271 -0.0044 0.0675  -0.0101 77  ASP B CB  
1631 C CG  . ASP B 90  ? 0.5246 0.2769 0.5444 0.0186  0.0816  -0.0216 77  ASP B CG  
1632 O OD1 . ASP B 90  ? 0.5644 0.2946 0.5282 0.0411  0.0894  -0.0411 77  ASP B OD1 
1633 O OD2 . ASP B 90  ? 0.6309 0.3375 0.6662 0.0185  0.0869  -0.0076 77  ASP B OD2 
1634 N N   . LEU B 91  ? 0.1913 0.1868 0.3120 -0.0148 0.0557  0.0031  78  LEU B N   
1635 C CA  . LEU B 91  ? 0.1792 0.2179 0.3199 -0.0250 0.0420  0.0084  78  LEU B CA  
1636 C C   . LEU B 91  ? 0.1324 0.1839 0.2441 -0.0192 0.0386  -0.0094 78  LEU B C   
1637 O O   . LEU B 91  ? 0.1354 0.1914 0.2429 -0.0290 0.0244  -0.0152 78  LEU B O   
1638 C CB  . LEU B 91  ? 0.1817 0.2787 0.3607 -0.0118 0.0529  0.0373  78  LEU B CB  
1639 C CG  . LEU B 91  ? 0.2449 0.3794 0.4448 -0.0156 0.0417  0.0551  78  LEU B CG  
1640 C CD1 . LEU B 91  ? 0.2897 0.4066 0.5248 -0.0481 0.0235  0.0676  78  LEU B CD1 
1641 C CD2 . LEU B 91  ? 0.2377 0.3958 0.4281 0.0071  0.0480  0.0742  78  LEU B CD2 
1642 N N   . GLU B 92  ? 0.1451 0.2053 0.2418 -0.0049 0.0507  -0.0129 79  GLU B N   
1643 C CA  . GLU B 92  ? 0.1199 0.1871 0.1967 -0.0046 0.0454  -0.0237 79  GLU B CA  
1644 C C   . GLU B 92  ? 0.1489 0.1834 0.1992 -0.0113 0.0388  -0.0373 79  GLU B C   
1645 O O   . GLU B 92  ? 0.1674 0.2073 0.2098 -0.0161 0.0294  -0.0424 79  GLU B O   
1646 C CB  . GLU B 92  ? 0.2060 0.2949 0.2819 0.0052  0.0551  -0.0163 79  GLU B CB  
1647 C CG  . GLU B 92  ? 0.2199 0.3358 0.3038 0.0104  0.0498  -0.0080 79  GLU B CG  
1648 C CD  . GLU B 92  ? 0.1708 0.3051 0.2525 0.0083  0.0452  -0.0028 79  GLU B CD  
1649 O OE1 . GLU B 92  ? 0.1794 0.3136 0.2612 0.0060  0.0508  0.0033  79  GLU B OE1 
1650 O OE2 . GLU B 92  ? 0.2356 0.3942 0.3156 0.0104  0.0355  -0.0029 79  GLU B OE2 
1651 N N   . GLU B 93  ? 0.1899 0.1862 0.2202 -0.0072 0.0442  -0.0431 80  GLU B N   
1652 C CA  . GLU B 93  ? 0.2139 0.1763 0.2042 -0.0064 0.0374  -0.0589 80  GLU B CA  
1653 C C   . GLU B 93  ? 0.2205 0.1775 0.2132 -0.0278 0.0129  -0.0674 80  GLU B C   
1654 O O   . GLU B 93  ? 0.2741 0.2330 0.2446 -0.0288 0.0039  -0.0748 80  GLU B O   
1655 C CB  . GLU B 93  ? 0.2636 0.1708 0.2156 0.0096  0.0473  -0.0680 80  GLU B CB  
1656 C CG  . GLU B 93  ? 0.4593 0.3240 0.3518 0.0186  0.0392  -0.0888 80  GLU B CG  
1657 C CD  . GLU B 93  ? 0.4550 0.3594 0.3347 0.0373  0.0523  -0.0784 80  GLU B CD  
1658 O OE1 . GLU B 93  ? 0.3814 0.3325 0.2925 0.0454  0.0696  -0.0550 80  GLU B OE1 
1659 O OE2 . GLU B 93  ? 0.4811 0.3739 0.3221 0.0421  0.0428  -0.0901 80  GLU B OE2 
1660 N N   . GLN B 94  ? 0.2031 0.1638 0.2284 -0.0438 0.0029  -0.0589 81  GLN B N   
1661 C CA  . GLN B 94  ? 0.2060 0.1815 0.2477 -0.0656 -0.0209 -0.0551 81  GLN B CA  
1662 C C   . GLN B 94  ? 0.1953 0.2213 0.2509 -0.0578 -0.0178 -0.0447 81  GLN B C   
1663 O O   . GLN B 94  ? 0.1785 0.2179 0.2287 -0.0648 -0.0318 -0.0444 81  GLN B O   
1664 C CB  . GLN B 94  ? 0.2099 0.1937 0.2976 -0.0839 -0.0300 -0.0348 81  GLN B CB  
1665 C CG  . GLN B 94  ? 0.2280 0.2395 0.3424 -0.1100 -0.0575 -0.0209 81  GLN B CG  
1666 C CD  . GLN B 94  ? 0.2491 0.2896 0.4192 -0.1231 -0.0607 0.0129  81  GLN B CD  
1667 O OE1 . GLN B 94  ? 0.2583 0.3572 0.4620 -0.1055 -0.0443 0.0405  81  GLN B OE1 
1668 N NE2 . GLN B 94  ? 0.3027 0.2990 0.4695 -0.1450 -0.0781 0.0099  81  GLN B NE2 
1669 N N   . ALA B 95  ? 0.1778 0.2270 0.2462 -0.0417 -0.0011 -0.0367 82  ALA B N   
1670 C CA  . ALA B 95  ? 0.1571 0.2319 0.2260 -0.0303 0.0011  -0.0320 82  ALA B CA  
1671 C C   . ALA B 95  ? 0.1240 0.1845 0.1660 -0.0289 -0.0007 -0.0420 82  ALA B C   
1672 O O   . ALA B 95  ? 0.1331 0.2044 0.1730 -0.0254 -0.0054 -0.0371 82  ALA B O   
1673 C CB  . ALA B 95  ? 0.1484 0.2355 0.2219 -0.0147 0.0127  -0.0285 82  ALA B CB  
1674 N N   . TRP B 96  ? 0.1227 0.1641 0.1466 -0.0270 0.0062  -0.0495 83  TRP B N   
1675 C CA  . TRP B 96  ? 0.2041 0.2427 0.2083 -0.0224 0.0079  -0.0494 83  TRP B CA  
1676 C C   . TRP B 96  ? 0.2031 0.2377 0.1860 -0.0257 -0.0040 -0.0548 83  TRP B C   
1677 O O   . TRP B 96  ? 0.1816 0.2297 0.1605 -0.0221 -0.0061 -0.0472 83  TRP B O   
1678 C CB  . TRP B 96  ? 0.2323 0.2649 0.2235 -0.0124 0.0220  -0.0468 83  TRP B CB  
1679 C CG  . TRP B 96  ? 0.1576 0.2096 0.1722 -0.0123 0.0291  -0.0335 83  TRP B CG  
1680 C CD1 . TRP B 96  ? 0.1901 0.2505 0.2150 -0.0077 0.0386  -0.0282 83  TRP B CD1 
1681 C CD2 . TRP B 96  ? 0.1317 0.1953 0.1618 -0.0198 0.0227  -0.0224 83  TRP B CD2 
1682 N NE1 . TRP B 96  ? 0.1517 0.2364 0.1978 -0.0142 0.0353  -0.0148 83  TRP B NE1 
1683 C CE2 . TRP B 96  ? 0.1208 0.2009 0.1696 -0.0242 0.0232  -0.0128 83  TRP B CE2 
1684 C CE3 . TRP B 96  ? 0.1470 0.2048 0.1773 -0.0242 0.0146  -0.0179 83  TRP B CE3 
1685 C CZ2 . TRP B 96  ? 0.1099 0.1948 0.1755 -0.0389 0.0096  -0.0024 83  TRP B CZ2 
1686 C CZ3 . TRP B 96  ? 0.1378 0.1923 0.1848 -0.0354 0.0054  -0.0067 83  TRP B CZ3 
1687 C CH2 . TRP B 96  ? 0.1407 0.2057 0.2044 -0.0456 -0.0002 -0.0009 83  TRP B CH2 
1688 N N   . GLU B 97  ? 0.2078 0.2208 0.1753 -0.0336 -0.0143 -0.0670 84  GLU B N   
1689 C CA  . GLU B 97  ? 0.2680 0.2753 0.2093 -0.0415 -0.0344 -0.0755 84  GLU B CA  
1690 C C   . GLU B 97  ? 0.2128 0.2615 0.1860 -0.0517 -0.0466 -0.0591 84  GLU B C   
1691 O O   . GLU B 97  ? 0.2229 0.2909 0.1828 -0.0501 -0.0558 -0.0547 84  GLU B O   
1692 C CB  . GLU B 97  ? 0.3326 0.2945 0.2513 -0.0551 -0.0518 -0.0939 84  GLU B CB  
1693 C CG  . GLU B 97  ? 0.4514 0.3637 0.3266 -0.0346 -0.0361 -0.1095 84  GLU B CG  
1694 C CD  . GLU B 97  ? 0.6417 0.4928 0.4949 -0.0463 -0.0527 -0.1280 84  GLU B CD  
1695 O OE1 . GLU B 97  ? 0.7179 0.5774 0.6040 -0.0752 -0.0768 -0.1237 84  GLU B OE1 
1696 O OE2 . GLU B 97  ? 0.7056 0.5152 0.5241 -0.0232 -0.0365 -0.1377 84  GLU B OE2 
1697 N N   . TRP B 98  ? 0.1722 0.2402 0.1857 -0.0561 -0.0433 -0.0456 85  TRP B N   
1698 C CA  . TRP B 98  ? 0.1781 0.2914 0.2221 -0.0550 -0.0477 -0.0227 85  TRP B CA  
1699 C C   . TRP B 98  ? 0.1858 0.3073 0.2200 -0.0339 -0.0348 -0.0159 85  TRP B C   
1700 O O   . TRP B 98  ? 0.2044 0.3543 0.2410 -0.0293 -0.0402 -0.0010 85  TRP B O   
1701 C CB  . TRP B 98  ? 0.1616 0.2947 0.2425 -0.0517 -0.0395 -0.0067 85  TRP B CB  
1702 C CG  . TRP B 98  ? 0.1509 0.3394 0.2647 -0.0447 -0.0414 0.0251  85  TRP B CG  
1703 C CD1 . TRP B 98  ? 0.1278 0.3517 0.2765 -0.0627 -0.0570 0.0493  85  TRP B CD1 
1704 C CD2 . TRP B 98  ? 0.1388 0.3470 0.2493 -0.0127 -0.0249 0.0394  85  TRP B CD2 
1705 N NE1 . TRP B 98  ? 0.1783 0.4452 0.3416 -0.0398 -0.0456 0.0808  85  TRP B NE1 
1706 C CE2 . TRP B 98  ? 0.1740 0.4418 0.3188 -0.0069 -0.0270 0.0763  85  TRP B CE2 
1707 C CE3 . TRP B 98  ? 0.1262 0.3005 0.2055 0.0112  -0.0103 0.0260  85  TRP B CE3 
1708 C CZ2 . TRP B 98  ? 0.1708 0.4552 0.3054 0.0303  -0.0084 0.0968  85  TRP B CZ2 
1709 C CZ3 . TRP B 98  ? 0.1442 0.3301 0.2164 0.0441  0.0020  0.0426  85  TRP B CZ3 
1710 C CH2 . TRP B 98  ? 0.1319 0.3788 0.2319 0.0594  0.0054  0.0787  85  TRP B CH2 
1711 N N   . LEU B 99  ? 0.1420 0.2381 0.1675 -0.0230 -0.0198 -0.0236 86  LEU B N   
1712 C CA  . LEU B 99  ? 0.1499 0.2371 0.1682 -0.0089 -0.0115 -0.0170 86  LEU B CA  
1713 C C   . LEU B 99  ? 0.1786 0.2722 0.1818 -0.0078 -0.0136 -0.0111 86  LEU B C   
1714 O O   . LEU B 99  ? 0.1802 0.2825 0.1848 0.0037  -0.0110 0.0044  86  LEU B O   
1715 C CB  . LEU B 99  ? 0.1329 0.1921 0.1491 -0.0086 -0.0043 -0.0249 86  LEU B CB  
1716 C CG  . LEU B 99  ? 0.1280 0.1784 0.1483 -0.0005 -0.0022 -0.0292 86  LEU B CG  
1717 C CD1 . LEU B 99  ? 0.1480 0.1798 0.1671 -0.0081 -0.0024 -0.0368 86  LEU B CD1 
1718 C CD2 . LEU B 99  ? 0.1514 0.1898 0.1610 0.0203  -0.0008 -0.0229 86  LEU B CD2 
1719 N N   . VAL B 100 ? 0.1954 0.2836 0.1791 -0.0137 -0.0159 -0.0215 87  VAL B N   
1720 C CA  . VAL B 100 ? 0.1996 0.2991 0.1599 -0.0054 -0.0157 -0.0149 87  VAL B CA  
1721 C C   . VAL B 100 ? 0.2155 0.3451 0.1699 -0.0078 -0.0319 -0.0093 87  VAL B C   
1722 O O   . VAL B 100 ? 0.2685 0.4212 0.2152 0.0039  -0.0301 0.0069  87  VAL B O   
1723 C CB  . VAL B 100 ? 0.2204 0.3042 0.1464 -0.0006 -0.0124 -0.0288 87  VAL B CB  
1724 C CG1 . VAL B 100 ? 0.3023 0.4034 0.1918 0.0157  -0.0128 -0.0224 87  VAL B CG1 
1725 C CG2 . VAL B 100 ? 0.2026 0.2765 0.1429 0.0040  0.0054  -0.0218 87  VAL B CG2 
1726 N N   . ARG B 101 ? 0.2015 0.3380 0.1664 -0.0242 -0.0485 -0.0164 88  ARG B N   
1727 C CA  . ARG B 101 ? 0.2924 0.4676 0.2598 -0.0344 -0.0711 -0.0064 88  ARG B CA  
1728 C C   . ARG B 101 ? 0.2272 0.4467 0.2295 -0.0219 -0.0638 0.0256  88  ARG B C   
1729 O O   . ARG B 101 ? 0.2756 0.5391 0.2785 -0.0186 -0.0736 0.0448  88  ARG B O   
1730 C CB  . ARG B 101 ? 0.3847 0.5514 0.3595 -0.0629 -0.0960 -0.0188 88  ARG B CB  
1731 C CG  . ARG B 101 ? 0.4739 0.6732 0.4589 -0.0800 -0.1241 -0.0064 88  ARG B CG  
1732 C CD  . ARG B 101 ? 0.5738 0.7355 0.5629 -0.1050 -0.1463 -0.0228 88  ARG B CD  
1733 N NE  . ARG B 101 ? 0.5943 0.7575 0.6293 -0.1130 -0.1358 -0.0099 88  ARG B NE  
1734 C CZ  . ARG B 101 ? 0.5640 0.6816 0.5925 -0.1146 -0.1268 -0.0280 88  ARG B CZ  
1735 N NH1 . ARG B 101 ? 0.6297 0.6936 0.6055 -0.1069 -0.1246 -0.0596 88  ARG B NH1 
1736 N NH2 . ARG B 101 ? 0.4347 0.5639 0.5067 -0.1185 -0.1166 -0.0105 88  ARG B NH2 
1737 N N   . HIS B 102 ? 0.2714 0.4128 0.2385 0.0144  -0.0744 0.0473  89  HIS B N   
1738 C CA  . HIS B 102 ? 0.2331 0.3785 0.2653 0.0122  -0.0738 0.0640  89  HIS B CA  
1739 C C   . HIS B 102 ? 0.2462 0.3932 0.2964 0.0152  -0.0682 0.0862  89  HIS B C   
1740 O O   . HIS B 102 ? 0.2546 0.3862 0.3253 0.0195  -0.0508 0.0819  89  HIS B O   
1741 C CB  . HIS B 102 ? 0.2043 0.3395 0.2682 0.0136  -0.0545 0.0488  89  HIS B CB  
1742 C CG  . HIS B 102 ? 0.2258 0.3635 0.3014 0.0035  -0.0675 0.0425  89  HIS B CG  
1743 N ND1 . HIS B 102 ? 0.2079 0.3712 0.3430 -0.0013 -0.0765 0.0577  89  HIS B ND1 
1744 C CD2 . HIS B 102 ? 0.2525 0.3697 0.2919 -0.0044 -0.0772 0.0256  89  HIS B CD2 
1745 C CE1 . HIS B 102 ? 0.2243 0.3869 0.3626 -0.0177 -0.0913 0.0544  89  HIS B CE1 
1746 N NE2 . HIS B 102 ? 0.2753 0.4021 0.3528 -0.0200 -0.0944 0.0340  89  HIS B NE2 
1747 N N   . ASP B 103 ? 0.2704 0.4306 0.3097 0.0114  -0.0877 0.1113  90  ASP B N   
1748 C CA  . ASP B 103 ? 0.2753 0.4308 0.3309 0.0089  -0.0906 0.1403  90  ASP B CA  
1749 C C   . ASP B 103 ? 0.2935 0.4363 0.4100 0.0172  -0.1060 0.1555  90  ASP B C   
1750 O O   . ASP B 103 ? 0.3338 0.4609 0.4660 0.0161  -0.1182 0.1820  90  ASP B O   
1751 C CB  . ASP B 103 ? 0.3731 0.5529 0.3810 -0.0003 -0.1032 0.1669  90  ASP B CB  
1752 C CG  . ASP B 103 ? 0.4484 0.6332 0.4454 -0.0004 -0.1272 0.1702  90  ASP B CG  
1753 O OD1 . ASP B 103 ? 0.4378 0.6214 0.4540 0.0036  -0.1388 0.1537  90  ASP B OD1 
1754 O OD2 . ASP B 103 ? 0.5492 0.7388 0.5207 -0.0067 -0.1345 0.1893  90  ASP B OD2 
1755 N N   . GLU B 104 ? 0.3067 0.4584 0.4610 0.0262  -0.1068 0.1411  91  GLU B N   
1756 C CA  . GLU B 104 ? 0.3187 0.4733 0.5376 0.0413  -0.1200 0.1543  91  GLU B CA  
1757 C C   . GLU B 104 ? 0.3071 0.4330 0.5594 0.0612  -0.1018 0.1423  91  GLU B C   
1758 O O   . GLU B 104 ? 0.3296 0.4462 0.6265 0.0807  -0.1117 0.1499  91  GLU B O   
1759 C CB  . GLU B 104 ? 0.2486 0.4385 0.5046 0.0424  -0.1261 0.1478  91  GLU B CB  
1760 C CG  . GLU B 104 ? 0.2384 0.4384 0.5132 0.0465  -0.0968 0.1224  91  GLU B CG  
1761 C CD  . GLU B 104 ? 0.2724 0.4626 0.4896 0.0282  -0.0888 0.1034  91  GLU B CD  
1762 O OE1 . GLU B 104 ? 0.2787 0.4583 0.4408 0.0177  -0.1033 0.1054  91  GLU B OE1 
1763 O OE2 . GLU B 104 ? 0.2451 0.4388 0.4697 0.0269  -0.0683 0.0869  91  GLU B OE2 
1764 N N   . ARG B 105 ? 0.2682 0.3754 0.4915 0.0583  -0.0769 0.1194  92  ARG B N   
1765 C CA  . ARG B 105 ? 0.2918 0.3658 0.5320 0.0778  -0.0614 0.1009  92  ARG B CA  
1766 C C   . ARG B 105 ? 0.2626 0.3099 0.4569 0.0642  -0.0479 0.0873  92  ARG B C   
1767 O O   . ARG B 105 ? 0.2690 0.3360 0.4278 0.0479  -0.0388 0.0820  92  ARG B O   
1768 C CB  . ARG B 105 ? 0.3052 0.4069 0.5801 0.0981  -0.0394 0.0799  92  ARG B CB  
1769 C CG  . ARG B 105 ? 0.3813 0.4529 0.6627 0.1259  -0.0205 0.0548  92  ARG B CG  
1770 C CD  . ARG B 105 ? 0.3876 0.5056 0.6950 0.1424  0.0087  0.0391  92  ARG B CD  
1771 N NE  . ARG B 105 ? 0.3975 0.4882 0.6815 0.1662  0.0312  0.0090  92  ARG B NE  
1772 C CZ  . ARG B 105 ? 0.4349 0.5249 0.7262 0.1993  0.0359  -0.0071 92  ARG B CZ  
1773 N NH1 . ARG B 105 ? 0.4394 0.5572 0.7739 0.2147  0.0231  0.0059  92  ARG B NH1 
1774 N NH2 . ARG B 105 ? 0.5033 0.5669 0.7556 0.2191  0.0501  -0.0382 92  ARG B NH2 
1775 N N   . GLU B 106 ? 0.2880 0.2879 0.4836 0.0724  -0.0510 0.0810  93  GLU B N   
1776 C CA  . GLU B 106 ? 0.2970 0.2734 0.4569 0.0578  -0.0435 0.0700  93  GLU B CA  
1777 C C   . GLU B 106 ? 0.2709 0.2556 0.4125 0.0663  -0.0161 0.0371  93  GLU B C   
1778 O O   . GLU B 106 ? 0.3186 0.2878 0.4709 0.0903  -0.0046 0.0152  93  GLU B O   
1779 C CB  . GLU B 106 ? 0.3704 0.2835 0.5364 0.0609  -0.0636 0.0720  93  GLU B CB  
1780 C CG  . GLU B 106 ? 0.4090 0.2998 0.5450 0.0419  -0.0626 0.0637  93  GLU B CG  
1781 C CD  . GLU B 106 ? 0.5136 0.3299 0.6542 0.0415  -0.0911 0.0633  93  GLU B CD  
1782 O OE1 . GLU B 106 ? 0.4780 0.2570 0.6434 0.0516  -0.1158 0.0779  93  GLU B OE1 
1783 O OE2 . GLU B 106 ? 0.6129 0.4025 0.7317 0.0309  -0.0938 0.0486  93  GLU B OE2 
1784 N N   . TYR B 107 ? 0.2172 0.2273 0.3286 0.0494  -0.0059 0.0343  94  TYR B N   
1785 C CA  . TYR B 107 ? 0.2010 0.2129 0.2901 0.0530  0.0149  0.0089  94  TYR B CA  
1786 C C   . TYR B 107 ? 0.2453 0.2430 0.3024 0.0396  0.0143  0.0037  94  TYR B C   
1787 O O   . TYR B 107 ? 0.2028 0.2183 0.2525 0.0241  0.0055  0.0213  94  TYR B O   
1788 C CB  . TYR B 107 ? 0.1766 0.2252 0.2617 0.0477  0.0222  0.0085  94  TYR B CB  
1789 C CG  . TYR B 107 ? 0.1727 0.2460 0.2973 0.0577  0.0242  0.0135  94  TYR B CG  
1790 C CD1 . TYR B 107 ? 0.1790 0.2590 0.3211 0.0738  0.0441  0.0010  94  TYR B CD1 
1791 C CD2 . TYR B 107 ? 0.1877 0.2855 0.3322 0.0515  0.0062  0.0326  94  TYR B CD2 
1792 C CE1 . TYR B 107 ? 0.1775 0.2976 0.3670 0.0832  0.0485  0.0103  94  TYR B CE1 
1793 C CE2 . TYR B 107 ? 0.1693 0.2984 0.3601 0.0586  0.0044  0.0408  94  TYR B CE2 
1794 C CZ  . TYR B 107 ? 0.1729 0.3179 0.3916 0.0743  0.0268  0.0311  94  TYR B CZ  
1795 O OH  . TYR B 107 ? 0.1690 0.3620 0.4446 0.0817  0.0274  0.0438  94  TYR B OH  
1796 N N   . SER B 108 ? 0.2116 0.1848 0.2502 0.0466  0.0240  -0.0188 95  SER B N   
1797 C CA  . SER B 108 ? 0.2199 0.1832 0.2325 0.0344  0.0203  -0.0242 95  SER B CA  
1798 C C   . SER B 108 ? 0.2121 0.2048 0.2032 0.0306  0.0310  -0.0290 95  SER B C   
1799 O O   . SER B 108 ? 0.1924 0.1987 0.1830 0.0358  0.0406  -0.0329 95  SER B O   
1800 C CB  . SER B 108 ? 0.3103 0.2286 0.3033 0.0444  0.0202  -0.0477 95  SER B CB  
1801 O OG  . SER B 108 ? 0.3142 0.2394 0.2860 0.0569  0.0414  -0.0656 95  SER B OG  
1802 N N   . PHE B 109 ? 0.2141 0.2134 0.2359 -0.0410 0.0674  -0.0214 96  PHE B N   
1803 C CA  . PHE B 109 ? 0.1713 0.2030 0.2015 -0.0371 0.0564  -0.0294 96  PHE B CA  
1804 C C   . PHE B 109 ? 0.1385 0.1938 0.1836 -0.0302 0.0359  -0.0354 96  PHE B C   
1805 O O   . PHE B 109 ? 0.1681 0.2283 0.2063 -0.0204 0.0258  -0.0327 96  PHE B O   
1806 C CB  . PHE B 109 ? 0.2258 0.2823 0.2835 -0.0485 0.0716  -0.0411 96  PHE B CB  
1807 C CG  . PHE B 109 ? 0.2099 0.3003 0.2852 -0.0378 0.0639  -0.0463 96  PHE B CG  
1808 C CD1 . PHE B 109 ? 0.1925 0.2704 0.2482 -0.0286 0.0704  -0.0432 96  PHE B CD1 
1809 C CD2 . PHE B 109 ? 0.1624 0.2969 0.2719 -0.0353 0.0523  -0.0539 96  PHE B CD2 
1810 C CE1 . PHE B 109 ? 0.1911 0.2883 0.2656 -0.0156 0.0704  -0.0470 96  PHE B CE1 
1811 C CE2 . PHE B 109 ? 0.1488 0.3106 0.2759 -0.0181 0.0485  -0.0511 96  PHE B CE2 
1812 C CZ  . PHE B 109 ? 0.1450 0.2824 0.2570 -0.0074 0.0601  -0.0474 96  PHE B CZ  
1813 N N   . VAL B 110 ? 0.1310 0.1986 0.1942 -0.0377 0.0333  -0.0449 97  VAL B N   
1814 C CA  . VAL B 110 ? 0.1169 0.2094 0.1874 -0.0311 0.0163  -0.0482 97  VAL B CA  
1815 C C   . VAL B 110 ? 0.1607 0.2332 0.2123 -0.0198 0.0070  -0.0370 97  VAL B C   
1816 O O   . VAL B 110 ? 0.1754 0.2592 0.2266 -0.0118 -0.0029 -0.0330 97  VAL B O   
1817 C CB  . VAL B 110 ? 0.1306 0.2420 0.2155 -0.0448 0.0168  -0.0654 97  VAL B CB  
1818 C CG1 . VAL B 110 ? 0.1348 0.2682 0.2153 -0.0366 0.0013  -0.0653 97  VAL B CG1 
1819 C CG2 . VAL B 110 ? 0.1323 0.2861 0.2444 -0.0591 0.0209  -0.0806 97  VAL B CG2 
1820 N N   . ASP B 111 ? 0.1566 0.2015 0.1955 -0.0183 0.0123  -0.0302 98  ASP B N   
1821 C CA  . ASP B 111 ? 0.1968 0.2375 0.2252 -0.0074 0.0021  -0.0198 98  ASP B CA  
1822 C C   . ASP B 111 ? 0.1795 0.2261 0.1953 -0.0054 -0.0055 -0.0164 98  ASP B C   
1823 O O   . ASP B 111 ? 0.1696 0.2265 0.1880 -0.0040 -0.0146 -0.0173 98  ASP B O   
1824 C CB  . ASP B 111 ? 0.2303 0.2476 0.2504 0.0005  0.0095  -0.0073 98  ASP B CB  
1825 C CG  . ASP B 111 ? 0.3065 0.3098 0.3407 0.0002  0.0206  -0.0144 98  ASP B CG  
1826 O OD1 . ASP B 111 ? 0.3279 0.3483 0.3732 -0.0084 0.0181  -0.0311 98  ASP B OD1 
1827 O OD2 . ASP B 111 ? 0.3911 0.3656 0.4230 0.0100  0.0338  -0.0025 98  ASP B OD2 
1828 N N   . ALA B 112 ? 0.1675 0.2058 0.1696 -0.0083 0.0023  -0.0156 99  ALA B N   
1829 C CA  . ALA B 112 ? 0.1651 0.2052 0.1508 -0.0100 -0.0004 -0.0195 99  ALA B CA  
1830 C C   . ALA B 112 ? 0.1732 0.2178 0.1751 -0.0104 0.0001  -0.0284 99  ALA B C   
1831 O O   . ALA B 112 ? 0.1943 0.2354 0.1903 -0.0138 -0.0025 -0.0342 99  ALA B O   
1832 C CB  . ALA B 112 ? 0.1860 0.2162 0.1516 -0.0133 0.0132  -0.0192 99  ALA B CB  
1833 N N   . THR B 113 ? 0.1499 0.2040 0.1730 -0.0069 0.0048  -0.0289 100 THR B N   
1834 C CA  . THR B 113 ? 0.1208 0.1801 0.1589 0.0008  0.0067  -0.0283 100 THR B CA  
1835 C C   . THR B 113 ? 0.1137 0.1755 0.1545 0.0026  -0.0023 -0.0227 100 THR B C   
1836 O O   . THR B 113 ? 0.1545 0.2052 0.1981 0.0066  0.0024  -0.0192 100 THR B O   
1837 C CB  . THR B 113 ? 0.1418 0.2284 0.2042 0.0081  0.0104  -0.0268 100 THR B CB  
1838 O OG1 . THR B 113 ? 0.1432 0.2527 0.2135 0.0024  0.0017  -0.0287 100 THR B OG1 
1839 C CG2 . THR B 113 ? 0.1157 0.2032 0.1816 0.0050  0.0245  -0.0331 100 THR B CG2 
1840 N N   . SER B 114 ? 0.0970 0.1686 0.1375 -0.0004 -0.0102 -0.0219 101 SER B N   
1841 C CA  . SER B 114 ? 0.1236 0.2007 0.1665 0.0006  -0.0152 -0.0178 101 SER B CA  
1842 C C   . SER B 114 ? 0.1330 0.1996 0.1715 -0.0056 -0.0161 -0.0193 101 SER B C   
1843 O O   . SER B 114 ? 0.1153 0.1779 0.1587 -0.0076 -0.0122 -0.0166 101 SER B O   
1844 C CB  . SER B 114 ? 0.1271 0.2136 0.1717 -0.0010 -0.0181 -0.0210 101 SER B CB  
1845 O OG  . SER B 114 ? 0.0979 0.2021 0.1477 -0.0021 -0.0174 -0.0266 101 SER B OG  
1846 N N   . PHE B 115 ? 0.1701 0.2360 0.1988 -0.0100 -0.0204 -0.0232 102 PHE B N   
1847 C CA  . PHE B 115 ? 0.1772 0.2499 0.2023 -0.0195 -0.0255 -0.0292 102 PHE B CA  
1848 C C   . PHE B 115 ? 0.1962 0.2497 0.2190 -0.0296 -0.0149 -0.0401 102 PHE B C   
1849 O O   . PHE B 115 ? 0.1844 0.2384 0.2152 -0.0422 -0.0122 -0.0477 102 PHE B O   
1850 C CB  . PHE B 115 ? 0.1415 0.2253 0.1488 -0.0189 -0.0337 -0.0282 102 PHE B CB  
1851 C CG  . PHE B 115 ? 0.1592 0.2490 0.1696 -0.0053 -0.0370 -0.0139 102 PHE B CG  
1852 C CD1 . PHE B 115 ? 0.1386 0.2323 0.1691 0.0010  -0.0355 -0.0102 102 PHE B CD1 
1853 C CD2 . PHE B 115 ? 0.1691 0.2550 0.1597 0.0019  -0.0370 -0.0036 102 PHE B CD2 
1854 C CE1 . PHE B 115 ? 0.1154 0.2042 0.1501 0.0137  -0.0317 -0.0004 102 PHE B CE1 
1855 C CE2 . PHE B 115 ? 0.1616 0.2400 0.1562 0.0165  -0.0329 0.0122  102 PHE B CE2 
1856 C CZ  . PHE B 115 ? 0.1487 0.2260 0.1676 0.0222  -0.0292 0.0118  102 PHE B CZ  
1857 N N   . ALA B 116 ? 0.1785 0.2132 0.1940 -0.0248 -0.0046 -0.0421 103 ALA B N   
1858 C CA  . ALA B 116 ? 0.2048 0.2112 0.2193 -0.0300 0.0125  -0.0528 103 ALA B CA  
1859 C C   . ALA B 116 ? 0.2044 0.1929 0.2366 -0.0235 0.0242  -0.0419 103 ALA B C   
1860 O O   . ALA B 116 ? 0.2337 0.1927 0.2686 -0.0338 0.0407  -0.0508 103 ALA B O   
1861 C CB  . ALA B 116 ? 0.2124 0.2078 0.2210 -0.0207 0.0240  -0.0548 103 ALA B CB  
1862 N N   . VAL B 117 ? 0.1915 0.1964 0.2328 -0.0076 0.0183  -0.0233 104 VAL B N   
1863 C CA  . VAL B 117 ? 0.1670 0.1616 0.2172 0.0024  0.0281  -0.0060 104 VAL B CA  
1864 C C   . VAL B 117 ? 0.1741 0.1647 0.2270 -0.0144 0.0305  -0.0091 104 VAL B C   
1865 O O   . VAL B 117 ? 0.2139 0.1737 0.2718 -0.0183 0.0501  -0.0039 104 VAL B O   
1866 C CB  . VAL B 117 ? 0.1816 0.2095 0.2342 0.0198  0.0172  0.0110  104 VAL B CB  
1867 C CG1 . VAL B 117 ? 0.1929 0.2172 0.2443 0.0302  0.0255  0.0327  104 VAL B CG1 
1868 C CG2 . VAL B 117 ? 0.1862 0.2283 0.2464 0.0353  0.0172  0.0144  104 VAL B CG2 
1869 N N   . MET B 118 ? 0.1616 0.1827 0.2150 -0.0236 0.0142  -0.0166 105 MET B N   
1870 C CA  . MET B 118 ? 0.1923 0.2245 0.2569 -0.0386 0.0158  -0.0202 105 MET B CA  
1871 C C   . MET B 118 ? 0.2257 0.2434 0.2963 -0.0634 0.0252  -0.0406 105 MET B C   
1872 O O   . MET B 118 ? 0.2559 0.2636 0.3402 -0.0792 0.0403  -0.0431 105 MET B O   
1873 C CB  . MET B 118 ? 0.1732 0.2451 0.2429 -0.0370 -0.0021 -0.0225 105 MET B CB  
1874 C CG  . MET B 118 ? 0.1242 0.2069 0.1892 -0.0202 -0.0055 -0.0106 105 MET B CG  
1875 S SD  . MET B 118 ? 0.1472 0.2596 0.2210 -0.0147 -0.0164 -0.0140 105 MET B SD  
1876 C CE  . MET B 118 ? 0.1330 0.2700 0.2311 -0.0249 -0.0099 -0.0152 105 MET B CE  
1877 N N   . ARG B 119 ? 0.2294 0.2467 0.2879 -0.0700 0.0190  -0.0577 106 ARG B N   
1878 C CA  . ARG B 119 ? 0.2313 0.2374 0.2895 -0.0979 0.0285  -0.0851 106 ARG B CA  
1879 C C   . ARG B 119 ? 0.2710 0.2153 0.3333 -0.1018 0.0618  -0.0861 106 ARG B C   
1880 O O   . ARG B 119 ? 0.3158 0.2407 0.3902 -0.1287 0.0802  -0.1034 106 ARG B O   
1881 C CB  . ARG B 119 ? 0.2541 0.2724 0.2883 -0.1020 0.0172  -0.1026 106 ARG B CB  
1882 C CG  . ARG B 119 ? 0.2516 0.3282 0.2796 -0.0994 -0.0119 -0.1000 106 ARG B CG  
1883 C CD  . ARG B 119 ? 0.3426 0.4304 0.3400 -0.1041 -0.0188 -0.1128 106 ARG B CD  
1884 N NE  . ARG B 119 ? 0.3689 0.4253 0.3434 -0.0962 -0.0081 -0.1156 106 ARG B NE  
1885 C CZ  . ARG B 119 ? 0.3713 0.4335 0.3349 -0.0744 -0.0154 -0.0947 106 ARG B CZ  
1886 N NH1 . ARG B 119 ? 0.3310 0.4239 0.3014 -0.0616 -0.0331 -0.0750 106 ARG B NH1 
1887 N NH2 . ARG B 119 ? 0.3168 0.3520 0.2664 -0.0660 -0.0009 -0.0946 106 ARG B NH2 
1888 N N   . LYS B 120 ? 0.2727 0.1874 0.3284 -0.0744 0.0717  -0.0668 107 LYS B N   
1889 C CA  . LYS B 120 ? 0.3228 0.1762 0.3840 -0.0665 0.1057  -0.0585 107 LYS B CA  
1890 C C   . LYS B 120 ? 0.3416 0.1766 0.4156 -0.0666 0.1222  -0.0368 107 LYS B C   
1891 O O   . LYS B 120 ? 0.4129 0.1942 0.4948 -0.0800 0.1553  -0.0411 107 LYS B O   
1892 C CB  . LYS B 120 ? 0.3730 0.2193 0.4314 -0.0301 0.1080  -0.0363 107 LYS B CB  
1893 C CG  . LYS B 120 ? 0.4869 0.2774 0.5553 -0.0079 0.1421  -0.0138 107 LYS B CG  
1894 C CD  . LYS B 120 ? 0.4901 0.2979 0.5639 0.0323  0.1381  0.0121  107 LYS B CD  
1895 C CE  . LYS B 120 ? 0.5728 0.3344 0.6582 0.0633  0.1702  0.0440  107 LYS B CE  
1896 N NZ  . LYS B 120 ? 0.5840 0.3847 0.6801 0.1015  0.1613  0.0680  107 LYS B NZ  
1897 N N   . LYS B 121 ? 0.3126 0.1890 0.3864 -0.0532 0.1029  -0.0147 108 LYS B N   
1898 C CA  . LYS B 121 ? 0.3666 0.2310 0.4446 -0.0488 0.1190  0.0110  108 LYS B CA  
1899 C C   . LYS B 121 ? 0.4003 0.2838 0.4942 -0.0820 0.1214  -0.0057 108 LYS B C   
1900 O O   . LYS B 121 ? 0.4187 0.2898 0.5175 -0.0849 0.1409  0.0124  108 LYS B O   
1901 C CB  . LYS B 121 ? 0.3148 0.2178 0.3805 -0.0187 0.1002  0.0398  108 LYS B CB  
1902 C CG  . LYS B 121 ? 0.3476 0.2460 0.4054 0.0146  0.0985  0.0598  108 LYS B CG  
1903 C CD  . LYS B 121 ? 0.4559 0.2974 0.5150 0.0325  0.1328  0.0870  108 LYS B CD  
1904 C CE  . LYS B 121 ? 0.5548 0.4080 0.6132 0.0728  0.1291  0.1126  108 LYS B CE  
1905 N NZ  . LYS B 121 ? 0.6554 0.4600 0.7158 0.0973  0.1622  0.1436  108 LYS B NZ  
1906 N N   . GLY B 122 ? 0.2974 0.2176 0.4000 -0.1057 0.1022  -0.0379 109 GLY B N   
1907 C CA  . GLY B 122 ? 0.2958 0.2521 0.4225 -0.1368 0.1010  -0.0561 109 GLY B CA  
1908 C C   . GLY B 122 ? 0.2708 0.2769 0.4042 -0.1231 0.0857  -0.0386 109 GLY B C   
1909 O O   . GLY B 122 ? 0.2951 0.3209 0.4500 -0.1393 0.0964  -0.0397 109 GLY B O   
1910 N N   . ILE B 123 ? 0.2159 0.2414 0.3317 -0.0941 0.0637  -0.0252 110 ILE B N   
1911 C CA  . ILE B 123 ? 0.2143 0.2797 0.3327 -0.0798 0.0526  -0.0134 110 ILE B CA  
1912 C C   . ILE B 123 ? 0.1843 0.3017 0.3184 -0.0823 0.0283  -0.0290 110 ILE B C   
1913 O O   . ILE B 123 ? 0.1976 0.3193 0.3215 -0.0783 0.0114  -0.0375 110 ILE B O   
1914 C CB  . ILE B 123 ? 0.2244 0.2816 0.3160 -0.0506 0.0459  0.0062  110 ILE B CB  
1915 C CG1 . ILE B 123 ? 0.3173 0.3342 0.3931 -0.0402 0.0674  0.0296  110 ILE B CG1 
1916 C CG2 . ILE B 123 ? 0.1816 0.2750 0.2727 -0.0402 0.0386  0.0099  110 ILE B CG2 
1917 C CD1 . ILE B 123 ? 0.3332 0.3565 0.3860 -0.0126 0.0567  0.0465  110 ILE B CD1 
1918 N N   . GLN B 124 ? 0.1774 0.3359 0.3366 -0.0860 0.0290  -0.0299 111 GLN B N   
1919 C CA  . GLN B 124 ? 0.1525 0.3625 0.3299 -0.0792 0.0076  -0.0369 111 GLN B CA  
1920 C C   . GLN B 124 ? 0.1365 0.3599 0.3127 -0.0533 0.0056  -0.0252 111 GLN B C   
1921 O O   . GLN B 124 ? 0.1512 0.3874 0.3267 -0.0355 -0.0094 -0.0226 111 GLN B O   
1922 C CB  . GLN B 124 ? 0.2151 0.4542 0.4188 -0.0941 0.0084  -0.0447 111 GLN B CB  
1923 C CG  . GLN B 124 ? 0.2203 0.5048 0.4386 -0.0783 -0.0125 -0.0430 111 GLN B CG  
1924 C CD  . GLN B 124 ? 0.2594 0.5471 0.4563 -0.0735 -0.0341 -0.0472 111 GLN B CD  
1925 O OE1 . GLN B 124 ? 0.2502 0.5076 0.4220 -0.0837 -0.0339 -0.0554 111 GLN B OE1 
1926 N NE2 . GLN B 124 ? 0.1626 0.4877 0.3694 -0.0566 -0.0501 -0.0402 111 GLN B NE2 
1927 N N   . ASN B 125 ? 0.1235 0.3289 0.2892 -0.0488 0.0237  -0.0160 112 ASN B N   
1928 C CA  . ASN B 125 ? 0.1353 0.3487 0.2954 -0.0290 0.0274  -0.0120 112 ASN B CA  
1929 C C   . ASN B 125 ? 0.1534 0.3351 0.2768 -0.0161 0.0221  -0.0089 112 ASN B C   
1930 O O   . ASN B 125 ? 0.1632 0.3208 0.2621 -0.0185 0.0254  -0.0016 112 ASN B O   
1931 C CB  . ASN B 125 ? 0.1709 0.3938 0.3362 -0.0338 0.0512  -0.0078 112 ASN B CB  
1932 C CG  . ASN B 125 ? 0.2219 0.4842 0.4318 -0.0459 0.0582  -0.0129 112 ASN B CG  
1933 O OD1 . ASN B 125 ? 0.2261 0.5106 0.4581 -0.0381 0.0416  -0.0166 112 ASN B OD1 
1934 N ND2 . ASN B 125 ? 0.2366 0.4954 0.4509 -0.0615 0.0814  -0.0079 112 ASN B ND2 
1935 N N   . ALA B 126 ? 0.1260 0.3099 0.2492 -0.0018 0.0162  -0.0138 113 ALA B N   
1936 C CA  . ALA B 126 ? 0.1107 0.2716 0.2057 0.0042  0.0138  -0.0172 113 ALA B CA  
1937 C C   . ALA B 126 ? 0.1379 0.3012 0.2278 0.0113  0.0273  -0.0275 113 ALA B C   
1938 O O   . ALA B 126 ? 0.1350 0.3075 0.2480 0.0208  0.0359  -0.0309 113 ALA B O   
1939 C CB  . ALA B 126 ? 0.1286 0.2759 0.2229 0.0087  0.0008  -0.0180 113 ALA B CB  
1940 N N   . TYR B 127 ? 0.1214 0.2807 0.1818 0.0074  0.0302  -0.0338 114 TYR B N   
1941 C CA  . TYR B 127 ? 0.1437 0.3010 0.1932 0.0085  0.0431  -0.0534 114 TYR B CA  
1942 C C   . TYR B 127 ? 0.1709 0.3050 0.2220 0.0081  0.0385  -0.0644 114 TYR B C   
1943 O O   . TYR B 127 ? 0.1508 0.2855 0.1863 -0.0002 0.0281  -0.0684 114 TYR B O   
1944 C CB  . TYR B 127 ? 0.1669 0.3424 0.1800 0.0012  0.0468  -0.0591 114 TYR B CB  
1945 C CG  . TYR B 127 ? 0.1871 0.3788 0.1943 0.0021  0.0654  -0.0559 114 TYR B CG  
1946 C CD1 . TYR B 127 ? 0.2094 0.4046 0.2500 0.0059  0.0740  -0.0444 114 TYR B CD1 
1947 C CD2 . TYR B 127 ? 0.2522 0.4630 0.2205 -0.0028 0.0751  -0.0659 114 TYR B CD2 
1948 C CE1 . TYR B 127 ? 0.2286 0.4414 0.2689 0.0046  0.0953  -0.0419 114 TYR B CE1 
1949 C CE2 . TYR B 127 ? 0.2477 0.4726 0.2067 -0.0024 0.0965  -0.0619 114 TYR B CE2 
1950 C CZ  . TYR B 127 ? 0.2329 0.4564 0.2306 0.0012  0.1084  -0.0494 114 TYR B CZ  
1951 O OH  . TYR B 127 ? 0.2625 0.4939 0.2563 -0.0001 0.1305  -0.0439 114 TYR B OH  
1952 N N   . ALA B 128 ? 0.1750 0.3854 0.1815 0.0023  -0.0307 -0.0273 115 ALA B N   
1953 C CA  . ALA B 128 ? 0.1482 0.3478 0.1753 -0.0109 -0.0375 -0.0380 115 ALA B CA  
1954 C C   . ALA B 128 ? 0.2104 0.3804 0.2386 -0.0105 -0.0291 -0.0493 115 ALA B C   
1955 O O   . ALA B 128 ? 0.1752 0.3404 0.2006 0.0013  -0.0186 -0.0455 115 ALA B O   
1956 C CB  . ALA B 128 ? 0.1203 0.3184 0.1695 -0.0152 -0.0344 -0.0226 115 ALA B CB  
1957 N N   . PHE B 129 ? 0.1961 0.3458 0.2360 -0.0228 -0.0303 -0.0621 116 PHE B N   
1958 C CA  . PHE B 129 ? 0.2367 0.3466 0.2827 -0.0191 -0.0185 -0.0677 116 PHE B CA  
1959 C C   . PHE B 129 ? 0.3151 0.4023 0.3787 -0.0256 -0.0141 -0.0501 116 PHE B C   
1960 O O   . PHE B 129 ? 0.3417 0.4469 0.4107 -0.0346 -0.0181 -0.0394 116 PHE B O   
1961 C CB  . PHE B 129 ? 0.2697 0.3599 0.3078 -0.0286 -0.0158 -0.1019 116 PHE B CB  
1962 C CG  . PHE B 129 ? 0.2889 0.4038 0.2924 -0.0224 -0.0201 -0.1202 116 PHE B CG  
1963 C CD1 . PHE B 129 ? 0.2839 0.3951 0.2720 -0.0026 -0.0046 -0.1171 116 PHE B CD1 
1964 C CD2 . PHE B 129 ? 0.3205 0.4668 0.3066 -0.0353 -0.0390 -0.1394 116 PHE B CD2 
1965 C CE1 . PHE B 129 ? 0.3133 0.4430 0.2592 0.0037  -0.0018 -0.1305 116 PHE B CE1 
1966 C CE2 . PHE B 129 ? 0.3448 0.5136 0.2838 -0.0264 -0.0438 -0.1520 116 PHE B CE2 
1967 C CZ  . PHE B 129 ? 0.3373 0.4932 0.2509 -0.0072 -0.0221 -0.1465 116 PHE B CZ  
1968 N N   . ASP B 130 ? 0.4119 0.4575 0.4815 -0.0174 -0.0024 -0.0443 117 ASP B N   
1969 C CA  . ASP B 130 ? 0.4795 0.4914 0.5555 -0.0213 0.0073  -0.0231 117 ASP B CA  
1970 C C   . ASP B 130 ? 0.3970 0.4249 0.4586 -0.0096 0.0012  0.0082  117 ASP B C   
1971 O O   . ASP B 130 ? 0.3791 0.3805 0.4316 -0.0101 0.0104  0.0302  117 ASP B O   
1972 C CB  . ASP B 130 ? 0.5116 0.5203 0.6035 -0.0505 0.0126  -0.0360 117 ASP B CB  
1973 C CG  . ASP B 130 ? 0.5557 0.5529 0.6617 -0.0676 0.0137  -0.0745 117 ASP B CG  
1974 O OD1 . ASP B 130 ? 0.6071 0.5654 0.7098 -0.0578 0.0238  -0.0866 117 ASP B OD1 
1975 O OD2 . ASP B 130 ? 0.5329 0.5633 0.6551 -0.0899 0.0038  -0.0953 117 ASP B OD2 
1976 N N   . GLY B 131 ? 0.2921 0.3608 0.3485 -0.0010 -0.0119 0.0089  118 GLY B N   
1977 C CA  . GLY B 131 ? 0.2757 0.3608 0.3205 0.0115  -0.0215 0.0293  118 GLY B CA  
1978 C C   . GLY B 131 ? 0.2627 0.3583 0.2857 0.0012  -0.0230 0.0387  118 GLY B C   
1979 O O   . GLY B 131 ? 0.2277 0.3368 0.2321 0.0104  -0.0337 0.0510  118 GLY B O   
1980 N N   . ASP B 132 ? 0.1941 0.2887 0.2201 -0.0168 -0.0128 0.0306  119 ASP B N   
1981 C CA  . ASP B 132 ? 0.2038 0.3063 0.2110 -0.0249 -0.0066 0.0363  119 ASP B CA  
1982 C C   . ASP B 132 ? 0.1961 0.3298 0.2018 -0.0242 -0.0160 0.0254  119 ASP B C   
1983 O O   . ASP B 132 ? 0.2034 0.3423 0.1834 -0.0250 -0.0168 0.0268  119 ASP B O   
1984 C CB  . ASP B 132 ? 0.2380 0.3381 0.2650 -0.0423 0.0102  0.0302  119 ASP B CB  
1985 C CG  . ASP B 132 ? 0.3414 0.4046 0.3749 -0.0506 0.0268  0.0398  119 ASP B CG  
1986 O OD1 . ASP B 132 ? 0.4206 0.4521 0.4240 -0.0408 0.0334  0.0627  119 ASP B OD1 
1987 O OD2 . ASP B 132 ? 0.4026 0.4688 0.4726 -0.0670 0.0329  0.0246  119 ASP B OD2 
1988 N N   . PHE B 133 ? 0.1578 0.3083 0.1872 -0.0235 -0.0205 0.0136  120 PHE B N   
1989 C CA  . PHE B 133 ? 0.1276 0.2975 0.1626 -0.0239 -0.0230 0.0057  120 PHE B CA  
1990 C C   . PHE B 133 ? 0.1611 0.3444 0.1935 -0.0188 -0.0359 0.0052  120 PHE B C   
1991 O O   . PHE B 133 ? 0.1440 0.3395 0.1729 -0.0257 -0.0387 -0.0042 120 PHE B O   
1992 C CB  . PHE B 133 ? 0.0977 0.2774 0.1519 -0.0213 -0.0207 0.0013  120 PHE B CB  
1993 C CG  . PHE B 133 ? 0.0923 0.2766 0.1557 -0.0239 -0.0145 0.0013  120 PHE B CG  
1994 C CD1 . PHE B 133 ? 0.1218 0.3069 0.1927 -0.0285 -0.0165 -0.0009 120 PHE B CD1 
1995 C CD2 . PHE B 133 ? 0.1140 0.3035 0.1868 -0.0214 -0.0061 0.0028  120 PHE B CD2 
1996 C CE1 . PHE B 133 ? 0.1177 0.3228 0.2101 -0.0301 -0.0155 -0.0021 120 PHE B CE1 
1997 C CE2 . PHE B 133 ? 0.0873 0.2890 0.1774 -0.0171 -0.0024 0.0067  120 PHE B CE2 
1998 C CZ  . PHE B 133 ? 0.0916 0.3081 0.1939 -0.0212 -0.0098 0.0040  120 PHE B CZ  
1999 N N   . SER B 134 ? 0.1555 0.3390 0.1956 -0.0067 -0.0436 0.0122  121 SER B N   
2000 C CA  . SER B 134 ? 0.1494 0.3581 0.1995 0.0027  -0.0596 0.0143  121 SER B CA  
2001 C C   . SER B 134 ? 0.2263 0.4392 0.2414 0.0033  -0.0733 0.0214  121 SER B C   
2002 O O   . SER B 134 ? 0.2016 0.4441 0.2188 -0.0001 -0.0890 0.0113  121 SER B O   
2003 C CB  . SER B 134 ? 0.1869 0.3908 0.2557 0.0221  -0.0610 0.0239  121 SER B CB  
2004 O OG  . SER B 134 ? 0.1923 0.3916 0.2801 0.0215  -0.0466 0.0135  121 SER B OG  
2005 N N   . ALA B 135 ? 0.2072 0.3878 0.1881 0.0058  -0.0647 0.0371  122 ALA B N   
2006 C CA  . ALA B 135 ? 0.2578 0.4369 0.1886 0.0089  -0.0725 0.0487  122 ALA B CA  
2007 C C   . ALA B 135 ? 0.2608 0.4517 0.1700 -0.0098 -0.0689 0.0258  122 ALA B C   
2008 O O   . ALA B 135 ? 0.3035 0.5120 0.1732 -0.0103 -0.0843 0.0209  122 ALA B O   
2009 C CB  . ALA B 135 ? 0.2959 0.4302 0.1977 0.0129  -0.0529 0.0733  122 ALA B CB  
2010 N N   . ALA B 136 ? 0.2246 0.4059 0.1586 -0.0233 -0.0491 0.0108  123 ALA B N   
2011 C CA  . ALA B 136 ? 0.2338 0.4147 0.1550 -0.0380 -0.0371 -0.0110 123 ALA B CA  
2012 C C   . ALA B 136 ? 0.2498 0.4544 0.1984 -0.0479 -0.0480 -0.0356 123 ALA B C   
2013 O O   . ALA B 136 ? 0.2945 0.4926 0.2382 -0.0615 -0.0364 -0.0589 123 ALA B O   
2014 C CB  . ALA B 136 ? 0.2095 0.3717 0.1530 -0.0425 -0.0103 -0.0115 123 ALA B CB  
2015 N N   . GLY B 137 ? 0.1995 0.4289 0.1826 -0.0421 -0.0653 -0.0322 124 GLY B N   
2016 C CA  . GLY B 137 ? 0.2216 0.4730 0.2396 -0.0537 -0.0720 -0.0538 124 GLY B CA  
2017 C C   . GLY B 137 ? 0.2029 0.4519 0.2703 -0.0599 -0.0535 -0.0568 124 GLY B C   
2018 O O   . GLY B 137 ? 0.2162 0.4707 0.3150 -0.0736 -0.0480 -0.0737 124 GLY B O   
2019 N N   . PHE B 138 ? 0.1431 0.3723 0.2122 -0.0479 -0.0403 -0.0378 125 PHE B N   
2020 C CA  . PHE B 138 ? 0.1716 0.3943 0.2714 -0.0470 -0.0225 -0.0331 125 PHE B CA  
2021 C C   . PHE B 138 ? 0.1856 0.4246 0.3036 -0.0345 -0.0275 -0.0231 125 PHE B C   
2022 O O   . PHE B 138 ? 0.2194 0.4641 0.3301 -0.0239 -0.0430 -0.0181 125 PHE B O   
2023 C CB  . PHE B 138 ? 0.1396 0.3362 0.2261 -0.0404 -0.0071 -0.0220 125 PHE B CB  
2024 C CG  . PHE B 138 ? 0.1402 0.3182 0.2174 -0.0475 0.0054  -0.0311 125 PHE B CG  
2025 C CD1 . PHE B 138 ? 0.1477 0.3095 0.2449 -0.0553 0.0241  -0.0402 125 PHE B CD1 
2026 C CD2 . PHE B 138 ? 0.1852 0.3569 0.2363 -0.0461 0.0048  -0.0308 125 PHE B CD2 
2027 C CE1 . PHE B 138 ? 0.1655 0.3037 0.2570 -0.0592 0.0409  -0.0519 125 PHE B CE1 
2028 C CE2 . PHE B 138 ? 0.2266 0.3815 0.2705 -0.0506 0.0226  -0.0417 125 PHE B CE2 
2029 C CZ  . PHE B 138 ? 0.1730 0.3105 0.2372 -0.0559 0.0400  -0.0540 125 PHE B CZ  
2030 N N   . VAL B 139 ? 0.0904 0.3274 0.2265 -0.0325 -0.0097 -0.0179 126 VAL B N   
2031 C CA  . VAL B 139 ? 0.0975 0.3469 0.2471 -0.0202 -0.0063 -0.0124 126 VAL B CA  
2032 C C   . VAL B 139 ? 0.1233 0.3528 0.2426 -0.0085 0.0001  -0.0040 126 VAL B C   
2033 O O   . VAL B 139 ? 0.1866 0.4037 0.2912 -0.0084 0.0120  0.0028  126 VAL B O   
2034 C CB  . VAL B 139 ? 0.1009 0.3620 0.2874 -0.0270 0.0141  -0.0140 126 VAL B CB  
2035 C CG1 . VAL B 139 ? 0.0970 0.3694 0.2912 -0.0121 0.0273  -0.0087 126 VAL B CG1 
2036 C CG2 . VAL B 139 ? 0.1052 0.3824 0.3254 -0.0401 0.0025  -0.0265 126 VAL B CG2 
2037 N N   . GLU B 140 ? 0.1272 0.3527 0.2373 0.0022  -0.0086 -0.0050 127 GLU B N   
2038 C CA  . GLU B 140 ? 0.1102 0.3194 0.1946 0.0089  -0.0037 -0.0071 127 GLU B CA  
2039 C C   . GLU B 140 ? 0.1297 0.3465 0.2188 0.0185  0.0139  -0.0107 127 GLU B C   
2040 O O   . GLU B 140 ? 0.1280 0.3524 0.2411 0.0281  0.0174  -0.0148 127 GLU B O   
2041 C CB  . GLU B 140 ? 0.1213 0.3112 0.1965 0.0115  -0.0141 -0.0109 127 GLU B CB  
2042 C CG  . GLU B 140 ? 0.1600 0.3424 0.2282 0.0016  -0.0236 -0.0052 127 GLU B CG  
2043 C CD  . GLU B 140 ? 0.2635 0.4200 0.3246 0.0009  -0.0258 -0.0047 127 GLU B CD  
2044 O OE1 . GLU B 140 ? 0.2248 0.3641 0.2876 0.0070  -0.0211 -0.0126 127 GLU B OE1 
2045 O OE2 . GLU B 140 ? 0.2815 0.4302 0.3352 -0.0066 -0.0272 0.0027  127 GLU B OE2 
2046 N N   . VAL B 141 ? 0.1601 0.3757 0.2256 0.0190  0.0275  -0.0062 128 VAL B N   
2047 C CA  . VAL B 141 ? 0.1644 0.3859 0.2247 0.0274  0.0526  -0.0065 128 VAL B CA  
2048 C C   . VAL B 141 ? 0.2180 0.4292 0.2587 0.0383  0.0557  -0.0246 128 VAL B C   
2049 O O   . VAL B 141 ? 0.2089 0.4045 0.2192 0.0365  0.0407  -0.0365 128 VAL B O   
2050 C CB  . VAL B 141 ? 0.2634 0.4798 0.2858 0.0293  0.0669  0.0090  128 VAL B CB  
2051 C CG1 . VAL B 141 ? 0.2339 0.4536 0.2422 0.0378  0.1006  0.0121  128 VAL B CG1 
2052 C CG2 . VAL B 141 ? 0.2617 0.4754 0.3088 0.0195  0.0698  0.0255  128 VAL B CG2 
2053 N N   . ARG B 142 ? 0.2391 0.4599 0.3055 0.0483  0.0778  -0.0298 129 ARG B N   
2054 C CA  . ARG B 142 ? 0.2719 0.4766 0.3263 0.0616  0.0893  -0.0504 129 ARG B CA  
2055 C C   . ARG B 142 ? 0.3521 0.5617 0.3816 0.0707  0.1263  -0.0558 129 ARG B C   
2056 O O   . ARG B 142 ? 0.3423 0.5734 0.3919 0.0684  0.1478  -0.0391 129 ARG B O   
2057 C CB  . ARG B 142 ? 0.2988 0.5087 0.4126 0.0734  0.0855  -0.0511 129 ARG B CB  
2058 C CG  . ARG B 142 ? 0.2457 0.4427 0.3673 0.0678  0.0540  -0.0436 129 ARG B CG  
2059 C CD  . ARG B 142 ? 0.3270 0.4818 0.4094 0.0634  0.0481  -0.0597 129 ARG B CD  
2060 N NE  . ARG B 142 ? 0.3439 0.4837 0.4308 0.0550  0.0259  -0.0490 129 ARG B NE  
2061 C CZ  . ARG B 142 ? 0.2733 0.4147 0.3391 0.0370  0.0110  -0.0455 129 ARG B CZ  
2062 N NH1 . ARG B 142 ? 0.2109 0.3689 0.2509 0.0288  0.0109  -0.0492 129 ARG B NH1 
2063 N NH2 . ARG B 142 ? 0.2238 0.3506 0.2945 0.0302  -0.0012 -0.0354 129 ARG B NH2 
2064 N N   . PRO B 143 ? 0.4117 0.5983 0.3954 0.0789  0.1377  -0.0813 130 PRO B N   
2065 C CA  . PRO B 143 ? 0.4936 0.6816 0.4368 0.0890  0.1771  -0.0893 130 PRO B CA  
2066 C C   . PRO B 143 ? 0.5114 0.7094 0.5200 0.1011  0.2116  -0.0900 130 PRO B C   
2067 O O   . PRO B 143 ? 0.5773 0.8015 0.6270 0.0923  0.2247  -0.0713 130 PRO B O   
2068 C CB  . PRO B 143 ? 0.5761 0.7334 0.4505 0.0900  0.1718  -0.1256 130 PRO B CB  
2069 C CG  . PRO B 143 ? 0.5582 0.6929 0.4760 0.0862  0.1472  -0.1392 130 PRO B CG  
2070 C CD  . PRO B 143 ? 0.4886 0.6429 0.4523 0.0763  0.1182  -0.1071 130 PRO B CD  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -12 ?   ?   ?   A . n 
A 1 2   GLY 2   -11 ?   ?   ?   A . n 
A 1 3   SER 3   -10 ?   ?   ?   A . n 
A 1 4   SER 4   -9  ?   ?   ?   A . n 
A 1 5   HIS 5   -8  ?   ?   ?   A . n 
A 1 6   HIS 6   -7  ?   ?   ?   A . n 
A 1 7   HIS 7   -6  ?   ?   ?   A . n 
A 1 8   HIS 8   -5  ?   ?   ?   A . n 
A 1 9   HIS 9   -4  ?   ?   ?   A . n 
A 1 10  HIS 10  -3  ?   ?   ?   A . n 
A 1 11  SER 11  -2  ?   ?   ?   A . n 
A 1 12  GLN 12  -1  ?   ?   ?   A . n 
A 1 13  ALA 13  0   ?   ?   ?   A . n 
A 1 14  SER 14  1   1   SER SER A . n 
A 1 15  ILE 15  2   2   ILE ILE A . n 
A 1 16  PHE 16  3   3   PHE PHE A . n 
A 1 17  VAL 17  4   4   VAL VAL A . n 
A 1 18  ASP 18  5   5   ASP ASP A . n 
A 1 19  THR 19  6   6   THR THR A . n 
A 1 20  SER 20  7   7   SER SER A . n 
A 1 21  PHE 21  8   8   PHE PHE A . n 
A 1 22  TRP 22  9   9   TRP TRP A . n 
A 1 23  ALA 23  10  10  ALA ALA A . n 
A 1 24  ALA 24  11  11  ALA ALA A . n 
A 1 25  LEU 25  12  12  LEU LEU A . n 
A 1 26  GLY 26  13  13  GLY GLY A . n 
A 1 27  ASN 27  14  14  ASN ASN A . n 
A 1 28  ALA 28  15  15  ALA ALA A . n 
A 1 29  GLY 29  16  16  GLY GLY A . n 
A 1 30  ASP 30  17  17  ASP ASP A . n 
A 1 31  ALA 31  18  18  ALA ALA A . n 
A 1 32  ARG 32  19  19  ARG ARG A . n 
A 1 33  HIS 33  20  20  HIS HIS A . n 
A 1 34  GLY 34  21  21  GLY GLY A . n 
A 1 35  THR 35  22  22  THR THR A . n 
A 1 36  ALA 36  23  23  ALA ALA A . n 
A 1 37  LYS 37  24  24  LYS LYS A . n 
A 1 38  ARG 38  25  25  ARG ARG A . n 
A 1 39  LEU 39  26  26  LEU LEU A . n 
A 1 40  TRP 40  27  27  TRP TRP A . n 
A 1 41  ALA 41  28  28  ALA ALA A . n 
A 1 42  SER 42  29  29  SER SER A . n 
A 1 43  LYS 43  30  30  LYS LYS A . n 
A 1 44  PRO 44  31  31  PRO PRO A . n 
A 1 45  PRO 45  32  32  PRO PRO A . n 
A 1 46  VAL 46  33  33  VAL VAL A . n 
A 1 47  VAL 47  34  34  VAL VAL A . n 
A 1 48  MET 48  35  35  MET MET A . n 
A 1 49  THR 49  36  36  THR THR A . n 
A 1 50  SER 50  37  37  SER SER A . n 
A 1 51  ASN 51  38  38  ASN ASN A . n 
A 1 52  HIS 52  39  39  HIS HIS A . n 
A 1 53  VAL 53  40  40  VAL VAL A . n 
A 1 54  LEU 54  41  41  LEU LEU A . n 
A 1 55  GLY 55  42  42  GLY GLY A . n 
A 1 56  GLU 56  43  43  GLU GLU A . n 
A 1 57  THR 57  44  44  THR THR A . n 
A 1 58  TRP 58  45  45  TRP TRP A . n 
A 1 59  THR 59  46  46  THR THR A . n 
A 1 60  LEU 60  47  47  LEU LEU A . n 
A 1 61  LEU 61  48  48  LEU LEU A . n 
A 1 62  ASN 62  49  49  ASN ASN A . n 
A 1 63  ARG 63  50  50  ARG ARG A . n 
A 1 64  ARG 64  51  51  ARG ARG A . n 
A 1 65  CYS 65  52  52  CYS CYS A . n 
A 1 66  GLY 66  53  53  GLY GLY A . n 
A 1 67  HIS 67  54  54  HIS HIS A . n 
A 1 68  ARG 68  55  55  ARG ARG A . n 
A 1 69  ALA 69  56  56  ALA ALA A . n 
A 1 70  ALA 70  57  57  ALA ALA A . n 
A 1 71  VAL 71  58  58  VAL VAL A . n 
A 1 72  ALA 72  59  59  ALA ALA A . n 
A 1 73  ALA 73  60  60  ALA ALA A . n 
A 1 74  ALA 74  61  61  ALA ALA A . n 
A 1 75  ALA 75  62  62  ALA ALA A . n 
A 1 76  ILE 76  63  63  ILE ILE A . n 
A 1 77  ARG 77  64  64  ARG ARG A . n 
A 1 78  LEU 78  65  65  LEU LEU A . n 
A 1 79  SER 79  66  66  SER SER A . n 
A 1 80  THR 80  67  67  THR THR A . n 
A 1 81  VAL 81  68  68  VAL VAL A . n 
A 1 82  VAL 82  69  69  VAL VAL A . n 
A 1 83  ARG 83  70  70  ARG ARG A . n 
A 1 84  VAL 84  71  71  VAL VAL A . n 
A 1 85  GLU 85  72  72  GLU GLU A . n 
A 1 86  HIS 86  73  73  HIS HIS A . n 
A 1 87  VAL 87  74  74  VAL VAL A . n 
A 1 88  THR 88  75  75  THR THR A . n 
A 1 89  ALA 89  76  76  ALA ALA A . n 
A 1 90  ASP 90  77  77  ASP ASP A . n 
A 1 91  LEU 91  78  78  LEU LEU A . n 
A 1 92  GLU 92  79  79  GLU GLU A . n 
A 1 93  GLU 93  80  80  GLU GLU A . n 
A 1 94  GLN 94  81  81  GLN GLN A . n 
A 1 95  ALA 95  82  82  ALA ALA A . n 
A 1 96  TRP 96  83  83  TRP TRP A . n 
A 1 97  GLU 97  84  84  GLU GLU A . n 
A 1 98  TRP 98  85  85  TRP TRP A . n 
A 1 99  LEU 99  86  86  LEU LEU A . n 
A 1 100 VAL 100 87  87  VAL VAL A . n 
A 1 101 ARG 101 88  88  ARG ARG A . n 
A 1 102 HIS 102 89  89  HIS HIS A . n 
A 1 103 ASP 103 90  90  ASP ASP A . n 
A 1 104 GLU 104 91  91  GLU GLU A . n 
A 1 105 ARG 105 92  92  ARG ARG A . n 
A 1 106 GLU 106 93  93  GLU GLU A . n 
A 1 107 TYR 107 94  94  TYR TYR A . n 
A 1 108 SER 108 95  95  SER SER A . n 
A 1 109 PHE 109 96  96  PHE PHE A . n 
A 1 110 VAL 110 97  97  VAL VAL A . n 
A 1 111 ASP 111 98  98  ASP ASP A . n 
A 1 112 ALA 112 99  99  ALA ALA A . n 
A 1 113 THR 113 100 100 THR THR A . n 
A 1 114 SER 114 101 101 SER SER A . n 
A 1 115 PHE 115 102 102 PHE PHE A . n 
A 1 116 ALA 116 103 103 ALA ALA A . n 
A 1 117 VAL 117 104 104 VAL VAL A . n 
A 1 118 MET 118 105 105 MET MET A . n 
A 1 119 ARG 119 106 106 ARG ARG A . n 
A 1 120 LYS 120 107 107 LYS LYS A . n 
A 1 121 LYS 121 108 108 LYS LYS A . n 
A 1 122 GLY 122 109 109 GLY GLY A . n 
A 1 123 ILE 123 110 110 ILE ILE A . n 
A 1 124 GLN 124 111 111 GLN GLN A . n 
A 1 125 ASN 125 112 112 ASN ASN A . n 
A 1 126 ALA 126 113 113 ALA ALA A . n 
A 1 127 TYR 127 114 114 TYR TYR A . n 
A 1 128 ALA 128 115 115 ALA ALA A . n 
A 1 129 PHE 129 116 116 PHE PHE A . n 
A 1 130 ASP 130 117 117 ASP ASP A . n 
A 1 131 GLY 131 118 118 GLY GLY A . n 
A 1 132 ASP 132 119 119 ASP ASP A . n 
A 1 133 PHE 133 120 120 PHE PHE A . n 
A 1 134 SER 134 121 121 SER SER A . n 
A 1 135 ALA 135 122 122 ALA ALA A . n 
A 1 136 ALA 136 123 123 ALA ALA A . n 
A 1 137 GLY 137 124 124 GLY GLY A . n 
A 1 138 PHE 138 125 125 PHE PHE A . n 
A 1 139 VAL 139 126 126 VAL VAL A . n 
A 1 140 GLU 140 127 127 GLU GLU A . n 
A 1 141 VAL 141 128 128 VAL VAL A . n 
A 1 142 ARG 142 129 129 ARG ARG A . n 
A 1 143 PRO 143 130 130 PRO PRO A . n 
A 1 144 GLU 144 131 ?   ?   ?   A . n 
B 2 1   MET 1   -12 ?   ?   ?   B . n 
B 2 2   GLY 2   -11 ?   ?   ?   B . n 
B 2 3   SER 3   -10 ?   ?   ?   B . n 
B 2 4   SER 4   -9  ?   ?   ?   B . n 
B 2 5   HIS 5   -8  ?   ?   ?   B . n 
B 2 6   HIS 6   -7  ?   ?   ?   B . n 
B 2 7   HIS 7   -6  ?   ?   ?   B . n 
B 2 8   HIS 8   -5  ?   ?   ?   B . n 
B 2 9   HIS 9   -4  ?   ?   ?   B . n 
B 2 10  HIS 10  -3  ?   ?   ?   B . n 
B 2 11  SER 11  -2  ?   ?   ?   B . n 
B 2 12  GLN 12  -1  ?   ?   ?   B . n 
B 2 13  ALA 13  0   0   ALA ALA B . n 
B 2 14  SER 14  1   1   SER SER B . n 
B 2 15  ILE 15  2   2   ILE ILE B . n 
B 2 16  PHE 16  3   3   PHE PHE B . n 
B 2 17  VAL 17  4   4   VAL VAL B . n 
B 2 18  ASP 18  5   5   ASP ASP B . n 
B 2 19  THR 19  6   6   THR THR B . n 
B 2 20  SER 20  7   7   SER SER B . n 
B 2 21  PHE 21  8   8   PHE PHE B . n 
B 2 22  TRP 22  9   9   TRP TRP B . n 
B 2 23  ALA 23  10  10  ALA ALA B . n 
B 2 24  ALA 24  11  11  ALA ALA B . n 
B 2 25  LEU 25  12  12  LEU LEU B . n 
B 2 26  GLY 26  13  13  GLY GLY B . n 
B 2 27  ASN 27  14  14  ASN ASN B . n 
B 2 28  ALA 28  15  15  ALA ALA B . n 
B 2 29  GLY 29  16  16  GLY GLY B . n 
B 2 30  ASP 30  17  17  ASP ASP B . n 
B 2 31  ALA 31  18  18  ALA ALA B . n 
B 2 32  ARG 32  19  19  ARG ARG B . n 
B 2 33  HIS 33  20  20  HIS HIS B . n 
B 2 34  GLY 34  21  21  GLY GLY B . n 
B 2 35  THR 35  22  22  THR THR B . n 
B 2 36  ALA 36  23  23  ALA ALA B . n 
B 2 37  LYS 37  24  24  LYS LYS B . n 
B 2 38  ARG 38  25  25  ARG ARG B . n 
B 2 39  LEU 39  26  26  LEU LEU B . n 
B 2 40  TRP 40  27  27  TRP TRP B . n 
B 2 41  ALA 41  28  28  ALA ALA B . n 
B 2 42  SER 42  29  29  SER SER B . n 
B 2 43  LYS 43  30  30  LYS LYS B . n 
B 2 44  PRO 44  31  31  PRO PRO B . n 
B 2 45  PRO 45  32  32  PRO PRO B . n 
B 2 46  VAL 46  33  33  VAL VAL B . n 
B 2 47  VAL 47  34  34  VAL VAL B . n 
B 2 48  MET 48  35  35  MET MET B . n 
B 2 49  THR 49  36  36  THR THR B . n 
B 2 50  SER 50  37  37  SER SER B . n 
B 2 51  ASN 51  38  38  ASN ASN B . n 
B 2 52  HIS 52  39  39  HIS HIS B . n 
B 2 53  VAL 53  40  40  VAL VAL B . n 
B 2 54  LEU 54  41  41  LEU LEU B . n 
B 2 55  GLY 55  42  42  GLY GLY B . n 
B 2 56  GLU 56  43  43  GLU GLU B . n 
B 2 57  THR 57  44  44  THR THR B . n 
B 2 58  TRP 58  45  45  TRP TRP B . n 
B 2 59  THR 59  46  46  THR THR B . n 
B 2 60  LEU 60  47  47  LEU LEU B . n 
B 2 61  LEU 61  48  48  LEU LEU B . n 
B 2 62  ASN 62  49  49  ASN ASN B . n 
B 2 63  ARG 63  50  50  ARG ARG B . n 
B 2 64  ARG 64  51  51  ARG ARG B . n 
B 2 65  CSO 65  52  52  CSO CSO B . n 
B 2 66  GLY 66  53  53  GLY GLY B . n 
B 2 67  HIS 67  54  54  HIS HIS B . n 
B 2 68  ARG 68  55  55  ARG ARG B . n 
B 2 69  ALA 69  56  56  ALA ALA B . n 
B 2 70  ALA 70  57  57  ALA ALA B . n 
B 2 71  VAL 71  58  58  VAL VAL B . n 
B 2 72  ALA 72  59  59  ALA ALA B . n 
B 2 73  ALA 73  60  60  ALA ALA B . n 
B 2 74  ALA 74  61  61  ALA ALA B . n 
B 2 75  ALA 75  62  62  ALA ALA B . n 
B 2 76  ILE 76  63  63  ILE ILE B . n 
B 2 77  ARG 77  64  64  ARG ARG B . n 
B 2 78  LEU 78  65  65  LEU LEU B . n 
B 2 79  SER 79  66  66  SER SER B . n 
B 2 80  THR 80  67  67  THR THR B . n 
B 2 81  VAL 81  68  68  VAL VAL B . n 
B 2 82  VAL 82  69  69  VAL VAL B . n 
B 2 83  ARG 83  70  70  ARG ARG B . n 
B 2 84  VAL 84  71  71  VAL VAL B . n 
B 2 85  GLU 85  72  72  GLU GLU B . n 
B 2 86  HIS 86  73  73  HIS HIS B . n 
B 2 87  VAL 87  74  74  VAL VAL B . n 
B 2 88  THR 88  75  75  THR THR B . n 
B 2 89  ALA 89  76  76  ALA ALA B . n 
B 2 90  ASP 90  77  77  ASP ASP B . n 
B 2 91  LEU 91  78  78  LEU LEU B . n 
B 2 92  GLU 92  79  79  GLU GLU B . n 
B 2 93  GLU 93  80  80  GLU GLU B . n 
B 2 94  GLN 94  81  81  GLN GLN B . n 
B 2 95  ALA 95  82  82  ALA ALA B . n 
B 2 96  TRP 96  83  83  TRP TRP B . n 
B 2 97  GLU 97  84  84  GLU GLU B . n 
B 2 98  TRP 98  85  85  TRP TRP B . n 
B 2 99  LEU 99  86  86  LEU LEU B . n 
B 2 100 VAL 100 87  87  VAL VAL B . n 
B 2 101 ARG 101 88  88  ARG ARG B . n 
B 2 102 HIS 102 89  89  HIS HIS B . n 
B 2 103 ASP 103 90  90  ASP ASP B . n 
B 2 104 GLU 104 91  91  GLU GLU B . n 
B 2 105 ARG 105 92  92  ARG ARG B . n 
B 2 106 GLU 106 93  93  GLU GLU B . n 
B 2 107 TYR 107 94  94  TYR TYR B . n 
B 2 108 SER 108 95  95  SER SER B . n 
B 2 109 PHE 109 96  96  PHE PHE B . n 
B 2 110 VAL 110 97  97  VAL VAL B . n 
B 2 111 ASP 111 98  98  ASP ASP B . n 
B 2 112 ALA 112 99  99  ALA ALA B . n 
B 2 113 THR 113 100 100 THR THR B . n 
B 2 114 SER 114 101 101 SER SER B . n 
B 2 115 PHE 115 102 102 PHE PHE B . n 
B 2 116 ALA 116 103 103 ALA ALA B . n 
B 2 117 VAL 117 104 104 VAL VAL B . n 
B 2 118 MET 118 105 105 MET MET B . n 
B 2 119 ARG 119 106 106 ARG ARG B . n 
B 2 120 LYS 120 107 107 LYS LYS B . n 
B 2 121 LYS 121 108 108 LYS LYS B . n 
B 2 122 GLY 122 109 109 GLY GLY B . n 
B 2 123 ILE 123 110 110 ILE ILE B . n 
B 2 124 GLN 124 111 111 GLN GLN B . n 
B 2 125 ASN 125 112 112 ASN ASN B . n 
B 2 126 ALA 126 113 113 ALA ALA B . n 
B 2 127 TYR 127 114 114 TYR TYR B . n 
B 2 128 ALA 128 115 115 ALA ALA B . n 
B 2 129 PHE 129 116 116 PHE PHE B . n 
B 2 130 ASP 130 117 117 ASP ASP B . n 
B 2 131 GLY 131 118 118 GLY GLY B . n 
B 2 132 ASP 132 119 119 ASP ASP B . n 
B 2 133 PHE 133 120 120 PHE PHE B . n 
B 2 134 SER 134 121 121 SER SER B . n 
B 2 135 ALA 135 122 122 ALA ALA B . n 
B 2 136 ALA 136 123 123 ALA ALA B . n 
B 2 137 GLY 137 124 124 GLY GLY B . n 
B 2 138 PHE 138 125 125 PHE PHE B . n 
B 2 139 VAL 139 126 126 VAL VAL B . n 
B 2 140 GLU 140 127 127 GLU GLU B . n 
B 2 141 VAL 141 128 128 VAL VAL B . n 
B 2 142 ARG 142 129 129 ARG ARG B . n 
B 2 143 PRO 143 130 130 PRO PRO B . n 
B 2 144 GLU 144 131 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   201 144 HOH HOH A . 
C 3 HOH 2   202 239 HOH HOH A . 
C 3 HOH 3   203 214 HOH HOH A . 
C 3 HOH 4   204 136 HOH HOH A . 
C 3 HOH 5   205 207 HOH HOH A . 
C 3 HOH 6   206 155 HOH HOH A . 
C 3 HOH 7   207 89  HOH HOH A . 
C 3 HOH 8   208 148 HOH HOH A . 
C 3 HOH 9   209 215 HOH HOH A . 
C 3 HOH 10  210 176 HOH HOH A . 
C 3 HOH 11  211 14  HOH HOH A . 
C 3 HOH 12  212 31  HOH HOH A . 
C 3 HOH 13  213 166 HOH HOH A . 
C 3 HOH 14  214 87  HOH HOH A . 
C 3 HOH 15  215 259 HOH HOH A . 
C 3 HOH 16  216 254 HOH HOH A . 
C 3 HOH 17  217 226 HOH HOH A . 
C 3 HOH 18  218 182 HOH HOH A . 
C 3 HOH 19  219 105 HOH HOH A . 
C 3 HOH 20  220 261 HOH HOH A . 
C 3 HOH 21  221 24  HOH HOH A . 
C 3 HOH 22  222 43  HOH HOH A . 
C 3 HOH 23  223 2   HOH HOH A . 
C 3 HOH 24  224 181 HOH HOH A . 
C 3 HOH 25  225 94  HOH HOH A . 
C 3 HOH 26  226 13  HOH HOH A . 
C 3 HOH 27  227 227 HOH HOH A . 
C 3 HOH 28  228 132 HOH HOH A . 
C 3 HOH 29  229 86  HOH HOH A . 
C 3 HOH 30  230 129 HOH HOH A . 
C 3 HOH 31  231 25  HOH HOH A . 
C 3 HOH 32  232 22  HOH HOH A . 
C 3 HOH 33  233 189 HOH HOH A . 
C 3 HOH 34  234 209 HOH HOH A . 
C 3 HOH 35  235 41  HOH HOH A . 
C 3 HOH 36  236 30  HOH HOH A . 
C 3 HOH 37  237 103 HOH HOH A . 
C 3 HOH 38  238 128 HOH HOH A . 
C 3 HOH 39  239 116 HOH HOH A . 
C 3 HOH 40  240 32  HOH HOH A . 
C 3 HOH 41  241 100 HOH HOH A . 
C 3 HOH 42  242 17  HOH HOH A . 
C 3 HOH 43  243 250 HOH HOH A . 
C 3 HOH 44  244 96  HOH HOH A . 
C 3 HOH 45  245 213 HOH HOH A . 
C 3 HOH 46  246 92  HOH HOH A . 
C 3 HOH 47  247 52  HOH HOH A . 
C 3 HOH 48  248 168 HOH HOH A . 
C 3 HOH 49  249 60  HOH HOH A . 
C 3 HOH 50  250 18  HOH HOH A . 
C 3 HOH 51  251 75  HOH HOH A . 
C 3 HOH 52  252 107 HOH HOH A . 
C 3 HOH 53  253 37  HOH HOH A . 
C 3 HOH 54  254 3   HOH HOH A . 
C 3 HOH 55  255 127 HOH HOH A . 
C 3 HOH 56  256 245 HOH HOH A . 
C 3 HOH 57  257 88  HOH HOH A . 
C 3 HOH 58  258 5   HOH HOH A . 
C 3 HOH 59  259 147 HOH HOH A . 
C 3 HOH 60  260 80  HOH HOH A . 
C 3 HOH 61  261 35  HOH HOH A . 
C 3 HOH 62  262 19  HOH HOH A . 
C 3 HOH 63  263 73  HOH HOH A . 
C 3 HOH 64  264 230 HOH HOH A . 
C 3 HOH 65  265 177 HOH HOH A . 
C 3 HOH 66  266 233 HOH HOH A . 
C 3 HOH 67  267 115 HOH HOH A . 
C 3 HOH 68  268 125 HOH HOH A . 
C 3 HOH 69  269 158 HOH HOH A . 
C 3 HOH 70  270 45  HOH HOH A . 
C 3 HOH 71  271 192 HOH HOH A . 
C 3 HOH 72  272 184 HOH HOH A . 
C 3 HOH 73  273 12  HOH HOH A . 
C 3 HOH 74  274 15  HOH HOH A . 
C 3 HOH 75  275 255 HOH HOH A . 
C 3 HOH 76  276 44  HOH HOH A . 
C 3 HOH 77  277 141 HOH HOH A . 
C 3 HOH 78  278 85  HOH HOH A . 
C 3 HOH 79  279 159 HOH HOH A . 
C 3 HOH 80  280 55  HOH HOH A . 
C 3 HOH 81  281 51  HOH HOH A . 
C 3 HOH 82  282 46  HOH HOH A . 
C 3 HOH 83  283 4   HOH HOH A . 
C 3 HOH 84  284 162 HOH HOH A . 
C 3 HOH 85  285 241 HOH HOH A . 
C 3 HOH 86  286 198 HOH HOH A . 
C 3 HOH 87  287 185 HOH HOH A . 
C 3 HOH 88  288 139 HOH HOH A . 
C 3 HOH 89  289 36  HOH HOH A . 
C 3 HOH 90  290 206 HOH HOH A . 
C 3 HOH 91  291 193 HOH HOH A . 
C 3 HOH 92  292 216 HOH HOH A . 
C 3 HOH 93  293 236 HOH HOH A . 
C 3 HOH 94  294 102 HOH HOH A . 
C 3 HOH 95  295 188 HOH HOH A . 
C 3 HOH 96  296 247 HOH HOH A . 
C 3 HOH 97  297 111 HOH HOH A . 
C 3 HOH 98  298 140 HOH HOH A . 
C 3 HOH 99  299 165 HOH HOH A . 
C 3 HOH 100 300 186 HOH HOH A . 
C 3 HOH 101 301 246 HOH HOH A . 
C 3 HOH 102 302 240 HOH HOH A . 
C 3 HOH 103 303 256 HOH HOH A . 
C 3 HOH 104 304 191 HOH HOH A . 
C 3 HOH 105 305 121 HOH HOH A . 
C 3 HOH 106 306 118 HOH HOH A . 
C 3 HOH 107 307 205 HOH HOH A . 
C 3 HOH 108 308 38  HOH HOH A . 
C 3 HOH 109 309 243 HOH HOH A . 
C 3 HOH 110 310 174 HOH HOH A . 
C 3 HOH 111 311 95  HOH HOH A . 
C 3 HOH 112 312 47  HOH HOH A . 
C 3 HOH 113 313 218 HOH HOH A . 
C 3 HOH 114 314 248 HOH HOH A . 
C 3 HOH 115 315 169 HOH HOH A . 
C 3 HOH 116 316 119 HOH HOH A . 
C 3 HOH 117 317 154 HOH HOH A . 
C 3 HOH 118 318 142 HOH HOH A . 
C 3 HOH 119 319 76  HOH HOH A . 
C 3 HOH 120 320 117 HOH HOH A . 
C 3 HOH 121 321 260 HOH HOH A . 
C 3 HOH 122 322 153 HOH HOH A . 
C 3 HOH 123 323 252 HOH HOH A . 
C 3 HOH 124 324 253 HOH HOH A . 
C 3 HOH 125 325 197 HOH HOH A . 
C 3 HOH 126 326 173 HOH HOH A . 
C 3 HOH 127 327 120 HOH HOH A . 
C 3 HOH 128 328 251 HOH HOH A . 
C 3 HOH 129 329 249 HOH HOH A . 
D 3 HOH 1   201 143 HOH HOH B . 
D 3 HOH 2   202 167 HOH HOH B . 
D 3 HOH 3   203 175 HOH HOH B . 
D 3 HOH 4   204 194 HOH HOH B . 
D 3 HOH 5   205 134 HOH HOH B . 
D 3 HOH 6   206 237 HOH HOH B . 
D 3 HOH 7   207 57  HOH HOH B . 
D 3 HOH 8   208 106 HOH HOH B . 
D 3 HOH 9   209 238 HOH HOH B . 
D 3 HOH 10  210 1   HOH HOH B . 
D 3 HOH 11  211 126 HOH HOH B . 
D 3 HOH 12  212 56  HOH HOH B . 
D 3 HOH 13  213 149 HOH HOH B . 
D 3 HOH 14  214 180 HOH HOH B . 
D 3 HOH 15  215 69  HOH HOH B . 
D 3 HOH 16  216 81  HOH HOH B . 
D 3 HOH 17  217 64  HOH HOH B . 
D 3 HOH 18  218 231 HOH HOH B . 
D 3 HOH 19  219 65  HOH HOH B . 
D 3 HOH 20  220 11  HOH HOH B . 
D 3 HOH 21  221 59  HOH HOH B . 
D 3 HOH 22  222 124 HOH HOH B . 
D 3 HOH 23  223 195 HOH HOH B . 
D 3 HOH 24  224 160 HOH HOH B . 
D 3 HOH 25  225 146 HOH HOH B . 
D 3 HOH 26  226 9   HOH HOH B . 
D 3 HOH 27  227 72  HOH HOH B . 
D 3 HOH 28  228 7   HOH HOH B . 
D 3 HOH 29  229 150 HOH HOH B . 
D 3 HOH 30  230 67  HOH HOH B . 
D 3 HOH 31  231 79  HOH HOH B . 
D 3 HOH 32  232 179 HOH HOH B . 
D 3 HOH 33  233 50  HOH HOH B . 
D 3 HOH 34  234 199 HOH HOH B . 
D 3 HOH 35  235 39  HOH HOH B . 
D 3 HOH 36  236 229 HOH HOH B . 
D 3 HOH 37  237 21  HOH HOH B . 
D 3 HOH 38  238 138 HOH HOH B . 
D 3 HOH 39  239 29  HOH HOH B . 
D 3 HOH 40  240 66  HOH HOH B . 
D 3 HOH 41  241 6   HOH HOH B . 
D 3 HOH 42  242 97  HOH HOH B . 
D 3 HOH 43  243 163 HOH HOH B . 
D 3 HOH 44  244 109 HOH HOH B . 
D 3 HOH 45  245 8   HOH HOH B . 
D 3 HOH 46  246 220 HOH HOH B . 
D 3 HOH 47  247 23  HOH HOH B . 
D 3 HOH 48  248 211 HOH HOH B . 
D 3 HOH 49  249 10  HOH HOH B . 
D 3 HOH 50  250 187 HOH HOH B . 
D 3 HOH 51  251 27  HOH HOH B . 
D 3 HOH 52  252 152 HOH HOH B . 
D 3 HOH 53  253 68  HOH HOH B . 
D 3 HOH 54  254 20  HOH HOH B . 
D 3 HOH 55  255 133 HOH HOH B . 
D 3 HOH 56  256 98  HOH HOH B . 
D 3 HOH 57  257 63  HOH HOH B . 
D 3 HOH 58  258 54  HOH HOH B . 
D 3 HOH 59  259 208 HOH HOH B . 
D 3 HOH 60  260 242 HOH HOH B . 
D 3 HOH 61  261 74  HOH HOH B . 
D 3 HOH 62  262 48  HOH HOH B . 
D 3 HOH 63  263 91  HOH HOH B . 
D 3 HOH 64  264 16  HOH HOH B . 
D 3 HOH 65  265 53  HOH HOH B . 
D 3 HOH 66  266 210 HOH HOH B . 
D 3 HOH 67  267 151 HOH HOH B . 
D 3 HOH 68  268 62  HOH HOH B . 
D 3 HOH 69  269 99  HOH HOH B . 
D 3 HOH 70  270 82  HOH HOH B . 
D 3 HOH 71  271 157 HOH HOH B . 
D 3 HOH 72  272 202 HOH HOH B . 
D 3 HOH 73  273 70  HOH HOH B . 
D 3 HOH 74  274 26  HOH HOH B . 
D 3 HOH 75  275 258 HOH HOH B . 
D 3 HOH 76  276 244 HOH HOH B . 
D 3 HOH 77  277 34  HOH HOH B . 
D 3 HOH 78  278 137 HOH HOH B . 
D 3 HOH 79  279 145 HOH HOH B . 
D 3 HOH 80  280 58  HOH HOH B . 
D 3 HOH 81  281 228 HOH HOH B . 
D 3 HOH 82  282 49  HOH HOH B . 
D 3 HOH 83  283 234 HOH HOH B . 
D 3 HOH 84  284 33  HOH HOH B . 
D 3 HOH 85  285 113 HOH HOH B . 
D 3 HOH 86  286 61  HOH HOH B . 
D 3 HOH 87  287 108 HOH HOH B . 
D 3 HOH 88  288 130 HOH HOH B . 
D 3 HOH 89  289 93  HOH HOH B . 
D 3 HOH 90  290 40  HOH HOH B . 
D 3 HOH 91  291 77  HOH HOH B . 
D 3 HOH 92  292 83  HOH HOH B . 
D 3 HOH 93  293 101 HOH HOH B . 
D 3 HOH 94  294 212 HOH HOH B . 
D 3 HOH 95  295 123 HOH HOH B . 
D 3 HOH 96  296 122 HOH HOH B . 
D 3 HOH 97  297 28  HOH HOH B . 
D 3 HOH 98  298 223 HOH HOH B . 
D 3 HOH 99  299 203 HOH HOH B . 
D 3 HOH 100 300 104 HOH HOH B . 
D 3 HOH 101 301 110 HOH HOH B . 
D 3 HOH 102 302 221 HOH HOH B . 
D 3 HOH 103 303 171 HOH HOH B . 
D 3 HOH 104 304 90  HOH HOH B . 
D 3 HOH 105 305 200 HOH HOH B . 
D 3 HOH 106 306 222 HOH HOH B . 
D 3 HOH 107 307 135 HOH HOH B . 
D 3 HOH 108 308 84  HOH HOH B . 
D 3 HOH 109 309 204 HOH HOH B . 
D 3 HOH 110 310 161 HOH HOH B . 
D 3 HOH 111 311 225 HOH HOH B . 
D 3 HOH 112 312 224 HOH HOH B . 
D 3 HOH 113 313 232 HOH HOH B . 
D 3 HOH 114 314 219 HOH HOH B . 
D 3 HOH 115 315 131 HOH HOH B . 
D 3 HOH 116 316 235 HOH HOH B . 
D 3 HOH 117 317 183 HOH HOH B . 
D 3 HOH 118 318 164 HOH HOH B . 
D 3 HOH 119 319 71  HOH HOH B . 
D 3 HOH 120 320 257 HOH HOH B . 
D 3 HOH 121 321 190 HOH HOH B . 
D 3 HOH 122 322 170 HOH HOH B . 
D 3 HOH 123 323 201 HOH HOH B . 
D 3 HOH 124 324 114 HOH HOH B . 
D 3 HOH 125 325 156 HOH HOH B . 
D 3 HOH 126 326 172 HOH HOH B . 
D 3 HOH 127 327 78  HOH HOH B . 
D 3 HOH 128 328 178 HOH HOH B . 
D 3 HOH 129 329 112 HOH HOH B . 
D 3 HOH 130 330 42  HOH HOH B . 
D 3 HOH 131 331 196 HOH HOH B . 
D 3 HOH 132 332 217 HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    CSO 
_pdbx_struct_mod_residue.label_seq_id     65 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     CSO 
_pdbx_struct_mod_residue.auth_seq_id      52 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   CYS 
_pdbx_struct_mod_residue.details          'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2350  ? 
1 MORE         -10   ? 
1 'SSA (A^2)'  11650 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-10-25 
2 'Structure model' 1 1 2017-12-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume' 
2 2 'Structure model' '_citation.page_first'     
3 2 'Structure model' '_citation.page_last'      
4 2 'Structure model' '_citation.title'          
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1  ? refined 19.0905 6.6850  85.4846  0.1725 0.1283 0.1141 -0.0077 0.0185  0.0032  5.5893 3.1969 3.2358 0.7617 
0.5036  -0.6530 -0.0919 0.0146  0.0517  0.1448  0.1992  -0.1509 -0.1967 -0.2415 0.1567  
'X-RAY DIFFRACTION' 2  ? refined 20.5609 -3.6930 100.8346 0.1176 0.1947 0.1551 0.0225  0.0033  0.0169  1.6331 2.2203 6.6770 
-0.4760 -0.0823 0.3989  -0.0732 0.1628  -0.1360 -0.2479 -0.1269 -0.1326 0.1664  0.6578  0.5795  
'X-RAY DIFFRACTION' 3  ? refined 23.0784 3.5598  102.9581 0.1312 0.1874 0.1648 -0.0204 -0.0127 0.0317  8.3431 5.1122 7.7070 
-0.2697 -2.6325 3.5110  0.0830  -0.0452 -0.0794 -0.3536 0.4332  -0.1656 0.1599  -0.1598 0.2724  
'X-RAY DIFFRACTION' 4  ? refined 29.7259 8.4458  94.8453  0.1437 0.1882 0.1988 -0.0318 0.0072  -0.0125 5.9450 5.1807 9.4434 2.3672 
-0.7607 -3.3490 0.1137  0.1911  -0.2671 -0.0451 0.6002  -0.0226 0.0102  -0.5849 0.2004  
'X-RAY DIFFRACTION' 5  ? refined -1.1678 1.3837  106.0805 0.1206 0.1666 0.1206 0.0129  0.0363  0.0105  7.1211 7.9237 7.3765 1.9145 
4.2118  4.9314  0.0375  0.0883  -0.1093 -0.0479 0.0648  0.0509  0.4367  0.3076  -0.1024 
'X-RAY DIFFRACTION' 6  ? refined -0.4663 13.1484 110.5889 0.2441 0.1644 0.2955 0.0193  -0.0186 -0.0671 7.6271 8.7341 5.0291 
-5.9624 -0.7013 -2.2478 -0.2931 0.5034  -0.2037 -0.3224 0.8716  -0.7951 0.1153  -0.5400 0.0317  
'X-RAY DIFFRACTION' 7  ? refined -6.8634 2.8829  113.2712 0.2624 0.3458 0.2167 0.0047  0.0732  0.0045  8.9079 8.6277 4.7070 5.3457 
1.1107  0.5390  -0.0940 -0.1170 0.2269  -0.3816 -0.1667 0.8652  0.5218  0.4290  -0.7637 
'X-RAY DIFFRACTION' 8  ? refined 7.5419  4.0057  104.8789 0.0869 0.1582 0.1105 0.0374  -0.0105 0.0203  6.8542 8.2875 5.2274 3.6641 
0.2124  2.6837  -0.1053 0.2409  -0.1123 0.1445  0.2956  -0.0378 -0.1370 -0.1361 0.0826  
'X-RAY DIFFRACTION' 9  ? refined 11.5918 2.8698  113.4245 0.1955 0.2875 0.1669 0.0084  0.0259  -0.0111 5.4342 8.1239 5.4395 1.6261 
-0.3576 -1.6555 -0.0010 0.0715  -0.1153 -0.6197 0.1856  0.4446  0.4435  -0.0428 -0.0799 
'X-RAY DIFFRACTION' 10 ? refined 5.5416  -9.1696 105.8640 0.2854 0.1875 0.2046 0.0184  0.0260  -0.0025 6.4644 2.5047 4.7173 
-3.4236 -5.2923 3.0101  -0.3948 0.1699  0.3186  -0.2409 -0.2149 0.2087  0.4615  0.8286  -0.2835 
'X-RAY DIFFRACTION' 11 ? refined 5.4370  -5.2881 86.7176  0.1473 0.1752 0.1723 -0.0401 -0.0063 -0.0537 6.8557 4.9548 8.4939 
-3.2715 0.7320  -5.5372 -0.0084 0.1307  -0.1522 0.2362  -0.4740 0.3603  -0.6427 0.5255  -0.3134 
'X-RAY DIFFRACTION' 12 ? refined -1.0357 5.4693  86.2780  0.1963 0.2846 0.3520 0.0493  -0.0243 0.0643  6.6659 5.8634 7.5321 
-0.8655 4.0091  -2.1419 -0.2867 0.2072  0.2104  0.4672  0.9442  0.8717  -0.1407 -0.4889 -0.4006 
'X-RAY DIFFRACTION' 13 ? refined -1.5387 -4.4665 96.9111  0.0988 0.1714 0.1498 -0.0136 -0.0136 -0.0160 7.5424 4.5969 6.8230 0.1508 
-3.9598 0.3862  -0.2239 0.0482  0.1583  -0.0060 -0.3815 0.1711  -0.0980 0.3555  -0.2373 
'X-RAY DIFFRACTION' 14 ? refined -7.7043 3.9214  98.8293  0.1099 0.2892 0.1774 0.0014  -0.0252 -0.0040 8.5288 8.0297 6.3601 
-0.7740 -3.1491 0.5647  -0.0603 0.0590  -0.0045 -0.0540 0.3296  0.2961  0.0096  -0.3910 -0.2434 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  A 1   A 65  
;chain 'A' and (resid 1 through 65 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 66  A 88  
;chain 'A' and (resid 66 through 88 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 89  A 108 
;chain 'A' and (resid 89 through 108 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 109 A 130 
;chain 'A' and (resid 109 through 130 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  B 0   B 12  
;chain 'B' and (resid 0 through 12 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  B 13  B 19  
;chain 'B' and (resid 13 through 19 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  B 20  B 32  
;chain 'B' and (resid 20 through 32 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  B 33  B 51  
;chain 'B' and (resid 33 through 51 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  B 53  B 65  
;chain 'B' and (resid 53 through 65 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 B 66  B 75  
;chain 'B' and (resid 66 through 75 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 B 76  B 88  
;chain 'B' and (resid 76 through 88 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 12 12 B 89  B 95  
;chain 'B' and (resid 89 through 95 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 13 13 B 96  B 114 
;chain 'B' and (resid 96 through 114 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 14 14 B 115 B 130 
;chain 'B' and (resid 115 through 130 )
;
? ? ? ? ? 
# 
_pdbx_phasing_MR.entry_id                     5WZF 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          5.950 
_pdbx_phasing_MR.d_res_low_rotation           34.010 
_pdbx_phasing_MR.d_res_high_translation       5.950 
_pdbx_phasing_MR.d_res_low_translation        34.010 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.9_1692 1 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MOSFLM      ? ? ? 3.3.22   2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALA       ? ? ? 3.3.22   3 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? 2.5.7    4 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22     5 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? MOSFLM      ? ? ? .        6 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .        7 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 295 ? ? O A HOH 300 ? ? 2.04 
2 1 NH1 A ARG 106 ? ? O A HOH 201 ? ? 2.06 
3 1 O   A HOH 205 ? ? O A HOH 210 ? ? 2.08 
4 1 OD2 B ASP 98  ? ? O B HOH 201 ? ? 2.15 
5 1 NE  B ARG 19  ? ? O B HOH 202 ? ? 2.16 
6 1 O   A HOH 303 ? ? O B HOH 259 ? ? 2.17 
7 1 OD1 A ASP 119 ? ? O A HOH 202 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     325 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     331 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_554 
_pdbx_validate_symm_contact.dist              1.99 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             O 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             CSO 
_pdbx_validate_rmsd_angle.auth_seq_id_1              52 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             C 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             CSO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              52 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             N 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_3              53 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                105.30 
_pdbx_validate_rmsd_angle.angle_target_value         123.20 
_pdbx_validate_rmsd_angle.angle_deviation            -17.90 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.70 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             CSO 
_pdbx_validate_main_chain_plane.auth_asym_id             B 
_pdbx_validate_main_chain_plane.auth_seq_id              52 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   26.82 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       329 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.79 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -12 ? A MET 1   
2  1 Y 1 A GLY -11 ? A GLY 2   
3  1 Y 1 A SER -10 ? A SER 3   
4  1 Y 1 A SER -9  ? A SER 4   
5  1 Y 1 A HIS -8  ? A HIS 5   
6  1 Y 1 A HIS -7  ? A HIS 6   
7  1 Y 1 A HIS -6  ? A HIS 7   
8  1 Y 1 A HIS -5  ? A HIS 8   
9  1 Y 1 A HIS -4  ? A HIS 9   
10 1 Y 1 A HIS -3  ? A HIS 10  
11 1 Y 1 A SER -2  ? A SER 11  
12 1 Y 1 A GLN -1  ? A GLN 12  
13 1 Y 1 A ALA 0   ? A ALA 13  
14 1 Y 1 A GLU 131 ? A GLU 144 
15 1 Y 1 B MET -12 ? B MET 1   
16 1 Y 1 B GLY -11 ? B GLY 2   
17 1 Y 1 B SER -10 ? B SER 3   
18 1 Y 1 B SER -9  ? B SER 4   
19 1 Y 1 B HIS -8  ? B HIS 5   
20 1 Y 1 B HIS -7  ? B HIS 6   
21 1 Y 1 B HIS -6  ? B HIS 7   
22 1 Y 1 B HIS -5  ? B HIS 8   
23 1 Y 1 B HIS -4  ? B HIS 9   
24 1 Y 1 B HIS -3  ? B HIS 10  
25 1 Y 1 B SER -2  ? B SER 11  
26 1 Y 1 B GLN -1  ? B GLN 12  
27 1 Y 1 B GLU 131 ? B GLU 144 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Council of Scientific and Industrial Research' India ? 1 
'Department of Science and Technology'          India ? 2 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#